BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c24346_g1_i1 len=1851 path=[1959:0-511 2471:512-557 2517:558-578
2538:579-660 2620:661-858 2818:859-895 2855:896-898 @2858@!:899-1374
3334:1375-1431 3391:1432-1471 3430:1472-1509 3468:1510-1512
132:1513-1579 3537:1580-1735 3693:1736-1759 3717:1760-1850]

Length=1851
                                                                      Score     E

ref|XP_002323910.2|  hypothetical protein POPTR_0017s04320g             250   3e-72   Populus trichocarpa [western balsam poplar]
ref|XP_011001807.1|  PREDICTED: vinorine synthase-like                  246   7e-71   
ref|XP_007030131.1|  3'-N-debenzoyl-2'-deoxytaxol N-benzoyltransf...    242   4e-69   
ref|XP_007030134.1|  3'-N-debenzoyl-2'-deoxytaxol N-benzoyltransf...    241   1e-68   
ref|XP_006372816.1|  hypothetical protein POPTR_0017s05330g             240   2e-68   
ref|XP_009610450.1|  PREDICTED: vinorine synthase-like                  239   3e-68   
ref|XP_007037900.1|  3'-N-debenzoyl-2'-deoxytaxol N-benzoyltransf...    239   7e-68   
ref|XP_011008627.1|  PREDICTED: vinorine synthase-like                  237   3e-67   
ref|XP_002308780.1|  hypothetical protein POPTR_0006s01190g             235   1e-66   Populus trichocarpa [western balsam poplar]
ref|XP_002511243.1|  3'-N-debenzoyl-2'-deoxytaxol N-benzoyltransf...    234   3e-66   Ricinus communis
ref|XP_004294207.1|  PREDICTED: vinorine synthase-like                  232   2e-65   
ref|XP_011037141.1|  PREDICTED: vinorine synthase-like                  231   3e-65   
ref|XP_011041297.1|  PREDICTED: vinorine synthase-like                  231   4e-65   
ref|XP_006482086.1|  PREDICTED: vinorine synthase-like                  231   6e-65   
ref|XP_008222084.1|  PREDICTED: BAHD acyltransferase At5g47980-like     228   6e-64   
gb|KDO45520.1|  hypothetical protein CISIN_1g039563mg                   229   6e-64   
gb|KDO53588.1|  hypothetical protein CISIN_1g048249mg                   228   9e-64   
gb|KDP40899.1|  hypothetical protein JCGZ_24898                         228   9e-64   
ref|XP_007044964.1|  HXXXD-type acyl-transferase family protein, ...    226   3e-63   
ref|XP_006430560.1|  hypothetical protein CICLE_v10011796mg             225   6e-63   
ref|XP_006443121.1|  hypothetical protein CICLE_v10023671mg             226   6e-63   
ref|XP_008222021.1|  PREDICTED: BAHD acyltransferase At5g47980-like     226   7e-63   
ref|XP_007044963.1|  HXXXD-type acyl-transferase family protein, ...    222   8e-62   
ref|XP_009359305.1|  PREDICTED: vinorine synthase                       220   5e-61   
ref|XP_008353036.1|  PREDICTED: vinorine synthase-like                  219   1e-60   
ref|XP_008368264.1|  PREDICTED: vinorine synthase-like                  219   1e-60   
ref|XP_006438136.1|  hypothetical protein CICLE_v10033777mg             219   1e-60   
ref|XP_009342764.1|  PREDICTED: vinorine synthase-like                  219   1e-60   
ref|XP_006484023.1|  PREDICTED: vinorine synthase-like                  219   3e-60   
ref|XP_008389785.1|  PREDICTED: vinorine synthase-like                  217   6e-60   
ref|XP_008360182.1|  PREDICTED: vinorine synthase-like                  218   6e-60   
ref|XP_006443122.1|  hypothetical protein CICLE_v10020052mg             218   7e-60   
ref|XP_010044504.1|  PREDICTED: vinorine synthase-like                  217   9e-60   
ref|XP_002511241.1|  Anthranilate N-benzoyltransferase protein, p...    216   1e-59   Ricinus communis
ref|XP_006292162.1|  hypothetical protein CARUB_v10018368mg             216   1e-59   
ref|XP_010554168.1|  PREDICTED: vinorine synthase                       216   4e-59   
ref|XP_002267341.1|  PREDICTED: vinorine synthase                       215   5e-59   Vitis vinifera
ref|XP_006430562.1|  hypothetical protein CICLE_v10013397mg             214   9e-59   
emb|CDP08574.1|  unnamed protein product                                214   1e-58   
ref|XP_008240535.1|  PREDICTED: vinorine synthase-like                  214   2e-58   
ref|XP_009359286.1|  PREDICTED: vinorine synthase-like                  213   2e-58   
ref|XP_008226170.1|  PREDICTED: vinorine synthase-like                  214   2e-58   
ref|XP_002514980.1|  Anthranilate N-benzoyltransferase protein, p...    213   3e-58   Ricinus communis
ref|XP_008222013.1|  PREDICTED: vinorine synthase-like                  213   4e-58   
ref|XP_006380880.1|  hypothetical protein POPTR_0006s01180g             211   5e-58   
ref|XP_008222012.1|  PREDICTED: vinorine synthase-like                  212   5e-58   
ref|XP_007037899.1|  3'-N-debenzoyl-2'-deoxytaxol N-benzoyltransf...    211   1e-57   
ref|XP_010506970.1|  PREDICTED: vinorine synthase-like                  211   2e-57   
ref|XP_006395599.1|  hypothetical protein EUTSA_v10005565mg             211   2e-57   
ref|XP_008226167.1|  PREDICTED: vinorine synthase-like                  211   3e-57   
ref|XP_011042323.1|  PREDICTED: vinorine synthase-like                  210   3e-57   
ref|XP_008340164.1|  PREDICTED: vinorine synthase-like                  210   3e-57   
ref|XP_002315639.2|  transferase family protein                         210   4e-57   Populus trichocarpa [western balsam poplar]
ref|XP_011071181.1|  PREDICTED: vinorine synthase-like isoform X1       209   5e-57   
gb|KDP36802.1|  hypothetical protein JCGZ_08093                         210   5e-57   
ref|XP_002511244.1|  Anthranilate N-benzoyltransferase protein, p...    209   7e-57   Ricinus communis
gb|KDP26742.1|  hypothetical protein JCGZ_17900                         209   7e-57   
ref|XP_011071304.1|  PREDICTED: vinorine synthase-like                  208   1e-56   
ref|XP_008222087.1|  PREDICTED: vinorine synthase-like                  208   2e-56   
emb|CDY39174.1|  BnaC09g21700D                                          208   2e-56   
dbj|BAB01067.1|  acetyltranferase-like protein                          208   2e-56   Arabidopsis thaliana [mouse-ear cress]
ref|NP_189233.1|  HXXXD-type acyl-transferase-like protein              207   3e-56   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002875299.1|  transferase family protein                         207   4e-56   
gb|KDO41287.1|  hypothetical protein CISIN_1g044243mg                   206   8e-56   
ref|XP_008222015.1|  PREDICTED: vinorine synthase-like                  206   9e-56   
ref|XP_006443123.1|  hypothetical protein CICLE_v10024067mg             206   1e-55   
ref|XP_008389833.1|  PREDICTED: vinorine synthase-like                  206   1e-55   
gb|KDO46443.1|  hypothetical protein CISIN_1g043811mg                   206   2e-55   
gb|KCW86595.1|  hypothetical protein EUGRSUZ_B03227                     205   2e-55   
ref|XP_006423966.1|  hypothetical protein CICLE_v10028504mg             204   2e-55   
ref|XP_006487765.1|  PREDICTED: vinorine synthase-like                  204   2e-55   
ref|XP_010044505.1|  PREDICTED: vinorine synthase-like                  205   2e-55   
ref|XP_010514234.1|  PREDICTED: vinorine synthase-like                  205   4e-55   
ref|XP_009361768.1|  PREDICTED: BAHD acyltransferase At5g47980-like     204   9e-55   
ref|XP_007028226.1|  HXXXD-type acyl-transferase family protein, ...    203   9e-55   
ref|XP_007134122.1|  hypothetical protein PHAVU_010G020900g             203   1e-54   
ref|XP_008222018.1|  PREDICTED: vinorine synthase-like                  203   1e-54   
gb|KDP26741.1|  hypothetical protein JCGZ_17899                         202   1e-54   
ref|XP_004239499.1|  PREDICTED: vinorine synthase                       202   1e-54   
emb|CDP10330.1|  unnamed protein product                                203   2e-54   
ref|XP_002517535.1|  Anthranilate N-benzoyltransferase protein, p...    202   2e-54   Ricinus communis
ref|XP_010046662.1|  PREDICTED: vinorine synthase-like                  202   2e-54   
ref|XP_009361770.1|  PREDICTED: vinorine synthase-like                  202   3e-54   
ref|XP_004310025.1|  PREDICTED: vinorine synthase-like                  201   5e-54   
gb|KCW86594.1|  hypothetical protein EUGRSUZ_B03226                     201   5e-54   
ref|XP_009114100.1|  PREDICTED: vinorine synthase                       202   6e-54   
emb|CDY04190.1|  BnaA09g19680D                                          201   7e-54   
ref|XP_006479029.1|  PREDICTED: vinorine synthase-like                  201   7e-54   
ref|XP_010682887.1|  PREDICTED: vinorine synthase-like                  200   9e-54   
emb|CDP13291.1|  unnamed protein product                                201   1e-53   
ref|XP_011070326.1|  PREDICTED: vinorine synthase-like                  200   1e-53   
ref|XP_008390114.1|  PREDICTED: vinorine synthase-like                  200   1e-53   
emb|CDP08578.1|  unnamed protein product                                200   1e-53   
ref|XP_010100293.1|  Vinorine synthase                                  200   1e-53   
ref|XP_008383117.1|  PREDICTED: vinorine synthase-like                  200   1e-53   
gb|KDP30966.1|  hypothetical protein JCGZ_11342                         200   2e-53   
ref|XP_006427936.1|  hypothetical protein CICLE_v10027290mg             199   3e-53   
ref|XP_004310187.1|  PREDICTED: salutaridinol 7-O-acetyltransfera...    199   4e-53   
gb|KDP30964.1|  hypothetical protein JCGZ_11340                         198   4e-53   
ref|XP_010044503.1|  PREDICTED: vinorine synthase-like                  198   6e-53   
ref|XP_007039558.1|  Anthranilate N-benzoyltransferase protein, p...    198   8e-53   
gb|KCW86592.1|  hypothetical protein EUGRSUZ_B03224                     197   1e-52   
ref|XP_006341810.1|  PREDICTED: vinorine synthase-like                  197   1e-52   
ref|XP_008340165.1|  PREDICTED: deacetylvindoline O-acetyltransfe...    197   2e-52   
gb|KDO46444.1|  hypothetical protein CISIN_1g037811mg                   197   2e-52   
ref|XP_008222079.1|  PREDICTED: vinorine synthase-like                  197   2e-52   
ref|XP_006482379.1|  PREDICTED: salutaridinol 7-O-acetyltransfera...    196   3e-52   
ref|XP_008372859.1|  PREDICTED: BAHD acyltransferase At5g47980-like     197   3e-52   
ref|XP_002314561.1|  transferase family protein                         196   3e-52   Populus trichocarpa [western balsam poplar]
ref|XP_009359304.1|  PREDICTED: deacetylvindoline O-acetyltransfe...    196   3e-52   
gb|KDP26743.1|  hypothetical protein JCGZ_17901                         196   4e-52   
ref|XP_009773462.1|  PREDICTED: vinorine synthase-like                  196   4e-52   
ref|XP_009602470.1|  PREDICTED: vinorine synthase-like                  195   4e-52   
gb|KDP38750.1|  hypothetical protein JCGZ_04103                         196   5e-52   
ref|XP_010100286.1|  Deacetylvindoline O-acetyltransferase              196   6e-52   
gb|ACI45390.1|  salutaridinol 7-O-acetyltransferase                     196   7e-52   Papaver somniferum
ref|XP_010027285.1|  PREDICTED: BAHD acyltransferase At5g47980-like     195   7e-52   
ref|XP_002510627.1|  Anthranilate N-benzoyltransferase protein, p...    195   7e-52   Ricinus communis
ref|XP_006348577.1|  PREDICTED: salutaridinol 7-O-acetyltransfera...    195   8e-52   
ref|XP_006342247.1|  PREDICTED: salutaridinol 7-O-acetyltransfera...    195   8e-52   
ref|XP_002514981.1|  Salutaridinol 7-O-acetyltransferase, putative      195   8e-52   Ricinus communis
gb|KDP35375.1|  hypothetical protein JCGZ_10359                         195   1e-51   
ref|XP_004238629.1|  PREDICTED: vinorine synthase-like                  195   1e-51   
ref|XP_010907772.1|  PREDICTED: salutaridinol 7-O-acetyltransfera...    194   1e-51   
ref|XP_009359355.1|  PREDICTED: vinorine synthase-like                  195   1e-51   
ref|XP_006582966.1|  PREDICTED: vinorine synthase-like                  194   1e-51   
ref|XP_009780612.1|  PREDICTED: vinorine synthase-like                  194   1e-51   
ref|XP_006430561.1|  hypothetical protein CICLE_v10011733mg             194   1e-51   
gb|KDP36822.1|  hypothetical protein JCGZ_08113                         199   2e-51   
ref|XP_009361854.1|  PREDICTED: BAHD acyltransferase At5g47980-like     194   2e-51   
ref|XP_006420178.1|  hypothetical protein CICLE_v10006986mg             194   2e-51   
ref|XP_010682956.1|  PREDICTED: BAHD acyltransferase At5g47980          195   2e-51   
ref|XP_004143047.1|  PREDICTED: salutaridinol 7-O-acetyltransfera...    194   2e-51   
ref|XP_010044501.1|  PREDICTED: vinorine synthase-like                  194   3e-51   
ref|XP_010046626.1|  PREDICTED: vinorine synthase-like                  193   5e-51   
ref|XP_006435345.1|  hypothetical protein CICLE_v10001106mg             193   5e-51   
ref|XP_002514983.1|  Anthranilate N-benzoyltransferase protein, p...    193   6e-51   Ricinus communis
ref|XP_011071306.1|  PREDICTED: vinorine synthase-like                  193   6e-51   
ref|XP_002514976.1|  3'-N-debenzoyl-2'-deoxytaxol N-benzoyltransf...    192   7e-51   Ricinus communis
ref|XP_003616845.1|  Vinorine synthase                                  192   7e-51   
ref|XP_008383113.1|  PREDICTED: vinorine synthase-like                  194   9e-51   
ref|XP_008389789.1|  PREDICTED: vinorine synthase-like                  192   1e-50   
ref|XP_003521961.1|  PREDICTED: vinorine synthase-like                  192   1e-50   
gb|KDO36951.1|  hypothetical protein CISIN_1g045540mg                   192   1e-50   
ref|XP_006598680.1|  PREDICTED: uncharacterized protein LOC100305...    192   1e-50   
ref|XP_002515007.1|  3'-N-debenzoyl-2'-deoxytaxol N-benzoyltransf...    192   1e-50   Ricinus communis
ref|XP_011021361.1|  PREDICTED: BAHD acyltransferase At5g47980-like     192   1e-50   
ref|XP_009790148.1|  PREDICTED: vinorine synthase-like                  192   1e-50   
sp|Q94FT4.1|SALAT_PAPSO  RecName: Full=Salutaridinol 7-O-acetyltr...    192   1e-50   Papaver somniferum
ref|XP_006493396.1|  PREDICTED: vinorine synthase-like                  191   1e-50   
ref|XP_010051001.1|  PREDICTED: vinorine synthase-like                  192   2e-50   
ref|XP_004504492.1|  PREDICTED: vinorine synthase-like                  191   2e-50   
ref|XP_011101100.1|  PREDICTED: vinorine synthase-like                  192   2e-50   
ref|XP_009342768.1|  PREDICTED: vinorine synthase-like                  191   2e-50   
gb|KDO82048.1|  hypothetical protein CISIN_1g012688mg                   192   2e-50   
ref|XP_010460459.1|  PREDICTED: vinorine synthase-like                  191   2e-50   
ref|XP_006484024.1|  PREDICTED: BAHD acyltransferase At5g47980-like     191   2e-50   
ref|XP_002311734.1|  hypothetical protein POPTR_0008s18070g             191   2e-50   Populus trichocarpa [western balsam poplar]
ref|XP_006345618.1|  PREDICTED: vinorine synthase-like                  191   2e-50   
gb|EYU22560.1|  hypothetical protein MIMGU_mgv1a020007mg                191   3e-50   
ref|XP_008226094.1|  PREDICTED: BAHD acyltransferase At5g47980-like     191   3e-50   
ref|XP_006465504.1|  PREDICTED: vinorine synthase-like                  192   3e-50   
emb|CDP10332.1|  unnamed protein product                                191   3e-50   
ref|XP_008226591.1|  PREDICTED: BAHD acyltransferase At5g47980-like     192   3e-50   
gb|ADD71922.1|  BAHD-type acyltransferase                               190   4e-50   Actaea racemosa
gb|KCW68080.1|  hypothetical protein EUGRSUZ_F01765                     191   5e-50   
gb|KGN64382.1|  hypothetical protein Csa_1G050210                       190   5e-50   
emb|CDP07885.1|  unnamed protein product                                190   6e-50   
ref|XP_011101142.1|  PREDICTED: vinorine synthase-like                  190   6e-50   
ref|XP_004295709.1|  PREDICTED: BAHD acyltransferase At5g47980-like     189   6e-50   
ref|XP_008444410.1|  PREDICTED: vinorine synthase                       190   8e-50   
ref|XP_004310028.1|  PREDICTED: vinorine synthase-like                  190   9e-50   
ref|XP_010528792.1|  PREDICTED: BAHD acyltransferase At5g47980-like     189   1e-49   
ref|XP_008346587.1|  PREDICTED: BAHD acyltransferase At5g47980-like     189   1e-49   
ref|XP_006443317.1|  hypothetical protein CICLE_v10020331mg             189   1e-49   
ref|XP_006429944.1|  hypothetical protein CICLE_v10011699mg             189   1e-49   
ref|XP_010499177.1|  PREDICTED: vinorine synthase-like                  189   2e-49   
ref|XP_008372858.1|  PREDICTED: BAHD acyltransferase At5g47980-like     189   2e-49   
ref|XP_006432232.1|  hypothetical protein CICLE_v10001086mg             189   2e-49   
ref|XP_008226064.1|  PREDICTED: BAHD acyltransferase At5g47980-like     189   2e-49   
ref|XP_009780317.1|  PREDICTED: vinorine synthase-like                  189   2e-49   
ref|XP_004310024.1|  PREDICTED: vinorine synthase-like                  188   3e-49   
ref|XP_004301806.1|  PREDICTED: vinorine synthase-like                  188   3e-49   
ref|XP_006464646.1|  PREDICTED: salutaridinol 7-O-acetyltransfera...    189   3e-49   
ref|XP_006438135.1|  hypothetical protein CICLE_v10031490mg             189   3e-49   
ref|NP_001238226.1|  uncharacterized protein LOC100305374               188   3e-49   
ref|XP_010100291.1|  Salutaridinol 7-O-acetyltransferase                188   3e-49   
gb|KEH20541.1|  3'-N-debenzoyl-2'-deoxytaxol benzoyltransferase         187   5e-49   
ref|XP_011083978.1|  PREDICTED: vinorine synthase-like                  187   6e-49   
ref|XP_008372855.1|  PREDICTED: BAHD acyltransferase At5g47980-like     188   6e-49   
ref|XP_010064604.1|  PREDICTED: vinorine synthase-like                  187   6e-49   
ref|XP_009759141.1|  PREDICTED: salutaridinol 7-O-acetyltransfera...    187   6e-49   
ref|XP_010025365.1|  PREDICTED: vinorine synthase-like                  187   7e-49   
ref|XP_010061156.1|  PREDICTED: vinorine synthase-like                  187   7e-49   
ref|XP_002314550.2|  hypothetical protein POPTR_0010s06640g             187   7e-49   Populus trichocarpa [western balsam poplar]
ref|XP_011029622.1|  PREDICTED: BAHD acyltransferase At5g47980          187   8e-49   
ref|XP_008392421.1|  PREDICTED: salutaridinol 7-O-acetyltransfera...    187   8e-49   
ref|XP_002530172.1|  Anthranilate N-benzoyltransferase protein, p...    187   1e-48   Ricinus communis
ref|XP_008226164.1|  PREDICTED: vinorine synthase-like                  187   1e-48   
ref|XP_007044970.1|  HXXXD-type acyl-transferase family protein, ...    186   1e-48   
ref|XP_004301957.1|  PREDICTED: BAHD acyltransferase At5g47980-like     186   2e-48   
ref|XP_008797275.1|  PREDICTED: salutaridinol 7-O-acetyltransfera...    185   2e-48   
ref|XP_008226087.1|  PREDICTED: BAHD acyltransferase At5g47980-like     186   2e-48   
ref|XP_007018014.1|  HXXXD-type acyl-transferase family protein, ...    189   2e-48   
ref|XP_002514982.1|  3'-N-debenzoyl-2'-deoxytaxol N-benzoyltransf...    186   2e-48   Ricinus communis
gb|ACI45392.1|  salutaridinol 7-O-acetyltransferase                     186   3e-48   Papaver bracteatum [great scarlet poppy]
ref|XP_002271612.1|  PREDICTED: vinorine synthase-like                  185   3e-48   Vitis vinifera
ref|XP_003532711.2|  PREDICTED: vinorine synthase-like                  186   3e-48   
ref|XP_003616843.1|  Salutaridinol 7-O-acetyltransferase                185   4e-48   
ref|XP_007134039.1|  hypothetical protein PHAVU_010G014300g             184   5e-48   
ref|XP_002284817.2|  PREDICTED: vinorine synthase-like                  185   5e-48   Vitis vinifera
ref|XP_006432226.1|  hypothetical protein CICLE_v10001111mg             185   5e-48   
ref|XP_011085805.1|  PREDICTED: vinorine synthase-like                  184   6e-48   
ref|XP_002315640.2|  hypothetical protein POPTR_0010s06380g             183   6e-48   Populus trichocarpa [western balsam poplar]
gb|KHN36442.1|  Vinorine synthase                                       185   8e-48   
gb|KCW86588.1|  hypothetical protein EUGRSUZ_B03220                     183   8e-48   
ref|XP_008222017.1|  PREDICTED: vinorine synthase-like                  184   9e-48   
gb|KEH20539.1|  HXXXD-type acyl-transferase family protein              184   1e-47   
gb|KCW68076.1|  hypothetical protein EUGRSUZ_F01760                     184   1e-47   
gb|KDO52922.1|  hypothetical protein CISIN_1g036706mg                   184   1e-47   
ref|XP_007134037.1|  hypothetical protein PHAVU_010G014100g             183   1e-47   
gb|AES72092.2|  anthranilate N-benzoyltransferase                       183   1e-47   
gb|AFK43775.1|  unknown                                                 182   2e-47   
ref|XP_006415801.1|  hypothetical protein EUTSA_v10007650mg             183   2e-47   
ref|XP_004240930.1|  PREDICTED: vinorine synthase-like                  183   2e-47   
ref|XP_009361769.1|  PREDICTED: BAHD acyltransferase At5g47980-like     183   2e-47   
ref|XP_009588476.1|  PREDICTED: vinorine synthase-like                  183   2e-47   
gb|KDO58317.1|  hypothetical protein CISIN_1g037128mg                   183   2e-47   
ref|XP_010090836.1|  Vinorine synthase                                  183   2e-47   
ref|XP_010425269.1|  PREDICTED: BAHD acyltransferase At5g47980-like     182   2e-47   
ref|XP_008226171.1|  PREDICTED: BAHD acyltransferase At5g47980-like     183   2e-47   
gb|KHN12420.1|  Vinorine synthase                                       184   2e-47   
ref|XP_003601841.1|  Vinorine synthase                                  184   2e-47   
ref|XP_003537018.2|  PREDICTED: vinorine synthase-like                  185   2e-47   
ref|XP_004310183.1|  PREDICTED: vinorine synthase-like                  182   2e-47   
ref|XP_008377211.1|  PREDICTED: vinorine synthase-like                  184   3e-47   
ref|XP_008372831.1|  PREDICTED: BAHD acyltransferase At5g47980-like     182   3e-47   
ref|XP_010044502.1|  PREDICTED: vinorine synthase-like                  182   3e-47   
gb|KEH20540.1|  HXXXD-type acyl-transferase family protein              182   3e-47   
gb|KDO85081.1|  hypothetical protein CISIN_1g015400mg                   181   3e-47   
ref|XP_006427169.1|  hypothetical protein CICLE_v10027043mg             183   4e-47   
ref|XP_010050993.1|  PREDICTED: vinorine synthase-like                  182   4e-47   
ref|XP_010092011.1|  BAHD acyltransferase                               182   4e-47   
ref|XP_007158727.1|  hypothetical protein PHAVU_002G177000g             182   4e-47   
ref|XP_006429945.1|  hypothetical protein CICLE_v10011714mg             182   4e-47   
ref|XP_009606783.1|  PREDICTED: vinorine synthase-like                  181   4e-47   
ref|XP_004159582.1|  PREDICTED: vinorine synthase-like                  181   6e-47   
ref|XP_010048659.1|  PREDICTED: vinorine synthase-like                  182   6e-47   
ref|XP_006427943.1|  hypothetical protein CICLE_v10027036mg             182   6e-47   
ref|XP_008240679.1|  PREDICTED: vinorine synthase-like                  182   6e-47   
gb|KDO40774.1|  hypothetical protein CISIN_1g037323mg                   182   6e-47   
ref|XP_004295693.1|  PREDICTED: BAHD acyltransferase At5g47980-like     182   6e-47   
emb|CDP14000.1|  unnamed protein product                                181   8e-47   
ref|XP_008446186.1|  PREDICTED: vinorine synthase-like                  181   9e-47   
ref|XP_002300646.2|  hypothetical protein POPTR_0002s01180g             181   1e-46   Populus trichocarpa [western balsam poplar]
ref|XP_008383041.1|  PREDICTED: BAHD acyltransferase At5g47980-like     181   1e-46   
ref|XP_006441394.1|  hypothetical protein CICLE_v10023627mg             180   1e-46   
ref|XP_010094574.1|  Salutaridinol 7-O-acetyltransferase                181   1e-46   
ref|XP_004152282.1|  PREDICTED: salutaridinol 7-O-acetyltransfera...    181   2e-46   
gb|AFK42496.1|  unknown                                                 180   2e-46   
ref|XP_009355133.1|  PREDICTED: BAHD acyltransferase At5g47980-like     180   2e-46   
ref|XP_007029093.1|  HXXXD-type acyl-transferase family protein, ...    182   2e-46   
ref|XP_006414522.1|  hypothetical protein EUTSA_v10025210mg             180   2e-46   
gb|KDP45585.1|  hypothetical protein JCGZ_17192                         180   3e-46   
ref|XP_010025364.1|  PREDICTED: BAHD acyltransferase At5g47980-like     180   3e-46   
ref|XP_004310177.1|  PREDICTED: vinorine synthase-like                  181   3e-46   
ref|XP_011041559.1|  PREDICTED: BAHD acyltransferase At5g47980-like     180   3e-46   
ref|XP_008222020.1|  PREDICTED: BAHD acyltransferase At5g47980-like     179   3e-46   
emb|CDY27594.1|  BnaA09g28130D                                          179   3e-46   
ref|XP_008240680.1|  PREDICTED: vinorine synthase-like                  180   4e-46   
ref|XP_007018005.1|  3'-N-debenzoyl-2'-deoxytaxol N-benzoyltransf...    180   4e-46   
ref|XP_006380275.1|  hypothetical protein POPTR_0007s00980g             178   4e-46   
ref|XP_011086241.1|  PREDICTED: vinorine synthase-like                  179   5e-46   
ref|XP_004301008.1|  PREDICTED: vinorine synthase-like                  178   8e-46   
ref|XP_008446094.1|  PREDICTED: vinorine synthase-like                  178   8e-46   
ref|XP_010050981.1|  PREDICTED: vinorine synthase-like                  178   9e-46   
ref|XP_006473916.1|  PREDICTED: vinorine synthase-like                  179   9e-46   
ref|XP_002875533.1|  transferase family protein                         178   9e-46   
ref|XP_010040066.1|  PREDICTED: vinorine synthase-like                  178   1e-45   
ref|XP_004310026.1|  PREDICTED: vinorine synthase-like                  178   1e-45   
ref|XP_006427933.1|  hypothetical protein CICLE_v10026950mg             179   1e-45   
ref|XP_008453950.1|  PREDICTED: salutaridinol 7-O-acetyltransfera...    179   1e-45   
gb|KCW81000.1|  hypothetical protein EUGRSUZ_C02376                     178   1e-45   
ref|XP_010531415.1|  PREDICTED: BAHD acyltransferase At5g47980-like     178   1e-45   
ref|NP_173852.4|  HXXXD-type acyl-transferase-like protein              177   1e-45   
ref|XP_009371390.1|  PREDICTED: vinorine synthase-like                  178   1e-45   
ref|XP_002533732.1|  3'-N-debenzoyl-2'-deoxytaxol N-benzoyltransf...    177   1e-45   
ref|XP_002514985.1|  3'-N-debenzoyl-2'-deoxytaxol N-benzoyltransf...    177   1e-45   
ref|XP_007018004.1|  Anthranilate N-benzoyltransferase protein, p...    177   1e-45   
gb|KDO48724.1|  hypothetical protein CISIN_1g047399mg                   177   2e-45   
ref|XP_004140566.1|  PREDICTED: BAHD acyltransferase At5g47980-like     177   2e-45   
ref|XP_008358908.1|  PREDICTED: vinorine synthase-like                  178   2e-45   
ref|XP_006464857.1|  PREDICTED: vinorine synthase-like                  178   2e-45   
ref|XP_011034885.1|  PREDICTED: vinorine synthase-like                  177   2e-45   
ref|XP_004292913.1|  PREDICTED: vinorine synthase-like                  178   2e-45   
ref|XP_007037901.1|  Anthranilate N-benzoyltransferase protein, p...    177   2e-45   
ref|XP_007135112.1|  hypothetical protein PHAVU_010G102000g             177   2e-45   
sp|Q70PR7.2|VINSY_RAUSE  RecName: Full=Vinorine synthase                177   2e-45   
ref|XP_008389788.1|  PREDICTED: vinorine synthase-like                  177   2e-45   
ref|XP_009147434.1|  PREDICTED: BAHD acyltransferase At5g47980-like     177   2e-45   
gb|KDO53587.1|  hypothetical protein CISIN_1g040754mg                   176   3e-45   
ref|XP_009113794.1|  PREDICTED: BAHD acyltransferase At5g47980          177   3e-45   
emb|CDX84944.1|  BnaC05g21110D                                          177   3e-45   
ref|NP_189647.1|  HXXXD-type acyl-transferase-like protein              177   3e-45   
ref|XP_004299139.1|  PREDICTED: vinorine synthase-like isoform 1        177   3e-45   
ref|XP_006372866.1|  hypothetical protein POPTR_0017s05810g             177   3e-45   
ref|XP_011040773.1|  PREDICTED: acetyl-CoA-benzylalcohol acetyltr...    177   3e-45   
ref|XP_004299140.1|  PREDICTED: vinorine synthase-like isoform 2        177   3e-45   
ref|XP_010514678.1|  PREDICTED: BAHD acyltransferase At5g47980-like     177   3e-45   
ref|XP_006292868.1|  hypothetical protein CARUB_v10019128mg             177   3e-45   
ref|XP_011041557.1|  PREDICTED: BAHD acyltransferase At5g47980-like     176   4e-45   
emb|CDY22927.1|  BnaA01g18650D                                          176   4e-45   
ref|XP_006345840.1|  PREDICTED: BAHD acyltransferase At5g47980-like     176   4e-45   
ref|XP_004485524.1|  PREDICTED: vinorine synthase-like                  176   4e-45   
gb|KDO85073.1|  hypothetical protein CISIN_1g044625mg                   177   5e-45   
ref|XP_011071305.1|  PREDICTED: vinorine synthase-like                  176   5e-45   
ref|XP_002868208.1|  hypothetical protein ARALYDRAFT_915274             176   5e-45   
ref|XP_010025920.1|  PREDICTED: vinorine synthase-like                  176   5e-45   
ref|XP_010466664.1|  PREDICTED: BAHD acyltransferase At5g47980-li...    176   5e-45   
gb|KDP36818.1|  hypothetical protein JCGZ_08109                         176   6e-45   
ref|XP_008226162.1|  PREDICTED: vinorine synthase-like                  177   7e-45   
ref|XP_002308878.2|  hypothetical protein POPTR_0006s03450g             176   7e-45   
gb|KDP36817.1|  hypothetical protein JCGZ_08108                         176   8e-45   
ref|XP_006378283.1|  hypothetical protein POPTR_0010s06650g             176   8e-45   
gb|KCW81026.1|  hypothetical protein EUGRSUZ_C02399                     174   9e-45   
ref|XP_010556178.1|  PREDICTED: vinorine synthase                       176   9e-45   
ref|XP_008459937.1|  PREDICTED: BAHD acyltransferase At5g47980-like     175   1e-44   
ref|XP_011041560.1|  PREDICTED: BAHD acyltransferase At5g47980-like     175   1e-44   
ref|XP_004514780.1|  PREDICTED: vinorine synthase-like                  175   1e-44   
ref|XP_008222036.1|  PREDICTED: deacetylvindoline O-acetyltransfe...    175   1e-44   
ref|XP_006423655.1|  hypothetical protein CICLE_v10028515mg             175   1e-44   
ref|XP_004135508.1|  PREDICTED: vinorine synthase-like                  175   1e-44   
ref|XP_006415694.1|  hypothetical protein EUTSA_v10007649mg             175   1e-44   
ref|XP_008390113.1|  PREDICTED: BAHD acyltransferase At5g47980          174   2e-44   
gb|KCW86591.1|  hypothetical protein EUGRSUZ_B03223                     173   2e-44   
gb|KDP36821.1|  hypothetical protein JCGZ_08112                         174   2e-44   
ref|XP_011091918.1|  PREDICTED: vinorine synthase-like                  174   2e-44   
gb|KCW45515.1|  hypothetical protein EUGRSUZ_L00759                     174   3e-44   
ref|XP_008226065.1|  PREDICTED: BAHD acyltransferase At5g47980-like     174   3e-44   
ref|XP_009359423.1|  PREDICTED: salutaridinol 7-O-acetyltransfera...    174   3e-44   
ref|XP_006469323.1|  PREDICTED: BAHD acyltransferase At5g47980-like     174   3e-44   
gb|KDO42120.1|  hypothetical protein CISIN_1g036438mg                   173   3e-44   
ref|XP_004135298.1|  PREDICTED: vinorine synthase-like                  174   3e-44   
ref|XP_008383040.1|  PREDICTED: BAHD acyltransferase At5g47980-like     174   4e-44   
ref|XP_008346326.1|  PREDICTED: BAHD acyltransferase At5g47980-like     174   4e-44   
ref|XP_006432229.1|  hypothetical protein CICLE_v10001082mg             174   4e-44   
ref|XP_010025917.1|  PREDICTED: vinorine synthase-like                  173   4e-44   
ref|XP_009763180.1|  PREDICTED: vinorine synthase-like                  173   4e-44   
ref|XP_011069600.1|  PREDICTED: vinorine synthase-like                  173   5e-44   
ref|XP_006379530.1|  hypothetical protein POPTR_0008s03350g             173   5e-44   
ref|XP_008437382.1|  PREDICTED: BAHD acyltransferase At5g47980-like     173   6e-44   
gb|KDO37672.1|  hypothetical protein CISIN_1g0394691mg                  170   6e-44   
ref|XP_008386397.1|  PREDICTED: BAHD acyltransferase At5g47980-like     173   6e-44   
emb|CDP21452.1|  unnamed protein product                                173   7e-44   
ref|XP_006464983.1|  PREDICTED: salutaridinol 7-O-acetyltransfera...    173   9e-44   
ref|XP_004295691.1|  PREDICTED: BAHD acyltransferase At5g47980-like     173   9e-44   
ref|XP_008241213.1|  PREDICTED: BAHD acyltransferase At5g47980-like     173   9e-44   
ref|XP_006432227.1|  hypothetical protein CICLE_v10001125mg             173   9e-44   
gb|KCW62003.1|  hypothetical protein EUGRSUZ_H04681                     172   1e-43   
ref|XP_010025363.1|  PREDICTED: BAHD acyltransferase At5g47980-like     172   1e-43   
ref|XP_008444409.1|  PREDICTED: vinorine synthase-like                  172   1e-43   
ref|XP_009353048.1|  PREDICTED: BAHD acyltransferase At5g47980-like     172   1e-43   
ref|XP_010527675.1|  PREDICTED: BAHD acyltransferase At5g47980-like     172   1e-43   
ref|NP_199606.1|  HXXXD-type acyl-transferase-like protein              172   1e-43   
ref|XP_011031655.1|  PREDICTED: vinorine synthase-like                  172   2e-43   
ref|XP_010046625.1|  PREDICTED: vinorine synthase-like                  169   2e-43   
gb|KDO50293.1|  hypothetical protein CISIN_1g012496mg                   172   2e-43   
ref|XP_010100288.1|  Salutaridinol 7-O-acetyltransferase                171   2e-43   
ref|XP_004242673.1|  PREDICTED: vinorine synthase-like                  171   2e-43   
ref|XP_002529587.1|  Anthranilate N-benzoyltransferase protein, p...    171   2e-43   
ref|XP_002533378.1|  Anthranilate N-benzoyltransferase protein, p...    171   3e-43   
ref|XP_006414524.1|  hypothetical protein EUTSA_v10027507mg             171   4e-43   
ref|XP_011037156.1|  PREDICTED: acetyl-CoA-benzylalcohol acetyltr...    171   4e-43   
ref|XP_002317521.2|  hypothetical protein POPTR_0011s12510g             171   4e-43   
emb|CDY68964.1|  BnaC01g42060D                                          171   4e-43   
ref|XP_009371383.1|  PREDICTED: BAHD acyltransferase At5g47980-like     171   4e-43   
ref|XP_007227141.1|  hypothetical protein PRUPE_ppa026262mg             171   5e-43   
ref|XP_002534423.1|  Anthranilate N-benzoyltransferase protein, p...    171   5e-43   
gb|KCW68078.1|  hypothetical protein EUGRSUZ_F01763                     171   5e-43   
gb|KDO60771.1|  hypothetical protein CISIN_1g012483mg                   171   5e-43   
ref|XP_008383035.1|  PREDICTED: vinorine synthase-like                  171   6e-43   
ref|XP_009371382.1|  PREDICTED: BAHD acyltransferase At5g47980-li...    171   6e-43   
ref|XP_002321827.2|  hypothetical protein POPTR_0015s14850g             170   6e-43   
ref|XP_004243890.1|  PREDICTED: deacetylvindoline O-acetyltransfe...    170   7e-43   
ref|XP_006448149.1|  hypothetical protein CICLE_v10015171mg             171   7e-43   
ref|XP_010100292.1|  Vinorine synthase                                  170   7e-43   
ref|XP_010061158.1|  PREDICTED: vinorine synthase-like                  171   7e-43   
ref|XP_008385235.1|  PREDICTED: uncharacterized protein LOC103447811    175   7e-43   
ref|XP_010100290.1|  Salutaridinol 7-O-acetyltransferase                170   8e-43   
ref|XP_011013913.1|  PREDICTED: salutaridinol 7-O-acetyltransfera...    170   8e-43   
ref|XP_010088399.1|  Salutaridinol 7-O-acetyltransferase                169   1e-42   
ref|XP_004310027.1|  PREDICTED: vinorine synthase-like                  169   1e-42   
ref|XP_009371379.1|  PREDICTED: vinorine synthase-like                  170   1e-42   
gb|KFK33809.1|  hypothetical protein AALP_AA5G062900                    169   1e-42   
ref|XP_006853006.1|  hypothetical protein AMTR_s00174p00025490          169   1e-42   
ref|XP_003538872.1|  PREDICTED: vinorine synthase-like                  169   1e-42   
ref|XP_011085818.1|  PREDICTED: vinorine synthase-like                  169   1e-42   
ref|XP_002893451.1|  transferase family protein                         169   1e-42   
ref|XP_009606831.1|  PREDICTED: vinorine synthase-like                  169   2e-42   
ref|XP_006414538.1|  hypothetical protein EUTSA_v10025255mg             169   2e-42   
ref|XP_009358370.1|  PREDICTED: BAHD acyltransferase At5g47980-like     169   2e-42   
ref|XP_004294209.1|  PREDICTED: BAHD acyltransferase At5g47980-like     169   2e-42   
ref|XP_002524038.1|  3'-N-debenzoyl-2'-deoxytaxol N-benzoyltransf...    169   2e-42   
ref|XP_010068270.1|  PREDICTED: acetyl-CoA-benzylalcohol acetyltr...    169   2e-42   
ref|XP_006427935.1|  hypothetical protein CICLE_v10027530mg             169   2e-42   
ref|XP_008446095.1|  PREDICTED: vinorine synthase-like                  169   2e-42   
ref|XP_011000149.1|  PREDICTED: pelargonidin 3-O-(6-caffeoylgluco...    168   2e-42   
emb|CDP12986.1|  unnamed protein product                                168   2e-42   
ref|XP_011000222.1|  PREDICTED: acetyl-CoA-benzylalcohol acetyltr...    169   2e-42   
ref|XP_008226093.1|  PREDICTED: BAHD acyltransferase At5g47980-like     168   3e-42   
ref|XP_006422067.1|  hypothetical protein CICLE_v10004997mg             168   3e-42   
ref|XP_011031654.1|  PREDICTED: vinorine synthase-like                  168   3e-42   
ref|XP_008377073.1|  PREDICTED: vinorine synthase-like                  169   3e-42   
ref|XP_010425703.1|  PREDICTED: BAHD acyltransferase At5g47980-like     167   4e-42   
ref|XP_011031656.1|  PREDICTED: vinorine synthase-like                  168   4e-42   
gb|KDP35166.1|  hypothetical protein JCGZ_10700                         168   4e-42   
ref|XP_009352970.1|  PREDICTED: vinorine synthase-like                  167   4e-42   
emb|CDP15032.1|  unnamed protein product                                167   4e-42   
ref|XP_011037677.1|  PREDICTED: acetyl-CoA-benzylalcohol acetyltr...    168   4e-42   
ref|XP_006428006.1|  hypothetical protein CICLE_v10025515mg             168   5e-42   
ref|XP_010647391.1|  PREDICTED: vinorine synthase-like                  167   5e-42   
ref|XP_010050974.1|  PREDICTED: vinorine synthase-like                  167   5e-42   
ref|XP_010100296.1|  Vinorine synthase                                  168   5e-42   
emb|CBI18889.3|  unnamed protein product                                170   5e-42   
emb|CAN63243.1|  hypothetical protein VITISV_028808                     167   5e-42   
ref|XP_002305585.1|  hypothetical protein POPTR_0004s01720g             167   6e-42   
gb|KCW81023.1|  hypothetical protein EUGRSUZ_C02397                     166   6e-42   
ref|XP_006363183.1|  PREDICTED: deacetylvindoline O-acetyltransfe...    167   7e-42   
ref|XP_011091741.1|  PREDICTED: pelargonidin 3-O-(6-caffeoylgluco...    167   7e-42   
gb|AFK47265.1|  unknown                                                 167   8e-42   
ref|XP_009590647.1|  PREDICTED: deacetylvindoline O-acetyltransfe...    167   9e-42   
ref|XP_004152284.1|  PREDICTED: salutaridinol 7-O-acetyltransfera...    167   1e-41   
gb|KCW57660.1|  hypothetical protein EUGRSUZ_H00424                     166   1e-41   
ref|XP_010068273.1|  PREDICTED: acetyl-CoA-benzylalcohol acetyltr...    166   1e-41   
ref|XP_007212426.1|  hypothetical protein PRUPE_ppa016640mg             167   1e-41   
ref|XP_009371380.1|  PREDICTED: BAHD acyltransferase At5g47980-like     166   1e-41   
ref|XP_010040717.1|  PREDICTED: vinorine synthase-like                  166   1e-41   
gb|AFB74620.1|  acetyltransferase 1                                     167   1e-41   
ref|XP_009782260.1|  PREDICTED: acetyl-CoA-benzylalcohol acetyltr...    166   1e-41   
ref|XP_011091913.1|  PREDICTED: vinorine synthase-like                  166   2e-41   
ref|XP_008226088.1|  PREDICTED: BAHD acyltransferase At5g47980-like     166   2e-41   
ref|XP_010514622.1|  PREDICTED: BAHD acyltransferase At5g47980-like     166   2e-41   
gb|ACI45395.1|  salutaridinol 7-O-acetyltransferase                     167   2e-41   
ref|XP_006435339.1|  hypothetical protein CICLE_v10003197mg             165   2e-41   
ref|XP_004138261.1|  PREDICTED: vinorine synthase-like                  165   2e-41   
ref|XP_006282607.1|  hypothetical protein CARUB_v10004825mg             166   2e-41   
ref|XP_009371381.1|  PREDICTED: BAHD acyltransferase At5g47980-li...    166   2e-41   
gb|KDP36806.1|  hypothetical protein JCGZ_08097                         166   2e-41   
ref|XP_004298111.1|  PREDICTED: salutaridinol 7-O-acetyltransfera...    166   2e-41   
gb|KDO37664.1|  hypothetical protein CISIN_1g045515mg                   166   2e-41   
ref|XP_006432225.1|  hypothetical protein CICLE_v10003243mg             165   3e-41   
ref|XP_010425699.1|  PREDICTED: BAHD acyltransferase At5g47980-like     165   3e-41   
ref|XP_010097637.1|  Salutaridinol 7-O-acetyltransferase                165   3e-41   
gb|AET80686.1|  spermidine hydroxycinnamoyl transferase                 165   3e-41   
ref|XP_006307565.1|  hypothetical protein CARUB_v10009188mg             165   4e-41   
gb|KDP26744.1|  hypothetical protein JCGZ_17902                         165   4e-41   
ref|XP_010088398.1|  Salutaridinol 7-O-acetyltransferase                165   4e-41   
ref|XP_002863835.1|  transferase family protein                         164   5e-41   
ref|XP_010064606.1|  PREDICTED: BAHD acyltransferase At5g47980-like     169   5e-41   
ref|XP_008372178.1|  PREDICTED: BAHD acyltransferase At5g47980-like     165   5e-41   
ref|XP_009770804.1|  PREDICTED: deacetylvindoline O-acetyltransfe...    164   6e-41   
gb|KFK44501.1|  hypothetical protein AALP_AA1G265200                    164   6e-41   
ref|XP_006379532.1|  hypothetical protein POPTR_0008s03420g             165   6e-41   
ref|XP_010460461.1|  PREDICTED: BAHD acyltransferase At5g47980-like     164   7e-41   
ref|XP_008226169.1|  PREDICTED: vinorine synthase-like                  164   7e-41   
ref|XP_006427934.1|  hypothetical protein CICLE_v10027010mg             165   8e-41   
gb|KDP30484.1|  hypothetical protein JCGZ_16163                         164   8e-41   
ref|XP_004301469.1|  PREDICTED: vinorine synthase-like                  164   8e-41   
ref|XP_007148464.1|  hypothetical protein PHAVU_006G211000g             164   8e-41   
ref|NP_193274.1|  HXXXD-type acyl-transferase family protein            164   9e-41   
gb|KGN52789.1|  hypothetical protein Csa_4G001560                       164   9e-41   
gb|KCW80998.1|  hypothetical protein EUGRSUZ_C02374                     163   1e-40   
emb|CBI37948.3|  unnamed protein product                                170   1e-40   
gb|KCW44307.1|  hypothetical protein EUGRSUZ_L02250                     162   1e-40   
ref|XP_006415800.1|  hypothetical protein EUTSA_v10007667mg             164   1e-40   
ref|XP_010502922.1|  PREDICTED: BAHD acyltransferase At5g47980-li...    163   1e-40   
ref|NP_173851.1|  HXXXD-type acyl-transferase-like protein              163   1e-40   
dbj|BAF02069.1|  HSR201 like protein                                    164   1e-40   
ref|XP_011041291.1|  PREDICTED: vinorine synthase-like                  164   1e-40   
ref|XP_010529016.1|  PREDICTED: BAHD acyltransferase At5g47980-like     163   1e-40   
ref|XP_009365957.1|  PREDICTED: BAHD acyltransferase At5g47980-like     164   1e-40   
ref|XP_006387729.1|  hypothetical protein POPTR_0640s00200g             164   1e-40   
ref|XP_008363049.1|  PREDICTED: salutaridinol 7-O-acetyltransfera...    163   1e-40   
ref|XP_008382276.1|  PREDICTED: BAHD acyltransferase At5g47980-like     164   2e-40   
ref|XP_004511244.1|  PREDICTED: vinorine synthase-like                  163   2e-40   
gb|KCW63277.1|  hypothetical protein EUGRSUZ_G00905                     163   2e-40   
ref|XP_010502924.1|  PREDICTED: BAHD acyltransferase At5g47980-li...    163   2e-40   
ref|XP_006387730.1|  hypothetical protein POPTR_0640s00210g             163   2e-40   
ref|XP_002267080.1|  PREDICTED: vinorine synthase-like                  162   2e-40   
ref|XP_008226085.1|  PREDICTED: BAHD acyltransferase At5g47980-like     163   2e-40   
gb|AGT56098.1|  BAHD8                                                   162   2e-40   
gb|KCW44979.1|  hypothetical protein EUGRSUZ_L01434                     162   2e-40   
ref|XP_010065678.1|  PREDICTED: acetyl-CoA-benzylalcohol acetyltr...    162   3e-40   
ref|XP_009361992.1|  PREDICTED: salutaridinol 7-O-acetyltransfera...    162   3e-40   
ref|XP_004292909.1|  PREDICTED: salutaridinol 7-O-acetyltransfera...    163   3e-40   
ref|XP_010502921.1|  PREDICTED: BAHD acyltransferase At5g47980-li...    162   3e-40   
ref|XP_004172751.1|  PREDICTED: vinorine synthase-like                  162   3e-40   
ref|XP_010502923.1|  PREDICTED: BAHD acyltransferase At5g47980-li...    162   4e-40   
emb|CAN69388.1|  hypothetical protein VITISV_027664                     162   4e-40   
gb|AHL24755.1|  ferulate monolignol transferase                         162   4e-40   



>ref|XP_002323910.2| hypothetical protein POPTR_0017s04320g [Populus trichocarpa]
 gb|EEF04043.2| hypothetical protein POPTR_0017s04320g [Populus trichocarpa]
Length=430

 Score =   250 bits (639),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 172/448 (38%), Positives = 253/448 (56%), Gaps = 31/448 (7%)
 Frame = -2

Query  1751  MKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLH-LNLMTPFVFFYDSPTISGACHHTKTI  1575
             M++++ SKEI +PS+PTP  LK YKLS +DQL   +   P + FY SPT   +   +K  
Sbjct  1     MEIQIISKEIIKPSAPTPHHLKTYKLSAVDQLAAFSADVPIILFY-SPTDEIS---SKNS  56

Query  1574  DElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEMEKIKQ  1395
             D LKKS +KTL+L YP AGR+K+D  +I+C+D+G  +I A VA NMS +L+ P+M++++Q
Sbjct  57    DYLKKSFAKTLTLFYPFAGRIKDDS-SIDCNDDGATYIEAHVAGNMSMILQQPDMDQLEQ  115

Query  1394  L---IPSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFN  1224
             L    P   V EP   GK ++A QVN F CGGIAI   + H I DAS+LA F++ W + +
Sbjct  116   LQSCKPDENVDEPS--GKVMLAAQVNYFDCGGIAISVRIRHRIGDASSLASFVKCWGAIS  173

Query  1223  RGCAANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIA  1044
              G   NN +G V D SS+ FPP  D S +  L  +    I +   ++  KRFV     +A
Sbjct  174   CGIYDNN-AGTVVDCSSV-FPP-QDLSGMSFLYNL----IPRSSFNISTKRFVFEGPKLA  226

Query  1043  QLRQDLTITGGSVQRPSRVEALTALVWAAVINATPTQTAT--LSCMVNLRRRMEPPLPPN  870
              LR  L   G  + RP+R EA++AL+W  V   + ++      +  V+LR+RM+PPLP +
Sbjct  227   ALRGKLC-NGPYLNRPTRFEAVSALIWGVVGEDSESKKVNRPATIAVDLRKRMDPPLPQH  285

Query  869   CLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLRAVIAR  690
             C+G +V  A     EA      +    L  +I ++   +     R+VY +G +   +  R
Sbjct  286   CIGNIVHLA-----EANWENKAMDCNGLAGKIHESISMINSDYVRQVYADGTFFSLMRQR  340

Query  689   GYELVRNRDS--STLYTSSLCRMAYYEVDFGWGKPRLVVN--MLDNSWVLFLDAING-AV  525
               E+  + +S    +  SS C+  +YEVDFGWGKP  V     L+ +WV+ LD  +G  +
Sbjct  341   MAEMAEDPNSFRGVIGFSSWCKFRFYEVDFGWGKPIWVGTSLRLEPNWVMLLDTRDGEGM  400

Query  524   EVWMKLPKQVMHTLTQDRHFLAYVSAFP  441
             EV + LP + M    Q+   LAY S  P
Sbjct  401   EVRIALPNEEMVKFEQNPDILAYASFTP  428



>ref|XP_011001807.1| PREDICTED: vinorine synthase-like [Populus euphratica]
Length=430

 Score =   246 bits (629),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 174/448 (39%), Positives = 251/448 (56%), Gaps = 31/448 (7%)
 Frame = -2

Query  1751  MKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLH-LNLMTPFVFFYDSPTISGACHHTKTI  1575
             M++++ SKEI +PS+PTP  LK YKLS +DQL       P + FY SPT   +   +KT 
Sbjct  1     MEIQIISKEIIKPSAPTPHHLKTYKLSAVDQLAAFAADIPIILFY-SPTDEIS---SKTS  56

Query  1574  DElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEMEKIKQ  1395
             D LKKS +KTL+L YP AGR+K D  +I+C+D+G  +I A VA NMS +L+ P+M++++Q
Sbjct  57    DYLKKSFAKTLTLFYPFAGRIK-DASSIDCNDDGASYIEAHVAGNMSMILQQPDMDQLEQ  115

Query  1394  L---IPSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFN  1224
             L    P   V EP   GK ++A QVN F CGG+AI   + H I DAS++A F++ W++  
Sbjct  116   LQSCKPDENVDEPS--GKGMLAAQVNYFDCGGMAISVRIRHRIGDASSVASFVKCWSAIC  173

Query  1223  RGCAANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIA  1044
              G   +N +G V D SS LFPP  D S I  L       I +   ++  KRFV     +A
Sbjct  174   CGI-YDNSAGTVVDCSS-LFPP-QDLSGISFLYN----PIPRSSFNISTKRFVFEGPKLA  226

Query  1043  QLRQDLTITGGSVQRPSRVEALTALVWAAVINATPTQTAT--LSCMVNLRRRMEPPLPPN  870
              LR  L   G  + RP+R EA++AL+W  V   + ++      +  V+LR+RM+PPLP +
Sbjct  227   ALRGKLC-NGPYLNRPTRFEAVSALIWGVVGEDSESKKVNKPATIAVDLRKRMDPPLPQH  285

Query  869   CLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLRAVIAR  690
             C+G +V  A+     A     VV    L  +I ++   +     R+VY +G +   +  R
Sbjct  286   CIGNIVHLAV-----ANWENKVVDYNGLAGKIHESISMINSDYVRQVYADGTFFSLMRQR  340

Query  689   GYELVRNRDS--STLYTSSLCRMAYYEVDFGWGKPRLVVNMLDNS--WVLFLDAING-AV  525
               E  ++ D+    +  SS C+  +YEVDFGWGKP  V   L  S  WV+ LD  +G  +
Sbjct  341   MAEKAQDPDNFRGVIGFSSWCKFRFYEVDFGWGKPIWVGTSLRLSPNWVMLLDTRDGEGM  400

Query  524   EVWMKLPKQVMHTLTQDRHFLAYVSAFP  441
             EV + LP + M    Q+   LAY S  P
Sbjct  401   EVRIALPNEEMVKFEQNPDILAYASFIP  428



>ref|XP_007030131.1| 3'-N-debenzoyl-2'-deoxytaxol N-benzoyltransferase, putative [Theobroma 
cacao]
 gb|EOY10633.1| 3'-N-debenzoyl-2'-deoxytaxol N-benzoyltransferase, putative [Theobroma 
cacao]
Length=444

 Score =   242 bits (618),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 170/455 (37%), Positives = 247/455 (54%), Gaps = 31/455 (7%)
 Frame = -2

Query  1751  MKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGACHHTKTID  1572
             M+V++ S+E  +P SPTP  L+ +KLS LDQL   +  P + FY S T      +    D
Sbjct  1     MEVQIISRETIKPFSPTPDHLRTHKLSLLDQLVPPIYLPMILFY-SATDENDPRNYNISD  59

Query  1571  ElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEMEKIKQL  1392
              LKKSLSK L+  YP AGR+K+D +T++C+D GV F+ A VA +MS +LE PE+E ++QL
Sbjct  60    YLKKSLSKALTHFYPFAGRIKDD-LTVDCNDGGVTFVEAQVACDMSFVLEEPEIE-VRQL  117

Query  1391  IPSAKVYEPQPVGKAL------VAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWAS  1230
             +P A  +E  P  ++       +AVQVN F+CGG+AI   +SH I DASA A F++ WA+
Sbjct  118   LPCAP-FEHSPQTQSSTDQVIPLAVQVNYFACGGMAISVCISHVIGDASAAAHFLKGWAA  176

Query  1229  FNRGCAANNGSGFVSDHSSILFPPLTDTSAIEQLMK--MGAEG-IEQEEKDMIVKRFVIP  1059
               RG  A+N  G + D SS LFPP  D S   + +   + A G +E  E   + KR +  
Sbjct  177   LARG--ADNIEGVIYDSSS-LFPP-RDLSIFRKYVGGLVDANGKVESPEDKFVTKRLMFN  232

Query  1058  ANAIAQLRQDLTITGGSVQRPSRVEALTALVWAAVINATPTQTAT-------LSCMVNLR  900
              + I  LR ++   G ++ RP+RVEA+TA+VW A+INAT     +       +S  +NLR
Sbjct  233   GSKITALRNEIG-DGLNLYRPTRVEAVTAVVWEALINATAENDGSGTSPILAVSNAMNLR  291

Query  899   RRMEPPLPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGE  720
             +RM PPLP  C+G +    +V     K    +     L + I ++ +   D   RK +  
Sbjct  292   KRMNPPLPQQCIGNVSFSKMVSSLNVK----IKNRSNLAKIINESIKETDDEYIRKTFTS  347

Query  719   GGWLRAVIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKP-RLVVNMLDNSWVLFLD  543
             G  L  +     +  +N        S  CR  +YEVDFGWGKP      +  N    F+D
Sbjct  348   GECLNLMEKLCEKFEKNSKLGMFIFSCWCRFPFYEVDFGWGKPVWFECPLRANRVGFFVD  407

Query  542   AING-AVEVWMKLPKQVMHTLTQDRHFLAYVSAFP  441
               +G  +E W+ L K+ M  L ++   LAY +  P
Sbjct  408   TSDGEGIEAWITLRKEEMAKLEKEPGILAYATFKP  442



>ref|XP_007030134.1| 3'-N-debenzoyl-2'-deoxytaxol N-benzoyltransferase, putative [Theobroma 
cacao]
 gb|EOY10636.1| 3'-N-debenzoyl-2'-deoxytaxol N-benzoyltransferase, putative [Theobroma 
cacao]
Length=439

 Score =   241 bits (614),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 154/454 (34%), Positives = 243/454 (54%), Gaps = 34/454 (7%)
 Frame = -2

Query  1751  MKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYD----SPTISGACHHT  1584
             M+V++  +E  +PSSPTP  L+ +KL   D L   +  P + FY     SPT S + +  
Sbjct  1     MEVQIIDRETIKPSSPTPDHLRTHKLCLFDLLASPIYIPTLLFYSARDGSPTNSISDNLK  60

Query  1583  KTIDElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEMEK  1404
             K++ +            YPLAGR+K+D +TI+C+D+G  FI A VA +MS +LE P++E 
Sbjct  61    KSLSKALTH-------FYPLAGRIKDD-LTIDCNDDGATFIEAQVARDMSFVLEEPDIEV  112

Query  1403  IKQLIPS---AKVYEPQP-VGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIW  1236
             ++QL+P      + + QP   + L+AVQVN F+CGG+AI   +SH +ADASA A F++ W
Sbjct  113   LQQLLPCDPLQHLPQTQPSTDQVLLAVQVNHFACGGMAICVCISHVVADASAAANFLKGW  172

Query  1235  ASFNRGCAANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPA  1056
             A     C A+   G + D SS+   PL D S   ++M++          ++I KRF+   
Sbjct  173   AEV--ACGADIIEGVIYDCSSLF--PLRDMSLFYRVMEILLHKTNSGSPEVITKRFLFDG  228

Query  1055  NAIAQLRQDLTITGGSVQRPSRVEALTALVWAAVINATPTQTAT-----LSCMVNLRRRM  891
             + IA LR ++     S   P+RVEA+TAL+W A++ AT     T      S +VNLR+RM
Sbjct  229   SKIAALRNEMGDELNSYH-PTRVEAVTALIWEALVAATAENVTTSPILEASNIVNLRKRM  287

Query  890   EPPLPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVY-GEGG  714
              PPLPP C+G +   ++V    +     +     L ++I ++ + + D   RK++  +  
Sbjct  288   NPPLPPQCIGNVCFVSMV----STPTENIENRTSLARKIHESIKEIDDDYIRKIFTSDAE  343

Query  713   WLRAVIARGYELVRNRDSSTLYT-SSLCRMAYYEVDFGWGKPRLVVNMLD-NSWVLFLDA  540
                 ++ + +E ++   +  ++  SS CR  +YE +FGWGKP         N     LD 
Sbjct  344   CFHNLMEKIFEEMKKSSNIGMFRFSSWCRFPFYETNFGWGKPIWFGTAFAINRNGCLLDT  403

Query  539   ING-AVEVWMKLPKQVMHTLTQDRHFLAYVSAFP  441
              +G  +E W+ L K+ M  L Q    LA+ +  P
Sbjct  404   SDGEGIEAWISLTKEEMAQLEQQPGILAHAAFKP  437



>ref|XP_006372816.1| hypothetical protein POPTR_0017s05330g [Populus trichocarpa]
 gb|ERP50613.1| hypothetical protein POPTR_0017s05330g [Populus trichocarpa]
Length=426

 Score =   240 bits (612),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 169/436 (39%), Positives = 245/436 (56%), Gaps = 32/436 (7%)
 Frame = -2

Query  1751  MKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLH-LNLMTPFVFFYDSPTISGACHHTKTI  1575
             M++++ SKEI +PS+PTP  LK YKLS +DQL       P V FY SPT   +   +K  
Sbjct  1     MEIQIISKEIIKPSAPTPHHLKTYKLSAVDQLAAFAADIPVVLFY-SPTDEIS---SKNS  56

Query  1574  DElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEMEKIKQ  1395
             D LKKS +KTL+L YP AGR+K+D  +I+C+D+G  +I A VA NMS +L+  +M++++Q
Sbjct  57    DYLKKSFAKTLTLFYPFAGRIKDDS-SIDCNDDGATYIEAHVAGNMSMILQQTDMDQLEQ  115

Query  1394  L---IPSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFN  1224
             L    P   V EP   GK ++A QVN F CGGIAI   + H I DAS+LA F++ W + +
Sbjct  116   LQSCKPDENVDEPS--GKVMLAAQVNYFDCGGIAISVRIRHRIGDASSLASFVKCWGAIS  173

Query  1223  RGCAANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIA  1044
              G   NN +G V D SS LFPP  D S +  L  +    I +   ++  KRFV     +A
Sbjct  174   CGIYDNN-AGTVVDCSS-LFPP-QDLSGMSFLYNL----IPRSSFNISTKRFVFEGPKLA  226

Query  1043  QLRQDLTITGGSVQRPSRVEALTALVWAAVINATPTQTAT--LSCMVNLRRRMEPPLPPN  870
              LR  L   G  + RP+R EA++AL+W  V   + ++      +  V+LR+RM+PPLP +
Sbjct  227   ALRGKLC-NGPYLNRPTRFEAVSALIWGVVGEDSESKKVNKPATFAVDLRKRMDPPLPQH  285

Query  869   CLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLRAVIAR  690
             C+G +V  A+   +   D         L  +I ++   +     R+VY +G +  ++  R
Sbjct  286   CIGNIVHLAVANWENKVDCNG------LAGKIHESISMINSDYVRQVYSDGTFFSSIRQR  339

Query  689   GYELVR--NRDSSTLYTSSLCRMAYYEVDFGWGKPRLVVNMLDNS--WVLFLDAING-AV  525
               E+    N   S +  SS C+  +YEVDFGWGKP  V   L  S  WV+ LD  +G  +
Sbjct  340   MAEMAEDPNNFRSVIGFSSWCKFRFYEVDFGWGKPVWVGTSLRLSPNWVMLLDTRDGEGM  399

Query  524   EVWMKLPKQVMHTLTQ  477
             EV + LP + M  L +
Sbjct  400   EVRIALPNEEMVKLLR  415



>ref|XP_009610450.1| PREDICTED: vinorine synthase-like [Nicotiana tomentosiformis]
Length=434

 Score =   239 bits (611),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 168/453 (37%), Positives = 257/453 (57%), Gaps = 45/453 (10%)
 Frame = -2

Query  1751  MKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGACHHTKTID  1572
             MKVE+  K+  +PSSPTP + ++YKLS +DQL      P V FYDS T    CH     D
Sbjct  3     MKVEITHKDTIKPSSPTPLSQRDYKLSLIDQLTPGPYVPIVLFYDSTT--KFCH-----D  55

Query  1571  ElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAE-NMSCLLENPEMEKIKQ  1395
              LKKSLSKTL+ MYPLAGR+K+D  TIEC+D+GV+F+ A+V+   +S ++ +P++  + Q
Sbjct  56    LLKKSLSKTLNYMYPLAGRIKDD-FTIECNDKGVDFLEANVSNITLSNIVNDPKIGTLSQ  114

Query  1394  LIP-SAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNR-  1221
             L+P        +P  + L+AVQV +F CGGI+IG  V H IADAS L   ++ WA+ N+ 
Sbjct  115   LLPCHPHARSKEPSDQVLLAVQVTKFPCGGISIGVCVWHLIADASTLVTLVKTWATMNQE  174

Query  1220  -GCAANN-GSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAI  1047
              G  +N  G+G++ + + I FPP  D S    L  +     E+    + +KRF+   + +
Sbjct  175   NGQESNVIGNGYIVNVTGI-FPP-RDLSNNPLLTMVPIP--EELPFKISMKRFIFDNSKL  230

Query  1046  AQLRQDLTITGGSVQRPSRVEALTALVWAAVINA-----TPTQTATLSCMVNLRRRMEPP  882
             A L Q   I       P+R EAL+A +W+A+I+      +  +   L   +NLR+RM P 
Sbjct  231   AALIQSCPIC------PTRFEALSAFLWSAIISTWKDKKSEIKVCILMTSINLRKRMIPN  284

Query  881   LPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGW---  711
             LP N +G L+   +   +  ++G  V+   +LV+R++++ R V+D   R+++ + G+   
Sbjct  285   LPTNSMGNLIYPTMAKWEVEEEG--VIDYKKLVERVQESIRMVEDSYIRRIHEKNGYIDY  342

Query  710   ----LRAVIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVVN-MLDNSWVLFL  546
                 L   I RG E+            S C++ + E DFGWGKP  + N M        L
Sbjct  343   LNSILELCITRGNEV------GIAGCISWCKLPFDEADFGWGKPIWIANPMKFPCGFNLL  396

Query  545   DAING-AVEVWMKLPKQVMHTLTQDRHFLAYVS  450
             D ++G  +EVWM LP++ M  L +++ FL+YVS
Sbjct  397   DTVDGKGIEVWMGLPEEEMQLLEKNKDFLSYVS  429



>ref|XP_007037900.1| 3'-N-debenzoyl-2'-deoxytaxol N-benzoyltransferase, putative [Theobroma 
cacao]
 gb|EOY22401.1| 3'-N-debenzoyl-2'-deoxytaxol N-benzoyltransferase, putative [Theobroma 
cacao]
Length=434

 Score =   239 bits (609),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 162/455 (36%), Positives = 243/455 (53%), Gaps = 39/455 (9%)
 Frame = -2

Query  1757  ITMKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGACHHTKT  1578
             + MKV + S+E  +PSSPTP   + +KLS  DQL   L  P + FY +   +   + +K 
Sbjct  1     MEMKVHIISRETIKPSSPTPHHQRTHKLSLFDQLAPPLYIPILLFYSA---TSETNPSKK  57

Query  1577  IDElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEMEKIK  1398
              D LK SLSK L+  YP AGRVKE   TI+C+D+G  ++ A V  +M  +L+ P ++ + 
Sbjct  58    SDLLKDSLSKILTHFYPFAGRVKEG-CTIDCNDDGAAYVEAQVDSDMFLVLKEPGIDLLL  116

Query  1397  QLIPSAKVYE-PQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNR  1221
             QL+P   + + P+P  + ++AVQVN F+CGG+AI   + H ++DASA A F++ WA    
Sbjct  117   QLLPCEPLEKLPEPSAQVILAVQVNYFACGGMAICVCLRHVVSDASAAAGFVKSWA----  172

Query  1220  GCAANNGSGFVSD----HSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPAN  1053
               A  +G   V D      + LFPP  D S + + ++     +  E   ++ KRF+   +
Sbjct  173   --AVASGVDMVLDAVIYDCTSLFPP-QDLSGLWKTIEKSQNALLAE---VVTKRFIFYGS  226

Query  1052  AIAQLRQDLTITGGSVQRPSRVEALTALVWAAVINA-------TPTQTATLSCMVNLRRR  894
              IA LR ++   G S+ RP+RVEAL++L+W A+I          P   AT +  VNLR+R
Sbjct  227   KIAALRNEIG-NGLSLYRPTRVEALSSLIWNAIIAGDTEEGEIVPMHVATTA--VNLRKR  283

Query  893   MEPPLPPNCLGTL--VDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGE  720
             M PPLP  C+G +  V  A +   + K   +      L ++I ++   + D   R+ +G 
Sbjct  284   MNPPLPQLCMGNISHVTMANLFMAKTKSRNS------LAEKIHESILKIDDKFVRQFFGS  337

Query  719   GGWLRAVIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVVNMLD-NSWVLFLD  543
             G  L  +     EL ++  +     SS CR  +YE DFGWGKP      L  N   +FLD
Sbjct  338   GAHLNVMKNMAAELGKSSKARLFNFSSWCRFPFYETDFGWGKPVWFATALRLNKLAIFLD  397

Query  542   AING-AVEVWMKLPKQVMHTLTQDRHFLAYVSAFP  441
               +G  +E W+ L K+ M  L +D   LAY S  P
Sbjct  398   TRDGKGIEAWIGLTKEEMTKLERDPGILAYASFNP  432



>ref|XP_011008627.1| PREDICTED: vinorine synthase-like [Populus euphratica]
Length=432

 Score =   237 bits (605),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 163/451 (36%), Positives = 242/451 (54%), Gaps = 35/451 (8%)
 Frame = -2

Query  1751  MKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGACHHTKTID  1572
             M+V++ SKEI +PSS TPQ L+ YKLS LDQL   L  P + FY SP     C   K  D
Sbjct  1     MEVQIISKEILKPSSSTPQHLRTYKLSVLDQLAPPLYIPIILFY-SPASENLC---KNSD  56

Query  1571  ElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEMEKIKQL  1392
              LK+S S+TL+  YP AGR+K+D  +++C+D G EFI A VA ++S +LE  ++ + +QL
Sbjct  57    HLKESFSQTLTHFYPFAGRIKDD-FSVDCNDYGAEFIEARVAGDISMVLEQADINQQQQL  115

Query  1391  IPSAKVYEPQPVGKA--------LVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIW  1236
             +P +      P GK+         +AVQVN F+CGG+AI   + HA+ADAS LA F+  W
Sbjct  116   LPCS------PYGKSSKLSTDQVTLAVQVNYFNCGGVAISLCIWHAVADASTLATFVNCW  169

Query  1235  ASFNRGCAANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPA  1056
             A+ +R    NN    V    + LFPP  D S+   L     E +  E   +++KRF+   
Sbjct  170   AAISRD--PNNVIDEVVFDCTTLFPP-QDLSSF-SLHNFVKEDVSSE---IVMKRFLFEG  222

Query  1055  NAIAQLRQDLTITGGSVQRPSRVEALTALVWAAVINAT----PTQTATLSCMVNLRRRME  888
             + +A LR ++   G S+ RPSR  A++ L+  A++  T      Q    +  V+LRRR+E
Sbjct  223   SKVAALRDEVG-NGPSLDRPSRFIAVSTLILTAMMTVTRENEAMQINAATIAVDLRRRLE  281

Query  887   PPLPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWL  708
             PP+P   +G +    I    E++     +T   L  ++ ++ R + D   RK++  GG+ 
Sbjct  282   PPMPKQSIGNIFQVTIAKWPESE--SNELTYNGLAGKLHESIRMMNDDFIRKIHAGGGYF  339

Query  707   RAVIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVVNMLDNSWV-LFLDAING  531
               +   G E  +  + +    SS C   +YE DFGWGKP  +   L    V +FLD  +G
Sbjct  340   NFLKRAGEEARKGLNFTVFGFSSWCNFPFYETDFGWGKPLWLSPALKLKRVAIFLDTKDG  399

Query  530   -AVEVWMKLPKQVMHTLTQDRHFLAYVSAFP  441
               +E W+ L ++ M    QD   L Y S  P
Sbjct  400   EGIEAWIGLSEEDMVKFEQDPGILTYASFSP  430



>ref|XP_002308780.1| hypothetical protein POPTR_0006s01190g [Populus trichocarpa]
 gb|EEE92303.1| hypothetical protein POPTR_0006s01190g [Populus trichocarpa]
Length=432

 Score =   235 bits (600),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 160/451 (35%), Positives = 240/451 (53%), Gaps = 35/451 (8%)
 Frame = -2

Query  1751  MKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGACHHTKTID  1572
             M+V++ SKEI +PSS TPQ L+ YKLS LDQL   +  P + FY SP     C   K  D
Sbjct  1     MEVQIISKEILKPSSSTPQHLRTYKLSVLDQLAPPIYIPIILFY-SPASEHLC---KNSD  56

Query  1571  ElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEMEKIKQL  1392
              LK+S S+TL+  YP AGR+K+D  +++C+D+G EFI A VA ++S +LE  ++ + +QL
Sbjct  57    HLKESFSQTLTHFYPFAGRIKDD-FSVDCNDDGAEFIEARVAGDISMVLEQADINQQQQL  115

Query  1391  IPSAKVYEPQPVGKA--------LVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIW  1236
             +P +      P GK+         +AVQVN F+CGG+AI   + HA+ADAS LA F+  W
Sbjct  116   LPCS------PYGKSSKLSTDQVTLAVQVNYFNCGGVAISICIWHAVADASTLATFVNCW  169

Query  1235  ASFNRGCAANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPA  1056
             A+ +R    NN    V    + LFPP  D S+   L     E +  E   +++KRF+   
Sbjct  170   AAISRD--PNNVIDEVVFDCTTLFPP-QDLSSF-SLHSFVKEDVSSE---IVMKRFLFDG  222

Query  1055  NAIAQLRQDLTITGGSVQRPSRVEALTALVWAAVINAT----PTQTATLSCMVNLRRRME  888
             + +A LR ++   G S+ RPSR  A++ L+  A++  T      Q    +  V+LRRR++
Sbjct  223   SKVAALRDEVG-NGPSLDRPSRFIAVSTLILTAMMTVTRENEAMQINAATIAVDLRRRLK  281

Query  887   PPLPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWL  708
             PP+P   +G +    I    E++          L  ++ ++ R + D   RK +  GG+ 
Sbjct  282   PPVPKQSIGNIFQVTIAKWPESESNELSYNG--LAGKLHESIRMMNDDFIRKFHAGGGYF  339

Query  707   RAVIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVVNMLD-NSWVLFLDAING  531
               +   G E  +  + +    SS C   +YE DFGWGKP  +   L  N   +FLD  +G
Sbjct  340   NFLKRSGEEARKGSNVTVFGFSSWCNFPFYETDFGWGKPLWLSPALKLNRVAIFLDTKDG  399

Query  530   -AVEVWMKLPKQVMHTLTQDRHFLAYVSAFP  441
               +E W+ L ++ M    QD   L Y S  P
Sbjct  400   EGIEAWIGLSEEDMVKFEQDPGILTYASFSP  430



>ref|XP_002511243.1| 3'-N-debenzoyl-2'-deoxytaxol N-benzoyltransferase, putative [Ricinus 
communis]
 gb|EEF51845.1| 3'-N-debenzoyl-2'-deoxytaxol N-benzoyltransferase, putative [Ricinus 
communis]
Length=429

 Score =   234 bits (597),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 152/445 (34%), Positives = 239/445 (54%), Gaps = 27/445 (6%)
 Frame = -2

Query  1751  MKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGACHHTKTID  1572
             M+VE+ SKE  RPSS TP  L+ Y LS LDQ+   +  P + FY SP  +   + +    
Sbjct  1     MEVEIISKETIRPSSSTPPHLRTYNLSLLDQIAPPVYVPVILFY-SPDAANDVNPSNKSH  59

Query  1571  ElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEMEKIKQL  1392
              LK++ SKTL+  YPLAGR+++D   I+C D G  +   +VA +MS +++ P + ++++L
Sbjct  60    HLKQAFSKTLTHFYPLAGRIQDDIFNIDCSDNGASYTEVNVAGDMSMVIQEPNIHQLEKL  119

Query  1391  IPSAKVYE--PQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRG  1218
             +P    YE  P+   + ++  QVN F CG IAI   + H I DA+  A F++ WA+   G
Sbjct  120   LP-CNPYEMLPEISSQEILKAQVNYFECGEIAISICIWHVIGDATTAASFIKSWAAIASG  178

Query  1217  CAANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQL  1038
                 +    V    + +FPP    S + +         ++   D+++KRFV   + +A L
Sbjct  179   GGGYSDIDNVVFDCTSIFPPQKIHSFLWRNFMT-----DEMLSDILMKRFVFDGSKVAAL  233

Query  1037  RQDLTITGGSVQRPSRVEALTALVWAAVINATPTQTATLSCMVNLRRRMEPPLPPNCLGT  858
             R+++   G S+  P+RVEA+ AL+W AV+ AT  +    + +++LR+R+EPPLP NC+G 
Sbjct  234   REEVG-KGPSLDHPTRVEAIGALIWKAVMAAT-GKDYVAATVIDLRKRVEPPLPKNCIGN  291

Query  857   LVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLRAVIARGYEL  678
             +   A      A D  +V+    L  +I ++ + + +   RK++  G +L  V     +L
Sbjct  292   INQMAF-----AAD-CSVMDYNYLAGKIHESIKMINNEYVRKIHAGGEYLEHV----RDL  341

Query  677   V-RNRDS----STLYTSSLCRMAYYEVDFGWGKPRLVVNMLDNSWVLFLDAING-AVEVW  516
               +NR+S    +    SS CR  +YE DFGWGKP  V   L N     LD  +G  +E W
Sbjct  342   ADQNRESPGWLNQFSISSWCRFPFYEADFGWGKPIWVTTALINRCAFLLDTKDGQGIEAW  401

Query  515   MKLPKQVMHTLTQDRHFLAYVSAFP  441
             + LPK+VM    Q+     Y S  P
Sbjct  402   IGLPKEVMSKFEQNPDICTYASFTP  426



>ref|XP_004294207.1| PREDICTED: vinorine synthase-like [Fragaria vesca subsp. vesca]
Length=440

 Score =   232 bits (592),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 152/450 (34%), Positives = 241/450 (54%), Gaps = 30/450 (7%)
 Frame = -2

Query  1751  MKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFY---DSPTISGACHHTK  1581
             MK+E+  ++I +PSSPTP  L+N++LSF DQ+ + + TP + F+   +S +    C H  
Sbjct  5     MKIEIIERQIIKPSSPTPHHLRNFELSFFDQMAITIYTPLLLFFPNTESTSKLEICEH--  62

Query  1580  TIDElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEMEKI  1401
                 L +SL+KTL+  YPLAGR+K   V +EC+D+G EF+ A V+ ++S  LENP ++ +
Sbjct  63    ----LTESLAKTLTHFYPLAGRIKGSTV-VECNDDGAEFVKAQVSCSLSDFLENPAVKIL  117

Query  1400  KQLIPSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNR  1221
             +Q +P A++   +     L+ VQV+ F CGG+A+GF +SH IADAS L+ F+  WA    
Sbjct  118   EQFLP-AEILSKEAGSGPLLLVQVSLFECGGMALGFSISHKIADASTLSTFINCWAQTTN  176

Query  1220  GCAANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQ  1041
                 ++        S+ LFPPL  +S   Q        +  +    I +RFV     I+ 
Sbjct  177   TSITDSEVTLPEFGSASLFPPLEKSSDSSQ----PPARVYSKNHINITRRFVFDGANISA  232

Query  1040  LRQDLTITGGSVQRPSRVEALTALVWAAVINATPTQTAT-----LSCMVNLRRRMEPPLP  876
             L+    +   SV +P+RVEA++AL+W   I A+ +++ +      S  VNLR+R+ PPLP
Sbjct  233   LQSK--VASPSVPKPTRVEAISALIWKCAIEASTSKSGSQRPSVFSQDVNLRKRVVPPLP  290

Query  875   PNCLGTLVDEAIVLCQEAKDGGTVVTAV-ELVQRIRDAFRAVKDGEARKVYGEGGWLRAV  699
              NC G +V        E +DG +V   + +LV + R+               +  W    
Sbjct  291   ENCAGNVVG-FFRSKVEVEDGTSVAIDLKDLVSKFREGIENYAAITETIFGSDEAW--QG  347

Query  698   IARGYELVRNRDSSTLYT-SSLCRMAYYEVDFGWGKPRLV--VNMLDNSWVLFLDAING-  531
             I   Y+ ++  D+   Y+ +S CR  +YE DFGWGKP  V   ++   + ++ LD  +G 
Sbjct  348   IKDKYKNLKKSDAMGFYSCTSWCRFPFYEADFGWGKPNWVSIASVSIENIIVMLDKRDGN  407

Query  530   AVEVWMKLPKQVMHTLTQDRHFLAYVSAFP  441
              +EVW+ +  + M     +   LAY S  P
Sbjct  408   GIEVWLTMNHETMALFESNAELLAYASVNP  437



>ref|XP_011037141.1| PREDICTED: vinorine synthase-like [Populus euphratica]
Length=430

 Score =   231 bits (590),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 166/437 (38%), Positives = 237/437 (54%), Gaps = 31/437 (7%)
 Frame = -2

Query  1718  RPSSPTPQTLKNYKLSFLDQLH-LNLMTPFVFFYDSPTISGACHHTKTIDElkkslsktl  1542
             +PS+PTP+ LK YKLS +DQL       P + FY SP    +   +K  D LKKS +KTL
Sbjct  12    KPSAPTPRHLKTYKLSAVDQLAAFAADIPVILFY-SPADEIS---SKNSDYLKKSFAKTL  67

Query  1541  sLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEMEKIKQL---IPSAKVY  1371
             +L YP AGR+K D  +I+C+D+G  +I A VA NMS +L+ P+M++++QL    P   + 
Sbjct  68    TLFYPFAGRIK-DASSIDCNDDGATYIEAHVAGNMSMILQQPDMDQLEQLQSCKPDENID  126

Query  1370  EPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGCAANNGSGF  1191
             E    GK ++A QVN F CGGIAI   + H I DAS+LA F++ WA+ + G   NN    
Sbjct  127   ELS--GKVMLAAQVNYFDCGGIAISVRIRHRIGDASSLASFVKCWAAISCGIYDNNAETV  184

Query  1190  VSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQLRQDLTITGG  1011
             V    S LFPP  D   +  L  +    I +   ++  KRFV     +A LR  L   G 
Sbjct  185   VD--CSSLFPP-QDFLGMSFLYNL----IPRSSLNISTKRFVFEGPKLAALRGKLC-NGP  236

Query  1010  SVQRPSRVEALTALVWAAVINATPTQTAT--LSCMVNLRRRMEPPLPPNCLGTLVDEAIV  837
              + RP+R EA++AL+W  V   + ++      +  V+LR+RM+PPLP +C+G +V  A  
Sbjct  237   YLNRPTRFEAVSALIWGVVGEDSESKKVNKLATIAVDLRKRMDPPLPQHCIGNIVHLA--  294

Query  836   LCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLRAVIARGYELVR--NRD  663
                EA     VV    L  +I ++   +     R+VY +G +  ++  R  E+    N  
Sbjct  295   ---EANWENKVVDYNGLAGKIHESISMINSDYVRQVYADGTFFSSMRQRMAEMAEDPNNF  351

Query  662   SSTLYTSSLCRMAYYEVDFGWGKPRLVVNMLDNS--WVLFLDAING-AVEVWMKLPKQVM  492
              S +  SS C+  +YEVDFGWGKP  V   L  S  WV+ LD  +G  +EV + LP + M
Sbjct  352   RSVIGFSSWCKFRFYEVDFGWGKPIWVGTSLRLSPNWVMLLDTRDGEGMEVRIALPNEEM  411

Query  491   HTLTQDRHFLAYVSAFP  441
                 Q+   LAY S  P
Sbjct  412   VKFEQNPDILAYASFTP  428



>ref|XP_011041297.1| PREDICTED: vinorine synthase-like [Populus euphratica]
Length=430

 Score =   231 bits (590),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 165/437 (38%), Positives = 237/437 (54%), Gaps = 31/437 (7%)
 Frame = -2

Query  1718  RPSSPTPQTLKNYKLSFLDQLH-LNLMTPFVFFYDSPTISGACHHTKTIDElkkslsktl  1542
             +PS+PTP+ LK YKLS +DQL       P + FY SP    +   +K  D LKKS +KTL
Sbjct  12    KPSAPTPRHLKTYKLSAVDQLAAFAADIPVILFY-SPADEIS---SKNSDYLKKSFAKTL  67

Query  1541  sLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEMEKIKQL---IPSAKVY  1371
             +L YP AGR+K+D  +I+C+D+G  +I A VA NMS +L+ P+M+K++QL    P   + 
Sbjct  68    TLFYPFAGRIKDDS-SIDCNDDGASYIEAHVAGNMSMILQQPDMDKLEQLQSCKPDENID  126

Query  1370  EPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGCAANNGSGF  1191
             E    GK ++A QVN F CGGIAI   + H I DAS+LA F++ WA+ + G   NN    
Sbjct  127   ELS--GKVMLAAQVNYFDCGGIAISVRIRHRIGDASSLASFVKCWAAISCGIYDNNAETV  184

Query  1190  VSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQLRQDLTITGG  1011
             V    S LFPP  D   +  L  +    I +   ++  KRFV     +A LR  L   G 
Sbjct  185   VD--CSSLFPP-QDFLGMSFLYNL----IPRSSLNISTKRFVFEGPKLAALRGKLC-NGP  236

Query  1010  SVQRPSRVEALTALVWAAVINATPTQTAT--LSCMVNLRRRMEPPLPPNCLGTLVDEAIV  837
              + RP+R EA++AL+W  V   + ++      +  V+LR+ M+PPLP +C+G +V  A+ 
Sbjct  237   YLNRPTRFEAVSALIWGVVGEDSESKKVNKLATIAVDLRKIMDPPLPQHCIGNIVHLAV-  295

Query  836   LCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLRAVIARGYELVR--NRD  663
                 A     VV    L  +I ++   +     R+VY +G +  ++  R  E+    N  
Sbjct  296   ----ANWENKVVDCNGLAGKIHESISMINSDYVRQVYADGTFFSSMRQRMAEMAEDPNNF  351

Query  662   SSTLYTSSLCRMAYYEVDFGWGKPRLVVNMLDNS--WVLFLDAING-AVEVWMKLPKQVM  492
              S +  SS C+  +YEVDFGWGKP  V   L  S  WV+ LD  +G  +EV + LP + M
Sbjct  352   RSVIGFSSWCKFRFYEVDFGWGKPIWVGTSLRLSPNWVMLLDTRDGEGMEVRIALPNEEM  411

Query  491   HTLTQDRHFLAYVSAFP  441
                 Q+   LAY S  P
Sbjct  412   VKFEQNPDILAYASFTP  428



>ref|XP_006482086.1| PREDICTED: vinorine synthase-like [Citrus sinensis]
Length=426

 Score =   231 bits (588),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 160/452 (35%), Positives = 241/452 (53%), Gaps = 44/452 (10%)
 Frame = -2

Query  1751  MKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGACHHTKTID  1572
             M +++   EI +PSSPTPQ    YKLS +DQL  N+    +  Y +   S A    KT D
Sbjct  1     MDLQITCTEIIKPSSPTPQHQSTYKLSIIDQLTPNVYFSIILLYSNAGESTA----KTSD  56

Query  1571  ElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEMEKIKQL  1392
              LKKSLS TL+  YPLAG++K D++ ++C+D+GV FI A VA +M  LL+ P ++ ++QL
Sbjct  57    HLKKSLSNTLTHYYPLAGQLKYDQLIVDCNDQGVPFIEAHVANDMRQLLKIPNIDVLEQL  116

Query  1391  IPSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGCA  1212
             +P  K +E     ++ + +QVN F CGG+AIG    H + DA+  A F++ W    RG  
Sbjct  117   LP-FKPHEGFDSDRSNLTLQVNYFGCGGMAIGLCFRHKVIDATTAAFFVKNWGVIARG--  173

Query  1211  ANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQE--EKDMIVKRFVIPANAIAQL  1038
             A      + DH+S+   P  D S +       A+ +++E  + +   KRFV     IA  
Sbjct  174   AGEIKDLIIDHASLF--PARDLSCL-------AKSVDEEFLKPESETKRFVFDGPTIASF  224

Query  1037  RQDLTITGGSVQRPSRVEALTALVWAAVINAT---------PTQTATLSCMVNLRRRMEP  885
             ++  T      +RP+R E ++A++  A+I AT         P +  T+   VNLR+RM P
Sbjct  225   QETFT---SFERRPTRFEVVSAVILGALITATRESDDESNVPERLDTI-ISVNLRQRMNP  280

Query  884   PLPPNCLGTLVDEAIVL--CQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGW  711
             P P +C+G ++   +V    ++  D G       L + I ++ + V D  ARK YG+  +
Sbjct  281   PFPEHCMGNIISGGLVYWPLEKKVDYGC------LAKEIHESIKKVDDQFARKFYGDAEF  334

Query  710   LRAVIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVVN-MLDNSWVLFLDAIN  534
             L      G E V+ R+    + +S C+   YE DFGWGKP+   N M  N   +F D+ +
Sbjct  335   LNLPRLAGAEDVKKRE---FWVTSWCKTPLYEADFGWGKPKWAGNSMRLNQITVFFDSSD  391

Query  533   G-AVEVWMKLPKQVMHTLTQDRHFLAYVSAFP  441
             G  VE W+ LPK+ M    +D   LAY S  P
Sbjct  392   GEGVEAWVGLPKKDMARFEKDSGILAYTSPNP  423



>ref|XP_008222084.1| PREDICTED: BAHD acyltransferase At5g47980-like [Prunus mume]
Length=446

 Score =   228 bits (582),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 157/448 (35%), Positives = 239/448 (53%), Gaps = 29/448 (6%)
 Frame = -2

Query  1751  MKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGACHHTKTID  1572
             MK+E+  KE  +PSSPTP  LK++KLS LDQL L    P V FY +  +S      +   
Sbjct  5     MKIEIVKKETIKPSSPTPHNLKSFKLSLLDQLSLVAYGPLVLFYPN-NVSEVTLTEERSH  63

Query  1571  ElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEMEKIKQL  1392
             +LKKSLS+ L+  YPLAGR+K D + IEC+DEG  ++ A V   +S  L+ P +E +K L
Sbjct  64    QLKKSLSEALTRFYPLAGRIK-DNLFIECNDEGAVYVEARVNALLSNFLDQPSLEILKLL  122

Query  1391  IPSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGCA  1212
             +P  KV  P+     L+ VQ + F CGG+AIG  +SH +ADAS L+ F+++WA+   G  
Sbjct  123   LP-IKVDSPEAATGCLLLVQASFFECGGLAIGVCMSHKLADASTLSTFIKVWAATALGL-  180

Query  1211  ANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQLRQ  1032
                G   V D S+    P  D SA     +  A  +E +    + KRFV     +  L+ 
Sbjct  181   ---GHTVVPDFSAATRYPPRDFSA-----QSPAAAVEMKIVKCVAKRFVFDGPKMRALKA  232

Query  1031  DLTITGGSVQRPSRVEALTALVWAAVINATP-----TQTATLSCMVNLRRRMEPPLPPNC  867
                +T GSVQRP+RVEA+T L+W   + A+      ++ + +S  VN+R+R+ P LP   
Sbjct  233   K--VTSGSVQRPTRVEAVTGLIWNCAMKASKLSSGISKLSMVSQSVNIRKRVVPRLPQTS  290

Query  866   LGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLRAVIARG  687
             +G LV     + +E+   G  + ++ELV R+R       +  ++++ G+  +  A+    
Sbjct  291   IGNLVGYYTAMAEES---GIELNSMELVSRLRKGMVEFNEIHSKRLQGDIVF-EAICEYF  346

Query  686   YE---LVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLV---VNMLDNSWVLFLDAINGAV  525
              E   ++R  D +    +SLC    YE+DFGWGKP  V    +++ N   L        V
Sbjct  347   MEIGNIMRRDDINLFICTSLCNFGIYEIDFGWGKPIWVSIPFDIIKNVACLIDTKEGDGV  406

Query  524   EVWMKLPKQVMHTLTQDRHFLAYVSAFP  441
             + W+ L ++ M    +D   LA+ S  P
Sbjct  407   DAWISLSEEDMALFERDPELLAFASLNP  434



>gb|KDO45520.1| hypothetical protein CISIN_1g039563mg [Citrus sinensis]
Length=472

 Score =   229 bits (584),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 156/478 (33%), Positives = 236/478 (49%), Gaps = 45/478 (9%)
 Frame = -2

Query  1757  ITMKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGACHHTKT  1578
             + M++ + SKEI +PSSPTP  LK +KLS LDQL  ++  P V FYDS +       T T
Sbjct  1     MNMQLRIISKEIIKPSSPTPHHLKTHKLSLLDQLAPDIYLPIVLFYDSSSRVDDKTSTAT  60

Query  1577  IDElkkslsktlsLM-------YPLAGRV-KEDKVTIECDDEGVEFIVADVAENMSCLLE  1422
             I+       +  + +       YP AGRV  +D   I+CDD GV  +   V  NM  +L 
Sbjct  61    INSTNNISRRLKNSLSKTLTHYYPFAGRVLLKDNYVIDCDDSGVPVVETLVGSNMFDVLN  120

Query  1421  NPEMEKIKQLIPSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFME  1242
              PEM+ ++QL+P     +        VAVQ+N F CGG+A+GF   H +AD +A   F++
Sbjct  121   FPEMDTLEQLLPFNPNKKHLSTHDVTVAVQINYFHCGGVAVGFNFRHIVADGAAAIGFIK  180

Query  1241  IWASFNRGCAANNGSGFVSDHSSI-----LFPPLTDTSAIEQLMKMGAEGIEQEEKDMIV  1077
              WA  N     ++ +  VS   ++     +FPP  + S   + +        Q   + + 
Sbjct  181   NWAKLNYSNDDHDINIDVSTKYAVVDCTNIFPPNKEISGYSRSINEW-----QRSTECVT  235

Query  1076  KRFVIPANAIAQLRQDLTITGGSVQ---RPSRVEALTALVWAAVINATPTQ----TATLS  918
             KRF    + IA LR+++ +   S+    RPSR EA+  L+W A++     +    T+T++
Sbjct  236   KRFRFNGSKIAALRREMIMEKASLNLQYRPSRFEAVCGLIWGALLAMDREKHIDSTSTIA  295

Query  917   CM-VNLRRRMEPPLPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGE  741
              + VNLR RM PPLP  C+G L   A+   +  + G        L + +R+  + V D  
Sbjct  296   TIPVNLRNRMNPPLPEGCIGNLF-HAVTCTENNEAGDGHYNKSTLARNVREFTKMVSDDF  354

Query  740   ARKVYGEGGWLRAVIARGY-----ELVRNRDSSTLYTSSL--------CRMAYYEVDFGW  600
              RKVY +GG    V    Y     EL+++  ++   T+S+          + YY +DFGW
Sbjct  355   VRKVYQDGG---VVFVNQYKEAVEELLKDGTNNNNTTNSVRMFGFSGPIGLQYYGIDFGW  411

Query  599   GKPRLVVNMLD-NSWVLFLDAING-AVEVWMKLPKQVMHTLTQDRHFLAYVSAFPKPK  432
             GKP  V  ++  N+  + LD  +G  VE W+ LP   M    QD   LAY S    P+
Sbjct  412   GKPLWVTTVMRLNNVAMLLDTCDGKGVEAWVGLPINDMSKFEQDLGILAYASFTSSPR  469



>gb|KDO53588.1| hypothetical protein CISIN_1g048249mg [Citrus sinensis]
Length=426

 Score =   228 bits (580),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 158/452 (35%), Positives = 240/452 (53%), Gaps = 44/452 (10%)
 Frame = -2

Query  1751  MKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGACHHTKTID  1572
             M +++   EI +PSSPTPQ    YKLS +DQL  N+    +  Y +   S A    KT D
Sbjct  1     MDLQITCTEIIKPSSPTPQHQSTYKLSIIDQLTPNVYFSIILLYSNAGESTA----KTSD  56

Query  1571  ElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEMEKIKQL  1392
              LKKSLS TL+  YPLAG++K D++ ++C+D+GV FI A VA +M  LL+ P ++ ++QL
Sbjct  57    HLKKSLSNTLTHYYPLAGQLKYDQLIVDCNDQGVPFIEAHVANDMRQLLKIPNIDVLEQL  116

Query  1391  IPSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGCA  1212
             +P  K +E     ++ + +QVN F CGG+AIG    H + DA+  A F++ W    RG  
Sbjct  117   LP-FKPHEGFDSDRSNLTLQVNYFGCGGMAIGLCFRHKVIDATTAAFFVKNWGVIARG--  173

Query  1211  ANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQE--EKDMIVKRFVIPANAIAQL  1038
             A      + DH+S+   P  D S +       A+ +++E  + +   KRFV     IA  
Sbjct  174   AGEIKDLIIDHASLF--PARDLSCL-------AKSVDEEFLKPESETKRFVFDGPTIASF  224

Query  1037  RQDLTITGGSVQRPSRVEALTALVWAAVINAT---------PTQTATLSCMVNLRRRMEP  885
             ++  T      +RP+R E ++A++  A+I AT         P +  T+   VNLR+RM P
Sbjct  225   QETFT---SFERRPTRFEVVSAVILGALITATRESDDESNVPERLDTI-ISVNLRQRMNP  280

Query  884   PLPPNCLGTLVDEAIVL--CQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGW  711
             P P +C+G ++   +V    ++  D G       L + I ++ + V D  ARK YG+  +
Sbjct  281   PFPEHCMGNIISGGLVYWPLEKKVDYGC------LAKEIHESIKKVDDQFARKFYGDAEF  334

Query  710   LRAVIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVVN-MLDNSWVLFLDAIN  534
             L      G E V+ R+    + +S C+   YE DFGWG P+   N M  N   +F D+ +
Sbjct  335   LNLPRLAGAEDVKKRE---FWVTSWCKTPLYEADFGWGNPKWAGNSMRLNQITVFFDSSD  391

Query  533   G-AVEVWMKLPKQVMHTLTQDRHFLAYVSAFP  441
             G  VE W+ LP++ M    +D   LAY S  P
Sbjct  392   GEGVEAWVGLPRKDMARFEKDSGILAYTSPNP  423



>gb|KDP40899.1| hypothetical protein JCGZ_24898 [Jatropha curcas]
Length=432

 Score =   228 bits (580),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 161/446 (36%), Positives = 244/446 (55%), Gaps = 35/446 (8%)
 Frame = -2

Query  1751  MKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGACHHTKTID  1572
             M+V++ SKE  +PS PTP  LK +KLS +DQL +    P + FY SP+ +       T  
Sbjct  1     MEVQIISKEKIKPSCPTPDHLKTHKLSIIDQLAIQCYVPVIIFY-SPSHNQDSSQIST--  57

Query  1571  ElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEMEKIKQL  1392
             +LKKSLS+TL+  YPLAG+       I+C+D+G  F+ A++  +MS +L   ++E ++ L
Sbjct  58    QLKKSLSETLTHFYPLAGKAINGSF-IDCNDDGASFVEANIVGDMSMVLNQSKIELLRLL  116

Query  1391  IPSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGCA  1212
             +PS K+ E     K +V+VQVN F+ GGI I   + H IADAS +A F+E+W +  R CA
Sbjct  117   LPS-KLNE-NFAEKEIVSVQVNYFTSGGIVISVCIKHLIADASTVASFVEVWGNIAR-CA  173

Query  1211  ANNGS-GFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDM----IVKRFVIPANAI  1047
              N+ S G + D +  LFPP+ +            EG+   E  +    + KRF+     I
Sbjct  174   TNSVSNGIIFDRTG-LFPPVNNK----------IEGLSWVEGSLLPETVTKRFLFDGLKI  222

Query  1046  AQLRQDLTITGGSVQRPSRVEALTALVWAAVINATPTQTATLSC-----MVNLRRRMEPP  882
             A LR+ ++  G SV +P+R EA++AL+W A I+A       +       +VNLR+++ P 
Sbjct  223   AALREMIS-NGVSVDQPTRFEAVSALIWGASISAARESEENVDSHVAVTVVNLRKKLNPN  281

Query  881   LPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLRA  702
             LP  C+G +   AI   + A +  T     ELV++IR +   + DG  RK + EG W   
Sbjct  282   LPQQCIGNICQVAI--AKSAIEKST--DYRELVRKIRKSIGVLDDGYVRKFHAEGKWFDF  337

Query  701   VIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVVNMLDN-SWVLFLDAING-A  528
             V     E   N     L  SS CR  +Y VDFGWGKP  V  +++  + V+FLD I+G  
Sbjct  338   VKKLVEEPGNNYKVKQLNFSSWCRFPFYGVDFGWGKPIWVSTVMEQENGVIFLDTIDGQG  397

Query  527   VEVWMKLPKQVMHTLTQDRHFLAYVS  450
             +E W+ L ++ M    ++   L + +
Sbjct  398   IEAWISLSRENMDKFEKNPEILEFAT  423



>ref|XP_007044964.1| HXXXD-type acyl-transferase family protein, putative [Theobroma 
cacao]
 gb|EOY00796.1| HXXXD-type acyl-transferase family protein, putative [Theobroma 
cacao]
Length=430

 Score =   226 bits (576),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 153/448 (34%), Positives = 232/448 (52%), Gaps = 37/448 (8%)
 Frame = -2

Query  1757  ITMKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGACHHTKT  1578
             + ++VEV SKEI +PSSPTP  L++Y+LSFLDQ+   +  P V FY     +   + TK 
Sbjct  1     MKLEVEVMSKEIIKPSSPTPDQLRHYQLSFLDQISPPVYNPLVLFYPMTECNILVNKTKI  60

Query  1577  IDElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEMEKIK  1398
              D LK+S+S  LS  YPLAGR+K++++ ++C+DEG+ F+ A V   +S +LENP   ++ 
Sbjct  61    TDHLKQSMSNALSYFYPLAGRIKDNRL-VDCNDEGIPFLEAQVKCKLSDILENPAPSELN  119

Query  1397  QLIPSA-KVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNR  1221
             +L+P      E  P+G     +Q N F  GGI IG  +SH +ADA +   F+  WA+  R
Sbjct  120   KLLPFVLDDAEELPLG-----IQFNIFDSGGICIGVCISHKLADALSFFTFVNTWAAIAR  174

Query  1220  GCAANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQ  1041
             G +      F    S+ LFPP   T   E    +  E I       + KRFV  A+ I +
Sbjct  175   GESYIVSPEFA---SAKLFPP-KSTLGFEPRTGISTERI-------VTKRFVFTASKIQE  223

Query  1040  LRQDLTITGGSVQR---PSRVEALTALVWAAVINATPTQTATLSCM------VNLRRRME  888
             ++   T +  S +    PSR+EAL+  +W+  + AT  +    +C       VNLR R++
Sbjct  224   IKAKYTKSTASAENQKGPSRIEALSTFIWSRFVAATKAKPIPDNCFYTIIHAVNLRPRLD  283

Query  887   PPLPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWL  708
             PPL  +  G     A+ +    +D         LV +IRD+ R +     R++     + 
Sbjct  284   PPLAEHSFGNFYRIAMTVPSSEED------CCSLVYQIRDSIRKLDMKYVRQLQDGQSYF  337

Query  707   RAVIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLV--VNMLDNSWVLFLDAIN  534
               +  R    +R    S  +T SLCR   Y+ DFGWGKP  V   N+   + V+F+D ++
Sbjct  338   DFMKERAESFIRGEIVSFSFT-SLCRFPIYKADFGWGKPIWVGSANLTFKNLVVFMDTVS  396

Query  533   G-AVEVWMKLPKQVMHTLTQDRHFLAYV  453
             G  +E W+ L ++ M     D   LAYV
Sbjct  397   GDGIEAWVSLKEEDMAMFGSDEVLLAYV  424



>ref|XP_006430560.1| hypothetical protein CICLE_v10011796mg [Citrus clementina]
 gb|ESR43800.1| hypothetical protein CICLE_v10011796mg [Citrus clementina]
Length=426

 Score =   225 bits (574),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 158/450 (35%), Positives = 237/450 (53%), Gaps = 40/450 (9%)
 Frame = -2

Query  1751  MKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGACHHTKTID  1572
             M +++   EI +PSSPTPQ    YKLS +DQL  N+    +  Y     S A    KT D
Sbjct  1     MDLQITCTEIIKPSSPTPQHQSTYKLSIIDQLTPNVYFSIILLYSKAGESTA----KTSD  56

Query  1571  ElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEMEKIKQL  1392
              LKKSLS TL+  YPLAG++K D++ ++C+D+GV FI A V  +   LL+ P ++ ++QL
Sbjct  57    HLKKSLSNTLTHYYPLAGQLKYDQLIVDCNDQGVPFIEAHVTNDRRQLLKIPNIDVLEQL  116

Query  1391  IPSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGCA  1212
             +P  K +E     ++ + +QVN F CGG+AIG    H + DA+  A F++ W    RG  
Sbjct  117   LP-FKPHEGFDSDRSNLTIQVNYFGCGGMAIGLCFRHKVIDATTAAFFVKNWGVIARG--  173

Query  1211  ANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQLRQ  1032
             A      + DH+S+   P  D S + +   +  E ++ E +    KRFV     IA L++
Sbjct  174   AGEIKDVIIDHASLF--PARDLSCLTK--SVDEEFLKPESE---TKRFVFDGATIASLQE  226

Query  1031  DLTITGGSVQRPSRVEALTALVWAAVINAT---------PTQTATLSCMVNLRRRMEPPL  879
                      +RP+R E ++A++  A+I AT         P +  T+   VNLR+RM PP 
Sbjct  227   TF---ASFERRPTRFEVVSAVILGALITATRESDDESNVPERLDTI-ISVNLRQRMNPPF  282

Query  878   PPNCLGTLVDEAIVL--CQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLR  705
             P +C+G ++   +V    ++  D G       L + I ++ + V D  ARK YG+  +L 
Sbjct  283   PEHCMGNIISGGLVYWPLEKKVDYGC------LAKEIHESIKKVDDQFARKFYGDAEFLN  336

Query  704   AVIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVVN-MLDNSWVLFLDAING-  531
                  G E V+ R+    + +S C+   YE DFGWGKP+   N M  N   +F D+ +G 
Sbjct  337   LPRLAGAEDVKKRE---FWVTSWCKTPLYEADFGWGKPKWAGNSMRLNQITVFFDSSDGE  393

Query  530   AVEVWMKLPKQVMHTLTQDRHFLAYVSAFP  441
              VE W+ LPK+ M    +D   LAY S  P
Sbjct  394   GVEAWVGLPKKDMARFEKDSGILAYTSPNP  423



>ref|XP_006443121.1| hypothetical protein CICLE_v10023671mg [Citrus clementina]
 gb|ESR56361.1| hypothetical protein CICLE_v10023671mg [Citrus clementina]
Length=470

 Score =   226 bits (577),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 167/476 (35%), Positives = 244/476 (51%), Gaps = 45/476 (9%)
 Frame = -2

Query  1751  MKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPT-----ISGAC-H  1590
             M++ + SKEI +PSSPTP  LK +KLS LDQL  ++  P V FYDS +     IS A  +
Sbjct  1     MQLRIISKEIIKPSSPTPHHLKTHKLSLLDQLAPDIYLPIVLFYDSSSRVDDKISTATIN  60

Query  1589  HTKTID-ElkkslsktlsLMYPLAGRV-KEDKVTIECDDEGVEFIVADVAENMSCLLENP  1416
              TK I   LKKSLSKTL+  YP AGRV  +D   I+CDD GV  +   V  NM  +L  P
Sbjct  61    STKNISRRLKKSLSKTLTHYYPFAGRVLLKDNYVIDCDDSGVPVVETLVGSNMFDVLSFP  120

Query  1415  EMEKIKQLIPSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIW  1236
             EM+ ++QL+P     +        VAVQ+N F CGG+A+GF   H +AD +A   F++ W
Sbjct  121   EMDTLEQLLPFNPNKKHLSTHDVTVAVQINYFHCGGVAVGFNFRHIVADGAAAIGFIKNW  180

Query  1235  ASFNRGCAANNGSGFVSDHSSI-----LFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKR  1071
                N     ++ +  VS   ++     +FPP  + S   + +        Q   + + KR
Sbjct  181   GKLNYSNDDHDINIDVSTKYAVVDCTNIFPPNKEISGYSRSINEW-----QRSTECVTKR  235

Query  1070  FVIPANAIAQLRQDLTITGGSVQ---RPSRVEALTALVWAAVINATPTQ----TATLSCM  912
             F    + IA LR+++ +   S+    RPSR EA+  L+W A++     +    T+T++ +
Sbjct  236   FRFNGSKIAALRREMIMEKASLNLQYRPSRFEAVCGLIWGALLAMDREKHIDSTSTIATI  295

Query  911   -VNLRRRMEPPLPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEAR  735
              VNLR RM PPLP  C+G L   A+   +  + G        L + +R+  + V D   R
Sbjct  296   PVNLRNRMNPPLPEGCIGNLF-HAVTCTENNEAGDGHYNKSTLARNVREFTKMVSDDFVR  354

Query  734   KVYGEGGWLRAVIARGY-----ELVRNRDSSTLYTSSL--------CRMAYYEVDFGWGK  594
             KVY +GG    V    Y     EL+++  ++   T+S+          + YY +DFGWGK
Sbjct  355   KVYQDGG---VVFVNQYKEAVEELLKDGTNNNNTTNSVRMFGFSGPIGLQYYGIDFGWGK  411

Query  593   PRLVVNMLD-NSWVLFLDAING-AVEVWMKLPKQVMHTLTQDRHFLAYVSAFPKPK  432
             P  V  ++  N+  + LD  +G  VE W+ LP   M    QD   LAY S    P+
Sbjct  412   PLWVTTVMRLNNVAMLLDTCDGKGVEAWVGLPINDMSKFEQDLGILAYASFTSSPR  467



>ref|XP_008222021.1| PREDICTED: BAHD acyltransferase At5g47980-like [Prunus mume]
Length=446

 Score =   226 bits (575),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 155/448 (35%), Positives = 236/448 (53%), Gaps = 29/448 (6%)
 Frame = -2

Query  1751  MKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGACHHTKTID  1572
             MK+E+  KE  +PSSPTP  LK++KLS LDQL      P V FY +  +S      +   
Sbjct  5     MKIEIVKKETIKPSSPTPHNLKSFKLSLLDQLSPVAYGPLVLFYPN-NVSEVTLTEERSH  63

Query  1571  ElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEMEKIKQL  1392
             +LKKSLS+ L+  YPLAGR+K D + IEC+DEG  ++ A V   +S  L+ P +E +K L
Sbjct  64    QLKKSLSEALTRFYPLAGRIK-DNLFIECNDEGAVYVEARVNALLSNFLDQPSLEILKLL  122

Query  1391  IPSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGCA  1212
             +P  KV  P+     L+ VQ + F CGG+AIG  +SH +ADAS L+ F+++WA+   G  
Sbjct  123   LP-IKVDSPEAATGCLLLVQASFFKCGGLAIGVCMSHKLADASTLSTFIKVWAATALGL-  180

Query  1211  ANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQLRQ  1032
                G   V D S+    P  D SA     +  A  +E +    + KRFV     +  L+ 
Sbjct  181   ---GHTVVPDFSAATRYPPRDFSA-----QSPAAAVEMKIVKCVTKRFVFDGPKMRALKA  232

Query  1031  DLTITGGSVQRPSRVEALTALVWAAVINATP-----TQTATLSCMVNLRRRMEPPLPPNC  867
                +T GSVQRP+RVEA+T L+W     A+      ++ + +S  VN+R+R+ P LP   
Sbjct  233   K--VTSGSVQRPTRVEAVTGLIWKCATKASKLSSGISKLSMVSQSVNIRKRVVPQLPQTS  290

Query  866   LGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLRAVIARG  687
             +G L      + +E+   G  + ++ELV R+R       +  ++++ G+  +  A+    
Sbjct  291   IGNLAGYYTAMAEES---GIELNSMELVSRLRKGMVEFNENHSKRLQGDNVF-EAICEYF  346

Query  686   YE---LVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVV---NMLDNSWVLFLDAINGAV  525
              E   ++R  D +    +SLC    YE+DFGWGKP  V     ++ N  +L        V
Sbjct  347   KEIGNIMRRDDINLFICTSLCNFGIYEIDFGWGKPIWVSIPGGVVKNVAILIDTKEGDGV  406

Query  524   EVWMKLPKQVMHTLTQDRHFLAYVSAFP  441
             + W+ L ++ M    +D   LA+ S  P
Sbjct  407   DAWISLSEEDMALFERDPELLAFASLNP  434



>ref|XP_007044963.1| HXXXD-type acyl-transferase family protein, putative [Theobroma 
cacao]
 gb|EOY00795.1| HXXXD-type acyl-transferase family protein, putative [Theobroma 
cacao]
Length=429

 Score =   222 bits (566),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 151/455 (33%), Positives = 226/455 (50%), Gaps = 46/455 (10%)
 Frame = -2

Query  1751  MKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFY--DSPTISGACHHTKT  1578
             MKVEV ++ I +PSSPTP  L+N   SFLDQ+   +  P VFFY  D     G  + T+ 
Sbjct  1     MKVEVVARGIIKPSSPTPGHLRNLHFSFLDQIATPVFMPMVFFYPIDGDVNVGNFNRTEW  60

Query  1577  IDElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEMEKIK  1398
             + +            YPLAGRVK D   I+C+DEGV F+ + V   +S ++  PE  ++ 
Sbjct  61    LKKSLSETLTR---FYPLAGRVK-DNAFIDCNDEGVPFVQSRVKCQLSDVVRQPEPAQLN  116

Query  1397  QLIPSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRG  1218
             +L+P    YE   VG  ++A+Q N F CGG+AIG  +SH IADA +L  F+  WA+  RG
Sbjct  117   KLLP----YELDNVGDLILAIQANIFDCGGMAIGVCISHKIADALSLIMFLNNWAATARG  172

Query  1217  CAANNGSGFVSDHSSILFPPLTDTSAIEQLMKMG----AEGIEQEEKDMIVKRFVIPANA  1050
                           S   PP  D + +     +     + GI +++  ++ +RFV  A+ 
Sbjct  173   -------------DSYTVPPRFDLATLFPARSISGFKPSTGIFKDK--IVTRRFVFSASM  217

Query  1049  IAQLRQDLTITGGS----VQRPSRVEALTALVWAAVINAT-----PTQTATLSCMVNLRR  897
             IA LR      G S     +RP+R+EAL+  +W+  +  T     P +  T+   VNLR 
Sbjct  218   IAALRAKYADDGASNGEFQRRPTRIEALSTFIWSRFMATTHGKPDPEKLYTVLHAVNLRT  277

Query  896   RMEPPLPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEG  717
             RM+PPLP    G +   AI +     +         +V  +RDA R +     RK+    
Sbjct  278   RMDPPLPEYYFGNISRFAIAIPSINSEE----ECFGIVSEVRDAIRKIDGDYVRKLQEGS  333

Query  716   GWLRAVIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLV--VNMLDNSWVLFLD  543
             G L  +  R  E +   D  +   +SLCR   YE DFGWG+P  V   ++   + V+F+D
Sbjct  334   GHLNFMKERA-ERITKGDVVSFSFTSLCRFPLYETDFGWGRPIWVGSASLTFKNLVVFMD  392

Query  542   -AINGAVEVWMKLPKQVMHTLTQDRHFLAYVSAFP  441
                +G +E W+ + ++ M     D   LA+V + P
Sbjct  393   TGSSGGIEAWINMKEEDMARFEGDEELLAFVCSAP  427



>ref|XP_009359305.1| PREDICTED: vinorine synthase [Pyrus x bretschneideri]
Length=435

 Score =   220 bits (561),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 154/451 (34%), Positives = 241/451 (53%), Gaps = 30/451 (7%)
 Frame = -2

Query  1757  ITMKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGACHHTKT  1578
             + MK+E+ S++  +PSSPTP  LK+YKLS LDQ+      P V FY  P        T  
Sbjct  1     MQMKIEIVSEDQCKPSSPTPNHLKSYKLSLLDQIAPIFYVPVVLFYSDPE---NIDDTTI  57

Query  1577  IDElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEMEKIK  1398
             +D LKKSLS+TL+  YPLAGR+ E   +++C+D GV F  A     +S +L+ PEM+ ++
Sbjct  58    VDRLKKSLSETLTCFYPLAGRI-EGNASVDCEDGGVVFTKARAHIQLSEILKTPEMDLVQ  116

Query  1397  QLIPSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRG  1218
             QL+P            A +AVQ+N F CGG+ IG  +SH IAD + L+ F++ WA+ +RG
Sbjct  117   QLLPLDPYNIRTDKAVAAMAVQLNCFDCGGMGIGICLSHKIADGATLSSFLDAWATRSRG  176

Query  1217  CAANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQL  1038
              + N        +S+ +FPP       ++ + M +  I++E  +++ KRFV  A+++A+L
Sbjct  177   ISENITPSL---NSATMFPPR------DKEIFMPSNLIKRE--NIVTKRFVFDASSLAKL  225

Query  1037  RQDLTITGGSVQR-PSRVEALTALVWAAVINATPTQ------TATLSCMVNLRRRMEPPL  879
             +   +    +  R P+RVEALTAL+  + +NA          +  +S +VNLR RM PPL
Sbjct  226   KVKASKGLCTDDRAPTRVEALTALICKSSMNAKNGTLGKGRPSMAISHVVNLRERMAPPL  285

Query  878   PPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLRAV  699
             P +  G +   A+      +    +    +LV R+R   R + D   RK+ GE G+  A 
Sbjct  286   PEHSFGNIWRFAVASIMNDESNPEL---HDLVVRLRKVIRKIDDDYVRKLQGEDGFTHAC  342

Query  698   --IARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPR--LVVNMLDNSWVLFLDAING  531
               +    E+V   +      SS  R + Y  DFGWGKP    + ++   + V+ L + +G
Sbjct  343   EPLKETSEMVSEGEVEFFRVSSWIRFSLYNTDFGWGKPTWACIPSVPIKNVVILLSSSSG  402

Query  530   -AVEVWMKLPKQVMHTLTQDRHFLAYVSAFP  441
               +E W+ L ++ M    +D   L +VS  P
Sbjct  403   DGIEAWVTLDEEDMAKFERDHELLEFVSVAP  433



>ref|XP_008353036.1| PREDICTED: vinorine synthase-like [Malus domestica]
Length=429

 Score =   219 bits (558),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 150/440 (34%), Positives = 237/440 (54%), Gaps = 30/440 (7%)
 Frame = -2

Query  1751  MKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGACHHTKTID  1572
             MK+EV  +   +PS PTP  L  ++ SFLDQ+  ++  P +FFY++  ++ A  ++   D
Sbjct  1     MKIEVIERAYIKPSMPTPPHLCKHEFSFLDQIATHIFMPMIFFYNNNHVNDARTYS---D  57

Query  1571  ElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEMEKIKQL  1392
             ++K+SLS+ L+  YPLAGR+ E+   I+C+D+G  ++ A V   +S ++   +  ++ +L
Sbjct  58    KVKQSLSEILTQYYPLAGRIIENAF-IDCNDQGAPYVQARVRSPLSDVISEADPNQLNKL  116

Query  1391  IPSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRG-C  1215
             +P     E   VG  ++A+QV+ F CGG+AIG  +SH +ADA +   F+  WAS +RG C
Sbjct  117   LPC----ELDKVGDLVLAIQVSMFDCGGMAIGICISHKVADALSFITFLNSWASISRGDC  172

Query  1214  AANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQLR  1035
                N S  + D ++ LFPP + +          + GI +E+  ++ KRFV  A+ IA LR
Sbjct  173   NITNISPPIFDLAT-LFPPRSISGF------KPSTGIAREK--IVTKRFVFSASTIASLR  223

Query  1034  QDLTITGGSVQRPSRVEALTALVWAAVINAT-----PTQTATLSCMVNLRRRMEPPLPPN  870
                T    +  +PSR+EAL+A +WA  I +T     P     +   VNLR RM+PPLP  
Sbjct  224   SKYTDNKANEIKPSRIEALSAFIWARFIASTQGKPNPNTLYRVLHTVNLRTRMDPPLPEY  283

Query  869   CLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLRAVIAR  690
               G +     V+   + D G   T   +V ++R A + + DG+      EG  L   + +
Sbjct  284   HFGNV--SRFVMSSPSFDEGE-DTCYGIVSQMRQAIKTI-DGDYIAKIKEGNELLEFLKQ  339

Query  689   GYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLV--VNMLDNSWVLFLDA-INGAVEV  519
               E     + ++   +SLCR   YE DFGWGKP  V  V+    + V F+DA  +G +E 
Sbjct  340   RMEEFMKGEVASFSFTSLCRFPLYETDFGWGKPVWVGSVSFPFKNLVSFIDAGSSGGIEA  399

Query  518   WMKLPKQVMHTLTQDRHFLA  459
             W+ L ++ M     D   LA
Sbjct  400   WVNLKEEDMAKFQHDEQLLA  419



>ref|XP_008368264.1| PREDICTED: vinorine synthase-like [Malus domestica]
Length=429

 Score =   219 bits (558),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 150/440 (34%), Positives = 237/440 (54%), Gaps = 30/440 (7%)
 Frame = -2

Query  1751  MKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGACHHTKTID  1572
             MK+EV  +   +PS PTP  L  ++ SFLDQ+  ++  P +FFY++  ++ A  ++   D
Sbjct  1     MKIEVIERAYIKPSMPTPPHLCKHEFSFLDQIATHIFMPMIFFYNNNHVNDARTYS---D  57

Query  1571  ElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEMEKIKQL  1392
             ++K+SLS+ L+  YPLAGR+ E+   I+C+D+G  ++ A V   +S ++   +  ++ +L
Sbjct  58    KVKQSLSEILTQYYPLAGRIIENAF-IDCNDQGAPYVQARVRSPLSDVISEABPNQLNKL  116

Query  1391  IPSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRG-C  1215
             +P     E   VG  ++A+QV+ F CGG+AIG  +SH +ADA +   F+  WAS +RG C
Sbjct  117   LPC----ELDKVGDLVLAIQVSMFDCGGMAIGICISHKVADALSFITFLNSWASISRGDC  172

Query  1214  AANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQLR  1035
                N S  + D ++ LFPP + +          + GI +E+  ++ KRFV  A+ IA LR
Sbjct  173   NITNISPPIFDLAT-LFPPRSISGF------KPSTGIAREK--IVTKRFVFSASTIASLR  223

Query  1034  QDLTITGGSVQRPSRVEALTALVWAAVINAT-----PTQTATLSCMVNLRRRMEPPLPPN  870
                T    +  +PSR+EAL+A +WA  I +T     P     +   VNLR RM+PPLP  
Sbjct  224   SKYTDNKANEIKPSRIEALSAFIWARFIASTQGKPNPNTLYRVLHTVNLRTRMDPPLPEY  283

Query  869   CLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLRAVIAR  690
               G +     V+   + D G   T   +V ++R A + + DG+      EG  L   + +
Sbjct  284   HFGNV--SRFVMSSPSFDEGE-DTCYGIVSQMRQAIKTI-DGDYIAKIKEGNELLEFLKQ  339

Query  689   GYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLV--VNMLDNSWVLFLDA-INGAVEV  519
               E     + ++   +SLCR   YE DFGWGKP  V  V+    + V F+DA  +G +E 
Sbjct  340   RMEEFMKGEVASFSFTSLCRFPLYETDFGWGKPVWVGSVSFPFKNLVSFIDAGSSGGIEA  399

Query  518   WMKLPKQVMHTLTQDRHFLA  459
             W+ L ++ M     D   LA
Sbjct  400   WVNLKEEDMAKFQHDEQLLA  419



>ref|XP_006438136.1| hypothetical protein CICLE_v10033777mg [Citrus clementina]
 gb|ESR51376.1| hypothetical protein CICLE_v10033777mg [Citrus clementina]
Length=430

 Score =   219 bits (558),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 149/449 (33%), Positives = 229/449 (51%), Gaps = 33/449 (7%)
 Frame = -2

Query  1757  ITMKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGACHHTKT  1578
             + ++VEV S E  +PSSPTPQ L +Y+LSFLDQ+   +  P V FY +       ++T+T
Sbjct  2     MKLEVEVISTETIKPSSPTPQHLGHYQLSFLDQISPPVYNPLVLFYTADDEINNNNNTET  61

Query  1577  IDElkkslsktlsL-MYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEMEKI  1401
             +    K     +    YPLAGR+ +D   IEC+DEG+ F  A V   +  LL+NP   ++
Sbjct  62    LGNFIKQSLSEVFTCFYPLAGRIHKDNNFIECNDEGIPFKKARVKCQLLHLLQNPNPNEL  121

Query  1400  KQLIPSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNR  1221
              +L+P    ++     +  + +Q N F CGGI +G  +SH + DA +   F++ WA+  R
Sbjct  122   NKLLP----FDLAEAKELPIGIQFNIFDCGGIGLGICISHKVGDAQSFFTFVKSWAATAR  177

Query  1220  GCAANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQ  1041
             G        FV   S+ LFPP  +    E      + GI +E  +++ KRFV  A  I +
Sbjct  178   GEKHTVRVEFV---SATLFPP-KNILGFEP-----STGITKE--NVVTKRFVFAAPKIEE  226

Query  1040  LRQDLTITGGSVQRPSRVEALTALVWAAVINAT-PTQTA------TLSCMVNLRRRMEPP  882
             +R + T +      PSRVEAL+A +W+  + AT P+         T++  VNLR +MEPP
Sbjct  227   IRSNYTHSESCT--PSRVEALSAFIWSRFVAATKPSHKTSDHRFYTITHAVNLRTKMEPP  284

Query  881   LPPNCLGTLVDEAIVL-CQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLR  705
             LP    G L   A+ + C + +D       +  + ++RD+ R V     +K+      L 
Sbjct  285   LPDYSFGNLYRTAVTIPCLDNEDEERYNHII--ISQMRDSLRKVDKDYVKKLQQGDEHLG  342

Query  704   AVIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLV--VNMLDNSWVLFLDAING  531
              +  R  +  R    S  +T SLCR   YE DFGWGKP      ++   + V F+D ++G
Sbjct  343   FIRDRAEKFARGEIVSFSFT-SLCRFPLYEADFGWGKPVWTASASLSFKNLVTFMDTVSG  401

Query  530   --AVEVWMKLPKQVMHTLTQDRHFLAYVS  450
                VE W+ L ++ M  L  D   L++ S
Sbjct  402   DHGVEAWINLKEEDMAKLEADEKLLSFAS  430



>ref|XP_009342764.1| PREDICTED: vinorine synthase-like [Pyrus x bretschneideri]
Length=433

 Score =   219 bits (558),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 152/446 (34%), Positives = 236/446 (53%), Gaps = 38/446 (9%)
 Frame = -2

Query  1751  MKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGACHHTKTID  1572
             MK+EV  K   +PS PTP  L+ ++ SFLDQ+   +  P + FY++   + A  ++   D
Sbjct  1     MKIEVIEKACIKPSMPTPPHLRKHEFSFLDQIATPIFMPMIIFYNNDHGNDAITYS---D  57

Query  1571  ElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEMEKIKQL  1392
              +K+SLSKTL+  YPLAGRV E+   ++C+D+G  ++ A V   +S ++  PE  ++ QL
Sbjct  58    RVKQSLSKTLTQYYPLAGRVIEN-AYVDCNDQGAPYVQARVRSPLSDVISQPEPNQLNQL  116

Query  1391  IPSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRG-C  1215
             +P     E   VG  ++AVQVN F CGG+AIG  +SH +ADA +L  F+  WAS +RG C
Sbjct  117   LPC----ELDNVGDLVLAVQVNVFDCGGMAIGVCISHKVADALSLIMFLNSWASISRGDC  172

Query  1214  AANNGSGFVSDHSSILFPPLTDTSAIEQLMKMG----AEGIEQEEKDMIVKRFVIPANAI  1047
                N         S + PP+ D +       +     + GI +E+  ++ KRFV  A+ +
Sbjct  173   NIKN---------STVNPPIFDLATHFPPRSISGFKPSTGITREK--IVTKRFVFSASTV  221

Query  1046  AQLRQDLTITGGSVQRPSRVEALTALVWAAVINAT-----PTQTATLSCMVNLRRRMEPP  882
             A LR   T    + ++P+R+EAL+A +WA VI +T     P     +   VNLR RM PP
Sbjct  222   ASLRSKYTDNKNNERKPTRIEALSAFIWARVIASTQGKPNPNTLYKVLHAVNLRTRMHPP  281

Query  881   LPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLRA  702
             LP    G +      +   + D G  +    +V ++R+A + +      K+      L+ 
Sbjct  282   LPEYHFGNV--SRFAMSSPSFDEGEDM-CCGMVGQMREAIKTIDGDYIAKIKDGNAHLKF  338

Query  701   VIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLV--VNMLDNSWVLFLDA---I  537
             +  R  E ++   +S  +T SLCR   YE DFGW KP  V   ++   + V+F+DA    
Sbjct  339   LKQRAEEFMKGEVASFSFT-SLCRFPLYETDFGWSKPVWVASASLTFKNLVVFMDAGPGS  397

Query  536   NGAVEVWMKLPKQVMHTLTQDRHFLA  459
             +G +EVW+ L ++ M     D   LA
Sbjct  398   SGGIEVWVNLKEEDMAKFQDDEQLLA  423



>ref|XP_006484023.1| PREDICTED: vinorine synthase-like [Citrus sinensis]
Length=480

 Score =   219 bits (559),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 149/450 (33%), Positives = 230/450 (51%), Gaps = 33/450 (7%)
 Frame = -2

Query  1760  QITMKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGACHHTK  1581
             ++ ++VEV S E  +PSSPTPQ L +Y+LSFLDQ+   +  P V FY +       ++T+
Sbjct  51    KLQLEVEVISTETIKPSSPTPQHLGHYQLSFLDQISPPVYNPLVLFYTADDEINNNNNTE  110

Query  1580  TIDElkkslsktlsL-MYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEMEK  1404
             T+    K     +    YPLAGR+ +D   IEC+DEG+ F  A V   +  LL+NP   +
Sbjct  111   TLGNFIKQSLSEVFTCFYPLAGRIHKDNNFIECNDEGIPFKKARVKCQLLHLLQNPNPNE  170

Query  1403  IKQLIPSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFN  1224
             + +L+P    ++     +  + +Q N F CGGI +G  +SH + DA +   F++ WA+  
Sbjct  171   LNKLLP----FDLAEAKELPIGIQFNIFDCGGIGLGICISHKVGDAQSFFTFVKSWAATA  226

Query  1223  RGCAANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIA  1044
             RG        FV   S+ LFPP  +    E      + GI +E  +++ KRFV  A  I 
Sbjct  227   RGEKHTVRVEFV---SATLFPP-KNILGFEP-----STGITKE--NVVTKRFVFAAPKIE  275

Query  1043  QLRQDLTITGGSVQRPSRVEALTALVWAAVINAT-PTQTA------TLSCMVNLRRRMEP  885
             ++R + T +      PSRVEAL+A +W+  + AT P+         T++  VNLR +MEP
Sbjct  276   EIRSNYTHSESCT--PSRVEALSAFIWSRFVAATKPSHKTSDHRFYTITHAVNLRTKMEP  333

Query  884   PLPPNCLGTLVDEAIVL-CQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWL  708
             PLP    G L   A+ + C + +D       +  + ++RD+ R V     +K+      L
Sbjct  334   PLPDYSFGNLYRTAVTIPCLDNEDEERYNHII--ISQMRDSLRKVDKDYVKKLQQGDEHL  391

Query  707   RAVIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLV--VNMLDNSWVLFLDAIN  534
               +  R  +  R    S  +T SLCR   YE DFGWGKP      ++   + V F+D ++
Sbjct  392   GFIRDRAEKFARGEIVSFSFT-SLCRFPLYEADFGWGKPVWAASASLSFKNLVTFMDTVS  450

Query  533   G--AVEVWMKLPKQVMHTLTQDRHFLAYVS  450
             G   VE W+ L ++ M  L  D   L++ S
Sbjct  451   GDHGVEAWINLKEEDMAKLEADEKLLSFAS  480



>ref|XP_008389785.1| PREDICTED: vinorine synthase-like [Malus domestica]
Length=431

 Score =   217 bits (553),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 150/444 (34%), Positives = 237/444 (53%), Gaps = 36/444 (8%)
 Frame = -2

Query  1751  MKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGACHHTKTID  1572
             MK+EV  K   +PS PTP  L+ ++ SFLDQ+   +  P + FY++   + A  ++   D
Sbjct  1     MKIEVIEKACIKPSMPTPPHLRKHEFSFLDQIATPIFMPMILFYNNDHGNDAITYS---D  57

Query  1571  ElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEMEKIKQL  1392
             ++K+SLSKTL+  YPLAGRV E+   + C+D+G  ++ A V   +S ++  P+  ++ QL
Sbjct  58    KVKQSLSKTLTQYYPLAGRVIEN-AYVNCNDQGAPYVQARVRSPLSDVISQPDPNQLNQL  116

Query  1391  IPSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRG-C  1215
             +P     +   VG  ++AVQVN F CGG+AI   +SH +ADA +L  F+  WAS +RG C
Sbjct  117   LPC----KLDNVGDLVLAVQVNVFDCGGMAIXICISHKVADALSLIMFLNSWASISRGDC  172

Query  1214  AANNGSGFVSDHSSILFPPLTDTSAIEQLMKMG----AEGIEQEEKDMIVKRFVIPANAI  1047
                N         S + PP+ D +       +     + GI +E+  ++ KRFV  A+ +
Sbjct  173   NIKN---------STVSPPIFDLATHFPPRSISGFKPSTGITREK--IVTKRFVFSASTV  221

Query  1046  AQLRQDLTITGGSVQRPSRVEALTALVWAAVINAT-----PTQTATLSCMVNLRRRMEPP  882
             A LR   T    + ++P+R+EAL+A +WA VI +T     P     +   VNLR RM+PP
Sbjct  222   ASLRSKYTDNKTNERKPTRIEALSAFIWARVIASTQGKPNPNTLYKVLHAVNLRTRMDPP  281

Query  881   LPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLRA  702
             LP    G +      +   + D G  +    +V ++R+A + +      K+      L+ 
Sbjct  282   LPEYHFGNV--SRFAMSSPSFDEGEDM-CYGMVGQMREAIKTIDGDYMAKIKDGNAHLKF  338

Query  701   VIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLV--VNMLDNSWVLFLDA-ING  531
             +  R  E ++   +S  +T SLCR   YE DFGWGKP  V   ++   + V+F+DA  +G
Sbjct  339   LKQRAEEFMKGEVASFSFT-SLCRFPLYETDFGWGKPVWVASASLTFKNLVVFMDAGSSG  397

Query  530   AVEVWMKLPKQVMHTLTQDRHFLA  459
              +EVW+ L ++ M     D   LA
Sbjct  398   GIEVWVNLKEEDMAKFQDDEQLLA  421



>ref|XP_008360182.1| PREDICTED: vinorine synthase-like [Malus domestica]
Length=443

 Score =   218 bits (554),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 163/455 (36%), Positives = 232/455 (51%), Gaps = 44/455 (10%)
 Frame = -2

Query  1751  MKVEVR--SKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYD-----SPTISGAC  1593
             MKV+V   SKEI RPSSPTP  L++Y+ SFLDQ+   +  P + FY+      P I+   
Sbjct  1     MKVQVVVISKEIIRPSSPTPGHLRHYQFSFLDQMAPQVYNPLLLFYEYNAKMHPNITEIS  60

Query  1592  HHTKTIDElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAE-NMSCLLENP  1416
             +H K       SLS+ LSL YPLAGR+K D   I C+DEG+ +I A V    +S +L NP
Sbjct  61    NHLKN------SLSEALSLFYPLAGRIK-DNCFIHCNDEGIPYIEARVLNCTLSDVLSNP  113

Query  1415  EMEKIKQLIPSA--KVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFME  1242
               +++ + +P     +  P P G     VQ+N F CGG AIG  VSH IAD  +   F +
Sbjct  114   NPDELNKFMPFELDDITNPLPFG-----VQLNIFQCGGFAIGQCVSHKIADGLSYFTFSK  168

Query  1241  IWASFNRGCAAN-NGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFV  1065
             IWA+  RG  AN +   FV   S+ LFPP    +  +     G  GI    KD + KRFV
Sbjct  169   IWAAIARGEQANIDPPQFV---SATLFPPKEFNTGFD-----GGVGI---TKDRVTKRFV  217

Query  1064  IPANAIAQLRQDLTITGGSVQ--RPSRVEALTALVWAAVINATPTQTATLSCM----VNL  903
               A+ I  L+        S+Q   P+RVE L+A +W+  + AT   T     M    VNL
Sbjct  218   FNASKIKTLQAKYEKDMKSLQLKHPTRVETLSAFIWSRYVAATKDCTVNKLYMVIHAVNL  277

Query  902   RRRMEPPLPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYG  723
             R R  PPLP +  G L   A+       +GG       ++  +R+A   + +   +++ G
Sbjct  278   RPRFSPPLPQHSFGNLFRVAMTSPLRISNGGEEECDGVVIGEVREAISKIDNEYVKQLQG  337

Query  722   EGGWLRAVIARGYELVRNRDS-STLYTSSLCRMAYYEVDFGWGKPRLVVN--MLDNSWVL  552
             +G     ++ +  +  +  D  + L  SS CR   YE DFGWGKP  V +  +   + VL
Sbjct  338   QGDEHLGLMKKAADSFKRGDMVAVLSFSSYCRFPLYENDFGWGKPAWVGSPALTYKNLVL  397

Query  551   FLDAING-AVEVWMKLPKQVMHTLTQDRHFLAYVS  450
             F+D   G  +E ++ L ++VM     D   L+YVS
Sbjct  398   FMDTKEGDGIEAYVSLEERVMVKFECDSELLSYVS  432



>ref|XP_006443122.1| hypothetical protein CICLE_v10020052mg [Citrus clementina]
 ref|XP_006478865.1| PREDICTED: vinorine synthase-like [Citrus sinensis]
 gb|ESR56362.1| hypothetical protein CICLE_v10020052mg [Citrus clementina]
Length=464

 Score =   218 bits (555),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 160/479 (33%), Positives = 239/479 (50%), Gaps = 57/479 (12%)
 Frame = -2

Query  1751  MKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGACHHTKTID  1572
             M++++ SK I +PSSPTP  LK +KLS LDQL  N  T  + FYD P+        +TI+
Sbjct  1     MQLDIISKNIIKPSSPTPLHLKTHKLSLLDQLAPNNYTSLLLFYDGPSRFDDKTSARTIN  60

Query  1571  ElkkslsktlsLM---YPLAGRVKEDKVTIECDDEGVEFIVADVAE--NMSCLLENPEME  1407
             +  +  S     +   YP AG+V +D   ++CDD GV F+   V    +MS +L+NPE  
Sbjct  61    DYHRLKSSLSKTLTLYYPFAGKVLKDNYVVDCDDSGVPFVETRVPSSISMSEVLKNPETN  120

Query  1406  KIKQLIPSAKVYEPQ-----PVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFME  1242
              ++QL+P    + P            +A+Q+N F+CGG+AIGF   H +ADA+A   F++
Sbjct  121   TLQQLLP----FNPNKKYLSSTDDVNMAIQINHFACGGMAIGFNFRHIVADATASIGFIK  176

Query  1241  IWASFNRGCAANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEK--DMIVKRF  1068
              WA  N   ++++ S     H  +     TDT    + +   A  I + ++  + + KRF
Sbjct  177   NWAKLN---SSDDNSIINYKHVVV---DCTDTFPRNKEIPSYARRINEWQRAPECVTKRF  230

Query  1067  VIPANAIAQLRQDLTITG----GSVQRPSRVEALTALVWAAVI------NATPTQTATLS  918
             V   + +A L++++ +           PSR EA+  L+W A+I      N   T T  +S
Sbjct  231   VFDGSKVAALKREMIVKNEASLNHQYSPSRFEAVCGLIWGALIAMDREKNIDSTST-IVS  289

Query  917   CMVNLRRRMEPPLPPNCLGTLVDEAIVLC---QEAKDGGTVVTAVELVQRIRDAFRAVKD  747
               VNLR RM P LP +C+G L     V C    EA DG    +   L + + ++ + V D
Sbjct  290   IPVNLRNRMNPLLPEDCIGNLFHS--VTCAANNEAGDGHRDKST--LARNVHESKKMVGD  345

Query  746   GEARKVYGEGGWLRAVIARGY-----ELVR---NRDSST----LYTSSLCRMAYYEVDFG  603
                RKVY +GG    V    Y     EL++   N D++        S    + YYE+DFG
Sbjct  346   DFVRKVYQDGG---VVFVNQYKEAVKELLKDGPNNDTTNSVRLFGFSGPIGLQYYEIDFG  402

Query  602   WGKPRLVVN-MLDNSWVLFLDAING-AVEVWMKLPKQVMHTLTQDRHFLAYVSAFPKPK  432
             WGKP  V + M  ++  + LD  +G  VE W+ LP   M  L QD   L Y S  P P+
Sbjct  403   WGKPVWVTSAMRMHNTAMLLDTRDGKGVEAWVGLPINDMPKLEQDPGILTYASFTPSPR  461



>ref|XP_010044504.1| PREDICTED: vinorine synthase-like [Eucalyptus grandis]
 gb|KCW86593.1| hypothetical protein EUGRSUZ_B03225 [Eucalyptus grandis]
Length=441

 Score =   217 bits (553),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 158/452 (35%), Positives = 236/452 (52%), Gaps = 43/452 (10%)
 Frame = -2

Query  1751  MKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGACHHTKTID  1572
             ++VEV S++  +PSSPT   L++YKLSFLDQ+ + +  P V F+  P   G     K + 
Sbjct  6     VEVEVVSRDTIKPSSPTLDHLRHYKLSFLDQIQVPVFMPLVLFF--PRDDGMLLDEK-LS  62

Query  1571  ElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEMEKIKQL  1392
              +K+SL+K L+  YPLAGRV+ D + ++C+DEG  ++ A V   +S +LENPE   + + 
Sbjct  63    RIKQSLAKALAKFYPLAGRVR-DNLYVDCNDEGALYVEARVRCKLSDILENPEPRVMNRF  121

Query  1391  IPSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGCA  1212
             +P     E   V    VAVQVN F CGG+A+   +SH +ADA +   F+  WAS  RG  
Sbjct  122   LPC----ELDNVQDLPVAVQVNFFECGGLALSLLISHKVADALSFFTFLNAWASAARGDP  177

Query  1211  ANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQLRQ  1032
                   F    SS LFPP+ D S  +      + GI ++  ++  +RF+  A  IA LR+
Sbjct  178   GIIDPCF---SSSELFPPI-DLSGFQT-----STGIVKD--NISTRRFIFDAATIASLRE  226

Query  1031  DLT-------ITGGSVQRPSRVEALTALVWAAV------INATPTQTATLSCMVNLRRRM  891
               T       +     +RP+RVEAL++ +W+        I A   +  T+   VNLR R 
Sbjct  227   KFTDLKKVADVADHPRRRPTRVEALSSFLWSRYMASTQPIEARGDKIYTVLHAVNLRTRT  286

Query  890   EPPLPPNCLGTLVDEAIVL--CQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEG  717
             EPP+     G +   AI +     + DGG      ++V ++RDA + V     RK+    
Sbjct  287   EPPISERHFGNISRLAIAVPTVDASTDGG-----YKIVDQVRDAIKQVNAEYVRKLQEGQ  341

Query  716   GWLRAVIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLV--VNMLDNSWVLFLD  543
             G L ++  R   + R    S  +T SLCR   YE DFGWGKP  V   ++   + ++F+D
Sbjct  342   GHLNSLKERSSRISRGEVVSFSFT-SLCRFPMYEADFGWGKPAWVGSASLTFKNLIVFMD  400

Query  542   AING-AVEVWMKLPKQVMHTLTQDRHFLAYVS  450
               +G  +E W+ L +  M    QD+  LA VS
Sbjct  401   TKSGDGIEAWVNLKEDDMAKFEQDKELLALVS  432



>ref|XP_002511241.1| Anthranilate N-benzoyltransferase protein, putative [Ricinus 
communis]
 gb|EEF51843.1| Anthranilate N-benzoyltransferase protein, putative [Ricinus 
communis]
Length=435

 Score =   216 bits (551),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 156/452 (35%), Positives = 248/452 (55%), Gaps = 34/452 (8%)
 Frame = -2

Query  1751  MKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGACHHTKTID  1572
             M+VE+ SKE  +P S TP+  + YKLS LDQL   +  P V FY +   +G     K  D
Sbjct  1     MEVEIISKETVKPCSSTPEHQRTYKLSLLDQLAPPVYIPIVLFYST---TGENSSQKLSD  57

Query  1571  ElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEMEKIKQL  1392
              LK S S  L+  YPLAGR+K D  +I+C+DEG  ++ A+VA +MS +L+ PE+ ++++L
Sbjct  58    HLKTSFSGVLTHFYPLAGRMK-DGFSIDCNDEGAPYVEANVAGDMSIVLQEPEIHQLQKL  116

Query  1391  IPSAKVYEPQPVG-KALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGC  1215
             +P         +  + ++A QVN F CGG+AI   + HAIADASA A F+  WA+    C
Sbjct  117   LPCNPYDISSDISSQVILAAQVNHFDCGGMAISICIWHAIADASAAASFITSWAAM--AC  174

Query  1214  AANNGSGFVSDHSSILFPPLTDTS-AIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQL  1038
              A++  G   D +S LFPP    S ++   +K      E+   +++VKRF+  +  +A L
Sbjct  175   GASDFQGVNVDCTS-LFPPQDMRSFSLRNFVK------EELSSNILVKRFLFDSLKLAAL  227

Query  1037  RQDLTITGGSVQRPSRVEALTALVWAAVINATPT----------QTATLSCMVNLRRRME  888
             ++ +  +G  +  P+RVEA+ AL+W AV+ A+              AT+S  V LR+R+ 
Sbjct  228   KEKVG-SGPCLDCPTRVEAVAALIWGAVMAASTEEEEDESTREINVATIS--VGLRKRLI  284

Query  887   PPLPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWL  708
             PPLP   +G +   A+  C + ++   ++    L  ++ ++   + +   RK++  GG+ 
Sbjct  285   PPLPQLSIGNIYQVALANCSKNEN---MLDYNGLAGKLHESIGKMDNNFVRKIHAGGGYF  341

Query  707   RAVIARGYELVRNRDSSTLYT-SSLCRMAYYEVDFGWGKPRLVVNMLDNSWV-LFLDAIN  534
               +  +  EL R  + + ++  SS CR  +YE DFGWGKP  V   +    V +F+D+ +
Sbjct  342   HFLKKKAEELGRRPNLTRVFGFSSWCRFPFYEADFGWGKPTWVGTAMKLYKVAIFIDSKD  401

Query  533   G-AVEVWMKLPKQVMHTLTQDRHFLAYVSAFP  441
             G  +E W+ LPK+ M    Q+    AY S  P
Sbjct  402   GQGIEAWVSLPKEDMAKFEQNPDICAYASFKP  433



>ref|XP_006292162.1| hypothetical protein CARUB_v10018368mg [Capsella rubella]
 gb|EOA25060.1| hypothetical protein CARUB_v10018368mg [Capsella rubella]
Length=431

 Score =   216 bits (551),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 159/452 (35%), Positives = 238/452 (53%), Gaps = 41/452 (9%)
 Frame = -2

Query  1751  MKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGACHHTKTID  1572
             M V+V S++I +PSSPTP  LK +KLS L+QL   +  P VFFY     +      + I 
Sbjct  1     MIVDVTSRDIIKPSSPTPNHLKTFKLSLLEQLGPTIFGPMVFFYSG---NNRIKPAEQIQ  57

Query  1571  ElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEMEKIKQL  1392
             +LK+SLS+TL+  +PLAGR+K + V+I+C+D GV+FI A V   +S LL+ P  + ++QL
Sbjct  58    KLKQSLSETLTHFHPLAGRLKGN-VSIDCNDSGVDFIEAQVDSPLSSLLQEPSSDSLQQL  116

Query  1391  IP-SAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASF-NRG  1218
             IP SA   E +     L+  Q + F CG +A+G  +SH  ADA+++  FM+ WA+  +RG
Sbjct  117   IPTSADSIETR---TKLLLAQASFFECGSMAVGVCISHKFADATSIGLFMKTWAAISSRG  173

Query  1217  CAANNGSGFVSDHSSILFPP--LTDTS---AIEQLMKMGAEGIEQEEKDMIVKRFVIPAN  1053
                  GS  V D + I FPP   ++TS    IE  +KM            + KRF+  ++
Sbjct  174   SIETVGSP-VFDTAKI-FPPGNFSETSPAPVIEPEIKMN---------QTVSKRFIFDSS  222

Query  1052  AIAQLRQDLTITGGSVQRPSRVEALTALVWAAVINATPTQTAT-----LSCMVNLRRRME  888
             +I  L+     +   V +P+RVEA++AL+W   + AT T + T     L+   +LR R+ 
Sbjct  223   SIQSLQAK--ASSFEVNQPTRVEAVSALIWKTAVKATRTVSGTSKPSILANSASLRSRLS  280

Query  887   PPLPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWL  708
             PP   N +G LV        +A++G        LV  IR A +  ++    K+ G     
Sbjct  281   PPFTENTIGNLVS---YFAAKAEEGINQTKLQTLVSEIRKAKQRFQENHVPKLVGNPNAT  337

Query  707   RAVIARGYE---LVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLV--VNMLDNSWVLFLD  543
               + +   E   ++ + +      SS CR   YE+DFGWGKP  V   ++   S V  LD
Sbjct  338   EVICSYQKEAGDMIASGEFDFYIISSACRFGLYEIDFGWGKPVWVGIPSIRQKSIVTLLD  397

Query  542   AIN-GAVEVWMKLPKQVMHTLTQDRHFLAYVS  450
                 G +E W+ L +Q M    QDR  L +VS
Sbjct  398   TREAGGIEAWVNLNEQEMKLFEQDRELLQFVS  429



>ref|XP_010554168.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554169.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554170.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554172.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554173.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554174.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554175.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554176.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554177.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554178.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554179.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554180.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554181.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554182.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554183.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554184.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554185.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554186.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554187.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554188.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554189.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554190.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554191.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554192.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554193.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554194.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554195.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554196.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554198.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554199.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554200.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554201.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554202.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554203.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554204.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554205.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554206.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554207.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554208.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554209.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554210.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554211.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554212.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554213.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554214.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554215.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554216.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554217.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554218.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
 ref|XP_010554219.1| PREDICTED: vinorine synthase [Tarenaya hassleriana]
Length=462

 Score =   216 bits (550),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 162/452 (36%), Positives = 238/452 (53%), Gaps = 38/452 (8%)
 Frame = -2

Query  1751  MKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGACHHTKTID  1572
             M+V+  +++I RPSSPTP  L+++KLS L+QL   +  P VFFY S     A    + + 
Sbjct  24    MRVDTVARDIIRPSSPTPDHLRHFKLSLLEQLGPTIFGPMVFFYSSSRFRQA----EQLQ  79

Query  1571  ElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEMEKIKQL  1392
             +LKKSLS+TLS  YPLAGR+K + V+I+C+D GV+F+ A+   ++S  LE P +E ++QL
Sbjct  80    KLKKSLSETLSHFYPLAGRLKGN-VSIDCNDSGVDFLEAEADSSLSGFLEEPYLEGLQQL  138

Query  1391  IPSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFN-RGC  1215
             IP+ +V  P+   K L+A Q + F CGGIA+G  +SH IADAS++   M+ WA+ + RG 
Sbjct  139   IPT-QVDSPEARTKLLLA-QASFFRCGGIALGVCLSHKIADASSIGLIMKSWAAMSARGS  196

Query  1214  AANNGSGFVSDHSSILFPP--LTDTSAIEQLMKMGAEGIEQE-EKDMIVKRFVIPANAIA  1044
                   GF   +++ LFPP   +DT          A  +E E  K  + KRFV  A+ I 
Sbjct  197   MKT--VGFPVYNTANLFPPGNFSDTDP--------APVVEPEIMKKTVSKRFVFGASDIQ  246

Query  1043  QLRQDLTITGGSVQRPSRVEALTALVWAAVINATPTQTAT-----LSCMVNLRRRMEPPL  879
              L+         V +P+RVEA++AL+W   + AT T + T     ++   N+RR + PPL
Sbjct  247   SLQAK--SASSEVSQPTRVEAVSALIWKCAMKATRTVSGTPKPSVIAHATNIRRLVSPPL  304

Query  878   PPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLRAV  699
             P   +G LV       +E            LV +IR A +  +D    K+ G       +
Sbjct  305   PETSIGNLVSYFAARAEEENQ----TKLQNLVFQIRKAKQNFRDKHVPKLIGNPEAPDII  360

Query  698   IARGYE---LVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLV---VNMLDNSWVLFLDAI  537
                  E   ++ + +      SS CR   YE DFGWGKP  V        N  VLF    
Sbjct  361   CNHQKEAGDMIASGEYDFYIFSSACRFDLYETDFGWGKPTWVGVPSVQQKNMMVLFDTKE  420

Query  536   NGAVEVWMKLPKQVMHTLTQDRHFLAYVSAFP  441
              G +EVW+ L ++ M    +D  F+ + S  P
Sbjct  421   PGGIEVWVNLHEEEMELFEKDSEFIEFASPNP  452



>ref|XP_002267341.1| PREDICTED: vinorine synthase [Vitis vinifera]
 emb|CBI27536.3| unnamed protein product [Vitis vinifera]
Length=431

 Score =   215 bits (547),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 153/454 (34%), Positives = 232/454 (51%), Gaps = 48/454 (11%)
 Frame = -2

Query  1751  MKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFY------DSPTISGACH  1590
             ++VEV S +  +PSSPTP  L++++LSFLDQ+   +  P + FY         TI  +  
Sbjct  4     IEVEVISTDTIKPSSPTPAHLRHFQLSFLDQVLSPIFIPIILFYPMDGDVKVDTIERSIW  63

Query  1589  HTKTIDElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEM  1410
               KT+         TL   YPLAGRVK D + I+C D+GV +  A V   +S  + NP+ 
Sbjct  64    LKKTLS-------MTLVQFYPLAGRVK-DNLFIDCTDQGVPYFEAQVKCQLSEFICNPDP  115

Query  1409  EKIKQLIPSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWAS  1230
              ++ + +P A       +   ++A+QVN F CGGIAIG  +SH +ADAS++  F+  WA+
Sbjct  116   MQLSKFVPHAL----DDIVDIVLAIQVNIFKCGGIAIGVCISHKVADASSVVTFVNGWAA  171

Query  1229  FNRGCAANNGSGFVSDHSSI--LFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPA  1056
                   A   +  V     +  LFPP+ + S       M  E I       + KRFV  A
Sbjct  172   -----VARRDTHMVCPQFGLANLFPPI-NLSGFNPSTGMTKEKI-------LTKRFVFSA  218

Query  1055  NAIAQLRQ---DLTITGGSVQRPSRVEALTALVWAAVINAT-----PTQTATLSCMVNLR  900
             +++A LR+   D + T    +RP+R+EAL+AL+W+  +  T     P +  T+   VNLR
Sbjct  219   SSVAALREKYADQSTTEDLPRRPTRIEALSALIWSRFVAVTHGMADPKKIYTILHAVNLR  278

Query  899   RRMEPPLPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGE  720
              RM+PPLP N  G ++  AI   +   DG        LV ++R+A   + DG+  K   E
Sbjct  279   TRMDPPLPENSFGNIIWFAIT--RPCIDGMKEGKRHALVNQMREAIEKI-DGDYIKKLPE  335

Query  719   GGWLRAVIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLV--VNMLDNSWVLFL  546
             G      +    E V   +  +   +S CR   YE DFGWGKP+ V   ++   + V+F+
Sbjct  336   GIKHLNFLKERAERVTKGEIESFRFTSFCRFPVYEADFGWGKPKWVGSGSLPFKNLVIFI  395

Query  545   DA--INGAVEVWMKLPKQVMHTLTQDRHFLAYVS  450
             D+   NG +E W+ L ++ M     D   L++VS
Sbjct  396   DSSGTNGGIEAWINLVEEDMDKFQGDEELLSFVS  429



>ref|XP_006430562.1| hypothetical protein CICLE_v10013397mg [Citrus clementina]
 gb|ESR43802.1| hypothetical protein CICLE_v10013397mg [Citrus clementina]
Length=431

 Score =   214 bits (545),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 152/459 (33%), Positives = 225/459 (49%), Gaps = 53/459 (12%)
 Frame = -2

Query  1751  MKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGACHHTKTID  1572
             M++ + S E  +PSSPTP  L+ ++LSF+DQL        + FY +   +   H  K++ 
Sbjct  1     MELRISSTENIKPSSPTPDHLRTHRLSFIDQLSPRAYLSMILFYSAG--ASPVHLKKSLS  58

Query  1571  ElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAE-NMSCLLENPEMEKIKQ  1395
             E            YP AG+ K+  V ++CDD GV FI A +AE ++S +++  +   ++Q
Sbjct  59    ETLTH-------FYPFAGQFKDSPV-VDCDDHGVTFIEAYLAEEDVSEVIQQAKANILEQ  110

Query  1394  LIPSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGC  1215
             L+P  K +E   V   L+ VQVN F CGG+AIG    H IADA+  A F++ W    RG 
Sbjct  111   LMP-CKPHESTRVEHNLI-VQVNYFGCGGMAIGICFHHKIADAATAANFLKTWGLHARGA  168

Query  1214  AANNGSGF---VSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIA  1044
              A + + F   V D +SI   P  D   +   + +G   +     D +VKRF I    IA
Sbjct  169   GAGDTNDFKHVVYDSNSIF--PAQDLPDMSVNLGLGLFSL-----DSVVKRFTIEGEKIA  221

Query  1043  QLRQDLTITGGSVQRPSRVEALTALVWAAVINA-------------TPTQTATLSCMVNL  903
              LR+ +      + RPSRVE +++++  A++ A             TP +  T    VNL
Sbjct  222   SLREKVVKAEPYLDRPSRVEVVSSVILGALLAAYGGLRDDDEEFTTTPPKNVTAIFAVNL  281

Query  902   RRRMEPPLPPNCLGTLVDEAIV---LCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARK  732
             R+RM PPLP    G +   A +   + +E K     +    L  ++R + R V D   RK
Sbjct  282   RKRMNPPLPEQSFGNISSAAFLNLPIDREKK-----INHSSLAGQLRQSIRMVDDQFVRK  336

Query  731   VYGEG---GWLRAVIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRL--VVNMLD  567
             +Y EG     L+AV A+G      + +     SS C+M +YE DFGWGKP    V     
Sbjct  337   LYAEGEILNILKAVEAQG----SPKSNKVFVISSWCKMPFYEADFGWGKPVSIGVGTRFT  392

Query  566   NSWVLFLDAINGAVEVWMKLPKQVMHTLTQDRHFLAYVS  450
             ++ +L       A+E W+ L KQ M    Q    LAY S
Sbjct  393   DAAILVDSCQTDAIEAWVGLSKQDMARFEQHLGVLAYTS  431



>emb|CDP08574.1| unnamed protein product [Coffea canephora]
Length=437

 Score =   214 bits (544),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 153/446 (34%), Positives = 224/446 (50%), Gaps = 42/446 (9%)
 Frame = -2

Query  1745  VEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGACHHTKTIDEl  1566
             +E+ SKE+ +PSSPTP  L+N+ LSFLDQL   +  P +FFY    +     H +    L
Sbjct  5     LEILSKEMIKPSSPTPYHLRNFTLSFLDQLAPPIYIPLIFFYQPSQLQTYKDHAQISQLL  64

Query  1565  kkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEMEKIKQLIP  1386
             K+SLS  L+  YPL GR+  D   I+ +D G  F+ A V  N+  ++E P M+++KQ +P
Sbjct  65    KQSLSNALTKFYPLGGRICSDDFAIDANDAGALFVEAQVHSNLLQVIEKPSMDEMKQYLP  124

Query  1385  SAKVYEPQPVGKA-------LVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASF  1227
                  +P   G         L+AVQ+N F CGG+AIG  +SH IAD ++L  FM  WA+ 
Sbjct  125   ----LQPNGSGHGITEANTILLAVQINIFDCGGLAIGVQMSHKIADGTSLVAFMNAWAAN  180

Query  1226  NRGCAANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAE---GIEQEEKDMIVKRFVIPA  1056
              RG A  + S    D +S LFPP       + ++  G +   GI +E+  +  KRFV   
Sbjct  181   CRGDAEIHQSSL--DLAS-LFPP-------KDVLNSGFKPTVGITKEK--ITTKRFVFDR  228

Query  1055  NAIAQLRQDLTITGGS-VQRPSRVEALTALVWAAVINATPTQTATLS-------CMVNLR  900
               +A+L+Q L  + GS V+ P+RVEA++A  W   I AT  +  + S         VNLR
Sbjct  229   EKLAKLKQALASSPGSQVKDPTRVEAVSAFFWRHFIEATKAKMDSKSKKMVAAVHAVNLR  288

Query  899   RRMEPPLPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGE  720
              RM P LP +  G L   A+ +     + G    A +L    R+A R +     + +   
Sbjct  289   PRMNPALPDHAFGNLWRHALAIPVAEGEKGYQNLAGDL----RNAIRNINSNYVKTLQIG  344

Query  719   GGWLRAVIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVVNM---LDNSWVLF  549
               +L A + +  ELV   D      SS CR   YEVD+GWGKP  V        N  +L 
Sbjct  345   DEYLHA-LKKTMELVSKGDIEFCNFSSWCRFPVYEVDYGWGKPTWVCTTTLPFKNVVILM  403

Query  548   LDAINGAVEVWMKLPKQVMHTLTQDR  471
               +    +E W+ + ++ M +   D 
Sbjct  404   STSCGEGIEAWVNMLEEDMASFESDH  429



>ref|XP_008240535.1| PREDICTED: vinorine synthase-like [Prunus mume]
Length=444

 Score =   214 bits (544),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 160/458 (35%), Positives = 239/458 (52%), Gaps = 46/458 (10%)
 Frame = -2

Query  1757  ITMKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYD-----SPTISGAC  1593
             + ++VEV SKEI +PSSPTP  L++Y+ SFLDQ+      P + FY+      P I+   
Sbjct  3     MKVEVEVISKEIIKPSSPTPDHLRHYQFSFLDQIAPQGYNPLLLFYEHNAKTQPNITEIS  62

Query  1592  HHTKTIDElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAE-NMSCLLENP  1416
             +H K       SL + L+L YPLAGR+K ++  I C+DEG+ F+ A V +  +S +L NP
Sbjct  63    NHLKN------SLCEVLNLFYPLAGRIKNNQF-IHCNDEGIPFVEARVLDCTLSDVLSNP  115

Query  1415  EMEKIKQLIPSAKVYEPQPVGKAL-VAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEI  1239
                ++ + +P    +E   +  +L + VQ+N F CGG AIG  +SH IAD  +   F +I
Sbjct  116   IPGELNKFMP----FELDDITNSLPLGVQLNIFQCGGFAIGQCISHKIADGLSYFMFSKI  171

Query  1238  WASFNRGCAAN-NGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVI  1062
             WA+  RG  AN N   FV   SS LFPP        +   +G +G     KD I KRFV 
Sbjct  172   WAAIARGDQANINPPEFV---SSTLFPP--------KEFNIGFDGSVGITKDRITKRFVF  220

Query  1061  PANAIAQLRQDLTITGGSV-QRPSRVEALTALVWAAVINATPTQTATLSCM------VNL  903
              A+ I  LR+    +  ++ +RP+RVE L+  +W+  + A  T+ +TL+ +      VNL
Sbjct  221   DASQIENLRERYEQSMHNMKKRPTRVETLSTFLWSRFVAA--TKDSTLNKLYRVIHAVNL  278

Query  902   RRRMEPPLPPNCLGTLVDEAIVL-CQEAKDGGTVVTAVE--LVQRIRDAFRAVKDGEARK  732
             R R++PPLP +  G L   AI    Q    GG         ++  IR+A   + +   +K
Sbjct  279   RPRIDPPLPQSSFGNLFHVAITAPLQIPSSGGGDEECGHGVVIPVIREAIDNIDNEYVKK  338

Query  731   VYGEGGWLRAVIAR-GYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLV--VNMLDNS  561
             +  EG     V+ +  Y   R    + L  SS CR   Y+ DFGWG+P  V   +    +
Sbjct  339   LQKEGDEYLGVMKKLAYSCKRGEMGTLLSFSSYCRFPLYDNDFGWGRPTWVGSPSRTYKN  398

Query  560   WVLFLDAI-NGAVEVWMKLPKQVMHTLTQDRHFLAYVS  450
              VLF+D    G +E ++ L ++VM     D   L+YV+
Sbjct  399   LVLFMDTKEGGGIEAYVSLEEEVMAKFECDSELLSYVA  436



>ref|XP_009359286.1| PREDICTED: vinorine synthase-like [Pyrus x bretschneideri]
Length=432

 Score =   213 bits (542),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 148/443 (33%), Positives = 232/443 (52%), Gaps = 33/443 (7%)
 Frame = -2

Query  1751  MKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGACHHTKTID  1572
             MK+EV  +   +PS PTP  L  ++ SFLDQ+   +  P +FFY++  ++ A  ++   D
Sbjct  1     MKIEVIERAYIKPSMPTPPHLCKHEFSFLDQIATQIFMPMIFFYNNHHVNDARTYS---D  57

Query  1571  ElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADV-AENMSCLLENPEMEKIKQ  1395
              +K+SLS+ L+  YP AGR+ E+   I+C+D+G  ++ A V +  +S ++  P+  ++ +
Sbjct  58    RVKQSLSEALTQYYPFAGRIVENAF-IDCNDQGAPYVQARVRSPPLSDVISEPDPNQLNK  116

Query  1394  LIPSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRG-  1218
             L+P     E   VG  + A+QVN F CGG+AIG   SH +ADA +   F+  WAS +RG 
Sbjct  117   LLPC----ELDNVGDLVFAIQVNMFDCGGMAIGICFSHKVADALSFITFLNSWASISRGD  172

Query  1217  CAANNG--SGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIA  1044
             C   N   S  + D ++ LFPP +        +      +E+  + ++ KRFV  A+ IA
Sbjct  173   CNIKNSTVSRPIFDLAT-LFPPRS--------ISGFKPSVEKAREKIVTKRFVFSASTIA  223

Query  1043  QLRQDLTITGGSVQRPSRVEALTALVWAAVINAT-----PTQTATLSCMVNLRRRMEPPL  879
              LR   T    +  +PSR+EAL+A +WA  I +T     P     ++  VNLR RM+PPL
Sbjct  224   SLRSRYTDNKANEIKPSRIEALSAFIWARFIASTQGKPNPNTLYRVAHAVNLRTRMDPPL  283

Query  878   PPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLRAV  699
             P    G +     V+   + D     T   +V+++R A + + DG+      EG      
Sbjct  284   PEYHFGNV--SRFVMSSPSFDERE-DTCYGMVRQMRQAIKTI-DGDYVAKIKEGNEHVEF  339

Query  698   IARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLV--VNMLDNSWVLFLDA-INGA  528
             + +  E    R+ ++   SSLCR  YYE D GWGKP  V   +    + V F+DA  +G 
Sbjct  340   LKQLAEESMKREVASFSFSSLCRFPYYETDLGWGKPVWVGSASFPFKNLVCFIDAGSSGG  399

Query  527   VEVWMKLPKQVMHTLTQDRHFLA  459
             +E W+ L ++ M     D   LA
Sbjct  400   IEAWVNLKEEDMAKFQHDEQLLA  422



>ref|XP_008226170.1| PREDICTED: vinorine synthase-like [Prunus mume]
Length=454

 Score =   214 bits (544),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 148/458 (32%), Positives = 245/458 (53%), Gaps = 36/458 (8%)
 Frame = -2

Query  1748  KVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFY-----DSPTISGACHHT  1584
             KV++  ++  +PSS TP  L+++KLSF DQ  + +  P + +Y      S   +G   H 
Sbjct  6     KVQIIERQTIKPSSATPPHLRSFKLSFFDQTAIVIYIPILLYYPNTGSTSKVRTGHHDHV  65

Query  1583  KTIDEl----kkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENP  1416
               I+E      +SLSKTL+  YPLAGR+ E K  +EC+D G EF+ A +  ++S +LE+P
Sbjct  66    VAINERCQHLIESLSKTLTHFYPLAGRIIEGKAMVECNDAGAEFVKARINCSLSEILEHP  125

Query  1415  EMEKIKQLIPSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIW  1236
             + + +K+ +P     +    G+ L+ VQ+N F CGG+AIG  +SH IADAS L+ F++ W
Sbjct  126   DAQMLKEFLPIEYESKEASTGR-LLRVQINCFECGGMAIGLSISHRIADASTLSTFIKCW  184

Query  1235  ASFNRGCAANNGSGFVSDH--SSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVI  1062
             A+   G   ++    V     ++ +FPP+  ++  +   +   E I+ E  + I KRFV 
Sbjct  185   ATIAFGSRDSDQVLLVLPKFGAAPVFPPIDFSNCTQPPAR---EVIKVE--NCITKRFVF  239

Query  1061  PANAIAQLRQDLTITGGSVQRPSRVEALTALVWAAVINATP-----TQTATLSCM-VNLR  900
              A+ IA L+ +   T   V +P+RVEA++AL+W   + A+      TQ  +  C  VNLR
Sbjct  240   DASKIAALQSES--TSSVVPKPTRVEAVSALIWKCAMEASSRSKLGTQRRSGFCQDVNLR  297

Query  899   RRMEPPLPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGE  720
             +R+ PPLP N +G +V       +E       +    LV ++R+    +K+  A+K+  +
Sbjct  298   KRVVPPLPENLVGNVVGSFTSTAEEG-----TIDLKGLVAKLREGIEELKEKYAKKLVFD  352

Query  719   GGWLRAVIARGYELVRNRDSSTLYT-SSLCRMAYYEVDFGWGKPRL--VVNMLDNSWVLF  549
                    I   +  ++N D   +Y+ +S CR  +YE DFGWGKP    V+++   + ++ 
Sbjct  353   SNEAWQGIKDKHSKLKNDDEMEIYSCTSWCRFPFYEADFGWGKPSWVSVISIAIKNIIVL  412

Query  548   LDA--INGAVEVWMKLPKQVMHTLTQDRHFLAYVSAFP  441
             +D    NG +E W+ + ++ M     +   L Y S  P
Sbjct  413   MDKGDCNG-IEAWLTMSQESMALFESNVELLRYASVNP  449



>ref|XP_002514980.1| Anthranilate N-benzoyltransferase protein, putative [Ricinus 
communis]
 gb|EEF47534.1| Anthranilate N-benzoyltransferase protein, putative [Ricinus 
communis]
Length=450

 Score =   213 bits (543),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 162/478 (34%), Positives = 240/478 (50%), Gaps = 68/478 (14%)
 Frame = -2

Query  1748  KVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFY----DSPTISGACHHTK  1581
             +V+V SKE+ +PSSPTP  L++Y+LSFLDQ+ + +  P V FY    ++ T    C+H K
Sbjct  3     EVKVISKELIKPSSPTPHLLRHYQLSFLDQIAVPVFMPLVLFYPKETNNITNQERCNHAK  62

Query  1580  TIDElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEMEKI  1401
                    SLSK L+  YPLAGRVK + + I+C+DEG  F+ A+    +S +L++P+   +
Sbjct  63    K------SLSKALTQFYPLAGRVKHN-MYIDCNDEGAYFVEAEAKCTLSHILQHPDPNDL  115

Query  1400  KQLIPSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNR  1221
              + +P     E   V       QV  F CGG+AI F +SH + DA +   F+  WA+  R
Sbjct  116   NKFLP----LELDDVNDLASVFQVTLFQCGGLAISFGMSHKVGDALSFFMFLNSWAAIAR  171

Query  1220  GCAA--NNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAI  1047
             G +   N    F    SS+LFPP  D S  +        GI ++   ++ KRFV  A+ I
Sbjct  172   GDSTTINTVPCF---QSSLLFPP-KDLSGFQP-----RTGIVKDT--IVAKRFVFDASTI  220

Query  1046  AQLRQDLTITGGSVQ---RPSRVEALTALVWA---AVINATPTQTA----TLSCMVNLRR  897
             + LR   T  G + +   RP+RVEAL+A +W+   A + A          TL   +NLR 
Sbjct  221   SALRAMYTDDGDNNKYPRRPTRVEALSAFIWSRFMASVEANKVHDCDKIYTLLHAINLRP  280

Query  896   RMEPPLPPNCLGTLVDEAIVLC-------------------QEAKDGGTVVTAVELVQRI  774
             RM+PPL     G +   A+ +                    ++ K+ GT       V+++
Sbjct  281   RMDPPLQELYFGNISRIAVAIASMEDIDNICGPKDICGGTKEDFKNHGT-------VKKM  333

Query  773   RDAFRAVKDGEARKVYGEGGWLRAVIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGK  594
             RDA R V     +K+    G L  +  R  ++++    S  +T SLCR   YE DFGWGK
Sbjct  334   RDAIRNVNVEYVKKLQESDGHLSFMKGRAEQVMKGEVVSFSFT-SLCRFPIYEADFGWGK  392

Query  593   PRLV--VNMLDNSWVLFLDAING-AVEVWMKLPKQVMHTLTQDRHFLAYVSAFPKPKL  429
             P  V    +   + V+FLD   G  +E W+ L  + M     D+ FLA+VS F   K+
Sbjct  393   PVWVGSARLTFKNLVVFLDTKEGDGIEAWINLKVEDMVKFEADKEFLAHVSPFSNVKI  450



>ref|XP_008222013.1| PREDICTED: vinorine synthase-like [Prunus mume]
Length=435

 Score =   213 bits (541),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 144/443 (33%), Positives = 229/443 (52%), Gaps = 31/443 (7%)
 Frame = -2

Query  1751  MKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGACHHTKTID  1572
             M+++V  ++  +PSSPTP  L+ ++LSFLDQ+   +  P + FY +       H     D
Sbjct  2     MRIQVIERDCIKPSSPTPPHLRKHELSFLDQIATPIFMPMILFYTNNNGRRGNHVKIYSD  61

Query  1571  ElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEMEKIKQL  1392
              +K+SLS+ L+  YPLAGRV +D   ++C+D+G  ++ A V   +S ++  P+  +  +L
Sbjct  62    RVKQSLSEILTQYYPLAGRVIDD-AYVDCNDQGAHYVQAQVNCTLSDVISQPDPNQHNKL  120

Query  1391  IPSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGCA  1212
             +P    Y+   VG  ++AVQVN F CGG+AIG  +SH I DA ++  F+  WAS +RG  
Sbjct  121   LP----YDLDNVGDLVLAVQVNIFDCGGMAIGICISHKIVDAFSVITFLNSWASVSRGD-  175

Query  1211  ANNGSGFVSDHSSILFPPLTDTSAIEQLMKMG----AEGIEQEEKDMIVKRFVIPANAIA  1044
                        ++ + PPL D + +     +     + GI +E  +++ KRFV  A+ +A
Sbjct  176   -------YDIKNNTISPPLFDVATLFPPRSISGYKPSTGITRE--NIVTKRFVFSASMVA  226

Query  1043  QLRQDLTITGGSVQRPSRVEALTALVWAAVINAT-----PTQTATLSCMVNLRRRMEPPL  879
              LR   T    +   P+R+EAL+  +WA  I +T     P +   +   VNLR RM+PPL
Sbjct  227   SLRSKYTENNSNEIYPTRIEALSCFIWARFIASTQGEPNPKKIYKVLHAVNLRTRMDPPL  286

Query  878   PPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLRAV  699
             P   +G +   AI    +    G+  T   LV ++RDA + +      K+      L  +
Sbjct  287   PEYHIGNVSRFAIA---KLSFDGSKDTCYRLVGQMRDALKTIDSDYLSKMRDGDTHLNFL  343

Query  698   IARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLV--VNMLDNSWVLFLDA-INGA  528
               R  E ++    S  +T SLCR   Y  DFGWGKP  V   ++   + V+F+D    G 
Sbjct  344   KERVAEFMKGEVVSLNFT-SLCRFPLYGTDFGWGKPVWVGSASLPFKNLVVFMDTESGGG  402

Query  527   VEVWMKLPKQVMHTLTQDRHFLA  459
             +E W+ L ++ M    +D   LA
Sbjct  403   IEAWVNLKEEDMAKFQEDEQLLA  425



>ref|XP_006380880.1| hypothetical protein POPTR_0006s01180g [Populus trichocarpa]
 gb|ERP58677.1| hypothetical protein POPTR_0006s01180g [Populus trichocarpa]
Length=403

 Score =   211 bits (538),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 158/443 (36%), Positives = 231/443 (52%), Gaps = 54/443 (12%)
 Frame = -2

Query  1751  MKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGACHHTKTID  1572
             MKV++ SKEI +PSS TPQ L+ YKLS LDQL             SP I   C   K  D
Sbjct  1     MKVQIISKEILKPSSSTPQHLRTYKLSVLDQLA------------SP-IEDLC---KNSD  44

Query  1571  ElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEMEKIKQL  1392
              LK S SKTL+  YP AGR+K+D  +++C+D+G EFI A VA ++S +LE  ++ + +QL
Sbjct  45    HLKDSFSKTLTHFYPFAGRIKDD-FSVDCNDDGAEFIEARVAGDISMVLEQADINQQQQL  103

Query  1391  IPSAKVYEPQPVG--KALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRG  1218
             +P +   +   +   +  +AVQVN F+CGG+AI   + HA+ADAS LA F+  WA+ +R 
Sbjct  104   LPCSPYVKSSKLSTDQVTLAVQVNYFNCGGVAISICIWHAVADASTLATFVNCWAAISRD  163

Query  1217  CAANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQL  1038
                NN    V    + LFPP  D S    L     E +  E   +++KRF+   + +A L
Sbjct  164   --PNNVIDEVVFDCTTLFPP-QDLSGF-SLHSFVKEDVLSE---IVMKRFLFDGSKVAAL  216

Query  1037  RQDLTITGGSVQRPSRVEALTALVWAAVINAT----PTQTATLSCMVNLRRRMEPPLPPN  870
             R ++   G S+ RP+R  A++AL+  A++  T      Q      +V+LRRR++PP    
Sbjct  217   RDEVG-NGPSLDRPTRFIAVSALILGAMMAVTRENNAMQINAAFIVVDLRRRLKPP----  271

Query  869   CLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLRAVIAR  690
                             +    V++   L  ++ ++ R + D   RK +  GG+   ++ R
Sbjct  272   ---------------PESESNVLSYNGLAGKLHESIRMMNDDYIRKFHAGGGYFN-LLKR  315

Query  689   GYELVRNRDSSTLYT-SSLCRMAYYEVDFGWGKPRLVVNMLD-NSWVLFLDAING-AVEV  519
               E  R   + TL+  SS C   +YE DFGWGKP  V   L  N   +FLD  +G  +E 
Sbjct  316   AGEEARKGSNLTLFGFSSWCNFPFYETDFGWGKPLWVSPALKFNRVAVFLDTKDGEGIEA  375

Query  518   WMKLPKQVMHTLTQDRHFLAYVS  450
             W+ L K+ M    QD   L Y S
Sbjct  376   WIGLSKEDMVKFEQDPGILTYAS  398



>ref|XP_008222012.1| PREDICTED: vinorine synthase-like [Prunus mume]
Length=434

 Score =   212 bits (540),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 145/444 (33%), Positives = 228/444 (51%), Gaps = 33/444 (7%)
 Frame = -2

Query  1751  MKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGACHHTKTID  1572
             M+++V  ++  +PSSPTP  L+ ++LSFLDQ+   +  P + FY +             D
Sbjct  1     MRIQVIERDCIKPSSPTPSHLRKHELSFLDQIATPIFMPMILFYTNNNGRRGNDVKIYSD  60

Query  1571  ElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEMEKIKQL  1392
              +K+SLS+ L+  YPLAGRV +D   ++C D+G  ++ A V   +S ++  P+  +  +L
Sbjct  61    RVKQSLSEILTQYYPLAGRVIDD-AYVDCIDQGAHYVQAQVNCTLSDVISQPDPNQHNKL  119

Query  1391  IPSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRG-C  1215
             +P    Y+   VG  ++AVQVN F CGG+AIG  +SH I DA ++  F+  WAS +RG C
Sbjct  120   LP----YDLDNVGDLVLAVQVNIFDCGGMAIGICISHKIVDAFSVITFLNSWASISRGDC  175

Query  1214  AANNGSGFVSDHSSILFPPLTDTSAIEQLMKMG----AEGIEQEEKDMIVKRFVIPANAI  1047
                N +         + PPL D + +     +     + GI +E  +++ KRFV  A+ +
Sbjct  176   DIKNNT---------ISPPLFDVATLFPPRSISGYKPSTGITRE--NIVTKRFVFSASMV  224

Query  1046  AQLRQDLTITGGSVQRPSRVEALTALVWAAVINAT-----PTQTATLSCMVNLRRRMEPP  882
             A LR   T    + + P+R+EAL+  +WA  I +T     P +   +   VNLR RM+PP
Sbjct  225   ASLRSKYTENNSNERYPTRIEALSCFIWARFIASTQGEPNPKKIYKVLHAVNLRTRMDPP  284

Query  881   LPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLRA  702
             LP   +G +   AI         G+  T   LV ++RDA + +      K+      L  
Sbjct  285   LPEYHIGNVSRFAIATLSF---DGSKDTCYGLVGQMRDALKTIDSDYLSKMRDGDTHLNF  341

Query  701   VIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLV--VNMLDNSWVLFLDA-ING  531
             +     E ++    S  +T SLCR   YE DFGWGKP  V   ++   + V+F+D    G
Sbjct  342   LKQGAAEFMKGEVVSLNFT-SLCRFPLYETDFGWGKPVWVGSASLPFKNLVVFMDTESGG  400

Query  530   AVEVWMKLPKQVMHTLTQDRHFLA  459
              +E W+ L ++ M    +D   LA
Sbjct  401   GIEAWVNLKEEDMAKFQEDEQLLA  424



>ref|XP_007037899.1| 3'-N-debenzoyl-2'-deoxytaxol N-benzoyltransferase, putative [Theobroma 
cacao]
 gb|EOY22400.1| 3'-N-debenzoyl-2'-deoxytaxol N-benzoyltransferase, putative [Theobroma 
cacao]
Length=444

 Score =   211 bits (538),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 143/448 (32%), Positives = 234/448 (52%), Gaps = 28/448 (6%)
 Frame = -2

Query  1760  QITMKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGACHHTK  1581
             ++ M++++ S+E  +PSSPTP  L+ +KLS LDQL   +  P + FY S T       + 
Sbjct  15    KLEMEIQIISRETIKPSSPTPHHLRTHKLSLLDQLVPPVNIPVLLFY-SATAENPRKRSL  73

Query  1580  TIDElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEMEKI  1401
              + E            Y  AGR+ E   +I+C+D G  +I A VA +MS +L+ PE++ +
Sbjct  74    QLKESLSKTLVH---FYTFAGRLSE-SFSIDCNDNGATYIEAQVAIDMSVVLKEPEIDLL  129

Query  1400  KQLIPSAKVYE-PQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFN  1224
              QL+P        +P  + ++++QVN F+CGG+AI   V HA+ADASA+A F++ WA+  
Sbjct  130   LQLLPCDPHENLAEPSAQVVLSIQVNYFACGGMAICVCVHHAVADASAVATFLQSWAAV-  188

Query  1223  RGCAANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIA  1044
               C AN       D +S+   P  D S   ++++   + I +E  D++  RF+   + I 
Sbjct  189   -ACGANLTDTETFDCTSLF--PRQDLSGFWEVLEENKDLIIRE--DVVTTRFLFDRSKID  243

Query  1043  QLRQDLTITGGSVQRPSRVEALTALVWAAVINATPTQTATL----SCMVNLRRRMEPPLP  876
              LR ++   G S+ RP+RVEA++AL+W A++ +      T+    +  VNLR+RM  P P
Sbjct  244   VLRDEIG-NGSSLYRPTRVEAVSALIWNAMVASIAEYDKTIPIYVATSVNLRKRMNFPFP  302

Query  875   PNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLRAVI  696
               C+  +     ++ +   +    ++   L   + D+   V D   RK++  G +L   I
Sbjct  303   QKCVANV--SQFIMTELPIEKTKNLS--NLAGNLHDSITKVDDEYVRKLHAGGAYLN--I  356

Query  695   ARGYELVRNRDSSTLYT-SSLCRMAYYEVDFGWGKPRLVVNMLD-NSWVLFLDAIN-GAV  525
              +G   ++    + +++ SS CR  +YE DFGWGKP      L  N    FLD  + G +
Sbjct  357   MKG--AIKGFGKNWIFSFSSWCRFPFYETDFGWGKPIWFGTTLRLNRVAFFLDTNDGGGI  414

Query  524   EVWMKLPKQVMHTLTQDRHFLAYVSAFP  441
             E W+ L ++ M  L QD   L Y +  P
Sbjct  415   EAWITLTQEEMVKLEQDTGILDYATFKP  442



>ref|XP_010506970.1| PREDICTED: vinorine synthase-like [Camelina sativa]
Length=459

 Score =   211 bits (538),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 160/454 (35%), Positives = 243/454 (54%), Gaps = 36/454 (8%)
 Frame = -2

Query  1754  TMKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGACHHTKTI  1575
             +M V+V S++I +PSSPTP  LK +KLS L+QL   +  P VFFY     +     T+ +
Sbjct  16    SMIVDVVSRDIIKPSSPTPNHLKKFKLSLLEQLGPTIFGPMVFFYSGN--NNRIKPTEQL  73

Query  1574  DElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEMEKIKQ  1395
              +LKKSLS+TL+  YPLAGR+K + V+I+C++ G +F+ A+V   +S LL+ P  + ++Q
Sbjct  74    QKLKKSLSETLTHFYPLAGRLKGN-VSIDCNNSGADFLEAEVNSPLSSLLQEPSSDNLQQ  132

Query  1394  LIPSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASF-NRG  1218
             LIP++ V   +   K L+A Q + F CG +AIG  +SH  ADA+++  FM+ WA+  +RG
Sbjct  133   LIPTS-VDSIETRTKLLLA-QASFFECGSMAIGVCISHKFADATSIGLFMKTWAAISSRG  190

Query  1217  CAANNGSGFVSDHSSILFPP--LTDTSAIEQLMKMGAEGIEQE--EKDMIVKRFVIPANA  1050
                  GS  V D   I FPP   ++TS         A  IE E      + KRFV  +++
Sbjct  191   SIKTVGSP-VFDTVKI-FPPGNFSETSP--------APVIEPEIMMNQTLSKRFVFDSSS  240

Query  1049  IAQLRQDLTITGGSVQRPSRVEALTALVWAAVINATPTQTAT-----LSCMVNLRRRMEP  885
             I  L+     +   V++P+RVEA++AL+W   + AT T + T     L+   +LR R+ P
Sbjct  241   IQSLQAK--ASSFEVKQPTRVEAVSALIWKTAMKATRTVSGTSKPSILANSASLRSRVSP  298

Query  884   PLPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLR  705
             P   N +G LV        +A++G        LV ++R+A +  ++    K+ G      
Sbjct  299   PFTENSVGNLVS---YFAAKAEEGVNQTKLQTLVSKLRNAKQRFRENHVPKLVGNPNATE  355

Query  704   AVIARGYE---LVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLV--VNMLDNSWVLFLDA  540
              + +   E   ++ + D      SS CR   YE DFGWGKP  V   ++   + V  LD 
Sbjct  356   IICSYQREAGDMIASGDFDFYIFSSACRFGLYETDFGWGKPVWVGIPSVRQKNIVTLLDT  415

Query  539   IN-GAVEVWMKLPKQVMHTLTQDRHFLAYVSAFP  441
                G +E W+ L +Q M    QDR  L +VS  P
Sbjct  416   KEAGGIEAWVNLNEQEMKLFEQDRELLHFVSLNP  449



>ref|XP_006395599.1| hypothetical protein EUTSA_v10005565mg [Eutrema salsugineum]
 gb|ESQ32885.1| hypothetical protein EUTSA_v10005565mg [Eutrema salsugineum]
Length=458

 Score =   211 bits (537),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 157/453 (35%), Positives = 242/453 (53%), Gaps = 37/453 (8%)
 Frame = -2

Query  1751  MKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGACHHTKTID  1572
             M+V++ S+++ +PSSPTP  LKN+KLS L+QL   +  P VFFY     +     T+ + 
Sbjct  17    MRVDLISRDMIKPSSPTPNHLKNFKLSLLEQLGPTIFGPMVFFYSG---NKGIKPTEQLQ  73

Query  1571  ElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEMEKIKQL  1392
             +LKKS S+TL+  YPLAGR+K + ++I+C+D G +F+ A+V   +S LL+ P  + ++QL
Sbjct  74    KLKKSFSETLTHFYPLAGRLKGN-ISIDCNDSGADFLEAEVNTPLSNLLQEPSSDILQQL  132

Query  1391  IPSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASF-NRGC  1215
             IP++ V   +   K L+A Q + F CGG+AIG  +SH +ADA++++ FM+ WA+  +RG 
Sbjct  133   IPTS-VDSIETRTKLLLA-QASFFECGGMAIGVCISHKLADATSISLFMKSWAAISSRGS  190

Query  1214  AANNGSGFVSDHSSILFPP--LTDTSAIEQLMKMGAEGIEQE--EKDMIVKRFVIPANAI  1047
                   GF    +  +FPP   ++TS         A  +E E      + KRFV  +++I
Sbjct  191   IKT--VGFPVFDTVKIFPPGNFSETSP--------APVVEPEIMMNQTLSKRFVFDSSSI  240

Query  1046  AQLRQDLTITGGSVQRPSRVEALTALVWAAVINATPT--QTATLSCMVN---LRRRMEPP  882
               L+     +   V +P+RVEA++AL+W A + AT T  +T+  S + N   LR R+ PP
Sbjct  241   QALQAK--ASSFEVNQPTRVEAVSALIWKAAMKATRTVSRTSKPSILANSACLRSRVSPP  298

Query  881   LPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLRA  702
                N +G LV        +A++G        LV  IR A +  +D    K+ G       
Sbjct  299   FTENSIGNLVS---YFAAKAEEGENQTKLRTLVFEIRKAKQRFRDNHVSKLVGNPDATEI  355

Query  701   VIARGYE---LVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLV--VNMLDNSWVLFLDAI  537
             +     E   ++ + D      SS CR   YE DFGWG P  V   ++   + V  LD  
Sbjct  356   ICNYQIEAGDMIASGDFDFYIFSSACRFGLYETDFGWGNPVWVGFPSVRQKNIVALLDTK  415

Query  536   N-GAVEVWMKLPKQVMHTLTQDRHFLAYVSAFP  441
               G +E W+ L +Q M    QDR  L++ S  P
Sbjct  416   EAGGIEAWVNLNEQEMKLFEQDRELLSFASVNP  448



>ref|XP_008226167.1| PREDICTED: vinorine synthase-like [Prunus mume]
Length=450

 Score =   211 bits (536),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 150/468 (32%), Positives = 228/468 (49%), Gaps = 55/468 (12%)
 Frame = -2

Query  1751  MKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFY---------DSPTISG  1599
             +KVE+  ++  +PSSPTP  L+NYKLS LDQ+      P + FY         D    + 
Sbjct  5     IKVEIIQRQTVKPSSPTPHHLRNYKLSILDQIAPQTYIPILLFYPNAADATSNDVMATNE  64

Query  1598  ACHHTKTIDElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLEN  1419
              C H      L +SL+KTL+  YP AGR+K D V IEC+D+G EF+ A V  ++S + E+
Sbjct  65    RCQH------LMQSLAKTLTHFYPSAGRIKGDAV-IECNDDGAEFVEARVKCSLSEIFEH  117

Query  1418  PEMEKIKQLIPSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEI  1239
             P+   +++ +P          G  L+ VQVN F CGG+AIGF +SH   DA+ L+ F+  
Sbjct  118   PDAVMLRRFLPVEPESREAGTG-TLLLVQVNLFECGGMAIGFSISHKFGDAATLSTFINC  176

Query  1238  WASFNRGCAANNGSGFVSDHSSIL-FPPLTDTSAIEQLMKMGAE---GIEQEEKDMIVKR  1071
             W +  R            D S++L  P     S    L    +E    +E + +  I +R
Sbjct  177   WTAAAR------------DQSNMLMLPKFGAASLFSPLNFSNSEPLPSVEVDNEKFITRR  224

Query  1070  FVIPANAIAQLRQDLTITGGSVQRPSRVEALTALVWAAVINATPTQTAT-----------  924
             FV  A+ IA L+    +T   V +P+RVEA +AL+W   I A+   ++            
Sbjct  225   FVFDASKIAALQSK--VTSSVVPKPTRVEAASALIWKCKIEASSRSSSNTLGTSLIRPSV  282

Query  923   LSCMVNLRRRMEPPLPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDG  744
              S  VN+R+   P LP N +G +++ +      +++  TV+    LV +IR      K+ 
Sbjct  283   FSLSVNMRKMAVPLLPENLVGNILEFSTTNYSHSEENSTVIDLKGLVAKIRGGLEETKER  342

Query  743   EARKVYGEG--GWLRAVIARGY-ELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVVNM  573
              A  V  +    W R    + Y  L++N D      SS CR  +YE DFGWGKP  V  +
Sbjct  343   CAAVVVFDSNEAWQR---TKWYMNLMKNDDMDKFICSSWCRFPFYEADFGWGKPSWVSYV  399

Query  572   ---LDNSWVLFLDAINGAVEVWMKLPKQVMHTLTQDRHFLAYVSAFPK  438
                ++N  VL     +  +E W+ L ++ M     ++  L Y S  P+
Sbjct  400   AVAINNITVLMNKRDDNGIEAWVTLSQENMALFESNKELLEYASLNPR  447



>ref|XP_011042323.1| PREDICTED: vinorine synthase-like [Populus euphratica]
Length=430

 Score =   210 bits (534),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 150/448 (33%), Positives = 243/448 (54%), Gaps = 36/448 (8%)
 Frame = -2

Query  1757  ITMKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGACHHTKT  1578
             + +++EV S EI +PSSPTP  L++Y+LSFLDQ+      P + FY +       ++ + 
Sbjct  1     MKIEIEVISNEIIKPSSPTPDHLRHYQLSFLDQISPPTYNPMLLFYPADG-DVKINNIEK  59

Query  1577  IDElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEMEKIK  1398
             ++++K+SLS+ L+L +PLAGR+K D + +EC+DEG+ F  A+V   +  ++E+PE  ++ 
Sbjct  60    LNQIKQSLSEVLNLYHPLAGRIK-DNLFVECNDEGIPFFQAEVKCRLPQVVEDPEPSELN  118

Query  1397  QLIPSA-KVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNR  1221
             +LIP A    E  P+G     +Q N F CGGI IG  +SH + DAS+L  F++ WA+  R
Sbjct  119   KLIPFALDDAEELPLG-----IQYNIFECGGIVIGLCISHKVGDASSLFTFIKYWAATAR  173

Query  1220  GCAAN-NGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIA  1044
             G A + +   F+   S+ LFPP+ + S  +      + GI +E  D++ KRFV  +++I 
Sbjct  174   GEADHISRPEFI---SATLFPPI-NISGFKP-----STGITKE--DVVTKRFVFRSSSIE  222

Query  1043  QLRQDLTITGGSVQR---PSRVEALTALVW-----AAVINATPTQTATLSCMVNLRRRME  888
              L++  +   GS++    PSRVEAL+  +W     A  + + P +  ++   VNLR RME
Sbjct  223   LLKEKCSTASGSLENQRPPSRVEALSVFIWQRFTAATKVESRPERIYSMVHAVNLRPRME  282

Query  887   PPLPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWL  708
             PPLP    G     A  +   + D G       LV +IRD+   +     +K+      L
Sbjct  283   PPLPEYSFGNYYRIAFTI--PSIDTGE--ENYNLVSQIRDSIGKIDKEYVKKLQKGSQHL  338

Query  707   RAVIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLV--VNMLDNSWVLFLDAIN  534
               +  +    ++    S  +T SLCR   YE DFGW KP  V   ++   + V+F+D  +
Sbjct  339   GFIKEQAARFLKGEVVSLNFT-SLCRFPLYEADFGWAKPIWVGSPSLTFKNLVVFMDTAS  397

Query  533   G-AVEVWMKLPKQVMHTLTQDRHFLAYV  453
             G  +E  + L ++ M    +D   L Y+
Sbjct  398   GDGIEALVHLKEEDMAKFQEDEELLQYI  425



>ref|XP_008340164.1| PREDICTED: vinorine synthase-like [Malus domestica]
Length=435

 Score =   210 bits (534),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 154/454 (34%), Positives = 237/454 (52%), Gaps = 36/454 (8%)
 Frame = -2

Query  1757  ITMKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGACHHTKT  1578
             + MK+E+ S++  +PSSPTP  LK YKLS LDQ+      P V FY +   S     T  
Sbjct  1     MQMKIEIVSEDQCKPSSPTPDHLKXYKLSLLDQIAPIFYVPVVLFYSA---SVNIDDTTI  57

Query  1577  IDElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEMEKIK  1398
             +D LKKSLS+TL+  YPLAGR+ E   +++C+D  V F  A     +S +L+ PEM+ ++
Sbjct  58    VDRLKKSLSETLTCFYPLAGRI-EGNASVDCEDGVVVFTKARAHIQLSEILKTPEMDLVQ  116

Query  1397  QLIPSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRG  1218
             QL+P            A +AVQ+N F CGG+ IG  +SH IAD + L+ F++ WA+ +RG
Sbjct  117   QLLPLDPYNIRTDKXVAAMAVQLNXFDCGGMGIGICLSHKIADGATLSSFLDAWATRSRG  176

Query  1217  CAANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQL  1038
              + N        +S+ +FPP       ++ + M    I++E  +++ KRFV  A+++A+L
Sbjct  177   ISENITPSL---NSATMFPPR------DKEIFMPTNLIKRE--NIVTKRFVFDASSLAKL  225

Query  1037  RQDLTITGGSVQR-PSRVEALTALVWAAVINATPTQTATL---------SCMVNLRRRME  888
             +   +    +  R P+RVEALTAL+  + +N   T+  TL         S +VNLR R  
Sbjct  226   KVKASKGLCTDDRAPTRVEALTALICKSSMN---TKNGTLGKGRPSMAISHVVNLRERXA  282

Query  887   PPLPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWL  708
             PPLP +  G +   A+      +    +    +   R+R   R + D   RK+ GE G+ 
Sbjct  283   PPLPEHSFGNIWRFAVASIMNDESNPEL---HDFXVRLRKVIRKIDDDYVRKLQGEDGFT  339

Query  707   RAV--IARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPR--LVVNMLDNSWVLFLDA  540
              A   +    ELV   +      SS  R + Y  DFGWGKP    + N+   + V+ L +
Sbjct  340   HACEPLKETSELVSEGEVEFFRFSSWIRFSLYNTDFGWGKPTWACIPNVPIKNVVILLSS  399

Query  539   ING-AVEVWMKLPKQVMHTLTQDRHFLAYVSAFP  441
              +G  +E W+ L ++ M    +D   L +VS  P
Sbjct  400   SSGDGIEAWVTLDEEDMAKFERDHELLEFVSVAP  433



>ref|XP_002315639.2| transferase family protein [Populus trichocarpa]
 gb|EEF01810.2| transferase family protein [Populus trichocarpa]
Length=430

 Score =   210 bits (534),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 155/451 (34%), Positives = 243/451 (54%), Gaps = 42/451 (9%)
 Frame = -2

Query  1757  ITMKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGACHHTKT  1578
             + +++EV S EI +PSSPTP  L +Y+LSFLDQ+      P + FY +       ++ + 
Sbjct  1     MKIEIEVISNEIIKPSSPTPDHLCHYQLSFLDQISPPTYNPLLLFYPADG-DVKINNIEK  59

Query  1577  IDElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEMEKIK  1398
              ++LK+SLS+ L+L YPLAGR+K D + +EC+DEG+ F  A+V   +  ++ENPE  ++ 
Sbjct  60    PNQLKQSLSEVLNLYYPLAGRIK-DNLFVECNDEGIPFFQAEVKCRLPQVVENPEPSELN  118

Query  1397  QLIPSA-KVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNR  1221
             +LIP A    E  P+G     +Q N F CGGI IG  +SH + DAS+L  F++ WA+  R
Sbjct  119   KLIPFALDDAEELPLG-----IQYNIFECGGIVIGLCISHKVGDASSLFTFIKYWAATAR  173

Query  1220  GCAAN-NGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIA  1044
             G A + +   F+   S+ LFPP+ + S  +      A GI +E  D++ KRFV  +++I 
Sbjct  174   GEADHISRPDFI---SATLFPPI-NISGFKP-----ATGITKE--DVVTKRFVFRSSSIE  222

Query  1043  QLRQDLTITGGSVQR---PSRVEALTALVW-----AAVINATPTQTATLSCMVNLRRRME  888
              L++  +   GS++    PSRVEAL+  +W     A+ + + P +  ++   VNLR RME
Sbjct  223   LLKEKCSPASGSLENQRPPSRVEALSVFIWQRFTAASKVESRPERIYSMVHAVNLRSRME  282

Query  887   PPLPPNCLGTLVDEAIVLCQEAKDGGTVVTAVE---LVQRIRDAFRAVKDGEARKVYGEG  717
             PPLP    G         C+ A    ++ T  E   L  +IRD+   V     +K+    
Sbjct  283   PPLPEYSFGN-------YCRIAFTIPSIDTGEENYNLASQIRDSIGKVDKEYVKKLQKGN  335

Query  716   GWLRAVIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLV--VNMLDNSWVLFLD  543
               L  +  +    +R  +   L  +SLCR   YE DFGW KP  V   ++   + V+F+D
Sbjct  336   EHLGFMKEQAARFLRG-EVVPLNFTSLCRFPLYEADFGWAKPIWVGSPSLTFKNLVVFMD  394

Query  542   AING-AVEVWMKLPKQVMHTLTQDRHFLAYV  453
               +G  +E  + L ++ M    +D   L Y+
Sbjct  395   TASGDGIEALVHLKEEDMAKFQEDEELLQYI  425



>ref|XP_011071181.1| PREDICTED: vinorine synthase-like isoform X1 [Sesamum indicum]
 ref|XP_011071182.1| PREDICTED: vinorine synthase-like isoform X2 [Sesamum indicum]
Length=422

 Score =   209 bits (532),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 151/446 (34%), Positives = 232/446 (52%), Gaps = 49/446 (11%)
 Frame = -2

Query  1757  ITMKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFY------DSPTISGA  1596
             + +++EV S E  +PSSPTP++L+ Y+LSFLDQ+   +  P V+FY       SP  S  
Sbjct  1     MEIEIEVVSNETIKPSSPTPESLRKYQLSFLDQIAPPIFMPLVYFYPADAKFSSPEKSN-  59

Query  1595  CHHTKTIDElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENP  1416
              H  K++ +        LS  YPLAG++ +D + ++C+DEG  ++ A    ++S ++ NP
Sbjct  60    -HLKKSLSQ-------VLSRFYPLAGQLIDD-LYVDCNDEGAPYVEAVANCSLSQVVTNP  110

Query  1415  EMEKIKQLIPSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIW  1236
               + + + +P  KV E Q +G   +AVQV  F CGG A+G  +SH IADA +L      W
Sbjct  111   IPKNMDKFLPY-KVDEVQNLG---MAVQVTYFQCGGTAVGVLISHKIADALSLFLVANTW  166

Query  1235  ASFNRGCAANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPA  1056
             A+  R    ++      + + I FPP  D +  +      + GI +E+  ++ K F  PA
Sbjct  167   AAVARNGNYDDVPSPKFEGAKI-FPP-RDAAGFKP-----STGIVKEQ--LVTKIFTFPA  217

Query  1055  NAIAQLRQDLTITGGSVQ----RPSRVEALTALVWAAVINAT-----PTQTATLSCMVNL  903
             + I+ L++    +GG+ +    RPSRVEAL+A +W   I+AT     P +  T+   VNL
Sbjct  218   SKISALQE--RYSGGTAELPQRRPSRVEALSAFIWTRFISATQMKADPNKIYTVHHAVNL  275

Query  902   RRRMEPPLPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYG  723
             R R++PPL     G +   AI +     DGG+     EL+Q++R+A RAV DGE      
Sbjct  276   RTRLDPPLSEYHFGNISRLAIAMPSVGVDGGS-----ELLQKVREAIRAV-DGEYVAQLR  329

Query  722   EGGWLRAVIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLV--VNMLDNSWVLF  549
             +G      +          +  T   +SLCR   YE DFGWGKP  V    ++  + V F
Sbjct  330   QGDKHLNFLKERMAQANKGELVTFNFTSLCRFPLYEADFGWGKPVWVGSAGLVYKNLVTF  389

Query  548   LDAING-AVEVWMKLPKQVMHTLTQD  474
             +D   G  +E W+ L K+ M     D
Sbjct  390   IDTAAGNGIEAWINLKKEDMEKFEAD  415



>gb|KDP36802.1| hypothetical protein JCGZ_08093 [Jatropha curcas]
Length=450

 Score =   210 bits (534),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 152/463 (33%), Positives = 237/463 (51%), Gaps = 47/463 (10%)
 Frame = -2

Query  1751  MKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGACHH--TKT  1578
             M+V++ SKE  +PSSPTP  LK +KLS LDQ   +   P V FY  P I    H   +  
Sbjct  1     MEVQIISKENVKPSSPTPPHLKIFKLSLLDQFMPSPYAPIVLFY--PMIKNTNHLDVSSK  58

Query  1577  IDElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEMEKIK  1398
             +  LK+SLS+TL+  YPLAG +K+D ++IEC+D+G  F+ A V   +   L  P++  I 
Sbjct  59    LKLLKESLSQTLTCFYPLAGIIKDD-LSIECNDKGANFVEARVTCRLHEFLAQPDLMLIN  117

Query  1397  QLIPSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRG  1218
             + +P   V     VG  +  +Q N F C GIAIG  +SH I D  AL+ F++ W   +RG
Sbjct  118   KFLPCQFVVNKSTVGAFVTNIQANIFDCDGIAIGICISHKILDGDALSTFLKGWTYASRG  177

Query  1217  CAANNGSGFVSDHSSILFPP----LTDTSAI--EQLMKMGAEGIEQEEKDMIVKRFVIPA  1056
             C       FV   +S LFP     L ++SA+    L++ G         + I +RFV  +
Sbjct  178   CNEAIYPKFV---ASFLFPANDLWLKNSSAVMWSSLLRKG---------NCITRRFVFDS  225

Query  1055  NAIAQLRQDLTITGGSVQRPSRVEALTALVWAAVINATPT-----QTATLSCMVNLRRRM  891
             +AI +L+     +G  +Q P+RVE ++A +W ++++A+       + + L+ +VNLRRRM
Sbjct  226   SAIEKLKAQANSSG--LQCPTRVETVSAFLWKSIMSASAKVNGFQKPSLLTHIVNLRRRM  283

Query  890   EPPLPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGW  711
             EP L  N LG  +   I   Q   +    ++  +LV ++++A   + +   +K+ GE   
Sbjct  284   EPSLSENSLGNFL--WIAAAQYTDEAKPKLS--DLVSKVKEAISRIDEEFVKKIKGEEE-  338

Query  710   LRAVIARGYELVRNRDS-----STLYTSSLCRMAYYEVDFGWGKPRLVVNM------LDN  564
               +V++   + +   DS          SS C+  YY+ DFGWGKP  + +M        N
Sbjct  339   -NSVLSESLKEIGEMDSYKNGRDCFGFSSWCKFGYYDADFGWGKPVWISSMGLEGSVFMN  397

Query  563   SWVLFLDAINGAVEVWMKLPKQVMHTLTQDRHFLAYVSAFPKP  435
               +L        +E W+ L +Q M  L  ++  L   S  P P
Sbjct  398   LIILVETRFGDGIEAWLTLDEQEMAILEGNQDLLKLASLNPSP  440



>ref|XP_002511244.1| Anthranilate N-benzoyltransferase protein, putative [Ricinus 
communis]
 gb|EEF51846.1| Anthranilate N-benzoyltransferase protein, putative [Ricinus 
communis]
Length=445

 Score =   209 bits (533),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 153/449 (34%), Positives = 228/449 (51%), Gaps = 31/449 (7%)
 Frame = -2

Query  1754  TMKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGACHHTKTI  1575
             ++ V V S+E  +PSSPTPQTLK +KLS LDQL      P + +Y S +      + + +
Sbjct  3     SVNVLVTSRETIKPSSPTPQTLKCFKLSLLDQLSPAAYVPMIIYYASNSELDEVKNQERL  62

Query  1574  DElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEMEKIKQ  1395
             D LKKSLS+TL+  YPLAGRVKE+ + IEC+D+GV+F  A V   +S +L  PE + + Q
Sbjct  63    DLLKKSLSRTLTQFYPLAGRVKEN-LFIECNDQGVDFFEARVNCPLSEILRRPEADVLNQ  121

Query  1394  LIPSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGC  1215
              +P           +  VA+QVN F+CGGIAIG  +SH + D      FM  WAS  RG 
Sbjct  122   FLPHEYHVPAASSMEFQVAIQVNTFTCGGIAIGTSISHKLVDGITFTCFMNNWASIARGS  181

Query  1214  AANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQLR  1035
               ++   FV  H    FPP  D S +  ++ +        +   I KRF+   + +A LR
Sbjct  182   DEHSPPVFVGPH---FFPP-KDLSGLFPVLDI-------PQAKNITKRFLFDLSKVASLR  230

Query  1034  QDLTITGGSVQRPSRVEALTALVWAAVINATPTQTATLSC---------MVNLRRRMEPP  882
             + +    GS   PSRVE ++AL+W   ++A+     +  C          VNLR RM PP
Sbjct  231   ERVFGGSGS-NAPSRVEIVSALIWKYAMDASSRAKPSSGCNKSPSFLTQTVNLRARMNPP  289

Query  881   LPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGW--L  708
             LP +  G  +    ++   A      +   ELV +++++F+       +K+ GE G   L
Sbjct  290   LPDSAAGNFI---WLIIAPAPSDFKKIELHELVYQVQNSFKNFNSEFVKKIQGEAGLLVL  346

Query  707   RAVIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVVN---MLDNSWVLFLDAI  537
                + +  ELV +R+      +SL +   YE DFGWG P  V +      N  VL     
Sbjct  347   GETLDQIGELV-SRNVDIYRFTSLRKFQLYEADFGWGVPAWVSSAGLAFKNVVVLIETRD  405

Query  536   NGAVEVWMKLPKQVMHTLTQDRHFLAYVS  450
                +E W+ L ++VM     ++  L++ S
Sbjct  406   ADRIEAWITLEEEVMAIFEHNQELLSFDS  434



>gb|KDP26742.1| hypothetical protein JCGZ_17900 [Jatropha curcas]
Length=438

 Score =   209 bits (532),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 154/453 (34%), Positives = 230/453 (51%), Gaps = 42/453 (9%)
 Frame = -2

Query  1748  KVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGACHHTKTIDE  1569
             K+ V + E  RPSSPTP  LK  KLS +DQ      T  V FY   +++   H    I +
Sbjct  6     KIRVINTETIRPSSPTPSDLKTLKLSLMDQFVPATYTSLVLFY---SLNNNTHTNTEILQ  62

Query  1568  lkkslsktlsL--MYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEMEKIKQ  1395
               K+          +PLAGR+K D  +IEC+DEG EFI A +  ++S +LE P+ E +KQ
Sbjct  63    KLKTSLSETLTHHFFPLAGRIK-DNSSIECNDEGAEFIEARINCSLSDILEKPDTEFLKQ  121

Query  1394  LIPSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGC  1215
             L+P+A +  P+     L+ VQ N F CGG+A+G  VSH IADA+ L  F+  WA+     
Sbjct  122   LLPAA-IESPEAATGNLLLVQANFFDCGGLALGVCVSHKIADAATLTIFINCWAAMASRS  180

Query  1214  AANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQLR  1035
                  S F    S  LFPP+ D S     +++ A      +++ I KRFV   + IA L+
Sbjct  181   NKVVDSPFFMGAS--LFPPI-DISIPNASLELVA------QQNCITKRFVFTESKIAALK  231

Query  1034  QDLTITGGSVQRPSRVEALTALVWAAVINATPTQTA----TLSCM-VNLRRRMEPPLPP-  873
               +  T   V  P+RVEA++ L+W AVI    ++      ++ CM VNLR R  P LP  
Sbjct  232   AKVAST--RVPEPTRVEAVSGLIWKAVITTVRSKLGVSRKSVLCMAVNLRSRFVPKLPEN  289

Query  872   ---NCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLR-  705
                NC+G++V    +         +V+ AVELV +IR       +   +++  EGG L  
Sbjct  290   YAGNCVGSIVPRLDI-------ASSVIDAVELVGKIRKEMEEFGENYVKRLQ-EGGSLAI  341

Query  704   -AVIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLV---VNMLDNSWVLFLDAI  537
                  +  ++  ++D      SS C+   Y  DFGWGKP  +   +  + N  VL +D  
Sbjct  342   CGFTKQFGDMAMSKDIDFYVCSSWCKYDLYGADFGWGKPIWLCTAITTIRNVAVL-VDTR  400

Query  536   NG-AVEVWMKLPKQVMHTLTQDRHFLAYVSAFP  441
             +G  +EVW+ L ++ M  L  ++  L + +  P
Sbjct  401   DGLGIEVWLTLTEEEMALLESNQELLQFAALNP  433



>ref|XP_011071304.1| PREDICTED: vinorine synthase-like [Sesamum indicum]
Length=433

 Score =   208 bits (530),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 160/454 (35%), Positives = 245/454 (54%), Gaps = 49/454 (11%)
 Frame = -2

Query  1757  ITMKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGACHHTKT  1578
             + +++EV S E  +PSSPTP++L+ Y+LSFLDQ+      P V+FY  P  +   +  K+
Sbjct  1     MEIEIEVISNETIKPSSPTPESLRKYQLSFLDQIAPPTFMPLVYFY--PADAKFSNPEKS  58

Query  1577  IDElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEMEKIK  1398
              + LKKSLS+ LS  YPLAGR+ +D + ++C++EG  ++ A    ++S ++ NP  + + 
Sbjct  59    -NHLKKSLSQVLSRFYPLAGRLIDD-LYVDCNNEGAPYVEAVANCSLSQVVTNPIPKNMN  116

Query  1397  QLIPSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRG  1218
             + +P  KV E Q +G   +AVQV  F CGG A+G  +SH IADA +       WA+  R 
Sbjct  117   KFLPY-KVDEVQNLG---MAVQVTYFQCGGTAVGLLISHKIADALSFFLVANTWAAIARN  172

Query  1217  CAANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQL  1038
                ++  G   + + I FPP  D +  +      + GI +EE  ++ K F  PA+ I+ L
Sbjct  173   GNYDDVPGPKFEGAKI-FPP-RDAAGFKP-----STGIVKEE--LVTKIFTFPASRISAL  223

Query  1037  RQDLTITGGSVQ----RPSRVEALTALVWAAVINAT-----PTQTATLSCMVNLRRRMEP  885
             ++    +GG+ +    RPSRVEAL+A +W   I+AT     P +  T+   VNLR R++P
Sbjct  224   QE--RYSGGAAELPQRRPSRVEALSAFLWTRFISATQMKADPNKIYTVLHAVNLRTRLDP  281

Query  884   PLPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEG----  717
             PL     G +   AI +     DGG+     EL+Q++R+A RAV DGE      +G    
Sbjct  282   PLSEYHFGNISRLAIAMPSVGVDGGS-----ELLQKVREAIRAV-DGEYVAQLRQGDKHL  335

Query  716   GWLRAVIARGY--ELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLV--VNMLDNSWVLF  549
              +L+  +A+    ELV      T   +SLCR   YE DFGWGKP       ++  + V F
Sbjct  336   NFLKERMAQANKGELV------TFNFTSLCRFPLYEADFGWGKPVWAGSAGLVYKNLVTF  389

Query  548   LDAING-AVEVWMKLPKQVMHTLTQDRHFLAYVS  450
             +D   G  +E W+ L K+ M     D     ++S
Sbjct  390   IDTATGNGIEAWINLRKEDMEKFEADLELQEFLS  423



>ref|XP_008222087.1| PREDICTED: vinorine synthase-like [Prunus mume]
Length=442

 Score =   208 bits (530),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 154/453 (34%), Positives = 243/453 (54%), Gaps = 36/453 (8%)
 Frame = -2

Query  1757  ITMKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGACHHTKT  1578
             + ++VEV SKEI +PSSPTP  L++Y+ SFLDQ+   +  P + FY+        + T+ 
Sbjct  1     MKVEVEVISKEIIKPSSPTPDHLRHYQFSFLDQIAPQVYNPLLLFYEH-NAKTQPNSTEI  59

Query  1577  IDElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAE-NMSCLLENPEMEKI  1401
              + LK SL + L+L YPLAGR+K ++  I C+DEG+ F+ A V +  +S +L NP   ++
Sbjct  60    SNHLKNSLCEVLNLFYPLAGRIKNNQF-IHCNDEGIPFVEARVLDCTLSDVLSNPIPGEL  118

Query  1400  KQLIPSAKVYEPQPVGKAL-VAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFN  1224
              + +P    +E   +  +L + VQ+N F CGG AIG  +SH IAD  +   F +IWA+  
Sbjct  119   NKFMP----FELDDITNSLPLGVQLNIFQCGGFAIGQCISHKIADGLSYFMFSKIWAAIA  174

Query  1223  RGCAAN-NGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAI  1047
             RG  AN N   FV   SS LFPP        +   +G +G     KD + KRFV  A+ I
Sbjct  175   RGDQANINPPKFV---SSTLFPP--------KEFNIGFDGSVGITKDRVTKRFVFAASQI  223

Query  1046  AQLRQDLTITGGSV-QRPSRVEALTALVWAAVINATPTQTATLSCM------VNLRRRME  888
               LR+    +  ++ +RP+RVE L+  +W+  +    T+ +TL+ +      VNLR R +
Sbjct  224   ENLRERYEQSMHNMKKRPTRVETLSTFLWSRFVAV--TKDSTLNKLYRVIHAVNLRPRFD  281

Query  887   PPLPPNCLGTLVDEAIVL-CQEAKDGGTVVTAVE--LVQRIRDAFRAVKDGEARKVYGEG  717
             PPLP +  G L   AI    Q    GG+        ++  +R+A   + +   +K+  +G
Sbjct  282   PPLPQSFFGNLFRLAITAPLQIPSSGGSDEECGHGVVIPVVREAIDNIDNEYVKKLQKQG  341

Query  716   GWLRAVIARGYELVRNRDSSTLYT-SSLCRMAYYEVDFGWGKPRLVVN--MLDNSWVLFL  546
                  V+ +  +  +  + +TL + SS CR   Y+ DFGWG+P  V +  +   + VLF+
Sbjct  342   DEHLGVMKKQADSFKRGEMATLLSFSSYCRFPLYDNDFGWGRPTWVGSPALTYKNLVLFM  401

Query  545   DAI-NGAVEVWMKLPKQVMHTLTQDRHFLAYVS  450
             D    G +E ++ L ++VM     D   L+YV+
Sbjct  402   DTKEGGGIEAYVSLEEEVMAKFECDGELLSYVA  434



>emb|CDY39174.1| BnaC09g21700D [Brassica napus]
Length=459

 Score =   208 bits (530),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 157/456 (34%), Positives = 237/456 (52%), Gaps = 39/456 (9%)
 Frame = -2

Query  1757  ITMKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGACHHTKT  1578
             +T +VEV S++I +PSSPTP  LKN+KLS L+QL   +  P +FFY +   +     T+ 
Sbjct  16    LTRRVEVISRDIIKPSSPTPNHLKNFKLSLLEQLGPTIFGPMLFFYSA---NNRIKQTEQ  72

Query  1577  IDElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEMEKIK  1398
             +  LKKSLS+TL+  YPLAGR+  + ++I C+D G +F+ A V   +S LL+ P  E ++
Sbjct  73    LQNLKKSLSETLTHFYPLAGRLNGN-ISINCNDSGADFLEAQVNSPLSNLLQEPSSEVLE  131

Query  1397  QLIPSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASF-NR  1221
             QLIP++ V   +   K L+A Q   F CGG+AIG  VSH +ADA+++  FM+ W++  +R
Sbjct  132   QLIPTS-VDSTEARTKLLLA-QATFFKCGGMAIGVCVSHKLADATSVGLFMKSWSAISSR  189

Query  1220  GCAANNGSGFVSDHSSILFPP--LTDTS---AIEQLMKMGAEGIEQEEKDMIVKRFVIPA  1056
             G     GS  V D   I FPP   ++TS    +E  +KM            + KRFV  +
Sbjct  190   GTIKTVGSP-VFDTLKI-FPPGNFSETSPAPVVEPEIKMN---------QTLSKRFVFDS  238

Query  1055  NAIAQLRQDLTITGGSVQRPSRVEALTALVWAAVINATPTQTAT-----LSCMVNLRRRM  891
              +I  L+     +   V +P+RVEA++A +W   + AT T + T     L+   +LR R+
Sbjct  239   WSIEALQAK--ASSFEVSQPTRVEAVSAFIWKLAMKATRTVSRTSKPSILANSASLRSRV  296

Query  890   EPPLPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGW  711
              PP   N +G LV       +E +    + T V  ++R +  FR   D    K+ G G  
Sbjct  297   SPPFTKNSIGNLVSYFAAKAEEGEKQRKLQTLVAEIRRAKQRFR---DDHIPKLVGNGDA  353

Query  710   LRAVIARGYE---LVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVV--NMLDNSWVLFL  546
                +     E   ++ +        +S CR   YE+DFGWGKP      ++   + V  L
Sbjct  354   TEVICNHQKEAGDMIASGGFDFYILTSACRFGLYEIDFGWGKPVWFAFPSVRQKNIVALL  413

Query  545   DAI-NGAVEVWMKLPKQVMHTLTQDRHFLAYVSAFP  441
             D    G +E W+ L +Q M    +DR  L + S  P
Sbjct  414   DTKEGGGIEAWVNLNEQEMKLFEEDRELLDFASVNP  449



>dbj|BAB01067.1| acetyltranferase-like protein [Arabidopsis thaliana]
Length=455

 Score =   208 bits (529),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 155/453 (34%), Positives = 240/453 (53%), Gaps = 37/453 (8%)
 Frame = -2

Query  1751  MKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGACHHTKTID  1572
             M+V+V S++I +PSSPTP  LK +KLS L+QL   +  P VFFY +   + +   T+ + 
Sbjct  14    MRVDVVSRDIIKPSSPTPNHLKKFKLSLLEQLGPTIFGPMVFFYSA---NNSIKPTEQLQ  70

Query  1571  ElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEMEKIKQL  1392
              LKKSLS+TL+  YPLAGR+K + ++I+C+D G +F+ A V   +S LL  P  + ++QL
Sbjct  71    MLKKSLSETLTHFYPLAGRLKGN-ISIDCNDSGADFLEARVNSPLSNLLLEPSSDSLQQL  129

Query  1391  IPSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASF-NRGC  1215
             IP++   +       L+  Q + F CG ++IG  +SH +ADA+++  FM+ WA+  +RG 
Sbjct  130   IPTS--VDSIETRTRLLLAQASFFECGSMSIGVCISHKLADATSIGLFMKSWAAISSRGS  187

Query  1214  AANNGSGFVSDHSSILFPP--LTDTSAIEQLMKMGAEGIEQE--EKDMIVKRFVIPANAI  1047
                 G+  V D   I FPP   ++TS         A  +E E      + KRF+  +++I
Sbjct  188   IKTIGAP-VFDTVKI-FPPGNFSETSP--------APVVEPEIMMNQTLSKRFIFDSSSI  237

Query  1046  AQLRQDLTITGGSVQRPSRVEALTALVWAAVINATPTQTAT-----LSCMVNLRRRMEPP  882
               L+     +   V +P+RVEA++AL+W + + AT T + T     L+  V+LR R+ PP
Sbjct  238   QALQAK--ASSFEVNQPTRVEAVSALIWKSAMKATRTVSGTSKPSILANSVSLRSRVSPP  295

Query  881   LPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLRA  702
                N +G LV        +A++G        LV +IR A +  +D    K+ G       
Sbjct  296   FTKNSIGNLVS---YFAAKAEEGINQTKLQTLVSKIRKAKQRFRDIHIPKLVGNPNATEI  352

Query  701   VIARGYE---LVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLV--VNMLDNSWVLFLDAI  537
             + +   E   ++ + D      SS CR   YE DFGWGKP  V   ++   + V  LD  
Sbjct  353   ICSYQKEAGDMIASGDFDFYIFSSACRFGLYETDFGWGKPVWVGFPSVRQKNIVTLLDTK  412

Query  536   N-GAVEVWMKLPKQVMHTLTQDRHFLAYVSAFP  441
               G +E W+ L +Q M+   QDR  L + S  P
Sbjct  413   EAGGIEAWVNLNEQEMNLFEQDRELLQFASLNP  445



>ref|NP_189233.1| HXXXD-type acyl-transferase-like protein [Arabidopsis thaliana]
 gb|AEE77107.1| HXXXD-type acyl-transferase-like protein [Arabidopsis thaliana]
Length=442

 Score =   207 bits (528),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 155/453 (34%), Positives = 240/453 (53%), Gaps = 37/453 (8%)
 Frame = -2

Query  1751  MKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGACHHTKTID  1572
             M+V+V S++I +PSSPTP  LK +KLS L+QL   +  P VFFY +   + +   T+ + 
Sbjct  1     MRVDVVSRDIIKPSSPTPNHLKKFKLSLLEQLGPTIFGPMVFFYSA---NNSIKPTEQLQ  57

Query  1571  ElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEMEKIKQL  1392
              LKKSLS+TL+  YPLAGR+K + ++I+C+D G +F+ A V   +S LL  P  + ++QL
Sbjct  58    MLKKSLSETLTHFYPLAGRLKGN-ISIDCNDSGADFLEARVNSPLSNLLLEPSSDSLQQL  116

Query  1391  IPSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASF-NRGC  1215
             IP++   +       L+  Q + F CG ++IG  +SH +ADA+++  FM+ WA+  +RG 
Sbjct  117   IPTS--VDSIETRTRLLLAQASFFECGSMSIGVCISHKLADATSIGLFMKSWAAISSRGS  174

Query  1214  AANNGSGFVSDHSSILFPP--LTDTSAIEQLMKMGAEGIEQE--EKDMIVKRFVIPANAI  1047
                 G+  V D   I FPP   ++TS         A  +E E      + KRF+  +++I
Sbjct  175   IKTIGAP-VFDTVKI-FPPGNFSETSP--------APVVEPEIMMNQTLSKRFIFDSSSI  224

Query  1046  AQLRQDLTITGGSVQRPSRVEALTALVWAAVINATPTQTAT-----LSCMVNLRRRMEPP  882
               L+     +   V +P+RVEA++AL+W + + AT T + T     L+  V+LR R+ PP
Sbjct  225   QALQAK--ASSFEVNQPTRVEAVSALIWKSAMKATRTVSGTSKPSILANSVSLRSRVSPP  282

Query  881   LPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLRA  702
                N +G LV        +A++G        LV +IR A +  +D    K+ G       
Sbjct  283   FTKNSIGNLVS---YFAAKAEEGINQTKLQTLVSKIRKAKQRFRDIHIPKLVGNPNATEI  339

Query  701   VIARGYE---LVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLV--VNMLDNSWVLFLDAI  537
             + +   E   ++ + D      SS CR   YE DFGWGKP  V   ++   + V  LD  
Sbjct  340   ICSYQKEAGDMIASGDFDFYIFSSACRFGLYETDFGWGKPVWVGFPSVRQKNIVTLLDTK  399

Query  536   N-GAVEVWMKLPKQVMHTLTQDRHFLAYVSAFP  441
               G +E W+ L +Q M+   QDR  L + S  P
Sbjct  400   EAGGIEAWVNLNEQEMNLFEQDRELLQFASLNP  432



>ref|XP_002875299.1| transferase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH51558.1| transferase family protein [Arabidopsis lyrata subsp. lyrata]
Length=442

 Score =   207 bits (527),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 149/452 (33%), Positives = 235/452 (52%), Gaps = 35/452 (8%)
 Frame = -2

Query  1751  MKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGACHHTKTID  1572
             M+V+V S++I +PSSPTP  LK ++LS L+QL   +  P VFFY     +      + + 
Sbjct  1     MRVDVISRDIIKPSSPTPNHLKKFQLSLLEQLGPTIFGPMVFFYSG---NNRIKPAEQLQ  57

Query  1571  ElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEMEKIKQL  1392
             +LKKSLS+TL+  YPLAGR+K + ++I+C+D G +F+ A+V   +S LL+ P  + ++QL
Sbjct  58    KLKKSLSETLTHFYPLAGRLKGN-ISIDCNDSGADFLEAEVNSPLSSLLQEPSSDSLQQL  116

Query  1391  IPSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGCA  1212
             IP++   +       L   Q + F CG +AIG  +SH +ADA+++  FM+ WA+ +   +
Sbjct  117   IPTS--VDSIETRTRLFLAQASFFECGSMAIGVCISHKLADATSIGLFMKSWAAISSQGS  174

Query  1211  ANNGSGFVSDHSSILFPP--LTDTSAIEQLMKMGAEGIEQE--EKDMIVKRFVIPANAIA  1044
                  GF    ++ +FPP   ++TS         A  +E E      + KRFV  +++I 
Sbjct  175   IKT-VGFPVFDTAKIFPPGNFSETSP--------APVVEPEIMMNQTLSKRFVFDSSSIQ  225

Query  1043  QLRQDLTITGGSVQRPSRVEALTALVWAAVINATPTQTAT-----LSCMVNLRRRMEPPL  879
              L+     +   V +P+RVEA++AL+W   + AT T + T     L+   +LR R+ PP 
Sbjct  226   ALQAK--ASSFEVNQPTRVEAVSALIWKTAMKATRTVSGTSKPSILANSASLRSRVSPPF  283

Query  878   PPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLRAV  699
               N +G LV        +A++G        LV +IR A +  +D    K+ G       +
Sbjct  284   TKNSIGNLVS---YFAAKAEEGTNQTKLQTLVSKIRKAKQWFRDNHIPKLVGNPNATEII  340

Query  698   IARGYE---LVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLV--VNMLDNSWVLFLDAIN  534
              +   E   ++ + D      SS CR   Y+ DFGWGKP  V    +   + V  LD   
Sbjct  341   CSYQKEAGDMIASGDFDFYIFSSACRFGLYDTDFGWGKPVWVGIPTVRQKNIVTLLDTKE  400

Query  533   -GAVEVWMKLPKQVMHTLTQDRHFLAYVSAFP  441
              G +E W+ L +Q M+   QDR  L + S  P
Sbjct  401   AGGIEAWVNLYEQEMNLFEQDRELLQFASLNP  432



>gb|KDO41287.1| hypothetical protein CISIN_1g044243mg [Citrus sinensis]
Length=425

 Score =   206 bits (524),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 151/452 (33%), Positives = 228/452 (50%), Gaps = 44/452 (10%)
 Frame = -2

Query  1757  ITMKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFY---DSPTISGACHH  1587
             + + VE  S+E+ +PS+PTP  L++Y  S+LDQ    L    ++FY   D   +S   H 
Sbjct  1     MKISVETISREMIKPSTPTPNHLRHYHFSYLDQTAPPLYVSLLYFYHLDDHKLVSNNNH-  59

Query  1586  TKTIDElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLE---NP  1416
                I+ LK SLS  L+  YPLAGRVK + V  +C+DEGV F  A V    SCLL    N 
Sbjct  60    -LFINSLKSSLSNVLTKYYPLAGRVKNNYV--DCNDEGVVFSEAKV----SCLLSEIINE  112

Query  1415  EMEKIKQLIPSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIW  1236
                +  +L P  +  +   +    +A+QVN F+CG +AI   +SH IADAS+L  F + W
Sbjct  113   LPSEFNKLRPFDQEKDVVSINGLPIAIQVNMFNCGSVAIAVMISHKIADASSLITFTKNW  172

Query  1235  ASFNRGCAANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEG--IEQEEKDMIVKRFVI  1062
             A+  RG + N    F    ++ LFPP  D          G+ G  ++   K +++K+F+ 
Sbjct  173   AAAARGGSENVFPEFA---AARLFPP-KDAG--------GSSGVSVDPRPKKIVLKKFLF  220

Query  1061  PANAIAQLRQDLTITGGSVQRPSRVEALTALVWAAV-----INATPTQTATLSCMVNLRR  897
                 I  LR    +  G    P+RVEAL+A +W+ +     I  +P +   L  +VNLR+
Sbjct  221   EGPKITALRDKYGLDNGIY--PTRVEALSAFIWSRLAASTRIKISPERPYMLVHLVNLRK  278

Query  896   RMEPPLPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEG  717
             RMEPPLP +  G ++  A+ + +E  D         +V + RDA   V     + +  E 
Sbjct  279   RMEPPLPDDSFGNIIGAAVTVLEENDDDD------RMVNKFRDAICKVDKDYLKVMKLEH  332

Query  716   GWLRAVIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVV--NMLDNSWVLFLD  543
               L  ++    E+V   +    + SSLC+   YE DFG GKP  V    +   + +  +D
Sbjct  333   SELTDLVITNGEIVDRGELGYCFFSSLCKFPVYEADFGLGKPMWVAWGRLPYKNIIHLID  392

Query  542   AING-AVEVWMKLPKQVMHTLTQDRHFLAYVS  450
               +G  +E W+ L ++VM     D+  LAYVS
Sbjct  393   TKSGDGIEAWVHLEEEVMAKFGNDQELLAYVS  424



>ref|XP_008222015.1| PREDICTED: vinorine synthase-like [Prunus mume]
Length=442

 Score =   206 bits (525),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 153/458 (33%), Positives = 241/458 (53%), Gaps = 46/458 (10%)
 Frame = -2

Query  1757  ITMKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYD-----SPTISGAC  1593
             + ++VEV SKEI +PSSPTP  L++Y+ SFLDQ+   +  P + FY+      P  +   
Sbjct  1     MKVEVEVISKEIIKPSSPTPDHLRHYQFSFLDQIAPQVYNPLLLFYEHNAKTQPNSTEIS  60

Query  1592  HHTKTIDElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAE-NMSCLLENP  1416
             +H K       SL + L+L YPLAGR+K ++  I C+DEG+ F+ A V +  +S +L NP
Sbjct  61    NHLKN------SLCEVLNLFYPLAGRIKNNQF-IHCNDEGIPFVEARVLDCTLSDVLSNP  113

Query  1415  EMEKIKQLIPSAKVYEPQPVGKAL-VAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEI  1239
                ++ + +P    +E   +  +L + VQ+N F CGG AIG  +SH IAD  +   F +I
Sbjct  114   IPGELNKFMP----FELDDITNSLPLGVQLNIFQCGGFAIGQCISHKIADGLSYFMFSKI  169

Query  1238  WASFNRGCAAN-NGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVI  1062
             WA+  RG  AN N   FV   SS LFPP        +   +G +G     KD + KRFV 
Sbjct  170   WAAIARGDQANINPPKFV---SSTLFPP--------KEFNIGFDGSVGITKDRVTKRFVF  218

Query  1061  PANAIAQLRQDLTITGGSV-QRPSRVEALTALVWAAVINATPTQTATLSCM------VNL  903
              A+ I  LR+    +  ++ +RP+RVE L+  +W+  +    T+ +TL+ +      VNL
Sbjct  219   AASQIENLRERYEQSMHNMKKRPTRVETLSTFLWSRFVAV--TKDSTLNKLYRVIHAVNL  276

Query  902   RRRMEPPLPPNCLGTLVDEAIVL-CQEAKDGGTVVTAVE--LVQRIRDAFRAVKDGEARK  732
             R R +PPLP +  G L   AI    Q    GG+        ++  +R+A   + +   +K
Sbjct  277   RPRFDPPLPQSFFGNLFRLAITAPLQIPSSGGSDEECGHGMVIPVVREAIDNIDNEYVKK  336

Query  731   VYGEGGWLRAVIARGYELVRNRDSSTLYT-SSLCRMAYYEVDFGWGKPRLVVN--MLDNS  561
             +  +G     V+ +  +  +  + + L + SS CR   Y+ DFGWG+P  V +  +   +
Sbjct  337   LQKQGDEHLGVMKKQADSFKRGEMAKLLSFSSYCRFPLYDNDFGWGRPTWVGSPALTYKN  396

Query  560   WVLFLDAI-NGAVEVWMKLPKQVMHTLTQDRHFLAYVS  450
              VLF+D    G +E ++ L ++VM     D   L+YV+
Sbjct  397   IVLFMDTKEGGGIEAYVSLEEEVMAKFECDSELLSYVA  434



>ref|XP_006443123.1| hypothetical protein CICLE_v10024067mg [Citrus clementina]
 ref|XP_006478989.1| PREDICTED: vinorine synthase-like [Citrus sinensis]
 gb|ESR56363.1| hypothetical protein CICLE_v10024067mg [Citrus clementina]
Length=447

 Score =   206 bits (525),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 153/460 (33%), Positives = 228/460 (50%), Gaps = 43/460 (9%)
 Frame = -2

Query  1751  MKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGACHHTKTID  1572
             M++ + SK+I +PSSPTP  LK +KLS LDQL  ++ T  +FFY+ P+      +T T +
Sbjct  1     MQLRIISKKIIKPSSPTPLHLKTHKLSLLDQLAPDIYTSLLFFYNGPSRVYDETNTSTNN  60

Query  1571  ---ElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFI--VADVAENMSCLLENPEME  1407
                 LK SLSKTL+L YP AG++ +D   ++CDD G+ F+      + +MS +L+NPEM 
Sbjct  61    VYHRLKSSLSKTLTLYYPFAGKLLQDNYVVDCDDSGIPFVETRGPSSISMSEVLKNPEMN  120

Query  1406  KIKQLIPSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASF  1227
              ++QL+P     +         AVQ+N F CGG+AIG    H +AD +A   F++ WA  
Sbjct  121   TLQQLLPFNPNKKYLSTDDVNAAVQINHFDCGGVAIGLNFRHIVADGAASVGFIQNWAKL  180

Query  1226  NRGCAANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEK--DMIVKRFVIPAN  1053
             +   ++++ S     H+ +     TDT    Q +   A  I +  +  + + KRFV    
Sbjct  181   H---SSDDNSIINYKHAVV---DCTDTFPSNQEISSYARRIIEWHRAPECVTKRFVFDGG  234

Query  1052  AIAQLRQDLTITGGSVQ----RPSRVEALTALVWAAVINATPTQTATLSCM----VNLRR  897
              +A LR ++     S+     RP+R EA++ L+W A+I     +    +C+    VNLR 
Sbjct  235   KVAALRGEIIKKDASLSLNQYRPTRFEAVSGLIWDALIAMDREENVGSTCIASVPVNLRN  294

Query  896   RMEPPLPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEG  717
             RM PPLP +C+G L     V C   K            + I    + V D   RKVY +G
Sbjct  295   RMNPPLPEDCIGNLYHA--VTCTTNKTSA---------RNINQFTKMVNDDFVRKVYQDG  343

Query  716   GWLRAVIARGY-----ELVRNRDSSTLYT-SSLCRMAYYEVDFGWGKP--RLVVNMLDNS  561
             G    V    Y     E+++  +   L+  + +  + +YE DFGWGKP        L+N 
Sbjct  344   G---IVFVNQYKEAVEEILKGDNGVRLFGFTGVIGLPFYEPDFGWGKPVWSTTAMSLNNI  400

Query  560   WVLFLDAINGAVEVWMKLPKQVMHTLTQDRHFLAYVSAFP  441
              VL        VE W+ LP   M    QD   L Y S  P
Sbjct  401   AVLLGTRDGKGVEAWVGLPINDMPKFEQDPGILTYASFIP  440



>ref|XP_008389833.1| PREDICTED: vinorine synthase-like [Malus domestica]
Length=443

 Score =   206 bits (523),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 154/455 (34%), Positives = 230/455 (51%), Gaps = 42/455 (9%)
 Frame = -2

Query  1757  ITMKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYD-----SPTISGAC  1593
             + ++VEV S E  +PSSPTP  L++Y+ SFLDQ+   +  P + FY+      P I+   
Sbjct  1     MKVEVEVISNENIKPSSPTPGHLRHYQFSFLDQMAPQVYNPLLLFYEYNANIHPNITEIS  60

Query  1592  HHTKTIDElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAE-NMSCLLENP  1416
             +H K       SLS+ LSL YPLAGR+K+++  I C+DEG+ ++ A V    +S +L NP
Sbjct  61    NHLKN------SLSEALSLFYPLAGRIKDNRF-IHCNDEGIPYVEARVLNCTLSDVLSNP  113

Query  1415  EMEKIKQLIPSA--KVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFME  1242
                ++ + +P     +  P P G     VQ+N F CGG AIG  +SH IAD  +   F +
Sbjct  114   NPGELNKFMPFELDDITNPLPFG-----VQLNIFRCGGFAIGQCISHKIADGLSYFTFSK  168

Query  1241  IWASFNRGCAAN-NGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFV  1065
             IWA+  RG  AN +   FV   S+ LFPP    +  +     G  GI    KD + KRFV
Sbjct  169   IWAAIARGEQANIDPPQFV---SATLFPPKELNTGFD-----GGVGI---TKDRVTKRFV  217

Query  1064  IPANAIAQLRQDLTITGGSVQ--RPSRVEALTALVWAAVINATPTQTATLSCM----VNL  903
               A+ I  L+        S+Q   P+RVE L+A +W+  + AT   T     M    VNL
Sbjct  218   FNASKIETLQAKYEKDMKSLQLKHPTRVETLSAFIWSRYVAATKDCTVNKLYMVIHAVNL  277

Query  902   RRRMEPPLPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYG  723
             R R  PPLP +  G L   ++        GG       ++  +R+A   + +   +++  
Sbjct  278   RPRFSPPLPQHSFGNLFRFSMTSPLRISYGGQEECDGVVIGEVREAISKIDNEYVKQLQR  337

Query  722   EGGWLRAVIARGYELVRNRDS-STLYTSSLCRMAYYEVDFGWGKPRLVVN--MLDNSWVL  552
             +G     ++ +  +  +  D  + L  SS CR   YE DFGWGKP  V +  +   + VL
Sbjct  338   QGEKHLGLMKKAADNFKRGDMVAVLSFSSYCRFPLYENDFGWGKPAWVGSPALTYKNLVL  397

Query  551   FLDAING-AVEVWMKLPKQVMHTLTQDRHFLAYVS  450
             F+D   G  +E ++ L ++VM     D   L+YVS
Sbjct  398   FMDTKEGDGIEAYVSLEERVMAKFECDSELLSYVS  432



>gb|KDO46443.1| hypothetical protein CISIN_1g043811mg [Citrus sinensis]
Length=448

 Score =   206 bits (523),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 156/467 (33%), Positives = 229/467 (49%), Gaps = 56/467 (12%)
 Frame = -2

Query  1751  MKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGACHHTKTID  1572
             M++ + SK+I +PSSPTP  LK +KLS LDQL  ++ T  +FFY+ P+      +T T +
Sbjct  1     MQLRIISKKIIKPSSPTPLHLKTHKLSLLDQLAPDIYTSLLFFYNGPSRVYDETNTSTNN  60

Query  1571  ---ElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFI--VADVAENMSCLLENPEME  1407
                 L+ SLSKTL+L YP AG++ +D   ++CDD G+ F+      + +MS +L+NPEM 
Sbjct  61    VYHRLQSSLSKTLNLYYPFAGKLLQDNYVVDCDDSGIPFVETRGPSSISMSEVLKNPEMN  120

Query  1406  KIKQLIPSAKVYEPQPVGKAL-------VAVQVNRFSCGGIAIGFFVSHAIADASALAKF  1248
              ++QL+P        P  K L        AVQ+N F CGG+AIG    H +AD +A   F
Sbjct  121   TLQQLLPF------NPNKKYLSSTDDVNAAVQINHFDCGGVAIGLNFRHIVADGAASVGF  174

Query  1247  MEIWASFNRGCAANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIE--QEEKDMIVK  1074
             ++ WA  +   ++++ S     H+ +     TDT    Q +   A  I   Q   + + K
Sbjct  175   IQNWAKLH---SSDDNSIINYKHTVV---DCTDTFPPNQEISSYARRINEWQRAPECVTK  228

Query  1073  RFVIPANAIAQLRQDLTITGGSVQ----RPSRVEALTALVWAAVINATPTQTATLSCM--  912
             RFV     +A LR ++     S+     RP+R EA++ L+W A+I     +    +C+  
Sbjct  229   RFVFDGGKVAALRGEIIKKDASLSLNQYRPTRFEAVSGLIWDALIAMDREENVGSTCIAS  288

Query  911   --VNLRRRMEPPLPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEA  738
               VNLR RM PPLP +C+G L     V C   K            + I    + V D   
Sbjct  289   VPVNLRNRMNPPLPEDCIGNLYHA--VTCTANKTSA---------RNINQFTKMVSDDFV  337

Query  737   RKVYGEGGWLRAVIARGY-----ELVRNRDSSTLYT-SSLCRMAYYEVDFGWGKP--RLV  582
             RKVY +GG    V    Y     E+++  +   L+  + +  + +YE DFGWGKP     
Sbjct  338   RKVYQDGG---IVFVNQYKEAVEEIMKGDNGVRLFGFTGVIGLPFYEPDFGWGKPVWSTT  394

Query  581   VNMLDNSWVLFLDAINGAVEVWMKLPKQVMHTLTQDRHFLAYVSAFP  441
                L+N  VL        VE W+ LP   M    QD   L Y S  P
Sbjct  395   AMSLNNIAVLLGTRDGKGVEAWVGLPINDMPKFEQDPGILTYASFIP  441



>gb|KCW86595.1| hypothetical protein EUGRSUZ_B03227 [Eucalyptus grandis]
Length=443

 Score =   205 bits (522),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 157/456 (34%), Positives = 238/456 (52%), Gaps = 48/456 (11%)
 Frame = -2

Query  1751  MKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGACHHTKTID  1572
             ++VEV S +  +PSSPTP  L++YKLSFLDQ+ + +  P V F+  P         K   
Sbjct  4     VEVEVVSSDTIKPSSPTPDHLRHYKLSFLDQIQVPVFMPLVLFF--PRDDDVSLDEKR-G  60

Query  1571  ElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEMEKIKQL  1392
              ++++L+K L+  YPLAGRV+ D + ++C+DEG  ++ A V   +S +LENP    + + 
Sbjct  61    RIRQALAKALTQFYPLAGRVR-DNLYVDCNDEGALYVEARVRCELSDILENPVPRVLNRF  119

Query  1391  IPSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGCA  1212
             +P     +   V    VAVQVN F CGG+A+   +SH +ADA +   F+  WA+  RG  
Sbjct  120   LPR----QIDDVQDLAVAVQVNFFECGGLALSLLISHKVADALSYFTFLNSWAATARGDT  175

Query  1211  ANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQLRQ  1032
                   F    SS LFPP+ + S  +      + GI ++  ++  +RFV  A  IA LR+
Sbjct  176   DIIDPCF---SSSELFPPI-NLSGFQT-----STGIVKD--NISTRRFVFDAATIASLRE  224

Query  1031  DLT----------ITGGSVQRPSRVEALTALVWAAVINAT-PTQTA-----TLSCMVNLR  900
              LT                 RP+RVEAL++ +W+  + +T P  T      T+   VNLR
Sbjct  225   QLTDLNNAAAAATTVDHQRSRPTRVEALSSFLWSRYMASTQPIDTRGDKLYTVLHAVNLR  284

Query  899   RRMEPPLPPNCLGTLVDEAIVLCQEAK--DGGTVVTAVELVQRIRDAFRAVKDGEARKVY  726
              RMEPP+  +  G +   AI +  +    DGG      ++V ++R+A + V DGE  K  
Sbjct  285   TRMEPPMSGHHFGNISRLAITVPTKDAVVDGGH-----KIVHQVREAIKQV-DGEHIKKL  338

Query  725   GEG-GWLRAVIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLV--VNMLDNSWV  555
              +G G+L  +  R   + +    S  +T SLCR   YE DFGWGKP      ++   + V
Sbjct  339   RDGEGYLNWLKERSARISQGEVVSFSFT-SLCRFPIYEADFGWGKPTWAGSASLTFKNLV  397

Query  554   LFLDAING-AVEVWMKLPKQVMHTLTQDRHFLAYVS  450
             +F+D  +G  +E W+ L +  M    QD+  LA VS
Sbjct  398   VFMDTKSGDGIEAWVHLKEDDMAKFEQDKELLALVS  433



>ref|XP_006423966.1| hypothetical protein CICLE_v10028504mg [Citrus clementina]
 gb|ESR37206.1| hypothetical protein CICLE_v10028504mg [Citrus clementina]
Length=425

 Score =   204 bits (520),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 151/452 (33%), Positives = 227/452 (50%), Gaps = 44/452 (10%)
 Frame = -2

Query  1757  ITMKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFY---DSPTISGACHH  1587
             + + VE  S+E+ +PS+PTP  L++Y  S+LDQ    L    ++FY   D   +S   H 
Sbjct  1     MKITVETISREMIKPSTPTPNHLRHYHFSYLDQTAPPLYMSLLYFYHLDDHKLVSNNNH-  59

Query  1586  TKTIDElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLE---NP  1416
                I+ LK SLS  L+  YPLAGRVK   V  +C+DEGV F  A V    SCLL    N 
Sbjct  60    -LFINSLKSSLSNVLTKYYPLAGRVKNSYV--DCNDEGVVFSEAKV----SCLLSEIINE  112

Query  1415  EMEKIKQLIPSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIW  1236
                +  +L P  +  +   +    +A+QVN F+CG +AI   +SH IADAS+L  F + W
Sbjct  113   LPSEFNKLRPFDQEKDVVSINGLPIAIQVNMFNCGSVAIAVMISHKIADASSLITFTKNW  172

Query  1235  ASFNRGCAANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEG--IEQEEKDMIVKRFVI  1062
             A+  RG + N    F    ++ LFPP  D          G+ G  ++   K +++K+F+ 
Sbjct  173   AAAARGGSENVFPEFA---AARLFPP-KDAG--------GSSGVSVDPRPKKIVLKKFLF  220

Query  1061  PANAIAQLRQDLTITGGSVQRPSRVEALTALVWAAV-----INATPTQTATLSCMVNLRR  897
                 I  LR    +  G    P+RVEAL+A +W+ +     I  +P +   L  +VNLR+
Sbjct  221   EGPKITALRDKYGLDNGIY--PTRVEALSAFIWSRLAASTRIKISPERPYMLVHLVNLRK  278

Query  896   RMEPPLPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEG  717
             RMEPPLP +  G ++  A+ + +E  D         +V + RDA   V     + +  E 
Sbjct  279   RMEPPLPDDSFGNIIGAAVTVLEENDDDD------RMVNKFRDAICKVDKDYLKVMKLEH  332

Query  716   GWLRAVIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVV--NMLDNSWVLFLD  543
               L  ++    E+V   +    + SSLC+   YE DFG GKP  V    +   + +  +D
Sbjct  333   SELTDLVITNGEIVDRGELGYCFFSSLCKFPVYEADFGLGKPMWVAWGRLPYKNIIHLID  392

Query  542   AING-AVEVWMKLPKQVMHTLTQDRHFLAYVS  450
               +G  +E W+ L ++VM     D+  LAYVS
Sbjct  393   TKSGDGIEAWVHLEEEVMAKFGNDQELLAYVS  424



>ref|XP_006487765.1| PREDICTED: vinorine synthase-like [Citrus sinensis]
Length=425

 Score =   204 bits (520),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 155/456 (34%), Positives = 228/456 (50%), Gaps = 52/456 (11%)
 Frame = -2

Query  1757  ITMKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFY---DSPTISGACHH  1587
             + + VE  S+E+ +PS+PTP  L++Y  S+LDQ    L    ++FY   D   +S   H 
Sbjct  1     MKISVETISREMIKPSTPTPNHLRHYHFSYLDQTAPPLYVSLLYFYHLDDHKLVSNNNH-  59

Query  1586  TKTIDElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEME  1407
                I+ LK SLS  L+  YPLAGRVK + V  +C+DEGV F  A V    SCLL     E
Sbjct  60    -LFINSLKSSLSNVLTKYYPLAGRVKNNYV--DCNDEGVVFSEAKV----SCLLS----E  108

Query  1406  KIKQLIPSAKVYEPQPVGKALV-------AVQVNRFSCGGIAIGFFVSHAIADASALAKF  1248
              IK+L        P    K +V       A+QVN F+CG +AI   + H IADA++L  F
Sbjct  109   IIKELPSEFNKLHPFDQEKDVVSINGLPIAIQVNMFNCGSVAIAVMIFHKIADAASLITF  168

Query  1247  MEIWASFNRGCAANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEG--IEQEEKDMIVK  1074
              + WA+  RG + N    FV   ++ LFPP  D          G+ G  ++   K +++K
Sbjct  169   TKNWAAAARGGSENVFPEFV---AARLFPP-QDAG--------GSSGVCVDPRTKKIVLK  216

Query  1073  RFVIPANAIAQLRQDLTITGGSVQRPSRVEALTALVWAAV-----INATPTQTATLSCMV  909
             +F+     I  LR    +  G    P+RVEAL+A +W+ +     I  +P +   L  +V
Sbjct  217   KFLFEGPKITALRDKYGLDNGIY--PTRVEALSAFIWSRLAASTRIKISPERPYMLVHLV  274

Query  908   NLRRRMEPPLPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKV  729
             NLRRRMEPPLP +  G ++  A+ + +E  D         +V + RDA   V     + +
Sbjct  275   NLRRRMEPPLPDDSFGNIIGAAVTVLEENDDDD------RMVNKFRDAICKVDKDYLKVM  328

Query  728   YGEGGWLRAVIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVV--NMLDNSWV  555
               E   L  ++    E+V   +    + SSLC+   YE DFG GKP  V    +   + +
Sbjct  329   KLEHSELTDLVITNGEIVDRGELGYCFFSSLCKFPVYEADFGLGKPMWVAWGRLPYKNII  388

Query  554   LFLDAING-AVEVWMKLPKQVMHTLTQDRHFLAYVS  450
               +D  +G  +E W+ L ++VM     D+  LAYVS
Sbjct  389   HLIDTKSGDGIEAWIHLEEEVMAKFGNDQELLAYVS  424



>ref|XP_010044505.1| PREDICTED: vinorine synthase-like [Eucalyptus grandis]
Length=445

 Score =   205 bits (522),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 157/456 (34%), Positives = 238/456 (52%), Gaps = 48/456 (11%)
 Frame = -2

Query  1751  MKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGACHHTKTID  1572
             ++VEV S +  +PSSPTP  L++YKLSFLDQ+ + +  P V F+  P         K   
Sbjct  6     VEVEVVSSDTIKPSSPTPDHLRHYKLSFLDQIQVPVFMPLVLFF--PRDDDVSLDEKR-G  62

Query  1571  ElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEMEKIKQL  1392
              ++++L+K L+  YPLAGRV+ D + ++C+DEG  ++ A V   +S +LENP    + + 
Sbjct  63    RIRQALAKALTQFYPLAGRVR-DNLYVDCNDEGALYVEARVRCELSDILENPVPRVLNRF  121

Query  1391  IPSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGCA  1212
             +P     +   V    VAVQVN F CGG+A+   +SH +ADA +   F+  WA+  RG  
Sbjct  122   LPR----QIDDVQDLAVAVQVNFFECGGLALSLLISHKVADALSYFTFLNSWAATARGDT  177

Query  1211  ANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQLRQ  1032
                   F    SS LFPP+ + S  +      + GI ++  ++  +RFV  A  IA LR+
Sbjct  178   DIIDPCF---SSSELFPPI-NLSGFQT-----STGIVKD--NISTRRFVFDAATIASLRE  226

Query  1031  DLT----------ITGGSVQRPSRVEALTALVWAAVINAT-PTQTA-----TLSCMVNLR  900
              LT                 RP+RVEAL++ +W+  + +T P  T      T+   VNLR
Sbjct  227   QLTDLNNAAAAATTVDHQRSRPTRVEALSSFLWSRYMASTQPIDTRGDKLYTVLHAVNLR  286

Query  899   RRMEPPLPPNCLGTLVDEAIVLCQEAK--DGGTVVTAVELVQRIRDAFRAVKDGEARKVY  726
              RMEPP+  +  G +   AI +  +    DGG      ++V ++R+A + V DGE  K  
Sbjct  287   TRMEPPMSGHHFGNISRLAITVPTKDAVVDGGH-----KIVHQVREAIKQV-DGEHIKKL  340

Query  725   GEG-GWLRAVIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLV--VNMLDNSWV  555
              +G G+L  +  R   + +    S  +T SLCR   YE DFGWGKP      ++   + V
Sbjct  341   RDGEGYLNWLKERSARISQGEVVSFSFT-SLCRFPIYEADFGWGKPTWAGSASLTFKNLV  399

Query  554   LFLDAING-AVEVWMKLPKQVMHTLTQDRHFLAYVS  450
             +F+D  +G  +E W+ L +  M    QD+  LA VS
Sbjct  400   VFMDTKSGDGIEAWVHLKEDDMAKFEQDKELLALVS  435



>ref|XP_010514234.1| PREDICTED: vinorine synthase-like [Camelina sativa]
Length=459

 Score =   205 bits (521),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 158/454 (35%), Positives = 239/454 (53%), Gaps = 36/454 (8%)
 Frame = -2

Query  1754  TMKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGACHHTKTI  1575
             +M V+V S++I +PSSPTP  LK +KLS L+QL   +  P V+FY     +     T+ +
Sbjct  16    SMIVDVVSRDIIKPSSPTPNHLKKFKLSLLEQLGPTIFGPMVYFYSGN--NNRIKPTEQL  73

Query  1574  DElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEMEKIKQ  1395
              +LKKSLS+TL+  YPLAGR+K + V+I+C+D G +F+ A+V   +S LL+ P  + +++
Sbjct  74    QKLKKSLSETLTHFYPLAGRLKGN-VSIDCNDSGADFLEAEVNSPLSSLLQEPSSDNLQR  132

Query  1394  LIPSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASF-NRG  1218
             LIP++ V   +   K L+A Q + F CG +AIG  +SH  ADA+++  FM+ WA+  +RG
Sbjct  133   LIPTS-VDSIETRTKLLLA-QASFFECGSMAIGVCISHKFADATSIGLFMKTWAAISSRG  190

Query  1217  CAANNGSGFVSDHSSILFPP--LTDTSAIEQLMKMGAEGIEQE--EKDMIVKRFVIPANA  1050
                  GS  V D   I FPP   ++TS         A  IE E      +  RFV  +++
Sbjct  191   SIKTVGSP-VFDTVKI-FPPGNFSETSP--------APVIEPEIMMNQTLSNRFVFDSSS  240

Query  1049  IAQLRQDLTITGGSVQRPSRVEALTALVWAAVINATPTQTAT-----LSCMVNLRRRMEP  885
             I  L+ +   +   V++P+RVEA++AL+W   + AT T + T     L+   +LR R+ P
Sbjct  241   IQSLQAN--ASSFEVKQPTRVEAVSALIWKTAMKATRTVSGTSKPSILANSASLRSRVSP  298

Query  884   PLPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLR  705
             P   N +G LV        +A++G        LV  +R   +  +D    K+ G      
Sbjct  299   PFTENSVGNLVS---YFAAKAEEGVNQTKLQTLVSELRKEKQRFRDNHVPKLVGNPSATE  355

Query  704   AVIARGYE---LVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLV--VNMLDNSWVLFLDA  540
              + +   E   ++ + D      SS CR   YE DFGWGKP  V    +   + V  LD 
Sbjct  356   IICSYQREAGHMIASGDFDFYIFSSACRFGLYETDFGWGKPAWVGIPCVRQKNIVTLLDT  415

Query  539   IN-GAVEVWMKLPKQVMHTLTQDRHFLAYVSAFP  441
                G +E W+ L +Q M  L QD   L +VS  P
Sbjct  416   KEAGGIEAWVNLNEQEMKLLEQDSELLHFVSLNP  449



>ref|XP_009361768.1| PREDICTED: BAHD acyltransferase At5g47980-like [Pyrus x bretschneideri]
Length=451

 Score =   204 bits (518),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 140/458 (31%), Positives = 236/458 (52%), Gaps = 37/458 (8%)
 Frame = -2

Query  1751  MKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYD-SPTISGAC--HHTK  1581
             +KVE+  ++  +PS+ TP  L++YKLSFLDQ+   + TP + FY  + T S     HH  
Sbjct  5     IKVEIIERQTIKPSTSTPHHLRSYKLSFLDQMAFVIYTPLLLFYPIASTTSNVSTRHHAM  64

Query  1580  TIDEl----kkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPE  1413
             +IDE      +SL+KTL+  YPLAGR+ +    +EC+D G  FI A ++  +S +LENP+
Sbjct  65    SIDERCRHLIESLAKTLTHFYPLAGRIVKGNSIVECNDGGAAFIKARISCCLSDILENPD  124

Query  1412  MEKIKQLIPSAKVYEPQPVGKA-LVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIW  1236
              + +K+ +P     E +  G   L+ VQVN F CGG+AIG  +SH IADAS L  F+  W
Sbjct  125   GQILKRFLPIE--IESKEAGTGWLLLVQVNLFECGGMAIGLSISHRIADASTLCTFINCW  182

Query  1235  ASFNRGCAANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAE----GIEQEEKDMIVKRF  1068
             A+   G          SD   +L  P    +++ + ++  +       E  ++  + +R+
Sbjct  183   ATIALGS---------SDSDQVLNLPEFGAASVFKPIEFSSSSQPPAREVVKEKCVTQRY  233

Query  1067  VIPANAIAQLRQDLTITGGSVQRPSRVEALTALVWAAVINATPTQT-----ATLSCMVNL  903
             V  A+ I+ L+ +  +    V +P+RVEA++AL+W     A+ +       +     VNL
Sbjct  234   VFDASKISTLQSE--VASSFVAKPTRVEAVSALIWKCATEASRSNLRKQGPSFFRQDVNL  291

Query  902   RRRMEPPLPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYG  723
             R+R+ PPLP N  G +V        +A +  +V+   +LV ++R+    +K+  A K+  
Sbjct  292   RKRVVPPLPENLAGNVVGS---FTSKADEESSVINLKDLVAKLREGIEGLKEKYAAKLVF  348

Query  722   EGGWLRAVIARGYELVRNRDSSTLYT-SSLCRMAYYEVDFGWGKPRL--VVNMLDNSWVL  552
             +       I       +  D+  +Y+ +S CR  +YE DFGWG+P    V ++   + ++
Sbjct  349   DSDEAWQEIKDEQNKPKTHDNMEIYSCTSWCRFPFYEADFGWGRPSWASVASIAIKNIIV  408

Query  551   FLDAIN-GAVEVWMKLPKQVMHTLTQDRHFLAYVSAFP  441
              +D  +   +E W+ + ++       +   L Y S  P
Sbjct  409   LMDKRDCSGIEAWVTMSEEGKALFESNVELLGYASVNP  446



>ref|XP_007028226.1| HXXXD-type acyl-transferase family protein, putative [Theobroma 
cacao]
 gb|EOY08728.1| HXXXD-type acyl-transferase family protein, putative [Theobroma 
cacao]
Length=442

 Score =   203 bits (517),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 147/452 (33%), Positives = 235/452 (52%), Gaps = 37/452 (8%)
 Frame = -2

Query  1751  MKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQ----LHLNLMTPFVFFYDSPTISGACHHT  1584
             MKVEV S++  +PS PTP  L+ + LS LDQ    +H   +   VFFY S   + +    
Sbjct  4     MKVEVTSRKTIKPSIPTPHHLRTFNLSLLDQDVPAIHYGSV---VFFYPSDNTARSSISQ  60

Query  1583  KTIDElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEMEK  1404
             K+   LK SLS+ L   YPLAG+VK D VTIEC+D+G  FI A     ++  L +P+   
Sbjct  61    KS-QSLKNSLSRILLHFYPLAGQVK-DAVTIECNDQGACFIEARTGCQLNDFLTHPDPGF  118

Query  1403  IKQLIPSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFN  1224
             +K+L+PS      +     ++ VQ+  F+CGG A+   VSH  ADAS+L  F++ W + +
Sbjct  119   LKELVPSTDPKAIRSTLACILLVQLTSFTCGGTAVAVCVSHKFADASSLCTFIQSWTAMS  178

Query  1223  RGCAANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIA  1044
                          ++  ++ P L   S +  + K+         ++   KRFV   + IA
Sbjct  179   S-----------REYGRVVVPKLVGASLLPPIHKLITSTPPPTTRNCATKRFVFHKSQIA  227

Query  1043  QLRQDLTITGGSVQRPSRVEALTALVWAAVINATPT------QTATLSCMVNLRRRMEPP  882
              L+  +  T G  QRP+ VE + A+V      A+ +      Q+A L+ +VNLR+RM PP
Sbjct  228   NLKAKVAATMGKQQRPANVEIVLAIVLRCASAASQSKYGSSRQSALLN-VVNLRKRMVPP  286

Query  881   LPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLRA  702
             LP N +G L+    VL QE+      V   ++V +++DAF  V + + + +  + G    
Sbjct  287   LPGNTIGNLIWTYPVLFQESD-----VQLHQIVAKMKDAFTNVCNDKLKTIKSKKGHTEV  341

Query  701   VIARGY--ELVRNR--DSSTLYTSSLCRMAYYEVDFGWGKPRLVVNMLD-NSWVLFLDAI  537
               +R    +L+  +  D++T   ++LC    +E+DFGWGKP  V +  +  + ++ LD+ 
Sbjct  342   QESRKQIAQLLNGKLVDTNTYTCTNLCSYPLHEMDFGWGKPLWVTSPSNFKNLIVLLDSK  401

Query  536   NGAVEVWMKLPKQVMHTLTQDRHFLAYVSAFP  441
              G +E W+ L +  M T  +D+  LA  S+ P
Sbjct  402   WGDIEAWVTLDELEMATFERDQELLAVASSNP  433



>ref|XP_007134122.1| hypothetical protein PHAVU_010G020900g [Phaseolus vulgaris]
 gb|ESW06116.1| hypothetical protein PHAVU_010G020900g [Phaseolus vulgaris]
Length=441

 Score =   203 bits (516),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 149/453 (33%), Positives = 234/453 (52%), Gaps = 38/453 (8%)
 Frame = -2

Query  1748  KVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTI-SGACHHTKTID  1572
             K E+ S E  +PSSPTP  L N+KLSFLDQL  +   P + FY +  + + A   T   +
Sbjct  4     KNEIISNERIKPSSPTPNHLHNFKLSFLDQLAPSFYVPILLFYSASDVRTFATDLTALSE  63

Query  1571  ElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEMEKIKQL  1392
             +LK SLSK L+L YP  GR++ +  TI+C+D+GV FI + +   +S +L+NP+   + QL
Sbjct  64    KLKTSLSKLLTLYYPFCGRLRGNS-TIDCNDQGVIFIHSKLPIPLSNILKNPKPHNLHQL  122

Query  1391  IPSAKVYEPQPVGK---ALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNR  1221
             +P A  Y  QP  +    ++AVQ+++F CGGIA+G   SH I DAS  A F+  WA+ +R
Sbjct  123   LPCAP-YNLQPQQRDTLGIMAVQLSQFKCGGIALGVCFSHKIIDASTAASFLSAWAATSR  181

Query  1220  GCAANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQ  1041
             G   ++ +    + +S+LFPP      +   M  G  G      + + KRF+   + I++
Sbjct  182   GHGNSSFAPPPMEETSLLFPPRN----VFVDMTSGMFG----HANTVTKRFIFSGSNISR  233

Query  1040  LRQDLTITGGSVQRPSRVEALTALVWAAVINATPTQT---------ATLSCMVNLRRRME  888
             LRQ++   G     PSRVEA+TAL+W + + A    +         +++  +VN+R RM 
Sbjct  234   LRQNI---GCPSFNPSRVEAVTALLWKSSLEAAKEGSDSGEENVAASSVCHIVNIRSRMV  290

Query  887   PPLPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWL  708
             P L  + +G +   A+    E + G   V   +L +R+R+  R V     RK+  +  ++
Sbjct  291   PALSKDSIGNIWQYAVSSLVEVEGG---VGLRDLAERVRETIRKVDGDYIRKLQSDVEFV  347

Query  707   RAVIARGYELVRNRDSSTLYT----SSLCRMAYYEVDFGWGKPRLVVNM---LDNSWVLF  549
               V  +G E  R   +   +     +S     +YEVDFGWGKP     +   + N  VL 
Sbjct  348   EVV--KGLEEARTMAAEKGHRFCAFTSWVGFGFYEVDFGWGKPTYATTIGMPIKNLGVLI  405

Query  548   LDAINGAVEVWMKLPKQVMHTLTQDRHFLAYVS  450
                    +E W+ L  + M  L  +   L + S
Sbjct  406   STKDGEGIEAWLTLTTREMAQLEHNAQLLDFAS  438



>ref|XP_008222018.1| PREDICTED: vinorine synthase-like [Prunus mume]
Length=436

 Score =   203 bits (516),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 158/456 (35%), Positives = 241/456 (53%), Gaps = 45/456 (10%)
 Frame = -2

Query  1757  ITMKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGACHHTKT  1578
             + ++VEV SKEI +PSSPTP  L+ Y LSFLDQ+   +  P V FY S       +    
Sbjct  1     MKVEVEVISKEIIKPSSPTPDHLRTYHLSFLDQISPPVHNPLVIFYSSEP-DTKFNIVDI  59

Query  1577  IDElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEMEKIK  1398
              ++LKKSLS  L+L YPLAGR   +   I+C+DEG+ ++   V   +S +++NP   ++ 
Sbjct  60    SNQLKKSLSDVLTLFYPLAGRAHGNSF-IDCNDEGIPYLETRVNCQLSHVIQNPIPSELN  118

Query  1397  QLIPSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRG  1218
             + IP    ++   V    + VQ+N F CGGIA+G  VSH IADA +L  F++ WA+  R 
Sbjct  119   KFIP----FQVHEVADLSLGVQLNIFDCGGIALGACVSHKIADALSLFMFIKSWAAIARQ  174

Query  1217  CAAN-NGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQ  1041
                +     FV   S+ LFPP  + S +         GI ++  +++ KRF+  A+ I  
Sbjct  175   QDEHIVCPQFV---SATLFPP-RNISGLNP-----RTGITKQ--NVVTKRFIFDASKIEA  223

Query  1040  LRQDLTITGGS------VQRPSRVEALTALVWAAVINAT-------PTQTATLSCMVNLR  900
             L+   +I   S       + PSRVEAL+AL+W+ V+ +T       P +   +   VNLR
Sbjct  224   LKAKYSIDNYSQSLESYQKPPSRVEALSALIWSRVVASTQVKSEPAPERLYAIVHAVNLR  283

Query  899   RRMEPPLPPNCLGTLVDEAIVLCQEAKDGGTVVTAVE---LVQRIRDAFRAVKDGEARKV  729
              R +PPLP +  G L   A+ +        ++ T  E   LV+++RD  R +      K+
Sbjct  284   TRTDPPLPEHSFGNLYRIAMTI-------PSLQTGEECYGLVRQVRDQVRQIDKHFVSKL  336

Query  728   YGEGGWLRAVIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVVN--MLDNSWV  555
               +G      I +  E     +  TL  +SLCR   YE DFGWGKP  V +  +  N+ V
Sbjct  337   -QQGSEHLDFIKQSSENFFKGEMVTLSFTSLCRFPLYEADFGWGKPTWVGSPPLTFNNLV  395

Query  554   LFLDAIN-GAVEVWMKLPKQVMHTLTQDRHFLAYVS  450
             +F+DA + G +E ++ + ++ +  L  D  FLA+VS
Sbjct  396   VFMDAKSGGGIEAYINMKEEDLAKLEGDNEFLAFVS  431



>gb|KDP26741.1| hypothetical protein JCGZ_17899 [Jatropha curcas]
Length=432

 Score =   202 bits (515),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 148/450 (33%), Positives = 232/450 (52%), Gaps = 33/450 (7%)
 Frame = -2

Query  1757  ITMKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGACHHTKT  1578
             + ++ E+ SKEI +PSSPTP  L++YKLSFLDQ+   +  P + FY++       +  + 
Sbjct  1     MKLECELISKEIIKPSSPTPDHLRHYKLSFLDQISPPVYNPLLLFYETDG-ETKFNSVEK  59

Query  1577  IDElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEMEKIK  1398
              ++LK+SLS+ L   YPLAGR+K++   ++C+DEG+  + A V+  +S ++++P   +IK
Sbjct  60    YNQLKQSLSQALIHFYPLAGRIKDNHF-VDCNDEGIPCLQAKVSGKLSDVVQSPVPTEIK  118

Query  1397  QLIPSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRG  1218
             +L+P    +E     +  + VQ N F CGGI IG  +SH I DA ++  F++IWA+  RG
Sbjct  119   KLLP----FELDQDQELPLGVQFNIFECGGICIGLCLSHNIGDALSIVLFVKIWAAITRG  174

Query  1217  CAANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQL  1038
                     FV   S+ LFPP  D S     +    E +       + +RFV  +++I  L
Sbjct  175   EEEITRPEFV---SAKLFPP-KDFSGFNPRIGFAKENV-------LTERFVFKSSSIESL  223

Query  1037  RQDLTITGG--SVQRPSRVEALTALVWAAVINATPTQTATLS-------CMVNLRRRMEP  885
             R     +    S + PSRVEAL+A +W   + A   QT   S         VNLR RM P
Sbjct  224   RAKYAASTSLKSQRPPSRVEALSAFIWTRFMAAIKQQTEEPSEKIYMMLHAVNLRTRMNP  283

Query  884   PLPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLR  705
             PLP N  G     A+       + G      ++V ++RD+   + D E  K   E G   
Sbjct  284   PLPENSFGNFYRVAMTF-PSPTNNGEESNYDDIVIQMRDSISKI-DTEYVKKLQEAGNDE  341

Query  704   AV--IARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLV--VNMLDNSWVLFLDAI  537
              +  I +  +     +  +L  +SLCR   YE DFGW KP  V   ++   + V+F+D  
Sbjct  342   HMDFIKQMAQFFMRGEMVSLNFTSLCRFPLYETDFGWRKPIWVGSPSLTFKNLVVFMDTP  401

Query  536   NG-AVEVWMKLPKQVMHTLTQDRHFLAYVS  450
             +G  +E  + L ++ M    +D+  L +VS
Sbjct  402   SGDGIEALIHLNQEDMQKFKEDQELLQFVS  431



>ref|XP_004239499.1| PREDICTED: vinorine synthase [Solanum lycopersicum]
Length=431

 Score =   202 bits (515),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 147/452 (33%), Positives = 227/452 (50%), Gaps = 38/452 (8%)
 Frame = -2

Query  1757  ITMKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGACHHTKT  1578
             + +++E+ SK + +PS+PTP  L NYKLS+LDQ+  N++ P VFFY +       H +  
Sbjct  1     MKIEIEIISKLVIKPSTPTPHELHNYKLSYLDQITPNILMPLVFFYQANNNFTKTHIS--  58

Query  1577  IDElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEMEKIK  1398
              ++LK SLS TL+  YPL GR+      + C+DEGV ++ A    N+S  L +P   ++ 
Sbjct  59    -NQLKTSLSHTLTKFYPLCGRLDVANTHVNCNDEGVPYVEAIAKCNLSDFLLDPLPNELN  117

Query  1397  QLIPSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRG  1218
             +LIP     +   V +  + VQ N F CGG+AIG  +SH IADA +    +  W +  RG
Sbjct  118   KLIPC----DLHDVKEFCLLVQANFFQCGGMAIGIAISHKIADALSTFMIINTWGAIARG  173

Query  1217  CAANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQL  1038
                     F    SSILFPP   T     +M         E+ +++ KRFV  A+ ++ L
Sbjct  174   SIDIPCPRF---DSSILFPPRDVTKFKSSVM--------IEKDNIVTKRFVFSASKVSAL  222

Query  1037  RQDLTITGGSVQR-PSRVEALTALVWA---AVINATPTQTATLSCM--VNLRRRMEPPLP  876
             R   T  G    R PSR+EAL+A +W    A I+A   +T     +  VNLR R +PPLP
Sbjct  223   RDKYTEKGTENTRPPSRIEALSAFIWTRLMASIHAERDETKIYGMVHTVNLRTRSDPPLP  282

Query  875   PNCLGTLVDEAI-VLCQEAKDGGTVVTA--VELVQRIRDAFRAVKDGEARKVYGEGGWLR  705
              +  G ++   + V   ++ D  +       ELV+++R++   V       +  +     
Sbjct  283   DSLFGNVMQVVVTVPATDSNDNNSTNKEQDFELVKKVRESINNVNSEFVSGLRKKDQKHL  342

Query  704   AVIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKP------RLVVNMLDNSWVLFLD  543
             + I       R  +      +SLCR+  Y+ DFGWGKP      RLV+  +    + FLD
Sbjct  343   SFIKEKANEQRKGELVVFNFTSLCRLPLYKADFGWGKPIWVGSARLVLKDV----IGFLD  398

Query  542   AING-AVEVWMKLPKQVMHTLTQDRHFLAYVS  450
               +G  +E W+ L ++ M     D+  L++ S
Sbjct  399   TKSGNGIEAWVNLREEDMAIFEADKELLSWCS  430



>emb|CDP10330.1| unnamed protein product [Coffea canephora]
Length=445

 Score =   203 bits (516),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 156/455 (34%), Positives = 232/455 (51%), Gaps = 33/455 (7%)
 Frame = -2

Query  1751  MKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGACHHTKTID  1572
             M+VE+ S+EI +PS PTP  LK +K SFLDQ+    +  F+ FY  P         +   
Sbjct  1     MEVEIISQEIIKPSIPTPDHLKIFKRSFLDQISGRFLVRFISFY--PRKETNLKINQVTH  58

Query  1571  ElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEMEKIKQL  1392
             +LK SLS+TL+L YPLAG  K+D  +IEC+D+G  F+ A V  N++ LL  P+ ++  +L
Sbjct  59    QLKISLSQTLTLYYPLAGVYKDDS-SIECNDKGALFVTAHVRCNINELLNLPKFQQFHKL  117

Query  1391  IPSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGCA  1212
               S+K  E  P     V VQ N FSCGG+AI    SH + D   ++ F++ WA+ +RG  
Sbjct  118   GTSSKFLEDGPFQ---VFVQFNTFSCGGVAIFTCFSHMVIDMPTISVFLKCWAAISRGSQ  174

Query  1211  ANNGSG--FVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQL  1038
              +   G  +    S +LFPP     ++     +  +G   ++   I KRFV  A AI+  
Sbjct  175   DDQSPGHPYPRYESQVLFPP---KDSVPLGFSVVVKGSLLKDGRSIRKRFVFSAPAIS--  229

Query  1037  RQDLTITGGS--VQRPSRVEALTALVWAAVINATPT-----QTATLSCMVNLRRRMEPPL  879
               DL + G S  V  P+ VE +++ +W   + A        Q + +    +LRRRM PPL
Sbjct  230   --DLKVKGTSKRVPDPTSVEVVSSFIWKHAMAAAKVVKGFQQPSVIFHAADLRRRMVPPL  287

Query  878   PPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGW--LR  705
             P    G +     ++ +  K     V    LV+ +R A    KD    K+   GG+  + 
Sbjct  288   PEYFAGNI--GCPIVAEYDKIDDLEVKFGRLVKILRLAKEKNKDEFVPKLLSSGGFDMMI  345

Query  704   AVIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKP---RLV----VNMLDNSWVLFL  546
               +    E   N+D +T   SS C++   EVDFGWGKP    LV    V  +  ++V+ +
Sbjct  346   KFLEDWGEKCSNKDLNTYQFSSWCKIGLNEVDFGWGKPIWTSLVGGTEVESMYKNFVVLV  405

Query  545   DAINGAVEVWMKLPKQVMHTLTQDRHFLAYVSAFP  441
             D  +G +E W+ L ++ M  L  DR FLAY S  P
Sbjct  406   DGSDGGIEAWLILEQKEMAILENDREFLAYASPNP  440



>ref|XP_002517535.1| Anthranilate N-benzoyltransferase protein, putative [Ricinus 
communis]
 gb|EEF44699.1| Anthranilate N-benzoyltransferase protein, putative [Ricinus 
communis]
Length=446

 Score =   202 bits (515),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 151/458 (33%), Positives = 231/458 (50%), Gaps = 37/458 (8%)
 Frame = -2

Query  1751  MKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGACHHTKTID  1572
             MKVE+ S+E+ +PSSPTP  LK++K+  LD+L      P +  Y S         +   D
Sbjct  1     MKVEIISREMIKPSSPTPIHLKDFKICLLDELAPPSYAPILLLYSSTDFVNENCFSAVAD  60

Query  1571  ElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEMEKIKQL  1392
             +LKKSLS+TL   YP +G++KE+  +I+C+DEG  F+ A V   +S +++NPE   + QL
Sbjct  61    KLKKSLSQTLVHFYPFSGKLKENLNSIDCNDEGALFLEAKVNVALSKIVKNPETNMLCQL  120

Query  1391  IPSAKVYEPQPVG-----KALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASF  1227
              P    ++P         +    VQVN F CGG+ IG  VSH IAD + +A F+  WAS 
Sbjct  121   FP----FDPYDAAVDGEIRVTTGVQVNVFECGGVGIGVCVSHKIADGATMASFISSWASS  176

Query  1226  NRGCAANNGSGFVSD---HSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPA  1056
                  +++     S     S+++FPP         +MK     I  E+  ++ KRF    
Sbjct  177   ATATGSDDDHQAFSSPRLDSAMIFPPKG-----MDMMKHCNMVIRNEK--IVTKRFEFDW  229

Query  1055  NAIAQLRQDLTITGGSVQ-RPSRVEALTALVW--AAVINATPTQTATLSC-----MVNLR  900
               +A L+ ++   G S +  P+RVEA+TAL+W  A  +  + ++  T+ C     +VN+R
Sbjct  230   KKLANLKANIDANGVSEKINPTRVEAVTALIWRSAMEVKRSMSEQDTIPCSIATHLVNIR  289

Query  899   RRMEPPLPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGE  720
              RM PPLP + +G L   A+    E K     V   ELV  IR++ R + +    ++ GE
Sbjct  290   ERMRPPLPGHSIGNLWRLAVAPYLEFKKD---VKLQELVDLIRESIRRIDNDYVTELQGE  346

Query  719   GGWLRAVIA----RGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLV--VNMLDNSW  558
              G+ + +      R   L+          SSL R  +YE+DFG GKP  V  + M   + 
Sbjct  347   DGFEKGIEPLKELRELALLGGEGVEVYTFSSLARFPFYEIDFGLGKPVKVCTITMPIRNC  406

Query  557   VLFLDAING-AVEVWMKLPKQVMHTLTQDRHFLAYVSA  447
             V  +D   G  +E W+ L +  M      +  L +VSA
Sbjct  407   VTLIDTRFGDGIEAWVTLTENDMAKFECSQELLQFVSA  444



>ref|XP_010046662.1| PREDICTED: vinorine synthase-like [Eucalyptus grandis]
 gb|KCW86861.1| hypothetical protein EUGRSUZ_B03452 [Eucalyptus grandis]
Length=436

 Score =   202 bits (514),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 149/457 (33%), Positives = 226/457 (49%), Gaps = 37/457 (8%)
 Frame = -2

Query  1751  MKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGACHHTKTID  1572
             MK++V SKE   PSS TP  ++ Y+ S LDQL      P V FY +P       H    +
Sbjct  1     MKIQVISKETIMPSSATPSPVQTYRFSLLDQLAPPFFVPVVLFYSAPDPDQDFDHVNIYE  60

Query  1571  ElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEMEKIKQL  1392
             +LK SLS+ LS  YPLAGR+K D+  ++     V F+   V   ++ LL NPE++ ++QL
Sbjct  61    KLKTSLSECLSCFYPLAGRIKGDEHAVDLGQRAV-FVRTRVNARLAKLLANPELKLVQQL  119

Query  1391  IPSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGCA  1212
             +P    Y  Q     + A+Q+N F+ GGI IG  +SH IAD + L+ F+  W + +RG  
Sbjct  120   LP-LDPYNIQCQNALVTAIQLNLFNRGGIGIGVCISHKIADRATLSTFLSSWGAISRG--  176

Query  1211  ANNGSGFVSDHSSILFPPLTDTSAI----EQLMKMGAEGIEQEEKDMIVKRFVIPANAIA  1044
                        +S L  P  DT+ I    E  + +    I++E+  ++ KRF   + ++A
Sbjct  177   -----------ASKLVAPYQDTTTIFPPREFRVPLPNNLIKKEK--IVTKRFEFDSASLA  223

Query  1043  QLRQDLTITGGSVQRPSRVEALTALVWAAVINA------TPTQTATLSCMVNLRRRMEPP  882
              LR      G + + P+ +EA+TAL+  A +NA          +  +S +VNLR RM PP
Sbjct  224   ALRTKAG-DGSTSKSPTLIEAVTALICKAAMNARTEISGNGRSSTVISHVVNLRGRMNPP  282

Query  881   LPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLRA  702
             LP +  G +   A    +E +D   +     L   +R A R + +   RK+ GE G+L A
Sbjct  283   LPDHSFGNIWRFATATIKEEEDDAELHV---LADHLRTAIRKIDNDYVRKLQGEDGFLWA  339

Query  701   V--IARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVVNM---LDNSWVLFLDAI  537
                +   +EL+   D  +   SS  R  +YE DFGWGKP         + N+ +L     
Sbjct  340   CESMREVHELMYKGDVESYRFSSWVRFPFYETDFGWGKPVWACISSVPIKNAVILMSSWS  399

Query  536   NGAVEVWMKLPKQVMHTLTQDRHFLAYVS-AFPKPKL  429
                +E W+ L +Q M     D   L +VS  +  PK+
Sbjct  400   GNGLEAWVTLDEQEMAKFQSDPLLLQFVSLPYKSPKI  436



>ref|XP_009361770.1| PREDICTED: vinorine synthase-like [Pyrus x bretschneideri]
Length=447

 Score =   202 bits (514),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 145/463 (31%), Positives = 237/463 (51%), Gaps = 47/463 (10%)
 Frame = -2

Query  1754  TMKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGACHHTKTI  1575
             +++VE+   +  +PSSPTPQ L+N+KL  LD     +   F+ FY +   +   H  K I
Sbjct  5     SIEVEIVDTQTVKPSSPTPQDLRNFKLYLLDLFMPGVDIKFLLFYPNVASTTTTHTAKAI  64

Query  1574  DElkk----slsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEME  1407
             ++  +    SL+KTL+  Y  AGR+K + V +EC+D+G + + A V  ++S + E P+ E
Sbjct  65    NDKYQHLIESLAKTLTHYYHFAGRIKSN-VAVECNDDGAQVVKAHVKCSLSDIFERPDPE  123

Query  1406  KIKQLIPS-AKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWAS  1230
              +++L+P+ A+  E +   +AL+ VQVN F CGG+A+G  VSH IAD S +  F+  WA+
Sbjct  124   MLRRLLPTGAESTEAEAGPRALLYVQVNLFECGGMAVGLGVSHKIADISTVCTFIHCWAA  183

Query  1229  FNRGCAANN-----GSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFV  1065
                   +NN       G  S      FPPL D    E            E++  + +R+V
Sbjct  184   --TALQSNNVILPQFGGVASS-----FPPL-DFPLWES---------PSEKEKPVTRRYV  226

Query  1064  IPANAIAQLRQDLTITGGSVQRPSRVEALTALVWAAVINA-----------TPTQTATLS  918
                + I+ L+ +   +   V +P+RVEA++AL+W   I A           +P + +TL 
Sbjct  227   FDNSKISVLQSE--TSSSLVPKPTRVEAISALIWKCAIEASSKSSPNTLCSSPIRPSTLR  284

Query  917   CMVNLRRRMEPPLPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEA  738
               VNLR+ + PP P N  G     AI   +E+     V+   +LV +IR     +K+  A
Sbjct  285   VAVNLRKMVTPPFPDNMAGNFSLSAIPKAEEST--SNVLDLKDLVVKIRAGIEEMKEA-A  341

Query  737   RKVYGEGGWLRAVIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVV--NMLDN  564
              KV+     ++ +       +++++  T Y SS CR  +YE DFGWGKP  V   +++ N
Sbjct  342   TKVFDPNEAMQVLTEYLTIPLKDQEIETYYCSSWCRFPFYETDFGWGKPSWVSVPSLVVN  401

Query  563   SWVLFLDAIN-GAVEVWMKLPKQVMHTLTQDRHFLAYVSAFPK  438
             +    +D  +   +E W+ L ++ M     +   LAY S  P+
Sbjct  402   NMFHLVDKRDCKGIEAWLTLSEEKMALFESNMELLAYASLNPR  444



>ref|XP_004310025.1| PREDICTED: vinorine synthase-like [Fragaria vesca subsp. vesca]
Length=428

 Score =   201 bits (511),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 149/441 (34%), Positives = 232/441 (53%), Gaps = 33/441 (7%)
 Frame = -2

Query  1751  MKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGACHHTKTID  1572
             MKVEV  ++  +PSSPTP  L+ ++LSFLDQ+   +  P + FY + T  G      +  
Sbjct  1     MKVEVIERDCIKPSSPTPNHLRKHELSFLDQVAPPIFMPMLLFYPA-TSYGNDETPLSAS  59

Query  1571  ElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEMEKIKQL  1392
              +K+SLS+TL+  YPLAGR+  D   + C+DEG  F+ A V   +S ++  P+  ++ +L
Sbjct  60    RVKQSLSETLTQFYPLAGRII-DNAFVNCNDEGTPFVEARVKCLLSDVVSQPDPNQLNKL  118

Query  1391  IPSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGCA  1212
             +P     + + V   ++AVQVN F CGG+AIG  +SH +ADA +L  F+  WAS +RG  
Sbjct  119   LPC----DLECVVDFVLAVQVNIFDCGGMAIGVCISHKVADALSLVMFLNSWASISRGDN  174

Query  1211  ANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQLRQ  1032
              N  +       +  FPP + +       K G  GI +++  ++ KRFV  A+ +A LR 
Sbjct  175   CNYRAPIFD--LATFFPPRSISG-----FKPGV-GIARDK--IVTKRFVFSASNVASLRT  224

Query  1031  DLTITGGSVQRPSRVEALTALVWAAVINAT---PTQTATLSCM--VNLRRRMEPPLPPNC  867
               T T  + +RP+R+EAL+A VW+  + +T   P        +  VNLR RMEP LP + 
Sbjct  225   KYT-TSETERRPTRIEALSAFVWSRFLASTQGKPNSDIVYKVLHAVNLRTRMEPALPEHH  283

Query  866   LGTL--VDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLRAVIA  693
              G +     A    +E ++          V ++RDA ++V     RK+      +  +  
Sbjct  284   FGNVSRFATATTSFEEGEE-----ECYGFVGQMRDAIKSVDGEYMRKILEGTAHVDYLKQ  338

Query  692   RGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLV--VNMLDNSWVLFLDA-INGAVE  522
             R  E ++    S  +T SLCR   YE DFGWGKP  V   ++   + V F+D+  +G +E
Sbjct  339   RAEEFLKGEVVSFSFT-SLCRFPLYETDFGWGKPIWVGSASLTFKNLVCFMDSGSSGGIE  397

Query  521   VWMKLPKQVMHTLTQDRHFLA  459
              W+ L ++ M    +D    A
Sbjct  398   AWVNLKEEDMAKFQEDEQLRA  418



>gb|KCW86594.1| hypothetical protein EUGRSUZ_B03226 [Eucalyptus grandis]
Length=412

 Score =   201 bits (510),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 145/452 (32%), Positives = 223/452 (49%), Gaps = 70/452 (15%)
 Frame = -2

Query  1751  MKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFY---DSPTISGACHHTK  1581
             ++VEV S +I +PSSPTP  L++YKLSFLDQ+ + +  P++ F+   D  ++   C + +
Sbjct  6     VEVEVISSDIVKPSSPTPDHLRHYKLSFLDQIQVPVFMPWILFFPRDDHLSLDEKCSNIR  65

Query  1580  TIDElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEMEKI  1401
                    SL++ L+  YPLAGRV+ D + I+C+DEG  ++ A V   +S +LENP    +
Sbjct  66    R------SLAEALTRFYPLAGRVR-DNLYIDCNDEGALYVEARVRCKLSDILENPVPRVL  118

Query  1400  KQLIPSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNR  1221
              + +P     E   V    VAVQVN F CGG+A+   +SH +ADA ++  F+  WA+  R
Sbjct  119   NRFLPR----ELDDVQDLAVAVQVNFFECGGLALALLISHKVADALSIFTFLNAWAATAR  174

Query  1220  GCAANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQ  1041
             G A              +  P  D+                        RFV  A AI  
Sbjct  175   GDAD-------------IIDPCFDS------------------------RFVFDATAIFS  197

Query  1040  LRQDLTITGGSVQ------RPSRVEALTALVWAAVINATPTQTA------TLSCMVNLRR  897
             LR+       +        RP+RVEAL++ +W+  + +T    A      T+   VNLR 
Sbjct  198   LREQFANLNSAAAADPQCCRPTRVEALSSFLWSRYMASTQPVDARGDKLYTVLHAVNLRT  257

Query  896   RMEPPLPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEG  717
             RMEPP+  +  G +   A+ +    KD GT     E+V ++R+A + V      K+    
Sbjct  258   RMEPPISGHHFGNISRVAVAV--PTKDAGT-DGGYEIVHQVREAIKQVDRQYIEKLQDGE  314

Query  716   GWLRAVIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLV--VNMLDNSWVLFLD  543
             G+L  +  R   + +    S  +T S+CR   YE DFGWGKP  V   ++   + ++F+D
Sbjct  315   GYLNWLKERSARISQGEVVSFSFT-SMCRFPIYEADFGWGKPAWVGSASLTFKNLIVFVD  373

Query  542   AING-AVEVWMKLPKQVMHTLTQDRHFLAYVS  450
               +G  +E W+ L +  M    QD+  LA VS
Sbjct  374   TKSGDGIEAWVHLKEDDMAKFEQDKELLALVS  405



>ref|XP_009114100.1| PREDICTED: vinorine synthase [Brassica rapa]
Length=459

 Score =   202 bits (513),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 151/455 (33%), Positives = 233/455 (51%), Gaps = 37/455 (8%)
 Frame = -2

Query  1757  ITMKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGACHHTKT  1578
             +T +VEV S++I +PSSPTP  LKN+KLS L+QL   +  P +FFY +   +     T+ 
Sbjct  16    LTTRVEVISRDIIKPSSPTPNHLKNFKLSLLEQLGPTIFGPMLFFYSA---NYRIKQTEQ  72

Query  1577  IDElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEMEKIK  1398
             +  LKKSLS+TL+  YPL+GR+  +  +I C+D G +F+ A V   +S LL+ P  E ++
Sbjct  73    LLNLKKSLSETLTHFYPLSGRLNGN-TSINCNDSGADFLEAQVNSPLSNLLQEPSSEMLE  131

Query  1397  QLIPSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRG  1218
             QLIP++ V   +   K L+A Q   F CGG+AIG  VSH +ADA+++  FM+ W++    
Sbjct  132   QLIPTS-VDSIEARTKLLLA-QATFFKCGGMAIGVCVSHKLADATSVGLFMKSWSAITSQ  189

Query  1217  CAANNGSGFVSDHSSILFPP--LTDTS---AIEQLMKMGAEGIEQEEKDMIVKRFVIPAN  1053
              +       V D   I FPP   ++TS    +E  +KM            + KRFV  ++
Sbjct  190   GSIKTVGSPVFDTLKI-FPPGNFSETSPAPVVEPEIKMN---------QTLSKRFVFDSS  239

Query  1052  AIAQLRQDLTITGGSVQRPSRVEALTALVWAAVINATPTQTAT-----LSCMVNLRRRME  888
             +I  L+     +   V +P+RVEA++A +W   + AT T + T     L+   +LR R+ 
Sbjct  240   SIEALQAK--ASSFEVTQPTRVEAVSAFIWKLAMKATRTVSRTSKPSILANSASLRSRVS  297

Query  887   PPLPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWL  708
             PP   N +G LV       +E +    + T V  ++R +  FR   D    K+ G G   
Sbjct  298   PPFTKNSIGNLVSYFAAKAEEGEKQRKLQTLVAEIRRAKQRFR---DDHIPKLVGNGDAT  354

Query  707   RAVIARGYE---LVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVV--NMLDNSWVLFLD  543
               +     E   ++ +        +S CR   YE+DFGWGKP      ++   + V  +D
Sbjct  355   EVICNYQKEAGNMIASGGFDFYILTSACRFGLYEIDFGWGKPVWFAFPSVRQKNIVALVD  414

Query  542   AI-NGAVEVWMKLPKQVMHTLTQDRHFLAYVSAFP  441
                 G +E W+ L +Q M    +DR  L + S  P
Sbjct  415   TKEGGGIEAWVNLNEQEMKLFEEDRELLDFASVNP  449



>emb|CDY04190.1| BnaA09g19680D [Brassica napus]
Length=459

 Score =   201 bits (512),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 151/455 (33%), Positives = 233/455 (51%), Gaps = 37/455 (8%)
 Frame = -2

Query  1757  ITMKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGACHHTKT  1578
             +T +VEV S++I +PSSPTP  LKN+KLS L+QL   +  P +FFY +   +     T+ 
Sbjct  16    LTTRVEVISRDIIKPSSPTPNHLKNFKLSLLEQLGPTIFGPMLFFYSA---NYRIKQTEQ  72

Query  1577  IDElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEMEKIK  1398
             +  LKKSLS+TL+  YPL+GR+  +  +I C+D G +F+ A V   +S LL+ P  E ++
Sbjct  73    LLNLKKSLSETLTHFYPLSGRLNGN-TSINCNDSGADFLEAQVNSPLSNLLQEPSSEMLE  131

Query  1397  QLIPSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRG  1218
             QLIP++ V   +   K L+A Q   F CGG+AIG  VSH +ADA+++  FM+ W++    
Sbjct  132   QLIPTS-VDSIEARTKLLLA-QATFFKCGGMAIGVCVSHKLADATSVGLFMKSWSAITSQ  189

Query  1217  CAANNGSGFVSDHSSILFPP--LTDTS---AIEQLMKMGAEGIEQEEKDMIVKRFVIPAN  1053
              +       V D   I FPP   ++TS    +E  +KM            + KRFV  ++
Sbjct  190   GSIKTVGSPVFDTLKI-FPPGNFSETSPAPVVEPDIKMN---------QTLSKRFVFDSS  239

Query  1052  AIAQLRQDLTITGGSVQRPSRVEALTALVWAAVINATPTQTAT-----LSCMVNLRRRME  888
             +I  L+     +   V +P+RVEA++A +W   + AT T + T     L+   +LR R+ 
Sbjct  240   SIEALQAK--ASSFEVTQPTRVEAVSAFIWKLAMKATRTVSRTSKPSILANSASLRSRVS  297

Query  887   PPLPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWL  708
             PP   N +G LV       +E +    + T V  ++R +  FR   D    K+ G G   
Sbjct  298   PPFTKNSIGNLVSYFAAKAEEGEKQRKLQTLVAEIRRAKQRFR---DEHIPKLVGNGDAT  354

Query  707   RAVIARGYE---LVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVV--NMLDNSWVLFLD  543
               +     E   ++ +        +S CR   YE+DFGWGKP      ++   + V  +D
Sbjct  355   EVICNHQKEAGDMIASGGFDFYILTSACRFGLYEIDFGWGKPVWFAFPSVRQKNIVALVD  414

Query  542   AI-NGAVEVWMKLPKQVMHTLTQDRHFLAYVSAFP  441
                 G +E W+ L +Q M    +DR  L + S  P
Sbjct  415   TKEGGGIEAWVNLNEQEMKLFEEDRELLDFASVNP  449



>ref|XP_006479029.1| PREDICTED: vinorine synthase-like [Citrus sinensis]
Length=442

 Score =   201 bits (511),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 150/448 (33%), Positives = 236/448 (53%), Gaps = 26/448 (6%)
 Frame = -2

Query  1751  MKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGACHHTKTID  1572
             M++   S EI +PSSPTPQ LK +KLS LDQ+  + + P + FY   T S      KT D
Sbjct  1     MEINNVSSEIIKPSSPTPQHLKTHKLSVLDQVAGDSLFPIILFYPQ-TCSNNTSLNKTTD  59

Query  1571  ElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVAD-VAENMSCLLENPEMEKIKQ  1395
              LK+SLS+TL+L +P AGR+K D+ +I+CDD G  FI A   A +MS +++ P ++ ++Q
Sbjct  60    LLKRSLSRTLTLYHPFAGRLK-DEFSIDCDDTGATFIEARAAASDMSEIVKQPTVDMLEQ  118

Query  1394  LIPSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGC  1215
             L+P  K+ E   V   L A       CGG+A+    SH IAD +  A F++ W +F  G 
Sbjct  119   LMP-YKLNEKPSVAVNLAAKVTYFEHCGGMALCVCFSHVIADITTAANFIKTWVTFASGS  177

Query  1214  AANNGSGFVSDHS----SILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAI  1047
               ++    V  H+    S +FPP   +S    ++   AE + +   +++ KRF+   + I
Sbjct  178   DTSSEDDDVIKHAVFGCSSIFPPQKFSSFSRNVI---AENLSK-SAEILTKRFIFEGDKI  233

Query  1046  AQLRQDLTITGGSVQRPSRVEALTALVWAAVIN----ATPTQTATL--SCMVNLRRRMEP  885
             A L++ +     S   P+RVEA++A++   +++    A     + L  S  VNLR R+ P
Sbjct  234   AALKEKMGSESSSGYHPTRVEAVSAIILGGIMSVEKEADDFNHSHLVASIAVNLRNRVNP  293

Query  884   PLPPNCLGTLVDEAIV-LCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWL  708
             P+P   +G +V   I  L  E K     +    L + +  +   + D   RK + +GG+L
Sbjct  294   PIPEQSIGNIVQAGIAKLPIEKK----TIDYRNLAETLHKSIEKINDEYLRKFHADGGFL  349

Query  707   RAVIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVVNMLDNSWV-LFLDAING  531
              + +    E + +++      S+ CR   YE DFGWGKP  V  ++ +  V + LD+ +G
Sbjct  350   -SNMNDVLEGLFDKNCRWFTISAWCRRPLYEADFGWGKPVWVSTVMKHKDVAVLLDSSDG  408

Query  530   -AVEVWMKLPKQVMHTLTQDRHFLAYVS  450
               +E W+ LPK+ M    QD   L Y S
Sbjct  409   KGIEAWVALPKKDMAKFEQDSGILRYAS  436



>ref|XP_010682887.1| PREDICTED: vinorine synthase-like [Beta vulgaris subsp. vulgaris]
Length=426

 Score =   200 bits (509),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 145/447 (32%), Positives = 230/447 (51%), Gaps = 33/447 (7%)
 Frame = -2

Query  1751  MKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGACHHTKTID  1572
             M+VE+ SKE  +PS PTP   K Y+LS LDQL  ++  P + FY++PT            
Sbjct  1     MEVEIISKEAIKPSKPTPSHCKLYRLSSLDQLSPSIYVPILLFYEAPTTPQ--KRADLSS  58

Query  1571  ElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEMEKIKQL  1392
             +LK SLS+TL+  YP AGR+K D   I+CDDEG  FI A    N+  +L  P++E +  L
Sbjct  59    QLKSSLSETLTYYYPFAGRIK-DGSYIDCDDEGSLFIEAQAKNNLVDILTFPKLEALDVL  117

Query  1391  IPSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGCA  1212
              P  K ++      +++AVQ++ F CGG++IG  +SH IADA  +  F+  WAS  R   
Sbjct  118   FPDEKQWK-SSRNSSVLAVQLSYFDCGGLSIGICISHKIADACTIFTFLNDWASQARKSG  176

Query  1211  ANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQLRQ  1032
              +    F   +++ +FPP  D   I +L        E  + +++ +R+V     I++L+ 
Sbjct  177   ESICPLF---NTTSIFPP-NDEFVIPEL--------EFVKSNVVTRRYVFHPTKISELKA  224

Query  1031  DLTITGGSVQRPSRVEALTALVWAAVINATP------TQTATLSCMVNLRRRMEPPLPPN  870
              +     S+  P+RVE +T+L++ ++I AT        ++  L+  VN+R RM PPL  N
Sbjct  225   TIVSNSNSLHNPTRVEVVTSLIFNSIIQATKIRSFGLVKSYVLAQTVNMRSRMVPPLVRN  284

Query  869   CLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLRAVIAR  690
              +G +V    V+ ++ +D    ++   L  ++R+    + D  A+ V G+  WL    A 
Sbjct  285   SMGNIVWYFPVMIKDNED----ISLERLATQMREGLVKLCDF-AKNVEGK-DWLLMAAAS  338

Query  689   GYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVVNM---LDNSWVLFLDAING-AVE  522
                   +  +     SS C+   Y+VDFGWG P  V        N+ +  +D  +G  +E
Sbjct  339   ENNGSEHSMNDAYKISSWCKYPVYQVDFGWGNPMWVSTAEYPYKNN-IFLIDCKDGEGIE  397

Query  521   VWMKLPKQVMHTLTQDRHFLAYVSAFP  441
              W+ L + VM  L  D  FL + S  P
Sbjct  398   AWVTLDEDVMFILQGDEEFLKFASLNP  424



>emb|CDP13291.1| unnamed protein product [Coffea canephora]
Length=443

 Score =   201 bits (510),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 147/454 (32%), Positives = 232/454 (51%), Gaps = 38/454 (8%)
 Frame = -2

Query  1751  MKVEVR--SKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPT--ISGACHHT  1584
             MKV+V+  S+   +PSSPTP  L++Y LSFLDQ++  +  P V FY S    +  +    
Sbjct  1     MKVDVQVISRYTIKPSSPTPDHLQHYPLSFLDQINPPVFMPLVLFYPSEQNHLITSTPGP  60

Query  1583  KTIDElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEMEK  1404
               +++LKKSLS+ L+  YPLAGR+  +   ++C+DEG+ ++ A  +  +S  L+NP   +
Sbjct  61    DKLNQLKKSLSEALTRFYPLAGRLIGN-TYVDCNDEGIPYVEARASCGLSDFLDNPIPGE  119

Query  1403  IKQLIPSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFN  1224
             + + +P   + + + +G   + +QV  F CGG+A+G  +SH IADA++L  F+  WA+ +
Sbjct  120   LNKFLP-CDLDDVKDIG---MVIQVTLFECGGVAVGVAISHKIADATSLFLFVTSWATIS  175

Query  1223  RGCAANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIA  1044
             R  + +  S      S+ +FPP  D +     + M    ++++E  ++ KR V  A  IA
Sbjct  176   RRDSHDTRSPIY--ESAAIFPP-RDVAGYNHALGM----VKKDE--IVTKRLVFTATKIA  226

Query  1043  QLRQDLTITGGSVQ-------RPSRVEALTALVWAAVINATPTQTAT------LSCMVNL  903
              LR+  T    +         RP+R+EAL+A +W   + AT            L+  VNL
Sbjct  227   SLREKYTTNSNTATGDEYHQIRPTRIEALSAFIWTRFLTATTGHKVNRDKMYMLNHAVNL  286

Query  902   RRRMEPPLPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYG  723
             R RM PPL     G L   AI +     D         +V ++RDA R V   +      
Sbjct  287   RPRMHPPLSECYFGNLSRPAITIPSFDNDE----QGYGIVNQVRDAIRNVGGDQYVTKLR  342

Query  722   EGGWLRAVIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLV--VNMLDNSWVLF  549
             EG      I    +LV   +  +   +SLCR   YE DFGWGKP  +   ++   + V+F
Sbjct  343   EGDKHLNFIRERAKLVNKGEVVSFSFTSLCRFPSYEADFGWGKPVWIGSASLTFKNLVVF  402

Query  548   LDAING-AVEVWMKLPKQVMHTLTQDRHFLAYVS  450
             LD  +G  +E W+ +  + M  L  D+  L YVS
Sbjct  403   LDTRSGDGIEAWINMKLEDMAKLEADKELLKYVS  436



>ref|XP_011070326.1| PREDICTED: vinorine synthase-like [Sesamum indicum]
Length=437

 Score =   200 bits (509),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 149/453 (33%), Positives = 232/453 (51%), Gaps = 40/453 (9%)
 Frame = -2

Query  1757  ITMKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGACHHTKT  1578
             + +++EV SKE  +PSSPTP++L  Y+LSF+DQ+   +  P V+FY +        +   
Sbjct  1     MEIEIEVVSKETIKPSSPTPESLGKYQLSFIDQIAPPIFMPLVYFYQA---DARFSNPGK  57

Query  1577  IDElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEMEKIK  1398
              D LK+SLSK LS  YPLAGRV +D + I+C+D+G  ++ A    ++S ++ NP    + 
Sbjct  58    SDHLKQSLSKVLSRFYPLAGRVVDD-LYIDCNDKGAPYVEAVANCSLSQVITNPVPMNMN  116

Query  1397  QLIPSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRG  1218
             + +P    Y+   V    +AVQV  F CGG A+G  +SH IADA +       WA+  R 
Sbjct  117   KFLP----YKLDDVQNLGMAVQVTHFQCGGTAVGLVISHKIADALSFFLLANTWAAVARN  172

Query  1217  CAANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQL  1038
                ++  G   + + I FPP  + +  +      + GI +E+  ++ K F  PA+ I+ L
Sbjct  173   GNYDDVPGPKFEGAKI-FPP-RNAAGFKP-----STGIVKEQ--LVTKIFTFPASKISTL  223

Query  1037  RQDLTITGGSVQ----RPSRVEALTALVWAAVINAT-----PTQTATLSCMVNLRRRMEP  885
             R+    +GG+ +    RP+RVEAL+A +W   I+AT     P +  T+   VNLR R++P
Sbjct  224   RE--RYSGGATEFLHRRPTRVEALSAFIWTRFISATGMKADPNKIYTVLHAVNLRTRLDP  281

Query  884   PLPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLR  705
             PL     G +   AI +     D G       L+Q++R+A R+V +GE      +G    
Sbjct  282   PLSEYHFGNISRLAIAMPSVGADDGCA-----LLQKVREAIRSV-NGEYVAQLRQGDKHL  335

Query  704   AVIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVVN--MLDNSWVLFLDAING  531
               +          +  T   +SLCR   Y  DFGWGKP  V +  +   + V F+D   G
Sbjct  336   NFLKERMAQANKSELHTFNFTSLCRFPLYGADFGWGKPVWVASAGLTYKNLVTFMDTATG  395

Query  530   -AVEVWMKLPKQVMHTLTQD---RHFLAYVSAF  444
               +E W+ L ++ M     D   + FL+ V  F
Sbjct  396   EGIEAWINLTQEDMEKFEADLELQEFLSKVKTF  428



>ref|XP_008390114.1| PREDICTED: vinorine synthase-like [Malus domestica]
Length=435

 Score =   200 bits (509),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 148/456 (32%), Positives = 236/456 (52%), Gaps = 40/456 (9%)
 Frame = -2

Query  1757  ITMKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGACHHTKT  1578
             + MK+E+ S++  +PSSP P  LK+YKLS L+Q+      P + FY +P        T  
Sbjct  1     MQMKIEIVSEDQCKPSSPIPDHLKSYKLSLLEQIAPMFYVPVILFYSAPE---NIDDTTI  57

Query  1577  IDElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEMEKIK  1398
             +D+L  SLS+TL+  YPLAGR+ E   +++C+D  V F  A     +S +L+ PEM+ ++
Sbjct  58    VDKLNNSLSETLTGFYPLAGRI-EGNASVDCEDGAVXFARARANIQLSEILKIPEMDLVQ  116

Query  1397  QLIPSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRG  1218
             QL+P            A +A+Q+N F CGG+ I   +SH IAD + L+ F++ WA+ +RG
Sbjct  117   QLLPLDPYNIRMDKAVAAMAIQLNFFDCGGMGIVICLSHKIADGATLSSFLDAWATRSRG  176

Query  1217  CAANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQL  1038
                N        +S+ +FPP       ++ + M +  I++E+   + KRFV  A+++A+L
Sbjct  177   VFENITPSL---NSANIFPPR------DKQIFMPSNLIKREK--FVTKRFVFDASSLAKL  225

Query  1037  R----QDLTITGGSVQRPSRVEALTALVWAAVINAT------PTQTATLSCMVNLRRRME  888
             +    + L   G   + P+RVEALTAL+  + +NA          +  +S +  LR RM 
Sbjct  226   KVKASKGLCTDG---RAPTRVEALTALICKSSMNAKIGTLGRGRPSMAISHVGYLRERMA  282

Query  887   PPLPPNCLGTL--VDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGG  714
             PPLP +  G +  V  A ++  E+K         + V ++R   R + D   RK+ GE G
Sbjct  283   PPLPEHSFGNIWRVAVASIMKDESKP-----ELHDFVVQLRKVIRKIDDDCVRKLQGEDG  337

Query  713   WLRAV--IARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPR--LVVNMLDNSWVLFL  546
             +  A   +    ELV   +      SS  R + Y  DFGWGKP    + N+   + V+ L
Sbjct  338   FSHACEPLKETSELVSEGEVEFFRFSSWIRFSLYNTDFGWGKPTWACISNVPIKNVVILL  397

Query  545   DAING-AVEVWMKLPKQVMHTLTQDRHFLAYVSAFP  441
              + +G  +E W+ L ++ M     D   L +VS  P
Sbjct  398   SSSSGDGIEAWVTLDEEDMAKFESDHELLEFVSVAP  433



>emb|CDP08578.1| unnamed protein product [Coffea canephora]
Length=431

 Score =   200 bits (508),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 137/436 (31%), Positives = 214/436 (49%), Gaps = 24/436 (6%)
 Frame = -2

Query  1745  VEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGACHHTKTIDEl  1566
             +E+ SKE+ +PSSPTP  L+++KLSFLDQ+   +  P +FFY +  +       +    L
Sbjct  5     LEILSKEMIKPSSPTPHHLRDHKLSFLDQIAPPVFIPLIFFYQTNQLETFQDRDQISQLL  64

Query  1565  kkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEMEKIKQLIP  1386
             K+SLS  L+  YPLAGR+     +I+C+D+G   I A V  N+  ++E P ME++KQ +P
Sbjct  65    KQSLSNILTQFYPLAGRICSKNFSIDCNDDGALCIEAQVHSNLLQVIEKPVMEELKQYLP  124

Query  1385  ---SAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGC  1215
                ++K          L+A+Q+N F CGGIAIG  +SH IAD ++L  FM  WA   + C
Sbjct  125   LELNSKGPGLTEAKTILLAIQINFFDCGGIAIGVQLSHKIADGTSLVTFMNAWA---KSC  181

Query  1214  AANNGSGFVSDHSSILFPPLTDTS-AIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQL  1038
             +  +     S   + LFPP   +S   +    M  E I       + KRFV     +A+L
Sbjct  182   SEVSEIVPSSFELASLFPPRDMSSFGFKPTTGMTKEKI-------VTKRFVFDKEKLAKL  234

Query  1037  RQDLTITGGSVQRPSRVEALTALVWAAVINATPTQTATLSCMVNLRRRMEPPLPPNCLGT  858
             +Q        V+ P+RVEA++A +W   I+A+  +       VN+R RM P L  +  G 
Sbjct  235   KQ--AAASSLVKDPTRVEAVSAFIWRHFIDASKAKVVAAVHAVNMRPRMNPALEDHAFGN  292

Query  857   LVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLRAVIARGYEL  678
             +    + +     + G       LV  +R A R +     +K+     +L+ ++ +  E 
Sbjct  293   IWTHTVAIPMLEGEKGY----ENLVGDLRKAIRNINSNYVKKLQNGDEYLK-ILKKSVEF  347

Query  677   VRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVVNM---LDNSWVLFLDAINGAVEVWMKL  507
                 D      SS CR   YEVDFGWGKP  V        N  +L   +    +E W+ +
Sbjct  348   ASKGDVELCNFSSWCRFPVYEVDFGWGKPTWVSTTAFPFKNVVILMSTSCGEGIEAWLNM  407

Query  506   PKQVMHTLTQDRHFLA  459
              +  + +   +   L+
Sbjct  408   HEDDVPSFQSNHRHLS  423



>ref|XP_010100293.1| Vinorine synthase [Morus notabilis]
 gb|EXB82427.1| Vinorine synthase [Morus notabilis]
Length=438

 Score =   200 bits (509),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 154/460 (33%), Positives = 230/460 (50%), Gaps = 49/460 (11%)
 Frame = -2

Query  1757  ITMKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFY-----------DSP  1611
             + +++E+ SKE  +PSSPTP  L++Y+LSFLDQL   +  P++ FY           +  
Sbjct  1     MEVEIELISKEFIKPSSPTPDHLRHYQLSFLDQLSPKVYNPWLLFYLLNNDDHVHHSEFN  60

Query  1610  TISGACHHTKTIDElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSC  1431
              I+   +H K       SLS+ LSL YPLAGRVK+    I+C+DEGV F  A V   +S 
Sbjct  61    NITNISYHLKK------SLSQVLSLYYPLAGRVKDGLNIIDCNDEGVPFFEARVKGKLSD  114

Query  1430  LLENPEMEKIKQLIPSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAK  1251
             +++NP + ++ + +P    ++   V +  + +Q+N F CGGIAIG   SH ++DA +   
Sbjct  115   VIDNPNINELDRFLP----FKLDDVTELALGLQINVFECGGIAIGVCNSHQLSDALSNIT  170

Query  1250  FMEIWASFNRGCAANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKR  1071
             F++ W +  R         F+   S  LFPP       + L+ +    I    K+++ KR
Sbjct  171   FIKTWVATARREPDIVRPEFI---SGKLFPP-------KNLVGLNP-SIGITRKNIMTKR  219

Query  1070  FVIPANAIAQLR--QDLTITGGSVQRPSRVEALTALVWAAVINAT--------PTQTATL  921
             FV  A  I  LR   D    G   +RPSRVEAL+A +W+  + AT          +T  +
Sbjct  220   FVFKAATIEALRAKYDENSLGEDRRRPSRVEALSAFIWSRFVAATNGDQSGHDDQKTYIV  279

Query  920   SCMVNLRRRMEPPLPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGE  741
                VNLR R EPPL  N  G     AI +    K G  +      V+++R+  R +    
Sbjct  280   LHAVNLRPRFEPPLGENHFGNYFRVAITV-PSLKTGEDLCHG--FVRQVREEIRKIDKEF  336

Query  740   ARKVYGEGGWLRAVIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVVNMLDN-  564
              RK+      L  +  R    V+  +  T   +SLCR   YE DFGWGKP  V +   N 
Sbjct  337   VRKLQEGNEHLELLKDRSEGFVKG-EVITFAFTSLCRFPVYEADFGWGKPTWVGSAALNF  395

Query  563   -SWVLFLDAING-AVEVWMKLPKQVMHTLTQDRHFLAYVS  450
              +  +F+DA NG  +E ++ L  + +  L  D+ F A VS
Sbjct  396   HNVTVFMDAKNGDGIEAYLSLKDEDLAKLEVDKEFQACVS  435



>ref|XP_008383117.1| PREDICTED: vinorine synthase-like [Malus domestica]
Length=451

 Score =   200 bits (509),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 152/471 (32%), Positives = 236/471 (50%), Gaps = 67/471 (14%)
 Frame = -2

Query  1754  TMKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFY----DSPTISGACHH  1587
             +++VE   K+  +PSS TP  L+N+KLS LDQ       PF+ FY     + T + + H 
Sbjct  5     SVEVETVEKQTVKPSSQTPHVLRNFKLSLLDQFSPVAYIPFLLFYPNVVSTTTSNVSTHS  64

Query  1586  TKTIDElkkslsktlsLM----YPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLEN  1419
              K I+E  + L K+LS +    YPLAGR+K + V I C+D+G EF+ A V  ++S +LE+
Sbjct  65    VKAINERYQHLIKSLSEILTHYYPLAGRIKGN-VVIVCNDDGAEFVKAHVKCSLSEILEH  123

Query  1418  PEMEKIKQLIPSAKVYEPQP---VGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKF  1248
             P+ E +++L+P     EP+    V   L+AVQVN F CGG+AIG  +SH IADAS +  F
Sbjct  124   PDAEMLRRLLP----IEPESTEAVTGKLLAVQVNLFECGGMAIGLTISHKIADASTVCTF  179

Query  1247  MEIWASFNRGCAANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRF  1068
             +  WA+       +N         + LFPPL  + +    M      I  +EK    +R+
Sbjct  180   INSWAA---TAHKSNKVMLPQFGVASLFPPLDFSDSEPPSM------IYVKEK-CTTRRY  229

Query  1067  VIPANAIAQLRQDLTITGGSVQRPSRVEALTALVWAAVINATPTQTAT-----------L  921
             V   + I+ L+    ++   V +P+RVEA++AL+W   I A+P  ++             
Sbjct  230   VFDDSKISVLQSK--VSSSLVPKPTRVEAISALIWKCAIEASPKSSSNTLGSSPVRPSIF  287

Query  920   SCMVNLRRRMEPPLPPNCLGTLVDEAIVLCQEAKDGGTVVTAV-ELVQRIRDAFRAVKDG  744
                VNLR+R+ PPLP N  G L+   ++   +A++  T V  + +LV +IR     +K+ 
Sbjct  288   HQAVNLRKRVTPPLPDNLAGNLL---VLSTSKAEESTTSVFDLKDLVAKIRAGIEEMKEC  344

Query  743   EARKVYGEGGWLRAVIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVVNMLDN  564
              A K+      ++ +      L+++++  T   +S CR  +Y  DFGWG P         
Sbjct  345   -ATKLVDPNEAMQVLTEYRTNLMKDQEIETYSCTSWCRFPFYGADFGWGMP---------  394

Query  563   SWVLFLDA-------------INGAVEVWMKLPKQVMHTLTQDRHFLAYVS  450
             SWV F                 NG +E W+ L ++ M         LAY S
Sbjct  395   SWVSFAGCSVKNLFGFMDKRDCNG-IETWLTLSEESMALFESKPKLLAYAS  444



>gb|KDP30966.1| hypothetical protein JCGZ_11342 [Jatropha curcas]
Length=454

 Score =   200 bits (508),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 152/454 (33%), Positives = 229/454 (50%), Gaps = 35/454 (8%)
 Frame = -2

Query  1754  TMKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGACHHTKTI  1575
             ++ V + S+E  +PSSPTPQ LK +KLS LDQL      P + +Y +PT      + + I
Sbjct  3     SVNVLIVSRETIKPSSPTPQNLKCFKLSLLDQLAPAAYVPMILYY-APTADSIVKNQERI  61

Query  1574  DElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEMEKIKQ  1395
             + LKKSLS+TL+  YPLAGRVK++ + IEC+D+G++FI A +  ++S +L  PE   + +
Sbjct  62    NLLKKSLSQTLTKFYPLAGRVKQN-LFIECNDQGIDFIEAKLNCSLSDILRRPEAHILDR  120

Query  1394  LIPSAKVYEPQPVGK--ALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNR  1221
              +P    +         + + +QVN FSCGG+AIG  +SH + D      F+  WA+  R
Sbjct  121   FLPQEYHFHVSSSSTKCSQMGIQVNSFSCGGMAIGTSISHKLVDGITFTSFINTWAAMAR  180

Query  1220  GCAANNGSG-FVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIA  1044
             G   N  S  FV  H   +FPP      I  L+ +    ++  +     KRFV   + I 
Sbjct  181   GSNDNLLSPIFVGPH---IFPP----KDIYGLLPV----LDIPKAKNTTKRFVFDLSKIG  229

Query  1043  QLRQDL----------TITGGSVQRPSRVEALTALVWAAVINATPTQTATLSCM-VNLRR  897
              LR+ L               +   PSRVE ++AL+W   I+A+ T+  + S   VNLR 
Sbjct  230   LLRERLFGNGNSSVNNKNNNNNNNLPSRVEIVSALIWKCAIDASRTKKPSFSTQTVNLRA  289

Query  896   RMEPPLPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEG  717
             RM+PPLP +  G L+  AI       DG + +   +LV ++R+A +       +K+ GE 
Sbjct  290   RMDPPLPESAAGNLLWLAI--APAPSDGSSKIEIQDLVYQVRNALKKFDTDYVKKLQGEN  347

Query  716   GW--LRAVIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVVN---MLDNSWVL  552
             G   L   + +  EL         +T SL +   YE DFGWGKP  + +      N  VL
Sbjct  348   GSLVLEETLKQITELALKHVDIYRFT-SLRKFQLYEGDFGWGKPVWISSAGLTFKNVVVL  406

Query  551   FLDAINGAVEVWMKLPKQVMHTLTQDRHFLAYVS  450
                     VE W+ L +Q M     ++  L++ S
Sbjct  407   IESRAGDRVEAWVTLDQQEMAVFECNQEILSFDS  440



>ref|XP_006427936.1| hypothetical protein CICLE_v10027290mg [Citrus clementina]
 gb|ESR41176.1| hypothetical protein CICLE_v10027290mg [Citrus clementina]
Length=439

 Score =   199 bits (507),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 156/455 (34%), Positives = 234/455 (51%), Gaps = 45/455 (10%)
 Frame = -2

Query  1745  VEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGACHHT--KTID  1572
             V++ S E  +PSSPTP+ L+ Y+LS LDQ+  NL  PFVFFY     S   H    K  D
Sbjct  4     VQIISTEAIKPSSPTPKHLRTYELSMLDQMFSNLYMPFVFFY-----SANKHQDFRKNSD  58

Query  1571  ElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEMEKIKQL  1392
              LK+SL+KTL+  YPLAGR   D  ++EC+D GV FI A V  +MS  L+ P M  ++QL
Sbjct  59    FLKQSLAKTLTHYYPLAGRFV-DSFSVECNDHGVTFIEAQVGCDMSKFLQPPNMGVMQQL  117

Query  1391  IP-SAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGC  1215
             IP S +    +   +AL+AVQVN FS G +AIG  + H +AD SA++ FM++WA  NRG 
Sbjct  118   IPPSPQSLRLEASERALLAVQVNYFSTGDVAIGICIWHGLADGSAISNFMKLWAEINRGV  177

Query  1214  AANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQLR  1035
               N  +  V D +S LFPP   +S  +Q +K       Q    ++ KR       I  L+
Sbjct  178   NENICNNVVLDCTS-LFPP--HSSLKDQHIK------PQLTSKVVFKRLFFDGKKIVALK  228

Query  1034  QDLT--ITGGSVQ---RPSRVEALTALVWAAVINATPTQ---------TATLSCMVNLRR  897
             + +   I  GS     + SR   +++L+W A I     +         +  +   +NLR 
Sbjct  229   EKVNKEIMVGSFDHELQASRFMVVSSLIWGAFIAVAQERKRAINNKLYSHAMYYTMNLRS  288

Query  896   RMEPPLPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEG  717
             +M PP+ P C+G +     V  +    G   + A  LV+++  A R V +      Y   
Sbjct  289   KMNPPMIPQCMGNIF--RFVRAEWPLVGDDDIEATSLVKKVIKAKRNVSNVMNNIEY--L  344

Query  716   GWLRAVIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKP---RLVVNMLDNSWVLFL  546
             G+++  +   +E     DS +L  +S+  + YYE DFGWGKP    +    L N+ +L  
Sbjct  345   GFMKD-MNEAWE-----DSRSLTLTSVVGLRYYEADFGWGKPVWLSIGSVSLPNAALLSD  398

Query  545   DAINGAVEVWMKLPKQVMHTLTQDRHFLAYVSAFP  441
              +    VE W+ L ++ M    ++   +A+ S+ P
Sbjct  399   TSDGKGVEAWVVLYEEDMDKFEKNPSIMAHASSNP  433



>ref|XP_004310187.1| PREDICTED: salutaridinol 7-O-acetyltransferase-like [Fragaria 
vesca subsp. vesca]
Length=437

 Score =   199 bits (506),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 159/461 (34%), Positives = 239/461 (52%), Gaps = 52/461 (11%)
 Frame = -2

Query  1751  MKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGACHHTKTI-  1575
             M+VE+ S+E  +PS+PT    + Y LSFL+QL+    TP V+FY  P  + A  H     
Sbjct  1     MEVEIVSRETIKPSTPTLPHYRTYNLSFLEQLNPRTYTPIVYFY--PKEASASDHYPNFC  58

Query  1574  ---DElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEMEK  1404
                D+LKKSLS+TL++ YP +GR+K D+V+I+C+DEGV FI A +   +S +LE P+ E+
Sbjct  59    DKSDQLKKSLSETLAIYYPFSGRIK-DRVSIDCNDEGVIFIEARIKVQLSQILEQPKDEE  117

Query  1403  IKQLIPSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFN  1224
             +  L      +        ++AVQV+ F CGG+AIG  +SH +AD S +  F+  WA+  
Sbjct  118   LDLLFTDKLQWNDDSNLTVILAVQVSFFDCGGMAIGICMSHKVADTSTMINFINDWAAMT  177

Query  1223  RGCAANN--GSGFVSDHSSILFP----PLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVI  1062
             R   A+      F+++    +FP    PL   S IE+              D I KR+V 
Sbjct  178   RDHKADQYVSPKFIAE---TVFPRGEIPLPPESVIEK-------------GDCISKRYVF  221

Query  1061  PANAIAQLRQDLTITGGSVQRPSRVEALTALVWAAVINATPTQTATLSC-------MVNL  903
              A+ IA L+    +    VQ P+RVE +TA +    I+A  + + +LS         VN+
Sbjct  222   DASKIAALK---ALVCDKVQNPTRVEVVTAFIHRCAISALKSNSGSLSNPNTLLIQTVNM  278

Query  902   RRRMEPPLPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYG  723
             R RM PPLP + +G++V    V   E +   +V+   ELV ++++   A   G   + +G
Sbjct  279   RARMVPPLPKSSVGSMVWYYAVSTAEEE---SVIELHELVTQMKERM-AQFCGTYLEKFG  334

Query  722   EGGWLRAVIARGYELVRNRDSSTLYT---SSLCRMAYYEVDFGWGKPRLVV---NMLDNS  561
             +  W    +    E  ++     L     SS CR   YE DFGWGKP  V     +L N+
Sbjct  335   K-EWPSIFLECMEESRKSFHIQNLVVYRCSSWCRFPIYEADFGWGKPIWVTIASCVLKNT  393

Query  560   WVLFLDAING-AVEVWMKLPKQVMHTLTQDRHFLAYVSAFP  441
              +  +DA NG  +EV++ L KQ M    +D   LA+ S  P
Sbjct  394   -IFLIDARNGEGIEVYVNLEKQHMDMFERDPELLAFASLNP  433



>gb|KDP30964.1| hypothetical protein JCGZ_11340 [Jatropha curcas]
Length=423

 Score =   198 bits (504),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 152/442 (34%), Positives = 242/442 (55%), Gaps = 26/442 (6%)
 Frame = -2

Query  1751  MKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGACHHTKTID  1572
             M+V++ SKEI +PSS  PQ  K Y LS LDQL   +  P + FY SP         K  D
Sbjct  1     MEVQIISKEIIKPSSSAPQNRKTYNLSLLDQLAPPVYIPIILFY-SPAFENG---YKISD  56

Query  1571  ElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSC-LLENPEMEKIKQ  1395
              LKKS S+TL+  YPLAGR+  D+ +I+C+D+G  ++ A V  +MS  L++ PE+ K+++
Sbjct  57    HLKKSFSETLTHFYPLAGRIN-DEFSIDCNDDGAPYVEARVNGDMSTVLIQEPEIHKLEK  115

Query  1394  LIPSAKVYEPQPVG-KALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRG  1218
             L+P      P  +  + ++A Q+N F CGGIAI   + HAIADASA+A F+  WA+   G
Sbjct  116   LLPC----NPHDLSSQVILAAQINHFDCGGIAISVCIWHAIADASAMASFITSWATIASG  171

Query  1217  CAANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQL  1038
              +  + +G + D +S LFPP  D         +  E + +    ++VKRF+  +  I+ L
Sbjct  172   -SNFDINGVIFDSTS-LFPP-QDMRGFSLHKFLSKELLSK----IVVKRFLFDSCNISAL  224

Query  1037  RQDLTITGGSVQRPSRVEALTALVWAAVINATPTQTATLSCMVNLRRRMEPPLPPNCLGT  858
             R+++   G  + RP+ VEA+ A++WAAV+ A   +    +  V LR+R+ P +P   +G 
Sbjct  225   REEVG-NGPCLDRPTMVEAVAAIIWAAVM-AGNEEEHVAAISVGLRKRIIPLIPELSIGN  282

Query  857   LVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLRAVIARGYEL  678
             +   AI  C + ++   V+    L   + ++   + +   RK++  G +   +  +  EL
Sbjct  283   IFQVAIANCSKNEN---VLDYNGLAGNLHESIERMNNEYVRKIHAGGRYFEFMKKKSEEL  339

Query  677   VRNRDSSTLYT-SSLCRMAYYEVDFGWGKPRLVVNMLDNSWV-LFLDAING-AVEVWMKL  507
              +N +   ++  SS CR  +YE DFGWGKP  V   L    V +F+D  +G  +E W+ L
Sbjct  340   GKNPNLMKVFGFSSWCRFPFYEADFGWGKPIWVGTALKLYKVAIFIDTKDGQGIEAWIAL  399

Query  506   PKQVMHTLTQDRHFLAYVSAFP  441
             PK+ M    ++    +Y S  P
Sbjct  400   PKEEMLKFEKNPGICSYASFKP  421



>ref|XP_010044503.1| PREDICTED: vinorine synthase-like [Eucalyptus grandis]
Length=434

 Score =   198 bits (504),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 146/445 (33%), Positives = 225/445 (51%), Gaps = 31/445 (7%)
 Frame = -2

Query  1757  ITMKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGACHHTKT  1578
             + + VE+ S+E  +PSSPTP  L++Y+LSFLDQ+   +  PFV FY         +    
Sbjct  1     MEIAVEITSRETVKPSSPTPDHLRHYRLSFLDQISPPVYNPFVLFYTPQNEDDQFNIDDI  60

Query  1577  IDElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEMEKIK  1398
               +LK SLS  L+  YPLAGR+K + V+IECDD GV +  A V   +S + ENP+ +++ 
Sbjct  61    SSKLKASLSCILTHFYPLAGRLKGN-VSIECDDVGVPYSEAIVKCQVSDVTENPDPQELG  119

Query  1397  QLIPSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRG  1218
             +L+P    +      +  + VQ N+F CGGIA+G  +SH I+DA +L  F+++WA+  RG
Sbjct  120   KLLP----FVLDVSDETTLGVQFNKFDCGGIAVGICMSHKISDALSLLTFIKMWAAVCRG  175

Query  1217  CAANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQL  1038
                     F S     LFPP  + S  E        GI ++  +++ KRF+   N I  L
Sbjct  176   EEIVTPPQFASAE---LFPP-KNISGFEP-----RTGITRD--NIVSKRFIFKTNKIETL  224

Query  1037  --RQDLTITGGSVQRPSRVEALTALVWAAV-----INATPTQTATLSCMVNLRRRMEPPL  879
               R    +  G  + PSRVEAL+  +W+       + + P++   +   VNLR + +PPL
Sbjct  225   KARYSKEMDLGQNRPPSRVEALSTFIWSRFAWSTRVYSEPSKKCIILHAVNLRTKFDPPL  284

Query  878   PPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLRAV  699
             P +  G     A+   Q   D G       L  ++R+  R +  G   K+  +G      
Sbjct  285   PQHSFGNFYRVAVTSLQ--LDSGKECYG--LAAKMRETVRGIDKGYVEKLR-DGKEHLDF  339

Query  698   IARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVVN--MLDNSWVLFLDAING-A  528
             I R  E+    +   +  +SLCR   YE DFGW  P  V +  +   + V+F+D  +G  
Sbjct  340   IKRSAEVYLKGELLAMNFTSLCRFPMYESDFGWDNPTWVGSPALTFQNLVVFMDTKSGDG  399

Query  527   VEVWMKLPKQVMHTLTQDRHFLAYV  453
             VE ++ L  + M  L  D  F+ +V
Sbjct  400   VEAYISLRVEDMAALESDEEFMEFV  424



>ref|XP_007039558.1| Anthranilate N-benzoyltransferase protein, putative [Theobroma 
cacao]
 gb|EOY24059.1| Anthranilate N-benzoyltransferase protein, putative [Theobroma 
cacao]
Length=444

 Score =   198 bits (504),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 144/458 (31%), Positives = 222/458 (48%), Gaps = 32/458 (7%)
 Frame = -2

Query  1757  ITMKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGAC--HHT  1584
             I +K E+ S++  +PS+PTP  LK +KLS LDQL   +     FFY S     +     +
Sbjct  2     IEIKSEIVSRQTIKPSTPTPSDLKTFKLSLLDQLSPAVHGNMTFFYPSSNTMDSIGDDFS  61

Query  1583  KTIDElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEMEK  1404
             +    L++S+SKTLSL YPL GR+ +D  TI+C+DEG  F  A V   +S  L  PE   
Sbjct  62    EKSQLLQESISKTLSLFYPLGGRL-QDAATIDCNDEGAFFAEAKVNIQLSEFLNQPEFNL  120

Query  1403  IKQLIPSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFN  1224
             +   +P+      +    A+  VQ+  F+CGG+AI   ++H +AD SAL   ++ W +  
Sbjct  121   MDHFLPTTDTKTMELSNGAMFIVQLTSFTCGGVAISLSLTHKLADVSALLTLLQSWTAVC  180

Query  1223  RGCAANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIA  1044
             RG +       + +       P  + SA+   + + AE         +++RFV  A+ IA
Sbjct  181   RGLSDPVTPDLIGEK---FLAPRDELSAMSASLNIAAE-------KFVLRRFVFSASKIA  230

Query  1043  QLRQ--DLTITGGSVQRPSRVEALTALVWAAVINATPTQTAT-----LSCMVNLRRRMEP  885
             +L+   D          PSRVE + AL+W   +     +T +     L   VNLR+RM P
Sbjct  231   ELKAKVDQEFQNEMQSHPSRVEVVLALLWKCAVACKKQKTGSFGPTALFQAVNLRKRMSP  290

Query  884   PLPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLR  705
             PLP   +G  +   +VL  E KD    +   ELV ++R +F    + +A    GE   L 
Sbjct  291   PLPETAIGNFIWPFMVLAHEEKD----LKLPELVIQMRKSFIEFNNTKANMFRGEAAPLA  346

Query  704   ---AVIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKP--RLVVNMLDNSWVLFLDA  540
                A+  RG     NR+ +    SS C+   Y+ DFGWGKP   + +N L ++ +   D 
Sbjct  347   IMGALKERGEFFRNNREMTVYKCSSWCKFPLYDTDFGWGKPLWHVSINKLVSNTIALADT  406

Query  539   IN-GAVEVWMKLPKQVMHTLTQDRHFLAYVSAFPKPKL  429
              +   +E  + L ++ M    Q+   L Y  A P P +
Sbjct  407   RSRDGIEALLTLDEEEMALFEQNEELLKY--ATPNPSI  442



>gb|KCW86592.1| hypothetical protein EUGRSUZ_B03224, partial [Eucalyptus grandis]
Length=423

 Score =   197 bits (501),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 145/444 (33%), Positives = 224/444 (50%), Gaps = 31/444 (7%)
 Frame = -2

Query  1757  ITMKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGACHHTKT  1578
             + + VE+ S+E  +PSSPTP  L++Y+LSFLDQ+   +  PFV FY         +    
Sbjct  1     MEIAVEITSRETVKPSSPTPDHLRHYRLSFLDQISPPVYNPFVLFYTPQNEDDQFNIDDI  60

Query  1577  IDElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEMEKIK  1398
               +LK SLS  L+  YPLAGR+K + V+IECDD GV +  A V   +S + ENP+ +++ 
Sbjct  61    SSKLKASLSCILTHFYPLAGRLKGN-VSIECDDVGVPYSEAIVKCQVSDVTENPDPQELG  119

Query  1397  QLIPSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRG  1218
             +L+P    +      +  + VQ N+F CGGIA+G  +SH I+DA +L  F+++WA+  RG
Sbjct  120   KLLP----FVLDVSDETTLGVQFNKFDCGGIAVGICMSHKISDALSLLTFIKMWAAVCRG  175

Query  1217  CAANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQL  1038
                     F S     LFPP  + S  E        GI ++  +++ KRF+   N I  L
Sbjct  176   EEIVTPPQFASAE---LFPP-KNISGFEP-----RTGITRD--NIVSKRFIFKTNKIETL  224

Query  1037  --RQDLTITGGSVQRPSRVEALTALVWAAV-----INATPTQTATLSCMVNLRRRMEPPL  879
               R    +  G  + PSRVEAL+  +W+       + + P++   +   VNLR + +PPL
Sbjct  225   KARYSKEMDLGQNRPPSRVEALSTFIWSRFAWSTRVYSEPSKKCIILHAVNLRTKFDPPL  284

Query  878   PPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLRAV  699
             P +  G     A+   Q   D G       L  ++R+  R +  G   K+  +G      
Sbjct  285   PQHSFGNFYRVAVTSLQ--LDSGKECYG--LAAKMRETVRGIDKGYVEKLR-DGKEHLDF  339

Query  698   IARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVVN--MLDNSWVLFLDAING-A  528
             I R  E+    +   +  +SLCR   YE DFGW  P  V +  +   + V+F+D  +G  
Sbjct  340   IKRSAEVYLKGELLAMNFTSLCRFPMYESDFGWDNPTWVGSPALTFQNLVVFMDTKSGDG  399

Query  527   VEVWMKLPKQVMHTLTQDRHFLAY  456
             VE ++ L  + M  L  D  F+ +
Sbjct  400   VEAYISLRVEDMAALESDEEFMEF  423



>ref|XP_006341810.1| PREDICTED: vinorine synthase-like [Solanum tuberosum]
Length=430

 Score =   197 bits (501),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 145/451 (32%), Positives = 222/451 (49%), Gaps = 37/451 (8%)
 Frame = -2

Query  1757  ITMKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGACHHTKT  1578
             + +++E+ SK I +PSS TP  L NYKLS+LDQ+  N++ P VFFY    ++    +T T
Sbjct  1     MKIEIEIISKLIIKPSSSTPHELHNYKLSYLDQITPNILMPLVFFY---PVNNNFTNTHT  57

Query  1577  IDElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEMEKIK  1398
              ++LK SLS TL+  YPL GR+      + C+DEGV ++ A    ++S  L +P   ++ 
Sbjct  58    SNQLKTSLSHTLTKFYPLGGRLDVANSHVNCNDEGVPYVEAIAKCSLSEFLLDPLPNELN  117

Query  1397  QLIPSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRG  1218
             + IP     +   V    + VQ N F CGG+AIG  +SH I DA +   F+  W +  RG
Sbjct  118   KFIPC----DLHDVKDFCLLVQANFFQCGGMAIGIAISHKITDALSTFMFINTWGAIARG  173

Query  1217  CAANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQL  1038
                     F    SSILFPP   T     +M         E+ +++ KRFV  A+ ++ L
Sbjct  174   SIDVPCPRF---DSSILFPPRDITKFKSSVM--------IEKDNIVTKRFVFSASKVSAL  222

Query  1037  RQDLTITGG-SVQRPSRVEALTALVWA---AVINATPTQTATLSCM--VNLRRRMEPPLP  876
             R   T  G  S + PSR+EAL+A +W    A ++A   +T     +  VNLR R  PPLP
Sbjct  223   RDKYTEKGSESTKPPSRIEALSAFLWTRLMASVHAERDETKIYGMVHTVNLRTRSNPPLP  282

Query  875   PNCLGTLVDEAIVLCQEAKDGGTVVTA--VELVQRIRDAFRAVKDGEARKVYGEGGWLRA  702
              +  G ++   I +     +          ELV+++R++   V       +        +
Sbjct  283   ESLFGNVMQVVITVPATNNNNNRTNEEQDFELVKKVRESINNVNSEFVSGLRKNDKKHLS  342

Query  701   VIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKP------RLVVNMLDNSWVLFLDA  540
              I       R  +      +SLCR+  Y+ DFGWGKP      RLV+  +    + FLD 
Sbjct  343   FIKEKANEQRKGELVVFNFTSLCRLPLYKADFGWGKPIWVGSARLVLKDV----IGFLDT  398

Query  539   ING-AVEVWMKLPKQVMHTLTQDRHFLAYVS  450
              +G  +E W+ L ++ M     D+  L++ S
Sbjct  399   KSGNGIEAWVNLKEEDMAIFEVDKELLSWCS  429



>ref|XP_008340165.1| PREDICTED: deacetylvindoline O-acetyltransferase-like [Malus 
domestica]
Length=437

 Score =   197 bits (501),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 148/450 (33%), Positives = 235/450 (52%), Gaps = 35/450 (8%)
 Frame = -2

Query  1751  MKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGACHHTKTID  1572
             M+V+  S+E+ +PS+PTP  L+ +KLS LDQ++     P V+FY            K+ +
Sbjct  4     MEVQNISREVIKPSTPTPPHLRTHKLSILDQINPRSYVPVVYFYPKEASDYWSVADKS-N  62

Query  1571  ElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAE-NMSCLLENPEMEKIKQ  1395
             +LKKSLS+TLS  YP AGR++ D+ +I+C+DEGV F+   +    +S +LENP+ E +  
Sbjct  63    QLKKSLSETLSKYYPFAGRIR-DRFSIDCNDEGVAFVETQIRNFKLSDILENPKDEDLAL  121

Query  1394  LIPSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGC  1215
             LI     +   P    +V VQV+ F CGG+A+G  +SH IADAS +  F+  WA+  R  
Sbjct  122   LISEDVAWNEDPDVSVIVDVQVSFFECGGMALGIGMSHKIADASTIINFVNDWAAVARDQ  181

Query  1214  AANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQLR  1035
                +   FV+++   +FP        +  + +  E +  E+ D + KRFV  A  IA L+
Sbjct  182   YVPSPE-FVAEN---IFP--------QGDLPLFPEAVP-EKSDCVAKRFVFDATKIAALK  228

Query  1034  QDLTITGGSVQRPSRVEALTALVWAAVINA------TPTQTATLSCMVNLRRRMEPPLPP  873
                 +    VQ P+RVE + A +++  I+A      + +    L+  VNLR RM PP+P 
Sbjct  229   ---ALVADKVQNPTRVEVVAAFIYSCTISALRLTSGSSSNPTVLTQSVNLRTRMVPPVPQ  285

Query  872   NCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGW--LRAV  699
             N +G +V   I     A+D  +V+   +LV +++       D  A+K  G+  W  +   
Sbjct  286   NSVGCMV--WIYTVSTAED--SVIELHDLVAQLKQNMTRFCDSYAQKFRGKDQWPVIFQX  341

Query  698   IARGYELVRNRDSSTLY-TSSLCRMAYYEVDFGWGKPRLVV--NMLDNSWVLFLDAING-  531
               +   +  +R +  +Y  +S CR   YEVDFGWGKP  +   +       + +D  NG 
Sbjct  342   CLQESMVEFSRPNLVMYKCTSWCRFPMYEVDFGWGKPIWITVPSCTTKDCFILIDTKNGE  401

Query  530   AVEVWMKLPKQVMHTLTQDRHFLAYVSAFP  441
              +E ++ L KQ +    +D   LA+ S  P
Sbjct  402   GIEAYVNLEKQQLDVFERDEELLAFASLNP  431



>gb|KDO46444.1| hypothetical protein CISIN_1g037811mg [Citrus sinensis]
Length=435

 Score =   197 bits (500),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 152/470 (32%), Positives = 224/470 (48%), Gaps = 68/470 (14%)
 Frame = -2

Query  1751  MKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGACHHTKTID  1572
             M++++ SK I +PSSPTP  LK +KLS LDQL  N  T  + FYD P+         TI+
Sbjct  1     MQLDIISKNIIKPSSPTPLHLKTHKLSLLDQLAPNNYTSLLLFYDGPSRFDDKTSASTIN  60

Query  1571  ElkkslsktlsLM---YPLAGRVKEDKVTIECDDEGVEFIVADVAE--NMSCLLENPEME  1407
             +     S     +   YP AG+V +D   ++CDD GV F+ A V    +MS +L+NPEM 
Sbjct  61    DYHHLKSSLSKTLTLYYPFAGKVLKDNYVVDCDDSGVPFVEARVPSSISMSEVLKNPEMN  120

Query  1406  KIKQLIPSAKVYEPQ-----PVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFME  1242
              ++QL+P    + P            +A+Q+N F+CGG+AIGF   H +ADA+A   F++
Sbjct  121   TLQQLLP----FNPNKKYLSSTDDVNMAIQINHFACGGVAIGFNFRHIVADATASIGFIK  176

Query  1241  IWASFNRGCAANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIE--QEEKDMIVKRF  1068
              WA  N   ++++ S     H  +     TDT    + +   A  I   Q   + + KRF
Sbjct  177   NWAKLN---SSDDNSIINYKHVVV---DCTDTFPRNKEIPSYARRINEWQRAPECVTKRF  230

Query  1067  VIPANAIAQLRQDLTITGGSVQRPSRVEALTALVWAAVINATPTQTATL-SCMVNLRRRM  891
             V     +A L++++ +                     +I      T+T+ S  VNLR RM
Sbjct  231   VFDGCKVAALKREMIL---------------------LIERNIDSTSTIESIPVNLRNRM  269

Query  890   EPPLPPNCLGTLVDEAIVLC---QEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGE  720
               PLP +C+G L     V C    EA DG        L + + ++ + V     RKVY +
Sbjct  270   NQPLPEDCIGNLFHS--VTCAANNEAGDGH--CDKSTLARNVHESKKMVGGDFVRKVYQD  325

Query  719   GGWLRAVIARGY-----ELVR---NRDSST----LYTSSLCRMAYYEVDFGWGKPRLVVN  576
             GG    V    Y     EL++   N D++        S    + +YE+DFGWGKP  V +
Sbjct  326   GG---VVFVNQYKEAVEELLKDGTNNDTTNSVRLFGFSGPMGLQFYEIDFGWGKPVWVTS  382

Query  575   -MLDNSWVLFLDAING-AVEVWMKLPKQVMHTLTQDRHFLAYVSAFPKPK  432
              M  ++  + LD  +G  VE W+ LP   M  L QD   L Y S  P P+
Sbjct  383   AMRMHNTAMLLDTRDGKGVEAWVGLPINDMPKLEQDPGILTYASFTPSPR  432



>ref|XP_008222079.1| PREDICTED: vinorine synthase-like [Prunus mume]
Length=438

 Score =   197 bits (500),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 150/450 (33%), Positives = 234/450 (52%), Gaps = 30/450 (7%)
 Frame = -2

Query  1757  ITMKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGACHHTKT  1578
             + ++VEV SKEI +PSSPTP  L++Y+ SFLDQ+   +  P + FY+    +   + T+ 
Sbjct  1     MKVEVEVISKEIIKPSSPTPDHLRHYQFSFLDQIAPQVYNPLLLFYEHKAKT-QFNITEI  59

Query  1577  IDElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAE-NMSCLLENPEMEKI  1401
              + LK SLS+ L+L YPLAGR+K ++  I C+DEG+ F  A V +  +S +L NP   ++
Sbjct  60    SNHLKNSLSEVLTLFYPLAGRIKHNQF-IHCNDEGIPFFEARVLDCTLSDVLNNPIPGEL  118

Query  1400  KQLIPSAKVYEPQPVGKAL-VAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFN  1224
              + +P    +E   +  +  + VQ+N F CGG AIG  +SH IAD  +   F +IWA+  
Sbjct  119   NKFMP----FELDDITNSFPLGVQLNIFQCGGFAIGQCISHKIADGLSYFMFSKIWAAIA  174

Query  1223  RGCAAN-NGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAI  1047
             RG  AN N   F+   SS LFPP     A +     G  GI    KD + KRFV  ++ I
Sbjct  175   RGDKANINPPEFI---SSTLFPPKEFNIAYD-----GGVGI---TKDRVTKRFVFDSSQI  223

Query  1046  AQLRQDLTITGGSVQRPSRVEALTALVWAAVINATPTQTAT----LSCMVNLRRRMEPPL  879
               LR          +R +RVE L+  +W+  + AT   T      +   VNLR R +PPL
Sbjct  224   ENLRARYEHNMHLKKRLTRVETLSTFLWSRFVAATKDCTMNKLYRVIHAVNLRPRFDPPL  283

Query  878   PPNCLGTLVDEAIV--LCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLR  705
             P +  G L   ++   L   +  G        ++Q +R+A   + +   +K+  +G    
Sbjct  284   PQSSFGNLFRFSMTAPLRIPSSGGDEECGHDVVIQAVREAVGKIDNEYVKKLQKQGDEHF  343

Query  704   AVIARGYELVRNRDSSTLYT-SSLCRMAYYEVDFGWGKPRLVVN--MLDNSWVLFLDAI-  537
              V+ +  +  +  +  TL + SS CR   Y+ DFG G+P  V +  +   + VLF+D   
Sbjct  344   GVMKKQADSFKRGEMGTLLSFSSYCRFPLYDNDFGLGRPTWVGSPALTYKNLVLFMDTKE  403

Query  536   NGAVEVWMKLPKQVMHTLTQDRHFLAYVSA  447
              G +E ++ L ++VM     D   L+YV++
Sbjct  404   GGGIEAYVSLEEEVMAKFECDSELLSYVAS  433



>ref|XP_006482379.1| PREDICTED: salutaridinol 7-O-acetyltransferase-like [Citrus sinensis]
Length=441

 Score =   196 bits (499),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 147/460 (32%), Positives = 213/460 (46%), Gaps = 49/460 (11%)
 Frame = -2

Query  1751  MKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGACHHTKTID  1572
             M++ + S E  +PSSPTP   + +KLSF+DQL+       + FY +   S      K++ 
Sbjct  1     MELRISSTENIKPSSPTPDHQRTHKLSFIDQLNPGAYFSIILFYSAGASSERL--KKSLS  58

Query  1571  ElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAE-NMSCLLENPEMEKIKQ  1395
             E            YP AG+ K++   ++CDD GV FI A     +MS +++  +   ++Q
Sbjct  59    ETLTH-------FYPFAGQFKDNHF-VDCDDHGVTFIEAHFHRGDMSEVIQQAKTNILEQ  110

Query  1394  LIPSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGC  1215
             LIP  K +E   V   L+ VQVN F CGG+AIG    H +ADA+  A F++ W    RG 
Sbjct  111   LIP-CKPHESTRVEHNLI-VQVNYFGCGGMAIGVCFHHKVADAATAANFLKTWGLHARGA  168

Query  1214  AANNGSGF---VSDHSSILFPPLTDTSAIEQLMKMGAE-GIEQEEKDMIVKRFVIPANAI  1047
              A + + F   + D +SI FP        + L  M    G+     D +VKRF      I
Sbjct  169   GAGDTNDFKHAIYDSNSI-FPA-------QDLPDMSVNLGLVLFSLDSVVKRFTFEGEKI  220

Query  1046  AQLRQDLTITGGSVQRPSRVEALTALVWAAVINA-------------TPTQTATLSCMVN  906
             A LR+ +      + RPSRVE +++++  A++ A              P    T    VN
Sbjct  221   ASLREKIVQAEPGLGRPSRVEVVSSVILGALLAAYRGSRDGDEEFTTAPLTHVTAIIAVN  280

Query  905   LRRRMEPPLPPNCLGTLVDEAI--VLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARK  732
             LR+RM PPLP    G +   A   +      D    +    L  ++  + R V D   RK
Sbjct  281   LRKRMNPPLPEESFGNICSAAFLNLPIDRDHDHEKKINHGSLAGQLHQSIRMVDDQFVRK  340

Query  731   VYGEGGWL---RAVIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRL--VVNMLD  567
             +Y EG  L   +AV A+G      + +     SS C+M +YE DFGWGKP    V     
Sbjct  341   LYVEGEILNIRKAVEAQG----SPKSNKVFVISSWCKMPFYEADFGWGKPVSIGVGTRFT  396

Query  566   NSWVLFLDAINGAVEVWMKLPKQVMHTLTQDRHFLAYVSA  447
              + VL        +E W+ L KQ M    Q    LAY S+
Sbjct  397   EAAVLVDGCQTDGIEAWVGLSKQDMARFEQHPGILAYTSS  436



>ref|XP_008372859.1| PREDICTED: BAHD acyltransferase At5g47980-like [Malus domestica]
Length=450

 Score =   197 bits (500),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 137/458 (30%), Positives = 233/458 (51%), Gaps = 38/458 (8%)
 Frame = -2

Query  1751  MKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGAC---HHTK  1581
             +KVE+  ++  +PS+ TP  L++Y+LSFLDQ+ + + TP + FY   + +      HH  
Sbjct  5     IKVEIIERQTIKPSTSTPHHLRSYELSFLDQMAIVIYTPLLLFYPITSTTSKVSTRHHAM  64

Query  1580  TIDEl----kkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPE  1413
             +IDE      +SL+KTL+  YPLAGR+ +  + +EC D+G  FI A ++  +S +LENP+
Sbjct  65    SIDEKCRHLIESLAKTLTHFYPLAGRIVKGNI-VECTDDGAAFITARISCCLSDILENPD  123

Query  1412  MEKIKQLIPSAKVYEPQPVGKA-LVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIW  1236
              + +K+ +P     E +  G   L+ VQVN F CGG+AIG  +SH IADAS L  F+  W
Sbjct  124   GQILKRFLPIE--IESKEAGTGWLLLVQVNLFECGGMAIGLSISHRIADASTLCTFINCW  181

Query  1235  ASFNRGCAANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAE----GIEQEEKDMIVKRF  1068
             A+   G          SD   +L  P    +++ + ++  +       E  ++  I +R+
Sbjct  182   ATIALGS---------SDSDQVLNLPEFGAASVFKPIEFSSSSQPPAREVVKEKCITQRY  232

Query  1067  VIPANAIAQLRQDLTITGGSVQRPSRVEALTALVWAAVINATPTQT-----ATLSCMVNL  903
             V  A  I+ L+ +  +    V +P+RVEA++AL+W     A+ +       +     VNL
Sbjct  233   VFDAPKISTLQSE--VASSVVAKPTRVEAVSALIWKCATEASRSNLRKQGPSFFRQDVNL  290

Query  902   RRRMEPPLPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYG  723
             R+R+  PLP N  G +V         A +  +V+   +LV ++R+    +K+  A K+  
Sbjct  291   RKRVVXPLPENLAGNVVGS---FTSRADEESSVINLKDLVAKLREGIEGLKEKYAAKLVF  347

Query  722   EGGWLRAVIARGYELVRNRDSSTLYT-SSLCRMAYYEVDFGWGKPRL--VVNMLDNSWVL  552
             +       I       +  D+  +Y+ +S CR   YE DFGWG+P    V ++   + ++
Sbjct  348   DSDEAWQEIKDKQNKPKTHDNMEIYSCTSWCRFPLYEADFGWGRPSWVSVASIAIKNIIV  407

Query  551   FLDAIN-GAVEVWMKLPKQVMHTLTQDRHFLAYVSAFP  441
              +D  +   +E W+ + ++       +   L Y S  P
Sbjct  408   LMDKRDCSGIEAWVTMSEESKALFESNVELLGYASVNP  445



>ref|XP_002314561.1| transferase family protein [Populus trichocarpa]
 gb|EEF00732.1| transferase family protein [Populus trichocarpa]
Length=445

 Score =   196 bits (499),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 150/450 (33%), Positives = 225/450 (50%), Gaps = 35/450 (8%)
 Frame = -2

Query  1751  MKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGACHHTKTID  1572
             + VE+ ++E+  PSSPT   L+ + LS LDQL      P V  Y +       +H     
Sbjct  6     VNVEIVAREVIGPSSPTLNHLRKFNLSLLDQLAPVSYEPLVLLYSNFQQRLTGNHQSL--  63

Query  1571  ElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEMEKIKQL  1392
              LK+SLS+TL+  YPLAGR+K D  +IEC+D G  F+ + V+  +S  LE P+ E I++ 
Sbjct  64    RLKRSLSETLTRFYPLAGRIK-DGASIECNDLGAVFVESRVSCLLSKFLEKPDAEAIRKF  122

Query  1391  IPSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIW--ASFNRG  1218
             IP  +   P+ +  +LV VQ N F+CGG+AIG  +SH  AD    + F++ W  A+F   
Sbjct  123   IP-VETESPEALTGSLVLVQANFFACGGLAIGVCISHKAADPVTFSTFIKAWAAAAFR--  179

Query  1217  CAANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQL  1038
              + N+ +     ++S LFPP       + L       +E      + KR V  A+ IA L
Sbjct  180   -SVNDSTVLPLFNASSLFPP-------QNLPLTRPAAVELMNDKCVTKRLVFDASKIAAL  231

Query  1037  RQDLTITGGSVQRPSRVEALTALVWAAVINATPTQT-----ATLSCMVNLRRRMEPPLPP  873
             +        SV  P+RVEA+TAL+W   +NA+ + +     + LS  VNLR+RM PPLP 
Sbjct  232   QAK--AVSESVTCPTRVEAVTALIWKCAMNASRSNSEHLRYSILSQSVNLRKRMVPPLPE  289

Query  872   NCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLRAVIA  693
             N +G LV        E +     +    LV ++R   R   +    K+ GEG    AV  
Sbjct  290   NTIGNLVGYFASCATECE-----IELQSLVGQLRKGLRDFGENYVEKL-GEGKAFMAVCE  343

Query  692   RGYE---LVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVV--NMLDNSWVLFLDAING-  531
                E   +++  +     ++  CR  +Y +DFGWGKP  V      + +    +D  +G 
Sbjct  344   SFQEAGSMLQEGNVDFYASTDFCRFPFYGIDFGWGKPTWVTIPTGANKNVTTIMDTRDGE  403

Query  530   AVEVWMKLPKQVMHTLTQDRHFLAYVSAFP  441
              VE W+ L ++ M    +DR  LA  S  P
Sbjct  404   GVEAWVTLTEEDMAFFERDRELLAAASLDP  433



>ref|XP_009359304.1| PREDICTED: deacetylvindoline O-acetyltransferase-like [Pyrus 
x bretschneideri]
Length=437

 Score =   196 bits (499),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 156/454 (34%), Positives = 238/454 (52%), Gaps = 38/454 (8%)
 Frame = -2

Query  1757  ITMKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGACHHTKT  1578
             +TM+VE+ S+EI +PS+PTP  L+ + LSF++Q       P V+FY   + S + +    
Sbjct  1     MTMEVELISREIIKPSTPTPPHLRTHNLSFIEQNTPRTYLPVVYFYHKES-SASPNGDHE  59

Query  1577  IDElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAE-NMSCLLENPEMEKI  1401
              ++LKKSLS+ LS  YP AGR++ D+ +++C+DEGV F+ A V    +S +LE+PE   +
Sbjct  60    SNQLKKSLSEILSKYYPFAGRIR-DRASVDCNDEGVAFVEARVRNVKLSEILEHPEDTWL  118

Query  1400  KQLIPSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNR  1221
               L      +        + AVQV+ F CGG+AIG  +SH +AD S +A F+  WA+ N+
Sbjct  119   ALLFTDNLQWNDDSSLSVIFAVQVSFFDCGGMAIGICMSHKVADTSTVANFINDWAARNK  178

Query  1220  GCAANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQ  1041
                      F+   +   FP        +  M +  E +  E+ D + KRFV  A  IA 
Sbjct  179   CDQYVPSPLFIGADT---FP--------QGDMPLFPETV-LEKGDCVTKRFVFDALKIAS  226

Query  1040  LRQDLTITGGSVQRPSRVEALTALVWAAVINA-TPTQTATLS-----CMVNLRRRMEPPL  879
             L+    I    VQ P+RVE +TAL+++  I+A   T  ++L+       VNLR R+ PPL
Sbjct  227   LK---AIVADKVQNPTRVEVVTALIYSCAISALRSTSQSSLNPTVFIHTVNLRTRVVPPL  283

Query  878   PPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLRAV  699
             P N +G+++  A  L   A+D  +V+   +LV +++ +     D  A+K  GE  W  A+
Sbjct  284   PKNSVGSMI-WAFTL-STAED--SVMELHDLVTQMKQSMTRFCDSYAQKFRGEDQW-PAI  338

Query  698   IARGYELVRNRDS----STLYTSSLCRMAYYEVDFGWGKPRLVVNM---LDNSWVLFLDA  540
                  + +R   S     T   SS CR   YE DFGWGKP  V      L N+ +  +D 
Sbjct  339   FKECTQALRKEFSIANLVTYRCSSWCRFPVYEADFGWGKPIWVTIASCPLKNA-IFLIDT  397

Query  539   ING-AVEVWMKLPKQVMHTLTQDRHFLAYVSAFP  441
              NG  +E ++ L KQ +    +D   LA+ S  P
Sbjct  398   RNGEGIEAYVNLEKQQLDVFERDAQLLAFASLNP  431



>gb|KDP26743.1| hypothetical protein JCGZ_17901 [Jatropha curcas]
Length=438

 Score =   196 bits (498),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 141/448 (31%), Positives = 230/448 (51%), Gaps = 35/448 (8%)
 Frame = -2

Query  1754  TMKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGACHHTKTI  1575
             +++ E+ S+E+ +PSSPTP+  K + L F +Q+   +  PFVFFY   T     H +  +
Sbjct  4     SLQAEIISREMVKPSSPTPKHQKIHALCFFEQISSTIYVPFVFFYAKDTCPDRSHISYLL  63

Query  1574  DElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEMEKIKQ  1395
                  SLS+TLS  YPLAGR+K D VT++C+DEG+EF    +  ++S + +NP  E IK 
Sbjct  64    K---GSLSETLSKYYPLAGRLK-DSVTVDCNDEGIEFFETRINCDLSYIFKNPNAETIKI  119

Query  1394  LIPSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGC  1215
             LIP+   Y+  P   +LV VQVN F CGG+ +   +SH IAD + L  F+  WA+  R  
Sbjct  120   LIPNDLEYK-DPFLSSLVIVQVNFFDCGGMGLTVCISHKIADMATLYSFINNWAAIAR--  176

Query  1214  AANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEK-DMIVKRFVIPANAIAQL  1038
               N+G  ++S        PL +  ++   + +     E  EK   I +R +     IA L
Sbjct  177   --NSGKEYIS--------PLFNLGSLYPPIDLPVMSYEVPEKVKCISRRIIFDFPKIAIL  226

Query  1037  RQDLTITGGSVQRPSRVEALTALVWAAVINATPTQTATLSCM-----VNLRRRMEPPLPP  873
             +   +I    +Q P+RVE +TAL++ + I+A  T + +L        ++LR  + PP+P 
Sbjct  227   K---SIIAKEIQDPTRVEVVTALIYKSAISAAKTVSRSLKPTILHQAIHLRSWVSPPVPE  283

Query  872   NCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLRAVIA  693
             N +G L     +      D   +    +LV++ R      ++   +K+  E  +  + I 
Sbjct  284   NAMGCLTG---IFPVPIMDESEIHQLAQLVRQTRQGKIRFREESKKKLVLEEFY--SFIL  338

Query  692   RGYELVRNRDSSTLY-TSSLCRMAYYEVDFGWGKPRLVVN-MLD-NSWVLFLDAING-AV  525
                + VR   +  +Y  SSLC  ++Y  DFGWGKP  V + +LD  + ++ +D   G  +
Sbjct  339   ECSKGVRESQNKNIYMCSSLCGFSFYVADFGWGKPTWVTHSILDARNIIMLIDTREGNGI  398

Query  524   EVWMKLPKQVMHTLTQDRHFLAYVSAFP  441
             E ++ L +  M     ++  LA+    P
Sbjct  399   EAYVSLEENEMAVFESNKELLAFAKINP  426



>ref|XP_009773462.1| PREDICTED: vinorine synthase-like [Nicotiana sylvestris]
Length=418

 Score =   196 bits (497),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 134/393 (34%), Positives = 204/393 (52%), Gaps = 27/393 (7%)
 Frame = -2

Query  1748  KVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGACHHTKTIDE  1569
             KVE+ SKE+ +PSSPT  TLK +KLS LDQ+   +  P +FFY      G  + ++ I  
Sbjct  4     KVEIISKEMIKPSSPTTCTLKTHKLSLLDQISPPVFIPLIFFYQDEL--GNINRSRNIQI  61

Query  1568  lkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEMEKIKQLI  1389
             LKKSLS  L+  YPLAGR  ++   I+C+D G EFI A V   +S ++E P+ E++++ +
Sbjct  62    LKKSLSDALTRFYPLAGRFNDNNF-IDCNDAGAEFIEAQVHGYLSQVIETPKTEEVREFL  120

Query  1388  PSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGCAA  1209
             P             L+AVQVN F+CGGIAIG  +SH + D S++  F+  WA+  RG   
Sbjct  121   PREACEVEN--NDVLLAVQVNIFNCGGIAIGVCMSHKVGDGSSIVTFINAWAAIARG---  175

Query  1208  NNGSGFVSD--HSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQLR  1035
              N +G      H S +FPPL     + +     + GI+ ++   + +RFV     +  ++
Sbjct  176   -NHTGIAQPNFHLSSIFPPLD----LSKSSFKPSIGIKNDK--FLSRRFVFNKEKLDAIK  228

Query  1034  QDLTITGGSVQRPSRVEALTALVWAAV-----INATPTQTATLSCMVNLRRRMEPPLPPN  870
             +  + +G  V+ P+RVEAL+A +W  +     +N   T+      +VN+R RM P L  N
Sbjct  229   K--SASGSQVKDPTRVEALSAFLWKNLMKVSKLNKDSTKMFAAVHVVNIRSRMNPTLSDN  286

Query  869   CLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLRAVIAR  690
               G L   A        +   +    +L+  +R A R + + +  ++   G      I++
Sbjct  287   SFGNLWTTAPAFLSPKSE--EIFGIDDLLYHLRSAIRKI-NSDYTEILQNGEEFLKHISK  343

Query  689   GYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKP  591
               EL    +      SS CR   YEVDFGWGKP
Sbjct  344   FAELFSKEEVEFYNFSSWCRFPVYEVDFGWGKP  376



>ref|XP_009602470.1| PREDICTED: vinorine synthase-like [Nicotiana tomentosiformis]
Length=412

 Score =   195 bits (496),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 139/426 (33%), Positives = 225/426 (53%), Gaps = 36/426 (8%)
 Frame = -2

Query  1748  KVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGACHHTKTIDE  1569
             KVE+ SKE+ +PSSPT  TL+ +KLS +DQ+   +  P +FFY      G  + ++ +  
Sbjct  4     KVEIISKEMIKPSSPTTSTLRTHKLSLVDQISPPVFIPLIFFYQDEL--GNINRSRKLQL  61

Query  1568  lkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEMEKIKQLI  1389
             LKKSLS  L   YPLAGR  ++   I+C+D G EFI A V   +S ++E P+ME +++ +
Sbjct  62    LKKSLSDALMRFYPLAGRFNDNNF-IDCNDAGAEFIEAQVHGYLSQVIETPKMEDLREFL  120

Query  1388  P-SAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGCA  1212
             P  A V E   V   L+AVQVN F CGGIAIG  +SH + D S++  F+  W++  RG  
Sbjct  121   PREACVVENNDV---LLAVQVNLFDCGGIAIGICMSHKVGDGSSIVTFINAWSAIARG--  175

Query  1211  ANNGSGFVSDHSSI--LFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQL  1038
                 +G V  + ++  +FPPL  +++  +     + GI+ ++  ++ +RFV     +  +
Sbjct  176   ---DTGIVQPNFNLSSIFPPLDLSNSSFK----PSIGIKNDK--LMTRRFVFDKEKLDAI  226

Query  1037  RQDLTITGGSVQRPSRVEALTALVWAAV-----INATPTQTATLSCMVNLRRRMEPPLPP  873
             ++  + +G  V+ P+RVEAL+A VW  +     +N   T+       VN+R RM P LP 
Sbjct  227   KK--SASGSQVKDPTRVEALSAFVWKHLMEVSKLNRDSTKMFAAVHAVNIRSRMNPTLPD  284

Query  872   NCLGTLVDEAI-VLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLRAVI  696
             +  G L   A+  L  E+++    +   +L+  +R A R + + +  ++   G      +
Sbjct  285   HSFGNLWTTALAFLSPESEE----IEIGDLLHHLRCAIRNI-NSDYIEILQNGQEFLKHM  339

Query  695   ARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVVNM---LDNSWVLFLDAINGAV  525
             ++  EL    +      SS CR   YEVDFGWGKP  V       +N+ +         +
Sbjct  340   SKLAELFSKEEVEFYNFSSWCRFPVYEVDFGWGKPVWVCTATFPYENTVIFVGTKCGEGI  399

Query  524   EVWMKL  507
             E W+ +
Sbjct  400   EAWVNM  405



>gb|KDP38750.1| hypothetical protein JCGZ_04103 [Jatropha curcas]
Length=449

 Score =   196 bits (498),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 143/451 (32%), Positives = 230/451 (51%), Gaps = 36/451 (8%)
 Frame = -2

Query  1751  MKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYD--SPTISGACHHTKT  1578
             +KVE+ ++E  +PSSPTP+ L+   LS LDQL   + TP + FY       +   H  K 
Sbjct  5     VKVEIITRETIKPSSPTPRNLRYKNLSLLDQLSFAMSTPMLLFYPFRCDKNNNIVHVIKE  64

Query  1577  IDElkkslsktlsLM-YPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEMEKI  1401
               +  K+       + YPLAG +K +   IEC+D GVE+I A V  +M  L +NPE   +
Sbjct  65    QSQNLKTSLSKTLTLFYPLAGELKNNSF-IECNDYGVEYIEAQVDCSMMELFQNPENYLL  123

Query  1400  KQLIPSAKVYEPQPVGKALVAV-QVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFN  1224
             + L P     +  PV K   A+  VN F+CGG+AIG  +SH IADA++L  F+  WAS  
Sbjct  124   ENLFP----IDLNPVDKFTGAIIHVNFFNCGGLAIGVSLSHKIADAASLGTFLLAWASM-  178

Query  1223  RGCAANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIA  1044
                 A+     + +     F   T   + E  + + +      +   I KRF + +  I 
Sbjct  179   ----ASLSMEILPETKCPHFVSNTVIPSAENSLILPSPPPSLTQTKCITKRFTLSSCKID  234

Query  1043  QLRQDLTITGGSVQRPSRVEALTALVWAAVINATPTQT------ATLSCMVNLRRRMEPP  882
              L+     +  ++Q P+RVE +TAL+W  +I+A+  ++      + L+  VNLRRR+ P 
Sbjct  235   MLKAKAATS--TLQTPTRVEVVTALIWKCLISASQAKSKGKHKKSVLAQAVNLRRRLVPH  292

Query  881   LPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLRA  702
             LP N +G L  + +V+ ++ +         +LV  +R+    V D   ++V     +   
Sbjct  293   LPQNYIGNLSGKFLVMAEKER-----AELKDLVAHLREGIEKVSDNVWKRVDEILDF---  344

Query  701   VIARGYELVRNRDSSTLYT-SSLCRMAYYEVDFGWGKP--RLVVNMLDNSWVLFLDAIN-  534
               A+ +  + +R+   LY+ +SLC   +Y+VDFGWGKP   +V N++  ++V+ LD  + 
Sbjct  345   --AKEFAELHSREDLDLYSFTSLCGFPFYDVDFGWGKPIWTVVTNLVLKNYVVMLDMKDR  402

Query  533   GAVEVWMKLPKQVMHTLTQDRHFLAYVSAFP  441
               VEVWM L ++ M     +   L + S  P
Sbjct  403   KGVEVWMSLSEEDMPLFEANGELLEFASVNP  433



>ref|XP_010100286.1| Deacetylvindoline O-acetyltransferase [Morus notabilis]
 gb|EXB82420.1| Deacetylvindoline O-acetyltransferase [Morus notabilis]
Length=439

 Score =   196 bits (497),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 152/452 (34%), Positives = 229/452 (51%), Gaps = 37/452 (8%)
 Frame = -2

Query  1745  VEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGACHH-TKTIDE  1569
             +E+  +E  +PSSPTPQ  + + L + DQ+      P + FY     + + +  ++T   
Sbjct  4     IEIIKRETIKPSSPTPQHNRIHNLCWFDQISTPFFIPILLFYRHGLFNTSINAVSETSSL  63

Query  1568  lkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEMEKIKQLI  1389
             L  SLSKTLS  YP AGR++ D+ +I C+DEGV+F+VA V +++S LL NP+ E +  L 
Sbjct  64    LINSLSKTLSKYYPFAGRIR-DRESILCNDEGVDFLVAKVKQDLSSLLHNPKAEILHLLF  122

Query  1388  PSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGCAA  1209
             P    +    V   L+AVQVN F CGG+AIG  +SH ++DA+ L  F+  WAS  R    
Sbjct  123   PDNLQWRNTDVS-FLLAVQVNYFDCGGLAIGVCMSHKLSDAATLVSFINCWASTARNAGR  181

Query  1208  NNGSGFVSDHSSILFPPLTDTSAIEQ-LMKMGAEGIEQEEKDMIVKRFVIPANAIAQLRQ  1032
             +           + FP L   S   +  + +  E +   + +   +RFV  A  I  L+ 
Sbjct  182   D-----------VSFPVLNVASLFPRGDLPLFPEAVHW-KGNYASRRFVFEAEKINSLK-  228

Query  1031  DLTITGGSVQRPSRVEALTALVWAAVINAT-------PTQTATLSCMVNLRRRMEPPLPP  873
                +    V+ P+RVEA+TAL++ + I A+        T +  L   VN+R RM P LP 
Sbjct  229   --AVISEKVENPTRVEAVTALLYKSAIKASRAVVSNAKTSSHLLVQQVNMRTRMVPELPE  286

Query  872   NCLGTLVDEAIVLCQ--EAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLRAV  699
               +G+L     VL    E  D    V    LV R+R+AF  +    A K  GE  +L  +
Sbjct  287   TSVGSLSWFFPVLWGSIEMDDQSFFVG---LVSRMREAFTKLCSSFADKFGGEDWFLEML  343

Query  698   -IARGYELVRNRDSSTLYT-SSLCRMAYYEVDFGWGKPRLV--VNMLDNSWVLFLD--AI  537
              I + Y+ + +R    +Y  SS CR   YE DFGWGKP  V  V  +D + ++ +D    
Sbjct  344   EILKEYKGLLSRSDQVVYRFSSWCRFPVYEADFGWGKPVWVTSVGTVDKNVIILMDHGKN  403

Query  536   NGAVEVWMKLPKQVMHTLTQDRHFLAYVSAFP  441
              G +E ++ L +  M     D+  LA+ S  P
Sbjct  404   GGGIEAFVTLEEDEMFVFECDQELLAFASCNP  435



>gb|ACI45390.1| salutaridinol 7-O-acetyltransferase [Papaver somniferum]
 gb|ACI45391.1| salutaridinol 7-O-acetyltransferase [Papaver somniferum]
Length=474

 Score =   196 bits (499),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 151/449 (34%), Positives = 224/449 (50%), Gaps = 44/449 (10%)
 Frame = -2

Query  1745  VEVRSKEIGRPSSPTPQTLKNYKLSFLDQ-LHLNLMTPFVFFY--DSPTISGACHHTKTI  1575
             VEV SKE  +P++PTP  LKN+ LS LDQ   L    P + FY   +   +G+ +H   +
Sbjct  9     VEVISKETIKPTTPTPSQLKNFNLSLLDQCFPLYYYVPIILFYPATAANSTGSSNHHDDL  68

Query  1574  DElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEMEKIKQ  1395
             D LK SLSKTL   YP+AGR+  D + ++C D+G+ F    +   M   +  P++  + Q
Sbjct  69    DLLKSSLSKTLVHFYPMAGRMI-DNILVDCHDQGINFYKVKIRGKMCEFMSQPDVP-LSQ  126

Query  1394  LIPSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGC  1215
             L+PS  V    P  +ALV VQVN F CGG AI   VSH IADA+ ++ F+  WAS  +  
Sbjct  127   LLPSEVVSASVP-KEALVIVQVNMFDCGGTAICSSVSHKIADAATMSTFIRSWASTTKTS  185

Query  1214  AANNGSGFVSDH-------SSILFPP---LTDTSAIEQLMKMGAEGIEQEEKDMIVKRFV  1065
              +   +  V+D        S+ LFPP   LT  S + ++    +   + E+   + KRFV
Sbjct  186   RSGGSTAAVTDQKLIPSFDSASLFPPSERLTSPSGMSEI-PFSSTPEDTEDDKTVSKRFV  244

Query  1064  IPANAIAQLRQDLTI---TGGSVQRPSRVEALTALVWAAVINATPTQ-TATLSCMVNLRR  897
                  I  +R+ L +        +RP+RVE +T+L+W +V+ +TP      +   VNLR+
Sbjct  245   FDFAKITSVREKLQVLMHDNYKSRRPTRVEVVTSLIWKSVMKSTPAGFLPVVHHAVNLRK  304

Query  896   RMEPPLPPNCLGTL-------VDEAIVLCQEAKDGGTVVTAVE---LVQRIRDAFRAVKD  747
             +M+PPL     G L       +         A +     T+ E   ++  + D F A   
Sbjct  305   KMDPPLQDVSFGNLSVTVSAFLPATTTTTTNAVNKTINSTSSESQVVLHELHD-FIAQMR  363

Query  746   GEARKVYGEGGWLRAVI---ARGYEL----VRNRDSSTLYTSSLCRMAYYEVDFGWGKPR  588
              E  KV G+ G L  VI   A G++     + + +    + SS CRM  YE+DFGWGKP 
Sbjct  364   SEIDKVKGDKGSLEKVIQNFASGHDASIKKINDVEVINFWISSWCRMGLYEIDFGWGKPI  423

Query  587   LVV---NMLDNSWVLFLDAIN--GAVEVW  516
              V    N+  N    F++       +EVW
Sbjct  424   WVTVDPNIKPNKNCFFMNDTKCGEGIEVW  452



>ref|XP_010027285.1| PREDICTED: BAHD acyltransferase At5g47980-like [Eucalyptus grandis]
 gb|KCW62007.1| hypothetical protein EUGRSUZ_H04686 [Eucalyptus grandis]
Length=438

 Score =   195 bits (496),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 152/452 (34%), Positives = 226/452 (50%), Gaps = 32/452 (7%)
 Frame = -2

Query  1757  ITMKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGACHHTKT  1578
             + +KVEV +KE  R SSPTP  LKN+KLS  DQL   L T  +FFY S T + + H +  
Sbjct  1     MELKVEVVAKETIRLSSPTPDHLKNFKLSVFDQLAPILYTSVLFFYTSNTNASSHHRSSC  60

Query  1577  IDElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEMEKIK  1398
             +     SLS  L+  YPLAGR++ D ++++C+D G EF+ A V   +S +L+ P    ++
Sbjct  61    LKS---SLSDVLTRFYPLAGRIR-DNLSVDCEDGGAEFVDAKVNCPLSHILDRPCPVSLR  116

Query  1397  QLIPSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRG  1218
             +L+P      P+     L+ VQ N F CGG+A+G  VSH IADAS L+ F++ W++    
Sbjct  117   KLLP-IDTESPEASTGRLLLVQANAFGCGGLAVGVCVSHKIADASTLSTFIKAWSAAALL  175

Query  1217  CAANNGSGFVS-DHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQ  1041
                N G      D +S  FPPL + +AI   + +        +   + +R+V+    I  
Sbjct  176   SDVNVGIEIPPLDTASAWFPPLVELAAILPTVVL-------PKARCVTRRYVLDPAKITP  228

Query  1040  LRQDLTITGGSVQRPSRVEALTALVWAAVINAT----PTQTATLSCMVNLRRRMEPPLPP  873
             L         +V  P++VEA+ ALVW  V  A+    P + + LS  VNLR R+  PLP 
Sbjct  229   L-----AASEAVPDPTQVEAVVALVWRCVARASRKNDPGRRSLLSQAVNLRGRLPEPLPE  283

Query  872   NCLGTLVDEAIV-LCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLRAVI  696
               +G  V    V +  +A++    +   +LV  +R+A R   D    ++ G      AV+
Sbjct  284   TTIGNFVGGFTVEMPPQAEEREMELK--KLVSDMREAKREYFDNYTPRLSGLVVGCMAVV  341

Query  695   ---ARGYELVRNRDSSTLYTSSLCRMAYYE-VDFGWGKPRLVVNM---LDNSWVLFLDAI  537
                A+   L+ + D      SS C    YE  DFGWG+P  +        NS VL     
Sbjct  342   EAAAKFGALINSGDVDFYNCSSWCGFGLYEAADFGWGRPAWISFAGVEYKNSIVLVDARD  401

Query  536   NGAVEVWMKLPKQVMHTLTQDRHFLAYVSAFP  441
              G +E W+ L ++ MH L  D   L + S  P
Sbjct  402   GGTIEAWLTLSQEDMHVLDADEELLRFASVNP  433



>ref|XP_002510627.1| Anthranilate N-benzoyltransferase protein, putative [Ricinus 
communis]
 gb|EEF52814.1| Anthranilate N-benzoyltransferase protein, putative [Ricinus 
communis]
Length=440

 Score =   195 bits (496),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 151/462 (33%), Positives = 226/462 (49%), Gaps = 47/462 (10%)
 Frame = -2

Query  1751  MKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGACHHTKT--  1578
             M++E+ S+E  +PSSPTP  LK YKLS LDQL  +   P +FFY      G  + T    
Sbjct  1     MEIEIMSRENIKPSSPTPSHLKTYKLSLLDQLMPSAHVPIIFFY------GPINQTDMSI  54

Query  1577  -IDElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEMEKI  1401
              + +LK+SLS+ L+  YP AG+VK+D + I+C+DEGV +  A V+  +S +L  P+ E I
Sbjct  55    RLPKLKQSLSEALTSFYPFAGKVKDD-LYIDCNDEGVSYTQAKVSCCLSDILGKPDSETI  113

Query  1400  KQLIPSAKVY-EPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFN  1224
              +L+P    + E    G  +  +QVN F CGG+AIG   SH I D      F++ WA+  
Sbjct  114   FKLLPGDSYFMESSGNGIPVAMIQVNVFKCGGVAIGTKTSHKIIDGPTSTAFLKAWAAIA  173

Query  1223  RGCAANNGSGFVSDHSSILFP-----PLTDTSAI-EQLMKMGAEGIEQEEKDMIVKRFVI  1062
             RG        F++     LFP     P     AI   L+K G           I KRFV 
Sbjct  174   RGSGETVEPCFIAPS---LFPQNDCLPKDTMLAIWPSLIKFGKG---------ITKRFVF  221

Query  1061  PANAIAQLRQDLTITGGSVQRPSRVEALTALVWAAVINATPTQTAT-----LSCMVNLRR  897
              A+++A L+     +   V RP+RVEA++A +W   + A+  +        LS +VNLR 
Sbjct  222   DASSVAILKAR-AASSLLVHRPTRVEAVSAFIWQCNMLASKAKHGCQRPSFLSLIVNLRG  280

Query  896   RMEPPLPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEG  717
             +    LP N +G L+   I  C       T      LV  +R++   +     +K+ GE 
Sbjct  281   KKGTQLPSNSVGNLLWMTIAQCSAE----TERELHPLVGLLRESISKIDGDFVQKLSGEE  336

Query  716   GWLRA--VIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVV------NMLDNS  561
             G+ +    +    E+  N  +  L  +SLC +  YE DFGWG+P  V        +  N 
Sbjct  337   GFSKVCECLQEFGEVYSNAGADYLTFTSLCNVGIYETDFGWGRPIWVTPGGITGPVFQNL  396

Query  560   WVLFLDAINGAVEVWMKLPKQVMHTLTQDRHFLAYVSAFPKP  435
               L   ++   +E W+ L +Q M  L +D   L++ +  P P
Sbjct  397   VFLNETSVGDGIEAWLTLDEQDMIILERDTEILSFSALDPSP  438



>ref|XP_006348577.1| PREDICTED: salutaridinol 7-O-acetyltransferase-like [Solanum 
tuberosum]
Length=438

 Score =   195 bits (496),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 147/452 (33%), Positives = 236/452 (52%), Gaps = 37/452 (8%)
 Frame = -2

Query  1757  ITMKVEVRSKE-IGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGACHHTK  1581
             + +++EV SKE + +P SPTP  L++Y LS+LDQ+  ++  P V+FY +   S    +T+
Sbjct  1     MKIEIEVISKETLIKPCSPTPIELRHYSLSYLDQIIPSIFMPLVYFYPA---SDLISNTE  57

Query  1580  TIDElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEMEKI  1401
               D++K SLS+ L+  YPLAGRV  D + ++C+DEGV ++   V  N++ ++ NP   ++
Sbjct  58    RSDKIKLSLSQALTKFYPLAGRVV-DNLYVDCNDEGVPYVEVIVKCNLTDIISNPIPNEL  116

Query  1400  KQLIPSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNR  1221
              + IP    YE   V    + VQVN F CGG+AIG  +SH +ADA++   F+ +WAS  R
Sbjct  117   NKFIP----YELDDVKDLGLVVQVNFFECGGMAIGIGISHKLADAASCFMFINMWASIAR  172

Query  1220  GCAANNGSGFV-SDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIA  1044
              C  ++   F  S  SS LFPP  D S +  +       +E  +++++ K+FV   + I 
Sbjct  173   -CDYDDTCHFSPSFDSSTLFPP-KDASLVRDVC------LEIRKENIVTKKFVFSNSDIL  224

Query  1043  QLRQDLTI--TGGSV-----QRPSRVEALTALVWAAVINATPTQTAT-----LSCMVNLR  900
              LR   T     GSV     Q PSR+ AL+A +W+  +    ++  T     ++  VNLR
Sbjct  225   TLRDKYTDQRMKGSVFERIGQHPSRILALSAFLWSRYMATVHSERDTDKIYAVTHTVNLR  284

Query  899   RRMEPPLPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKV-YG  723
              R +PPL     G ++  A+V+     D G+     E + ++R++ + + +    +    
Sbjct  285   GRTDPPLHEFLFGNIMRSALVI--PFFDKGSENEVFEFMNKVRESIQEINNNFVSQFKKN  342

Query  722   EGGWLRAVIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVVN--MLDNSWVLF  549
             +   L  +  R  E  R      L  SSLC+   YE DFGWGKP  V +  +   + + F
Sbjct  343   DQQHLNFLQERANE-KRKGHMELLCFSSLCKFPLYEADFGWGKPIWVGSGRLATKNIIGF  401

Query  548   LDA-INGAVEVWMKLPKQVMHTLTQDRHFLAY  456
             +D  +   VE W+ L    M     D+  LA+
Sbjct  402   MDTKLGDGVEAWVNLEADDMAKFEADKKLLAF  433



>ref|XP_006342247.1| PREDICTED: salutaridinol 7-O-acetyltransferase-like [Solanum 
tuberosum]
Length=435

 Score =   195 bits (496),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 136/454 (30%), Positives = 235/454 (52%), Gaps = 42/454 (9%)
 Frame = -2

Query  1751  MKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGACHHTKTID  1572
             MKV+V S+E  +PSSPTP  LK + L  LDQL      P V FY  P ++      K+  
Sbjct  2     MKVQVISRENIQPSSPTPNHLKKFNLCLLDQLIPAPYAPIVLFY--PNLNDVKLREKS-S  58

Query  1571  ElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEMEKIKQL  1392
              LKKSL++TLS  YPLAGR K D+++I+C+D+GV ++  +V  ++   L  P +E I Q 
Sbjct  59    LLKKSLAQTLSSFYPLAGRFK-DELSIDCNDQGVNYVTTNVNCHLIDYLNEPNLESIGQF  117

Query  1391  IPSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGCA  1212
             +P    ++   VG  +  +Q+N F CGGIAIG  ++H + D + L+ F++ W        
Sbjct  118   LPCQPPFKVLGVGDYVTNIQINVFECGGIAIGLCIAHKVLDGAGLSTFLKNW--------  169

Query  1211  ANNGSGFVS--DHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQL  1038
                 SG V+  +  +  F P  D    +  M M +   ++   + + KRFV   + I  L
Sbjct  170   ----SGLVTCPNLMANYFFPCDDLWLRDTSMTMWSSMFKK--GNFVTKRFVFNDSVIDNL  223

Query  1037  RQDLTITGGSVQRPSRVEALTALVWAAVINATPTQTATLSCMVNLRRRMEPPLPPNCLGT  858
             ++    T   ++ P++VE +++ +W  +I +     + L+ +VNLR+R  P LP N LG 
Sbjct  224   KR--MSTSAHIKYPTKVEVVSSFIWKCLIASNKKSNSLLTHIVNLRKRAAPALPENILGN  281

Query  857   LVDEAIVLCQEAKDGGTVVTAV---ELVQRIRDAFRAVKDGEARKVYGEGG--WLRAVIA  693
             L     +    AK+  T  + V   +LV ++R +   + D   +++ G+ G   +R  + 
Sbjct  282   L-----IWLSSAKNNNTAKSDVVLSDLVNQVRRSILRIDDCFVKRLRGDEGCSLMRKSLK  336

Query  692   RGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVVNMLDNSWVLFLDAI--------  537
                +   ++ ++    SS C+  +Y++DFG+GKP + V+ + +    F++ I        
Sbjct  337   EIGDFC-SKGANHYGFSSWCKFGFYDIDFGFGKP-IWVSSISSKCSFFMNLIILMESSRC  394

Query  536   NGAVEVWMKLPKQVMHTLTQDRHFLAYVSAFPKP  435
             +  +E W+ L ++ M+ L  ++  L + S  P P
Sbjct  395   DNGIEAWVTLDEEEMNMLVSNQELLVFASIDPSP  428



>ref|XP_002514981.1| Salutaridinol 7-O-acetyltransferase, putative [Ricinus communis]
 gb|EEF47535.1| Salutaridinol 7-O-acetyltransferase, putative [Ricinus communis]
Length=430

 Score =   195 bits (495),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 143/440 (33%), Positives = 230/440 (52%), Gaps = 39/440 (9%)
 Frame = -2

Query  1718  RPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGA-CHHTKTIDElkkslsktl  1542
             +PSSPTP  L++YKLSFLDQ+   +  P + FY  PT      ++ +  D+LK+SLS+ L
Sbjct  14    KPSSPTPDHLRHYKLSFLDQISPPVYNPLLLFY--PTDGRVKSNNAQKYDQLKQSLSQVL  71

Query  1541  sLMYPLAGRVKEDKVTIECDDEGVEFIVAD-VAENMSCLLENPEMEKIKQLIPSAKVYEP  1365
             +  YPLAGR+K++ + ++C+DEGV F+ A  +A  +S  + NP   + ++L+P  ++ EP
Sbjct  72    TYYYPLAGRIKDNNL-VDCNDEGVPFLQAQAIACRLSDAVNNPMPTEFRKLLP-FELDEP  129

Query  1364  QPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGCAAN-NGSGFV  1188
             Q        +Q+N F CGGI I F +SH IADA +   F++ WA+  RG   +     F+
Sbjct  130   QEFA---FGIQLNIFDCGGICIAFCLSHKIADALSTLVFLKTWAAITRGETDDIVCPEFI  186

Query  1187  SDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQLRQDLTITGGS  1008
                S+ LFPP  + S         A GI +E  +++ KRFV   ++I  L +  + +  S
Sbjct  187   ---SATLFPP-KNLSGFNP-----AIGITKE--NVVTKRFVFRLSSIESLIEKYSTSTTS  235

Query  1007  VQR-----PSRVEALTALVWAAVINAT-----PTQTATLSCMVNLRRRMEPPLPPNCLGT  858
             ++      PSR+EAL+  +W+  + AT     P +   +   VNLR RM P LP +  G 
Sbjct  236   IENQQQKSPSRIEALSVFIWSRFMAATKVESEPGRVYLMLHAVNLRTRMNPQLPEHSFGN  295

Query  857   LVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLRAVIARGYEL  678
                 AI +        T   +  LV+R+RD+   +     +K+      L  +  R    
Sbjct  296   YYRVAITI----PSSDTEEESYNLVRRMRDSISKIDKDYVKKLQDGNEHLHFIKERAESF  351

Query  677   VRNRDSSTLYTSSLCRMAYYEVDFGWGKPRL--VVNMLDNSWVLFLDAING-AVEVWMKL  507
              R  + +TL  +SLCR   YE DFGW KP      ++   + V+F+D ++G  +E  + L
Sbjct  352   TRG-EMATLNFTSLCRFPLYEADFGWSKPIWAGAPSLTFKNLVVFMDTVSGDGIEALIHL  410

Query  506   PKQVMHTLTQDRHFLAYVSA  447
              ++ M    +D+  L + + 
Sbjct  411   KEEDMAKFQEDQELLQFATG  430



>gb|KDP35375.1| hypothetical protein JCGZ_10359 [Jatropha curcas]
Length=440

 Score =   195 bits (495),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 152/463 (33%), Positives = 228/463 (49%), Gaps = 51/463 (11%)
 Frame = -2

Query  1757  ITMKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTI---SGACHH  1587
             + M VE  S E  +PSSPTP  L+N+K+  LD+L      P +  Y SP+    +G   +
Sbjct  1     MAMMVEKISSETIKPSSPTPNDLRNFKICLLDELAPPSYVPILLLY-SPSADFNNGVADY  59

Query  1586  TKTIDElkkslsktlsL-MYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEM  1410
                I E  K          YPL G++ E  +++EC+D+G  F+ A V   +S +++N E 
Sbjct  60    FDAISEKLKKSLSETLTRFYPLCGKL-EGNLSVECNDDGALFVKAKVNIAVSEIVKNLET  118

Query  1409  EKIKQLIPSAKVYEPQPVGK------ALVAVQVNRFSCGGIAIGFFVSHAIADASALAKF  1248
             + + QL P    Y+ +P G        +  VQVN F CGG+ IG  VSH I D +A+A F
Sbjct  119   DLLYQLFP-FNPYKVRPDGARENGEAMITGVQVNLFECGGVGIGVCVSHKIVDGAAMAAF  177

Query  1247  MEIWASFNRGCAANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRF  1068
             +  WA+   G   N  S  +  H   LFPP      I+Q     ++ I  E+  +I KRF
Sbjct  178   LNAWAATATGI-DNTISPRLDAHK--LFPP-KGIDIIKQ-----SDMIRNEK--VITKRF  226

Query  1067  VIPANAIAQLRQDLTITGGSVQRPSRVEALTALVWAAVINAT---------PTQTATLSC  915
                A ++A L++ +   G S    +RVEA+TAL+W + + A          P+  AT   
Sbjct  227   EFDAKSLANLKEKIK-NGNS----TRVEAVTALIWKSAMKAVRLNSGKDKLPSSIAT--H  279

Query  914   MVNLRRRMEPPLPPNCLGTLVDEAIVLC-QEAKDGGTVVTAVELVQRIRDAFRAVKDGEA  738
             ++N+R RM+PPLP   LG L   ++  C  E KD    V   ELV  +R + R V +   
Sbjct  280   LINIRDRMDPPLPGYSLGNLWRLSLAPCVDEKKD----VELQELVSLLRKSIRRVDNDYV  335

Query  737   RKVYGEGGWLRAV--IARGYELVRNRDSSTLYT-SSLCRMAYYEVDFGWGKPRLVVNM--  573
              ++ G+GG L+A+  +    +L    +   +YT SS  R   YE+DFGWGKPR V  +  
Sbjct  336   NELQGDGGLLKALEPLKELRQLALGGEGVEVYTFSSWARFPLYEIDFGWGKPRRVCTITV  395

Query  572   -LDNSWVLFLDAINGAVEVWMKLPKQVMHTLTQDRHFLAYVSA  447
              + N  +L        +E W+ L ++ M         L +VS 
Sbjct  396   PVRNCVILMGTRSGDGIEAWVTLTEKDMAKFESSEELLQFVSG  438



>ref|XP_004238629.1| PREDICTED: vinorine synthase-like [Solanum lycopersicum]
Length=435

 Score =   195 bits (495),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 141/458 (31%), Positives = 235/458 (51%), Gaps = 50/458 (11%)
 Frame = -2

Query  1751  MKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGACHHTKTID  1572
             MKV+V S+E  +PSSPTP+ LK + L  LDQL      P V FY  P ++      K+  
Sbjct  2     MKVQVISRENIQPSSPTPKHLKKFNLCLLDQLIPAPYAPIVLFY--PNLNDVKLREKS-S  58

Query  1571  ElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEMEKIKQL  1392
              LKKSL++TLS  YPLAGR + D+++I+C+D+GV ++  +V  ++   L  P +E I Q 
Sbjct  59    LLKKSLAQTLSSFYPLAGRFR-DELSIDCNDQGVNYVTTNVNCHLIDYLNKPNLESISQF  117

Query  1391  IPSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGCA  1212
             +P    ++   VG  +  +Q+N F CGGIAIG  ++H + D + L+ F++ W        
Sbjct  118   LPCQPPFKVLGVGDYVTNIQINVFECGGIAIGLCIAHKVLDGAGLSTFLKNW--------  169

Query  1211  ANNGSGFVSD---HSSILFPP----LTDTSAI--EQLMKMGAEGIEQEEKDMIVKRFVIP  1059
                 SG V+     ++  FP     L DTS I    + K G         + + KR V  
Sbjct  170   ----SGLVTCPNLMANYFFPSDDLWLRDTSMIMWSSMFKKG---------NFVTKRLVFN  216

Query  1058  ANAIAQLRQDLTITGGSVQRPSRVEALTALVWAAVINATPTQTATLSCMVNLRRRMEPPL  879
              +AI  L++    T   ++ P++VE +++ +W  +I +     + L+ +VNLR+R  P L
Sbjct  217   DSAIDNLKR--MSTSAHIKYPTKVEVVSSFIWKCLIASNKKSNSLLTHIVNLRKRATPAL  274

Query  878   PPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYG-EGGWLRA  702
             P N LG L+  +      AK     V   +LV ++R +   + DG  +++ G EG  L  
Sbjct  275   PENILGNLIWLSSAKNNNAK---RYVELADLVNQVRKSILKIDDGYVKRLRGDEGCSLMR  331

Query  701   VIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVVNMLDNSWVLFLDAI-----  537
                +  E   ++ ++    SS C+  +Y++DFG+GKP + V+ + +    F++ I     
Sbjct  332   KSLKEIEDFCSKGANHYGFSSWCKFGFYDIDFGFGKP-IWVSSISSKCSFFMNLIILMES  390

Query  536   ---NGAVEVWMKL-PKQVMHTLTQDRHFLAYVSAFPKP  435
                +  +E W+ L  ++ M+ L  ++  L + S  P P
Sbjct  391   NRCDNGIEAWVTLDEEEEMNMLVDNQELLVFASVDPSP  428



>ref|XP_010907772.1| PREDICTED: salutaridinol 7-O-acetyltransferase-like [Elaeis guineensis]
Length=426

 Score =   194 bits (494),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 152/452 (34%), Positives = 226/452 (50%), Gaps = 44/452 (10%)
 Frame = -2

Query  1751  MKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGACHHTKTID  1572
             + V++ SKE  +PSSPTPQ L +  LS LDQ+   + +  + FY         +  +T+ 
Sbjct  2     LAVQIISKETIKPSSPTPQNLHSLPLSLLDQIAPQIYSHILLFYSK-------NPPQTLI  54

Query  1571  ElkkslsktlsLMYPLAGRVKEDK----VTIECDDEGVEFIVADVAENMSCLLENPEMEK  1404
             +LK SLSKTL+  YPL GR+K  K    + +EC+D+GVEFI A     +  +L  P +++
Sbjct  55    QLKSSLSKTLTHFYPLGGRIKASKDDNTLYVECNDDGVEFIHAQTNAELDSVLLQPPIDQ  114

Query  1403  IKQLIP-SAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASF  1227
               +L+P  A  +     G  L+AVQ+  F   G  +GF +SH IAD +++A F+  WA  
Sbjct  115   FNELLPIKASNFR---YGDPLLAVQLTWFKPHGFVLGFSISHLIADGASMAMFLNRWADV  171

Query  1226  NRGCAANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAI  1047
              RG   +    F    S   FPP        Q     A   E  +   I+KRFV+   AI
Sbjct  172   ARGLELHPAPRF---DSMAAFPPRP------QFTTNQAPKQESGQPAAIIKRFVMSPRAI  222

Query  1046  AQLRQDLTITGGSVQRPSRVEALTALVWAAVI----NATPTQTATLSCMVNLRRRMEPPL  879
             A+LR       G V  P+R+EAL+ALV   ++     A   + A  +  VNLRRR+ PPL
Sbjct  223   ARLRGGGGYDNGRVHAPTRIEALSALVLRCLVRARGEAARGKRAVAAHSVNLRRRLSPPL  282

Query  878   PPNCLGTL-VDEAIV--LCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWL  708
                  G L +  A V  L  +  D G+    +E  + +R+  R V +   R+   E    
Sbjct  283   SDESFGNLWISVAAVGKLVGDGCDDGSGQGVLE--EALRNGVREVDEEYVRRKAEE----  336

Query  707   RAVIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLV----VNMLDNSWVLFLDA  540
             R +   G + V   DS     SS CRM +Y+ DFGWG+P  V     +M D    + +D 
Sbjct  337   RWLGRDGMDGVVEGDSEVWIFSSWCRMPWYKTDFGWGEPEWVGCGISDMKDV--CILIDT  394

Query  539   ING-AVEVWMKLPKQVMHTLTQDRHFLAYVSA  447
              +G  +EVW+ L  + M  + +D  FL ++S+
Sbjct  395   KDGDGMEVWLWLRAEEMERVERDPEFLDFISS  426



>ref|XP_009359355.1| PREDICTED: vinorine synthase-like [Pyrus x bretschneideri]
Length=455

 Score =   195 bits (496),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 151/467 (32%), Positives = 222/467 (48%), Gaps = 51/467 (11%)
 Frame = -2

Query  1751  MKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFY-------DSPTISGAC  1593
             ++VEV S +  +PSSPTP  L+ + LSFLDQL   +  P V F+       D PT    C
Sbjct  4     LEVEVVSSKTIKPSSPTPDHLRRHNLSFLDQLQPPIFMPMVLFFPKDPHTTDDPT--ERC  61

Query  1592  HHTKTIDElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPE  1413
                KT      +LSKTL+  YPLAGR++  +  ++C+DEG  ++ A    N++ +++NP 
Sbjct  62    TKIKT------ALSKTLTKFYPLAGRIRGIQY-VDCNDEGAYYVEAKANSNITDIIQNPC  114

Query  1412  MEKIKQLIPSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWA  1233
                    IP A         +  + +QV  F+CGG++IG  +SH + DA ++  F+   A
Sbjct  115   PSDFNMFIPCAL----DAASELPICLQVTFFACGGMSIGMGMSHKVGDALSIFIFLNSLA  170

Query  1232  SFNRG-CAANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPA  1056
             +  RG     +   F+SD     FP    + + +    M    I         KRFV  A
Sbjct  171   ATTRGEPDYGHAPEFISDK---YFPQQDLSGSYQHSSGMIKHNIS-------TKRFVFDA  220

Query  1055  NAIAQLRQDLT-ITGGSVQRPSRVEALTALVWAAVINATPTQTA-----------TLSCM  912
             +A++ LR   T +     +RP+RVEAL+A VW   I A  +Q             T+S  
Sbjct  221   SAVSALRARSTDVENEHARRPTRVEALSAFVWRRYIAACTSQQQNDHADDVPAMYTVSHA  280

Query  911   VNLRRRMEPPLPPNCLGTLVDEAIV---LCQEAKDGG-TVVTAVELVQRIRDAFRAVKDG  744
             VNLR RM+PPLP    G +   AI    +  E KDG  +  +   +V  +R A + V   
Sbjct  281   VNLRTRMDPPLPEYTFGNVTRTAISVPPILMEPKDGSLSDPSLYSVVGHVRQALKQVDRE  340

Query  743   EARKVYGEGGWLRAVIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLV--VNML  570
               +K+    G++  +  R  ++ R    S  +T SLCR   Y+ DFGWGKP         
Sbjct  341   YVKKLQEGEGYVSFLKERSSQVKRGEVVSFSFT-SLCRFPIYDADFGWGKPAYAGSARFT  399

Query  569   DNSWVLFLDAING-AVEVWMKLPKQVMHTLTQDRHFLAYVSAFPKPK  432
               + V F D  +G  VE W+ L ++ M     D   L YVS  P  K
Sbjct  400   FKNLVSFFDTTSGDGVEAWINLKEEDMEKFEADEEVLKYVSPNPSSK  446



>ref|XP_006582966.1| PREDICTED: vinorine synthase-like [Glycine max]
 gb|KHN39388.1| Vinorine synthase [Glycine soja]
Length=424

 Score =   194 bits (494),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 143/444 (32%), Positives = 220/444 (50%), Gaps = 33/444 (7%)
 Frame = -2

Query  1757  ITMKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGACHHTKT  1578
             + ++VEV SKE+ +PSSPT   L++Y LSFLDQ+   +  P V FY   +  G      T
Sbjct  1     MKLEVEVISKEMIKPSSPTQDHLRHYPLSFLDQVSPMVYNPMVLFY---SCYGITQTQFT  57

Query  1577  IDElkkslsk-tlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEMEKI  1401
             I E  K      L+  YPLAGRV  +   I+C+DEG+ ++ A V   +  ++  P   ++
Sbjct  58    ISEKLKKSLSDVLTHFYPLAGRVNGNSTFIDCNDEGIPYLEAKVKCKVVDVIHKPVPGEL  117

Query  1400  KQLIPSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASF-N  1224
               L+P    +    +      VQ+N F CGGIAIG  +SH IAD  +   F+  WA+F +
Sbjct  118   NHLVP----FLLDDITNITFGVQLNVFDCGGIAIGACLSHQIADGLSFFMFLNSWAAFAS  173

Query  1223  RG-CAANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAI  1047
             RG  A      F+   S+ LFPP  + S  +        GI +E  ++I K FV   + +
Sbjct  174   RGEQAVLPNPQFI---SAKLFPP-KNISGFDP-----RSGIIKE--NIICKMFVFDGSVV  222

Query  1046  AQLRQDLTITGGSVQR-PSRVEALTALVWAAVINAT-PTQTATLSCMVNLRRRMEPPLPP  873
               LR     T    ++ P+RVEAL+A +W+  +  T P +T  +   VNLR +MEPPLPP
Sbjct  223   ESLRARYAATSFENEKHPTRVEALSAFIWSRYVAVTGPQRTYAVVHAVNLRPKMEPPLPP  282

Query  872   NCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLRAVIA  693
             +  G     ++ +        ++ T   LV++ RD  + +     RK+      L  +  
Sbjct  283   DSFGNYYRISLTI-------PSLNTEEHLVKQARDQIKKIDKDYVRKLQYGNDHLDFLKD  335

Query  692   RGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVVN--MLDNSWVLFLDAIN-GAVE  522
               Y ++   +      +SLCR   Y+ DFGWG+P  V +  +   + V+F+D  N G +E
Sbjct  336   SSYRVLLKGELVPFNITSLCRFPLYDADFGWGEPTWVGSPALTFKNLVVFIDTKNGGGIE  395

Query  521   VWMKLPKQVMHTLTQDRHFLAYVS  450
              ++ L  + M     D   LA VS
Sbjct  396   AYVSLKVEDMTKFEADEELLACVS  419



>ref|XP_009780612.1| PREDICTED: vinorine synthase-like [Nicotiana sylvestris]
Length=418

 Score =   194 bits (493),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 135/394 (34%), Positives = 208/394 (53%), Gaps = 29/394 (7%)
 Frame = -2

Query  1748  KVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGACHHTKTIDE  1569
             KVE+ SKE+ +PSSPT  TLK +KLS LDQ+   +  P +FFY      G  + ++ I  
Sbjct  4     KVEIISKEMIKPSSPTTCTLKTHKLSLLDQISPPVFIPLIFFYQDEL--GNINRSRNIQI  61

Query  1568  lkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEMEKIKQLI  1389
             LKKSLS  L+  YPLAGR  ++   I+C+D G EFI A V   +S ++E P+ E++++ +
Sbjct  62    LKKSLSDALTRFYPLAGRFNDNNF-IDCNDAGAEFIEAQVHGYLSQVIETPKTEEVREFL  120

Query  1388  P-SAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGCA  1212
             P  A   E   V   L+AVQVN F+CGGIAIG  +SH + D S++  F+  WA+  RG  
Sbjct  121   PREASEVENNDV---LLAVQVNIFNCGGIAIGVCMSHKVGDGSSIVTFINAWAAIARG--  175

Query  1211  ANNGSGFVSDHSSI--LFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQL  1038
               N +G    + ++  +FPPL     + +     + GI+ ++   + +RFV     +  +
Sbjct  176   --NHTGIAQPNFNMSSIFPPLD----LSKSSFKPSIGIKNDK--FLSRRFVFNKEKLDAI  227

Query  1037  RQDLTITGGSVQRPSRVEALTALVWAAV-----INATPTQTATLSCMVNLRRRMEPPLPP  873
             ++  + +G  V+ P+RVEAL+A +W  +     +N   T+      +VN+R RM P L  
Sbjct  228   KK--SASGSQVKDPTRVEALSAFLWKNLMKVSKLNKDSTKMFAAVHVVNIRSRMNPTLSD  285

Query  872   NCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLRAVIA  693
             N  G L   A        +   +    +L+  +R A R + + +  ++   G      I+
Sbjct  286   NSFGNLWTTAPAFLSPKSE--EIFGIDDLLYHLRSAIRKI-NSDYTEILQNGEEFLKHIS  342

Query  692   RGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKP  591
             +  EL    +      SS CR   YEVDFGWGKP
Sbjct  343   KFAELFSKEEVEFYNFSSWCRFPVYEVDFGWGKP  376



>ref|XP_006430561.1| hypothetical protein CICLE_v10011733mg [Citrus clementina]
 gb|ESR43801.1| hypothetical protein CICLE_v10011733mg [Citrus clementina]
Length=441

 Score =   194 bits (494),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 144/459 (31%), Positives = 212/459 (46%), Gaps = 47/459 (10%)
 Frame = -2

Query  1751  MKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGACHHTKTID  1572
             M++   S E  +PSSPTP   + +KLSF+DQL+       + FY +   S      K++ 
Sbjct  1     MELRFSSIENIKPSSPTPDHQRTHKLSFIDQLNPGAYFSIILFYSAGASSERL--KKSLS  58

Query  1571  ElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAE-NMSCLLENPEMEKIKQ  1395
             E            YP AG+ K++   ++CDD GV FI A     +MS +++  +   ++Q
Sbjct  59    ETLTH-------FYPFAGQFKDNHF-VDCDDHGVTFIEAHFDRGDMSEVIQQAKTNILEQ  110

Query  1394  LIPSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGC  1215
             LIP  K +E   V   L+ VQVN F CGG+AIG    H +ADA+  A F++ W    RG 
Sbjct  111   LIP-CKPHESTRVEHNLI-VQVNYFGCGGMAIGVCFHHKVADAATAANFLKTWGLHARGA  168

Query  1214  AANNGSGF---VSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIA  1044
              A + + F   + D +SI   P  D   +   + +G   +     D +VKRF      IA
Sbjct  169   GAGDTNDFKHAIYDSNSIF--PAQDLPDMSVNLGLGLFSL-----DSVVKRFTFEGEKIA  221

Query  1043  QLRQDLTITGGSVQRPSRVEALTALVWAAVINA-------------TPTQTATLSCMVNL  903
              LR+ +      + RPSRVE +++++  A++ A              P    T    VNL
Sbjct  222   SLREKIVQAEPGLGRPSRVEVVSSVILGALLAAYGGSRDDDEEFTTAPLTHVTAIIAVNL  281

Query  902   RRRMEPPLPPNCLGTLVDEAI--VLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKV  729
             R+RM PPLP    G +   A   +      D    +    L  ++  + R V D   RK+
Sbjct  282   RKRMNPPLPEESFGNICSAAFLNLPIDRDHDHEKKINHGSLAGQLHQSIRMVDDQFVRKL  341

Query  728   YGEGGWL---RAVIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRL--VVNMLDN  564
             Y EG  L   +AV A+G      + +     SS C+M +YE DFGWGKP    V      
Sbjct  342   YVEGEILNIRKAVEAQG----SPKSNKVFVISSWCKMPFYEADFGWGKPVSIGVGTRFTE  397

Query  563   SWVLFLDAINGAVEVWMKLPKQVMHTLTQDRHFLAYVSA  447
             + VL        +E W+ L KQ M    Q    LA+ S+
Sbjct  398   AAVLVDSCQTDGIEAWVGLSKQDMARFEQHPGILAHTSS  436



>gb|KDP36822.1| hypothetical protein JCGZ_08113 [Jatropha curcas]
Length=696

 Score =   199 bits (506),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 153/468 (33%), Positives = 235/468 (50%), Gaps = 56/468 (12%)
 Frame = -2

Query  1751  MKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFY---DSPTISGACHHTK  1581
             M++EV S+E  +P S TP  L+ YKLS LDQL  +   P +FFY   D P I       K
Sbjct  1     MEIEVFSRESIKPPSLTPSHLRTYKLSLLDQLMPSAHVPIIFFYRPIDQPVIPARLQRLK  60

Query  1580  TIDElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEMEKI  1401
                    SLS+ L+  YP AG++K+D + I+C+D+GV +  A V+  +S +L +P+ + I
Sbjct  61    ------HSLSQALTSFYPFAGKIKDD-LYIDCNDDGVSYTEAKVSSFLSDILGHPDTKTI  113

Query  1400  KQLIPS-AKVYEPQPVGKAL--VAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWAS  1230
              +L+P  + + E    G  +    +QVN F CGGIAIG   SH I D      F++ WA+
Sbjct  114   FKLLPDDSYLLETYNEGNGIPVAMIQVNVFKCGGIAIGTKTSHKIIDGPTSTSFLKAWAA  173

Query  1229  FNRGCAA-------NNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKR  1071
               RG             S F  +HS    P  T  +    L+K G           ++KR
Sbjct  174   IARGSGELVVQPSFTAPSLFPQNHS---LPKDTLLAVWPSLVKFGKG---------VMKR  221

Query  1070  FVIPANAIAQLRQDLTITGGSVQRPSRVEALTALVWAAVINATPTQTAT-----LSCMVN  906
             FV  ++AIA L+   + +   VQRP+RVEA++A +W   + A+  +  +     LS  VN
Sbjct  222   FVFDSSAIATLKARAS-SSSFVQRPTRVEAVSAFIWQCTMVASEKRNGSYKPSVLSHTVN  280

Query  905   LRRRMEPPLPPNCLGTLVDEAIV-LCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKV  729
             LR +    LP + +G L+  +I   C EA+    V     LV  +R++   +     +K+
Sbjct  281   LRGKKTVHLPESSVGNLLWMSIAKCCTEAERELHV-----LVGLLRESILKIDSNFVQKL  335

Query  728   YGEGGWLRA--VIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKP------RLVVNM  573
              GE G+ +    +    E+  N  +  L  SSLC++  YE DFGWGKP       ++  +
Sbjct  336   SGEEGFYKVCECLQEFSEVYSNAGADYLTFSSLCKVGIYETDFGWGKPIWVSPGGVIGPV  395

Query  572   LDNSWVLFLDAING--AVEVWMKLPKQVMHTLTQDRHFLAYVSAFPKP  435
               N  ++FL+  +G   +EVW+ L +Q M  L  + H L++ S  P P
Sbjct  396   FQN--LVFLNETSGGDGIEVWLTLDEQDMAILELETHILSFSSLDPSP  441


 Score = 89.4 bits (220),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 66/258 (26%), Positives = 119/258 (46%), Gaps = 22/258 (9%)
 Frame = -2

Query  1466  FIVADVAENMSCLLENPEMEKIKQLIPSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFV  1287
             +I A     +S  L  P++  +++L+P        P G  +  +Q   F+CGG  IG + 
Sbjct  448   YIEATSNITLSQYLAKPDLALLRKLLPDIICEYELPSGSHIALIQETTFACGGFTIGIYA  507

Query  1286  SHAIADASALAKFMEIWASFNRGCAANNGSGFVSDHSSILFPPLTD-TSAIEQLMKMGAE  1110
             SH   D ++L  F++ WA+    C +     +++     +FPP T   S +     M A 
Sbjct  508   SHMFCDGASLFLFLKDWAA--TTCKSPTKHPYLAAEG--IFPPYTAFPSGVSFFTTMYAP  563

Query  1109  GIEQEEKDMIVKRFVIPANAIAQLRQDLTITGGSVQRPSRVEALTALVWAAVINATPTQT  930
              +++ +  +   R V   +AI  L+   ++       P+RVE +TA +   +I +   +T
Sbjct  564   FVKKGKYTL--NRIVFNESAITNLKAKASLNN---INPTRVEVVTAFLSKCLIASFKNKT  618

Query  929   A-----TLSCMVNLRRRMEPPLPPNCLGTLVDEA-IVLCQEAKDGGTVVTAVELVQRIRD  768
                    +   VNLRR+ +PPLP + LG ++  A  V   + K+       +ELV  +R+
Sbjct  619   GIDKPLAICHAVNLRRKADPPLPESLLGNIISFAGAVFTTKEKE------LIELVSELRE  672

Query  767   AFRAVKDGEARKVYGEGG  714
               + V +   +K+   GG
Sbjct  673   EMKKVDNDFLKKIKSGGG  690



>ref|XP_009361854.1| PREDICTED: BAHD acyltransferase At5g47980-like [Pyrus x bretschneideri]
Length=440

 Score =   194 bits (493),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 142/454 (31%), Positives = 220/454 (48%), Gaps = 39/454 (9%)
 Frame = -2

Query  1751  MKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGACHHTKTID  1572
             MKV+V +KE  +PSSPTP  L+N +LSF DQ    +  P + FY +   +      +  +
Sbjct  5     MKVQVLNKETIKPSSPTPPDLRNLRLSFFDQFEPEIFIPLLLFYRNKPCAAVADDQERSN  64

Query  1571  ElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEMEKIKQL  1392
              LK SLS+ L+  YP AG  + +  +I C+D GV F+ A V   MS + + P+   ++QL
Sbjct  65    FLKTSLSEALTHFYPFAGEFQRND-SICCNDHGVAFLQAQVNCYMSMVFDKPDDGILEQL  123

Query  1391  IPSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGCA  1212
             +P+ K          L+ +Q N F CGG+AIG   +H ++DA  ++KF+E WA+   G A
Sbjct  124   VPTDKESTLSNT-DYLLLIQANFFECGGLAIGVSFAHKVSDAFTISKFIERWAAIALGSA  182

Query  1211  ANNGSGFVSDHSSI----------LFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVI  1062
             +       +DH ++          LFPPL   ++ +  + +  EG        I +RFV 
Sbjct  183   ST-----TTDHHAVLPGEFGVSASLFPPLDIFNSPDFAVTLSTEG-------SITRRFVF  230

Query  1061  PANAIAQLRQDLTITGGSVQRPSRVEALTALVWAAVINATPTQT-----ATLSCMVNLRR  897
              A+ IA L+        S   P+RVE ++AL+W   I A+ ++      + L  +VN+R+
Sbjct  231   DASKIATLKSK---AANSTPNPTRVEVVSALIWKCAIQASRSKLGIIKPSMLCPIVNMRK  287

Query  896   RMEPPLPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEG  717
             R    L  N LG  V    V+  E++     +    LV ++R       +     V G  
Sbjct  288   RSRQALAENILGNCVWSFAVMTVESE-----IEHESLVAKLRKGIEEHTEKYPNGVSGND  342

Query  716   GWLRAVIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLV-VNMLDNSWVLFLDA  540
                 A  + G +L+ + D      SS CR ++YE DFGWGKP  V V  L  + +L +D 
Sbjct  343   IIEAAKESGGSKLLDSDDLDIYTCSSWCRFSFYEADFGWGKPSWVSVRSLYKNTILLMDM  402

Query  539   ING-AVEVWMKLPKQVMHTLTQDRHFLAYVSAFP  441
              +G  +E  + L +  M         LAY S  P
Sbjct  403   RDGDGIEASLTLKEDDMALFENSEELLAYASPNP  436



>ref|XP_006420178.1| hypothetical protein CICLE_v10006986mg [Citrus clementina]
 gb|ESR33418.1| hypothetical protein CICLE_v10006986mg [Citrus clementina]
Length=428

 Score =   194 bits (492),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 154/456 (34%), Positives = 221/456 (48%), Gaps = 59/456 (13%)
 Frame = -2

Query  1751  MKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYD-------SPTISGAC  1593
             M VEV SKE  +PS+PTP+ L+ YK SF DQ+  +   P ++FY+       +  ISG  
Sbjct  1     MDVEVISKETIKPSTPTPKHLQIYKFSFTDQISPSFYIPLIYFYNLNDHKLGNNIISG--  58

Query  1592  HHTKTIDElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPE  1413
                    +LKKSLSK L+  YPLAG + +D V  +C+D+GV F+ A V  N+S ++  P 
Sbjct  59    -------DLKKSLSKVLTHYYPLAGCLNDDYV--DCNDKGVLFLEAKVKCNLSQIIGEPN  109

Query  1412  MEKIKQLIPSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWA  1233
               K+ + +P         V   ++A+QVN F CG IAIG  VSH IADAS    F++ WA
Sbjct  110   PRKLNKFLPDH-------VKNFILAIQVNFFDCGNIAIGACVSHKIADASTFITFIKNWA  162

Query  1232  SFNRGCAANNGSGFV---SDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVI  1062
             +                    S+ LFPP     +    +          EK+++ K FV 
Sbjct  163   AAASFGGGGGDDSVKICPELLSATLFPPRDVGESCRVSL--------PAEKNIVCKSFVF  214

Query  1061  PANAIAQLRQDLTITGGSVQRPSRVEALTALVWAAVINAT-----PTQTATLSCMVNLRR  897
               + IA L++     GG    P+RVEAL+A +W+    +T     P + + L   VNLR+
Sbjct  215   RGSRIAALKE--KYAGGI--HPTRVEALSAFIWSRFAASTEIKIGPERVSMLVHAVNLRK  270

Query  896   RMEPPLPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARK----V  729
             RM+PP P +  G +      +  E  D G       LV+  RDA   +    A+K    V
Sbjct  271   RMDPPQPDDSFGNISGPTATIISE--DIGEECYG--LVKMFRDAIGRINKDYAKKLQEGV  326

Query  728   YGEGGWLRAVIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVVNM---LDNSW  558
             +   G L ++   G++    R+    Y +SLCR   YE DFGWGKP  V        N  
Sbjct  327   FEHFGLLGSINDDGFD---RREVVNFYYTSLCRFPLYEADFGWGKPIWVAWGGWPYRNIA  383

Query  557   VLFLDAINGAVEVWMKLPKQVMHTLTQDRHFLAYVS  450
             VL        +E W+ L ++ M     D+ FL+YVS
Sbjct  384   VLMDTKCGNGIEAWIHLKEEDMVKFEADKEFLSYVS  419



>ref|XP_010682956.1| PREDICTED: BAHD acyltransferase At5g47980 [Beta vulgaris subsp. 
vulgaris]
Length=473

 Score =   195 bits (495),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 146/450 (32%), Positives = 219/450 (49%), Gaps = 32/450 (7%)
 Frame = -2

Query  1751  MKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGACHHTK-TI  1575
             MKV   +++  +PSS T   L+N+K S LDQL  +L  P VFFY    IS     T   +
Sbjct  10    MKVARVARDYIKPSSITAPHLRNFKFSLLDQLAPSLYAPMVFFYPMQDISNIKDDTSYRV  69

Query  1574  DElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAEN-MSCLLENPEMEKIK  1398
             + LK+SLS  L+  YP AGR+K D V+I+C+D GVEF  A V    ++  L  P    +K
Sbjct  70    NHLKRSLSPFLNRFYPFAGRIK-DHVSIDCNDAGVEFFEAKVINTRLNDFLRLPNANALK  128

Query  1397  QLIPSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRG  1218
             Q +P     E       LV VQ N F CGG+A+G   SH I D    + FM+ W+S   G
Sbjct  129   QFLPVD--IESNKSMDHLVHVQTNTFECGGMALGICWSHKITDGGTASTFMKGWSSMASG  186

Query  1217  CAANNGSGFVSDH-SSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQ  1041
                  G   V ++ +S LFPP+ D+S  +  +K+       ++     +RFV   + I +
Sbjct  187   L----GDEVVPEYVASSLFPPM-DSSITQHALKL-------DKDRTTTRRFVFDGSKIVK  234

Query  1040  LRQDLTITGGSVQRPSRVEALTALVWAAVINATPTQTAT--LSCM---VNLRRRMEPPLP  876
             L+    +    V +P+RVEA+++L+W     A+   + +  LS M   +N+RRR  PPLP
Sbjct  235   LKD--KVASKEVPKPTRVEAVSSLLWQCATKASRANSGSQALSVMSQSMNIRRRTLPPLP  292

Query  875   PNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGW--LRA  702
                +G LV   I   +E  D   ++   +LV + R       +  A+K+ G   +  ++ 
Sbjct  293   DTSIGNLVGYYIAKMEENSD--HIMHLEDLVTKQRQGKTEAINNYAKKLQGNDAYVVIQE  350

Query  701   VIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKP---RLVVNMLDNSWVLFLDAING  531
             +      L+R  D +     S C    Y+ DFGWGKP    LV     N++ L      G
Sbjct  351   LFKEAGSLLRRDDVAFFKCLSTCGDGLYDADFGWGKPAWQSLVSLGYKNTFALSETKEGG  410

Query  530   AVEVWMKLPKQVMHTLTQDRHFLAYVSAFP  441
              +E W+ L +  M     D   L + S+ P
Sbjct  411   GIEAWVTLNEDDMAIFEHDFDLLQFASSNP  440



>ref|XP_004143047.1| PREDICTED: salutaridinol 7-O-acetyltransferase-like [Cucumis 
sativus]
 gb|KGN62352.1| hypothetical protein Csa_2G350350 [Cucumis sativus]
Length=447

 Score =   194 bits (493),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 153/454 (34%), Positives = 229/454 (50%), Gaps = 37/454 (8%)
 Frame = -2

Query  1745  VEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYD--SPTISGACHHTKTID  1572
             +++ S +I +PSSPTP  L  + LS  DQL  +   P +FF+    P+ SG  +   T++
Sbjct  9     LQIVSTQIIKPSSPTPPNLNIHTLSLFDQLAPHTFVPLLFFFSHHGPS-SGTYYDHTTVE  67

Query  1571  ElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADV-AENMSCLLENPEMEKIKQ  1395
              L++SLS TLS  YPLAGR+K DKV+I+C+DEGV F+ A +    +S +LENP  E +++
Sbjct  68    LLRQSLSTTLSRYYPLAGRIK-DKVSIDCNDEGVTFVEARLEGVTVSKILENPRSEIVEK  126

Query  1394  LIPSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGC  1215
             L      ++   +G +L+ VQ+  F CGG++IG  +SH + D + L KF++ W    R  
Sbjct  127   LFVDGLQWKDSKMG-SLLKVQITLFECGGLSIGVLLSHKLGDLATLVKFIQDWGVITR--  183

Query  1214  AANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQLR  1035
               NNG     D   I+ P                 G   EE +   KRFV   + I  L+
Sbjct  184   --NNG---FCDEEEIINPLFFSGDLFPHGDLPAMSGAVIEEGNFTCKRFVFEGSKIESLK  238

Query  1034  QDLTITGGSVQRPSRVEALTALVWAAVINATPTQTAT-------LSCMVNLRRRMEPPLP  876
               ++     VQ PSRVE ++AL++ A+I+A+ T   +       L   +NLR+R+ PPLP
Sbjct  239   NRIS---EKVQNPSRVEVVSALIYKAIISASRTNNNSQNHPATLLLQTLNLRKRVAPPLP  295

Query  875   PNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLRAVI  696
                +G+LV    V     ++   VV   ELV  +R       +  A+K Y    WL  + 
Sbjct  296   DTLVGSLVSFFPVGVDGERE---VVELHELVGTMRKEMGEFCEKYAKK-YRTKEWLELIK  351

Query  695   ARGYE----LVRNRDSSTLY-TSSLCRMAYYEVDFGWGKPRLVVN---MLDNSWVLFLDA  540
              R  E    L +N ++  +Y  SS C    YEVDFGWG    +      + N+ V+ LDA
Sbjct  352   KRLNESREILSKNGNNQLVYRCSSGCNFPIYEVDFGWGAADWITMPAFKMKNT-VMMLDA  410

Query  539   ING-AVEVWMKLPKQVMHTLTQDRHFLAYVSAFP  441
              NG  +E  + L    M     +   LA+ S  P
Sbjct  411   KNGRGIEALVSLQDGEMAAFQDNEELLAFASLNP  444



>ref|XP_010044501.1| PREDICTED: vinorine synthase-like [Eucalyptus grandis]
 gb|KCW86587.1| hypothetical protein EUGRSUZ_B03219 [Eucalyptus grandis]
Length=434

 Score =   194 bits (492),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 148/446 (33%), Positives = 216/446 (48%), Gaps = 33/446 (7%)
 Frame = -2

Query  1757  ITMKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGACHHTKT  1578
             + + VE+ S+E  +PSS TP  L++Y+LSFLDQ+   +  PFV FY      G  +    
Sbjct  1     MEIAVEITSRETIKPSSLTPDHLRHYRLSFLDQISPPVYNPFVLFYTPKKEGGQSNIDDI  60

Query  1577  IDElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEMEKIK  1398
               +LK SLS  L+  YPLAGR+K + V+IECDD GV +  A V   +S   ENP+  +++
Sbjct  61    SSKLKASLSCILTHFYPLAGRLKGN-VSIECDDAGVPYSEAIVKCQVSEFTENPDPRELR  119

Query  1397  QLIPSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRG  1218
              L+P    +      +    VQ NRF CGGIAIG  +SH IADA +L  F+ +WA+  RG
Sbjct  120   NLVP----FVLDASDETTFGVQFNRFDCGGIAIGICMSHKIADALSLLTFINMWAAVCRG  175

Query  1217  CAANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIV-KRFVIPANAIAQ  1041
                     F S     LFPP            +G E      +D IV KRF+   + I  
Sbjct  176   EEIVAPPQFPSAE---LFPPKN---------ILGFEPSTGIIRDNIVSKRFIFKTDKIEN  223

Query  1040  L--RQDLTITGGSVQRPSRVEALTALVWAAV-----INATPTQTATLSCMVNLRRRMEPP  882
             L  R    +     + PSR+EAL+  +W+       + + P++   +   VNLR + +PP
Sbjct  224   LKARYSKEMDLDRNRPPSRIEALSTFIWSRFAWSTRVYSEPSKKCIVLHAVNLRTKFDPP  283

Query  881   LPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLRA  702
             LP    G     A+   Q   D G       LV ++R+  R +  G   K+  +G     
Sbjct  284   LPQYSFGNFYRVAVTSLQ--LDSGKECYG--LVAKMRETLRGIDKGYVEKLR-DGKEHLD  338

Query  701   VIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVVN--MLDNSWVLFLDAING-  531
              I R  E+        +  +SLCR   YE DFGWG P    +  +   + V+F+D  +G 
Sbjct  339   FIKRSAEVYLKGQLLAMNFTSLCRFPVYESDFGWGNPTWAGSPALTFQNLVVFMDTKSGD  398

Query  530   AVEVWMKLPKQVMHTLTQDRHFLAYV  453
              VE ++ L  + M  L  D  F+ +V
Sbjct  399   GVETYISLRVEDMAALESDEEFMEFV  424



>ref|XP_010046626.1| PREDICTED: vinorine synthase-like [Eucalyptus grandis]
 gb|KCW86590.1| hypothetical protein EUGRSUZ_B03222 [Eucalyptus grandis]
Length=434

 Score =   193 bits (490),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 147/446 (33%), Positives = 217/446 (49%), Gaps = 33/446 (7%)
 Frame = -2

Query  1757  ITMKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGACHHTKT  1578
             + + VE+ S+E  +PSSPTP  L++Y+LSFLDQ+   +  PFV FY         +    
Sbjct  1     MEIAVEITSRETIKPSSPTPDHLRHYRLSFLDQISPPVYNPFVLFYTPQNEGDQSNIDDL  60

Query  1577  IDElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEMEKIK  1398
               +LK SLS  L+  YPLAGR++ + V+IECDD GV +  A V   +S   ENP+  +++
Sbjct  61    SSKLKASLSIILTHFYPLAGRLRGN-VSIECDDAGVPYSEAIVKCQVSEFTENPDPRELR  119

Query  1397  QLIPSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRG  1218
              L+P    +      +  + VQ NRF CGGIAIG  +SH I+DA +L  F+ +WA+  RG
Sbjct  120   NLVP----FVLDASDETTLGVQFNRFDCGGIAIGICMSHKISDALSLLTFINMWAAVCRG  175

Query  1217  CAANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIV-KRFVIPANAIAQ  1041
                     F S     LFPP            +G E      +D IV KRFV   + I  
Sbjct  176   EEILAPPQFPSAE---LFPPKN---------ILGFEPSTGIIRDNIVSKRFVFKTDKIEN  223

Query  1040  L--RQDLTITGGSVQRPSRVEALTALVWAAV-----INATPTQTATLSCMVNLRRRMEPP  882
             L  R    +     + PSR+EAL+  +W+       + + P++   +   VNLR + +PP
Sbjct  224   LKARYSKEMDLDRNRPPSRIEALSTFIWSRFAWSTRVYSEPSKKCIVLHAVNLRTKFDPP  283

Query  881   LPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLRA  702
             LP    G     A+   Q   D G       LV ++R+  R +  G   K+  +G     
Sbjct  284   LPQYSFGNFYRVAVTSLQ--LDSGKECYG--LVAKMRETLRGIDKGYVEKLR-DGKEHLD  338

Query  701   VIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVVN--MLDNSWVLFLDAING-  531
              I R  E+        +  +SLCR   YE  FGWG P  V +  +   + V+F+D  +G 
Sbjct  339   FIKRSAEVYLKGQLLAMNFTSLCRFPVYESSFGWGNPTWVGSPALTFQNLVVFMDTKSGD  398

Query  530   AVEVWMKLPKQVMHTLTQDRHFLAYV  453
              VE ++ L  + M  L  D  F+ +V
Sbjct  399   GVETYISLRVEDMAALESDEEFMEFV  424



>ref|XP_006435345.1| hypothetical protein CICLE_v10001106mg [Citrus clementina]
 ref|XP_006473775.1| PREDICTED: BAHD acyltransferase At5g47980-like [Citrus sinensis]
 gb|ESR48585.1| hypothetical protein CICLE_v10001106mg [Citrus clementina]
Length=455

 Score =   193 bits (491),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 156/466 (33%), Positives = 232/466 (50%), Gaps = 49/466 (11%)
 Frame = -2

Query  1751  MKVEVR--SKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGACHHTKT  1578
             MK+EV+  SKE  +PSSPTP  LK +K S LDQ   +   P + FY +  ++ A    K 
Sbjct  1     MKIEVQIISKEDIKPSSPTPPHLKTFKFSLLDQFIPSPYAPIILFYPNDCMTLA-EIPKR  59

Query  1577  IDElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEMEKIK  1398
             +  LK+SLS+TL+  YPLAG++K+D ++IEC+D+G  F+ A V   +   L  P++  + 
Sbjct  60    LALLKRSLSETLTRFYPLAGKIKDD-LSIECNDDGAYFVEAQVNCRLDEFLTKPDLLLLH  118

Query  1397  QLIPSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRG  1218
             + +P   + E   V   L  +QVN F CGGIAIG  +SH + D +AL+ F+  W++  RG
Sbjct  119   RFLPCELMKELTAV-TYLTNIQVNVFDCGGIAIGICISHKMLDGAALSTFLRAWSATARG  177

Query  1217  CAANNGSGFVSDHSSILFPP----LTDTSAI--EQLMKMGAEGIEQEEKDMIVKRFVIPA  1056
             C       F +     LFP     L DTS +    L K G           I KRFV  A
Sbjct  178   CEEVIYPNFAAPS---LFPANDLWLRDTSMVMWGSLFKKGK---------CITKRFVFDA  225

Query  1055  NAIAQLRQDLTITGGSVQ---RPSRVEALTALVWAAVINATPTQTA-------TLSCMVN  906
             +AIA L+  +  T   ++    P+RVEA++A +W  ++ A+  +          L+ +VN
Sbjct  226   SAIAALK--VVATSSKIKCPTPPTRVEAVSAFIWKCIMAASKEKHGYQTRRPCVLTHLVN  283

Query  905   LRRRMEPPLPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGE-ARKV  729
             LRRRM PPL  NC G L+  A   C             +LV  ++DA   + DGE  +K+
Sbjct  284   LRRRMTPPLSDNCTGNLLWMAAAKCMTPDKP----ELHDLVGELKDAISKL-DGEFVKKL  338

Query  728   YGEGG--WLRAVIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVVNM------  573
               + G   +   + +  EL    +   +  SS C   +YE+DFG GKP  V +       
Sbjct  339   SSDEGNSLMCESLKQIGELCSKDEVDHVGFSSWCNFGFYEIDFGRGKPVWVSSYGLSGSP  398

Query  572   LDNSWVLFLDAINGAVEVWMKLPKQVMHTLTQDRHFLAYVSAFPKP  435
             + N  +L        +E WM L +Q M  L     ++ + S  P P
Sbjct  399   VMNLVILVETRYGDGIEAWMTLDEQDMSNLECSSEYIKFASMDPSP  444



>ref|XP_002514983.1| Anthranilate N-benzoyltransferase protein, putative [Ricinus 
communis]
 gb|EEF47537.1| Anthranilate N-benzoyltransferase protein, putative [Ricinus 
communis]
Length=442

 Score =   193 bits (490),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 146/465 (31%), Positives = 220/465 (47%), Gaps = 48/465 (10%)
 Frame = -2

Query  1757  ITMKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISG---ACHH  1587
             +  KVE+  K+  +PSSPTP  LK  KLS LDQ      T  + FY  P   G     HH
Sbjct  3     MATKVEIIQKDTIKPSSPTPHDLKILKLSLLDQFIPITYTSLLLFY--PINYGDDNLDHH  60

Query  1586  TKTIDElkkslsktlsLM---YPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENP  1416
               T ++  K        +   +PLAGR++ D  ++ CDD+G EFI A V   +S LL+NP
Sbjct  61    ASTSEKSLKLKKSLSETLTHFHPLAGRLR-DNTSVACDDQGAEFIEARVNCLLSELLKNP  119

Query  1415  EMEKIKQLIPSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIW  1236
             + + + Q +P A +  P+     L+ VQ   F CGG+A+G  +SH +ADA+ L  F+  W
Sbjct  120   DAQVLSQFLP-APIESPEAATGNLLLVQATFFDCGGLAVGICISHKMADAATLTTFIRCW  178

Query  1235  ASFNRGCAANNGSGFVSDHSSILFPPLTDTSAIEQL-MKMGAEGIEQEEKDMIVKRFVIP  1059
                         S   +D S IL P     S    + + +    +E  ++  + +RFV  
Sbjct  179   ------------SATATDRSKILNPVFMGASIFPPIDISIPRTPVELMQQKCVTRRFVFA  226

Query  1058  ANAIAQLRQDLTITGGSVQRPSRVEALTALVWAAVINATP-----TQTATLSCMVNLRRR  894
             A  IA LR  +  T  +V  P+RVEA++ ++W + + A+      ++ +  S  VN+R R
Sbjct  227   APKIAALRAKVAST--TVPDPTRVEAVSGILWKSAVTASRIRFGYSRPSIWSISVNMRTR  284

Query  893   MEPPLPP----NCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVY  726
               PP P     NCLG +   A +L     DG       ELV R+R   +   +   +K+ 
Sbjct  285   FVPPFPENYAGNCLGHI---APIL----MDGECEFELKELVGRVRKEIKGFGENYVKKLQ  337

Query  725   GEGGWLRAVIARGYE---LVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVVNMLDN--S  561
             GEG  L AV     E   L  + D+     +S C+   Y+ DFGWGKP  V N      +
Sbjct  338   GEGA-LLAVCGFAKEFGNLAMSNDNDFYICTSWCKYELYDADFGWGKPVWVGNASHKVRN  396

Query  560   WVLFLDAING-AVEVWMKLPKQVMHTLTQDRHFLAYVSAFPKPKL  429
               + +D  +G  +EVW+ L ++ M     +   L +    P   L
Sbjct  397   VAILMDTRDGDGIEVWLTLGEEDMAFFESNEELLEFADINPSVSL  441



>ref|XP_011071306.1| PREDICTED: vinorine synthase-like [Sesamum indicum]
Length=439

 Score =   193 bits (490),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 154/454 (34%), Positives = 238/454 (52%), Gaps = 45/454 (10%)
 Frame = -2

Query  1757  ITMKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGACHHTKT  1578
             + +++EV SKEI +PSSPTP++L+ ++LSFLDQ+      P ++FY +        + K 
Sbjct  1     MEIEIEVISKEIIKPSSPTPESLRKHQLSFLDQIAPPAFMPVLYFYQA---DAKFSNLKK  57

Query  1577  IDElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEMEKIK  1398
              + LKKSLS+ LS  YPLAGR+ +D + ++C+DEG  ++ A     +S ++ NP M+ + 
Sbjct  58    SNNLKKSLSQVLSRFYPLAGRLVDD-LYVDCNDEGAPYVEAVANCTLSQIITNPVMKNMD  116

Query  1397  QLIPSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRG  1218
             + +P  KV E   V    +AVQV  F CGG A+G  +SH IAD S+       WA+  R 
Sbjct  117   KFLPY-KVDE--YVQNLCMAVQVTYFQCGGTAVGLVISHKIADGSSFVPVANTWAAVARN  173

Query  1217  CAANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQL  1038
                ++      + + I FPP   T          + GI +E   +I K F  PA+ I+ L
Sbjct  174   GNYDDVPAPKFEGAKI-FPPQDATG----FKPPSSTGIVKEA--VITKIFTFPASKISAL  226

Query  1037  RQDLTITGGS-VQR-PSRVEALTALVWAAVINAT-----PTQTATLSCMVNLRRRMEPPL  879
             ++  +      +QR PSRVEAL+A +W   ++AT     P +  T+   VNLR R+ PPL
Sbjct  227   QERYSSGAAEFLQRPPSRVEALSAFIWTRFVSATEMKANPNKIYTVRHTVNLRPRLNPPL  286

Query  878   PPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGG----W  711
                  G +   A+ +     + G     VE++Q++++A RAV +GE      +GG    +
Sbjct  287   SDYHFGNIFWVAVAMPSVGANCG-----VEVMQKVKEAIRAV-NGENVAQLLQGGETLNF  340

Query  710   LRAVIA---RGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVVN---MLDNSWVLF  549
             L+  +A   RG ELVR         +SL +   Y+ DFGWGKP  VV    +LD + V+ 
Sbjct  341   LKEKMAYANRG-ELVR------FTFTSLHKFPLYKADFGWGKPVWVVTLAGLLDKNLVVL  393

Query  548   LDAING-AVEVWMKLPKQVMHTLTQDRHFLAYVS  450
             +D   G  +E  + L K+ M     D     ++S
Sbjct  394   VDTATGDGIEARINLSKEDMEKFEADLELQEFLS  427



>ref|XP_002514976.1| 3'-N-debenzoyl-2'-deoxytaxol N-benzoyltransferase, putative [Ricinus 
communis]
 gb|EEF47530.1| 3'-N-debenzoyl-2'-deoxytaxol N-benzoyltransferase, putative [Ricinus 
communis]
Length=435

 Score =   192 bits (489),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 148/449 (33%), Positives = 223/449 (50%), Gaps = 36/449 (8%)
 Frame = -2

Query  1751  MKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDS-PTISGACHHTKTI  1575
             ++VE  S+E+ +PSSPTP  L++++LSFLDQ+ + +  PFV FY   P  S         
Sbjct  3     VEVEFISQELIKPSSPTPDHLRHFQLSFLDQIQVPVWMPFVLFYSKEPNTSNLAR----C  58

Query  1574  DElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEMEKIKQ  1395
             ++LKKSLSKTL++ YPLAGRV  +  +I C+DEGV F+ A     +S +L N       +
Sbjct  59    NQLKKSLSKTLTIFYPLAGRV-NNNTSIHCNDEGVLFVEAQANCQLSDILRNANPSDNNK  117

Query  1394  LIPSAKVYEPQPVGKALVA-VQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRG  1218
             LIP      P   GK L A +QV  F+CGG+AI   +SH + DA +   F+  WA+  RG
Sbjct  118   LIPL-----PLDDGKGLAAFLQVTFFTCGGLAISLAMSHKLGDALSKLIFLNCWAAITRG  172

Query  1217  CAANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQL  1038
                 N  G     S+ LFPP        +++     G    + +++ KRFV  ++ ++ L
Sbjct  173   DTDPNIIGVSPSGSATLFPP--------KILSGFDAGAAIVKDNIVTKRFVFDSSTVSGL  224

Query  1037  RQDLTITGGSVQRPSRVEALTALVWAAVINA-----TPTQTATLSCMVNLRRRMEPPLPP  873
             R       G     SRVEAL A +W+  + A     T  +   +   VNLR RMEPPL  
Sbjct  225   RAKYKHKNGC--SVSRVEALAAFIWSRFMAATQADRTDNKLYMVLHAVNLRPRMEPPLSN  282

Query  872   NCLGTLVDEAIVLCQ-EAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLRAVI  696
                G +   A  +    AKD         +V R+ +A R+V     + +    G L  + 
Sbjct  283   LYFGNITRIATTMADMNAKDD----ECYGIVSRMNNAIRSVNADFVKSLQKSDGHLNFLK  338

Query  695   ARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVVN--MLDNSWVLFLDAING-AV  525
                 ++ +       +T SLC+   YE+DFGWGKP  V +  ++  +  LF D   G  +
Sbjct  339   EEAGKITKGELIHFAFT-SLCKFPVYEIDFGWGKPVWVGSACLVFKNLALFFDTKEGNGI  397

Query  524   EVWMKLPKQVMHTLTQDRHFLAYVSAFPK  438
             E W+ L ++ M     D    A++++ P 
Sbjct  398   EAWINLKEEDMAKFELDEELRAHITSTPN  426



>ref|XP_003616845.1| Vinorine synthase [Medicago truncatula]
 gb|AES99803.1| anthranilate N-benzoyltransferase [Medicago truncatula]
Length=440

 Score =   192 bits (489),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 140/454 (31%), Positives = 230/454 (51%), Gaps = 43/454 (9%)
 Frame = -2

Query  1751  MKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGACHHTKTID  1572
             M++E+ S+E  +PSSPTP  LK Y LSF+D +      P ++FY+    + +      I 
Sbjct  1     MEIELLSRETIKPSSPTPSHLKLYPLSFIDNIIFRNYAPLLYFYNP---NKSIDQNSKIS  57

Query  1571  ElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEMEKIKQL  1392
             +L+KSLS+ LS  YP AGR+K D++TIEC+D+GV F+V  +   +S +L+NP  + +  L
Sbjct  58    QLRKSLSQLLSKYYPFAGRIK-DRITIECNDQGVLFLVTKIKNKLSEILQNPTEKLLNPL  116

Query  1391  IPSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGCA  1212
              P    ++      + +A+Q+N F+CGG+ I   ++H I DAS + KFM  WA  N+   
Sbjct  117   FPDELQWKEMDWRASFIAIQINWFTCGGMVISICMTHKIGDASTIFKFMNDWAIINQKIE  176

Query  1211  ANNGSGFVS-----DHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAI  1047
              +     VS     D  + +FP        ++ + +  E + ++E +++ KRFV     I
Sbjct  177   EDKKELLVSPLSLLDAGATIFP--------QRDLPIFPEMVIKKENNVVFKRFVFQPAMI  228

Query  1046  AQLRQDLTITGGSVQRPSRVEALTALVW--AAVINATPTQTATLSCMVNLRRRMEPPLPP  873
               L+    +T  S+  P++V+ +TA ++  A  I     QTA  S +V+LRRRM PPL  
Sbjct  229   KSLKA--MVTSSSMHSPTQVQVVTAWIYKHAVSIMGLNFQTAMFSMIVDLRRRMVPPLSE  286

Query  872   NCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVY------GEGGW  711
             +C+G +   + +L  + +     +   +LV +I++        E   VY       E   
Sbjct  287   HCVGNIFWFSSMLANKKE-----MELEDLVCQIKEGL-----SECCNVYPKLFREKENNN  336

Query  710   LRAVIARGYELVRNRDSSTLYT-SSLCRMAYYEVDFGWGKPRLVVNM-LDNSWVLFL-DA  540
             +   + +  E     ++  L+T SS CR   YE DFGWGKP  +    L +  ++FL D 
Sbjct  337   ISECLKQVTEPY--SENKNLFTFSSWCRFPMYEADFGWGKPIWITTTGLSSRNIIFLMDT  394

Query  539   ING-AVEVWMKLPKQVMHTLTQDRHFLAYVSAFP  441
              +G  +E  + +    M     +   L Y S  P
Sbjct  395   RDGDGIEAIVNMEDNYMAKFEHEFELLQYASFNP  428



>ref|XP_008383113.1| PREDICTED: vinorine synthase-like [Malus domestica]
Length=506

 Score =   194 bits (493),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 150/458 (33%), Positives = 225/458 (49%), Gaps = 57/458 (12%)
 Frame = -2

Query  1751  MKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYD-----SPTISGACHH  1587
             +KVEV SKEI +PSSPTP  L +Y+ SFLDQ++  + T  V F++      PTI+    H
Sbjct  4     IKVEVISKEIIKPSSPTPNHLSHYQFSFLDQINPPVYTSLVLFFEFNGERQPTINEISQH  63

Query  1586  TKTIDElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAE-NMSCLLENPEM  1410
              K       SL+  L+L YPLAGR + +   + C+DEGV ++ A V    +S +L NP  
Sbjct  64    LKK------SLAYVLTLYYPLAGRARLENHFVNCNDEGVPYLEAQVKNCQLSEVLNNPIP  117

Query  1409  EKIKQLIPSAKVYEPQPV-GKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWA  1233
             E++ +L+P    +E   V G+ ++ VQ+N F CGG AIG   SH IAD  ++  F + WA
Sbjct  118   EELNKLVP----FELDDVAGEFILGVQLNMFECGGFAIGLCTSHKIADGLSMLMFTKTWA  173

Query  1232  SFNRGCAANNGSG-------FVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVK  1074
             +  RG   ++ +        FV   S+ LFPP   T     +      GI +++   + K
Sbjct  174   AIARGGHDHDDNQAKIERPEFV---SASLFPPKEITGYDAHV------GITRKK---VTK  221

Query  1073  RFVIPANAIAQLRQDLTITGGSVQRPSRVEALTALVWAAVINATP--------TQTATLS  918
             RFV  A+ I +LR+  T    +  RPSR+E L+A +W  ++ A           +   L 
Sbjct  222   RFVFDASTIEELRKKYTGLESNKIRPSRIEILSAFIWRRIVEAAKGGDHIDVENKLHMLI  281

Query  917   CMVNLRRRMEPPLPPNCLGTLVDEAIVLCQEAKDGGTVVT---AVELVQRIRDAFRAVKD  747
               VNLR RM+PPLP +  G +    I +        T +       +V+ IR+A   + D
Sbjct  282   HAVNLRPRMDPPLPRSSFGNIC--LISMTGPFTSSNTSLDNDPCYGMVRHIREAMSKI-D  338

Query  746   GEARKVYGEGGWLRAVIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLV--VNM  573
              E  K   EG    + + +  +        T   +SLCR   Y+ DFGWG+P  V    +
Sbjct  339   NEYVKRLQEGDEHLSSVKKLADSFTREHLVTYNFTSLCRYPLYDNDFGWGRPTWVGLPAL  398

Query  572   LDNSWVLFLDAING-----AVEVWMKLPKQVMHTLTQD  474
                + ++FLD          +E ++ L KQVM     D
Sbjct  399   TFKNLIVFLDTKEAGGGGRGIEAYVSLEKQVMAKFETD  436



>ref|XP_008389789.1| PREDICTED: vinorine synthase-like [Malus domestica]
 ref|XP_008367046.1| PREDICTED: vinorine synthase-like [Malus domestica]
Length=435

 Score =   192 bits (488),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 152/459 (33%), Positives = 238/459 (52%), Gaps = 52/459 (11%)
 Frame = -2

Query  1751  MKVEVR--SKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGACHHTKT  1578
             MKVEV   SKEI RPSSPTP  L+ Y+LSFLDQ+   +  P V FY S          + 
Sbjct  1     MKVEVVVISKEIIRPSSPTPDHLRTYQLSFLDQISPPVYNPLVIFYSSSEPETKFDIVEI  60

Query  1577  IDElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEMEKIK  1398
              ++LKKSLS  L+  YPLAGR + + + I+C+D+G+ ++   V   +S +++NP   ++ 
Sbjct  61    SNQLKKSLSNALTQFYPLAGRAQGN-LFIDCNDQGIPYLETRVKCQLSDVIQNPIPVELN  119

Query  1397  QLIPSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRG  1218
             + IP    ++   V      VQ+N F CGGIA+G  +SH IADA +   F++ WA+  R 
Sbjct  120   KFIP----FQLDEVVDISFGVQLNIFECGGIALGLCISHKIADALSFFNFIKTWAATARQ  175

Query  1217  CAANNGSGFVSDH-------SSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIP  1059
                       SDH       S+ LFPP   +    ++      GI +E  +++ + FV  
Sbjct  176   ---------QSDHLVCPQFVSAKLFPPKNISGYSPRV------GITKE--NIVTRMFVFE  218

Query  1058  ANAIAQLRQ-----DLTITGGSVQR-PSRVEALTALVWAAVINAT-------PTQTATLS  918
             A+ I  L+      D + +  + Q+ PSRVEAL+A +W+  + AT       P +   + 
Sbjct  219   ASKIETLKSKYGAGDHSKSLENHQKPPSRVEALSAFIWSRFMAATQVKSDIAPKRIYAIV  278

Query  917   CMVNLRRRMEPPLPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEA  738
               VNLR R++PPLP +  G L   A+ +   + D G       L+ ++RD  + + D   
Sbjct  279   HAVNLRTRIDPPLPEHSFGNLYRIAMTI--PSLDIGE--ECYGLLSQVRDQVKKI-DKHY  333

Query  737   RKVYGEGGWLRAVIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVVN--MLDN  564
              +   +G      I +  + V   +  TL  +SLCR   YE DFGWG P  V +  +  N
Sbjct  334   VENLQKGSEHLDFIKQTSDNVFKGEMVTLNFTSLCRFPLYEADFGWGNPTWVGSPALTFN  393

Query  563   SWVLFLDAIN-GAVEVWMKLPKQVMHTLTQDRHFLAYVS  450
             + V+F+DA + G +E ++ + ++ +  +  D  FLA+VS
Sbjct  394   NLVVFIDAKSGGGIEAYINMKEEDLAKIEGDGEFLAFVS  432



>ref|XP_003521961.1| PREDICTED: vinorine synthase-like [Glycine max]
 gb|KHN35623.1| Vinorine synthase [Glycine soja]
Length=433

 Score =   192 bits (487),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 139/451 (31%), Positives = 223/451 (49%), Gaps = 36/451 (8%)
 Frame = -2

Query  1757  ITMKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGACHHTKT  1578
             + +KVE+ SK+  +PSSPTP  L+++KLS LDQL      P + FY     S +    KT
Sbjct  1     MAVKVEIVSKDTIKPSSPTPNHLQHFKLSLLDQLAPPFYVPILLFY-----SFSDDDFKT  55

Query  1577  IDElkkslsktlsLMY-PLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEMEKI  1401
             I    K+    +  +Y P  G ++ +   +EC+DEG+ +  + V+  +S +++NP + +I
Sbjct  56    ISHKLKASLSQVLTLYHPFCGTLRGNS-AVECNDEGILYTESRVSVELSNVVKNPHLHEI  114

Query  1400  KQLIPSAKVYEPQPV---GKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWAS  1230
              +L P    Y P      G+ ++AVQ+N+F CGG+A+G   SH IADAS  A F+  WA+
Sbjct  115   NELFP-FDPYNPARETLEGRNMMAVQLNQFKCGGVALGVCFSHKIADASTAASFLSAWAA  173

Query  1229  FNRGCAANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANA  1050
              +R    N       +  ++LFPP      IE  M  G  G    +KD++ KRFV   + 
Sbjct  174   TSRKEDNNKVVPPQMEEGALLFPPRN----IEMDMTRGMVG----DKDIVTKRFVFNDSN  225

Query  1049  IAQLRQDLTITGGSVQRPSRVEALTALVWAAVINATPTQTA-------TLSCMVNLRRRM  891
             I++LRQ +   G     P+RVEA+TAL+W + + A   ++A        +S  VN+R R+
Sbjct  226   ISKLRQKM---GCFNFNPTRVEAVTALIWKSSLEAAKERSAEGRFPASMISHAVNIRHRI  282

Query  890   EPPLPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGW  711
                   + +G L  +A+    E ++    +   +L +R+R   R V      K+ G   +
Sbjct  283   MASSKHHSIGNLWQQAVSQLVEVEEE---MGLCDLAERVRKTTREVDGNYVAKLQGLEFY  339

Query  710   LRAVIARGYELVRNRDSSTLYT-SSLCRMAYYEVDFGWGKPRLVVNM---LDNSWVLFLD  543
                   +   ++ +      Y+ SS  R  +YEVDFGWGKP  V  +   + N  +L   
Sbjct  340   KVIESLKEARIMASEKGVPCYSFSSWVRFGFYEVDFGWGKPTYVRTIGVPIKNVVILMGT  399

Query  542   AINGAVEVWMKLPKQVMHTLTQDRHFLAYVS  450
                  +E W+ L    M    Q+   L + S
Sbjct  400   KDGDGLEAWVTLTTSNMVQFEQNPELLEFAS  430



>gb|KDO36951.1| hypothetical protein CISIN_1g045540mg [Citrus sinensis]
Length=428

 Score =   192 bits (487),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 152/456 (33%), Positives = 221/456 (48%), Gaps = 59/456 (13%)
 Frame = -2

Query  1751  MKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYD-------SPTISGAC  1593
             M VEV SKE  +PS+PTP+  + YK SF DQ+  +   P ++FY+       +  ISG  
Sbjct  1     MDVEVISKETIKPSTPTPKHRQIYKFSFTDQISPSFYIPLIYFYNLNDHKLGNNIISG--  58

Query  1592  HHTKTIDElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPE  1413
                    +LKKSLSK L+  YPLAG + +D V  +C+D+GV F+ A V  N+S ++  P 
Sbjct  59    -------DLKKSLSKVLTHYYPLAGCLNDDYV--DCNDKGVLFLEAKVKCNLSQIIGEPN  109

Query  1412  MEKIKQLIPSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWA  1233
               K+ + +P         V   ++A+QVN F+CG IAIG  VSH IADAS    F++ WA
Sbjct  110   PRKLNKFLPDH-------VKNFILAIQVNFFNCGNIAIGACVSHKIADASTFITFIKNWA  162

Query  1232  SFNRGCAANNGSGFV---SDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVI  1062
             +                    S+ LFPP     +    +          EK+++ K FV 
Sbjct  163   AAASFGGGGGDDSVKICPELLSATLFPPRDVGESCRVSLPA--------EKNIVCKSFVF  214

Query  1061  PANAIAQLRQDLTITGGSVQRPSRVEALTALVWAAVINAT-----PTQTATLSCMVNLRR  897
               + IA L++      G +  P+RVEAL+A +W+    +T     P + + L   VNLR+
Sbjct  215   RGSRIAALKEKY---AGGIH-PTRVEALSAFIWSRFAASTEIKIGPERVSMLVHAVNLRK  270

Query  896   RMEPPLPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARK----V  729
             RM+PP P +  G +      +  E  D G       LV+  RDA   +    A+K    V
Sbjct  271   RMDPPQPDDSFGNISGPTATIISE--DIGEECYG--LVKMFRDAIGKINKDYAKKLQEGV  326

Query  728   YGEGGWLRAVIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVVNM---LDNSW  558
             +   G L ++   G++    R+    Y +SLCR   YE DFGWGKP  V        N  
Sbjct  327   FEHFGLLGSINDDGFD---RREVVNFYYTSLCRFPLYEADFGWGKPIWVAWGGWPYRNIA  383

Query  557   VLFLDAINGAVEVWMKLPKQVMHTLTQDRHFLAYVS  450
             VL        +E W+ L ++ M     D+ FL+YVS
Sbjct  384   VLMDTKCGNGIEAWIHLKEEDMVKFEADKEFLSYVS  419



>ref|XP_006598680.1| PREDICTED: uncharacterized protein LOC100305374 isoform X1 [Glycine 
max]
Length=455

 Score =   192 bits (489),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 140/464 (30%), Positives = 232/464 (50%), Gaps = 36/464 (8%)
 Frame = -2

Query  1757  ITMKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGACHHT--  1584
             + ++VE+ S+E  RPSSPTP  L+ + LS LD L  +   P + +Y SP     C     
Sbjct  1     MKVEVEIISREDIRPSSPTPSHLRVFNLSLLDHLIPSPYAPIILYYTSPNSDKTCFSEVP  60

Query  1583  KTIDElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEMEK  1404
             K ++ LKKSLS+TL+  YPL G++KE   +IEC+DEG  F+ A V   +   L  P++  
Sbjct  61    KRLELLKKSLSETLTQFYPLGGKIKELDFSIECNDEGANFVQAKVKCPLDKFLVQPQLTL  120

Query  1403  IKQLIPSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFN  1224
             + + +P+  V E    G  +  +QVN F CGGIAIG  +SH I D +AL+ F++ W+   
Sbjct  121   LHKFLPTDLVSEGSNSGTYVTNIQVNIFECGGIAIGLCISHRILDGAALSTFIKGWSERA  180

Query  1223  RG--CAANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANA  1050
             +G  C       F+    S LFP   +    +  M+M     +Q +   + KRF+   + 
Sbjct  181   KGFNCDQLTKPNFI---GSALFPTNNNPWLRDLSMRMWGSFFKQGK--WVTKRFLFRNSD  235

Query  1049  IAQLRQDLTITGGSVQRPSRVEALTALVWAAVINATPTQTAT-----LSCMVNLRRRMEP  885
             IA+L+     T  S    +R+E +++++W +++  +  +  T     ++ +VNLRRRM+ 
Sbjct  236   IAKLKAQTLGTATS----TRLEIVSSMLWKSLMGVSKVRFGTQRPSLVTHLVNLRRRMDE  291

Query  884   PL-PPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWL  708
              L P + +G L+   +V  ++  D    +   +LV ++R +   V +    ++ G+ G  
Sbjct  292   ALCPQHAMGNLL--WLVAAEKMCDDHDEMGLEDLVGKLRKSISQVDEKFVEELRGDKG--  347

Query  707   RAVIARGYELVRNRDS-----STLYTSSLCRMAYYEVDFGWGKPRLV--------VNMLD  567
             R+++      +  + S       +  SS C   YYE DFGWGKP  V        V+M  
Sbjct  348   RSIMKESLGAISEKGSKGEVVDYVGFSSWCNFGYYEADFGWGKPTWVSGVGSIGSVSMFM  407

Query  566   NSWVLFLDAINGAVEVWMKLPKQVMHTLTQDRHFLAYVSAFPKP  435
             N  +L    +   +E W+ L ++ M  L  +   L   +  P P
Sbjct  408   NLIILVDTRLGDGIEAWVTLDEEDMTHLEANTELLTCATLDPSP  451



>ref|XP_002515007.1| 3'-N-debenzoyl-2'-deoxytaxol N-benzoyltransferase, putative [Ricinus 
communis]
 gb|EEF47561.1| 3'-N-debenzoyl-2'-deoxytaxol N-benzoyltransferase, putative [Ricinus 
communis]
Length=441

 Score =   192 bits (488),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 141/459 (31%), Positives = 227/459 (49%), Gaps = 53/459 (12%)
 Frame = -2

Query  1748  KVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGACHHTKTIDE  1569
             KV++  +E  +PSSPTP  LK +KLS LDQL      P V FY +       HH  + + 
Sbjct  6     KVKIIQRETIKPSSPTPPELKIHKLSLLDQLIPTNYIPVVLFYPANDGDNLDHHANSTER  65

Query  1568  lkkslsktlsLM---YPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEMEKIK  1398
               K  +     +   YP AGR+K D  ++ECDD+G +FI A +   +S +L++P+   ++
Sbjct  66    SLKLKTSLSETLTHYYPFAGRIK-DSTSVECDDQGADFIQARINCLLSDVLKSPDAVVLR  124

Query  1397  QLIPSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRG  1218
             Q +P+A        G  L+ VQ   F CGG+A+G  +SH I+DA+ L  F++ W +    
Sbjct  125   QFLPAAITSTEAATGN-LLLVQATFFHCGGLAVGVCISHKISDATTLKAFIKCWVATATS  183

Query  1217  CAANNGSGFVSDHSSILFPP--LTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIA  1044
              +  + +      S  +FPP  ++  +++ +LMK          K  I KRFV   + IA
Sbjct  184   SSTESATPLFMGAS--IFPPVDISIPTSVVELMK----------KQCITKRFVFTGSKIA  231

Query  1043  QLRQDLTITGGSVQRPSRVEALTALVWAAVINATPTQT-----ATLSCMVNLRRRMEPPL  879
              L+  +  T  +++ P+RVE ++ L+W   + AT ++      +  S  VN+R R  PPL
Sbjct  232   ALKAKVAST--TMRNPTRVETVSGLLWKTAMAATRSKLGYSRPSVWSMPVNMRTRFLPPL  289

Query  878   PP----NCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGW  711
             P     NCL   ++  I    E K         ELV RIR      ++   +K+ GE   
Sbjct  290   PESYAGNCL-LHINPKIADESELK---------ELVGRIRKEIEGFRENYVKKLRGE---  336

Query  710   LRAVIAR-GY-----ELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLV-VNMLDNSWVL  552
              RAV+A  G+      L  N D      +S C++  Y+ DFGWG+P  V ++ +  S V+
Sbjct  337   -RAVLATFGFFQEYGNLAMNNDIDLYTCTSWCKLELYDADFGWGRPLWVGIDSIPLSNVV  395

Query  551   -FLDAING-AVEVWMKLPKQVMHTLTQDRHFLAYVSAFP  441
               +D  +G  +E W+ L ++ M     ++  L + +  P
Sbjct  396   CLMDTRDGDGIEAWLTLGEENMALFESNQELLQFAAVNP  434



>ref|XP_011021361.1| PREDICTED: BAHD acyltransferase At5g47980-like [Populus euphratica]
Length=445

 Score =   192 bits (488),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 147/451 (33%), Positives = 224/451 (50%), Gaps = 37/451 (8%)
 Frame = -2

Query  1751  MKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGACHHTKTID  1572
             + VE+ ++E+ RPSSPT   L+ + LS LDQL      P V  Y +     A  H     
Sbjct  6     VNVEIVAREVIRPSSPTLNHLRKFNLSLLDQLAPVSYEPLVLLYSNFQQQLAGTHES--Q  63

Query  1571  ElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEMEKIKQL  1392
              LK+SLS+TL+  YPLAGR+K D  +IEC+D G  F+ + V+  +S  LE P+ E I++ 
Sbjct  64    RLKRSLSETLTRFYPLAGRIK-DGASIECNDLGAVFVESRVSCLLSKFLEKPDAEAIRKF  122

Query  1391  IPSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGCA  1212
             IP  +   P+ +  +LV VQ N F+CGG+AIG  +SH  AD    + F++ WA+      
Sbjct  123   IP-VETESPEALTGSLVLVQANFFACGGLAIGVCISHKAADPVTFSTFIKAWAA------  175

Query  1211  ANNGSGFVS-DHSSILFPPLTDTSAI---EQLMKMGAEGIEQEEKDMIVKRFVIPANAIA  1044
                 + F S D S++L  PL + S++   + L       +E      + KR V  A+ IA
Sbjct  176   ----AAFRSVDDSTVL--PLFNASSLFPPQNLPLTRPAAVELMNDKCVTKRLVFDASKIA  229

Query  1043  QLRQDLTITGGSVQRPSRVEALTALVWAAVINATPTQT-----ATLSCMVNLRRRMEPPL  879
              L+        SV  P+RVEA+TAL+W   +NA+ + +     + LS  VNLR RM PPL
Sbjct  230   ALQAK--AVSESVTCPTRVEAVTALIWKCAMNASRSNSEHLRYSILSQSVNLRERMVPPL  287

Query  878   PPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWL--R  705
             P N +G LV        E +     +    LV ++R       +    K+  +  ++  R
Sbjct  288   PENTIGNLVGYFASCATECE-----IELQSLVGQLRKGLLDFGENYVEKLGEDKAFMAVR  342

Query  704   AVIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVV--NMLDNSWVLFLDAING  531
                     +++  +     ++  CR  +Y +DFGWGKP  V      + +    +D  +G
Sbjct  343   ESFQEAGSMLQEGNVDFYASTDFCRFPFYGIDFGWGKPTWVTIPTGANKNVTTIMDTRDG  402

Query  530   -AVEVWMKLPKQVMHTLTQDRHFLAYVSAFP  441
               VE W+ L ++ M    +DR  LA  S  P
Sbjct  403   EGVEAWVTLTEEDMAFFERDRELLAAASLDP  433



>ref|XP_009790148.1| PREDICTED: vinorine synthase-like [Nicotiana sylvestris]
Length=438

 Score =   192 bits (487),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 147/457 (32%), Positives = 228/457 (50%), Gaps = 44/457 (10%)
 Frame = -2

Query  1751  MKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGACHHTKTID  1572
             M+  + SK+  +PS PTP  LKN+KL FLDQ+   +    + FY++ T +   ++ K   
Sbjct  1     METIILSKQKVKPSKPTPPHLKNHKLCFLDQVQPPVRIKTILFYENTTPAQNQNNLKN--  58

Query  1571  ElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEMEKIKQL  1392
                 +LS+TL+L YPLAG +KE    ++C+D GV ++ A     +S  LENP++ ++K+L
Sbjct  59    ----ALSETLTLFYPLAGELKEGSTFVDCNDTGVVYVEAQAKTCLSYFLENPDLSQLKKL  114

Query  1391  IPSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGCA  1212
             +   + +         V+ QV RF CGG+AIG  + H ++DA+ ++ F+  WA+  R   
Sbjct  115   MIDVECH--------FVSFQVTRFECGGMAIGASMFHLVSDANTMSAFLNTWANIARERI  166

Query  1211  ANNGS-GFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQLR  1035
                 S  F S  SS+LFPP       ++L         +E    + +RFV  + AIA ++
Sbjct  167   MPLASLDFTS--SSLLFPP--QNHLPQELSAFLKTLFFKEGDQFLQRRFVFDSKAIAAIK  222

Query  1034  QDLTITGGS---VQRPSRVEALTALVWAAVINATPT--QTATLSCM----VNLRRRMEPP  882
                 + GGS   V +P+RVEALTAL+W  ++ A+     +++ SCM    VNLR R+ PP
Sbjct  223   ----LKGGSSSTVPKPTRVEALTALIWKHMMLASKAVKGSSSPSCMLNHAVNLRPRLHPP  278

Query  881   LPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLRA  702
             L PN  G +V  A     E++     +    LV  +R+ F    +GE  K          
Sbjct  279   L-PNASGNVVWFATTF-YESEITSDNIDLSHLVGLVREVFETFSNGENLKELEGDASFTY  336

Query  701   VIARGYELVRNRDSSTLYT-SSLCRMAYYEVDFGWGKPRLVVNMLDNSWVLFLDAI----  537
             ++    + + +      Y  +S CR    EVDFGWGKP  V  +LD +  L    I    
Sbjct  337   LVNLATDTINSFGKVDNYMFTSWCRFGLDEVDFGWGKPIWVAPLLDPTCSLGHVQIVILV  396

Query  536   -----NGAVEVWMKLPKQVMHTLTQDRHFLAYVSAFP  441
                  +  +E W+   K+ +  L  D  FL Y S  P
Sbjct  397   ESGRSSDGIEAWILRNKEEILELENDEEFLQYASPNP  433



>sp|Q94FT4.1|SALAT_PAPSO RecName: Full=Salutaridinol 7-O-acetyltransferase; Short=salAT 
[Papaver somniferum]
 gb|AAK73661.1|AF339913_1 salutaridinol 7-O-acetyltransferase [Papaver somniferum]
Length=474

 Score =   192 bits (489),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 150/449 (33%), Positives = 223/449 (50%), Gaps = 44/449 (10%)
 Frame = -2

Query  1745  VEVRSKEIGRPSSPTPQTLKNYKLSFLDQ-LHLNLMTPFVFFY--DSPTISGACHHTKTI  1575
             VEV SKE  +P++PTP  LKN+ LS LDQ   L    P + FY   +   +G+ +H   +
Sbjct  9     VEVISKETIKPTTPTPSQLKNFNLSLLDQCFPLYYYVPIILFYPATAANSTGSSNHHDDL  68

Query  1574  DElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEMEKIKQ  1395
             D LK SLSKTL   YP+AGR+  D + ++C D+G+ F    +   M   +  P++  + Q
Sbjct  69    DLLKSSLSKTLVHFYPMAGRMI-DNILVDCHDQGINFYKVKIRGKMCEFMSQPDVP-LSQ  126

Query  1394  LIPSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGC  1215
             L+PS  V    P  +ALV VQVN F CGG AI   VSH IADA+ ++ F+  WAS  +  
Sbjct  127   LLPSEVVSASVP-KEALVIVQVNMFDCGGTAICSSVSHKIADAATMSTFIRSWASTTKTS  185

Query  1214  AANNGSGFVSDH-------SSILFPP---LTDTSAIEQLMKMGAEGIEQEEKDMIVKRFV  1065
              +   +  V+D        S+ LFPP   LT  S + ++    +   + E+   + KRFV
Sbjct  186   RSGGSTAAVTDQKLIPSFDSASLFPPSERLTSPSGMSEI-PFSSTPEDTEDDKTVSKRFV  244

Query  1064  IPANAIAQLRQDLTI---TGGSVQRPSRVEALTALVWAAVINATPTQ-TATLSCMVNLRR  897
                  I  +R+ L +        +R +RVE +T+L+W +V+ +TP      +   VNLR+
Sbjct  245   FDFAKITSVREKLQVLMHDNYKSRRQTRVEVVTSLIWKSVMKSTPAGFLPVVHHAVNLRK  304

Query  896   RMEPPLPPNCLGTL-------VDEAIVLCQEAKDGGTVVTAVE---LVQRIRDAFRAVKD  747
             +M+PPL     G L       +         A +     T+ E   ++  + D F A   
Sbjct  305   KMDPPLQDVSFGNLSVTVSAFLPATTTTTTNAVNKTINSTSSESQVVLHELHD-FIAQMR  363

Query  746   GEARKVYGEGGWLRAVI---ARGYEL----VRNRDSSTLYTSSLCRMAYYEVDFGWGKPR  588
              E  KV G+ G L  VI   A G++     + + +    + SS CRM  YE+DFGWGKP 
Sbjct  364   SEIDKVKGDKGSLEKVIQNFASGHDASIKKINDVEVINFWISSWCRMGLYEIDFGWGKPI  423

Query  587   LVV---NMLDNSWVLFLDAIN--GAVEVW  516
              V    N+  N    F++       +EVW
Sbjct  424   WVTVDPNIKPNKNCFFMNDTKCGEGIEVW  452



>ref|XP_006493396.1| PREDICTED: vinorine synthase-like [Citrus sinensis]
Length=425

 Score =   191 bits (486),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 144/452 (32%), Positives = 223/452 (49%), Gaps = 44/452 (10%)
 Frame = -2

Query  1757  ITMKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGACHHTKT  1578
             + + VE  S+E+ +PS+PTP  L++Y+ S LDQ+   +    ++FY         ++   
Sbjct  1     MKIDVETISEEMIKPSTPTPSQLRHYQFSHLDQIGPPVYISLLYFYHLDDHKLVSNNHLF  60

Query  1577  IDElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEME-KI  1401
              + LK SLS  L+  YPLAGR+K + V  +C+DEGV F  A V+ ++S ++  PE   + 
Sbjct  61    SNSLKSSLSNVLTKYYPLAGRIKNNYV--DCNDEGVVFSEAKVSCHLSEIVNEPEFSSEF  118

Query  1400  KQLIPSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNR  1221
             K+L+P  +  +   V    +A+QVN F+CG +AI   +SH IAD S+L  F + WA+  R
Sbjct  119   KKLLPFDQEKDVVSVDGLAIAIQVNIFNCGNVAIAVMISHRIADGSSLITFTKNWAAVAR  178

Query  1220  GCAANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQ  1041
             G   N    FV   ++ LF P     +            +   K +++K+F+   + I  
Sbjct  179   GEGENILPEFV---AAKLFAPKDAGGS-------SGTSFDPRPKKVVLKKFLFEGSKITT  228

Query  1040  LRQDLTITGGSVQRPSRVEALTALVWAAV-----INATPTQTATLSCMVNLRRRMEPPLP  876
             LR    +   ++  P+RVEAL+A +W+ +     I  +P +   L   VNLR+RMEP LP
Sbjct  229   LRDKYGLD--NLIYPTRVEALSAFLWSRLAASTRIKVSPERPCMLVHAVNLRKRMEPQLP  286

Query  875   PNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAV-KDGEARKVYGEGGWLRAV  699
              +  G L   A+ + +E  D         +V + RDA   + KD    K       +   
Sbjct  287   ADSFGNLFAFAVTILEENHDN-------RMVNKFRDAIGKIDKDYLKAKNVEHSELIDLA  339

Query  698   IARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVVNMLDNSW--------VLFLD  543
             I  G E     +      SSLC+   YE DFG GKP  V      +W        + F+D
Sbjct  340   ITNG-ERFDKVELGYCIISSLCKFPVYEADFGLGKPIWV------AWGCFPYKNVIHFMD  392

Query  542   AING-AVEVWMKLPKQVMHTLTQDRHFLAYVS  450
               +G  +EVW+ L ++VM     D+  LAYVS
Sbjct  393   TKSGDGIEVWVHLEEEVMAIFENDQELLAYVS  424



>ref|XP_010051001.1| PREDICTED: vinorine synthase-like [Eucalyptus grandis]
 gb|KCW81034.1| hypothetical protein EUGRSUZ_C02410 [Eucalyptus grandis]
Length=440

 Score =   192 bits (487),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 144/463 (31%), Positives = 220/463 (48%), Gaps = 47/463 (10%)
 Frame = -2

Query  1757  ITMKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGACHHTKT  1578
             +  K+EV S E  +PSSPTP  L+N+    LDQL  +   P V FY +P    A      
Sbjct  1     MATKIEVVSTETIKPSSPTPPHLRNFNFCLLDQLAPSFYVPVVLFYLAPDQKAAPDSALV  60

Query  1577  IDElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEMEKIK  1398
                LK SL++ LSL YPL GRVK +   I+C+DEG  ++ A     +S +L NP++++++
Sbjct  61    SGYLKTSLAQALSLFYPLGGRVKGN-AGIDCNDEGALYMEAKARFELSKVLSNPDIDQLQ  119

Query  1397  QLIPSAKVYEPQPVG-----KALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWA  1233
             Q +P    + P  V      + +V VQ N F CGG+ IG  +SH IAD ++++ F+  W+
Sbjct  120   QFLP----FSPSRVSTNINEQVIVGVQANFFDCGGMGIGICISHKIADGASVSAFLNAWS  175

Query  1232  SFNRGCAANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAE---GIEQEEKDMIVKRFVI  1062
                    ANNG     D  + L  P    S + Q   +  +   G+   EK +  KRF  
Sbjct  176   EI-----ANNG----VDGEASLITPFLKASELFQPKDINYQIPSGVISREK-LSTKRFCF  225

Query  1061  PANAIAQLRQDLTITGGSVQRPSRVEALTALVWAAVINAT----------PTQTATLSCM  912
                ++A+LR      GG+   P+RVEA+TAL+W + + A           P  +A +   
Sbjct  226   NGESLARLRAGF---GGA--NPTRVEAVTALIWKSALAAARKRPEWKEKYPPSSAVIHA-  279

Query  911   VNLRRRMEP-PLPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEAR  735
             VN+R R+ P PLP   LG LV   +    E   G  +    +    +R++ RA+      
Sbjct  280   VNIRSRIRPQPLPETTLGNLVQAVVAPLMEPNKGDEL---QDFAGTLRNSIRAIDSEYLS  336

Query  734   KVYGEGGWLRAV--IARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVVNM--LD  567
              + GE G  +A   +    +L  +        SS  R  +YE DFGWG+P  V  +  + 
Sbjct  337   ALQGENGLAKACENLMATRKLAASSAIELYRFSSWARFPFYEADFGWGRPAWVCTIAPIK  396

Query  566   NSWVLFLDAINGAVEVWMKLPKQVMHTLTQDRHFLAYVSAFPK  438
             N  +L        +E W+ L +  M     +   L +VS  P+
Sbjct  397   NLVILMGTRCGDGIEAWITLAEHDMIEFEHNDELLQFVSPNPR  439



>ref|XP_004504492.1| PREDICTED: vinorine synthase-like [Cicer arietinum]
Length=438

 Score =   191 bits (486),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 133/398 (33%), Positives = 208/398 (52%), Gaps = 32/398 (8%)
 Frame = -2

Query  1751  MKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGACHHTKTID  1572
             M++E+ S+EI +PSSPTP  LKN+ LSF+D +      P +FFYD    +  C  T  I 
Sbjct  1     MEMEIISREIIKPSSPTPPHLKNFPLSFIDHITFRNYVPLLFFYDD---TKVCDQTSKIS  57

Query  1571  ElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEMEKIKQL  1392
              LK SLS+ LS+ YP AGR K D+V+IEC+D+GV F+VA++   +S +L+NP    +  L
Sbjct  58    HLKNSLSQILSIYYPFAGRFK-DQVSIECNDQGVSFLVANIGTKLSTILQNPNQNLLNPL  116

Query  1391  IPSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGCA  1212
              P    ++     ++++A+Q+N F+CG I I     H I DAS    F+  WA  NR   
Sbjct  117   FPDELQWKTANWSESILAIQINCFACGRIVISVCACHKIIDASTAFNFVNDWAEINREKQ  176

Query  1211  ANNGSGFVSDHSSI-----LFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAI  1047
              +     +  ++++     +FP  T     E       E ++ E   ++ KRFV  A+ I
Sbjct  177   KSKSILSILPYNALYAGGTIFPRATFPIFPE------VEFVKHEA--IVCKRFVFEASKI  228

Query  1046  AQLRQDLTITGGS-VQRPSRVEALTALVWAAVINATPT--QTATLSCMVNLRRRMEPPLP  876
               L+  +  +  + V+ P+RVE +TAL++   ++A     +T +L   V+LRRRM PPL 
Sbjct  229   KLLKGMMVNSHSNPVKNPTRVEVVTALIYKCAVSALGLNFKTTSLRMAVDLRRRMVPPLL  288

Query  875   PNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLRAVI  696
                +G LV    V+  E  D         +V +IR+      +   +K  G+   L  ++
Sbjct  289   DKSVGNLVWFLFVINPELHD---------VVCKIREGLCEFCEIYPKKFGGKEKDLSFIL  339

Query  695   ARGYELVRNRDS---STLYTSSLCRMAYYEVDFGWGKP  591
                 ++  N ++   S +  +S CR   YE DFGWGKP
Sbjct  340   ECLKQVTTNSNAENQSLIIYASWCRFPMYEADFGWGKP  377



>ref|XP_011101100.1| PREDICTED: vinorine synthase-like [Sesamum indicum]
Length=462

 Score =   192 bits (488),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 152/474 (32%), Positives = 227/474 (48%), Gaps = 67/474 (14%)
 Frame = -2

Query  1742  EVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFY----DSPTISGACHHTKTI  1575
             E+ S+E  +PSSPTP   + YKLS LDQ+   +  P V +Y    ++P        T  I
Sbjct  6     EIISREHIKPSSPTPLEQRTYKLSLLDQIVPPIYVPLVLYYPNLENTPKDPDFISQTTQI  65

Query  1574  DElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEMEKIKQ  1395
               L++SLS TL+  YPLAGR+K DK++I+C+DEGV F+V      +S  L+NP+ +  + 
Sbjct  66    --LRQSLSATLTRFYPLAGRIK-DKLSIDCNDEGVPFVVTKFNTRLSDFLKNPDSQVCRG  122

Query  1394  LIPSAKVY-EPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRG  1218
              IPS   + EP P G  +  +QVN F CGGIA+G    H +AD   +  FM+ WA+  RG
Sbjct  123   HIPSPLTWAEPGP-GSNVALIQVNFFDCGGIAVGSLFLHKVADGVTIGTFMKAWAAAARG  181

Query  1217  CAANNGSGFVSDHSSILFPPLTDT--------SAIEQLMKMGAEGIEQEEKDMIVKRFVI  1062
                        D+++  F P  +T        SA+ Q  K G           +++R+V 
Sbjct  182   SVET----VSPDYAAQSFFPQNETMKRESHLFSAMRQYFKFGK---------TVMRRYVF  228

Query  1061  PANAIAQLRQDLTITGGSVQRPSRVEALTALVWAAVI-------NATPTQTATLSCMVNL  903
              A AI+ LR  L+ T G  QRPS+VE ++AL+W   I       N  PT T+ ++  VN+
Sbjct  229   DALAISALRAKLSSTEGLKQRPSKVEVVSALLWKCFIIASNKSSNNHPT-TSLVTHGVNM  287

Query  902   RRRMEPPLPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYG  723
             RR+ EPP P +  G  V    ++   + +  T      L  ++R+    V     +++ G
Sbjct  288   RRKAEPPFPEHSFGNFV---WLVPASSTNDHTDADLENLFSKVRNTISTVDVEFVKRMQG  344

Query  722   EGGWLRAVIARGYELVRNRDSS---------TLYTSSLCRMAYYEVDFGWGKPRLVVNML  570
             E G+L      GY   +N + S          L  SS C    Y +DFG G+P  +    
Sbjct  345   ESGFL------GY--CKNLEESWKGFPENADYLAISSWCNFGLYSIDFGLGRPIWISKCD  396

Query  569   DNS---W----VLFL--DAINGAVEVWMKLPKQVMHTLTQDRHFLAYVSAFPKP  435
               S   W    VL+L      G +E W+ L +  +    + +      S  P P
Sbjct  397   AGSEVDWPFINVLWLMDTRQGGGIEAWLTLDEHYIEAFDKIQELRDLASVDPSP  450



>ref|XP_009342768.1| PREDICTED: vinorine synthase-like [Pyrus x bretschneideri]
Length=444

 Score =   191 bits (486),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 148/454 (33%), Positives = 222/454 (49%), Gaps = 42/454 (9%)
 Frame = -2

Query  1751  MKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFY----DSPTI-SGACHH  1587
             ++VEV S E  +PSSPTP  L+ +KLSFLDQ+   +  P V F+     +P + +  C  
Sbjct  4     LEVEVVSTETIKPSSPTPDHLRRHKLSFLDQIQPPIFMPMVLFFPKDPHTPEVPTERCTK  63

Query  1586  TKTIDElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEME  1407
              KT      +LS+TL+  YPLAGRV+  +  ++C+DEG  ++ A    N+  +++NP   
Sbjct  64    IKT------ALSETLTNFYPLAGRVRGTQY-VDCNDEGAYYVEAKANSNIIDIIQNPNPI  116

Query  1406  KIKQLIPSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASF  1227
                + IP A         +  + +QV  F+CGG++IG  +SH + DA +   F+   A+ 
Sbjct  117   DFNKFIPCAL----DAASELPICLQVTFFACGGMSIGMGMSHKVGDALSYFMFLNSLAAT  172

Query  1226  NRGCAAN-NGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANA  1050
              RG     +   FVSD     + P  D S   Q     + GI +   ++  KRFV  A A
Sbjct  173   TRGEPDYVHAPEFVSDK----YFPQQDLSGSYQ----HSSGIIKH--NISTKRFVFDAPA  222

Query  1049  IAQLR-QDLTITGGSVQRPSRVEALTALVWAAVINATPTQT------ATLSCMVNLRRRM  891
             ++ LR Q   +     +RP+RVEAL+A +W   I A   +        T+S  VNLR RM
Sbjct  223   VSALRAQSTDVENEQARRPTRVEALSAFIWRRYIAACTRRADDVPAMYTVSHAVNLRTRM  282

Query  890   EPPLPPNCLGTLVDEAIVLCQ---EAKDGGTVVTAV-ELVQRIRDAFRAVKDGEARKVYG  723
             +PPLP    G +    I +     E K+G +   ++  +V  +R+A + V D E  K   
Sbjct  283   DPPLPEYTFGNVTRTTISVPPIQVEPKEGSSSDPSLYSVVSHVREALKQV-DREYIKKLQ  341

Query  722   EGGWLRAVIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLV--VNMLDNSWVLF  549
             EG    + +      V+  D  +   +SLCR   Y+ DFGWGKP      +    + V F
Sbjct  342   EGEAFLSFLKERSSQVKRGDVVSFSFTSLCRFPIYDADFGWGKPVYAGSASFTFKNLVSF  401

Query  548   LDAING-AVEVWMKLPKQVMHTLTQDRHFLAYVS  450
              D  +   VE W+ L K+ M     D   L YVS
Sbjct  402   FDTTSADGVEAWINLKKEDMEKFEADEEVLKYVS  435



>gb|KDO82048.1| hypothetical protein CISIN_1g012688mg [Citrus sinensis]
Length=458

 Score =   192 bits (487),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 154/466 (33%), Positives = 230/466 (49%), Gaps = 46/466 (10%)
 Frame = -2

Query  1751  MKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGACHH-----  1587
             MKVE+ SKE  +PSSPTP  LK+YKLS LDQ+        + FY         HH     
Sbjct  9     MKVEIISKETIKPSSPTPNHLKDYKLSLLDQIAPPSYETLLLFYSFNGDDDRQHHHHISV  68

Query  1586  ---TKTIDElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENP  1416
                 K   +LK+SLS+TL+  YPLAGRVK D +TI+C D G  ++ A V   +  LL+ P
Sbjct  69    YKANKLSLQLKQSLSETLTRFYPLAGRVK-DNITIDCSDHGAVYVEAQVNCLLQDLLKQP  127

Query  1415  EMEKIKQLIPSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIW  1236
               + + QL+P     E +P    L+ VQ + F+CGG+AIG  +SH IADA+ +  F+  W
Sbjct  128   NGDSVIQLVPIQLAEESKP--GLLLFVQSSFFTCGGVAIGVCISHKIADAATVVTFIRSW  185

Query  1235  ASFNRGCAANNGSG--FVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVI  1062
             A    G AA +     + S ++S LFPP  D +A   L       +  +EK    KRFV 
Sbjct  186   A----GAAAGDHRRVYYPSYNASSLFPP-RDVTATAMLFLNPPFNMAMKEK-CFTKRFVF  239

Query  1061  PANAIAQLRQDLTITGGSVQRPSRVEALTALVWAAVINATPTQT-----ATLSCMVNLRR  897
                 IA L   L+         +R EA+TAL+W   +NA+ + +     + LS  V++R+
Sbjct  240   YGPKIAALEAALSAPS------TRGEAVTALIWKCAVNASRSNSGVSKLSILSRSVDIRK  293

Query  896   RMEPPLPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEG  717
                PPLP N +G LV        E+      +    LV+ +R+  +       +K+  E 
Sbjct  294   ITVPPLPDNSVGNLVGYYASQKDESD-----IQLQGLVRELREGIQDFSKSYLQKLQRED  348

Query  716   GWLRAVIARGYELVR---NRDSSTLYTSSLCRMAYYEVDFGWGKPRLVVNMLDNS-----  561
               L A+     + +    + D      +SLC ++ Y++DFGWG P  V N+  N+     
Sbjct  349   A-LEAITESCKDAIAILISNDVDLYVCNSLCDVSLYDIDFGWGNPTWVTNISSNAPNHKN  407

Query  560   WVLFLDAI--NGAVEVWMKLPKQVMHTLTQDRHFLAYVSAFPKPKL  429
              V  +D+   +G++E W+ L +  M    +D   L Y + F  P +
Sbjct  408   LVGLIDSSTGDGSIEAWVTLSEADMALFERDPDLLCYAATFDYPSV  453



>ref|XP_010460459.1| PREDICTED: vinorine synthase-like [Camelina sativa]
Length=433

 Score =   191 bits (486),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 144/447 (32%), Positives = 228/447 (51%), Gaps = 35/447 (8%)
 Frame = -2

Query  1748  KVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGACHHTKTIDE  1569
             K+ V S+E+ +PSS     L  + LSFLDQL   +  PF+FFY + T       +   D+
Sbjct  4     KITVTSQELVKPSSLNLNHLPCHHLSFLDQLAPPIFMPFLFFYHNKTNLSTNERS---DQ  60

Query  1568  lkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEMEKIKQLI  1389
             +K SLS+ L+L YPLAGR++     + C+D GV F+ A    NMS +LENP   ++ +L 
Sbjct  61    IKSSLSEILNLFYPLAGRIRNSGDVVLCNDMGVSFVEAKADFNMSQILENPNSNELNKLH  120

Query  1388  PSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGCAA  1209
             P    +E   V   L+ VQ+  F CGG+A+G  +SH + DA +   F++ WA   RG   
Sbjct  121   P----FEFHEVSDVLLTVQLTFFQCGGLALGIGLSHKLCDALSGLIFIKSWADLARG---  173

Query  1208  NNGSGFVSDHSSI--LFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQLR  1035
                +G V+    +  +FPP      IE L    A GI +E  +++ KRFV   +++  LR
Sbjct  174   --DTGIVTPSFDLAKMFPPCD----IENLNM--ATGITKE--NIVTKRFVFLKSSVESLR  223

Query  1034  QDLTITGGSVQRPSRVEALTALVWAAVINAT--PTQTATLSCM---VNLRRRMEPPLPPN  870
             +    +G    + +RVEAL+  +W+  + +T    +T  +  M   VNLRR+ +P +P N
Sbjct  224   E--RFSGNKEIQATRVEALSVFIWSRFMASTNQDDKTGKIYTMIHPVNLRRQADPVIPDN  281

Query  869   CLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEG-GWLRAVIA  693
               G ++  ++ + +   +         LV+++R+  R +     +K+  +  G L  +  
Sbjct  282   MFGNIMRFSVTIPKMTINEDDEAQP-SLVEQMREEIRKIDAVYVKKLQEDSRGHLEFLNK  340

Query  692   RGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVVN--MLDNSWVLFLDAING-AVE  522
             +    V     S  +T SLC+   YE DFGWGKP  V +  M   + V F+D   G ++E
Sbjct  341   QASGFVNGEIVSFSFT-SLCKFPVYEADFGWGKPLWVASARMSYKNLVAFIDTKEGDSIE  399

Query  521   VWMKLPKQVMHTLTQDRHFLAYVSAFP  441
              W+ L +  M     D   L YVS+ P
Sbjct  400   AWINLDQNDMSRFEADEELLQYVSSNP  426



>ref|XP_006484024.1| PREDICTED: BAHD acyltransferase At5g47980-like [Citrus sinensis]
Length=450

 Score =   191 bits (486),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 154/466 (33%), Positives = 229/466 (49%), Gaps = 46/466 (10%)
 Frame = -2

Query  1751  MKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGACHH-----  1587
             MKVE+ SKE  +PSSPTP  LK+YKLS LDQ+        + FY         HH     
Sbjct  1     MKVEIISKETIKPSSPTPNHLKDYKLSLLDQIAPPSYETLLLFYSFNGDDDRQHHHHISV  60

Query  1586  ---TKTIDElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENP  1416
                 K   +LK+SLS+TL+  YPLAGRVK D +TI+C D G  ++ A V   +  LL+ P
Sbjct  61    YKANKLSLQLKQSLSETLTRFYPLAGRVK-DNITIDCSDHGAVYVEAQVNCLLQDLLKQP  119

Query  1415  EMEKIKQLIPSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIW  1236
               + + QL+P     E +P    L+ VQ + F+CGG+AIG  +SH IADA+ +  F+  W
Sbjct  120   NGDSVIQLVPIQLAEESKP--GLLLFVQSSFFTCGGVAIGVCISHKIADAATVVTFIRSW  177

Query  1235  ASFNRGCAANNGSG--FVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVI  1062
             A    G AA +     + S ++S LFPP  D +A   L       +  +EK    KRFV 
Sbjct  178   A----GAAAGDHRRVYYPSYNASSLFPP-RDVTATAMLFLNPPFNMAMKEK-CFTKRFVF  231

Query  1061  PANAIAQLRQDLTITGGSVQRPSRVEALTALVWAAVINATPTQT-----ATLSCMVNLRR  897
                 IA L   L+         +R EA+TAL+W   +NA+ + +     + LS  V++R+
Sbjct  232   YGPKIAALEAALSAPS------TRGEAVTALIWKCAVNASRSNSGVSKLSILSRSVDIRK  285

Query  896   RMEPPLPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEG  717
                PPLP N +G LV        E+      +    LV+ +R   +       +K+  E 
Sbjct  286   ITVPPLPDNSVGNLVGYYASQKDESD-----IQLQGLVRELRKGIQDFSKSYLQKLQRED  340

Query  716   GWLRAVIARGYELVR---NRDSSTLYTSSLCRMAYYEVDFGWGKPRLVVNMLDNS-----  561
               L A+     + +    + D      +SLC ++ Y++DFGWG P  V N+  N+     
Sbjct  341   A-LEAITESCKDAIAILISNDVDLYVCNSLCDVSLYDIDFGWGNPTWVTNISSNAANHKN  399

Query  560   WVLFLDAI--NGAVEVWMKLPKQVMHTLTQDRHFLAYVSAFPKPKL  429
              V  +D+   +G++E W+ L +  M    +D   L Y + F  P +
Sbjct  400   LVGLIDSSTGDGSIEAWVTLSEADMALFERDPDLLCYAATFDYPSV  445



>ref|XP_002311734.1| hypothetical protein POPTR_0008s18070g [Populus trichocarpa]
 gb|EEE89101.1| hypothetical protein POPTR_0008s18070g [Populus trichocarpa]
Length=439

 Score =   191 bits (486),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 148/451 (33%), Positives = 230/451 (51%), Gaps = 38/451 (8%)
 Frame = -2

Query  1751  MKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGACHHTKTID  1572
             M VE+ ++E  +PSSPTP  L+ + L  LDQL      P V FY +        H    +
Sbjct  1     MAVEIITREAVKPSSPTPDHLREFNLRLLDQLAPVAYEPLVLFYSNFQQKFTVAHKS--E  58

Query  1571  ElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEMEKIKQL  1392
              LK+SLS+TLS  YPLAGR+K+D  +IEC+D G  F+ A V+  +S LLE P+ E I++ 
Sbjct  59    RLKRSLSETLSRFYPLAGRIKDD-ASIECNDFGAVFVQARVSCLLSKLLEKPDAEVIRKF  117

Query  1391  IPSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGCA  1212
             IP  ++  P+ +  +LV VQ N F+CGG+AIG  +SH +AD    + F++ WA+      
Sbjct  118   IP-IEIESPEELTGSLVLVQANFFACGGLAIGVCISHKVADPVTFSTFIKAWAA------  170

Query  1211  ANNGSGFVSDHSSILFPPLTDTSAI---EQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQ  1041
                 + F S  S++L  PL + S++   + +       +E      + KR V+ A+ +A 
Sbjct  171   ----AAFRSGDSTVL--PLFNASSVFPPQNIPLARPAALEFIRDRCVTKRVVLDASKVAA  224

Query  1040  LRQDLTITGGSVQRPSRVEALTALVWAAVINATPTQT-----ATLSCMVNLRRRMEPPLP  876
             L+  +     SV  P+RVEA+TAL+W   +NA  + +     + LS  VNLR++M  PLP
Sbjct  225   LQ--VKAVSESVTCPTRVEAVTALIWKCAMNAARSNSEHLRYSILSQSVNLRKKMVRPLP  282

Query  875   PNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLRAVI  696
              + +G L         E +     V    LV+++R   +   +   +K+ G+     A+ 
Sbjct  283   EHTIGNLAGYFASCATECE-----VELQSLVRQLRKGLQDFGENYLKKL-GKDKASMAIC  336

Query  695   ARGYELVRNRDSSTL---YTSSLCRMAYYEVDFGWGKPRLVV--NMLDNSWVLFLDAING  531
                 E        T+    ++S CR+ +Y +DFGWGKP  V        +    +DA +G
Sbjct  337   ESFQEAASMLPEGTVDFYVSTSFCRLPFYGIDFGWGKPTWVTIPTGAYKNVASIMDAKDG  396

Query  530   -AVEVWMKLPKQVMHTLTQDRHFLAYVSAFP  441
               +E W+ L +  M    +DR  LA  S  P
Sbjct  397   KGIEAWVTLTEDDMAFFERDRELLAAASFDP  427



>ref|XP_006345618.1| PREDICTED: vinorine synthase-like [Solanum tuberosum]
Length=425

 Score =   191 bits (485),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 148/449 (33%), Positives = 243/449 (54%), Gaps = 43/449 (10%)
 Frame = -2

Query  1757  ITMKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGACHHTKT  1578
             + +KVE+ SKE  +P SP+ ++ K++KLS LDQ   N  T FV FY+  + S        
Sbjct  1     MDIKVEIISKETIKPFSPSSKSHKSHKLSLLDQKAPNCYTTFVLFYNKNSSSDL---ENV  57

Query  1577  IDElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEMEKIK  1398
             ID LK SLSKTLS + PLAGRVK D +T+EC+D+GV+   A+V E+MS +L N +++ ++
Sbjct  58    IDSLKVSLSKTLSYLNPLAGRVK-DGITVECNDQGVDLTRANVHEDMSNVLMNLKIQVLR  116

Query  1397  QLIPSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRG  1218
             +L+P   +         L+A+Q+N F+CGGIAIG  +SH I D S++A F++ WAS ++ 
Sbjct  117   KLLPMNPLTRSD--DNVLLALQINCFACGGIAIGVCISHLITDGSSIATFLKTWASISQS  174

Query  1217  CAANNG----SGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANA  1050
              A N+          D +SI FPP      +         G +Q +  M  +RFV   + 
Sbjct  175   RAENDNITISDKLFMDCTSI-FPP----KKVHSFSVFQFGGKDQLQPKMAARRFVFDESN  229

Query  1049  IAQLRQDLTITGGSVQRPSRVEALTALVWAAVI-------NATPTQTATLSCMVNLRRRM  891
             I      L +   + +  S+VEA+ A VW +VI       N    +   +   ++LRRR+
Sbjct  230   I------LALNTKAERSTSQVEAVLAFVWESVIAAMQKRSNNNGIKNYVIRIPIDLRRRI  283

Query  890   EPPLPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGW  711
             +PPLP   +G ++   +    E  +G   +    LV++I+D+         + V   G  
Sbjct  284   QPPLPQQTMGNII-HMVEANWEVSEGP--LDYKLLVKKIQDSI--------KNVTKHGYD  332

Query  710   LRAVIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLV-VNMLDNSWVLFLDAIN  534
             ++ +  R   L  N++   L ++S C+  +Y++DFGWG+P+   V  +  + V+ +D  +
Sbjct  333   VKNMDDRVRTL--NKEERILGSTSFCKFPFYDIDFGWGRPKWASVGSIAPNLVVLMDTSD  390

Query  533   G-AVEVWMKLPKQVMHTLTQDRHFLAYVS  450
             G  +EVW+ L ++ M  L +++ F  +VS
Sbjct  391   GKGIEVWLGLVEEDMAILEKNQEFFKFVS  419



>gb|EYU22560.1| hypothetical protein MIMGU_mgv1a020007mg [Erythranthe guttata]
Length=430

 Score =   191 bits (484),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 148/430 (34%), Positives = 215/430 (50%), Gaps = 27/430 (6%)
 Frame = -2

Query  1715  PSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGACHHTKTIDElkkslsktlsL  1536
             PSSPTP++L+ Y LSFLDQ+      P V+FY   T      +++  D LKKSLS+ LS 
Sbjct  13    PSSPTPKSLEKYHLSFLDQIAPPTFMPLVYFYSPHT---KYTNSQKSDHLKKSLSEALST  69

Query  1535  MYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEMEKIKQLIPSAKVYEPQPV  1356
              +PLAGR+      ++C D+G  F  A V  ++S  + NP    + + +P    YE   +
Sbjct  70    FHPLAGRLVAGDAYVDCRDQGAPFFEAQVNCDLSQAITNPIPRNMNKFLP----YELNDL  125

Query  1355  GKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGCAANNGSGFVSDHS  1176
                 VAVQ   F CGG+A+G  VSH IADA +   F   WA+  R  +A          +
Sbjct  126   QNLGVAVQATYFRCGGVAVGVLVSHKIADALSFFLFANAWAAAARNESAAAAPPVF--EA  183

Query  1175  SILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQLRQDLTITGGSVQ-R  999
             +++FPP  D +      K G   +++ E D   K F  PA+ I+ LR+  +    + + R
Sbjct  184   ALIFPP-RDVAG----YKPGTGIVKEGELD--TKIFTFPASKISDLRERYSAAAAAGERR  236

Query  998   PSRVEALTALVWAAVINAT-----PTQTATLSCMVNLRRRMEPPLPPNCLGTLVDEAIVL  834
             P+RVEAL+A +W   I+AT     P +  T+   VNLR R+EPPL  N  G +   AI +
Sbjct  237   PTRVEALSAFIWTRFISATEMKPEPNKIYTVLHAVNLRNRLEPPLSDNHFGNISRLAIAV  296

Query  833   CQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLRAVIARGYELVRNRDSST  654
                  DGG++    EL+Q++R+A  AV +GE      EG      +          +  T
Sbjct  297   -PAVDDGGSIDGGYELMQKVREAIGAV-NGEYVARLREGDKHLNFLKERMAQANKSELVT  354

Query  653   LYTSSLCRMAYYEVDFGWGKPRLVVN--MLDNSWVLFLDAING-AVEVWMKLPKQVMHTL  483
                +SLCR   YE DFGWGKP  V +  M   + V  +D   G  +E W+ L K+ M   
Sbjct  355   FNFTSLCRFPLYEADFGWGKPVRVGSAVMSYKNLVTLMDTATGNGIEAWINLKKEDMVKF  414

Query  482   TQDRHFLAYV  453
               D     ++
Sbjct  415   EADLELQEFI  424



>ref|XP_008226094.1| PREDICTED: BAHD acyltransferase At5g47980-like [Prunus mume]
Length=435

 Score =   191 bits (485),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 148/454 (33%), Positives = 220/454 (48%), Gaps = 43/454 (9%)
 Frame = -2

Query  1751  MKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGACHHTKTID  1572
             +KVEV  KE   PSSPTP  LK   LS  DQ    + TP + FY S +  G   H     
Sbjct  5     IKVEVIHKETIEPSSPTPHHLKKINLSVFDQFQPEIYTPLLLFYPSTSDEGNIDHKSLFA  64

Query  1571  Elkk----slsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEMEK  1404
             E  K    SLS+ L+  YP AG    +  +I C+D G  F+ A V   +S +LE P+ + 
Sbjct  65    EKSKLLKRSLSEALTHFYPFAGEFVYN-ASITCNDHGAAFLEAQVNCPISKILEKPDFQV  123

Query  1403  IKQLIPSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFN  1224
             + Q +P+A +   Q     ++ VQ + F CGG+AIG  + H +ADAS L+ F++ WA+  
Sbjct  124   LNQFLPTA-IESKQAEAGYILLVQASLFECGGLAIGVSILHKVADASTLSAFIKRWAAIA  182

Query  1223  RGCAANNGSGFVSDH-----SSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIP  1059
              G A        +DH     +S LFPPL   S+ +  M +         K+ I KRFV  
Sbjct  183   LGSAN------TTDHVEFGVASSLFPPLDFFSSPQFSMILS-------NKNCITKRFVFD  229

Query  1058  ANAIAQLRQDLTITGGSVQRPSRVEALTALVWAAVINATPTQTATLS----C-MVNLRRR  894
             A+ IA L+     T   V  P+RVE ++AL+W  +I A+ ++   +     C +VN+R+R
Sbjct  230   ASKIAALKSKAATT---VPNPTRVEVVSALIWKCIIQASRSKLGVIKPSMWCPVVNMRKR  286

Query  893   MEPPLPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGG  714
                 L  N LG  V     +  E++     V    LV ++R      K+     V GE  
Sbjct  287   SPQGLAENILGNFVWVFAAMAMESE-----VKFESLVVKLRKGIEQYKEKYPNGVTGE-D  340

Query  713   WLRAVIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVV--NMLDNSWVLFLDA  540
               +A+   G  L    D  T   SS CR+  YE +FGWG+P  V   + + N+ ++ +D 
Sbjct  341   IFQAIKGSG-NLAERDDLETNSCSSWCRLPLYETEFGWGRPSWVSTRSTVKNT-IMLMDL  398

Query  539   ING-AVEVWMKLPKQVMHTLTQDRHFLAYVSAFP  441
              +G  +E  + L ++ M  +  +   LAY S  P
Sbjct  399   SDGEGIEASVTLKEEDMTIIESNEELLAYASLNP  432



>ref|XP_006465504.1| PREDICTED: vinorine synthase-like [Citrus sinensis]
Length=470

 Score =   192 bits (487),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 147/469 (31%), Positives = 228/469 (49%), Gaps = 46/469 (10%)
 Frame = -2

Query  1751  MKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGACHHTKTID  1572
             M VE+ SKE  +PSSPTP  LK YKLS LDQLH +   P   +Y     +     +  ID
Sbjct  1     MDVEIISKEFIKPSSPTPLHLKTYKLSLLDQLHDHCYPPVSLYYPLKQDTDLSISSTDID  60

Query  1571  E--------lkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENP  1416
             +        LK+SLS+TLS  YPLAG++K DK++++C+DEG+ F  A     ++  L  P
Sbjct  61    QIVSKRLQLLKQSLSETLSSFYPLAGKMK-DKLSVDCNDEGIYFAEARAKCTLNEFLNRP  119

Query  1415  EME----KIKQLIPSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKF  1248
             ++     K   ++ + +    +  G  +  +QV RFSCGG+ I   + H +AD   L  F
Sbjct  120   DLSLVIFKFHPVVGNEQRQSKEIAGAHVGKIQVTRFSCGGLVICACILHMVADGVTLGSF  179

Query  1247  MEIWASFNRGCAANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRF  1068
             +  WA+        + S   +   S LFP   D +   +       G        +V+RF
Sbjct  180   LMSWAARAGKNIGEDTSICPNYEISSLFPQ-NDHTYPREATTFSKSG------KFVVRRF  232

Query  1067  VIPANAIAQLRQDLTITGGSVQRPSRVEALTALVWAAVINATPTQTAT-----LSCMVNL  903
             V  A AIA L+   T +  S+Q PSRVE +TAL+   ++ A   ++ +     L+ ++NL
Sbjct  233   VFDAQAIANLKAKATTSSTSLQNPSRVEVVTALISKRIMAAFKAKSGSYKPTLLTRVLNL  292

Query  902   RRRMEPPLPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYG  723
             R  + PPL  N  G  V  A  LC++  D    V    LV ++R++F  V     +++ G
Sbjct  293   RPLVRPPLSENSFGNFVWNADALCKDHDDE---VELDGLVWKLRESFTKV----VKRLQG  345

Query  722   EGGWLRAVIARGYELVRNRD-----SSTLYTSSLCRMAYYEVDFGWGKP-RLVVNMLDNS  561
             +G      +  G +   N++        +  SS+C+  +Y++DFGWGKP  +     D S
Sbjct  346   DGEGSLISLCEGIK-DENKEVFADAKDRISFSSVCKFPFYDIDFGWGKPIWMNFTSFDGS  404

Query  560   WVLFLDAI-------NGAVEVWMKLPKQVMHTLTQDRHFLAYVSAFPKP  435
              V F + +          +E W+ L ++ M  L  DR  L + S  P P
Sbjct  405   IVQFANFVILSDTRSGDGIEAWLHLLEEDMALLELDRELLGFASLDPSP  453



>emb|CDP10332.1| unnamed protein product [Coffea canephora]
Length=443

 Score =   191 bits (485),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 141/453 (31%), Positives = 227/453 (50%), Gaps = 30/453 (7%)
 Frame = -2

Query  1751  MKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGACHHTKTID  1572
             M+VE+ S+EI +PS PTP  LK +K SF+DQ+    +  F+ FY  P         +  +
Sbjct  1     MEVEIISQEIIKPSLPTPDHLKIFKRSFIDQITGGYLVRFISFY--PRKESKLKINEVTN  58

Query  1571  ElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEMEKIKQL  1392
             +LK SLS+TL+  YPLAG  K+D  TIEC+D+G  F+ A V  NM+ L+  P+ ++  +L
Sbjct  59    QLKTSLSQTLTRYYPLAGIYKDDS-TIECNDKGALFVTAHVHCNMNELINQPKFQQFHKL  117

Query  1391  IPSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGCA  1212
               S++ Y     G   V+VQ N FSCGG+AI     H I D + ++ F++ WA+   G  
Sbjct  118   GTSSRFYGD---GSFQVSVQFNTFSCGGVAIFTCFYHMIMDITTISVFLKCWAAMASGSQ  174

Query  1211  ANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQLRQ  1032
              +  + F  ++ S +  P+ D+        +  + +   E     KRFV  + AI++L+ 
Sbjct  175   DHESAFFYPEYRSAVLFPVKDSVPFG--FSVIIKSLSLNEGRSTRKRFVFSSAAISELK-  231

Query  1031  DLTITGGS--VQRPSRVEALTALVWAAVINATPT-----QTATLSCMVNLRRRMEPPLPP  873
                + G S  V  P+ VE +++ +W   + A        + + L    ++RRRM PPLP 
Sbjct  232   ---VKGSSDRVPDPTSVEVVSSFIWKHAMTAAKVVQGVQEPSVLVHAADMRRRMVPPLPE  288

Query  872   NCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGW--LRAV  699
                G ++  ++++ +        V    LV+ +R A    K+    K+    G+  +   
Sbjct  289   YSAGNII--SMIIAEYDGIDECEVKFGRLVELLRVAKEENKNEFVPKIQSSKGYDVMMKF  346

Query  698   IARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKP---RLV----VNMLDNSWVLFLDA  540
             +    E    +  +T   +  C+M   EVDFGWGKP    LV    V  +  ++V+ LD 
Sbjct  347   LEEWGEKCSRKGLNTYQFTCWCKMGLNEVDFGWGKPVWTSLVGGTEVESMYKNFVVLLDG  406

Query  539   INGAVEVWMKLPKQVMHTLTQDRHFLAYVSAFP  441
              +G +E W+ L +Q    L  D+ FLAY S  P
Sbjct  407   SDGGIEAWLILEQQETAILENDQEFLAYASLNP  439



>ref|XP_008226591.1| PREDICTED: BAHD acyltransferase At5g47980-like [Prunus mume]
Length=477

 Score =   192 bits (487),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 152/479 (32%), Positives = 231/479 (48%), Gaps = 50/479 (10%)
 Frame = -2

Query  1751  MKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQL-HLNLMTPFVFFYDSPT-ISGACHHTKT  1578
             +KVE+  ++  +PSSPTP  L+  +LS  DQ+       P +FFY +   +SG+     +
Sbjct  6     IKVEIIQRQTVKPSSPTPHPLRTLQLSVFDQMIPSEDYPPTLFFYTTNNNVSGSGGGAPS  65

Query  1577  ID-------------ElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENM  1437
              D              L +SL+KTL+  YPLAGR+ +    I+C D+G EF+ A V  ++
Sbjct  66    TDMADMRMKERDYCQHLIQSLAKTLTHFYPLAGRLSKGHDMIQCTDDGAEFVTARVKCSL  125

Query  1436  SCLLENPEMEKIKQLIPSAKVYEPQPVGKA----LVAVQVNRFSCGGIAIGFFVSHAIAD  1269
             S + E+P+ E +  L+P+  + +P   G A    L+AVQ N F CGG+AIG  +SH I D
Sbjct  126   SQIFEHPDPEILTGLVPA--IGQPDGDGDATRLPLLAVQFNLFECGGMAIGLKMSHKIVD  183

Query  1268  ASALAKFMEIWA--SFNRGCAANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQE  1095
              +    F+  WA  + + G      S      ++  FPPL D S   Q       GI + 
Sbjct  184   GTTCNAFISCWAKTALDDGDNDQVTSMIPKFDAASYFPPL-DFSNSSQPSSAKLVGISKH  242

Query  1094  EKDMIVKRFVIPANAIAQLRQDLTITGGSVQRPSRVEALTALVWAAVINATP--------  939
             +   I +RFV  A+ IA L Q    +      P+RV A+ AL+W   + A+         
Sbjct  243   K--YITQRFVFDASKIATL-QSYLASPSPAHEPTRVLAVLALIWKCAMEASSKSSNIALG  299

Query  938   TQTATLSCMVNLRRRMEPPLPPNCLGTLVDEAIVLC-------QEAKDGGTVVTAVELVQ  780
             ++ ++L   ++LRRR EPPLP N  G +V   IV+        QE  D  T +   +LV 
Sbjct  300   SRPSSLRLTMDLRRRFEPPLPQNLAGNVVSNLIVIATASLLKRQEESDDET-IDLKDLVA  358

Query  779   RIRDAFRAVKDGEARK--VYGEGGWLRAVIARGYELVRNRDSSTLYTSSLCRMAYYEVDF  606
              +R  F   K+  + K        W R    R  +L RN D      +S CR A+YE DF
Sbjct  359   TLRKGFEQQKETYSTKQPFDSNKAWQRVQEYR--KLTRNVDMDHFSCASWCRFAFYEADF  416

Query  605   GWGKPRLVV--NMLDNSWVLFLDAING-AVEVWMKLPKQVMHTLTQDRHFLAYVSAFPK  438
             GWGKP  V   ++     V+ +D  +G  +E  + + +++M     +   L Y S  P+
Sbjct  417   GWGKPAWVSIPSIPLKDAVILIDKRDGKGIEALLTVSEEIMEHFESNPELLKYASVNPR  475



>gb|ADD71922.1| BAHD-type acyltransferase [Actaea racemosa]
Length=424

 Score =   190 bits (482),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 146/441 (33%), Positives = 216/441 (49%), Gaps = 35/441 (8%)
 Frame = -2

Query  1751  MKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGACHHTKTID  1572
             M+V V S+EI +PSSPTP  LK    S  DQ   + ++  + FY +         T T D
Sbjct  1     MEVVVSSREIIKPSSPTPNHLKKLNFSLNDQYSTHYVS-VLLFYSAQGDVDRFKQTNTSD  59

Query  1571  ElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEMEKIKQL  1392
              LKKSLS+ L+  YPLAGR+  ++  I+C+D+G+E++ A V   +S LL  P+ +++ QL
Sbjct  60    RLKKSLSEILTQFYPLAGRIINNEC-IDCNDDGLEYLEARVPCPLSQLLGCPKADELNQL  118

Query  1391  IPSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGCA  1212
             IP           + L AVQV+ F CGGIAIG  +SH   DAS+L  F+  WA+  +G  
Sbjct  119   IP---------FSQKLSAVQVSLFDCGGIAIGVTISHTAGDASSLTAFINSWAATAKGAN  169

Query  1211  ANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIV-KRFVIPANAIAQLR  1035
                   F  D+   LFPP  D   +      G   ++  +    V KRF+  ++ +A L+
Sbjct  170   EIVPPKFGFDY---LFPP-RDVPTV----SFGGGAVDYTQLPRFVGKRFIFDSSKLAALK  221

Query  1034  QDLTITGGSVQRPSRVEALTALVWAAVIN---ATPTQTATLSCMVNLRRRMEPPLPPNCL  864
                      V+RP+RVE +TA ++   +N   +  ++ + LS  +NLR RM PPLPP+  
Sbjct  222   S----ACADVERPTRVEVVTAFIYKCFLNTIRSRSSKPSVLSMPINLRGRMNPPLPPHSF  277

Query  863   GTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLR----AVI  696
             G L   AI L  +            LV+++R+  R V  G   K+  +   L        
Sbjct  278   GNL---AIRLTSQPWPAEKEPELNCLVKQLRETIRKVNGGFVEKLQADNAELLFEHWKDW  334

Query  695   ARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVVNMLDNSWVLFLDAING-AVEV  519
              +G EL    D + L     CR  +YE DFGWGKP     +     V  +D  +G  VE 
Sbjct  335   KKGIELSLTGDLNVLMVLICCRFPFYEADFGWGKPAWATRVNLYPSVSLVDTKDGEGVEA  394

Query  518   WMKLPKQVMHTLTQDRHFLAY  456
             W+ L +  M     +   L +
Sbjct  395   WVTLAEGDMTRFCSEPDLLDF  415



>gb|KCW68080.1| hypothetical protein EUGRSUZ_F01765 [Eucalyptus grandis]
Length=448

 Score =   191 bits (484),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 149/455 (33%), Positives = 222/455 (49%), Gaps = 32/455 (7%)
 Frame = -2

Query  1751  MKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYD-SPTISGACHHTKTI  1575
             M+V V S+E  +P SPTP  LK +KLS LDQ    L  P V FY        A   ++ I
Sbjct  1     MEVVVVSREFVKPYSPTPNHLKIHKLSLLDQFVPTLYVPLVLFYTIEEADRAATTPSRMI  60

Query  1574  DElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEMEKIKQ  1395
               LK+SLS+TL L YPLAG++  D ++IECDDEGV  + A     +S LL  P+ E I++
Sbjct  61    QLLKQSLSETLPLFYPLAGKINGDGLSIECDDEGVLLVEARAEFALSRLLHRPDFETIRK  120

Query  1394  LIPSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGC  1215
              +P A  +    VG  +  VQV  F CGG+ +G  +SHA AD ++ A F++ WA+  R  
Sbjct  121   FLPCAAPWRRVEVGDRVAMVQVTAFPCGGVVVGVLISHAAADGASFATFLKGWAATARKT  180

Query  1214  AANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQLR  1035
                    F    +  LF  + + +  E+    G   + +       +R V  A+ +A+L+
Sbjct  181   GEAPRPSF---DAPTLF--IQNKAFSEEDTYFGVCPVNRGRYG--TRRLVFDASTMARLK  233

Query  1034  QDLTITGGSVQRPSRVEALTALVWAAVINATPTQTATL-----SCMVNLRRRMEPPLPPN  870
              +    G  VQ P+R E +TAL+  + + AT T+ + L     +  VNLRRR  P    +
Sbjct  234   AETANVG--VQNPTRAEVVTALICKS-LTATMTKVSGLDKVVFTNAVNLRRRAVPNFHDD  290

Query  869   CLGTLVDEAIVLCQ-EAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGW--LRAV  699
              +G  V    +LC  E KD   + +   L+  +R A   +  G  R + G+GG   L+  
Sbjct  291   SMGNYVWLPTILCPLEEKDYDGLPS---LIGWLRQAKSKIDGGFVRGLEGDGGLNALQDA  347

Query  698   IARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVV---------NMLDNSWVLFL  546
             +    E +   D    + SS C   +YE+DFGWG+P  V          N++ N  +L  
Sbjct  348   LGEMRESLARTDRLVTF-SSWCNFGHYEIDFGWGRPAWVSPVGFPEESGNLIMNVVLLLD  406

Query  545   DAINGAVEVWMKLPKQVMHTLTQDRHFLAYVSAFP  441
                   VE W+ + +Q +  L QD     Y S  P
Sbjct  407   TRCRKGVEAWVFMDEQELEVLEQDEELTEYASINP  441



>gb|KGN64382.1| hypothetical protein Csa_1G050210 [Cucumis sativus]
Length=431

 Score =   190 bits (482),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 145/453 (32%), Positives = 221/453 (49%), Gaps = 44/453 (10%)
 Frame = -2

Query  1754  TMKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGACHHTKTI  1575
             + K+++ S EI +PSSPTP T +++KLSFLDQ      TP +FFY      G  +H    
Sbjct  7     SFKIDIISTEIIKPSSPTPSTHQHHKLSFLDQFAPGSYTPLLFFY-----PGGGNHRDRC  61

Query  1574  DElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENP-EMEKIK  1398
               LK+SL++TLS  YPLAG + E  + +EC+DEGV F  A V+  +S ++ENP ++    
Sbjct  62    RRLKESLAETLSRFYPLAGTLVEAYL-VECNDEGVAFSEARVSGRLSEVMENPNDVVTYH  120

Query  1397  QLIPSAKVYEPQPV--GKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFN  1224
             +L+P    + P  V   + ++ VQ N F CGG  I   ++H I D ++   F + WAS  
Sbjct  121   RLLP----FHPDAVLERECILGVQYNVFECGGAVIALCITHKIVDGTSTTMFTKAWASTC  176

Query  1223  RGCAANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIA  1044
             RG           D+   + P    T     +   G        + ++ +RFV   + IA
Sbjct  177   RG-----------DNEYPIVPNFDATDLFPAMEIRGGNKRHPRMQKIVTRRFVFNKSNIA  225

Query  1043  QLRQDLTITGGSVQR--PSRVEALTALVWAAVI----NATPTQTATLSCM--VNLRRRME  888
              L++  +     + +  PSRVE+++  +W   I      TPT+    + +  VNLR RM 
Sbjct  226   ALKKQASSAALFLNQRPPSRVESVSGFLWKRFIALYHKKTPTKAKRFAVIQAVNLRNRMN  285

Query  887   PPLPPNCLGTL--VDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGG  714
             PPLPPN  G +     A V   E +D  +      LV ++R+A R + D   + +     
Sbjct  286   PPLPPNSFGNIWWFATADVPIDEEQDFPS------LVGKVREAIREIDDEYTKTLQDTEK  339

Query  713   WLRAVIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVVN--MLDNSWVLFLDA  540
              LRA +  G E V + +      +S C    YE DFGWGKP  V        + VLF++ 
Sbjct  340   SLRAKMKMG-ERVYSGEVEMACFTSWCNFPVYETDFGWGKPTWVCTPGRPYKNVVLFVNT  398

Query  539   ING-AVEVWMKLPKQVMHTLTQDRHFLAYVSAF  444
              +G  +E W+ L +  M     D   L++ S F
Sbjct  399   SDGEGIEAWVNLEESDMALFENDCELLSFTSLF  431



>emb|CDP07885.1| unnamed protein product [Coffea canephora]
Length=453

 Score =   190 bits (483),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 147/462 (32%), Positives = 224/462 (48%), Gaps = 42/462 (9%)
 Frame = -2

Query  1751  MKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQL--HLNLMTPFVFFYDSPTISGACHHTKT  1578
             +++E+ S+E  +P SPTP   K +K+S LDQL  HL  + P V+F+ +    G    +K 
Sbjct  4     LEIEIISREYIKPESPTPNDFKTFKISLLDQLLPHL-YVVPLVYFFKN---DGKSDISKR  59

Query  1577  IDElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEMEKIK  1398
              + LK+SLSKTL   YPLAG+VK D + ++C+D+G+ ++ A V   +S  L +P+ E I 
Sbjct  60    RELLKQSLSKTLVHFYPLAGKVK-DNLHVDCNDDGMYYVEARVNAQLSDFLGHPQQELIH  118

Query  1397  QLIPSAKVYEPQPV---GKALVA-VQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWAS  1230
              L+P    + P       K  VA VQVN F CGGIAIG + SH + D  +   FM  WA+
Sbjct  119   GLLP----FHPSSTELFTKTYVAMVQVNIFECGGIAIGIYSSHKVMDGQSTVTFMNAWAA  174

Query  1229  FNRGCAANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANA  1050
                G +      F+S  SSI  P     +A   L+       + E+     +RFV  A+A
Sbjct  175   TASGSSEEIHPSFIS--SSIFHPNPKLPNATSILIPPP----QSEQSKSATRRFVFDASA  228

Query  1049  IAQLRQDLTITGGSVQRPSRVEALTALVWAAVINATPT-----QTATLSCMVNLRRRMEP  885
             +  L+ +      +V  PSRV A   L+W   I  +       + + L+ +VNLR R  P
Sbjct  229   LNVLKNNANCAESNVTNPSRVTAAMGLIWQCAIATSQARFGFRKPSILTFVVNLRSRNSP  288

Query  884   PLPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLR  705
             PLPP  +G +       C    D    +    +V+R+R+    + +     + G+ G L 
Sbjct  289   PLPPYSMGNIFWVTYAKCLVNSD----LKLPSMVRRVRNGIDKLDNSFLEDIKGKDGSLV  344

Query  704   AVIARGYEL----VRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLV------VNMLD-NSW  558
              V+    EL      N D+  L  SS+C    Y  DFGWGKP         ++ L   + 
Sbjct  345   NVMKHLKELEEVHTGNLDTEYLSLSSICNGGIYNADFGWGKPIWTCIGSAGIDALGLPNL  404

Query  557   VLFLDAING-AVEVWMKLPKQVMHTLTQDRHFLAYVSAFPKP  435
             V+F+D  +G  +E W+ L +  M    +    L + +  P P
Sbjct  405   VVFMDTRSGDGIEAWVTLKENDMAIFEKIPELLNFATLDPSP  446



>ref|XP_011101142.1| PREDICTED: vinorine synthase-like [Sesamum indicum]
Length=447

 Score =   190 bits (483),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 140/469 (30%), Positives = 228/469 (49%), Gaps = 58/469 (12%)
 Frame = -2

Query  1757  ITMKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGACHHTKT  1578
             + M VE+ S E  +PS PTP  L+N+KL  LDQL      P V +Y +    GA  H + 
Sbjct  1     MIMDVEIISVERIKPSFPTPNHLRNFKLCVLDQLIPAAYGPVVVYYPN---EGAASHFEV  57

Query  1577  IDElkkslsktlsLM---YPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEME  1407
             ++            +   +PLAG +++D V+I+CDD G  F  A V   ++  LE+P+++
Sbjct  58    LERFAVLKKSLSETLTGFFPLAGTIRDD-VSIDCDDHGACFTTAKVKCTLTEFLESPDLK  116

Query  1406  KIKQLIPSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASF  1227
              I QL+P       +  G  +  VQ + F+CGGIA+G  +SH I D +AL+ F++ W + 
Sbjct  117   MIAQLLPCGL----KSAGACVTNVQASEFACGGIAVGLCISHRILDGTALSTFLKSWGT-  171

Query  1226  NRGCAANNGSGFVS-DHS-SILFPP----LTDTSAIEQLMKMGAEGIEQEEKDMIVKRFV  1065
                 A+++    VS D S S LFP     L D S       M   G   ++   + +RF+
Sbjct  172   ---AASSSVEKLVSPDFSASALFPAAGVWLKDAS-------MAMWGSLFKKGQFVTRRFM  221

Query  1064  IPANAIAQLRQDLTITGGSVQRPSRVEALTALVWAAVINATP-----TQTATLSCMVNLR  900
                +AIA L+ D+        +P+RVEA++  +W   + A+       + + L+ +VNLR
Sbjct  222   FDGSAIASLK-DMATGTSRTGKPTRVEAVSGFIWKCAMAASEERFGCKRPSLLTHIVNLR  280

Query  899   RRMEPPLPPNCLGTLVDEAIVLCQEAKDGGTV-VTAVELVQRIRDAFRAVKDGEARKVYG  723
             +R  P      LG L    I +      GGT  +   ELV  IR +   +     +K+ G
Sbjct  281   KRAAPNFSEQSLGNL----IWMTSAKFTGGTENLEFPELVDEIRRSISKIDADYVKKLQG  336

Query  722   EGG------WLRAVIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVVNMLDNS  561
             + G      +L+ ++        ++D      +S C++ +Y+VDFGWGKP + V+ +D+S
Sbjct  337   DEGSNMMQKYLKEIVE-----FSSKDVDYFGFTSWCKLGFYDVDFGWGKP-VWVSSIDSS  390

Query  560   WVLFLDA-------INGAVEVWMKLPKQVMHTLTQDRHFLAYVSAFPKP  435
                F++            +E W+ L +Q M  L  ++ F  + S  P P
Sbjct  391   GPFFMNLSVLMDSRCGDGIEAWVTLDEQEMVILEGNQEFKIFASLNPSP  439



>ref|XP_004295709.1| PREDICTED: BAHD acyltransferase At5g47980-like [Fragaria vesca 
subsp. vesca]
Length=423

 Score =   189 bits (481),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 147/449 (33%), Positives = 216/449 (48%), Gaps = 42/449 (9%)
 Frame = -2

Query  1751  MKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGACHHTKTID  1572
             MKV++  KE   PSSPTP  LK   LSF+DQL   +  P + FY +PT     H   +I 
Sbjct  1     MKVKIIHKETITPSSPTPSHLKTLHLSFMDQLVPEVYVPLLLFYPNPTT----HEKSSI-  55

Query  1571  ElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEMEKIKQL  1392
              LK SLS+TL+  YPLAG+ + +  +I CDD G  F+ A V   +S +LENP+ E +K L
Sbjct  56    -LKTSLSETLTHFYPLAGKFQYND-SICCDDHGAAFVEARVNCRVSKILENPDAEMLKHL  113

Query  1391  IPSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGCA  1212
              P+A     Q +   L+ VQVN F CGG+AI   +SH +ADA  L+ F +IWA   +G  
Sbjct  114   FPAA-FESTQALTGHLLLVQVNFFECGGMAIAINISHKVADAFTLSTFTKIWARVAQG--  170

Query  1211  ANNGSGFVSDHSSIL----FPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIA  1044
                       H  +L    F  LT     +  +       E  ++  +++RFV  A+ IA
Sbjct  171   ----------HPVLLPADSFGALTYLYPPQDFLNASKPLAEYTQEQCMIRRFVFDASRIA  220

Query  1043  QLRQDLTITGGSVQRPSRVEALTALVWAAVINATPTQTATL-----SCMVNLRRRMEPPL  879
              L+        SV  P+R+E ++AL+W   + A+ + + ++     S  VN+R+R   P 
Sbjct  221   ALQ--FKAASASVTNPTRIEVVSALIWKCAMEASRSNSGSIRPSVCSQPVNMRKRSGKPF  278

Query  878   PPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLRAV  699
               N LG  V     +  E +     V    LV   R      K      V  E  +    
Sbjct  279   VENVLGNFVWFFKAITVEGE-----VDLQSLVATFRKCMEDFKVNYRNGVSAEQAY--QT  331

Query  698   IARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVVN--MLDNSWVLFLDAING-A  528
             I    +L+      +   +S CR  +YE +FGWGKP  V     L N + L +DA +G  
Sbjct  332   IKESAKLLEKEGMDSYTCTSWCRFPFYETNFGWGKPSWVSTPYALKNKFYL-MDANDGNG  390

Query  527   VEVWMKLPKQVMHTLTQDRHFLAYVSAFP  441
             +E ++ L ++ M     ++  LAY S  P
Sbjct  391   IEAYVTLLEEDMAIFGSNQELLAYASLNP  419



>ref|XP_008444410.1| PREDICTED: vinorine synthase [Cucumis melo]
Length=448

 Score =   190 bits (482),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 152/460 (33%), Positives = 227/460 (49%), Gaps = 48/460 (10%)
 Frame = -2

Query  1745  VEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYD--SPTISGACHHTKTID  1572
             +++ S +I +PSSPTP  L  + LS  DQL  +   P VFF+    P  SG  +HT T+D
Sbjct  9     LQIVSTQIIKPSSPTPPNLNIHTLSLFDQLAPHTFVPLVFFFSHQGPGRSGTYYHT-TVD  67

Query  1571  ElkkslsktlsLM---YPLAGRVKEDKVTIECDDEGVEFIVADV-AENMSCLLENPEMEK  1404
             +L+       + +   YP AGR+K DKV+I+C+DEGV F+ A +    +S +LENP  E 
Sbjct  68    KLELLRQSLSTTLSRYYPFAGRIK-DKVSIDCNDEGVTFVEAWLEGVTVSKILENPRSEI  126

Query  1403  IKQLIPSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFN  1224
             ++ L      ++   +G +L+ VQ+  F CGG++IG  +SH + D + L KF++ W    
Sbjct  127   VEMLFVDGLQWKDSKMG-SLLKVQITLFECGGLSIGVLLSHKLGDLATLVKFVQDWGLIT  185

Query  1223  RGCAANNGSGFVSDHSSILFP----PLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPA  1056
             R    NNG       + + F     P  D  A+         G   EE +   KRFV   
Sbjct  186   R----NNGFCEEETVNPLFFSADVFPHGDLPAM--------SGAVIEEGNFTCKRFVFEG  233

Query  1055  NAIAQLRQDLTITGGSVQRPSRVEALTALVWAAVINAT------PTQTATLSCMVNLRRR  894
             + I  L+  ++     VQ PSRVE ++AL++ A+I+A+        Q+  L   +NLR+R
Sbjct  234   SKIESLKNRIS---EKVQNPSRVEVVSALIYKAIISASRNNNNSQNQSTLLLQTLNLRKR  290

Query  893   MEPPLPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGG  714
             + PPLP   +G+LV    V     ++   VV   ELV  +R       D  A+K Y    
Sbjct  291   VVPPLPETLVGSLVSFFPVGVDGERE---VVELHELVGTMRKEMGEFCDRYAKK-YRTKE  346

Query  713   WLRAVIARGYE----LVRNRDSSTLY-TSSLCRMAYYEVDFGWGKPRLVVN---MLDNSW  558
             WL  +  R  E    L +N ++  +Y  SS C    YEVDFGWG    +      + N+ 
Sbjct  347   WLELIKKRLNESREILSKNGNNQLVYRCSSGCNFPIYEVDFGWGVADWITMPAFKMKNT-  405

Query  557   VLFLDAIN-GAVEVWMKLPKQVMHTLTQDRHFLAYVSAFP  441
             V+ LDA N G +E  + L    M     +   LA+ S  P
Sbjct  406   VMMLDAKNGGGIEALISLQDGEMAAFQDNEELLAFASLNP  445



>ref|XP_004310028.1| PREDICTED: vinorine synthase-like [Fragaria vesca subsp. vesca]
Length=442

 Score =   190 bits (482),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 151/456 (33%), Positives = 227/456 (50%), Gaps = 51/456 (11%)
 Frame = -2

Query  1757  ITMKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGACHHTKT  1578
             + + VEV S+E   PSSPTP  L++++LSFLDQL  +   PF++FY  P       HT+ 
Sbjct  1     MKIDVEVISQETVTPSSPTPHHLRHHQLSFLDQLAPHAYVPFLYFYSLPNTHS---HTQI  57

Query  1577  IDElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAE-NMSCLLENPEMEKI  1401
                LKKSLSK L+  YPLAGRVK + + +EC+D GV F  A V   ++S ++ NP + ++
Sbjct  58    STHLKKSLSKALTQYYPLAGRVKLN-LFVECNDFGVPFYEARVKSLSLSDVITNPSLPEL  116

Query  1400  KQLIPSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNR  1221
               L+P    ++   +    + VQ+N F CGG+AIG   SH +AD  +   F++ WAS   
Sbjct  117   NNLLP----FKLDELKDIALGVQLNLFRCGGVAIGLCASHRVADGLSYFTFVKNWAS---  169

Query  1220  GCAANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIV-KRFVIPANAIA  1044
               A  N S      ++ +FPP             G  G+   +++ IV K FV     I 
Sbjct  170   -AACGNESVSPDFSAASIFPPKNMD---------GYNGVLIPKRNEIVTKGFVFDGLKIE  219

Query  1043  QLRQDLT--ITGGSVQRPSRVEALTALVWAAVINATPTQTATLS-------CMVNLRRRM  891
              LR      I   + + PSRVEAL+A +W   + A   +  + S        +++LR R 
Sbjct  220   ALRSKYAEGIRLKTKKIPSRVEALSAFLWNKFMAAAAKEEGSSSRKLYAVVYIMDLRSRF  279

Query  890   EPPLPPNCLGTLVDEAI---VLCQEAKDGGTVVTAVELVQRIRDAF-RAVKDGEARKVYG  723
             +PPLP +  G     A     L    + GG V   +E +++I + + R  +DG    +  
Sbjct  280   DPPLPQHSFGNYYRAATATPTLVNGEERGGLVRQVIEEIEKIDNKYMRKFQDGYKEHL--  337

Query  722   EGGWLRAVIARGY--ELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLV--VNMLDNSWV  555
                ++R  + R    ELV      TL  SSLCR   YE DFGWGKP  V   +M  N+ +
Sbjct  338   --DFMRRRMERAAKGELV------TLTFSSLCRFPLYEADFGWGKPEWVSMASMKINNQI  389

Query  554   LFLDA-INGAVEVWMKLPKQVMHTLTQDRHFLAYVS  450
             +F+D  +   +E +    ++ M     D  FL  +S
Sbjct  390   VFMDTKLGDGIESYFSFKEEDMAKFELDSEFLQLIS  425



>ref|XP_010528792.1| PREDICTED: BAHD acyltransferase At5g47980-like [Tarenaya hassleriana]
Length=447

 Score =   189 bits (481),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 144/464 (31%), Positives = 231/464 (50%), Gaps = 46/464 (10%)
 Frame = -2

Query  1751  MKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGACHHTKTID  1572
             MKVE   KE  +PSSPTP  L+  KLS  DQ    + T  V F+     S +C H +T  
Sbjct  1     MKVEAIGKETIKPSSPTPNDLRTVKLSVYDQFLPPVYTVSVLFF-----SNSCRHDQTQR  55

Query  1571  E------------lkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCL  1428
             E            LK SLS+TL+  YPL+GR+ +    I+C+DEG  F+ A     +   
Sbjct  56    EGPMFSEHDTSLKLKSSLSETLTRFYPLSGRINDGGDAIDCNDEGAVFVDARSDSTLLDF  115

Query  1427  LENPEMEKIKQLIPSAKVYEPQPVGKA--LVAVQVNRFSCGGIAIGFFVSHAIADASALA  1254
             L++P+   +++ +P   V  P        L+ V+   F CGG+AIG  +SH IADA++++
Sbjct  116   LKSPDFAALQRFLPLDTVENPYESAATWPLLLVKATYFKCGGLAIGICISHKIADAASIS  175

Query  1253  KFMEIWASFNRGCAANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVK  1074
              F+  WA+  RG   ++ + +    ++  FPP ++++         +  I  + K    K
Sbjct  176   MFVRGWAATARG--DSDSATYPEFTAAKFFPPASESTRF-------SGKITLDRKICATK  226

Query  1073  RFVIPANAIAQLRQDLTITGGSVQRPSRVEALTALVWAAVINATPT-----QTATLSCMV  909
             RFV   + IA+LR+   +  G V  P+RVE++T L+W  V+ A+ +      +  L+  V
Sbjct  227   RFVFDGSKIAELRR--KVASGDVAEPTRVESITGLLWKCVVTASNSVSEKLLSKVLNQPV  284

Query  908   NLRRRMEPPLPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAF-RAVKDGEARK  732
             NLR ++   L  N +G ++  ++ L  + +    +  AV+ ++R  D   R ++D     
Sbjct  285   NLRGKVPSLLSENVMGNVMYSSMPLMIDGQGEVEIQDAVKDLRRKADELKRFIRDDGGSS  344

Query  731   VYGEGGWLRAVIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVVN----MLDN  564
             + G    +  +I      +          SS C++  YE DFGWG P  V       LDN
Sbjct  345   LIGTK--MVDLILSNISGLSYETHEPYSVSSWCKLPLYEADFGWGSPAWVTGNVAPALDN  402

Query  563   SWVLFLDAINGA-VEVWMKLPKQVMHTLTQDRHFLAYVSAFPKP  435
               +L +D+ +GA VE W+ LP+QVM +  Q+   LA+  A P P
Sbjct  403   LMIL-IDSKDGAGVEAWVTLPEQVMLSFEQNAELLAF--ACPNP  443



>ref|XP_008346587.1| PREDICTED: BAHD acyltransferase At5g47980-like [Malus domestica]
Length=445

 Score =   189 bits (481),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 146/457 (32%), Positives = 222/457 (49%), Gaps = 39/457 (9%)
 Frame = -2

Query  1751  MKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGAC----HHT  1584
             MKVEV  KE  +PSSPTP  LK  +LS  DQL  ++  P + FY S   S A     HH+
Sbjct  5     MKVEVIYKETIKPSSPTPSHLKTTQLSVFDQLAPDVFXPLLLFYPSNINSDAVDSIDHHS  64

Query  1583  KTIDElkkslsktlsLM---YPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPE  1413
                +      +     +   YP AG  + + V+I CDD GV F+ A V   MS +LE P+
Sbjct  65    SVXERSNILKASLSEALTHFYPFAGTFQYN-VSISCDDHGVAFLQAHVNCPMSKILEKPD  123

Query  1412  MEKIKQLIPSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWA  1233
              E ++QL+P+++       G  L+ +Q N F CGG+AI    SH I D   L+ F++ WA
Sbjct  124   FEILRQLLPASQGSSQAETGH-LLLIQANFFECGGLAIAVSSSHIIIDGYTLSTFIQSWA  182

Query  1232  SFNRGCAANNGSGFVSDHSSILFPPLTD--TSAIEQLMKMGA--EGIEQEEKDMIVKRFV  1065
             +      A   S   +DH  +L  P  D   S   QL  + +    +E  E+  I KRFV
Sbjct  183   A-----VALASSTVSTDH--VLLTPKFDVAVSLFPQLDFLNSPPPAMELVEEKCISKRFV  235

Query  1064  IPANAIAQLRQDLTITGGSVQRPSRVEALTALVWAAVINATPTQTATL-----SCMVNLR  900
               A+  A L+     T  SV  P+R+E+++AL+W     A+ + +  +     S   +LR
Sbjct  236   FEASKAAALKSKAVST--SVPNPTRIESVSALIWKCATAASRSXSGVVRQSVWSTNASLR  293

Query  899   RRMEPPLPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGE  720
             + ++ PL  N +G LV   +V  + ++       +V  V ++R      K+  A  V GE
Sbjct  294   KIVQRPLAENLMGNLVGMIVVKIEASEVVDIDFPSV--VAKLRKGMEEFKEKYANGVSGE  351

Query  719   G--GWLRAVIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVVNMLDNSWV-LF  549
                G+++    R    ++  D+   + SS CR  +YE +FGWGKP  V   +    V +F
Sbjct  352   EACGFMKDFXDR----IKRVDN--YHCSSWCRFPFYEANFGWGKPLWVCQTITMKNVAMF  405

Query  548   LDAING-AVEVWMKLPKQVMHTLTQDRHFLAYVSAFP  441
              D  +G  +E  + L ++ M     D+  LAY S  P
Sbjct  406   TDTRDGEGIEALVTLSEEDMAKFECDKELLAYASVNP  442



>ref|XP_006443317.1| hypothetical protein CICLE_v10020331mg [Citrus clementina]
 gb|ESR56557.1| hypothetical protein CICLE_v10020331mg [Citrus clementina]
Length=418

 Score =   189 bits (479),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 146/448 (33%), Positives = 223/448 (50%), Gaps = 50/448 (11%)
 Frame = -2

Query  1751  MKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGACHHTKTID  1572
             M++   S EI +PSSPTPQ LK +KLS LDQ+  + + P + FY   T S      KT D
Sbjct  1     MEINNVSSEIIKPSSPTPQHLKTHKLSVLDQVAGDSLFPIILFYPQ-TCSNNTSLNKTTD  59

Query  1571  ElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVAD-VAENMSCLLENPEMEKIKQ  1395
              LK+SLS+TL+L +P AGR+K D+ +I+CDD G  FI A   A +MS +++ P ++ ++Q
Sbjct  60    LLKRSLSRTLTLYHPFAGRLK-DEFSIDCDDTGATFIEARAAASDMSEIVKQPTVDMLEQ  118

Query  1394  LIPSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGC  1215
             L+P  K+ E   V   L A       CGG+A+    SH IAD +  A F++ W +F  G 
Sbjct  119   LMP-YKLNEKPSVAVNLAAKVTYFEHCGGMALCVCFSHVIADITTAANFIKTWVTFASGS  177

Query  1214  AANNGSGFVSDHS----SILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAI  1047
               ++    V  H+    S +FPP   +S    ++   AE + +   +++ KRF+   + I
Sbjct  178   DTSSEDDDVIKHAVFGCSSIFPPQKFSSFSRNVI---AENLSK-SAEILTKRFIFEGDKI  233

Query  1046  AQLRQDLTITGGSVQRPSRVEALTALVWAAVIN----ATPTQTATL--SCMVNLRRRMEP  885
             A L++ +     S   P+RVEA++A++   +++    A     + L  S  VNLR R+ P
Sbjct  234   AALKEKMGSESSSGYHPTRVEAVSAIILGGIMSVEKEADDFNHSHLVASIAVNLRNRVNP  293

Query  884   PLPPNCLGTLVDEAIV-LCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWL  708
             P+P   +G +V   I  L  E K     +    L + +  +   + D   RK +    W 
Sbjct  294   PIPEQSIGNIVQAGIAKLPIEKK----TIDYRNLAETLHKSIEKINDEYLRKWFTISAW-  348

Query  707   RAVIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVVNMLDNSWV-LFLDAING  531
                                     CR   YE DFGWGKP  V  ++ +  V + LD+ +G
Sbjct  349   ------------------------CRRPLYEADFGWGKPVWVSTVMKHKDVAVLLDSSDG  384

Query  530   -AVEVWMKLPKQVMHTLTQDRHFLAYVS  450
               +E W+ LPK+ M    QD   L Y S
Sbjct  385   KGIEAWVALPKKDMAKFEQDSGILRYAS  412



>ref|XP_006429944.1| hypothetical protein CICLE_v10011699mg [Citrus clementina]
 gb|ESR43184.1| hypothetical protein CICLE_v10011699mg [Citrus clementina]
Length=453

 Score =   189 bits (481),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 151/453 (33%), Positives = 222/453 (49%), Gaps = 26/453 (6%)
 Frame = -2

Query  1751  MKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGACHHTKTID  1572
             M++ + S+E+ RPSS     LK +++S LDQL      P V FY  P  S     T+   
Sbjct  1     MEIGIVSREVVRPSSLNVHLLKPFRISLLDQLTPTTFAPLVLFY--PMKSTHLKGTQIST  58

Query  1571  ElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEMEKIKQL  1392
             +LK+SLSKTL   YPLAGRV+ D + I   DEGV +I   V  ++   L+NP ME + Q 
Sbjct  59    QLKESLSKTLEHFYPLAGRVR-DNLIINDYDEGVPYIETRVNTHLFEFLQNPPMELLNQC  117

Query  1391  IPSAKV-YEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGC  1215
             +P     Y+P P     VAVQ+N F CGGIA+G   SH I D +  + F+  WA+ +RG 
Sbjct  118   LPYPPFRYQPNPDRVPQVAVQLNTFDCGGIALGLSFSHKINDGATTSAFLRSWAANSRGA  177

Query  1214  AANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQLR  1035
                         +S++FPP  + S    L  M  E I   E     +RFV  A AIA LR
Sbjct  178   CHKAVKYKNLSEASMIFPP-QNPSPNHHLSVM--EKIWFREAKYKTRRFVFDAKAIATLR  234

Query  1034  QDLTITGGSVQRPSRVEALTALVWAAVINATPTQTAT---LSCMVNLRRRMEPPLPPNCL  864
              +    G  V  P+R+EAL+A +  + + A+ +  ++   L   VNLRR  EP L P  +
Sbjct  235   SE--CKGERVPNPTRIEALSAFILKSAMLASRSTASSRFVLHQAVNLRRLTEPRLSPCSV  292

Query  863   GTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLRA--VIAR  690
             G L   A        +    +    LV R++ A   +     + ++G+ G+ +    I R
Sbjct  293   GNLFLWATAAYN--MEHAAEMELHGLVARMKQAVGKINSEYLKTLHGDEGFPKVCEYIKR  350

Query  689   GYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKP---RLVVNMLDNSW---VLFLDA----  540
               E+  +++      SS  +  + EVDFGWG P    +   +  NS+     F +     
Sbjct  351   IEEVSAHKNLEAFTFSSWVKFGFNEVDFGWGNPIWSGIFGEVGSNSFRNLTFFKETRSAN  410

Query  539   INGAVEVWMKLPKQVMHTLTQDRHFLAYVSAFP  441
              + AVE W+ L +++M  L  D  FLA+ S  P
Sbjct  411   YDNAVEAWVTLDEKIMSLLEHDPQFLAFASPNP  443



>ref|XP_010499177.1| PREDICTED: vinorine synthase-like [Camelina sativa]
Length=444

 Score =   189 bits (480),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 144/451 (32%), Positives = 228/451 (51%), Gaps = 35/451 (8%)
 Frame = -2

Query  1760  QITMKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGACHHTK  1581
             ++ +K+ V S+E+ +PSS     L  + LSFLDQL   +  PF+FFY + T      + +
Sbjct  14    RMELKITVTSQELVKPSSLNLNHLPCHHLSFLDQLAPPIFMPFLFFYHNKT---NLSNNE  70

Query  1580  TIDElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEMEKI  1401
               D +K SLS+ L+L  PLAGR+K     + C+D G  F+ A    NMS +LENP   ++
Sbjct  71    RSDHIKNSLSEILNLFNPLAGRMKNSGDVVVCNDMGASFVEAKADSNMSQILENPNPNEL  130

Query  1400  KQLIPSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNR  1221
              +L P    +E   V   L+ VQ+  F CGG+A+G  +SH + DA +   F++ WA+  R
Sbjct  131   NKLHP----FEFHEVSDVLLTVQLTFFQCGGLALGIGLSHKLCDALSGLIFIKSWAALAR  186

Query  1220  GCAANNGSGFVSDHSSI--LFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAI  1047
             G      +G V+    +  +FPP      IE L    A GI +E  +++ KRFV   +++
Sbjct  187   G-----DTGIVTPSFDLAKMFPPCD----IENLNM--ATGITKE--NIVTKRFVFLKSSV  233

Query  1046  AQLRQDLTITGGSVQRPSRVEALTALVWAAVINATPT-----QTATLSCMVNLRRRMEPP  882
               LR+    +G    R +RVEAL+  +W+  + +T       +  TL   VNLRR+ +P 
Sbjct  234   ESLRE--RFSGNKEIRATRVEALSVFIWSRFMASTNQDDKTGKIYTLIHPVNLRRQADPF  291

Query  881   LPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEG-GWLR  705
             +P N  G ++  ++ + +   +         LV+++R+  R +     +K+  +  G L 
Sbjct  292   IPDNMFGNIMRFSVTVPKMTINEDDEAEP-SLVEQMREEIRKIDAVYVKKLQEDSRGHLE  350

Query  704   AVIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVVN--MLDNSWVLFLDAING  531
              +  +    V     S  +T SLC+   YE DFGWGKP  V +  M   + V F+D   G
Sbjct  351   FLNKQASGFVNGEIVSFSFT-SLCKFPVYEADFGWGKPLWVASARMSYKNLVAFIDTKEG  409

Query  530   -AVEVWMKLPKQVMHTLTQDRHFLAYVSAFP  441
               +E W+ L +  M     D   L YVS+ P
Sbjct  410   DGIEAWINLDQNDMSRFEADEELLRYVSSNP  440



>ref|XP_008372858.1| PREDICTED: BAHD acyltransferase At5g47980-like [Malus domestica]
Length=440

 Score =   189 bits (479),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 140/454 (31%), Positives = 215/454 (47%), Gaps = 39/454 (9%)
 Frame = -2

Query  1751  MKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGACHHTKTID  1572
             MKV+V +KE  +PSSPTP  L+N +LSF DQ    +  P + FY +   +      +   
Sbjct  5     MKVQVLNKETIKPSSPTPPDLRNLRLSFFDQFEPEIFIPLLLFYRNKPCAAVADDQERSX  64

Query  1571  ElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEMEKIKQL  1392
              LK SLS+ L+  YP AG  + +  +I C+D GV F+ A V   MS + + P+   ++QL
Sbjct  65    FLKTSLSEALTXFYPFAGEFQRND-SIXCNDHGVAFLQAQVNCYMSMVFDKPDDXILEQL  123

Query  1391  IPSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGCA  1212
             +P+ K          L+ +Q N F CGG+AIG   +H ++DA  + KF+E WA+   G A
Sbjct  124   VPTDKESTLSNT-DYLLLIQANFFECGGLAIGVSFAHKVSDAFTICKFIERWAAIALGSA  182

Query  1211  ANNGSGFVSDH----------SSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVI  1062
             +       +DH          S+ LFPPL   ++ +  + +  EG          +RFV 
Sbjct  183   ST-----TTDHHXVLXGEFGVSASLFPPLDIFNSPDFAVTLSTEG-------SXTRRFVF  230

Query  1061  PANAIAQLRQDLTITGGSVQRPSRVEALTALVWAAVINATPTQT-----ATLSCMVNLRR  897
              A+ IA L+        +   P+RVE ++AL+W   I A+ ++      + L  +VN+R+
Sbjct  231   DASKIATLKSK---AASTTPNPTRVEVVSALIWKCAIQASRSKLGIIKPSMLCPIVNMRK  287

Query  896   RMEPPLPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEG  717
             R    L  N LG  V     +  E +     +    LV ++R       +     V G  
Sbjct  288   RSRQALAENILGNCVWSFAAMTVEXE-----IEHESLVAKLRKGIEEHXEKYPNGVSGND  342

Query  716   GWLRAVIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLV-VNMLDNSWVLFLDA  540
                 A  + G +L+ + D      SS CR ++YE DFGWGKP  V V  L  + +L +D 
Sbjct  343   IIEAAKESGGSKLLDSDDIDIYTCSSWCRFSFYEADFGWGKPSWVSVRSLYKNTILLMDM  402

Query  539   ING-AVEVWMKLPKQVMHTLTQDRHFLAYVSAFP  441
              +G  +E  + L +  M         LAY S  P
Sbjct  403   RDGDGIEASLTLKEDDMAXFENSEELLAYASPNP  436



>ref|XP_006432232.1| hypothetical protein CICLE_v10001086mg [Citrus clementina]
 gb|ESR45472.1| hypothetical protein CICLE_v10001086mg [Citrus clementina]
Length=460

 Score =   189 bits (481),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 144/468 (31%), Positives = 227/468 (49%), Gaps = 42/468 (9%)
 Frame = -2

Query  1751  MKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYD------SPTISGACH  1590
             M+VE+ S+E  +PSSPTP  LK++KL  LDQ   N+  P V +Y       S TI     
Sbjct  1     MEVEIISRESIKPSSPTPHDLKSHKLCLLDQFRSNIYVPRVLYYPLNQDDLSSTIDIDHI  60

Query  1589  HTKTIDElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEM  1410
              +K + +LK+SLS+ L   YPLAG++  +  +++C+DEGV F+ A    +++  L  P+ 
Sbjct  61    VSKRLQQLKQSLSEALVRFYPLAGKLT-NNFSVDCNDEGVYFVEAAAKIHLNEFLIQPDH  119

Query  1409  EKIKQLIP-SAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWA  1233
               I +  P        Q  G  +  VQV  F+CGG+ I   +SHA  D ++ + FM+ WA
Sbjct  120   NLIYKFFPVDGNEQRGQIAGAHVAKVQVTSFACGGLVICACISHAFGDGTSFSSFMKAWA  179

Query  1232  SFNRGCAANNGSGFVSDH--SSILFPPLTDTSAIEQLMKMGAEGIEQ--EEKDMIVKRFV  1065
             +  R   +   + ++  +  +S LFPP  D     QL         +  E    +V+RFV
Sbjct  180   ATARNKTSEEEAIYICPNYDASSLFPP-NDGDLFHQLKATSRASFGRFFETGKFVVRRFV  238

Query  1064  IPANAIAQLRQDLTITGGSVQRPSRVEALTALVWAAVINATPTQTAT-----LSCMVNLR  900
               A A A+L+         VQ P+RVE ++A +  +V+ A  T++ +     LS  VNLR
Sbjct  239   FDAKATAELKA--KAKSSRVQNPTRVEVVSATLSKSVMTAFKTRSGSLKPTLLSHAVNLR  296

Query  899   RRMEPPLPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGE  720
              +  PPL  N +G +V +   LC E +     V    LV ++R+A         + + G 
Sbjct  297   SKARPPLSENLIGNIVWKTNALCTEEE-----VDLDVLVWQLREALSKFDGDFVKSLQGV  351

Query  719   GGWLR-----AVIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVVN-------  576
             GG L+        A  Y   +N+    +  SS C   +Y +DFGWGKP  V         
Sbjct  352   GGLLKLSEDIKCEAEAYSDAKNK----IMFSSWCTFGFYGIDFGWGKPIWVSGACLGGSI  407

Query  575   MLDNSWVLFLDAING-AVEVWMKLPKQVMHTLTQDRHFLAYVSAFPKP  435
             +  +  ++ +D+ +G  +E W+ L ++ M  L  D   L   +  P P
Sbjct  408   VQSSPTIILMDSRSGNGIEAWVLLLEEDMALLEVDEKLLEVATIDPSP  455



>ref|XP_008226064.1| PREDICTED: BAHD acyltransferase At5g47980-like [Prunus mume]
Length=446

 Score =   189 bits (479),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 144/460 (31%), Positives = 232/460 (50%), Gaps = 45/460 (10%)
 Frame = -2

Query  1751  MKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGACHHTKTID  1572
             M+ E+  +E  +PSSPTP  L+N+KLS LDQL      P V FY     +G     K+I 
Sbjct  1     MEFEIIKRETIKPSSPTPHYLRNFKLSLLDQLGPVAYEPLVLFYPK---NGIATPQKSIW  57

Query  1571  ElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEMEKIKQL  1392
              +KKSLS+TL+  YPLAGR+K + ++I+C+D GV+++ A V   +S  L  P+ + +++L
Sbjct  58    IIKKSLSETLTRFYPLAGRIKGN-ISIDCNDHGVDYVEARVNGLLSTFLSKPDAQTLRKL  116

Query  1391  IPSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGCA  1212
             +P      P+     L+ VQ N F CGG+AIG  +SH +ADA++L+ F+  W++   G +
Sbjct  117   LP-VDAESPEAGRGPLLLVQANVFDCGGLAIGVCMSHKLADAASLSTFILAWSATALGFS  175

Query  1211  ANNGSGFVSDHS-SILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQLR  1035
                    + D S S  FPP    S+ +Q        ++ +  + + KRFV  A+ IA LR
Sbjct  176   ----QALLPDFSASFRFPPTDHASSFQQ------SSVDVKRVNCVTKRFVFYASKIAGLR  225

Query  1034  QDLTITGGSVQRPSRVEALTALVWAAVINATPT--------QTATLSCMVNLRRRMEPPL  879
                      V +P+R EA+TAL+W  V+ A           + + LS  V++R+R+ PPL
Sbjct  226   T--KAASAIVDQPTRAEAVTALIWRCVVAAASRSSSSLQSPKLSVLSQSVDIRKRVVPPL  283

Query  878   PPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLRAV  699
               + +G LV        E K     +    LV ++R   + + +   +++  +      V
Sbjct  284   SDDSIGNLVGYFAAHTDETK-----LELQGLVVKLRKGIKELSNSYTKRLQKDQAL--QV  336

Query  698   IARGY----ELVRNRDSSTLYT-SSLCRMA-YYEVDFGWGKPRLVVNML----DNSWVLF  549
             + + +    E ++  D    Y  + LC     Y V FGWG P  + N+     +N   L 
Sbjct  337   VCKSFKEADEFIKRDDIINFYVGTDLCNYKLLYGVSFGWGNPIWLSNVPAASNNNVASLV  396

Query  548   LDAINGAVEVWMKLPKQVMHTLTQDRHFLAYVSAFPKPKL  429
                 +G +E W+ L ++ M    QD+  LA+  AF  P +
Sbjct  397   STREDGGIEAWVTLSEEDMAAFEQDQELLAF--AFMNPSV  434



>ref|XP_009780317.1| PREDICTED: vinorine synthase-like [Nicotiana sylvestris]
Length=445

 Score =   189 bits (479),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 134/462 (29%), Positives = 235/462 (51%), Gaps = 43/462 (9%)
 Frame = -2

Query  1757  ITMKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGACHHTKT  1578
             + +KV++ S E+ +PSSPTP  LKN+ L  LDQL      P + FY  P +     H K+
Sbjct  1     MNIKVKLISTEMIQPSSPTPNHLKNFNLCLLDQLIPAPYAPILLFY--PNLGDIKVHEKS  58

Query  1577  IDElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEMEKIK  1398
                LKKSL  TL   YPLAGR K D+++I+C+D+GV ++  +V  ++   L  P +E I 
Sbjct  59    A-LLKKSLVDTLYRFYPLAGRFK-DELSIDCNDQGVNYVTTNVNCHLIEFLNEPNLESIS  116

Query  1397  QLIPSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRG  1218
             Q +P    ++    G  +  +Q+N F CGGIAIG  ++H I D   L+ F++ WA     
Sbjct  117   QFLPCQPPFKVLAAGDYVTNIQINVFKCGGIAIGLCIAHKILDGVGLSTFLKYWAGL--A  174

Query  1217  CAANNGSGFVSDHSSILFPP----LTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANA  1050
             C++N    + +  ++  FP     L DTS     M M +   ++   + + +RFV  A+A
Sbjct  175   CSSNEVQ-YPNLMANYFFPAEDLWLRDTS-----MTMWSSMFKK--GNFVTRRFVFNASA  226

Query  1049  IAQLRQDLTITGGSVQRPSRVEALTALVWAAVINATPTQTAT--------LSCMVNLRRR  894
             I  L+     T   ++ P++VE +++ +W   I A+  +  +        L+ +VNLR+R
Sbjct  227   INNLKT--MSTSSHIKHPTKVEVVSSFIWKCSIAASKQKNCSNKRHSNSILTHIVNLRKR  284

Query  893   MEPPLPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGG  714
               P LP N LG L    + L          +   +LV ++R +   + D   +++  + G
Sbjct  285   AAPSLPENILGNL----LWLSSAKNTAKHEMELPDLVNQVRKSISTIDDRYIKRLRSDEG  340

Query  713   W--LRAVIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVVNMLDNSWVLFLDA  540
             +  +R  +    E V ++ +     +S C+  +Y++DFG+GKP + ++ + +  + F++ 
Sbjct  341   FNLMRKSLKEIGE-VCSKGADHYGFTSWCKFGFYDIDFGFGKP-IWISSISSRCLFFMNL  398

Query  539   I-------NGAVEVWMKLPKQVMHTLTQDRHFLAYVSAFPKP  435
             I          +E W+ L ++ M+ +  ++  L + S  P P
Sbjct  399   IILMETKCVDGIEAWVTLDEEEMNMIVGNQELLVFASIDPSP  440



>ref|XP_004310024.1| PREDICTED: vinorine synthase-like [Fragaria vesca subsp. vesca]
Length=447

 Score =   188 bits (478),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 151/463 (33%), Positives = 221/463 (48%), Gaps = 45/463 (10%)
 Frame = -2

Query  1757  ITMKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFY----DSPTISGACH  1590
             +  +VEV S E  +PSSPTP  L+++KLS+LDQ+   +  P V FY    D   +     
Sbjct  1     MKFQVEVLSTETIKPSSPTPDHLRHHKLSYLDQIQPPIFMPMVLFYPKEHDHNDLDLISI  60

Query  1589  HTKTIDElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEM  1410
             H +   ++KK+LS TL   YPLAGRV   +  ++C+DEG  ++ A     +S ++ENP  
Sbjct  61    HEQRCSKIKKALSDTLVKFYPLAGRVHGTQY-VDCNDEGAYYVEAKTDCKLSDIIENPNP  119

Query  1409  EKIKQLIPSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWAS  1230
             +   + +P    +E     +  V  QV  F+CGG++I   +SH + DA +   F+   A+
Sbjct  120   KDFNKFLP----FELDAAHELPVCFQVTFFACGGMSIAMGMSHKVGDALSYFTFLNGLAA  175

Query  1229  FNRGCAANNGSG--FVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPA  1056
               RG   N+     FVSD     + P  D S   Q       GI ++  ++  KRFV   
Sbjct  176   EARG-EGNDVCAPVFVSDK----YFPQKDLSGFYQ----HRSGIIKQ--NISTKRFVFDG  224

Query  1055  NAIAQLRQDLTITGGSVQRPSRVEALTALVWAAVI---------NATPTQTATLSCMVNL  903
               +  +R          +RP+RVEAL+A +W   I           T     T+S  VNL
Sbjct  225   PMVQAIRAKCVDMS---RRPTRVEALSAFIWCRYIASCTSIQQEGVTTDAMYTVSHAVNL  281

Query  902   RRRMEPPLPPNCLGTLVDEAIVLCQ---EAKDGGTVVTAVELVQRIRDAFRAVKDGEARK  732
             R RMEPPLP +  G +   AI +     + KDG    T   +V  +R+A + V     RK
Sbjct  282   RTRMEPPLPEHTFGNVTRTAIAVPPVPVDPKDG----TLHGVVNHVREAIKQVDKEYIRK  337

Query  731   VYGEGGWLRAVIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLV--VNMLDNSW  558
             +      L  + +R  E+ R    S  +T SLCR   Y+ DFGWGKP  V   +    + 
Sbjct  338   LQEGDAHLNFLRSRTEEVKRGEVVSFSFT-SLCRFPIYDADFGWGKPVYVGSASFTFKNL  396

Query  557   VLFLDA-INGAVEVWMKLPKQVMHTLTQDRHFLAYVSAFPKPK  432
             V F D  +   VE W+ L ++ M    +D   L YVS  P  K
Sbjct  397   VSFFDTNVGDGVEAWINLLEEDMEKFEKDEELLKYVSLAPSYK  439



>ref|XP_004301806.1| PREDICTED: vinorine synthase-like [Fragaria vesca subsp. vesca]
Length=423

 Score =   188 bits (477),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 144/453 (32%), Positives = 224/453 (49%), Gaps = 51/453 (11%)
 Frame = -2

Query  1757  ITMKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYD-----SPTISGAC  1593
             +  + EV SK I +P+SPTP  L++Y+ SFLDQ+   + +P + FY+      P I+   
Sbjct  1     MKFEAEVISKHIIKPASPTPDHLRHYQFSFLDQISPPVYSPLLLFYEFNAKIQPNITEIS  60

Query  1592  HHTKTIDElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPE  1413
             +H KT      SL+K LSL YPLAGR K+++  ++C+D GV ++   V   +S +L NP 
Sbjct  61    NHLKT------SLAKVLSLYYPLAGRFKDNQY-VDCNDNGVPYLEVQVNCKLSDVLNNPI  113

Query  1412  MEKIKQLIPSAKVYEPQPVG-KALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIW  1236
               ++ +L+P    +E   V  K  + VQ+N F CGG AI   ++H +AD  +   F + W
Sbjct  114   PGELNKLMP----FELDDVANKYPLGVQLNIFQCGGFAIAQCLTHKLADGLSYFTFSKTW  169

Query  1235  ASFNRGCAANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPA  1056
             A+  RG        F+   S+ LFPP   +         G +      ++ + KRFV  A
Sbjct  170   AATARGEPKIEHPQFI---SATLFPPRNLS---------GFDARTGITRNKVSKRFVFSA  217

Query  1055  NAIAQLRQDLTITGGSVQRPSRVEALTALVWAAVINAT-----PTQTATLSCMVNLRRRM  891
             + I +LR+       +  RPSRVEAL++ + +  + AT     P +   +   VNLR R 
Sbjct  218   SDIEELRE--VQANKASARPSRVEALSSFILSRFVEATKDIGSPDKFYRVVHAVNLRSRF  275

Query  890   EPPLPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGW  711
             EPPLP +  G L   A+        G       E    IR+    + +   RK+      
Sbjct  276   EPPLPHHSFGNLYRVAMTAPLRISSG-------EPFHGIREEISKIDNAYVRKLQKGDEH  328

Query  710   LRAV--IARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVVN--MLDNSWVLFLD  543
             L ++  IA+ +      +  T+  SS CR   Y+ DFGWG+P  V +  +   + V F+D
Sbjct  329   LSSIKTIAKSFA---KGEQVTISFSSYCRFPLYDNDFGWGRPTWVGSPALTFKNLVNFMD  385

Query  542   AI-NGAVEVWMKLPKQVMHTLTQDRHFLAYVSA  447
                 G +E ++ L ++VM     D   LAYVS+
Sbjct  386   TREGGGIEAYISLEEEVMTKFESDVELLAYVSS  418



>ref|XP_006464646.1| PREDICTED: salutaridinol 7-O-acetyltransferase-like [Citrus sinensis]
Length=476

 Score =   189 bits (480),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 144/468 (31%), Positives = 227/468 (49%), Gaps = 42/468 (9%)
 Frame = -2

Query  1751  MKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYD------SPTISGACH  1590
             M+VE+ S+E  +PSSPTP  LK++KL  LDQ   N+  P V +Y       S TI     
Sbjct  17    MEVEIISRESIKPSSPTPHDLKSHKLCLLDQFRSNIYVPRVLYYPLNQDDLSSTIDIDHI  76

Query  1589  HTKTIDElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEM  1410
              +K + +LK+SLS+ L   YPLAG++  +  +++C+DEGV F+ A    +++  L  P+ 
Sbjct  77    VSKRLQQLKQSLSEALVRFYPLAGKLT-NNFSVDCNDEGVYFVEAAAKIHLNEFLIQPDH  135

Query  1409  EKIKQLIP-SAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWA  1233
               I +  P        Q  G  +  VQV  F+CGG+ I   +SHA  D ++ + FM+ WA
Sbjct  136   NLIYKFFPVDGNEQRGQIAGAHVAKVQVTSFACGGLVICACISHAFGDGTSFSSFMKAWA  195

Query  1232  SFNRGCAANNGSGFVSDH--SSILFPPLTDTSAIEQLMKMGAEGIEQ--EEKDMIVKRFV  1065
             +  R   +   + ++  +  +S LFPP  D     QL         +  E    +V+RFV
Sbjct  196   ATARNKTSEEEAIYICPNYDASSLFPP-NDGDLFHQLKATSRASFGRFFETGKFVVRRFV  254

Query  1064  IPANAIAQLRQDLTITGGSVQRPSRVEALTALVWAAVINATPTQTAT-----LSCMVNLR  900
               A A A+L+         VQ P+RVE ++A +  +V+ A  T++ +     LS  VNLR
Sbjct  255   FDAKATAELKA--KAKSSRVQNPTRVEVVSATLSKSVMTAFKTRSGSLKPTLLSHAVNLR  312

Query  899   RRMEPPLPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGE  720
              +  PPL  N +G +V +   LC E +     V    LV ++R+A         + + G 
Sbjct  313   SKARPPLSENLIGNIVWKTNALCTEEE-----VDLDVLVWQLREALSKFDGDFVKSLQGV  367

Query  719   GGWLR-----AVIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVVN-------  576
             GG L+        A  Y   +N+    +  SS C   +Y +DFGWGKP  V         
Sbjct  368   GGLLKLSEDIKCEAEAYSDAKNK----IMFSSWCTFGFYGIDFGWGKPIWVSGACLGGSI  423

Query  575   MLDNSWVLFLDAING-AVEVWMKLPKQVMHTLTQDRHFLAYVSAFPKP  435
             +  +  ++ +D+ +G  +E W+ L ++ M  L  D   L   +  P P
Sbjct  424   VQSSPTIILMDSRSGNGIEAWVLLLEEDMALLEVDEKLLEVATIDPSP  471



>ref|XP_006438135.1| hypothetical protein CICLE_v10031490mg [Citrus clementina]
 gb|ESR51375.1| hypothetical protein CICLE_v10031490mg [Citrus clementina]
Length=458

 Score =   189 bits (479),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 154/466 (33%), Positives = 230/466 (49%), Gaps = 46/466 (10%)
 Frame = -2

Query  1751  MKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFY--DSPTISGACHH---  1587
             MKVE+ SKE  +PSSPTP  LK+YKLS LDQ+        + FY  +        HH   
Sbjct  9     MKVEIISKETIKPSSPTPNHLKDYKLSLLDQIAPPSYETLLLFYSFNGDDDRQHDHHISV  68

Query  1586  ---TKTIDElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENP  1416
                 K   +LK+SLS+TL+  YPLAGRVK D +TI+C D G  ++ A V   +  LL+ P
Sbjct  69    YKANKLSLQLKQSLSETLTRFYPLAGRVK-DNITIDCSDHGAVYVEAQVNCLLQDLLKQP  127

Query  1415  EMEKIKQLIPSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIW  1236
               + + QL+P     E +P    L+ VQ + F+CGG+AIG  +SH IADA+ +  F+  W
Sbjct  128   NGDSVIQLVPIQLAEESKP--GLLLFVQSSFFTCGGVAIGVCISHKIADAATVVTFIRSW  185

Query  1235  ASFNRGCAANNGSG--FVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVI  1062
             A    G AA +     + S ++S LFPP  D +A   L       +  +EK    KRFV 
Sbjct  186   A----GAAAGDHRRVYYPSYNASSLFPP-RDVTATAMLFLNPPFNMAMKEK-CFTKRFVF  239

Query  1061  PANAIAQLRQDLTITGGSVQRPSRVEALTALVWAAVINATPTQT-----ATLSCMVNLRR  897
                 IA L   L+         +R EA+TAL+W   +NA+ + +     + LS  V++R+
Sbjct  240   YGPKIAALEAALSAPS------TRGEAVTALIWKCAVNASRSNSGVSKLSILSRSVDIRK  293

Query  896   RMEPPLPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEG  717
                PPLP N +G LV        E+      +    LV+ +R   +       +K+  E 
Sbjct  294   ITVPPLPDNSVGNLVGYYASQKDESD-----IQLQGLVRELRKGIQDFSKSYLQKLQRED  348

Query  716   GWLRAVIARGYELVR---NRDSSTLYTSSLCRMAYYEVDFGWGKPRLVVNMLDNS-----  561
               L A+     + +    + D      +SLC ++ Y++DFGWG P  V N+  N+     
Sbjct  349   A-LEAITESCKDAIAILISNDVDLYVCNSLCDVSLYDIDFGWGNPTWVTNISSNAANHKN  407

Query  560   WVLFLDAI--NGAVEVWMKLPKQVMHTLTQDRHFLAYVSAFPKPKL  429
              V  +D+   +G++E W+ L +  M    +D   L Y + F  P +
Sbjct  408   LVGLIDSSTGDGSIEAWVTLSEADMALFERDPDLLCYAATFDYPSV  453



>ref|NP_001238226.1| uncharacterized protein LOC100305374 [Glycine max]
 gb|ACS94570.1| unknown [Glycine max]
Length=456

 Score =   188 bits (478),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 133/472 (28%), Positives = 223/472 (47%), Gaps = 51/472 (11%)
 Frame = -2

Query  1757  ITMKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGACH----  1590
             + ++VE+ S+E  RPSSPTP  L+ + LS LD L  +   P + +Y SP     C     
Sbjct  1     MKVEVEIISREDIRPSSPTPSHLRVFNLSLLDHLIPSPYAPIILYYTSPNSDKTCFSEVP  60

Query  1589  ------HTKTIDElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCL  1428
                     K++ E            YPL G++KE   +IEC+DEG  F+ A V   +   
Sbjct  61    KRLELLKKKSLSETLTQ-------FYPLGGKIKELDFSIECNDEGANFVQAKVKCPLDKF  113

Query  1427  LENPEMEKIKQLIPSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKF  1248
             L  P++  + + +P+  V E    G  +  +QVN F CGGIAIG  +SH I D +AL+ F
Sbjct  114   LVQPQLTLLHKFLPTDLVSEGSNSGTYVTNIQVNIFECGGIAIGLCISHRILDGAALSTF  173

Query  1247  MEIWASFNRG--CAANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVK  1074
             ++ W+   +G  C       F+    S LFP   +    +  M+M     +Q +   + K
Sbjct  174   IKGWSERAKGFNCDQLTKPNFI---GSALFPTNNNPWLRDLSMRMWGSFFKQGK--WVTK  228

Query  1073  RFVIPANAIAQLRQDLTITGGSVQRPSRVEALTALVWAAVINATPTQTAT-----LSCMV  909
             RF+   + IA+L+     T  S    +R+E +++++W +++  +  +  T     ++ +V
Sbjct  229   RFLFRNSDIAKLKAQTLGTATS----TRLEIVSSMLWKSLMGVSKVRFGTQRPSLVTHLV  284

Query  908   NLRRRMEPPL-PPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARK  732
             NLRRRM+  L P + +G L+   +V  ++  D    +   +LV ++R +   V +    +
Sbjct  285   NLRRRMDEALCPQHAMGNLL--WLVAAEKMCDDHDEMGLEDLVGKLRKSISQVDEKFVEE  342

Query  731   VYGEGGWLRAVIARGYELVRNRDS-----STLYTSSLCRMAYYEVDFGWGKPRLV-----  582
             + G+ G  R+++      +  + S       +  SS C   YYE DFGWGKP  V     
Sbjct  343   LRGDKG--RSIMKESLGAISEKGSKGEVVDYVGFSSWCNFGYYEADFGWGKPTWVSGVGS  400

Query  581   ---VNMLDNSWVLFLDAINGAVEVWMKLPKQVMHTLTQDRHFLAYVSAFPKP  435
                V+M  N  +L    +   +E W+ L ++ M  L  +   L   +  P P
Sbjct  401   IGSVSMFMNLIILVDTRLGDGIEAWVTLDEEDMTHLEANTELLTCATLDPSP  452



>ref|XP_010100291.1| Salutaridinol 7-O-acetyltransferase [Morus notabilis]
 gb|EXB82425.1| Salutaridinol 7-O-acetyltransferase [Morus notabilis]
Length=434

 Score =   188 bits (477),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 142/458 (31%), Positives = 231/458 (50%), Gaps = 51/458 (11%)
 Frame = -2

Query  1754  TMKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTI----SGACHH  1587
             TMKV++  +EI +PSSPTP  LK +KLSFLDQ+   + T  V FY +  +      + H 
Sbjct  5     TMKVDIIGREIIKPSSPTPSHLKTFKLSFLDQIVPAVYTSLVLFYPNINVLTPDQTSNHL  64

Query  1586  TKTIDElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEME  1407
              K++ E        L+L YPLAGRVK++ V IEC D+G +++ A     +S  L+    +
Sbjct  65    KKSLSE-------ALTLFYPLAGRVKDNTV-IECHDDGAQYVEAKFNCLLSIFLDQQHKD  116

Query  1406  K--IKQLIPSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWA  1233
             +  I++ +P+A +  P+     L+ VQ   F CGG+A+G  VSH +ADA+ L+ F++ WA
Sbjct  117   EALIRRFLPAA-MESPEAGTWPLLIVQATFFDCGGVAVGVCVSHKLADAATLSVFLKTWA  175

Query  1232  SFNRGCAANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPAN  1053
               N        + +     +  F P                 +E +  + + KR V   +
Sbjct  176   --NTAVPDFEAASYYLPRDTFSFAP--------------PAALELKRVEGVSKRCVFDKS  219

Query  1052  AIAQLRQDLTITGGSVQRPSRVEALTALVWAAVINATPTQTAT-----LSCMVNLRRRME  888
              IA L+  L     SV++P++VE +TAL+W  ++ A+ +   T     ++  V++R+R+E
Sbjct  220   TIAALKAKL--VSDSVKQPTKVEVVTALLWRCLMAASSSAQVTPRYSLVTQSVDMRKRVE  277

Query  887   PPLPPNCLGTLVDE-AIVLCQEAKDGGTVVTAVE---LVQRIRDAFRAVKDGEARKVYGE  720
             PP   N  G LV   A+ +     +G T     +   LV ++R   +   + +A++  G+
Sbjct  278   PPFSQNSAGNLVSYFALQVENNIYEGSTEPLECQLQGLVAKLRQGIKDFTERKAKRFRGD  337

Query  719   GGWLRAVIAR---GYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVV---NMLDNSW  558
              G L+AV+     G +LV   D    + +S C   +YEVD G+GKP  V    N  +N  
Sbjct  338   EG-LQAVVEHFMEGRKLVTRDDVCYFFCTSWCNFQFYEVDVGFGKPVYVTVPSNTYEN-M  395

Query  557   VLFLDAING-AVEVWMKLPKQVMHTLTQDRHFLAYVSA  447
             +LF+D  +G  VEV   L K+ +         L+  S+
Sbjct  396   ILFMDTRDGDGVEVIFTLSKENVALFENQLEILSLASS  433



>gb|KEH20541.1| 3'-N-debenzoyl-2'-deoxytaxol benzoyltransferase [Medicago truncatula]
Length=436

 Score =   187 bits (476),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 139/450 (31%), Positives = 227/450 (50%), Gaps = 30/450 (7%)
 Frame = -2

Query  1751  MKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGACHHTKTID  1572
             M++E+ S+E  +PSSPTP  L+N+ +SF+D +      P +FFYD    +  C  T  I 
Sbjct  1     MEMEIISREFIKPSSPTPSHLRNFPISFIDHISFRNYVPLLFFYDD---TKVCDQTSKIS  57

Query  1571  ElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVA-ENMSCLLENPEMEKIKQ  1395
              LK SLS+ LS+ YP AGR K D+++IEC+D+G  F+VA++A   +S +L+NP    +  
Sbjct  58    HLKNSLSQILSIYYPFAGRFK-DQLSIECNDQGASFLVANIAGTKLSTILKNPTENLLNP  116

Query  1394  LIPSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGC  1215
             L P    ++      +++ +Q+N F+CGGI I     H I DA+    FM  WA  N   
Sbjct  117   LFPDELQWKNMDCNGSILVIQINCFACGGIIISVCACHKIVDAATAFNFMNDWAKLNSEG  176

Query  1214  AANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQLR  1035
              +N+ S  +S   ++L+    DT   +  +    E     +K ++ KRFV  A+ +  L+
Sbjct  177   ESNSKST-LSLPYNLLYA--GDTIFSQGSLPNFPECEFVIDKTIVSKRFVFEASKVKLLK  233

Query  1034  QDLTITGGS-VQRPSRVEALTALVWAAVINATPT--QTATLSCMVNLRRRMEPPLPPNCL  864
               +  +  + V+ P+RVE +TA+++  V++A     +T +L   V+LRRRM PPL    +
Sbjct  234   SMMVNSDSNEVKNPTRVEVVTAMIYKCVVSALELNFKTTSLRMAVDLRRRMVPPLSDKSV  293

Query  863   GTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLRAVIARGY  684
             G +V    ++  E  D         LV +IR       +   +K  G+   L  +     
Sbjct  294   GNIVWFLFLINPELHD---------LVFKIRQGLHEFCEVYPKKFGGKEKDLSFIFECLK  344

Query  683   ELV-----RNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVVNM---LDNSWVLFLDAING-  531
             ++       + + S +  +S C+   YE DFGWGKP  V      + N+ VL +D  NG 
Sbjct  345   QVTTPVSESDYNQSLIVYASWCKFPMYEADFGWGKPIWVTTSTCPVKNAIVL-MDTRNGD  403

Query  530   AVEVWMKLPKQVMHTLTQDRHFLAYVSAFP  441
              +E  + + +  M    ++   L Y S  P
Sbjct  404   GIEAIVNMKESDMVRFEREVELLQYASLNP  433



>ref|XP_011083978.1| PREDICTED: vinorine synthase-like [Sesamum indicum]
Length=435

 Score =   187 bits (475),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 134/448 (30%), Positives = 220/448 (49%), Gaps = 27/448 (6%)
 Frame = -2

Query  1751  MKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGACHHTKTID  1572
             MK++  S ++ RPSSPTP  L+++ LSF+DQ       P V +Y+  T     +    + 
Sbjct  1     MKIKTASTQLIRPSSPTPPQLRHFNLSFIDQRIPPSYVPLVLYYNVSTEERYINKQPEMS  60

Query  1571  ElkkslsktlsLM-YPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEMEKIKQ  1395
                KS      ++ YPLAGR+ E +  ++C+DEG+ +I A     +S ++ +P+   +  
Sbjct  61    RRLKSSMSDALVLFYPLAGRILEGQPLVDCNDEGILYIEATADGKISDIVRSPDTRTLDN  120

Query  1394  LIPSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGC  1215
             LIP  K        + L+AVQ   F+CGGI+IG  +SH+IADA++L+ F+  WA+   G 
Sbjct  121   LIP-FKSNGSISNAEELLAVQATLFNCGGISIGICISHSIADAASLSSFINCWAAIAAGE  179

Query  1214  AANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQLR  1035
               N  S     +S+  FPPL           +    I+    +++++R +   +AI  L+
Sbjct  180   QPNVVSPVF--NSATFFPPLNTPDFRPNFRNL---AIQAPPVNLVMERLLFTPSAIDALK  234

Query  1034  QDLTITGGSVQRPSRVEALTALVWAAVINATPTQTATLSCM---VNLRRRMEPPLPPNCL  864
             Q +     S+ +P+RVE +TA +W+  + A   + +  S     VNLR R+ P L     
Sbjct  235   QKVAENKSSIVKPTRVEVVTAFLWSRCLVAKGLELSHKSVAFHPVNLRGRV-PGLTERSF  293

Query  863   GTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLRAVIARGY  684
             G +      +      G T  T   LV+++R AF  +     + + GE G    V    +
Sbjct  294   GNIFQ----MTHAEVVGETNWTG--LVEKLRAAFGKIDSEYVKMLLGEKGC--EVAKENF  345

Query  683   ELVRN----RDSSTLYTSSLCRMAYYEVDFGWGKPRLV--VNMLDNSWVLFLDAI--NGA  528
             + + +     + + L  SS CR   YEVDFGWGKP  V   +      ++  D++   G 
Sbjct  346   QGISSFLTLGNVAVLLFSSYCRFPIYEVDFGWGKPAWVSSASFSIKDMIMLFDSVVSRGG  405

Query  527   VEVWMKLPKQVMHTLTQDRHFLAYVSAF  444
             +EVW+ + +Q M  L QD     + S+F
Sbjct  406   IEVWIVMAEQEMDRLRQDSDIQHFTSSF  433



>ref|XP_008372855.1| PREDICTED: BAHD acyltransferase At5g47980-like [Malus domestica]
Length=465

 Score =   188 bits (477),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 138/460 (30%), Positives = 215/460 (47%), Gaps = 50/460 (11%)
 Frame = -2

Query  1751  MKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFY---DSPTISGACHHTK  1581
             MK++V  K+  +PS PTP  L+N  LS  DQL  ++  P + FY   ++    G   H+ 
Sbjct  30    MKIQVIYKDTIKPSLPTPHHLRNLSLSVFDQLFPDIYVPLLLFYPNDNNKYFEG--KHSL  87

Query  1580  TIDElkkslsktlsLM---YPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEM  1410
               +  K         +   YP AG  + +  +I C+D G  ++ A V   MS +L  PE+
Sbjct  88    VAERSKLLKKSLSEALTRFYPYAGNFQHN-ASICCNDHGAAYVEARVNCPMSKILNKPEL  146

Query  1409  EKIKQLIPSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWAS  1230
               +KQL+P+      +  G  L+ V+ N F CGG+AIG   SH +ADA  L+KF   WA+
Sbjct  147   MILKQLLPTVLDSSQEDTG-YLLLVKANFFECGGLAIGVGSSHKVADAYTLSKFTSCWAA  205

Query  1229  FNRGCAANNGSGFVSDH---------SSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIV  1077
               R      GS  ++DH         ++ LFP +   ++++         +E  ++  I 
Sbjct  206   IAR------GSNTITDHIELPDKFGVAASLFPQVDFLNSLQP-------ALEFSQEKCIT  252

Query  1076  KRFVIPANAIAQLRQDLTITGGSVQRPSRVEALTALVWAAVINATPT-----QTATLSCM  912
             KRFV  A+ IA L+        +V+ P+RVE ++AL+W   + A+ +     + + LS  
Sbjct  253   KRFVFXASKIAALKS--KAGSATVENPTRVEVVSALIWKCAMEASRSNLGVVRPSELSQF  310

Query  911   VNLRRRMEPPLPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARK  732
             VN+R+ +  PL  N LG LV     LC    +   V     LV + R      K    + 
Sbjct  311   VNIRKILVSPLAENLLGNLVG----LCVAKTEASEVDDVQSLVTKFRKEMEEFKVXYGKG  366

Query  731   VYGEGGWLRAVIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLV--VNMLDNSW  558
             + GE         + Y  +  RD       S CR  +YE DFGWGKP  V  +  L N  
Sbjct  367   ISGEEA---CEFYKEYGHLMKRDVDNYNCXSWCRFPFYEADFGWGKPLWVPHIGGLKN-L  422

Query  557   VLFLDAING-AVEVWMKLPKQVMHTLTQDRHFLAYVSAFP  441
             +L +D  +G  +E  + L ++ M     ++  L+Y S  P
Sbjct  423   ILLMDTRDGEGIEASLTLKEEDMAKFESNKELLSYASVNP  462



>ref|XP_010064604.1| PREDICTED: vinorine synthase-like [Eucalyptus grandis]
 gb|KCW68077.1| hypothetical protein EUGRSUZ_F01762 [Eucalyptus grandis]
Length=449

 Score =   187 bits (476),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 147/457 (32%), Positives = 227/457 (50%), Gaps = 35/457 (8%)
 Frame = -2

Query  1751  MKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYD-SPTISGACHHTKTI  1575
             M+V V S+E  +P SPTP  LK +KLS LDQ    L  P V FY        A   ++ I
Sbjct  1     MEVVVVSREFVKPYSPTPNHLKIHKLSLLDQFVPTLYVPLVLFYTIEEADRAATTPSRMI  60

Query  1574  DElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEMEKIKQ  1395
               LK+SLS+TL L YPLAG++  D ++IECDDEGV  + A     +S LL  P+ E +++
Sbjct  61    QLLKQSLSETLPLFYPLAGKINGDGLSIECDDEGVLLVEARAEFALSRLLHRPDFETVRK  120

Query  1394  LIPSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGC  1215
              +P A  +    VG  +  +Q   F CGG+ +G  +SHA AD ++ A F++ WA+  R  
Sbjct  121   FLPCAAAWRRVEVGDRVAMIQATAFPCGGVVVGVLISHAAADGASFATFLKGWAAAARKT  180

Query  1214  AANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQLR  1035
                    F    +S LF  + + +  E+    G   + +       +R V  A+ +A+L+
Sbjct  181   GEAPRPSF---DASTLF--IQNKAFSEEDTFFGVCPVNRGRYG--TRRLVFDASTMARLK  233

Query  1034  QDLTITGGSVQRPSRVEALTALVWAAVINATPTQTATL------SCMVNLRRRMEPPLPP  873
              +    G  VQ P+R E +TAL+  + + AT T+ + L      +  VNLRRR  P    
Sbjct  234   AEAANVG--VQNPTRAEVVTALICKS-LTATMTKVSGLDKPVVFTNAVNLRRRAVPNFHD  290

Query  872   NCLGTLVDEAIVLCQ-EAKDGGTVVTAVELVQRIRDAFRAVKDGE-ARKVYGEGGW--LR  705
             + +G  V     LC  E KD   + +   L+  +R+A ++  DGE  R + G+GG+  L+
Sbjct  291   DSMGNYVWLPTFLCPLEEKDYDGLPS---LIGWLREA-KSKIDGEFVRGLEGDGGFNALQ  346

Query  704   AVIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVV---------NMLDNSWVL  552
               +    E +   D    + SS C   +YE+DFGWG+P  V          N++ N+ +L
Sbjct  347   DALGEMREFLARTDRLVTF-SSWCNFGHYEIDFGWGRPAWVSPVGFPEESGNLIVNTVLL  405

Query  551   FLDAINGAVEVWMKLPKQVMHTLTQDRHFLAYVSAFP  441
                     +E W+ + +Q +  L Q+     Y S  P
Sbjct  406   LDTRCRKGIEAWVFIDEQELEVLEQNEELTEYASINP  442



>ref|XP_009759141.1| PREDICTED: salutaridinol 7-O-acetyltransferase-like [Nicotiana 
sylvestris]
 gb|AHM22936.1| vinorine synthase [Nicotiana tabacum]
Length=435

 Score =   187 bits (475),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 145/458 (32%), Positives = 241/458 (53%), Gaps = 53/458 (12%)
 Frame = -2

Query  1751  MKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYD-SPTI--SGACHHTK  1581
             MK+E   +E  +PSSPTP   +N+K+SF+D++  +   P + FY+ + TI  S  C H K
Sbjct  1     MKIEKLCEEHIKPSSPTPLKHRNHKISFIDEIIPHSSIPLILFYNKNETIPQSEICSHLK  60

Query  1580  TIDElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCL--LENPEME  1407
             T      SLS+ L+  YPLAGR+   + +I+C+D+GV +  A+V  N+S L  ++NP+  
Sbjct  61    T------SLSQILTQFYPLAGRM-SSQYSIDCNDQGVYY--AEVQVNVSLLDIIKNPKSN  111

Query  1406  KIKQLIPSAKVYEPQPV---GKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIW  1236
             ++ QL P    Y         + L+A+QVN F+CGGIAI   +SH I DAS+L  F++ W
Sbjct  112   ELVQLTP----YNSDGTISNFQELLAIQVNLFTCGGIAISISISHKIGDASSLCTFIKNW  167

Query  1235  ASFNRGCAAN----NGSGFVSDHSSILFPP---LTDTSAIEQLMKMGAEGIEQEEKDMIV  1077
              + +    +N    N S F+S  S   FPP   + ++ + E+ +      I+   + ++V
Sbjct  168   CNTSEELRSNKKVINDSIFISLSS--FFPPREIVHNSMSSEKCV-----AIQPVVEKLVV  220

Query  1076  KRFVIPANAIAQLRQDLTITGGSVQRPSRVEALTALVWAAVINATPTQTATLSCMVNLRR  897
             KRF+  A+ I +++  +  +G + +R +RVE +TAL+W   + A    +  +   VN+R+
Sbjct  221   KRFIFTASNIVKMKTKVINSGYNKERVTRVEVITALLWKCFMAAKGCNSIAI-LPVNIRK  279

Query  896   RMEPPLPPNCLGT--LVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYG  723
             ++ PPLP N  G   LV  AI        G        LV +I++    +    A K+ G
Sbjct  280   KIVPPLPENSFGNFFLVSSAI--------GNVENEWFSLVGKIKNVIERIDGNYAEKIRG  331

Query  722   EGG--WLRAVIARGYELV-RNRDSSTLYTSSLCRMAYYEVDFGWGKPRL-VVNMLD-NSW  558
             E G  ++++   +  EL+ +  D   L   S C      V+FGWG+  L +V +L     
Sbjct  332   ENGFEFVKSNFNQVGELLSQGDDIKVLRIGSWCNFPINGVNFGWGESILAIVAILGIKDH  391

Query  557   VLFLDAI--NGAVEVWMKLPKQVMHTLTQDRHFLAYVS  450
             ++ LD++  +G +E W+ +  Q M    QD+    + S
Sbjct  392   IVLLDSLKYSGGIEAWVVMSDQEMELFEQDKELQDFTS  429



>ref|XP_010025365.1| PREDICTED: vinorine synthase-like [Eucalyptus grandis]
 gb|KCW62008.1| hypothetical protein EUGRSUZ_H04687 [Eucalyptus grandis]
Length=436

 Score =   187 bits (475),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 147/462 (32%), Positives = 234/462 (51%), Gaps = 50/462 (11%)
 Frame = -2

Query  1751  MKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGACHHTKTID  1572
             M V V   E  +PSSPTP  L+ + LSFLDQ+   +  P + F+    +     + + + 
Sbjct  1     MNVIVEHTETIKPSSPTPPNLRRHGLSFLDQISPPIFMPLLLFFPKDDL---LTNEEKLS  57

Query  1571  ElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEMEKIKQL  1392
             +L++SL++TL+  YPLAGR + D + +EC+D+GV F VA     +S +LE+P+ EK+ +L
Sbjct  58    KLRRSLAETLTRFYPLAGRSR-DNLYVECNDDGVPFAVARATCQLSEVLESPDPEKLDRL  116

Query  1391  IPSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGCA  1212
             +P  K+Y+   +G    AVQV+ F CGG+ +   +SH +ADA +   F+  WA+  RG  
Sbjct  117   LP-FKLYD---LGDLTTAVQVSFFECGGLCLALCLSHKLADALSFFSFLNSWAAITRG--  170

Query  1211  ANNGSGFVSD--HSSILFPP--LTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIA  1044
               +G   +S    SS LFPP  L   +    L+K G          ++ KRFV  A +I 
Sbjct  171   --DGGHIISPIFESSSLFPPVNLVGYAPSTGLLKEG----------LVTKRFVFDARSIT  218

Query  1043  QLRQ-----DLTITGGSVQRPSRVEALTALVWAAVINATPTQTATLS---------CMVN  906
              LR      ++    G  +RP+RVEAL+A +W   + +T  +   +S           VN
Sbjct  219   TLRDKYSTAEIAEAEGQRRRPTRVEALSAFLWRRYMESTQKKGDRISENDKIYTVLHAVN  278

Query  905   LRRRMEPPLPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVY  726
             LR RM+PPL     G +    I L +   D    +    +V ++R+A + V     +K+ 
Sbjct  279   LRPRMDPPLSDRHFGNI--SRIALTRPTVDTDEHM----IVNQVREAIKEVDTSYVKKLK  332

Query  725   GEGGWLRAVIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVVN--MLDNSWVL  552
                G L  +  R  ++ +       +T SLCR    E DFGWGKP  V +      + ++
Sbjct  333   EGEGHLNFLKERSSQITKGEIVPFSFT-SLCRFPTNEADFGWGKPAWVGSSAFPFRNLIV  391

Query  551   FLDAIN-GAVEVWMKLPKQVMHTLTQDRHFLAYVSAFPKPKL  429
             FLD  + G +E +  L  + M    +D+  L++ S+   PK+
Sbjct  392   FLDTRDGGGIEAYANLKPEDMALFEKDKELLSFASSSASPKV  433



>ref|XP_010061156.1| PREDICTED: vinorine synthase-like [Eucalyptus grandis]
 gb|KCW68074.1| hypothetical protein EUGRSUZ_F01758 [Eucalyptus grandis]
Length=449

 Score =   187 bits (475),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 151/460 (33%), Positives = 228/460 (50%), Gaps = 41/460 (9%)
 Frame = -2

Query  1751  MKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGACHHTKT--  1578
             M+V V SKE  +P SPTP  LK +KLS LDQ       P V FY   TI  A     T  
Sbjct  1     MEVVVVSKEFVKPYSPTPNHLKIHKLSLLDQFMPTAYVPLVLFY---TIEEADRAATTPL  57

Query  1577  --IDElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEMEK  1404
               +  LK+SLS+TL L YPLAG++  D ++IECDDEGV F+ A     +S LL  P+ + 
Sbjct  58    RMVQLLKQSLSETLPLFYPLAGKINGDGLSIECDDEGVLFVEARAEFALSRLLHQPDFKT  117

Query  1403  IKQLIPSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFN  1224
             +++ +P A  +    VG  +  VQV  F CGG+ +G  +SH  AD ++ A F++ WA+  
Sbjct  118   VRKFLPCAAAWRRTEVGDRVAMVQVTAFPCGGVVVGVLISHTAADGASFATFLKGWAAAA  177

Query  1223  RGCAANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIA  1044
             R         F    +  LF  + + +  E+    G   + +       +R V  A+A+A
Sbjct  178   RKTGEAPHPSF---DAPTLF--IQNKAFSEEDTFFGMCPVNRGRYG--TRRLVFDASAMA  230

Query  1043  QLRQDLTITGGSVQRPSRVEALTALVWAAVINATPTQTATLS------CMVNLRRRMEPP  882
             +L+      G  VQ P+R E +TAL+  + + AT T+ + L         VNLRRR  P 
Sbjct  231   RLKAKTANVG--VQNPTRTEVVTALMCKS-LTATMTKVSGLDKPVVFPNAVNLRRRAVPN  287

Query  881   LPPNCLGTLVDEAIVLCQ-EAKDGGTVVTAVELVQRIRDAFRAVKDGE-ARKVYGEGGW-  711
                + +G  V    +LCQ E KD   + +   L+  +R+A ++  DGE  + + G+GG+ 
Sbjct  288   FHDDSMGNYVWLPTILCQLEEKDYDGLPS---LIGWLREA-KSKIDGEFVKSLEGDGGFN  343

Query  710   -LRAVIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVV---------NMLDNS  561
              L+  +    E +   D    + SS C   +YE+DFGWG+P  V          N++ N+
Sbjct  344   ALQDALRETRESLARTDRLVSF-SSWCNFGHYEIDFGWGRPAWVSPVGFPEESENLIGNT  402

Query  560   WVLFLDAINGAVEVWMKLPKQVMHTLTQDRHFLAYVSAFP  441
              +L        VE W+ + ++ +  L QD     Y S  P
Sbjct  403   VLLMDTRCRKGVEAWVFMDERELEVLEQDEELTEYASINP  442



>ref|XP_002314550.2| hypothetical protein POPTR_0010s06640g [Populus trichocarpa]
 gb|EEF00721.2| hypothetical protein POPTR_0010s06640g [Populus trichocarpa]
Length=441

 Score =   187 bits (475),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 140/457 (31%), Positives = 224/457 (49%), Gaps = 38/457 (8%)
 Frame = -2

Query  1760  QITMKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGACHHTK  1581
              + M++E+  +E  +PSSPTP  L++ KLS LDQ       P   FY  P       H  
Sbjct  2     SVPMRIEIMQRETIKPSSPTPLHLRSLKLSLLDQFMPVGHIPLQLFY--PRNGNDTDHLA  59

Query  1580  TIDElk----kslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPE  1413
                E       SLS+ L+  YP AGR+K D  +IECDD G E+I A +   +S +L+ P+
Sbjct  60    KATERSLLLKTSLSEALTHFYPFAGRLK-DNSSIECDDHGAEYIEARIHCILSDILKKPD  118

Query  1412  MEKIKQLIPSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWA  1233
              E +KQL+P+A V EP     + + VQ + F CGG+AIG  +SH +ADA+ L  F++ WA
Sbjct  119   TEVLKQLMPAA-VSEPATARDSQLIVQASFFDCGGLAIGVNLSHKVADAATLTSFIKCWA  177

Query  1232  SFNRGCAANNGSGFVSDHSSILFPPLTDTSAIEQL-MKMGAEGIEQEEKDMIVKRFVIPA  1056
             +  R           S    ++ P     S   Q+ + +    ++  + + ++KRFV  A
Sbjct  178   ATARR----------SSTEVVISPVFMGASIFPQMDLPISMLPVDLIQGESVMKRFVFEA  227

Query  1055  NAIAQLRQDLTITGGSVQRPSRVEALTALVWAAVINATPT-----QTATLSCMVNLRRRM  891
               I  L+        SV  P+RVE++TAL+W   ++A+ +     + A LS  VN+R+R+
Sbjct  228   PKITALKA--KAISASVPDPTRVESVTALIWKCAMSASRSNLGVPRKAVLSLGVNIRKRL  285

Query  890   EPPLPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGW  711
              P LP N  G  V       ++  D    +    +V RIR       +  A+   G+   
Sbjct  286   VPTLPDNYGGNYVGSISARIEDHDD----LELQGIVSRIRKDLIEFGENYAKITQGDDTS  341

Query  710   L---RAVIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVVNMLD---NSWVLF  549
             L   +AV   G ++  ++D  +   +S CR   Y+ DFGWGKP  + N+      + +  
Sbjct  342   LAICKAVEEFG-KMAMSKDIDSYNGTSWCRFELYDADFGWGKPTWLSNVFTIELKNIMCL  400

Query  548   LDAING-AVEVWMKLPKQVMHTLTQDRHFLAYVSAFP  441
             +D  +G  +E  + L ++ M     ++  L + +A P
Sbjct  401   MDTRDGDGIEACISLSREDMALFESNKELLEFAAANP  437



>ref|XP_011029622.1| PREDICTED: BAHD acyltransferase At5g47980 [Populus euphratica]
Length=439

 Score =   187 bits (474),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 143/450 (32%), Positives = 223/450 (50%), Gaps = 36/450 (8%)
 Frame = -2

Query  1751  MKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGACHHTKTID  1572
             M VE+ ++E  +PSSPTP  L+ + L FLDQL      P +  Y S        H    +
Sbjct  1     MAVEIITREAVKPSSPTPDHLREFNLCFLDQLPPVANEPLLLVYSSFQQKFTVAHKS--E  58

Query  1571  ElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEMEKIKQL  1392
              LK+SLS+TLS  YPLAGR+K+D  +IEC+D G  F+ A V   +S  LE P+ E I++ 
Sbjct  59    RLKRSLSETLSRFYPLAGRIKDD-ASIECNDFGAVFVEARVNCLLSKFLEKPDAEVIRKF  117

Query  1391  IPSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGCA  1212
             IP+  +  P+ +  +LV VQ N F+CGG+AIG  +SH +AD    + F++ WA+      
Sbjct  118   IPTG-IESPEELTGSLVLVQANFFACGGLAIGVCISHMVADPVTFSTFVKAWAA------  170

Query  1211  ANNGSGFVSDHSSILFPPLTDTSAI---EQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQ  1041
                 + F S  S+IL  PL +  ++   + +       +E      + KR V  A+ +A 
Sbjct  171   ----AAFHSGDSTIL--PLFNAPSVFPPQNISLSKPAALEVMRDRCVTKRVVFDASKVAA  224

Query  1040  LRQDLTITGGSVQRPSRVEALTALVWAAVINATPTQT-----ATLSCMVNLRRRMEPPLP  876
             L+  +     SV  P+RVEA+TAL+W   +NA  + +     + LS  VNLR +M PPLP
Sbjct  225   LQ--VKAVCESVTCPTRVEAVTALIWKCAMNAARSNSEHLRYSILSQSVNLRNKMVPPLP  282

Query  875   PNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLRAV-  699
              + +G L         E +     V    L +++R   +   +   +K+  +   +    
Sbjct  283   EHTIGNLAGYFASCATECE-----VELQSLARQLRKGLQDFGENYLKKLGKDKASMAICE  337

Query  698   -IARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVV--NMLDNSWVLFLDAING-  531
                    ++   +     ++S CR+ +Y +DFGWGKP  V        +    +DA +G 
Sbjct  338   PFQEAASMLPEGNVDFYVSTSFCRLPFYGIDFGWGKPTWVTIPTGAYKNVASIMDAKDGK  397

Query  530   AVEVWMKLPKQVMHTLTQDRHFLAYVSAFP  441
              +E W+ L +  M    +DR  LA  S  P
Sbjct  398   GIEAWVTLTEDDMAFFERDRELLAAASFDP  427



>ref|XP_008392421.1| PREDICTED: salutaridinol 7-O-acetyltransferase-like [Malus domestica]
Length=455

 Score =   187 bits (475),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 147/460 (32%), Positives = 234/460 (51%), Gaps = 41/460 (9%)
 Frame = -2

Query  1751  MKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHL-NLMTPFVFFYDSPTISGAC------  1593
             MKVE+ S++  RPSSPTP   KN+KLS LDQ H  NL    +FFY S +           
Sbjct  5     MKVEIISRKTIRPSSPTPHHHKNFKLSLLDQRHSPNLYGNMIFFYSSTSNYDHTYGDFNP  64

Query  1592  HHTKTIDElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPE  1413
             H  K    L+KSLSKTL   YPLAGR+K D  TIEC+D+GV F+ A +  ++   L  P+
Sbjct  65    HALKMSSHLQKSLSKTLVHFYPLAGRLK-DAATIECNDQGVYFVEARMDCHLLNFLSQPD  123

Query  1412  MEKIKQLIPSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWA  1233
                 +  IP++   +   +   ++ VQ+  F+CGGIAI   + H IADAS+L  F++ W 
Sbjct  124   STLFQHFIPTSSAEKEDVI---VLLVQLTVFNCGGIAIAVSLLHKIADASSLCTFVQSWT  180

Query  1232  SFNRGCAANNGSGFVSDHSSI--LFPPLTDTSAI--EQLMKMGAEGIEQEEKDMIVKRFV  1065
             +      A + S F+     +  + P    +S +   +++      I    ++   +RFV
Sbjct  181   A---ASTALDQSEFIGHDQRLGQVLPLFIGSSLLPPSEMLITRTLDIPDPHQNFTTRRFV  237

Query  1064  IPANAIAQLRQDLTITGGSVQRPSRVEALTALVWAAVINATP------TQTATLSCMVNL  903
                + +A L+    IT      P+ VE ++A+V    I A        ++ + L   +NL
Sbjct  238   FSTSKMASLKAKAAIT---TNNPTNVELVSAVVVKCAIAAAQSISTSSSRPSVLFHAMNL  294

Query  902   RRRMEPPLPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYG  723
             R+RM  PLP N +G LV    VL +E+      +   E+V ++R       + +A +  G
Sbjct  295   RKRMVSPLPXNTVGNLVWAFPVLIEESD-----IKLHEVVVKLRKGLTDFCNDKANRFKG  349

Query  722   EGGWLRAVIARGY----ELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLV-VNMLDNSW  558
             E G+  AV++  +    E + +R  +    +SLC+   Y++DFGWGKP  V  +M   ++
Sbjct  350   EDGF--AVVSEYHTKEVEFI-SRGVNIFRCTSLCKFPIYDMDFGWGKPTWVATSMGFKNF  406

Query  557   VLFLDAINGA-VEVWMKLPKQVMHTLTQDRHFLAYVSAFP  441
             ++ +D+  G  +E W+ L +Q M    +D   L++ S  P
Sbjct  407   IVLIDSKLGENIEAWVTLAEQEMAIFQRDEMLLSFASLNP  446



>ref|XP_002530172.1| Anthranilate N-benzoyltransferase protein, putative [Ricinus 
communis]
 gb|EEF32227.1| Anthranilate N-benzoyltransferase protein, putative [Ricinus 
communis]
Length=460

 Score =   187 bits (475),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 149/483 (31%), Positives = 235/483 (49%), Gaps = 67/483 (14%)
 Frame = -2

Query  1757  ITMKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGACHH---  1587
             + M++++ SK   +PS PTP  L+ YK+S LDQ    + TP + FY +  I+        
Sbjct  1     MKMEIDILSKGCIKPSVPTPSDLRTYKISLLDQFMPLVYTPMILFYSNQDINPVKDDDDD  60

Query  1586  ---TKTIDElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENP  1416
                +K +  L++SLS+TL+  +PLAG++K+D  +I+C DEG  F+ A     +S  L+ P
Sbjct  61    DIISKRLLLLQQSLSQTLTRFHPLAGKIKDD-FSIDCSDEGAFFVAARTKIALSDYLQQP  119

Query  1415  EMEKIKQLIPSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIW  1236
             ++  + +L+PS    EP   G  +  +Q   F+CGGIAIG +V H + D S LA F++ W
Sbjct  120   DLNSLYKLLPSTD--EPTS-GSYVSMIQETIFACGGIAIGVYVLHTVMDGSGLASFLKAW  176

Query  1235  ASF------NRGCAANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVK  1074
             A+        + C  N       D +S +FP          +M  G+    ++   +  +
Sbjct  177   AAIACDEQSTKACYPN------FDGTS-MFPQYGAFPRDANVMAYGSH--FRKRGKITRR  227

Query  1073  RFVIPANAIAQLRQDLTITGGSVQRPSRVEALTALVWAAVINATPTQTA-----TLSCMV  909
             RFV    AIA L +      G  + P+RVE ++AL+   ++     ++       ++  V
Sbjct  228   RFVFDGPAIANLMEKARAETGVPENPTRVEVVSALLIKHMMAIFKAKSGVDKPLAINHAV  287

Query  908   NLRRRMEPPLPPNCLGTLVDEAIVLCQ--EAKDGGTVVTAVELVQRIRDAF-RAVKDGEA  738
             N+RRRM PP+P   +G  V  A  +C+  E +    V    E + +I   F R +K G+ 
Sbjct  288   NMRRRMVPPIPECSVGNFVWPAATICKPNETQLSSLVYQLKEAIMKINSDFVRNIKGGD-  346

Query  737   RKVYGEGGWLRAVIARGYELVRNRDS---STLYT--------SSLCRMAYYEVDFGWGKP  591
                   GG+++      YEL +   S   S L++        SS C    Y+VDFGWGKP
Sbjct  347   -----HGGFIKL-----YELKKEAASSFTSPLFSNGVDYVLFSSWCNFGLYQVDFGWGKP  396

Query  590   -----------RLVVNMLDNSWVLFLDAINGAVEVWMKLPKQVMHTLTQDRHFLAYVSAF  444
                         L +  L NS VL     N  +E WM L + +M  L +D++F+ Y S  
Sbjct  397   VWTTTARYSNGDLEIPFL-NSIVLMDARKNKGIEAWMVLDEDIMVMLDKDKNFIQYASPN  455

Query  443   PKP  435
             P P
Sbjct  456   PSP  458



>ref|XP_008226164.1| PREDICTED: vinorine synthase-like [Prunus mume]
Length=486

 Score =   187 bits (476),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 154/445 (35%), Positives = 224/445 (50%), Gaps = 38/445 (9%)
 Frame = -2

Query  1757  ITMKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGACHHTKT  1578
             + ++VEV S+EI +PSSPTP  L++YKLSFLDQL     T  VFFY+    +G  H    
Sbjct  1     MNVQVEVISREIIKPSSPTPNPLRHYKLSFLDQLTPPSYTSLVFFYE---FNGETH--PA  55

Query  1577  IDElkkslsktl----sLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSC-LLENPE  1413
             I+E+ K L K+L    +L YPLAGRVK     ++C+DEG+ ++ A V     C  L NP 
Sbjct  56    INEVSKKLKKSLAKVLTLFYPLAGRVKIKDHFVDCNDEGIAYLEAQVTNCRLCDFLNNPL  115

Query  1412  MEKIKQLIPSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWA  1233
              +++ + IP A+  +     +  + VQ+N F  GG AIG   SH +AD   +  F + WA
Sbjct  116   PDELNKFIPFAQ--DEHIANEIALGVQLNMFE-GGFAIGLCTSHKLADLLCMLMFTKTWA  172

Query  1232  SFNRGCAANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPAN  1053
             +  R         FV   S+ LFPP   TS        GA GI  ++   + KRFV  A+
Sbjct  173   AIARDEVEIQRPQFV---SATLFPPKGITS-----YNWGA-GIATKK---VTKRFVFDAS  220

Query  1052  AIAQLRQDLTITGGSVQRPSRVEALTALVWAAVINATPTQTA------TLSCMVNLRRRM  891
              I  LR   T    S ++PS VEAL+A +W   + AT    A      +L   V+LR  +
Sbjct  221   TIEDLRAKYTGLQNSEKQPSPVEALSAFMWRRFVGATKDDHADENKLHSLIHSVDLRPLI  280

Query  890   EPPLPPNCLGTLVDEAIV---LCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGE  720
             +PPL P   G +   ++    L     D G   ++  +V+R+R+A   + D +  K    
Sbjct  281   DPPLSPYSFGNIYGNSLTAPFLSSGDDDDGDQESSYGMVRRVREAISKI-DKDFVKRLQH  339

Query  719   GGWLRAVIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVV--NMLDNSWVLFL  546
             G    ++I R  +     +  T Y SSLC+   Y+ DFGWG+P  V    +     ++FL
Sbjct  340   GDEQLSLIGRLAQSASKGEVVTSYHSSLCQFPLYDHDFGWGRPIWVSLPPLPVKDIIVFL  399

Query  545   DAIN-GAVEVWMKLPKQVMHTLTQD  474
             D    G VE ++ L K+VM     D
Sbjct  400   DTKEPGGVEAYVSLAKEVMTKFESD  424



>ref|XP_007044970.1| HXXXD-type acyl-transferase family protein, putative [Theobroma 
cacao]
 gb|EOY00802.1| HXXXD-type acyl-transferase family protein, putative [Theobroma 
cacao]
Length=436

 Score =   186 bits (473),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 143/462 (31%), Positives = 217/462 (47%), Gaps = 44/462 (10%)
 Frame = -2

Query  1757  ITMKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGACHH---  1587
             I MKVE+ S++  +PSSPTP  LKN++LS LDQL  +     VFFY S   + + HH   
Sbjct  2     IKMKVEITSRQTIKPSSPTPYHLKNFRLSLLDQLLPSFYGLIVFFYAS---TPSTHHQNE  58

Query  1586  ---TKTIDElkkslsktlsLM---YPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLL  1425
                +K+ D      S    ++   YP+AGR+K D  +I+C+DEG  F+ A +   +S  L
Sbjct  59    DCRSKSCDRSHILKSSLSKVLTHFYPMAGRLK-DATSIDCNDEGAYFVEARIDCQLSDFL  117

Query  1424  ENPEMEKIKQLIPSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFM  1245
             + P+ME +   +P+      +      + VQ+  F CGG AI   + H   D S+LA F+
Sbjct  118   KQPDMEALNGFLPTTDPETSKAASGCNLLVQLTTFECGGTAISICLLHKNTDVSSLATFL  177

Query  1244  EIWASFNRGCAANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFV  1065
             + W +  R         FV    + L PP  D S +          +     + + KRF 
Sbjct  178   QSWTAIARDSGEAVSPEFV---GASLLPP-GDLSFMPP--------VNNPSGNFVTKRFK  225

Query  1064  IPANAIAQLRQDLTITGGSVQRPSRVEALTALVWAAVINATPTQTA-----TLSCMVNLR  900
               A+ IA L+      G  V  PSRVE + AL+    + A+  ++       L   VNLR
Sbjct  226   FEASKIASLKAK--AAGQFV--PSRVEVVLALILKCSVAASRAKSGLARPIALFQAVNLR  281

Query  899   RRMEPPLPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGE  720
             +R+ PPLP N +G L+    V       G   +   ELV  +R       + +A K  G+
Sbjct  282   KRIVPPLPENSIGNLIWTVPVFL-----GDGEMELNELVTVMRREMTQFCNEKANKFKGD  336

Query  719   GGWLRAVIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLV--VNMLDNSWVLFL  546
              G+L    +        +D++    +S CR   YE+D+GWGKP  V   ++   + V+ +
Sbjct  337   DGFLLITESLKERRELCKDAAVYRCTSWCRFPLYEMDYGWGKPVWVSSASLSFRNIVVLI  396

Query  545   DAING-AVEVWMKLPKQVMHTLTQDRHFLAYVSAFPKPKL*I  423
             D  NG  +E W+ L +Q M     D+  L   SA   P + I
Sbjct  397   DTKNGDGIEAWVTLEEQEMSIFECDKELLG--SALLNPSIFI  436



>ref|XP_004301957.1| PREDICTED: BAHD acyltransferase At5g47980-like [Fragaria vesca 
subsp. vesca]
Length=452

 Score =   186 bits (473),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 144/462 (31%), Positives = 222/462 (48%), Gaps = 38/462 (8%)
 Frame = -2

Query  1757  ITMKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGACHHTKT  1578
             + +KVEV  KE   PSSPTP  L+ + LS  DQL   +  P + FY + T+        +
Sbjct  3     LEVKVEVLHKENISPSSPTPHPLRFFSLSVFDQLTPTVYFPLLLFYPN-TVQPRDRELNS  61

Query  1577  IDElk----------kslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCL  1428
             ID              SLS+TL+  YP AGR+  D  +I C+D+G  F+ A V  ++S +
Sbjct  62    IDPQSLVVERTKLLKTSLSETLTRFYPFAGRI-HDHASICCNDQGAVFVEAKVKCSISRV  120

Query  1427  LENPEMEKIKQLIPSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKF  1248
             LE P++E + +LIP  +  +    G  L+ VQVN F CGGIAIGF VSH + DA  L+ F
Sbjct  121   LEEPDLEFLTELIPKLESTDEGETGYVLLNVQVNFFECGGIAIGFNVSHKMIDAFTLSTF  180

Query  1247  MEIWASFNRGCAANNGSGFVSDH---SSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIV  1077
             +  WA+ + G   ++ + F S     ++  FPPL    +  Q  K+  E         I 
Sbjct  181   VNSWAATSLGFGTSDHTVFPSHQYVGAASRFPPLDLFKSPPQFGKLAKE-------KCIT  233

Query  1076  KRFVIPANAIAQLRQDLTITGGSVQRPSRVEALTALVWAAVINATPTQ------TATLSC  915
             KRFV  ++ IA L+ +      +V  P+RVE ++AL+W   + A+         ++T   
Sbjct  234   KRFVFESSKIAYLKSE--AASDAVPNPTRVEVVSALIWKTAMKASSANSDSVRPSSTWLQ  291

Query  914   MVNLRRRMEPPLPPNCLGTLVDEAIVLCQEAKDGGTVVTAVE-LVQRIRDAFRAVKDGEA  738
             +VN+R  +  P   N +G L+         +  GG     ++ LV  +R  F   K    
Sbjct  292   IVNMRNILAQPSGKNLMGNLLG---FFAARSTGGGESKDDLQGLVAAMRKGFEEFKVKYG  348

Query  737   RKVYGEGGWLRAVIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVVNM---LD  567
              K +  G  +  ++    E ++  D     ++S CR  + E DFGWGKP + V     L 
Sbjct  349   TK-FVSGEDVSKLMNEYREQMQKDDIECYCSTSWCRFPFCEADFGWGKPLMSVPATVELK  407

Query  566   NSWVLFLDAINGAVEVWMKLPKQVMHTLTQDRHFLAYVSAFP  441
             N  +L   +  G VE  + L ++ M    ++   LA+ S  P
Sbjct  408   NLIMLMDTSDGGGVEARLTLKEEDMAKFEKNEELLAFASLNP  449



>ref|XP_008797275.1| PREDICTED: salutaridinol 7-O-acetyltransferase-like [Phoenix 
dactylifera]
Length=422

 Score =   185 bits (470),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 152/448 (34%), Positives = 221/448 (49%), Gaps = 43/448 (10%)
 Frame = -2

Query  1748  KVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGACHHTKTIDE  1569
             KV+V SKE  +PSSPTPQ L + +LS LDQ+   +    + FY         +  + + +
Sbjct  4     KVQVISKETIKPSSPTPQNLHSLQLSLLDQIAPQIYNHLLLFYSK-------NPPQALTQ  56

Query  1568  lkkslsktlsLMYPLAGRVKEDK----VTIECDDEGVEFIVADVAENMSCLLENPEMEKI  1401
             LK SLSKTL+  YPLAGR+KE K    + +EC+DEGVEFI A     +  +L  P +++ 
Sbjct  57    LKSSLSKTLTCFYPLAGRIKESKDDNTLYVECNDEGVEFIQARAEAELHSVLLQPPIDQF  116

Query  1400  KQLIP-SAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFN  1224
              +L+P  A  +     G  L+AVQ+  F   G A+G  +SH IAD +++A F+  WA   
Sbjct  117   SELLPIRASDFR---YGDPLLAVQLTWFERRGFALGLSMSHLIADGASMAMFLNRWADVA  173

Query  1223  RGCAANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIA  1044
             RG        F    S   FPP      I+Q  K       Q      ++RFV+ + AIA
Sbjct  174   RGLDLRPAPRF---DSMATFPP--RPQFIDQAPKRAQPASGQPAA--AIRRFVMSSRAIA  226

Query  1043  QLRQDLTITGGSVQR---PSRVEALTALVWAAVINATPTQTATLSCMVNLRRRMEPPLPP  873
             +LR      GGS  R   P+RVEA++ALV   ++ A   +       VNLRR++ PPL  
Sbjct  227   RLR------GGSYDRVHAPTRVEAVSALVLRCLVRARGKKRPVAKHSVNLRRKLSPPLSD  280

Query  872   NCLGTL-VDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLRAVI  696
                G + +  A V                L + +R+  R V D E  +   E  WL    
Sbjct  281   ESFGNMWISVAAVGKLVGDGCDDGGGQGFLEEALRNGVRKV-DEEYVRRKAEEKWLG---  336

Query  695   ARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRL----VVNMLDNSWVLFLDAING-  531
               G + V   +S T   SS CRM +Y  DFGWG+P      + +M D    + +D  +G 
Sbjct  337   RDGMDGVVVGESETWIFSSWCRMPWYRTDFGWGEPEWLGCGIRDMKDV--CILVDTKDGD  394

Query  530   AVEVWMKLPKQVMHTLTQDRHFLAYVSA  447
              +EVW+ L  + M  + +D  FL ++S+
Sbjct  395   GMEVWLWLRAEEMEKVARDPEFLDFISS  422



>ref|XP_008226087.1| PREDICTED: BAHD acyltransferase At5g47980-like [Prunus mume]
Length=455

 Score =   186 bits (472),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 149/465 (32%), Positives = 229/465 (49%), Gaps = 54/465 (12%)
 Frame = -2

Query  1751  MKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYD---SPTISGACHHTK  1581
             +KVEV  KE  +PSSPTP  L++  LS  DQL   +  P + FY    S  +     H  
Sbjct  14    IKVEVIRKETIKPSSPTPHHLRSSSLSVFDQLQPEMYIPLLLFYPNNISDDVVNNIDHNS  73

Query  1580  TIDElk----kslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPE  1413
                E       SLS+ L+  YP AG   E  V+I C+D G  FI + V   +S +LENP+
Sbjct  74    LFAERSKLLKTSLSEALTQFYPFAGEF-EYNVSISCNDHGAGFIESQVNCPISKILENPD  132

Query  1412  MEKIKQLIPSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWA  1233
              E +KQL+P+A V   Q     L+ VQVN F CGG+ IG  +SH +ADA  L+ F++ WA
Sbjct  133   FEILKQLLPTA-VKSKQSEAGHLLLVQVNLFECGGLTIGVNISHKVADAFTLSTFIKSWA  191

Query  1232  SFNRGCAANNGSGFVSDH---------SSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMI  1080
             +   G A+       SD          ++ LFPP    +A + +       +E  + + I
Sbjct  192   TIALGSAST-----ASDQVLLPVEFGVAATLFPPQDVFNAPQPI-------VESIKNNCI  239

Query  1079  VKRFVIPANAIAQLRQDLTITGGSVQRPSRVEALTALVWAAVINATPT-----QTATLSC  915
              KRFV  A+ IA L+        SV  P+RVE ++AL+W   + A+ +     + +  + 
Sbjct  240   TKRFVFDASKIAALKSKAASA--SVPNPTRVEVVSALIWKCALQASKSNLGFRKPSAWNQ  297

Query  914   MVNLRRRMEPPLPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEAR  735
             +VN+R+     +  N LG+LV    V+  E+ +    V    LV ++R      K+  A+
Sbjct  298   LVNMRKISGLAMTENILGSLVSLFTVMTVESDE----VKLESLVHKLRKGIEKYKEKYAK  353

Query  734   KVYGEGGWLRAVIARGYELVRN---RDSSTLY-TSSLCRMAYYEVDFGWGKPRL--VVNM  573
                GE       + +  E ++N   +DS   Y  +S CR ++YE DFGWGKP    + ++
Sbjct  354   GFSGED------LIQTMEGLKNLIMKDSIETYGCTSWCRFSFYEADFGWGKPSWMSLCHI  407

Query  572   LDNSWVLFLDAING-AVEVWMKLPKQVMHTLTQDRHFLAYVSAFP  441
                +  L +D  +G  +E  + L ++ M  + ++   LAY S  P
Sbjct  408   ESMNTTLLMDTSDGVGIEALLCLEEEHMAIIERNEDLLAYASLNP  452



>ref|XP_007018014.1| HXXXD-type acyl-transferase family protein, putative [Theobroma 
cacao]
 gb|EOY15239.1| HXXXD-type acyl-transferase family protein, putative [Theobroma 
cacao]
Length=648

 Score =   189 bits (481),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 149/459 (32%), Positives = 232/459 (51%), Gaps = 41/459 (9%)
 Frame = -2

Query  1751  MKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGACHHTKTID  1572
             M+VE+ S +  +PSS TPQ LK +KLS LDQ   +   P + FY +   +      + ++
Sbjct  202   MEVEIISTQHIKPSSLTPQHLKIFKLSLLDQFIPSPYAPIILFYPTDESTSHLEIPRRLE  261

Query  1571  ElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEMEKIKQL  1392
              LKKSLS TL+  YPLAG+++ D ++IEC D+G  ++ A V   ++  L  P++  + + 
Sbjct  262   LLKKSLSNTLTSFYPLAGKIRND-LSIECSDQGAYYVEAGVNCRLNEFLNQPDLLFLPRF  320

Query  1391  IPSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGCA  1212
             +P   + +    G  +  +QVN F CGGIAIG  +SH I D +AL+ F++ W +  RGC 
Sbjct  321   LPREFILDEPTAGTYVTNIQVNMFECGGIAIGICISHKILDGAALSTFLKAWTATARGCK  380

Query  1211  ANNGSGFVSDHSSILFPP----LTDTSAI--EQLMKMGAEGIEQEEKDMIVKRFVIPANA  1050
                   F+   ++ LFP     L D+S +    L + G           I +R +   ++
Sbjct  381   EAIYPNFI---ATSLFPTDDLWLRDSSLVMWGSLFRKGKS---------ITRRMIFGTSS  428

Query  1049  IAQLRQDLTITGGSVQRPSRVEALTALVWAAVINATPTQT-----ATLSCMVNLRRRMEP  885
             IA L+   TI G   Q P+RVEA++A +W   ++A+  +      + L+ +VNLRRRM  
Sbjct  429   IAALKAQATIPGR--QCPTRVEAVSAFLWKCTMDASKGKNGFQRPSLLTHLVNLRRRMVQ  486

Query  884   PLPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGE--GGW  711
             P   N  G L+   I   +   +  + +   +LV R+R+A   V DG+  K  G+  G  
Sbjct  487   P-TENSTGNLL--WIASAKSKVENKSDLP--DLVGRVREAISRV-DGDFLKKLGDDKGKS  540

Query  710   LRAVIARGY-ELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVVNM-LDNS----WVLF  549
             L     R   +LV          SS C+  +YE DFGWGKP  V +  ++NS     ++ 
Sbjct  541   LMCETLREIGDLVSKEGLDHFGFSSWCKFGFYEADFGWGKPAWVSSFGMENSVYMNLIIL  600

Query  548   LDAING-AVEVWMKLPKQVMHTLTQDRHFLAYVSAFPKP  435
             +D   G  +E W+ L +Q M  L +D   L      P P
Sbjct  601   VDTRFGDGIEAWVTLDEQDMAILERDEELLRLAMFDPSP  639



>ref|XP_002514982.1| 3'-N-debenzoyl-2'-deoxytaxol N-benzoyltransferase, putative [Ricinus 
communis]
 gb|EEF47536.1| 3'-N-debenzoyl-2'-deoxytaxol N-benzoyltransferase, putative [Ricinus 
communis]
Length=441

 Score =   186 bits (471),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 137/440 (31%), Positives = 223/440 (51%), Gaps = 40/440 (9%)
 Frame = -2

Query  1715  PSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGACHHTKTIDElkkslsktlsL  1536
             PSSPTP  L+ +KLS LDQL        +  Y     S A   ++ +             
Sbjct  15    PSSPTPNHLRIFKLSLLDQLSPAAYGSMLLVYSINKPSTAIDKSQLLKRSLSETLTR---  71

Query  1535  MYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEMEK-IKQLIPSAKVYE-PQ  1362
              YPLAG++K D   +EC+D+G  ++ A V   +S LLE P+  + I+ LIP+  +    +
Sbjct  72    FYPLAGKIK-DNSAVECNDDGAVYLEAQVDCLLSKLLEKPDDHQVIRNLIPAEHIQSLSE  130

Query  1361  PVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGCAANNGSGFVSD  1182
                  L+ VQ   F+CGG+AIG  +SH +ADA  +  F++ WA+   G          +D
Sbjct  131   TQAGCLLLVQATFFACGGLAIGVCISHKLADARTVCTFIQGWAAAALG----------TD  180

Query  1181  HSSILFPPLTDTSAIEQLMKMGAE-GIEQEEKDMIVKRFVIPANAIAQLRQDLTITGGSV  1005
             H ++   P  + S+I     + +E  ++  E+  + KR+V  A+ IA L+        SV
Sbjct  181   HEAVR--PKFNVSSIFPPQNLPSELAVKLNEEKCVTKRYVFHASGIATLKDK--AASESV  236

Query  1004  QRPSRVEALTALVWAAVINATPTQT-----ATLSCMVNLRRRMEPPLPPNCLGTLVDE-A  843
             + P+RVEA+TAL+W   + A+ + +     + L+  VN+R+++ PPL    +G L+   A
Sbjct  237   RHPTRVEAVTALIWKCAMKASRSNSKQPKMSVLAQSVNIRKKLVPPLSEYSIGNLMGHFA  296

Query  842   IVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLRAVIARGYEL--VRN  669
             +   +   + GT+VT      ++R   +   +   +K+  EG  L+AV     E+  + +
Sbjct  297   LRATENEVELGTLVT------KMRKGIQEFGENYVKKLQ-EGNALKAVFEALKEMGSLLH  349

Query  668   RDSSTLY-TSSLCRMAYYEVDFGWGKPRLVVNMLD--NSWVLFLDAING-AVEVWMKLPK  501
               S+  Y TSSLCR  +Y +DFGWGKP  VV   D   + +  +DA +G  +E W+ L +
Sbjct  350   GGSTEFYITSSLCRFPFYGIDFGWGKPAWVVPPRDPIKNIISLIDARDGNGIEAWVTLKE  409

Query  500   QVMHTLTQDRHFLAYVSAFP  441
             + M    +D+  LA  S  P
Sbjct  410   EDMAIFERDQELLAVASLNP  429



>gb|ACI45392.1| salutaridinol 7-O-acetyltransferase [Papaver bracteatum]
Length=477

 Score =   186 bits (473),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 146/451 (32%), Positives = 220/451 (49%), Gaps = 45/451 (10%)
 Frame = -2

Query  1745  VEVRSKEIGRPSSPTPQTLKNYKLSFLDQ-LHLNLMTPFVFFYDSPTI--SGACHHTKTI  1575
             VEV SKE  +P++PTP  LKN+ LS LDQ   L    P + FY       +G+  H   +
Sbjct  9     VEVISKETIKPTTPTPSQLKNFNLSLLDQCFPLYYYVPIILFYPDTVANSTGSSSHHDDL  68

Query  1574  DElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEMEKIKQ  1395
             D LK SLSKTL  +YP+AGR+  D + ++C D+G++F    +   M   +  P++  + Q
Sbjct  69    DLLKSSLSKTLVHLYPMAGRMI-DNILVDCHDQGIDFYKVKIRGKMCDFMSQPDVP-LSQ  126

Query  1394  LIPSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGC  1215
             L+PS  V    P  +ALV VQVN F CGG AI   +SH I+D + +  F+  WAS  +  
Sbjct  127   LLPSEVVSANVP-KEALVIVQVNMFDCGGTAICSSISHKISDVATMGTFIRSWASTTKTS  185

Query  1214  AANNGSGFV--------SDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKD--MIVKRFV  1065
              + + +  V        S  S+ LFPP    ++   + ++    I ++ +D   + KRFV
Sbjct  186   RSGDATAAVITDQKLIPSFDSASLFPPSERLASPSGMAEIPFSSIPEDTEDDKTVSKRFV  245

Query  1064  IPANAIAQLRQDLTI---TGGSVQRPSRVEALTALVWAAVINATPTQ-TATLSCMVNLRR  897
                  I  + + L +        +RP+RVE +T+L+W +V+ +TP      +   VNLR+
Sbjct  246   FDFAKITSVSEKLQVLMHDNYKSRRPTRVEVVTSLIWKSVMKSTPAGFLPVVDHAVNLRK  305

Query  896   RMEPPLPPNCLGTL-------VDEAIVLCQEAKDGGTVVTAVE---LVQRIRDAFRAVKD  747
             +M+PPL     G L       +         A +     T+ E   ++  + D F A   
Sbjct  306   KMDPPLQDASFGNLSVTVSAFLPATTTTTTNAVNKTINSTSSESQVVLHELHD-FIAQLR  364

Query  746   GEARKVYGEGGWLRAVI---ARGYELVRNRDSS------TLYTSSLCRMAYYEVDFGWGK  594
              E  KV G+ G L  VI     GY+    + +         + SS CRM  YE+DFGWGK
Sbjct  365   SEIDKVKGDKGSLEKVIQNFVSGYDASIKKINDVEDKVINFWISSWCRMGLYEIDFGWGK  424

Query  593   PRLVV---NMLDNSWVLFLDAIN--GAVEVW  516
             P  V    N+  N   LF++       +EVW
Sbjct  425   PIWVTIDPNIKPNKNCLFMNDTKCGQGIEVW  455



>ref|XP_002271612.1| PREDICTED: vinorine synthase-like [Vitis vinifera]
Length=433

 Score =   185 bits (469),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 140/455 (31%), Positives = 235/455 (52%), Gaps = 48/455 (11%)
 Frame = -2

Query  1751  MKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTIS-GACHHTKTI  1575
             MK+++ S +  +PSSPTP  L+++K+S LDQL      P +  + +      A  H    
Sbjct  3     MKIDILSTQPIKPSSPTPNHLRSFKISLLDQLAPPFYVPVILLFSADDFDCEAVDHVTIC  62

Query  1574  DElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEMEKIKQ  1395
             D LK+SLS+TLS  YPLAG++K +  +++C D+G  F+ A     +S +L +PE++ +++
Sbjct  63    DLLKRSLSQTLSRFYPLAGKLKGND-SVDCSDDGAVFMEARANVELSEILRDPEIDLLQK  121

Query  1394  LIPSAKVYEPQPVG-----KALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWAS  1230
             L+P     EP  VG     +A+ A+Q   F CGGI IG  +SH +AD + LA F+  W++
Sbjct  122   LLPC----EPYSVGSESSDRAITAIQATIFECGGIGIGVCMSHKVADGATLATFLTAWSA  177

Query  1229  FNRGCAANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANA  1050
                G   ++G     D +S LFPP         +  + + G+    K  + +RF+  A +
Sbjct  178   TAMG--TDDGITPFLDSAS-LFPP-------RDINTVLSSGVISHGK-TLTRRFLFDAAS  226

Query  1049  IAQLRQDLTITGGSVQRPSRVEALTALVWAAVIN------ATPTQTATLSCMVNLRRRME  888
             +A+L+             +RVEA+T+L+W + ++         T ++ ++ +VNLR + E
Sbjct  227   LARLQS-------KASNSTRVEAVTSLIWKSAMDVAREKSGKDTISSIVTHVVNLRGKTE  279

Query  887   PPLPPNCLGTLVDEAI--VLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGG  714
             PPL    LG L  +A+  V  QE K     V   +LV R+R A + V     +++ GE G
Sbjct  280   PPLSDRSLGNLWQQAVATVTEQEGK-----VELDDLVGRLRRAIKKVDKEYVKEIQGEEG  334

Query  713   WLRAVIARG--YELVRNRDSSTLYT-SSLCRMAYYEVDFGWGKPRLVVNM---LDNSWVL  552
               +A  A     +++ ++    LY  SS  R  +YE DFG+G+P  V  +   + N  +L
Sbjct  335   LSKACGAMKEVQKMIMSKGEMELYRFSSWSRFPFYETDFGFGRPIWVCTITAPIKNVIIL  394

Query  551   FLDAINGAVEVWMKLPKQVMHTLTQDRHFLAYVSA  447
                   G +E W+ + ++ M    +    L +VS+
Sbjct  395   MDTKSGGGIEAWVTMVEEDMTKFQRHYELLEFVSS  429



>ref|XP_003532711.2| PREDICTED: vinorine synthase-like [Glycine max]
Length=456

 Score =   186 bits (471),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 140/456 (31%), Positives = 225/456 (49%), Gaps = 39/456 (9%)
 Frame = -2

Query  1745  VEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGACHHTKTIDEl  1566
             +E  S+E  +PS+PTP  L+ + LSF+D +      P +FFY+SP    A     TI +L
Sbjct  1     MEFISRETIKPSNPTPPHLRIHPLSFIDHIVFRNYIPLLFFYNSPNHEQA----STISKL  56

Query  1565  kkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEMEKIKQLIP  1386
             KKSLS+ LS  YP AG+++ D+V+I+C+D+GV F+V  +  N+S +L+NP  E +  L P
Sbjct  57    KKSLSQVLSRYYPFAGKLR-DQVSIDCNDQGVSFLVTRLRCNLSTILQNPTEESLNPLFP  115

Query  1385  SAKVYEPQPVGKA--LVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGCA  1212
                 ++P     +  ++A+Q+N F+CGGIA+   + H + DA+ L+ F+  WA+ NR   
Sbjct  116   DELQWKPMSSSSSSSIIAIQINCFACGGIAMSVCMCHKVGDAATLSNFINDWATLNRQKE  175

Query  1211  ANNGSGFVSDHSSILFP-PLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQLR  1035
                 +  +     +L P P+   S   Q        +   E D + +RFV  A+ I  L+
Sbjct  176   LEQETAEL-----LLLPFPVPGASLFPQENLPVFPEVLFVENDTVCRRFVFEASKIDSLK  230

Query  1034  QDLTITGGSVQRPSRVEALTALVWAAVINATP--TQTATLSCMVNLRRRMEPPLPPNCLG  861
                T++  +V  P+RVE ++AL++   ++A    ++T +    VNLR R  PPLP   +G
Sbjct  231   S--TVSSHNVPNPTRVEVVSALIYNRAVSALGLISKTTSFRTAVNLRTRTVPPLPEKSVG  288

Query  860   TLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEG---GWLRAVIAR  690
              LV    VL     +        ELV +++       +  A+K  GE     ++   + +
Sbjct  289   NLVWFLFVLSPWETE------LHELVLKMKQGLTEFCETYAKKFGGEDKDMSFISECLKQ  342

Query  689   ----------GYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVVNM---LDNSWVLF  549
                       G +   ++  +    +S CR   YE DFGWGKP         + NS VL 
Sbjct  343   AASVPEPQPGGSDDEESQIVTMFCCASWCRFPMYEADFGWGKPVWFTTSKCPVKNSIVLM  402

Query  548   LDAINGAVEVWMKLPKQVMHTLTQDRHFLAYVSAFP  441
                  G +E  + + +Q M    +D   L Y S  P
Sbjct  403   DTRDGGGIEAIVNMEEQDMARFERDVELLKYASLNP  438



>ref|XP_003616843.1| Salutaridinol 7-O-acetyltransferase [Medicago truncatula]
 gb|AES99801.1| transferase family protein [Medicago truncatula]
Length=439

 Score =   185 bits (469),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 133/445 (30%), Positives = 222/445 (50%), Gaps = 26/445 (6%)
 Frame = -2

Query  1751  MKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGACHHTKTID  1572
             M++E+ S+E  +PSSPTP  LK Y LSF+D +  +   P ++FY+    +G         
Sbjct  1     MEIELLSRETIKPSSPTPSHLKLYPLSFIDNIVCSNYLPLLYFYNP---NGNRDQNSKTS  57

Query  1571  ElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEMEKIKQL  1392
             +L+KSLS+ LS  Y  AGR+K DK+TIEC+D+GV F+V  V   +S +++NP  + +  L
Sbjct  58    QLRKSLSQLLSKYYHFAGRIK-DKITIECNDQGVLFLVTKVKNKLSEIVQNPTEKLLNPL  116

Query  1391  IPSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGCA  1212
              P    ++      + +A+QVN F+CGG+ I   +SH I DA+ +  FM  WA   +   
Sbjct  117   FPDELQWKEMDWRASFIAIQVNWFACGGMVISICISHKIGDAATIFNFMNDWAIIYQKFD  176

Query  1211  ANNGSGF-VSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQLR  1035
              +      + D    +FP        ++ + +  E + + E ++  KRFV     I  L+
Sbjct  177   EDEKDLLSLLDAGGTIFP--------QRDLPIFPENVLKRENNVEFKRFVFQPAMIKSLK  228

Query  1034  QDLTITGGSVQRPSRVEALTALVW--AAVINATPTQTATLSCMVNLRRRMEPPLPPNCLG  861
                 +T  S+  P+RV+ + A ++  A  I     QTA+   +VNLR+RM PPL   C+G
Sbjct  229   A--MVTSSSMPSPTRVQVVIAWIYKHAVSIMGLNFQTASFYMVVNLRKRMVPPLSEKCVG  286

Query  860   TLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEAR--KVYGEGGWLRAVIARG  687
              ++  + ++    K+    +   ELV +I++      D   +  +  G+   L +   + 
Sbjct  287   NILWFSSMMMTNKKE----MKLEELVCKIKEGLSECCDVYPKMFREIGKNNLLISECLKQ  342

Query  686   YELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVVNMLDNSW--VLFLDAING-AVEVW  516
                 ++ + +    SS CR   YE DFGWGKP  +     +S   +L +D  +G  +E  
Sbjct  343   ATEPQSENKNVFGFSSWCRFPMYEADFGWGKPIWITTTGCSSKNNILLMDTRDGDGIEAV  402

Query  515   MKLPKQVMHTLTQDRHFLAYVSAFP  441
             + + ++ M     D   L Y S  P
Sbjct  403   VNMEEKYMAKFEHDFELLQYASLNP  427



>ref|XP_007134039.1| hypothetical protein PHAVU_010G014300g [Phaseolus vulgaris]
 gb|ESW06033.1| hypothetical protein PHAVU_010G014300g [Phaseolus vulgaris]
Length=432

 Score =   184 bits (468),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 146/454 (32%), Positives = 227/454 (50%), Gaps = 44/454 (10%)
 Frame = -2

Query  1757  ITMKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFY---DSPTISGACHH  1587
             + +KVE+ SKE  + SSP P  LK++KLS LDQL      P + FY   D+  I+   H+
Sbjct  1     MEVKVEIVSKERVKASSPPPNKLKHFKLSLLDQLAPPFYVPVLLFYSASDATDITTISHN  60

Query  1586  TKTIDElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEME  1407
              K       SLS+ L+L YP  G ++ D  T+EC+ EGV F  + +  ++S +L+NP + 
Sbjct  61    LKA------SLSQLLTLYYPFCGTLR-DNSTVECNHEGVLFTHSTLPIHLSTILKNPHLH  113

Query  1406  KIKQLIPSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASF  1227
             +I QL P       +      + VQ+N+FSCGG+A+    SH IADAS+ A F+  WA+ 
Sbjct  114   RINQLFPLDPYNPARDTLLETMVVQLNQFSCGGVALAVCFSHKIADASSAASFLTAWAAT  173

Query  1226  NRGCAANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAI  1047
             +R    N       +  +++FPP      IE  +  G  G     KD++ KRF+     I
Sbjct  174   SRK-EENILIAPQMEEGALVFPP----RKIEMDITRGMVG----HKDIVTKRFMFNRTNI  224

Query  1046  AQLRQDLTITGGSVQ-RPSRVEALTALVWAAVINATPTQT-------ATLSCMVNLRRRM  891
             ++L+Q +    GS++  P+ VEA+TAL+W + + A    +       + +S  VN+R RM
Sbjct  225   SRLKQKV----GSLEFFPTSVEAVTALIWKSSLEAAKASSEEGKFPASMVSHAVNIRSRM  280

Query  890   EPPLPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGW  711
                L  + +G L  +A+    E +     V   +L +R+R+  R V      K+ G+  +
Sbjct  281   ASTLGKHSMGNLWQQAVSPLVEVEGE---VGLRDLGERVRETIRKVDGNYVSKLQGDEFY  337

Query  710   LRAVIARGYELVRNRDSST---LYT-SSLCRMAYYEVDFGWGKPRLV--VNMLDNSWVLF  549
                 +  G +  R   S      Y+ SS  R   YE DFGWGKP  V  + +   + V F
Sbjct  338   ---EVIEGLKEARRMASEKGVPCYSFSSWVRFGLYETDFGWGKPSYVSRIGVPIKNVVSF  394

Query  548   LDAING-AVEVWMKLPKQVMHTLTQDRHFLAYVS  450
             +    G  +E W+ L K  M    Q++  L +VS
Sbjct  395   MPTKGGDGIEAWISLTKPHMLHFEQNQELLQFVS  428



>ref|XP_002284817.2| PREDICTED: vinorine synthase-like [Vitis vinifera]
Length=445

 Score =   185 bits (469),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 149/461 (32%), Positives = 222/461 (48%), Gaps = 47/461 (10%)
 Frame = -2

Query  1751  MKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGACHHTKTID  1572
             M+V + S+E  +PSSPTP  L+ +KLS LDQL     T  + FY      G    T  I 
Sbjct  1     MEVTIISRETIKPSSPTPHHLRAFKLSLLDQLVPCCYTQVLLFYLIDGFHGQSIETSHIS  60

Query  1571  -ElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEMEKIKQ  1395
               LK SLS+TL+  YPLAG + +D++ I+C+DEGV +  A V  N+S  L+ PE+E + Q
Sbjct  61    TRLKDSLSETLTHFYPLAGSIGDDELQIDCNDEGVPYFEARVDCNLSEFLQEPELELLNQ  120

Query  1394  LIPSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGC  1215
               P   +  P      L  +QVN F+ GGIAIG  +SH IAD  +++ F++ WA+  RGC
Sbjct  121   FFPCDPLNTPPMAKLHLAMIQVNIFNRGGIAIGVCLSHKIADGVSISAFLKAWAAIARGC  180

Query  1214  AANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQLR  1035
                    + S  +  LFP      ++ Q   M            + KR V  A+AIA L+
Sbjct  181   FEE----YPSFEAKSLFP---QNESLPQDYSMVLGKCLIRTGKCVTKRVVFDASAIAALK  233

Query  1034  QDLTITGGSVQRPSRVEALTALVWAAVINATPTQ-----TATLSCMVNLRRRMEPPLPPN  870
                ++        +RVE ++A +W   + A   +     ++ L+  VNLR++    LP +
Sbjct  234   AKASVDC------TRVEVVSAFIWKRAMAAAKQKLGFQRSSILTHAVNLRKKTILSLPES  287

Query  869   CLGTLVDEAIVLCQEAKDGGTVVTAVE---LVQRIRDAFRAVKDGEARKVYGEGGWLRAV  699
              +G L   AI         G V    E   LV + R A   +    A+K+ GE G+    
Sbjct  288   SMGNLFWIAIT-------EGRVDDEAELDLLVDKTRKAISKISCDFAKKLQGEEGF----  336

Query  698   IARGYELVR------NRDSSTLYT-SSLCRMAYYEVDFGWGKPRLVVNM-----LDNSWV  555
              A  +E V+        D    Y  SS C+   YE DFGWG+P  V +      +  + +
Sbjct  337   -AVAFEHVKEVKAAFEEDGVDFYGFSSWCKFEVYEGDFGWGRPIWVSSFSGKGSVYKNLI  395

Query  554   LFLDAING-AVEVWMKLPKQVMHTLTQDRHFLAYVSAFPKP  435
              F+D   G  +E W+ L ++ +  L  D  FL++ S  P P
Sbjct  396   FFMDTRCGNGIEEWVTLDEEELGILECDPEFLSFGSMDPSP  436



>ref|XP_006432226.1| hypothetical protein CICLE_v10001111mg [Citrus clementina]
 ref|XP_006464982.1| PREDICTED: salutaridinol 7-O-acetyltransferase-like [Citrus sinensis]
 gb|ESR45466.1| hypothetical protein CICLE_v10001111mg [Citrus clementina]
Length=454

 Score =   185 bits (469),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 148/472 (31%), Positives = 229/472 (49%), Gaps = 55/472 (12%)
 Frame = -2

Query  1751  MKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGAC--HH--T  1584
             M+VE+ S+E  +PSSPTP  LK YK S LDQ   ++  P V +Y    +S A    H  +
Sbjct  1     MEVEIISRECIKPSSPTPLHLKTYKFSLLDQFRNHIFAPRVLYYPLINLSDASVIDHIVS  60

Query  1583  KTIDElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEMEK  1404
             K +  LK+SLS+TL   YPLAG++ E+  +I C+DEG+ F+ A     ++  L  P+   
Sbjct  61    KRLQLLKQSLSETLVRFYPLAGKMTEN-FSINCNDEGIYFVEARAKSPLNEFLNKPDPSL  119

Query  1403  IKQLIP--SAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWAS  1230
               +  P   ++    +  G  +  VQ+  F CGG+ I    SH   D ++ + FM+ WA+
Sbjct  120   THKFFPVEGSESLTGRIAGAHVAKVQITSFPCGGLVICSCFSHMFGDGTSFSLFMKSWAA  179

Query  1229  FNRGCAANNGSGFVSDH--SSILFPP-------LTDTSAIEQLMKMGAEGIEQEEKDMIV  1077
               R   +N G+  +  +  +SILFPP       L   S   +  + G           ++
Sbjct  180   TAR--KSNTGAAVMCPNFDASILFPPNEAYPRELNWNSLFTRFFETGR---------FVM  228

Query  1076  KRFVIPANAIAQLRQDLTITGGSVQRPSRVEALTALVWAAV-----INATPTQTATLSCM  912
             +RFV  A AIA L+    I    VQ P+RVE ++AL+   +     + + P +   L+ +
Sbjct  229   RRFVFDAKAIADLKAK-AIISSCVQNPTRVEVVSALLSKHIMATFKLKSGPHKPTLLTHV  287

Query  911   VNLRRRMEPPLPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARK  732
             VNLR +  PPLP N +G +V    VLC++ +     V    L  ++R A   +     + 
Sbjct  288   VNLRPKARPPLPGNLIGNIVWHTNVLCEDEE-----VELAGLASQLRQAITKLDGDFLKS  342

Query  731   VYGEGGWL---RAV--IARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVVNM-L  570
             + G  G+L   +A+   A  Y  V++R    +  SS C   +YE+DFGWG+P  V  + L
Sbjct  343   LQGSEGFLTLCKAIEDEAEAYYDVKDR----ILFSSWCTFGFYEIDFGWGRPTWVSCVGL  398

Query  569   DNS-------WVLFLDAINGAVEVWMKLPKQVMHTLTQDRHFLAYVSAFPKP  435
             D S        VL    +   +E W+ L    M  L  D   LA+ +  P P
Sbjct  399   DGSIITHSPTIVLTDTRLRDGIEAWVFLLDDDMALLEVDEELLAFANLDPSP  450



>ref|XP_011085805.1| PREDICTED: vinorine synthase-like [Sesamum indicum]
Length=436

 Score =   184 bits (468),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 138/443 (31%), Positives = 211/443 (48%), Gaps = 48/443 (11%)
 Frame = -2

Query  1745  VEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGA---------C  1593
             V V SKE+ +P +PTP  LK  KLS LDQL   +  P +FFY++  + G          C
Sbjct  7     VHVISKELIKPLTPTPDHLKTVKLSVLDQLTPPVYVPLIFFYEADELKGLASGTDKAQIC  66

Query  1592  HHTKTIDElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPE  1413
             HH K      +SLSKTL+L YPLAG++  +  T+ CDD GVEF+ A     +  ++ + +
Sbjct  67    HHLK------QSLSKTLTLFYPLAGKIDPESFTVCCDDTGVEFVEARARARLRDVVRDAK  120

Query  1412  MEKIKQLIPSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWA  1233
             +E+  + +P  ++         +  VQ+N F CGG+A+   VSH +AD S+L  FM  WA
Sbjct  121   LEEFDKYLPVHRLRGVHVGEGTIFTVQINFFDCGGVAVAACVSHLVADGSSLVDFMNAWA  180

Query  1232  SFNRGCAANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPAN  1053
             +  RG  +     F       L   L+D++    ++   A+        ++ KR V    
Sbjct  181   ATCRGENSKTAPEFDVLGRYFLARDLSDSNFTPSILMGNAK--------LVTKRLVFDKE  232

Query  1052  AIAQLRQDLTITGGSVQRPSRVEALTALVWAAVINATP---TQTATLSCMVNLRRRMEPP  882
              +A L+Q      G V+ P+RVEA++A +    I   P    ++     MVN+R R  PP
Sbjct  233   KLAALKQ--AAATGDVRDPTRVEAVSAFILKHFIETNPLDAKKSLLFGHMVNIRSRASPP  290

Query  881   LPP-------NCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYG  723
             L          C+  L  +  +   E           ELV ++R A R + D   R+   
Sbjct  291   LENTFGNGCFTCVAELSHQHRLPAPELH---------ELVSKLRKAIRTIDDEYIRETER  341

Query  722   EGGWLRAVIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKP--RLVVNMLDNSWVLF  549
             E  +L + +AR  +L+   D+     SS CR   YEVDFGWGKP       +  N+  + 
Sbjct  342   EDRYL-SDLARVCDLISEGDADAFLFSSWCRFPMYEVDFGWGKPVWACTTALRVNNLTIL  400

Query  548   LDAING-AVEVWMKLPKQVMHTL  483
             +   +G  +E W+ L     H+L
Sbjct  401   MSTRDGKGIEAWINLLPDHFHSL  423



>ref|XP_002315640.2| hypothetical protein POPTR_0010s06380g [Populus trichocarpa]
 gb|EEF01811.2| hypothetical protein POPTR_0010s06380g [Populus trichocarpa]
Length=394

 Score =   183 bits (465),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 147/447 (33%), Positives = 233/447 (52%), Gaps = 70/447 (16%)
 Frame = -2

Query  1757  ITMKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGACHHTKT  1578
             + +++EV S EI +PSSPTP  L++Y+LSFLDQ+      P + FY +       ++ + 
Sbjct  1     MKIEIEVISNEIIKPSSPTPDHLRHYQLSFLDQISPPTYNPLLLFYPADG-DVKINNIEK  59

Query  1577  IDElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEMEKIK  1398
              ++LK+SLS+ L+L YPLAGR+K D + +EC+DEG+ F  A+V   +  ++ENPE  ++ 
Sbjct  60    PNQLKQSLSEVLNLYYPLAGRIK-DNLFVECNDEGIPFFQAEVKCRLPQVVENPEPSELN  118

Query  1397  QLIPSA-KVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNR  1221
             +LIP A    E  P+G     +Q N F CGGI IG  +SH + DAS+L  F++ WA+  R
Sbjct  119   KLIPFALDDAEELPLG-----IQYNIFECGGIVIGLCISHKVGDASSLFTFIKYWAATAR  173

Query  1220  GCAAN-NGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIA  1044
             G A + +   F+   S+ LFPP+ + S  +      A GI +E  D++ KRFV  +++I 
Sbjct  174   GEADHISRPEFI---SATLFPPI-NISGFKP-----ATGITKE--DVVTKRFVFRSSSIE  222

Query  1043  QLRQDLTITGGSVQR---PSRVEALTALVWAAVINATPTQTATLSCMVNLRRRMEPPLPP  873
              L++  +   GS++    PSRVEAL+  +W     AT  ++                  P
Sbjct  223   LLKEKCSPASGSLENQRPPSRVEALSVFIWQRFTAATKVESR-----------------P  265

Query  872   NCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEG----GWLR  705
               + ++ +                    LV +IRD+   V D E  K   +G    G+++
Sbjct  266   ERIYSMEN------------------YNLVSQIRDSIGKV-DKEYVKKLQKGSEHLGFMK  306

Query  704   AVIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLV--VNMLDNSWVLFLDAING  531
                AR    +R  +  TL  +SLCR   YE DFGW KP  V   ++   + V+F+D  +G
Sbjct  307   EQAAR---FLRG-EVVTLNFTSLCRFPLYEADFGWAKPIWVGSPSLTFKNLVVFMDTASG  362

Query  530   -AVEVWMKLPKQVMHTLTQDRHFLAYV  453
               +E  + L ++ M    +D   L Y+
Sbjct  363   DGIEALVHLKEEDMAKFEEDEELLQYI  389



>gb|KHN36442.1| Vinorine synthase [Glycine soja]
Length=466

 Score =   185 bits (469),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 149/475 (31%), Positives = 233/475 (49%), Gaps = 48/475 (10%)
 Frame = -2

Query  1751  MKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGACHHT----  1584
             M+VE+ S +  +PS  TP     Y LS LDQ   ++  P V FY     S A   +    
Sbjct  1     MEVEIISTQCIKPSCTTPNHPNTYNLSILDQFMPSIYIPMVLFYSFAQSSQANIDSTITQ  60

Query  1583  KTIDElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEMEK  1404
             + + +LK+SLS+ L+  YP AGRVK DK TI+C+DEGV +  A V+  ++     P    
Sbjct  61    QRLKQLKESLSQVLTHFYPFAGRVK-DKFTIDCNDEGVHYTEAKVSCTLAEFFNQPNFSS  119

Query  1403  -IKQLIPSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWAS-  1230
              I +L+P+  + E    G   + VQVN F+CGG+ IG  +SH IAD +  + F+  W S 
Sbjct  120   LIHKLVPNQPIMELATEGYTAM-VQVNCFACGGMVIGTLISHMIADGAGASFFLNSWGSN  178

Query  1229  --FNRGCAANNGSGFVSDHSSILFPPLTDTSAIEQLMK-MGAEGIEQEEKDMIVKRFVIP  1059
               F+   A +    F +      FP   +  A       M   G    E  + ++RF+  
Sbjct  179   SNFSHQDAFDQFPNFDTP-----FPQNNNNYACPHDTNVMNLCGQFLNEGRVAMRRFLFD  233

Query  1058  ANAIAQLR-QDLTITGGSVQRPSRVEALTALVW---AAVINAT-----PTQTATLSCMVN  906
             A AI++LR Q  ++T   VQ P+RVE +T+L+    A V NA      PT    ++  VN
Sbjct  234   AEAISRLRAQGSSLT---VQNPTRVEVVTSLLCKCTAKVFNANFGLERPT---LITHAVN  287

Query  905   LRRRMEPPLPPNCLGTLVDEAIVLCQEAKDGGTVVTAV-ELVQRIRDAFRAVKDGEARKV  729
             +RRR  P  P +C+G     A+ L   +KD   ++  + +LV ++R+A  ++     +  
Sbjct  288   MRRRASPMFPKSCMGNFAWLALALIMSSKDNKVIMELLPDLVVKLREAVSSINSDFVKGF  347

Query  728   YGEGGWL------RAVIARGYELVRNRDSSTLYT--SSLCRMAYYEVDFGWGKP---RLV  582
              G+ G+       + +I +         S   Y   +S C    Y+VD+GWGKP     V
Sbjct  348   EGDEGYAKYCEVSKELIEKASSFAATTTSGVNYVHFTSWCNFGLYDVDYGWGKPIWVSCV  407

Query  581   VNMLDNSW----VLFLDAING-AVEVWMKLPKQVMHTLTQDRHFLAYVSAFPKPK  432
              + +D+S     V+ +D  +G  +E W+ L +  M  L QD+  LA+ +  P P+
Sbjct  408   ADSVDDSMFFNAVILMDTPSGNGIECWVYLNEDEMAILQQDKELLAFSTLDPNPQ  462



>gb|KCW86588.1| hypothetical protein EUGRSUZ_B03220 [Eucalyptus grandis]
Length=409

 Score =   183 bits (465),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 143/447 (32%), Positives = 215/447 (48%), Gaps = 59/447 (13%)
 Frame = -2

Query  1751  MKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGACHHTKTID  1572
             MK++V SKE   PSS TP  ++ Y+ S LDQL      P V FY +P       H    +
Sbjct  1     MKIQVISKETIMPSSATPSPVQTYRFSLLDQLAPPFYVPVVLFYSAPDPEQDFDHVNIYE  60

Query  1571  ElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEMEKIKQL  1392
             +LK SLS+ LS  YPLAGR K D+  ++   +G  F+   V   ++ LL NPE++ ++QL
Sbjct  61    KLKTSLSECLSCFYPLAGRSKGDEHAVDL-GQGAVFVRTRVNARLAKLLANPELKLVQQL  119

Query  1391  IPSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGCA  1212
             +P    Y  Q     + A+Q+N F CGGI IG  +SH IAD + L+ F+  W + +RG  
Sbjct  120   LP-LDPYNIQCQNALVTAIQLNLFDCGGIGIGVCISHKIADGATLSTFLSSWGAISRG--  176

Query  1211  ANNGSGFVSDHSSILFPPLTDTSAI----EQLMKMGAEGIEQEEKDMIVKRFVIPANAIA  1044
                        +S L  P  DT+ I    E  + +    I++E+  ++ KRF   + ++A
Sbjct  177   -----------ASKLVAPYQDTTTIFPPREFRVPLPNNLIKKEK--IVTKRFEFDSASLA  223

Query  1043  QLRQDLTITGGSVQRPSRVEALTALVWAAVINA------TPTQTATLSCMVNLRRRMEPP  882
              LR      G + + P  VEA+TAL+  A +NA          +  +S +VNLR RM PP
Sbjct  224   ALRTKAG-DGSTSKSPILVEAVTALICKAAMNARTEISGNGRSSTVISHVVNLRGRMNPP  282

Query  881   LPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLRA  702
             LP +  G +   A    +E +D        EL  R  ++ R V                 
Sbjct  283   LPDHSFGNIWRFATATIKEEEDDA------ELHVRACESMREV-----------------  319

Query  701   VIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKP--RLVVNMLDNSWVLFLDAING-  531
                  +EL+   D  +   SS  R  +YE DFGWGKP    + ++   + V+ + + +G 
Sbjct  320   -----HELMYKGDVESYRFSSWVRFPFYETDFGWGKPVWACISSVPIKNVVILMSSWSGN  374

Query  530   AVEVWMKLPKQVMHTLTQDRHFLAYVS  450
              +E W+ L +Q M     D   L +VS
Sbjct  375   GLEAWVTLDEQEMAKFQSDPLLLQFVS  401



>ref|XP_008222017.1| PREDICTED: vinorine synthase-like [Prunus mume]
Length=444

 Score =   184 bits (467),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 147/468 (31%), Positives = 226/468 (48%), Gaps = 60/468 (13%)
 Frame = -2

Query  1757  ITMKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYD-----SPTISGAC  1593
             + ++VEV SKEI +PSSPTP  L+  +LSFLDQL   +  PFV FY+      P I+   
Sbjct  1     MKVEVEVISKEIIKPSSPTPDHLRYLQLSFLDQLAPPVYNPFVLFYEFNGQTQPKITEIS  60

Query  1592  HHTKTIDElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPE  1413
              H K       SL+  L+L YPLAGRV +    ++C+DEGV ++ A V  ++S  L NP 
Sbjct  61    GHLKK------SLADVLTLFYPLAGRVFKQNHFVDCNDEGVPYVEAQVKCSLSDFLNNPI  114

Query  1412  MEKIKQLIPSAKVYEPQPVGKAL-VAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIW  1236
              +++K+ IP     E   +   L + VQ+N F CGG AIG  +SH IAD  +   F + W
Sbjct  115   PDELKKFIP----LELDNIANELALGVQLNIFECGGFAIGQCISHKIADGLSHFMFSKTW  170

Query  1235  ASFNRGCAAN-NGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIP  1059
             A+   G         FV   S+ LFPP        +   +G +      ++ + KRFV  
Sbjct  171   AATALGDQPRIERPEFV---SAALFPP--------KEFNIGYDAGIGITRNRVTKRFVFD  219

Query  1058  ANAIAQLRQDL-----------TITGGSVQRPSRVEALTALVWAAVINATPTQTA-----  927
              + I  L+               ++  + + PSRVEAL+A +W+  +  T          
Sbjct  220   TSKIESLKTKYKGEDSSGFNSRALSLENEKGPSRVEALSAFIWSRFVATTKDDAGHDEKH  279

Query  926   -TLSCMVNLRRRMEPPLPPNCLGTLVDEA-----IVLCQEAKDGGTVVTAVELVQRIRDA  765
               +   VNLR R +PPLP +C G L   A     ++   E  + G V+T      ++R+ 
Sbjct  280   YIVLHSVNLRPRFDPPLPQHCFGNLYRGAMTAPFLLSSGEECNYGAVIT------KVREE  333

Query  764   FRAVKDGEARKVYGEGGWLRAVIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRL  585
                + +   +++  +G    +V+    + V   +  T   SS CR   Y+ DFGWG+P  
Sbjct  334   INKINNDYIKRL-QQGIEHLSVLQESSDNVIRGEVDTFSFSSFCRFPVYDNDFGWGRPVW  392

Query  584   VVN--MLDNSWVLFLDAING-AVEVWMKLPKQVMHTLTQDRHFLAYVS  450
             V +  +   + V+F+D      +E ++ L ++VM     D  FLA VS
Sbjct  393   VSSPPLTFKNLVVFMDTKEADGIEAYISLEEEVMAKFECDTEFLACVS  440



>gb|KEH20539.1| HXXXD-type acyl-transferase family protein [Medicago truncatula]
Length=453

 Score =   184 bits (467),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 136/449 (30%), Positives = 222/449 (49%), Gaps = 27/449 (6%)
 Frame = -2

Query  1751  MKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGACHHTKTID  1572
             M++E+ S+E  +PSSPTP  L+ Y LSF+D +   L  P +FFY+    S        + 
Sbjct  1     MEIELISRETIKPSSPTPTHLRIYPLSFIDNIFFRLYVPVIFFYNPNECSD---QNSKVS  57

Query  1571  ElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEMEKIKQL  1392
              L+KSLS+ LS  YP AGR+K DK+TIEC+D+GV F+V  +   +S +L+NP  + +  L
Sbjct  58    LLRKSLSQLLSKYYPFAGRLK-DKITIECNDQGVSFLVTKIKNKLSEILKNPTDKILNPL  116

Query  1391  IPSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGCA  1212
              P    ++       L+AVQ+N F+CGG+AI   +SH I DAS +  FM  W+  N+   
Sbjct  117   FPDKLQWKDMDWSDTLIAVQINCFACGGMAISICMSHKIGDASTIFNFMNDWSIINQKLQ  176

Query  1211  ANNGSGFVSDHSSILFP-PLTDTSAI---EQLMKMGAEGIEQEEKDMIVKRFVIPANAIA  1044
                      D   ++ P PL D  A    ++ + +  E +   + +++ KRFV   + I 
Sbjct  177   EEE-----EDKGLLVLPFPLLDGGASVFPQRDLTIFPELVLTRKNNVVCKRFVFQPSMIK  231

Query  1043  QLRQDLTITGGSVQRPSRVEALTALVW--AAVINATPTQTATLSCMVNLRRRMEPPLPPN  870
              L+  +  +      PSRV+A+TA ++  A  +     QTA  S  V+LR+RM P L   
Sbjct  232   SLKA-MATSSSMHSPPSRVQAVTAWIYKRAVSLMGLNFQTALFSMGVDLRKRMVPALSEK  290

Query  869   CLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLRAVIAR  690
             C+G +V  + ++  + +     +   ELV +I++      D        +     ++I+ 
Sbjct  291   CVGNIVWFSSMVADKKE-----MELHELVSKIKEGLSQFGDFIPETFGAKENENLSLISE  345

Query  689   GYELVR--NRDSSTLYT-SSLCRMAYYEVDFGWGKPRLVVNM--LDNSWVLFLDAING-A  528
               + V   + ++  L+T SS CR   YE +FGWG P  V        + +  +D  +G  
Sbjct  346   CLKQVTEPHPENENLFTFSSWCRFPMYETNFGWGNPTWVTTFGCSSRNIIFLMDTKDGEG  405

Query  527   VEVWMKLPKQVMHTLTQDRHFLAYVSAFP  441
             +E  + +    M     +   L + S  P
Sbjct  406   IEAIVNMEDNYMTKFEHEVELLRHASLNP  434



>gb|KCW68076.1| hypothetical protein EUGRSUZ_F01760 [Eucalyptus grandis]
Length=449

 Score =   184 bits (466),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 151/460 (33%), Positives = 225/460 (49%), Gaps = 41/460 (9%)
 Frame = -2

Query  1751  MKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGACHHTKT--  1578
             M+V V SKE  +P SPTP  LK +KLS LDQ       P V FY   TI  A     T  
Sbjct  1     MEVVVVSKEFVKPYSPTPNHLKIHKLSLLDQFMPTAYVPLVLFY---TIEEADRAATTPL  57

Query  1577  --IDElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEMEK  1404
               +  LK+SLS+TL L YPLAG++  D ++IECDD+GV  + A      S LL  P+ E 
Sbjct  58    RMVQLLKQSLSETLPLFYPLAGKINGDGLSIECDDDGVLLVEARAEFAPSRLLHQPDFET  117

Query  1403  IKQLIPSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFN  1224
             +++ +P A  +    VG  +  VQV  F CGG+ +G  +SH  AD ++ + F++ WA+  
Sbjct  118   VRKFLPCAAAWRRTEVGDRVAMVQVTVFPCGGVVVGVLISHTAADGASFSTFLKGWAAAA  177

Query  1223  RGCAANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIA  1044
             R         F    +  LF  + + +  E+    G   + +       +R V  A+A+A
Sbjct  178   RKTGEAPRPSF---DAPTLF--IQNKAFSEEDTFFGMCPVNRGRYG--TRRLVFDASAMA  230

Query  1043  QLRQDLTITGGSVQRPSRVEALTALVWAAVINATPTQTATLS------CMVNLRRRMEPP  882
             +L+      G  VQ P+R E +TAL+  + + AT T+ + L         VNLRRR  P 
Sbjct  231   RLKAKTANVG--VQNPTRAEVVTALMCKS-LTATMTKVSGLDKPVVFPNAVNLRRRAVPN  287

Query  881   LPPNCLGTLVDEAIVLCQ-EAKDGGTVVTAVELVQRIRDAFRAVKDGE-ARKVYGEGGW-  711
                + +G  V    +LCQ E KD   + +   L+  +R+A ++  DGE  R + G+GG+ 
Sbjct  288   FHDDSMGNYVWLPTILCQLEEKDYDGLPS---LIGWLREA-KSKIDGEFVRGLEGDGGFN  343

Query  710   -LRAVIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVV---------NMLDNS  561
              L+  +    E +   D    + SS C   +YE+DFGWG+P  V          N++ N 
Sbjct  344   ALQDALRETRESLARTDRLVSF-SSWCNFGHYEIDFGWGRPAWVSPVGFPEESENLIGNG  402

Query  560   WVLFLDAINGAVEVWMKLPKQVMHTLTQDRHFLAYVSAFP  441
              +L        VE W+ + +Q +  L QD     Y S  P
Sbjct  403   VLLLDTRCRKGVEAWVFMDEQELEVLEQDEELTEYASINP  442



>gb|KDO52922.1| hypothetical protein CISIN_1g036706mg [Citrus sinensis]
Length=470

 Score =   184 bits (467),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 148/469 (32%), Positives = 229/469 (49%), Gaps = 46/469 (10%)
 Frame = -2

Query  1751  MKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGACHHTKTID  1572
             M VE+ SKE  +PSSPTP  LK YKLS LDQLH +   P   +Y     +     +  ID
Sbjct  1     MDVEIISKEFIKPSSPTPLHLKTYKLSLLDQLHDHCYPPVSLYYPLKQDTELSISSTDID  60

Query  1571  E--------lkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENP  1416
             +        LK+SLS+TLS  YPLAG++K DK++++C+DEG+ F  A     ++  L  P
Sbjct  61    QIVSKRLQLLKQSLSETLSSFYPLAGKMK-DKLSVDCNDEGIYFAEARAKCTLNEFLNRP  119

Query  1415  EME----KIKQLIPSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKF  1248
             ++     K   ++ + +    +  G  +  +QV RFSCGG+ I   + H +AD   L  F
Sbjct  120   DLSLVIFKFHPVVGNEQRQSKEIAGAHVGKIQVTRFSCGGLVICACILHMVADGVTLGSF  179

Query  1247  MEIWASFNRGCAANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRF  1068
             +  WA+        + S   +   S LFP    T   E      A    +  K  +V+RF
Sbjct  180   LMSWAARAGKNIGEDTSICPNYEISSLFPQNDHTYPRE------ATAFSKSGK-FVVRRF  232

Query  1067  VIPANAIAQLRQDLTITGGSVQRPSRVEALTALVWAAVINATPTQTAT-----LSCMVNL  903
             V  A AIA L+   T +  S+Q PSRVE +TAL+   ++ A   ++ +     L+ ++NL
Sbjct  233   VFDAQAIANLKAKATTSSTSLQNPSRVEVVTALISKRIMAAFKAKSGSYKPTLLTRVLNL  292

Query  902   RRRMEPPLPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYG  723
             R  + PPL  N  G  V  A  LC++  D    V    LV ++R++F  V     +++ G
Sbjct  293   RPLVRPPLSENSFGNFVWNADALCKDHDDE---VELDGLVWKLRESFTKV----VKRLQG  345

Query  722   EGGWLRAVIARGYELVRNRD-----SSTLYTSSLCRMAYYEVDFGWGKP-RLVVNMLDNS  561
             +G      +  G +   N++        +  SS+C+  +Y++DFGWGKP  +     D S
Sbjct  346   DGEGSLISLCEGIK-DENKEVFADAKDRISFSSVCKFPFYDIDFGWGKPIWMNFTSFDGS  404

Query  560   WVLFLDAI-------NGAVEVWMKLPKQVMHTLTQDRHFLAYVSAFPKP  435
              V F + +          +E W+ L ++ +  L  DR  L + S  P P
Sbjct  405   IVQFANFVILSDTRSGDGIEAWLHLLEEDLALLELDRELLGFASLDPTP  453



>ref|XP_007134037.1| hypothetical protein PHAVU_010G014100g [Phaseolus vulgaris]
 gb|ESW06031.1| hypothetical protein PHAVU_010G014100g [Phaseolus vulgaris]
Length=432

 Score =   183 bits (465),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 143/452 (32%), Positives = 223/452 (49%), Gaps = 44/452 (10%)
 Frame = -2

Query  1751  MKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFY---DSPTISGACHHTK  1581
             +KVE+ SKE  + SSP P  LK++KLS LDQL      P + FY   D+  I+   H+ K
Sbjct  3     VKVEIVSKERVKASSPPPNKLKHFKLSLLDQLAPPFYVPVLLFYSASDATDITTISHNLK  62

Query  1580  TIDElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEMEKI  1401
                    SLS+ L+L YP  G ++ D  T+EC+ EGV F  + +  ++S +L+NP + +I
Sbjct  63    A------SLSQLLTLYYPFCGTLR-DNSTVECNHEGVLFTHSTLPIHLSTILKNPHLHRI  115

Query  1400  KQLIPSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNR  1221
              QL P       +      + VQ+N+FSCGG+A+    SH IADAS+ A F+  WA+ +R
Sbjct  116   NQLFPLDPYNPARDTLLETMVVQLNQFSCGGVALAVCFSHKIADASSAASFLTAWAATSR  175

Query  1220  GCAANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQ  1041
                 N       +  +++FPP      IE  +  G  G     KD++ KRF+     I++
Sbjct  176   K-EENILIAPQMEEGALVFPP----RKIEMDITRGMVG----HKDIVTKRFMFNRTNISR  226

Query  1040  LRQDLTITGGSVQ-RPSRVEALTALVWAAVINATPTQT-------ATLSCMVNLRRRMEP  885
             L+Q +    GS++  P+ VEA+TAL+W + + A    +       + +S  VN+R RM  
Sbjct  227   LKQKV----GSLEFFPTSVEAVTALIWKSSLEAAKASSEEGKFPASMVSHAVNIRSRMAS  282

Query  884   PLPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLR  705
              L  + +G L  +A+    E +     V   +L +R+R+  R V      K+ G+  +  
Sbjct  283   TLGKHSMGNLWQQAVSPLVEVEGE---VGLRDLGERVRETIRKVDGNYVSKLQGDEFY--  337

Query  704   AVIARGYELVRNRDSST---LYT-SSLCRMAYYEVDFGWGKPRLVVNM---LDNSWVLFL  546
               +  G +  R   S      Y+ SS  R   YE DFGWGKP  V  +   + N  +L  
Sbjct  338   -EVIEGLKEARRMASEKGVPCYSFSSWVRFGLYETDFGWGKPSYVRTIGVPIKNVVILMP  396

Query  545   DAINGAVEVWMKLPKQVMHTLTQDRHFLAYVS  450
               +   +E W+ L    M    Q+   L ++S
Sbjct  397   TKVGDGIEAWITLTTNDMLHFQQNPELLHFLS  428



>gb|AES72092.2| anthranilate N-benzoyltransferase [Medicago truncatula]
Length=416

 Score =   183 bits (464),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 145/445 (33%), Positives = 228/445 (51%), Gaps = 39/445 (9%)
 Frame = -2

Query  1757  ITMKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGACHHTKT  1578
             + ++VE+ SKEI +PSSPTP  L++Y+LSFLDQ+   +  P V FY     + A +    
Sbjct  1     MKLEVEIISKEIIKPSSPTPSHLRHYQLSFLDQIAPMVYNPIVLFYSH---NDALNTATI  57

Query  1577  IDElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAE-NMSCLLENPEMEKI  1401
              + LKKSLSK L+  YPLAGR+  +K  I+C+DEG+ +I   +   N+  +++NP   ++
Sbjct  58    SNTLKKSLSKILTHFYPLAGRM-NNKNFIDCNDEGIPYIETKITNYNLKDIIQNPIPNEL  116

Query  1400  KQLIPSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNR  1221
              +LIP    ++   +      +Q+N FSCGGIAIG  +SH IAD  +   F+  WA+  R
Sbjct  117   NRLIP----FQLDDITNIAFGIQLNFFSCGGIAIGACLSHQIADGLSFFNFLNSWANITR  172

Query  1220  GCAANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQ  1041
                       + D SS LFPP  + S  +        GI +E  +++ K FV  A+ +  
Sbjct  173   KLIFPKP---IFD-SSKLFPP-KNISGFDP-----RSGIAKE--NIVCKIFVFNADVVEN  220

Query  1040  LRQDLTITGGSVQRPSRVEALTALVWA----AVINATPTQTATLSCMVNLRRRMEPPLPP  873
             LR            P+RVEAL+A +W+     + N    +   +   VNLR++MEPPLP 
Sbjct  221   LRAKYINFN-----PTRVEALSAFIWSRYVDVIYNDGVQRNYGVVHAVNLRQKMEPPLPL  275

Query  872   NCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLRAVIA  693
                G  +   I + +   + G       L +++RD  + + D E  K   EG      + 
Sbjct  276   ESFGNYLRFTITIPK--MNSGE--ECYGLAKQVRDEIKKI-DKEYVKKVQEGKEHLEFLK  330

Query  692   RGYELVRNRDSSTLYT-SSLCRMAYYEVDFGWGKPRLVVNMLDN--SWVLFLDAIN-GAV  525
               ++ V  ++   ++  +SLCR   Y+ DFGWGKP  V +   N  + V+F+D  + G +
Sbjct  331   ESFDRVIVKEELVVFNFTSLCRFPLYDADFGWGKPIWVGSTALNFKNLVVFVDCKDGGGI  390

Query  524   EVWMKLPKQVMHTLTQDRHFLAYVS  450
             E ++ L  + M     D   LA V+
Sbjct  391   EAYVSLKVEDMVKFEADLELLACVN  415



>gb|AFK43775.1| unknown [Medicago truncatula]
Length=416

 Score =   182 bits (463),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 146/445 (33%), Positives = 227/445 (51%), Gaps = 39/445 (9%)
 Frame = -2

Query  1757  ITMKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGACHHTKT  1578
             + ++VE+ SKEI +PSSPTP  L++Y+LSFLDQ+   +  P V FY     + A +    
Sbjct  1     MKLEVEIISKEIIKPSSPTPSHLRHYQLSFLDQIAPMVYNPIVLFYSH---NDALNTATI  57

Query  1577  IDElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAE-NMSCLLENPEMEKI  1401
              + LKKSLSK L+  YPLAGR+  +K  I+C+DEG+ +I   +   N+  +++NP   ++
Sbjct  58    SNTLKKSLSKILTHFYPLAGRM-NNKNFIDCNDEGIPYIETKITNYNLKDIIQNPIPNEL  116

Query  1400  KQLIPSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNR  1221
              +LIP    ++   +      +Q+N FSCGGIAIG  +SH IAD  +   F+  WA+  R
Sbjct  117   NRLIP----FQLDDITNIAFGIQLNFFSCGGIAIGACLSHQIADGLSFFNFLNSWANITR  172

Query  1220  GCAANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQ  1041
                    S  + D SS LFPP  + S  +        GI +E  +++ K FV  A+ +  
Sbjct  173   KLIF---SKPIFD-SSKLFPP-KNISGFDP-----RSGIAKE--NIVCKIFVFNADVVEN  220

Query  1040  LRQDLTITGGSVQRPSRVEALTALVWA----AVINATPTQTATLSCMVNLRRRMEPPLPP  873
             LR            P+RVEAL+A +W+     + N    +   +   VNLR++MEPPLP 
Sbjct  221   LRAKYINFN-----PTRVEALSAFIWSRYVDVIYNDGVQRNYGVVHAVNLRQKMEPPLPL  275

Query  872   NCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLRAVIA  693
                G  +   I + +   + G       L +++RD  + + D E  K   EG      + 
Sbjct  276   ESFGNYLRFTITIPK--MNSGE--ECYGLAKQVRDEIKKI-DKEYVKKVQEGKEHLEFLK  330

Query  692   RGYELVRNRDSSTLYT-SSLCRMAYYEVDFGWGKPRLVVNMLDN--SWVLFLDAIN-GAV  525
               ++ V  ++   ++  +SLCR   Y+ DFGWGKP  V +   N  + V+F D  + G +
Sbjct  331   ESFDRVIVKEELVVFNFTSLCRFPLYDADFGWGKPIWVGSTALNFKNLVVFFDCKDGGGI  390

Query  524   EVWMKLPKQVMHTLTQDRHFLAYVS  450
             E ++ L    M     D   LA V+
Sbjct  391   EAYVSLKVGDMVKFEADLELLACVN  415



>ref|XP_006415801.1| hypothetical protein EUTSA_v10007650mg [Eutrema salsugineum]
 gb|ESQ34154.1| hypothetical protein EUTSA_v10007650mg [Eutrema salsugineum]
Length=441

 Score =   183 bits (465),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 141/455 (31%), Positives = 224/455 (49%), Gaps = 43/455 (9%)
 Frame = -2

Query  1757  ITMKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGACHHTKT  1578
             + +++ V S+E+ +PSS +   L  + LSFLDQ+  +   PF+FFY +          + 
Sbjct  1     MELEITVTSQELIKPSSLSINHLPYHYLSFLDQIAPSFFMPFLFFYHNKR---NLSDRER  57

Query  1577  IDElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEMEKIK  1398
              D +K SLSK L+L YPLAGR+K     + C+D GV F+ A    NMS +LENP   ++ 
Sbjct  58    ADHIKSSLSKILNLFYPLAGRIKNSGNVVLCNDVGVSFVEAKAGCNMSQILENPNPYELD  117

Query  1397  QLIPSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRG  1218
               +P    ++   VG   + +Q+  F CGG+A+G  + H + DA +   F+  WA+F RG
Sbjct  118   MFLP----FKFDEVGDVPLKIQLTFFECGGLALGIGLCHKLCDAMSGLIFIRSWAAFARG  173

Query  1217  CAANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQL  1038
                   +   S   + +FPP       E+L    A  I  E  +M+ +RFV   +++  L
Sbjct  174   HTDEIVTP--SFDMAKMFPP----RGTEELNM--ATSITNE--NMVTRRFVFSKSSVESL  223

Query  1037  RQDLTITGGSVQRPSRVEALTALVWA---AVIN--ATPTQTATLSCMVNLRRRMEPPLPP  873
             R     +G    R +RVEAL+A +W+   A IN      +  TL   VNLRR+ +P +P 
Sbjct  224   RA--RFSGNKKFRATRVEALSAFLWSRFVATINRDGKTEKIYTLKHTVNLRRKADPFIPD  281

Query  872   NCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLRAVIA  693
             +  G +   ++ + +   +     +   LV++IR+  R +     +K+  +        +
Sbjct  282   HMFGNIRSFSVTVPKMIINEDDDESKPSLVEQIREDIRKIDAKHVKKIQED--------S  333

Query  692   RGYELVRNRDSS--------TLYTSSLCRMAYYEVDFGWGKPRLVVNMLDN--SWVLFLD  543
             R +   +NR  S         L  +SLC    YE DFGWGKP  + +   N  + V+F+D
Sbjct  334   RAHLEFQNRQVSGFVKGEIVPLSFTSLCNFPVYEADFGWGKPLWLGSTRRNRKNQVVFID  393

Query  542   AI-NGAVEVWMKLPKQVMHTLTQDRHFLAYVSAFP  441
                 G +E W+ L +  M  L  D   L YVS+ P
Sbjct  394   TKEGGGIEAWINLDQNDMSMLESDGELLRYVSSNP  428



>ref|XP_004240930.1| PREDICTED: vinorine synthase-like [Solanum lycopersicum]
Length=439

 Score =   183 bits (465),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 145/467 (31%), Positives = 227/467 (49%), Gaps = 51/467 (11%)
 Frame = -2

Query  1751  MKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGACHHTKTID  1572
             M V+V S+EI +P  PTP+ L+NYK+SF+DQ       P + FY++       H  K + 
Sbjct  1     MDVKVISEEIIKPCIPTPRHLRNYKISFIDQFTPCSYIPVILFYNAN--DDVDHELKPMQ  58

Query  1571  ElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEMEKIKQL  1392
                 +L++TLS  YPLAGR K D  +IEC+DEGV ++ A    N+S  L+NP++  + + 
Sbjct  59    ---VALAETLSYYYPLAGRFK-DVYSIECNDEGVVYVEAQANFNLSKFLQNPDIPFLNKF  114

Query  1391  IP-SAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGC  1215
             +P      EP    + LVA+Q   F CGG+AIG  + H + DAS ++ F++ WA  +RG 
Sbjct  115   LPFKGNCLEPS-YNQPLVALQTTAFECGGMAIGVCMLHKVVDASTMSVFLKTWAKISRG-  172

Query  1214  AANNGSGFVSDHSSI--LFPPLTD--TSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAI  1047
                       D +S   LFPP+    T  I        +G +       ++RF+  + +I
Sbjct  173   --EGDKTLHPDFTSAISLFPPIDSLPTKFITDFDNFYFQGSKSP-----MRRFLFDSKSI  225

Query  1046  AQLRQDLTITGGSVQRPSRVEALTALVW----AAVINATPTQTATLSCMVNLRRRMEPPL  879
               L+ +   +  SV  PS++EALTA +     AA++     +T  ++   NLR R++PPL
Sbjct  226   KALKAN--TSSESVPFPSKIEALTAFICKRIGAALMANNVPKTLMITHAANLRPRVDPPL  283

Query  878   PPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAF-----RAVKDGEARKVYGEGG  714
             P    G L+  A            +    +L   +R+ F       +KD ++  V+    
Sbjct  284   PQKTFGNLLWLAFAFYDPLDTNNEL---PDLGIMLREVFAQLTAENIKDIDSECVFES--  338

Query  713   WLRAVIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVVNMLD---------NS  561
              L  V+     L  N +  T   +S C M  Y+V+FGWGKP  V +M D           
Sbjct  339   -LSEVLE---SLSTNENIKTYRFTSWCNMGLYDVNFGWGKPVWVAHMGDLPAANVRSKQQ  394

Query  560   WVLFLDAINGAVEVWMKLPKQVMHTLTQDRHFLAYVSAFPKPKL*IQ  420
             +V    A    +E+W+   ++ +  L +D  FLAY +  P P + I 
Sbjct  395   FVFIESASRQGIELWVASDEEEIRFLEKDAEFLAYAN--PNPSICIN  439



>ref|XP_009361769.1| PREDICTED: BAHD acyltransferase At5g47980-like [Pyrus x bretschneideri]
Length=446

 Score =   183 bits (465),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 132/450 (29%), Positives = 225/450 (50%), Gaps = 42/450 (9%)
 Frame = -2

Query  1751  MKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFY---DSPTISGACH-HT  1584
             M+ E+  +E  +PSSPTPQ L+N+KLS L+QL        V FY   DS T   +     
Sbjct  1     MEFEMIKRETLKPSSPTPQYLRNFKLSLLNQLSPAAYESLVLFYPGNDSTTNQSSLRILK  60

Query  1583  KTIDElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEMEK  1404
             K++ E            YPLAGR+K D ++++C+D GV+++ A V   +S  L  P+   
Sbjct  61    KSLSETLVR-------FYPLAGRMK-DNISVDCNDYGVDYVEAKVNGLLSTFLSQPDAGT  112

Query  1403  IKQLIPSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFN  1224
             ++QL+P A    P+    AL+ VQ N F C G+AIG  +SH +ADA++L+ F+  W++  
Sbjct  113   LRQLLPVA-TESPEASKGALLLVQANVFGCSGLAIGMCMSHKLADAASLSTFIMSWSATA  171

Query  1223  RGCAANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIA  1044
              G +      F    +S  FPP+  +S+  Q  ++GA     + ++ + KRFV  A+ I+
Sbjct  172   LGFSQALLPDFT---ASFRFPPIDYSSSFHQSSQVGA-----KRENCVTKRFVFNASKIS  223

Query  1043  QLRQDLTITGGSVQRPSRVEALTALVWAAVINAT--------PTQTATLSCMVNLRRRME  888
              LR     T   V +P++ EA+TAL+W   + A+        P + + LS  V++R+ + 
Sbjct  224   ALRTKAAST--IVDQPTQAEAVTALIWRCAVAASRSSNSLQPPPKLSVLSQSVDIRKSVV  281

Query  887   PPLPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWL  708
             PPL  + +G L+        E +     +    LV ++R     + +  A++   +    
Sbjct  282   PPLSDDSIGNLMGYFAAQTDENE-----LELQGLVAQLRRGIEELSNNYAKRPGKDQAIR  336

Query  707   RAVIARGYELVRNRDSSTLYTSSLC--RMAYYEVDFGWGKPRLVVNM--LDNSWVLFLDA  540
              +V       V+  D+   Y  +        YEV+FGWGKP  + N+    ++ V +L +
Sbjct  337   ESVTEVHNNFVKRDDTINFYVGTDLGNYKLLYEVNFGWGKPIWLSNVPAASSTNVAYLVS  396

Query  539   I--NGAVEVWMKLPKQVMHTLTQDRHFLAY  456
                +  +E W+ L ++ M    +++  LA+
Sbjct  397   TRKDDGIEAWVTLSEEDMAAFERNQELLAF  426



>ref|XP_009588476.1| PREDICTED: vinorine synthase-like [Nicotiana tomentosiformis]
Length=443

 Score =   183 bits (465),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 132/456 (29%), Positives = 229/456 (50%), Gaps = 35/456 (8%)
 Frame = -2

Query  1751  MKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGACHHTKTID  1572
             M+V++ S E+ +PSSPTP  LKN+ L  LDQL      P + FY +  +     H K+  
Sbjct  1     MEVKLISTEMIQPSSPTPNHLKNFSLCLLDQLIPASYAPIILFYTN--LGDIKVHEKSA-  57

Query  1571  ElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEMEKIKQL  1392
              LKKSL+ TLS  YPLAGR K D+++I+C+D+GV ++  +V   +   L  P +E I Q 
Sbjct  58    LLKKSLADTLSRFYPLAGRFK-DELSIDCNDQGVNYVTTNVNCLLIEFLNEPNLESIGQF  116

Query  1391  IPSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGCA  1212
             +P    ++    G  +  +Q+N F CGGIAIG  ++H I D   L+ F++ WA     C+
Sbjct  117   LPCQPPFKELVGGDCVTNIQINVFECGGIAIGLCIAHKILDGVGLSTFLKYWAGL--ACS  174

Query  1211  ANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQLRQ  1032
             +N       +  +  F P  D    +  M M +   ++   + I +RFV  A+AI  L+ 
Sbjct  175   SNEVQ--CPNLMANYFFPADDLWLRDTSMTMWSSLFKK--GNFITRRFVFNASAIDNLKT  230

Query  1031  DLTITGGSVQRPSRVEALTALVWAAVINATPTQTAT--------LSCMVNLRRRMEPPLP  876
                 T   ++ P++VE +++ +W   I A+  ++ +        L+ +VNLR+R  P LP
Sbjct  231   --MSTSSHIKHPTKVEVVSSFIWKCSIAASKEKSCSNKRPSNSLLTHIVNLRKRAAPALP  288

Query  875   PNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGW--LRA  702
              N LG L    + L          +   +LV ++R + R + D   +++  + G+  +R 
Sbjct  289   ENILGNL----LWLSSAKNTAKHEMGLPDLVNQVRKSIRRIDDHYVKRLRSDEGFNLMRK  344

Query  701   VIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVVNMLDNSWVLFLDAI-----  537
              +    +          +T S C+  +Y++DFG+GKP + ++ + +    F++ I     
Sbjct  345   SLNEIGDFCTKGADHYGFT-SWCKFGFYDIDFGFGKP-IWISSISSRCSFFMNLIILMET  402

Query  536   --NGAVEVWMKLPKQVMHTLTQDRHFLAYVSAFPKP  435
                  +E W+ L ++ M+ L  ++  + + S  P P
Sbjct  403   KCVDGIEAWVTLDEEEMNMLVGNQELVVFASIDPSP  438



>gb|KDO58317.1| hypothetical protein CISIN_1g037128mg [Citrus sinensis]
Length=460

 Score =   183 bits (465),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 143/468 (31%), Positives = 229/468 (49%), Gaps = 42/468 (9%)
 Frame = -2

Query  1751  MKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYD------SPTISGACH  1590
             M+VE+ S+E  +PSSPTP  LK++KL  LDQ   N+  P V +Y       S TI     
Sbjct  1     MEVEIISRESIKPSSPTPHDLKSHKLCLLDQFRSNIYVPRVLYYPLNQDDLSSTIDIDHI  60

Query  1589  HTKTIDElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEM  1410
              +K + +LK+SLS+ L   YPLAG++  +  +++C+DEGV F+ A    +++  L  P+ 
Sbjct  61    VSKRLQQLKQSLSEALVRFYPLAGKLT-NNFSVDCNDEGVYFVEAAAKIHLNEFLIQPDH  119

Query  1409  EKIKQLIP-SAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWA  1233
               I +  P        Q  G  +  VQV  F+CGG+ I   +SHA  D ++ + FM+ WA
Sbjct  120   NLIYKFFPVDGNEQRGQIAGAHVAKVQVTSFACGGLVICACISHAFGDGTSFSSFMKAWA  179

Query  1232  SFNRGCAANNGSGFVSDH--SSILFPPLTDTSAIEQLMKMGAEGIEQ--EEKDMIVKRFV  1065
             +  R   +   + ++  +  +S LFPP  D     QL         +  E    +V+RFV
Sbjct  180   ATARNKTSEEEAIYICPNYDASSLFPP-NDGDLFHQLKATSRASFGRFFETGKFVVRRFV  238

Query  1064  IPANAIAQLRQDLTITGGSVQRPSRVEALTALVWAAVINATPTQTAT-----LSCMVNLR  900
               A A A+L+         VQ P+RVE ++A +  +V+ A  T++ +     LS  VNLR
Sbjct  239   FDAKATAELKA--KAKSSRVQNPTRVEVVSATLSKSVMTAFKTRSGSLKPTLLSHAVNLR  296

Query  899   RRMEPPLPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGE  720
              +  PPL  N +G +V +   LC E +     V    LV ++R+A         + + G 
Sbjct  297   SKARPPLSENLIGNIVWKTNALCTEEE-----VDLDVLVWQLREALSKFDGDFVKSLQGV  351

Query  719   GGWLR-----AVIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVV------NM  573
             GG L+        A  Y   +N+    +  SS     +Y ++FGWGKP  V       ++
Sbjct  352   GGLLKLSEDIKCEAEAYSDAKNK----IMFSSWSTFGFYGINFGWGKPIWVSGACLGGSI  407

Query  572   LDNS-WVLFLDAING-AVEVWMKLPKQVMHTLTQDRHFLAYVSAFPKP  435
             +++S  ++ +D  +G  +E W+ L ++ M  L  D   L   +  P P
Sbjct  408   VESSPTIILMDTRSGNGIEAWVLLIEEDMALLEVDEKLLEVATIDPSP  455



>ref|XP_010090836.1| Vinorine synthase [Morus notabilis]
 gb|EXB40961.1| Vinorine synthase [Morus notabilis]
Length=462

 Score =   183 bits (465),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 156/474 (33%), Positives = 235/474 (50%), Gaps = 56/474 (12%)
 Frame = -2

Query  1754  TMKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGACHH----  1587
             T  VE+  +E  +PSSPTPQ L+ ++LS LDQL L +  P + FY   TI    HH    
Sbjct  5     TFNVEIVQRERIKPSSPTPQDLRIHELSILDQLALVIYIPIILFYPRRTIDDKRHHYSNC  64

Query  1586  -TKTID----ElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLE  1422
                 ID     LK SLSKTL+L YPLAGR+K+D   +EC+DEG E   A V   MS +LE
Sbjct  65    VNNNIDMIIYSLKSSLSKTLTLFYPLAGRIKQDYTVVECNDEGAELTEARVDHPMSEILE  124

Query  1421  N--PEMEKIKQLIPSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKF  1248
                P+ E +++L+ +  V   +    AL+ VQ+N F+CGG AIG  +SH +ADAS L+ F
Sbjct  125   RPAPDPEALRKLL-AVDVESKEASDGALLHVQINVFACGGTAIGVSLSHKVADASTLSMF  183

Query  1247  MEIWASFNRGCAANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRF  1068
             +  WA+  +    N+        S+ LFP      A     ++G       EK  +++R+
Sbjct  184   ISTWAATAK---LNHIEALPEFSSASLFP------ARHGHHQLGLNKELAREK-CLMRRY  233

Query  1067  VIPANAIAQLRQDLTITGGSVQRPSRVEALTALVWAAVINATP-------TQTATLSCM-  912
             V  A+ IA L+        SV+ P+RVE ++A++W   +  +        + ++T S   
Sbjct  234   VFDASNIAILKA--KSASSSVESPTRVEVVSAVIWKCALGVSRAKFRGKYSSSSTNSIYV  291

Query  911   -----VNLRRRMEPPLPPNCLGTLV------DEAIVLCQEAKDGGTVVTAVE-LVQRIRD  768
                  VN+RRR  PPLP    G LV       + +       D       V+ LV  +R 
Sbjct  292   QFRQDVNIRRRTSPPLPEILAGNLVGSFSAKHDLLRDHIADDDHDDPDDGVQVLVSELRK  351

Query  767   AFRAVKDGEARK-VYGEGGWLRAVI-ARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGK  594
                 +K+  ++  ++G    L+A+  +R Y+ V N        SS C   +YE DFGWG 
Sbjct  352   GIEEMKEDYSKGIIFGSEKMLKALKESRKYDHVVN-------CSSWCGFKFYEADFGWGL  404

Query  593   PRLV--VNMLDNSWVLFLDAING-AVEVWMKLPKQVMHTLTQDRHFLAYVSAFP  441
             P  V   ++   + V+ LDA +G  +E W+ L +  +  L  +    A+ +  P
Sbjct  405   PFWVSLASVAMKNIVVLLDARDGKGIEAWLTLGEDDVALLESNEVLRAFATFNP  458



>ref|XP_010425269.1| PREDICTED: BAHD acyltransferase At5g47980-like [Camelina sativa]
Length=425

 Score =   182 bits (463),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 143/454 (31%), Positives = 215/454 (47%), Gaps = 70/454 (15%)
 Frame = -2

Query  1754  TMKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGACHHTKTI  1575
             +M V+V S++I +PSS TP   K +KLS L+QL   +  P VFFY               
Sbjct  16    SMVVDVVSRDIIKPSSLTPNHSKKFKLSILEQLGPTIFGPMVFFYSG-------------  62

Query  1574  DElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEMEKIKQ  1395
                                      V+I+C+D G +F+ A+V+  +S LL+ P  + ++Q
Sbjct  63    ------------------------NVSIDCNDSGADFLEAEVSSPLSSLLQEPSSDSLQQ  98

Query  1394  LIPSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASF-NRG  1218
             LIP++ V   +   K L+A Q + F CG +AIG  +SH  ADA+++  FM+ WA+  +RG
Sbjct  99    LIPTS-VDSIETRTKLLLA-QASFFECGSMAIGVCISHKFADATSIGLFMKTWAAISSRG  156

Query  1217  CAANNGSGFVSDHSSILFPP--LTDTSAIEQLMKMGAEGIEQE--EKDMIVKRFVIPANA  1050
                  GS  V D   I FPP   ++TS         A  IE E      + KRFV  +++
Sbjct  157   SIKTVGSP-VFDTVKI-FPPGNFSETSP--------APVIEPEIMMNQTLSKRFVYDSSS  206

Query  1049  IAQLRQDLTITGGSVQRPSRVEALTALVWAAVINATPTQTAT-----LSCMVNLRRRMEP  885
             I  L+     +   V++P+RVEA++AL+W   + AT T + T     L+   +LR R+ P
Sbjct  207   IQSLQAK--ASSFEVKQPTRVEAVSALIWKTAMKATRTVSGTSKPSILANSASLRSRVSP  264

Query  884   PLPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLR  705
             P   N +G LV        +A++G        LV  +R A +  +D    K+ G      
Sbjct  265   PFTENSVGNLVS---YFAAKAEEGVNQTKLQTLVSELRKAKQRFRDNHVPKLVGNPNATE  321

Query  704   AVIARGYE---LVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLV--VNMLDNSWVLFLDA  540
              + +   E   ++ + D      SS CR   YE DFGWGKP  V   ++   + V  LD 
Sbjct  322   IICSYQREAGDMIASGDFDFYIFSSACRFGLYETDFGWGKPVWVGIPSVRQKNIVTLLDT  381

Query  539   IN-GAVEVWMKLPKQVMHTLTQDRHFLAYVSAFP  441
                G +E W+ L +Q M    QD   L +VS  P
Sbjct  382   KEAGGIEAWVNLNEQEMKLFEQDSELLQFVSLNP  415



>ref|XP_008226171.1| PREDICTED: BAHD acyltransferase At5g47980-like [Prunus mume]
Length=443

 Score =   183 bits (464),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 141/468 (30%), Positives = 216/468 (46%), Gaps = 63/468 (13%)
 Frame = -2

Query  1751  MKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFY-----DSPTISGACHH  1587
             +KV+V  +E  RPSSPTP  L++  LS  DQL   +  P + FY     D  + + A   
Sbjct  5     IKVDVSREETIRPSSPTPHHLRSSNLSVFDQLTPQVYVPLLLFYPSNNSDHHSPASAAER  64

Query  1586  TKTIDElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEME  1407
             +K +              YP AG ++ + V+I C+D G  F+ A V   MS +LE P++ 
Sbjct  65    SKLLKRSLSETLSH---FYPFAGTIQSNDVSICCNDHGATFVEARVNCLMSKILEKPDLG  121

Query  1406  KIKQLIPSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASF  1227
               KQL P+   +  Q     L+ VQ N F CGG+AIG  +SH I DA  L KF+  WA+ 
Sbjct  122   IQKQLHPNELEFMAQSGTCHLLLVQANFFECGGVAIGLNISHKIIDAYTLCKFINSWAAI  181

Query  1226  NRGCAANNGSGFVSDH---------SSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVK  1074
               G A        +DH         ++ LFPPL         +      I+  +++ I +
Sbjct  182   ALGSAN-------TDHVVPPVEFGAAASLFPPL-------DFLNSPQPSIDFVKENCITR  227

Query  1073  RFVIPANAIAQLRQDLTITGGSVQRPSRVEALTALVWAAVINATPTQT----ATLSC-MV  909
             R+V  A+ IA L+        +V  P+RVE ++AL+W  V+ A+ + +     ++ C  V
Sbjct  228   RYVFDASKIAALKS--KAVSAAVPNPTRVEVVSALIWKCVMEASRSNSDFVRPSVWCQFV  285

Query  908   NLRRRMEPPLPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKV  729
             N+R+ +      N  G L+  ++   +E +    V +   LV ++R         E +  
Sbjct  286   NMRKILPQAPAENLSGNLLGYSVAKTEEREVEHDVKS---LVSKLRKGLE-----EFKVK  337

Query  728   YGEGGWLRAVIARGYE---LVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRL--------V  582
             YG G     V  R  E   LV   D  T  ++S CR  +YE DFGWGKP          +
Sbjct  338   YGNGISREDVFQRCIELSKLVGKVDIDTYCSTSWCRFPFYEADFGWGKPSWMSIPSTVEI  397

Query  581   VNMLDNSWVLFLDAING-AVEVWMKLPKQVMHTLTQDRHFLAYVSAFP  441
              NM+       +D  +G  +EV + L  + M  +  ++  LAY S  P
Sbjct  398   KNMIS-----LVDVSDGIGIEVRLTLKDEDMAIIKSNQEMLAYASLNP  440



>gb|KHN12420.1| Vinorine synthase [Glycine soja]
Length=479

 Score =   184 bits (466),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 146/485 (30%), Positives = 232/485 (48%), Gaps = 62/485 (13%)
 Frame = -2

Query  1745  VEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGACHHTKTIDEl  1566
             +E  S+E  +PS+PTP  L+ + LSF+D +      P +FFY+SP    A     TI +L
Sbjct  1     MEFISRETIKPSNPTPPHLRIHPLSFIDHIVFRNYIPLLFFYNSPNHEQA----STISKL  56

Query  1565  kkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEMEKIKQLIP  1386
             KKSLS+ LS  YP AG+++ D+V+I+C+D+GV F+V  +  N+S +L+NP  E +  L P
Sbjct  57    KKSLSQVLSRYYPFAGKLR-DQVSIDCNDQGVSFLVTRLRCNLSTILQNPTEESLNPLFP  115

Query  1385  SAKVYEPQPVGKA--LVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGCA  1212
                 ++P     +  ++A+Q+N F+CGGIA+   + H + DA+ L+ F+  WA+ NR   
Sbjct  116   DELQWKPMSSSSSSSIIAIQINCFACGGIAMSVCMCHKVGDAATLSNFINDWATLNRQKE  175

Query  1211  ANNGSGFVSDHSSILFP-PLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQLR  1035
                 +  +     +L P P+   S   Q        +   E D + +RFV  A+ I  L+
Sbjct  176   LEQETAEL-----LLLPFPVPGASLFPQENLPVFPEVLFVENDTVCRRFVFEASKIDSLK  230

Query  1034  QDLTITGGSVQRPSRVEALTALVWAAVINATP--TQTATLSCMVNLRRRMEPPLPPNCLG  861
                T++  +V  P+RVE ++AL++   ++A    ++T +    VNLR R  PPLP   LG
Sbjct  231   S--TVSSHNVPNPTRVEVVSALIYNRAVSALGLISKTTSFRTAVNLRNRTVPPLPEKSLG  288

Query  860   TLV--------DEAIVLCQ----------EAKDGGTVVTAV-----------ELVQRIRD  768
              LV        D+ +              EAK  G +V  +           ELV +++ 
Sbjct  289   NLVWFLSFGAKDKDMPFVSECLKQAASVPEAKSVGNLVWFLFVLSPWETELHELVLKMKQ  348

Query  767   AFRAVKDGEARKVYGEG---GWLRAVIAR----------GYELVRNRDSSTLYTSSLCRM  627
                   D  A+K  GE     ++   + +          G +   ++  +    +S CR 
Sbjct  349   GLTEFCDTYAKKFGGEDKDMSFISECLKQAASVPEPQPGGSDDEESQIVTMFCCASWCRF  408

Query  626   AYYEVDFGWGKPRLVVNM---LDNSWVLFLDAINGAVEVWMKLPKQVMHTLTQDRHFLAY  456
               YE DFGWGKP         + NS VL      G +E  + + +Q M    +D   L Y
Sbjct  409   PMYEADFGWGKPVWFTTSECPVKNSIVLMDTRDGGGIEAIVNMEEQDMARFERDVELLKY  468

Query  455   VSAFP  441
              S  P
Sbjct  469   ASLNP  473



>ref|XP_003601841.1| Vinorine synthase [Medicago truncatula]
Length=496

 Score =   184 bits (467),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 145/443 (33%), Positives = 227/443 (51%), Gaps = 39/443 (9%)
 Frame = -2

Query  1757  ITMKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGACHHTKT  1578
             + ++VE+ SKEI +PSSPTP  L++Y+LSFLDQ+   +  P V FY     + A +    
Sbjct  1     MKLEVEIISKEIIKPSSPTPSHLRHYQLSFLDQIAPMVYNPIVLFYSH---NDALNTATI  57

Query  1577  IDElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAE-NMSCLLENPEMEKI  1401
              + LKKSLSK L+  YPLAGR+  +K  I+C+DEG+ +I   +   N+  +++NP   ++
Sbjct  58    SNTLKKSLSKILTHFYPLAGRM-NNKNFIDCNDEGIPYIETKITNYNLKDIIQNPIPNEL  116

Query  1400  KQLIPSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNR  1221
              +LIP    ++   +      +Q+N FSCGGIAIG  +SH IAD  +   F+  WA+  R
Sbjct  117   NRLIP----FQLDDITNIAFGIQLNFFSCGGIAIGACLSHQIADGLSFFNFLNSWANITR  172

Query  1220  GCAANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQ  1041
                       + D SS LFPP  + S  +        GI +E  +++ K FV  A+ +  
Sbjct  173   KLIFPKP---IFD-SSKLFPP-KNISGFDP-----RSGIAKE--NIVCKIFVFNADVVEN  220

Query  1040  LRQDLTITGGSVQRPSRVEALTALVWA----AVINATPTQTATLSCMVNLRRRMEPPLPP  873
             LR            P+RVEAL+A +W+     + N    +   +   VNLR++MEPPLP 
Sbjct  221   LRAKYINFN-----PTRVEALSAFIWSRYVDVIYNDGVQRNYGVVHAVNLRQKMEPPLPL  275

Query  872   NCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLRAVIA  693
                G  +   I + +   + G       L +++RD  + + D E  K   EG      + 
Sbjct  276   ESFGNYLRFTITIPK--MNSGE--ECYGLAKQVRDEIKKI-DKEYVKKVQEGKEHLEFLK  330

Query  692   RGYELVRNRDSSTLYT-SSLCRMAYYEVDFGWGKPRLVVNMLDN--SWVLFLDAIN-GAV  525
               ++ V  ++   ++  +SLCR   Y+ DFGWGKP  V +   N  + V+F+D  + G +
Sbjct  331   ESFDRVIVKEELVVFNFTSLCRFPLYDADFGWGKPIWVGSTALNFKNLVVFVDCKDGGGI  390

Query  524   EVWMKLPKQVMHTLTQDRHFLAY  456
             E ++ L  + M     D   LAY
Sbjct  391   EAYVSLKVEDMVKFEADLELLAY  413



>ref|XP_003537018.2| PREDICTED: vinorine synthase-like [Glycine max]
Length=530

 Score =   185 bits (469),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 149/476 (31%), Positives = 233/476 (49%), Gaps = 48/476 (10%)
 Frame = -2

Query  1754  TMKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGACHHT---  1584
              M+VE+ S +  +PS  TP     Y LS LDQ   ++  P V FY     S A   +   
Sbjct  64    NMEVEIISTQCIKPSCTTPNHPNTYNLSILDQFMPSIYIPMVLFYSFAQSSQANIDSTIT  123

Query  1583  -KTIDElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEME  1407
              + + +LK+SLS+ L+  YP AGRVK DK TI+C+DEGV +  A V+  ++     P   
Sbjct  124   QQRLKQLKESLSQVLTHFYPFAGRVK-DKFTIDCNDEGVHYTEAKVSCTLAEFFNQPNFS  182

Query  1406  K-IKQLIPSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWAS  1230
               I +L+P+  + E    G   + VQVN F+CGG+ IG  +SH IAD +  + F+  W S
Sbjct  183   SLIHKLVPNQPIMELATEGYTAM-VQVNCFACGGMVIGTLISHMIADGAGASFFLNSWGS  241

Query  1229  ---FNRGCAANNGSGFVSDHSSILFPPLTDTSAIEQLMK-MGAEGIEQEEKDMIVKRFVI  1062
                F+   A +    F +      FP   +  A       M   G    E  + ++RF+ 
Sbjct  242   NSNFSHQDAFDQFPNFDTP-----FPQNNNNYACPHDTNVMNLCGQFLNEGRVAMRRFLF  296

Query  1061  PANAIAQLR-QDLTITGGSVQRPSRVEALTALVW---AAVINAT-----PTQTATLSCMV  909
              A AI++LR Q  ++T   VQ P+RVE +T+L+    A V NA      PT    ++  V
Sbjct  297   DAEAISRLRAQGSSLT---VQNPTRVEVVTSLLCKCTAKVFNANFGLERPT---LITHAV  350

Query  908   NLRRRMEPPLPPNCLGTLVDEAIVLCQEAKDGGTVVTAV-ELVQRIRDAFRAVKDGEARK  732
             N+RRR  P  P +C+G     A+ L   +KD   ++  + +LV ++R+A  ++     + 
Sbjct  351   NMRRRASPMFPKSCMGNFAWLALALIMSSKDNKVIMELLPDLVVKLREAVSSINSDFVKG  410

Query  731   VYGEGGWL------RAVIARGYELVRNRDSSTLYT--SSLCRMAYYEVDFGWGKP---RL  585
               G+ G+       + +I +         S   Y   +S C    Y+VD+GWGKP     
Sbjct  411   FEGDEGYAKYCEVSKELIEKASSFAATTTSGVNYVHFTSWCNFGLYDVDYGWGKPIWVSC  470

Query  584   VVNMLDNSW----VLFLDAING-AVEVWMKLPKQVMHTLTQDRHFLAYVSAFPKPK  432
             V + +D+S     V+ +D  +G  +E W+ L +  M  L QD+  LA+ +  P P+
Sbjct  471   VADSVDDSMFFNAVILMDTPSGNGIECWVYLNEDEMAILQQDKELLAFSTLDPNPQ  526



>ref|XP_004310183.1| PREDICTED: vinorine synthase-like [Fragaria vesca subsp. vesca]
Length=435

 Score =   182 bits (463),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 156/466 (33%), Positives = 228/466 (49%), Gaps = 65/466 (14%)
 Frame = -2

Query  1757  ITMKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDS-----PTISGAC  1593
             + + VEV SKEI  PSSPTP  L++Y+LS LDQL   +  P V FY+S     P I+   
Sbjct  1     MKVDVEVTSKEIITPSSPTPAHLRHYQLSSLDQLAPLVYNPLVLFYESNDKTVPNITEIS  60

Query  1592  HHTKTIDElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPE  1413
              H K       SL++ L+L YPLAGR+K D   ++C+DEG+ ++ A V   +S  L+NP 
Sbjct  61    SHLKK------SLAEVLTLFYPLAGRIKHD-WCVDCNDEGIPYLEAQVNCKLSDFLKNPI  113

Query  1412  MEKIKQLIPSAKVYE-PQPVGKAL-VAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEI  1239
              +++ + +P    +E    + K L + VQ++ F CGG AIG  VSH +ADAS+   F + 
Sbjct  114   PDQLTKFVP----FELGDHIDKELALGVQLSVFDCGGFAIGQCVSHRLADASSYFMFSKT  169

Query  1238  WASFNRGCAANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIP  1059
             WA+  RG A           S   FPP  D  A +    +         K+ + KRF+  
Sbjct  170   WAATARGEANIEHPDLF---SGTRFPP-KDVLAYDPSFNIS--------KNKVTKRFLFN  217

Query  1058  ANAIAQLRQDLTITGG-----SVQRPSRVEALTALVW----AAVINATPTQTATLSCM--  912
             A  +  LR+   + G      + +RPSRV+ALT+ VW    A  I  T      L  M  
Sbjct  218   ATMLEALREKY-VEGAFGSKENQKRPSRVDALTSFVWSRYLANSIKITGADDEKLYIMIH  276

Query  911   -VNLRRRMEPPLPPNCLGTLVDEAIV--LCQEAKDGGTVVTAVELVQRIRDAFRAVKDGE  741
              VNLR R  PPLP N  G +   A+   L ++A +     T    ++ +R   + + D  
Sbjct  277   AVNLRPRFVPPLPQNSFGNIYRVAMTGPLLRDACN-----TYGRAMEEVRAEIKKIDDEC  331

Query  740   ARKVY--GEGGWLRAVIARG----YELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVV  579
              + +    E  W+      G     ELV      +L  +S CR   Y+ DFGWG+P  V 
Sbjct  332   VKGLQQGAEQSWIPVNENTGRLTELELV------SLGFTSYCRFPAYDNDFGWGRPAWVF  385

Query  578   N--MLDNSWVLFLDAING-AVEVWMKLPKQVMHTLTQDRHFLAYVS  450
             +  +   +   F+D   G  +E ++ L +Q+M     D  FLAYVS
Sbjct  386   SAPLTFKNLTAFMDTKEGDGIEAYIGLEEQLMAEFETDAEFLAYVS  431



>ref|XP_008377211.1| PREDICTED: vinorine synthase-like [Malus domestica]
Length=501

 Score =   184 bits (467),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 143/497 (29%), Positives = 224/497 (45%), Gaps = 67/497 (13%)
 Frame = -2

Query  1751  MKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYD-SPTISGACHHTKTI  1575
             M+V++ S E  +PSSPTPQ L+ +KLS LDQ   ++  P + F++ S +I     +  T 
Sbjct  6     MQVKIISDECIKPSSPTPQHLRTHKLSLLDQFIPSIYVPMILFFNPSSSIHPININITTP  65

Query  1574  DElkkslsktlsLM---YPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEMEK  1404
                +         +   +PLAGR++ D ++I+C+DE   +I A+V  N+S  L +P++  
Sbjct  66    MRSQLLKQSLSETLTHFHPLAGRIR-DSLSIDCNDERARYIEAEVDSNLSQFLNHPDLSF  124

Query  1403  IKQLIPSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFN  1224
             I Q +P    +     G  +  +Q+  F+CGG  +G FVSH + D +AL+ F + WA+  
Sbjct  125   ISQFLPGEASWHEAAPGAHVAMMQITNFACGGFVLGAFVSHMVVDGTALSAFFKAWAAAT  184

Query  1223  -RGCAANNGSGFVSDHSSILFP---PLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPA  1056
              R  A  N   ++        P   P  D    E  M M       +  + + +R V  A
Sbjct  185   FRYIATPNTPHYIYTKGKFDAPSLFPQNDAYPREATM-MALYYRFLKVGNCVTRRIVFDA  243

Query  1055  NAIAQLRQDLTITGGSVQRPSRVEALTALVWAAVI---------NATPTQTATL-SCMVN  906
              A+A L++       +V  P+RVE +TAL+W  ++         N    ++ TL +  VN
Sbjct  244   PALATLKR--KAASSTVPNPTRVEVVTALIWKHIMAAFNLKTERNIVQNRSTTLITHAVN  301

Query  905   LRRRMEPPLPPNCLGTLVDEAIVLCQ-------EAKDGGTVVT------AVELVQRIRDA  765
             LRRR  PP     +G  +  A  L Q       + +D    V          L + +R+A
Sbjct  302   LRRRAVPPFSEYTMGNFLSMAAALSQCSTEDNYQKEDNLAHVDDDRDHELGRLAKHVREA  361

Query  764   FRAVKDGEARKVYGEGGWLRAVIARGYELVRNRDSST------------LYTSSLCRMAY  621
                +     + + G+G          ++ +R   S T            +  SS C    
Sbjct  362   ISKLDGDFVQSLQGDGTRGLTKFCEPFKEIRETLSRTSADAADGQSLDCIGFSSWCNFGL  421

Query  620   YEVDFGWGKPRLV--------------VNMLDNSWVLFLDAING-AVEVWMKLPKQVMHT  486
             YEVDFGWGKP  V              +NM     V+ +D  +G  VE W+ L +Q +  
Sbjct  422   YEVDFGWGKPSWVSCVGGKRGADEPVYMNM-----VVLMDTRSGDGVEAWIYLDEQDIAI  476

Query  485   LTQDRHFLAYVSAFPKP  435
             L  D HFLA+VS  P P
Sbjct  477   LEHDPHFLAFVSLNPSP  493



>ref|XP_008372831.1| PREDICTED: BAHD acyltransferase At5g47980-like [Malus domestica]
 ref|XP_008346322.1| PREDICTED: BAHD acyltransferase At5g47980-like [Malus domestica]
Length=446

 Score =   182 bits (463),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 130/451 (29%), Positives = 227/451 (50%), Gaps = 44/451 (10%)
 Frame = -2

Query  1751  MKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFY-----DSPTISGACHH  1587
             M+ E+  +E  +PSSPTPQ L+N+KLS L+QL        V FY      +P IS     
Sbjct  1     MEFEMIKRETLKPSSPTPQYLRNFKLSLLNQLSPAAYESLVLFYPRNDXTTPQISLRILK  60

Query  1586  TKTIDElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEME  1407
              K++ E            YPLAGR+K D ++++C+D GV+++ A V   +S  L  P+  
Sbjct  61    -KSLSETLVR-------FYPLAGRMK-DNISVDCNDYGVDYVEAKVNGLLSTFLSQPDAG  111

Query  1406  KIKQLIPSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASF  1227
              ++QL+P      P+    AL+ VQ N F CGG+AIG  +SH +ADA++L+ F+  W++ 
Sbjct  112   TLRQLLP-VXTESPEAGKGALLLVQANVFGCGGLAIGICMSHKLADAASLSTFIMSWSAT  170

Query  1226  NRGCAANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAI  1047
               G +      F    +S  FPP+  +S+  Q     +  ++ + ++ + KRFV  A+ I
Sbjct  171   ALGFSQALLPDFT---ASFRFPPIDYSSSFHQ-----SSPVDAKRENCVTKRFVFNASKI  222

Query  1046  AQLRQDLTITGGSVQRPSRVEALTALVWAAVINAT--------PTQTATLSCMVNLRRRM  891
             + LR     T   V +P++ EA+TAL+W   + A+        P + + LS  V++R+ +
Sbjct  223   SALRTKAAST--IVDQPTQAEAVTALIWRCAVAASRSSNSLQPPPKLSVLSQSVDIRKSV  280

Query  890   EPPLPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGW  711
              PPL  + +G L+        E +     +    LV ++R   + + +  A++   +   
Sbjct  281   VPPLSDDSIGNLMGYFAAQTDENE-----LELQGLVAQLRRGIKELSNNYAKRPGKDQAI  335

Query  710   LRAVIARGYELVRNRDSSTLYTSSLC--RMAYYEVDFGWGKPRLVVNM--LDNSWVLFLD  543
               +V       V+  D+++ Y  +        YEV+FGWGKP  + N+    ++ V +L 
Sbjct  336   RESVKEVHNNFVKRDDTTSFYVGTDLGNYKLLYEVNFGWGKPIWLSNVPAASSTNVAYLV  395

Query  542   AI--NGAVEVWMKLPKQVMHTLTQDRHFLAY  456
             +   +  +E W+ L ++ M    +++  LA+
Sbjct  396   STRKDDGIEAWVTLSEEDMAAFERNQELLAF  426



>ref|XP_010044502.1| PREDICTED: vinorine synthase-like [Eucalyptus grandis]
Length=436

 Score =   182 bits (462),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 148/445 (33%), Positives = 219/445 (49%), Gaps = 28/445 (6%)
 Frame = -2

Query  1751  MKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGACHHTKTID  1572
             MK+ V SKE  +PS  TP   + Y+ S LDQL      P V FY +P       H    +
Sbjct  1     MKIRVISKETIKPSLVTPSQDQTYRFSLLDQLAPPFYVPVVLFYSAPEPDQDFDHVNIYE  60

Query  1571  ElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEMEKIKQL  1392
             +LK SLS+ L+  YPLAG++K D+  ++   +G  F+ A V   ++ LL NPE++ ++QL
Sbjct  61    KLKTSLSECLTCFYPLAGQIKGDEHAVDL-GQGAVFVKARVNARLAKLLANPELKLVQQL  119

Query  1391  IPSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGCA  1212
             +P    Y  +     + A+Q+N F CGGI IG  +SH IAD + L+ F+  WA+ +RG  
Sbjct  120   LP-LDPYNIKCQNALVTAIQLNLFDCGGIGIGICISHKIADGATLSTFLSSWAAISRG--  176

Query  1211  ANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQLRQ  1032
             AN       D ++ LFPP       E  + +    I++E+  ++ KRF     ++A LR 
Sbjct  177   ANKLVAPYLD-TTTLFPPR------EFQVPLPNNLIKKEK--IVTKRFEFDTASLAALRT  227

Query  1031  DLTITGGSVQRPSRVEALTALVWAAVINATPT------QTATLSCMVNLRRRMEPPLPPN  870
                  G + + P+ VEA+TAL+  + +NA          +  +S  VNLR RM PPLP +
Sbjct  228   KAG-NGSTSKSPTLVEAVTALICKSAMNARTEISGKGRSSTVISHAVNLRGRMNPPLPDH  286

Query  869   CLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGG--WLRAVI  696
               G +   AI   +E  D   +     L   +R A R +     RK+ GE G  W    I
Sbjct  287   SFGNIWRFAIATIKEDVDDAELHV---LADHLRTAIRKIDSDYMRKLQGEDGFHWACESI  343

Query  695   ARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVVNM---LDNSWVLFLDAINGAV  525
                 EL+   D  +   SS  R+ +YE DFGWGKP         + N+ +L        +
Sbjct  344   REVRELMYKGDVESYRFSSWVRLPFYETDFGWGKPVWACISSVPIKNAVILMSSRSGNGI  403

Query  524   EVWMKLPKQVMHTLTQDRHFLAYVS  450
             E W+ L +Q M     D   L +VS
Sbjct  404   EAWVTLDEQEMAKFQSDPLLLQFVS  428



>gb|KEH20540.1| HXXXD-type acyl-transferase family protein [Medicago truncatula]
Length=437

 Score =   182 bits (462),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 133/453 (29%), Positives = 223/453 (49%), Gaps = 35/453 (8%)
 Frame = -2

Query  1751  MKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGACHHTKTID  1572
             M++E+ S+E  +PSSPTP  LK Y LSF+D + +    P ++FY     S        I 
Sbjct  1     MEIELISRETIKPSSPTPSHLKIYPLSFIDNILMRNYVPLLYFYKPNKDS---DQNVKIS  57

Query  1571  ElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEMEKIKQL  1392
             +L+KSLS+ LS  YP AGR+K DK+T+EC+D+GV F+V +V   +S +L+NP  + +  L
Sbjct  58    QLRKSLSQLLSKYYPFAGRLK-DKITVECNDQGVPFLVTNVKNKLSEVLQNPIEKLLNPL  116

Query  1391  IPSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGCA  1212
              P    ++     + L+A+Q+N F+CGG+AI   +SH I D S L  FM  W+  N    
Sbjct  117   FPDELQWKEMDWSETLIAIQINCFACGGMAISVCMSHKIGDGSTLFNFMNDWSIINENLP  176

Query  1211  ANN--GSGFVS------DHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPA  1056
                    G +       D  + +FP        ++ + +  E + + E +++ KRFV   
Sbjct  177   KEKEGEKGLLELPFHFLDGGASMFP--------QRDLPIFQELVLKRENNVVCKRFVFQP  228

Query  1055  NAIAQLRQDLTITGGSVQRPSRVEALTALVWAAVINATPT--QTATLSCMVNLRRRMEPP  882
             + I  L++    T  SV  P+RV+ +TA ++   ++ T    +T+  S  V+ R+RM PP
Sbjct  229   SMIKSLKK--MATSSSVHSPTRVQVVTAWIYKCTVSITGLNFKTSLFSMAVDFRKRMVPP  286

Query  881   LPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLRA  702
             L   C+G +   + +   + +     +   +LV +I++      D   +   G+      
Sbjct  287   LSEKCVGNIFWFSSMFADKKE-----MELKDLVCKIKEGLSECCDVYPKIFGGKKNDNLL  341

Query  701   VIARGYELVR---NRDSSTLYTSSLCRMAYYEVDFGWGKPRLVVN--MLDNSWVLFLDAI  537
              I+   + V    + + + +  SS CR   YE DFGWGKP  V        + ++ +D  
Sbjct  342   KISECLKQVTESYSENGNLISFSSWCRFPMYEADFGWGKPIWVTTSACYVRNGIILMDTR  401

Query  536   NG-AVEVWMKLPKQVMHTLTQDRHFLAYVSAFP  441
             +G  +E  + + +  M     +   L Y S  P
Sbjct  402   DGDGIEAVVNMEENDMTKFEHEVKLLQYASLNP  434



>gb|KDO85081.1| hypothetical protein CISIN_1g015400mg [Citrus sinensis]
Length=407

 Score =   181 bits (460),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 143/408 (35%), Positives = 211/408 (52%), Gaps = 43/408 (11%)
 Frame = -2

Query  1751  MKVEVR--SKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGACHHTKT  1578
             MK+EV+  SKE  +PSSPTP  LK +K S LDQ   +   P + FY +  ++ A    K 
Sbjct  1     MKIEVQIISKEDIKPSSPTPPHLKTFKFSLLDQFIPSPYAPIILFYPNDCMTLA-EIPKR  59

Query  1577  IDElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEMEKIK  1398
             +  LK+SLS+TL+  YPLAG++K+D ++IEC+D+G  F+ A V   +   L  P++  + 
Sbjct  60    LALLKRSLSETLTRFYPLAGKIKDD-LSIECNDDGAYFVEAQVNCRLDEFLTKPDLLLLH  118

Query  1397  QLIPSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRG  1218
             + +P   + E   V   L  +QVN F CGGIAIG  +SH + D +AL+ F+  W++  RG
Sbjct  119   RFLPCELMKELTAV-TYLTNIQVNVFDCGGIAIGICISHKMLDGAALSTFLRAWSATARG  177

Query  1217  CAANNGSGFVSDHSSILFPP----LTDTSAI--EQLMKMGAEGIEQEEKDMIVKRFVIPA  1056
             C       F +     LFP     L DTS +    L K G           I KRFV  A
Sbjct  178   CEEVIYPNFAAPS---LFPANDLWLRDTSMVMWGSLFKKGK---------CITKRFVFDA  225

Query  1055  NAIAQLRQDLTITGGSVQ---RPSRVEALTALVWAAVINATPTQ-------TATLSCMVN  906
             +AIA L+  +  T   ++    P+RVEA++A +W  ++ A+  +          L+ +VN
Sbjct  226   SAIAALK--VVATSSKIKCPTPPTRVEAVSAFIWKCIMAASKEKHGYQTRRPCVLTHLVN  283

Query  905   LRRRMEPPLPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGE-ARKV  729
             LRRRM PPL  NC G L+  A   C             +LV  ++DA   + DGE  +K+
Sbjct  284   LRRRMTPPLSDNCTGNLLWMAAAKCMTPDKP----ELHDLVGELKDAISKL-DGEFVKKL  338

Query  728   YGEGG--WLRAVIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKP  591
               + G   +   + +  EL    +   +  SS C   +YE+DFG GKP
Sbjct  339   SSDEGNSLMCESLKQIGELCSKDEVDHVGFSSWCNFGFYEIDFGRGKP  386



>ref|XP_006427169.1| hypothetical protein CICLE_v10027043mg [Citrus clementina]
 gb|ESR40409.1| hypothetical protein CICLE_v10027043mg [Citrus clementina]
Length=470

 Score =   183 bits (464),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 148/469 (32%), Positives = 228/469 (49%), Gaps = 46/469 (10%)
 Frame = -2

Query  1751  MKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGACHHTKTID  1572
             M VE+ SKE  +PSSPTP  LK YKLS LDQLH +   P   +Y     +     +  ID
Sbjct  1     MDVEIISKEFIKPSSPTPLHLKTYKLSLLDQLHDHCYPPVSLYYPLKQDTELSISSTDID  60

Query  1571  E--------lkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENP  1416
             +        LK+SLS+TLS  YPLAG++K DK++++C+DEG+ F  A     ++  L  P
Sbjct  61    QIVSKRLQLLKQSLSETLSSFYPLAGKMK-DKLSVDCNDEGIYFAEARAKCTLNEFLNRP  119

Query  1415  EME----KIKQLIPSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKF  1248
             ++     K   ++ + +    +  G  +  +QV RFSCGG+ I   + H +AD   L  F
Sbjct  120   DLSLVIFKFHPVVGNEQRQSKEIAGAHVGKIQVTRFSCGGLVICACILHMVADGVTLGSF  179

Query  1247  MEIWASFNRGCAANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRF  1068
             +  WA+        + S   +   S LFP    T   E      A    +  K  +V+RF
Sbjct  180   LMSWAARAGKNIGEDTSICPNYEISSLFPQNDHTYPRE------ATAFSKSGK-FVVRRF  232

Query  1067  VIPANAIAQLRQDLTITGGSVQRPSRVEALTALVWAAVINATPTQTAT-----LSCMVNL  903
             V  A AIA L+   T +  S+Q PSRVE +TAL+   ++ A   ++ +     L+ ++NL
Sbjct  233   VFDAQAIANLKAKATTSSTSLQNPSRVEVVTALISKRIMAAFKAKSGSYKPNLLTRVLNL  292

Query  902   RRRMEPPLPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYG  723
             R  + PPL  N  G  V  A  LC++  D    V    LV ++R++F  V     +++ G
Sbjct  293   RPLVRPPLSENSFGNFVWNADALCKDHDDE---VELDGLVWKLRESFTKV----VKRLQG  345

Query  722   EGGWLRAVIARGYELVRNRD-----SSTLYTSSLCRMAYYEVDFGWGKP-RLVVNMLDNS  561
             +G      +  G +   N++        +  SS+C   +Y++DFGWGKP  +     D S
Sbjct  346   DGEGSLISLCEGIK-DENKEVFADAKDRISFSSVCNFPFYDIDFGWGKPIWMNFTSFDGS  404

Query  560   WVLFLDAI-------NGAVEVWMKLPKQVMHTLTQDRHFLAYVSAFPKP  435
              V F + +          +E W+ L ++ +  L  DR  L + S  P P
Sbjct  405   IVQFANFVILSDTRSGDGIEAWLHLLEEDLALLELDRELLGFASLDPTP  453



>ref|XP_010050993.1| PREDICTED: vinorine synthase-like [Eucalyptus grandis]
 gb|KCW81029.1| hypothetical protein EUGRSUZ_C02403 [Eucalyptus grandis]
Length=439

 Score =   182 bits (462),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 140/462 (30%), Positives = 218/462 (47%), Gaps = 46/462 (10%)
 Frame = -2

Query  1757  ITMKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGACHHTKT  1578
             +  K+EV S E  +PSSPTP  L+N+    LDQL      P V FY +P    A      
Sbjct  1     MATKIEVVSTETIKPSSPTPPYLRNFNFCLLDQLAPPFYVPVVLFYSAPDQKVAPDSALV  60

Query  1577  IDElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEMEKIK  1398
                LK SL++ LSL YPL GRVK +    +C+DEG  ++ A     +S +L NP+M++++
Sbjct  61    SGNLKTSLAQALSLFYPLGGRVKGN-AGFDCNDEGALYMEAKARFELSKVLPNPDMDQLQ  119

Query  1397  QLIPSAKVYEPQPVG-----KALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWA  1233
             Q +P    + P  V      + +V VQ N F CGG+ IG  +SH IAD ++++ F+  W+
Sbjct  120   QFLP----FSPCRVSTNIDEQVIVGVQANFFDCGGMGIGICISHKIADGASVSAFLNAWS  175

Query  1232  SFNRGCAANNGSGFVSDHSSILFPPLTDTSAIEQ--LMKMGAEGIEQEEKDMIVKRFVIP  1059
                    AN+G   V+  +S++ P L  +   ++  +      G+   EK +  KRF   
Sbjct  176   KI-----ANSG---VNGEASLITPFLKASELFQRKDINYQLPSGVISREK-LSTKRFCFN  226

Query  1058  ANAIAQLRQDLTITGGSVQRPSRVEALTALVWAAVINAT----------PTQTATLSCMV  909
               ++A+LR      GG+   P+RVEA+TAL+W + + A           P  +A +   V
Sbjct  227   GESLARLRAGF---GGA--NPTRVEAVTALIWKSAVAAARKRPEWKEKYPPSSAVMHA-V  280

Query  908   NLRRRMEP-PLPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARK  732
             N+R R+ P PLP   LG LV   +    E   G  +    +    +R++ RA+       
Sbjct  281   NIRSRIRPQPLPETTLGNLVQAVVAPLMEPNKGDEL---QDFAGILRNSIRAIDSEYLSA  337

Query  731   VYGEGGWLRAV--IARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVVNM---LD  567
             + GE G  +A   +    +L  +        SS  R  +Y+ DFGWG+P  V      + 
Sbjct  338   LQGENGLAKACENLMATRKLAASSAIELYRFSSWARFPFYDADFGWGRPAWVCTTSVPIK  397

Query  566   NSWVLFLDAINGAVEVWMKLPKQVMHTLTQDRHFLAYVSAFP  441
             N  +L        +E W+ L +  M     +   L + S  P
Sbjct  398   NLVILMGTRCGDGIEAWITLAEHDMIEFEHNDELLQFFSPNP  439



>ref|XP_010092011.1| BAHD acyltransferase [Morus notabilis]
 gb|EXB49715.1| BAHD acyltransferase [Morus notabilis]
Length=439

 Score =   182 bits (462),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 135/452 (30%), Positives = 219/452 (48%), Gaps = 38/452 (8%)
 Frame = -2

Query  1748  KVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTI----SGACHHTK  1581
             K+E+ S++   P SPT    +N K S LDQ+     T  + FY + T     S +  H++
Sbjct  6     KIEIISRKAINPFSPTSPQCRNLKFSLLDQIVPPRYTSIILFYTANTNQNIDSSSTAHSE  65

Query  1580  TIDElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEMEKI  1401
               + L+KSLSKTL   YP AGR+K D   IEC DEG  FI A +   +S  ++ P+   +
Sbjct  66    ISNSLQKSLSKTLVHFYPFAGRLK-DNTCIECSDEGAYFIEARINCQLSEFIKEPDPNFL  124

Query  1400  KQLIPSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNR  1221
               L+P++     + VG+ ++ +Q+  F CGG A+    SH IADAS++ +F++ WA+  R
Sbjct  125   SHLLPTSDPKGAELVGRVVLLIQLTVFKCGGTAVSVCASHKIADASSMCEFIKSWAAMAR  184

Query  1220  GCAANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEG-IEQEEKDMIVKRFVIPANAIA  1044
                         DH  ++ P     S +        EG +E   +  + KRFV   + +A
Sbjct  185   ------------DHDEVVHPEFIGASMMRPTTDPSIEGRLEAPGESFVTKRFVFDVSKLA  232

Query  1043  QLRQDLTITGGSVQR--PSRVEALTALVWAAVINATPTQTATLSC-----MVNLRRRMEP  885
              L+  +   G  V +  P+ VE ++A+     I A  + T  L        VNLR RM P
Sbjct  233   NLKAKI---GSGVPQLVPTNVELVSAIFLRCAIAACQSTTGCLKPSLLYQTVNLRTRMVP  289

Query  884   PLPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLR  705
             P+P   +G L+    V+ +EA      +   ++V ++R       + +A +  GE G+  
Sbjct  290   PVPEAAIGNLIWGFPVVVEEASK----MEVGDIVVKMRKGLIDFCNEKANRFKGEDGY--  343

Query  704   AVIARGYELVRN--RDSSTLYTSSLCRMAYYEVDFGWGKPR-LVVNMLDNSWVLFLDAIN  534
             + +   +++  +     +  + SS C+  +YEVDFGWGKP  +   M   + +  +D   
Sbjct  344   SFVFESFKVGESLKMGMNMYFCSSWCKFPFYEVDFGWGKPTWITCPMYSMNAITLMDTKR  403

Query  533   GA-VEVWMKLPKQVMHTLTQDRHFLAYVSAFP  441
             G  +E W+ L KQ M     +   LA+ S  P
Sbjct  404   GERIEAWVTLEKQEMAMFETNEELLAFASINP  435



>ref|XP_007158727.1| hypothetical protein PHAVU_002G177000g [Phaseolus vulgaris]
 gb|ESW30721.1| hypothetical protein PHAVU_002G177000g [Phaseolus vulgaris]
Length=449

 Score =   182 bits (462),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 141/447 (32%), Positives = 214/447 (48%), Gaps = 23/447 (5%)
 Frame = -2

Query  1748  KVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGACHHTKTIDE  1569
             K+E+ S+E  +PS  TP  LK Y L F+D +      P + FY +   S   HH   I  
Sbjct  12    KMELVSRETIKPSIATPPHLKIYPLCFIDNIVFRNYIPILLFYSANHHSKN-HHESKIST  70

Query  1568  lkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEMEKIKQLI  1389
             LKKSLS+ LS  YP AG ++ D+++IEC+D+GV F+V   A N+S +L NP      +L 
Sbjct  71    LKKSLSQVLSRYYPFAGMLR-DQLSIECNDQGVSFLVTSFACNLSSILHNPNHASFHRLF  129

Query  1388  PSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGCAA  1209
             P    ++P      +VA+Q+N F+CGGI I   + H +ADA+ L  F+  WA F+R    
Sbjct  130   PDQLQWKPMEPTSTIVAIQINCFACGGIVISVCMCHKVADAATLCNFINDWAMFSRQ-NQ  188

Query  1208  NNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQLRQD  1029
             +         SS+ FP    +   ++ + +  E     + D + +RFV     I  L+  
Sbjct  189   DQQEEQEKLLSSLPFPVPGASFLPQENLPVFPE-TAFVKNDTVCRRFVFEGAKIDSLKA-  246

Query  1028  LTITGGSVQRPSRVEALTALVWAAVINA--TPTQTATLSCMVNLRRRMEPPLPPNCLGTL  855
               ++   V  P+RVE ++AL++   +++     +T      VNLR R  PPLP   LG L
Sbjct  247   -MVSSRDVHNPTRVEVVSALIYNRAVSSLGLTFKTMPFRTAVNLRNRTVPPLPEKSLGNL  305

Query  854   VDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLRAVIARGYELV  675
             V    V      + G      ELV +++   R  +D   +K  G+    R +     +  
Sbjct  306   VWFLFV-----SNLGEETELQELVVKMKQGLREFRDTFGKKFGGKNKDSRFITECLEQAT  360

Query  674   RNRD-----SSTLYTSSLCRMAYYEVDFGWGKPRLVVNM---LDNSWVLFLDAING-AVE  522
             R  +      S +  +S CR   YE DFGWGKP         + NS VL +D  +G  +E
Sbjct  361   RVPEGGGCVESLVCCASWCRFPMYEADFGWGKPVWFSTSECPVKNSVVL-MDTRDGEGIE  419

Query  521   VWMKLPKQVMHTLTQDRHFLAYVSAFP  441
               + + +  M    +D H L Y S  P
Sbjct  420   ALVNMEEHDMAKFERDFHLLQYASLNP  446



>ref|XP_006429945.1| hypothetical protein CICLE_v10011714mg [Citrus clementina]
 gb|ESR43185.1| hypothetical protein CICLE_v10011714mg [Citrus clementina]
Length=448

 Score =   182 bits (462),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 152/455 (33%), Positives = 215/455 (47%), Gaps = 29/455 (6%)
 Frame = -2

Query  1751  MKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGACHHTKTID  1572
             M++ + S+E+ RPSS     LK +K+S LDQL      P V FY  P  S     T+   
Sbjct  1     MEIGIVSREVVRPSSLHVHLLKPFKISLLDQLTPTTFAPLVLFY--PMKSTHLKGTQIST  58

Query  1571  ElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEMEKIKQL  1392
             +LK+SLSKTL   YPLAGRV+ D + I   DEGV +I   V  ++   L+N  ME + Q 
Sbjct  59    QLKESLSKTLEHFYPLAGRVR-DNLIINDYDEGVPYIETRVNTHLFEFLQNRPMELLNQC  117

Query  1391  IPSAKV-YEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGC  1215
             +P     ++P P     VAVQ+N F CGG+A+G   SH I D    + F+  WA+  RG 
Sbjct  118   LPYPPFSHQPNPHQVPQVAVQLNTFDCGGVALGLCFSHKIIDGGTASAFLRSWAANTRGG  177

Query  1214  AANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQLR  1035
                         +S++FPP   +   + L  M  E I   E     +RFV  A AIA LR
Sbjct  178   YHKAVKYENLSQASMIFPPQNPSPNHQYLSVM--EKIWFREAKYKTRRFVFDAKAIATLR  235

Query  1034  QDLTITGGSVQRPSRVEALTALVWAAV---INATPTQTATLSCMVNLRRRMEPPLPPNCL  864
              +    G  V  P+R EAL+A +  +    + +T +    L   VNLRR  EP L    +
Sbjct  236   SE--CKGERVPNPTRTEALSAFILKSTMLALRSTASSRFVLHQAVNLRRLTEPRLSTCSV  293

Query  863   GTLV--DEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLRA--VI  696
             G L     A    + A + G       LV R+R     +     + ++G+ G+ +    I
Sbjct  294   GNLFLWATAAYDMEHAAEMGL----HGLVARMRQGVGKINSEYLKTLHGDEGFPKVCEYI  349

Query  695   ARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKP---RLVVNMLDNSW--VLFLDAING  531
              R  E+  + +   L  SS  +  + EVDFGWG P    +   +  NS+  V F     G
Sbjct  350   KRMEEVSAHENLEALKFSSWVKFGFNEVDFGWGNPIWSSIFGEVGSNSFQNVTFFKETGG  409

Query  530   -----AVEVWMKLPKQVMHTLTQDRHFLAYVSAFP  441
                  AVE W+ L +++M  L  D  FLA  S  P
Sbjct  410   AIYDTAVEAWVTLDEKIMSVLEHDPQFLALASPNP  444



>ref|XP_009606783.1| PREDICTED: vinorine synthase-like [Nicotiana tomentosiformis]
Length=414

 Score =   181 bits (460),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 133/437 (30%), Positives = 225/437 (51%), Gaps = 41/437 (9%)
 Frame = -2

Query  1718  RPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGACHHTKTIDElkkslsktls  1539
             +PSSPTP  L +Y+LS+LDQ+  N++ P VFFY +        +T+  ++LKKSLS  L+
Sbjct  4     KPSSPTPDDLHHYQLSYLDQIAPNILMPLVFFYAA---DNNLTNTQRSNQLKKSLSHVLT  60

Query  1538  LMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEMEKIKQLIPSAKVYEPQP  1359
               YPL+GR+ E    + C+DEG+ +I A    ++S  L +P  +++ + IP  K+++   
Sbjct  61    RFYPLSGRL-EANSHVNCNDEGIPYIEAIAKCSLSDFLLDPVPKELNKFIP-CKLHD---  115

Query  1358  VGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGCAANNGSGFVSDH  1179
             V    + VQ N F CGG+AIG  +SH +ADA +   F+  W +  RG        F   +
Sbjct  116   VKDFFLLVQANFFECGGMAIGIAISHKLADAMSTFMFINCWGAIARGNTNVPSPRF---N  172

Query  1178  SSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQLRQDLTITGGSVQR  999
             SSILFP   DTS ++  + +G + I       + KRFV  A+ ++ L+   T    + + 
Sbjct  173   SSILFPQ-RDTSELKSSITIGKDTI-------VTKRFVFSASKVSALKDKYT---ENTRP  221

Query  998   PSRVEALTALVWAAVINAT-----PTQTATLSCMVNLRRRMEPPLPPNCLGTLVDEAIVL  834
             PSR+EAL+  +W  ++ +        +   +   +NLR R  PPLP +  G ++   + +
Sbjct  222   PSRIEALSTFLWTRLMASIHRKRDENKNYGIVHTLNLRTRSNPPLPESLFGNVMQVVVTI  281

Query  833   CQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYG-----EGGWLRAVIARGYELVRN  669
                  +        ELV+++R+    + +  +  V G     +   L  +  +  E  + 
Sbjct  282   PSLDHNISDEEQGFELVKQVRE---GIHNANSEFVSGLQKINDDKHLSFIKEKANE--QR  336

Query  668   RDSSTLYT-SSLCRMAYYEVDFGWGKPRLV--VNMLDNSWVLFLDAING-AVEVWMKLPK  501
             +    L+  +SLCR   YE DFGWG+P  V   +++  + + FLD  +G  +E W+ L +
Sbjct  337   KGGLVLFNFTSLCRFPLYEADFGWGQPIWVGSASLVLKNVIGFLDTKSGNGIEAWVNLKE  396

Query  500   QVMHTLTQDRHFLAYVS  450
             + M     D+  L++ S
Sbjct  397   EDMARFEADKELLSWCS  413



>ref|XP_004159582.1| PREDICTED: vinorine synthase-like [Cucumis sativus]
Length=429

 Score =   181 bits (460),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 153/454 (34%), Positives = 227/454 (50%), Gaps = 55/454 (12%)
 Frame = -2

Query  1745  VEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYD--SPTISGACHHTKTID  1572
             +++ S +I +PSSPTP  L  + LS  DQL  +   P +FF+    P+ SG  +   T++
Sbjct  9     LQIVSTQIIKPSSPTPPNLNIHTLSLFDQLAPHTFVPLLFFFSHHGPS-SGTYYDHTTVE  67

Query  1571  ElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADV-AENMSCLLENPEMEKIKQ  1395
              L++SLS TLS  YPLAGR+K DKV+I+C+DEGV F+ A +    +S +LENP  E +++
Sbjct  68    LLRQSLSTTLSRYYPLAGRIK-DKVSIDCNDEGVTFVEARLEGVTVSKILENPRSEIVEK  126

Query  1394  LIPSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRGC  1215
             L      ++   +G +L+ VQ+  F CGG++IG  +SH + D + L K            
Sbjct  127   LFVDGLQWKDSKMG-SLLKVQITLFECGGLSIGVLLSHKLGDLATLVK------------  173

Query  1214  AANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQLR  1035
               NN   F S     LFP   D  A+         G   EE +   KRFV   + I  L+
Sbjct  174   -RNNKPAFFSGD---LFPH-GDLPAM--------SGAVIEEGNFTCKRFVFEGSKIESLK  220

Query  1034  QDLTITGGSVQRPSRVEALTALVWAAVINATPTQTAT-------LSCMVNLRRRMEPPLP  876
               ++     VQ PSRVE ++AL++ A+I+A+ T   +       L   +NLR+R+ PPLP
Sbjct  221   NRIS---EKVQNPSRVEVVSALIYKAIISASRTNNNSQNHPATLLLQTLNLRKRVAPPLP  277

Query  875   PNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWLRAVI  696
                +G+LV    V     ++   VV   ELV  +R       +  A+K Y    WL  + 
Sbjct  278   DTLVGSLVSFFPVGVDGERE---VVELHELVGTMRKEMGEFCEKYAKK-YRTKEWLELIK  333

Query  695   ARGYE----LVRNRDSSTLY-TSSLCRMAYYEVDFGWGKPRLVVN---MLDNSWVLFLDA  540
              R  E    L +N ++  +Y  SS C    YEVDFGWG    +      + N+ V+ LDA
Sbjct  334   KRLNESREILSKNGNNQLVYRCSSGCNFPIYEVDFGWGAADWITMPAFKMKNT-VMMLDA  392

Query  539   ING-AVEVWMKLPKQVMHTLTQDRHFLAYVSAFP  441
              NG  +E  + L    M     +   LA+ S  P
Sbjct  393   KNGRGIEALVSLQDGEMAAFQDNEELLAFASLNP  426



>ref|XP_010048659.1| PREDICTED: vinorine synthase-like [Eucalyptus grandis]
Length=442

 Score =   182 bits (461),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 146/458 (32%), Positives = 218/458 (48%), Gaps = 43/458 (9%)
 Frame = -2

Query  1757  ITMKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGACHHTKT  1578
             +TMKVEV S E  +PSSPTP  L+++K+  LDQL      P + FY +     A +    
Sbjct  1     MTMKVEVVSTETVKPSSPTPSHLRDFKICLLDQLAPPFWVPVILFYSASNNEVAANSASV  60

Query  1577  IDElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEMEKIK  1398
                LK SLS+ LSL YPL GR+K +   I+C+D+G  ++ A     +S +L NP++ +++
Sbjct  61    TGNLKTSLSQALSLFYPLGGRIKGNSA-IDCNDQGALYLEAKARFELSEVLLNPDINQLQ  119

Query  1397  QLIP-SAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNR  1221
             Q +P S+    P    + +V VQ N F CGGI IG  +SH IADA++++ F+  W+    
Sbjct  120   QFLPFSSDKVVPNIEEQVIVGVQANFFDCGGIGIGICMSHKIADAASVSAFLTAWSKI--  177

Query  1220  GCAANNGSGFVSD---HSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIPANA  1050
                  NG   V      +S LFPP  D +      +M      +E+  +  KRF     +
Sbjct  178   ALNGINGKAKVITPFLKASELFPP-KDVN-----FQMPRRFTSREK--LFTKRFRFDGES  229

Query  1049  IAQLRQDLTITGGSVQRPSRVEALTALVWAAVINAT----------PTQTATLSCMVNLR  900
             +A+LR       GS   P+RVEA+TAL+W + + A           P+  AT   +VN+R
Sbjct  230   LARLRARF----GSAT-PTRVEAVTALIWKSAVEAARKRPEWNEKYPSSVAT--HVVNIR  282

Query  899   RRMEP-PLPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYG  723
              RM P PLP + LG L    I    +   G   V   +    +R + RA+ D     + G
Sbjct  283   SRMRPQPLPEHALGNLWQTTIAPLIDTNKG---VELQDFAGSLRKSIRAIDDEYLSVLQG  339

Query  722   EGGWLRA----VIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVVNM---LDN  564
             E G  +A      AR           +   SS  +  +YEVD G G+P  V      + N
Sbjct  340   ERGLTKAYESLTAARKLAESSAGKMESYGFSSWVKFPFYEVDLGLGRPTWVCTTGFPIGN  399

Query  563   SWVLFLDAINGAVEVWMKLPKQVMHTLTQDRHFLAYVS  450
                L        +E W+ LP+  M    ++   L ++S
Sbjct  400   MVFLMGTRCEDGIEAWITLPEHDMIEFERNDELLQFIS  437



>ref|XP_006427943.1| hypothetical protein CICLE_v10027036mg [Citrus clementina]
 ref|XP_006464852.1| PREDICTED: salutaridinol 7-O-acetyltransferase-like [Citrus sinensis]
 gb|ESR41183.1| hypothetical protein CICLE_v10027036mg [Citrus clementina]
Length=475

 Score =   182 bits (463),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 146/462 (32%), Positives = 229/462 (50%), Gaps = 49/462 (11%)
 Frame = -2

Query  1754  TMKVEVRSKEIGRPSSPTPQTLKNYKLSFLDQLHLNLMTPFVFFYDSPTISGACHH---T  1584
             T  V++ S E+ +PSSPTP+ L+ YKLS LDQL   +  P VFFY     S  C H   +
Sbjct  33    TSDVQIISTEVIKPSSPTPKHLRTYKLSLLDQLFSKIYVPLVFFY-----SANCKHQYFS  87

Query  1583  KTIDElkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEMEK  1404
             K  D LK+SL+KTL+  YP AGR+  D  +++C D G  FI A+V  ++S  L+ P+ME 
Sbjct  88    KKSDLLKQSLAKTLTHYYPFAGRLI-DSFSVDCSDHGAAFIEANVGCDISKFLQPPDMEL  146

Query  1403  IKQLI-PSAKVYEPQPVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASF  1227
             ++QLI PS ++       + L+AVQVN FS G +AIG   SH +AD SA+  FM+ W   
Sbjct  147   LQQLIPPSPQLSNLDVSERELLAVQVNLFSGGEMAIGVCFSHGVADGSAIFNFMKTWGEI  206

Query  1226  NRGC----AANNGSGFVSDHSSILFPPLTDTSAIEQLMKMGAEGIEQEEKDMIVKRFVIP  1059
              RG          +  V D +S LFPP+      + +    + G      +++ KR +  
Sbjct  207   TRGVINGNDNICNNNVVLDCTS-LFPPVNFPKPYQIVTSPQSSG------NIVFKRLLFD  259

Query  1058  ANAIAQLRQDLTITGGSVQ--RPSRVEALTALVWAAVINATPTQ---------TATLSCM  912
             +  IA L++ +    G     + +R   ++AL+W A I     +         +  +   
Sbjct  260   SKKIAALKEKVNKEIGKFNELQATRFGVVSALIWGAFIAIARERKRAIDNKLYSHAIYYT  319

Query  911   VNLRRRMEPPLPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARK  732
             +NLR ++ PP+ P C+G +          AKD      A+E    +R+  +A + G  R+
Sbjct  320   MNLRNKLNPPMIPQCMGNIYRLVRAEWSLAKDD-----AIEETSLLREVIKAKRMG--RE  372

Query  731   VYGEGGWLRAV--IARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKP---RLVVNMLD  567
             V     +L  +  +   +E     DS +   +S+  +  YEVDFGWGKP    +   +L 
Sbjct  373   VMHNNEYLGFIKDMKETWE-----DSRSFGLTSVVGLPCYEVDFGWGKPVWFSVGPLLLI  427

Query  566   NSWVLFLDAINGAVEVWMKLPKQVMHTLTQDRHFLAYVSAFP  441
             +  +L   +    +E  M + K+ M    Q+   +AY S+ P
Sbjct  428   DLAILTSTSDGEGIEALMVMFKEDMDKFEQEPSIMAYASSNP  469



>ref|XP_008240679.1| PREDICTED: vinorine synthase-like [Prunus mume]
Length=464

 Score =   182 bits (462),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 148/449 (33%), Positives = 215/449 (48%), Gaps = 33/449 (7%)
 Frame = -2

Query  1745  VEVRSKEIGRPSSPTPQTLKNYKLSFLDQ-LHLNLMTPFVFFYDSPTISGACHHTKTIDE  1569
             VE+ S++I +P SPTP  LK  KLS LDQ L   L    VF Y +    GA   +     
Sbjct  9     VEITSRKIIKPLSPTPYHLKALKLSLLDQILPPTLYGTLVFLYTN-HWHGADFVSNASKR  67

Query  1568  lkkslsktlsLMYPLAGRVKEDKVTIECDDEGVEFIVADVAENMSCLLENPEMEKIKQLI  1389
             L++SLSKTL L YPLAGR+K     IEC+DEG  F+ A V   ++  L+ PE + I  LI
Sbjct  68    LQESLSKTLVLFYPLAGRLK-GAAFIECNDEGAHFLEARVNCLLADFLQQPEPKLIGHLI  126

Query  1388  PSAKVYEPQ-PVGKALVAVQVNRFSCGGIAIGFFVSHAIADASALAKFMEIWASFNRG-C  1215
             P       Q  +G  L+ VQ+N F CGGIAI    SH IAD ++L  F   WA+ NR   
Sbjct  127   PETDSQTAQVALGSVLLLVQINVFKCGGIAIAVSPSHKIADLTSLYTFARTWAAINRDED  186

Query  1214  AANNGSGFVSDHSSILFPPLTDTSAI-EQLMKMGAEGIEQEEKDMIVKRFVIPANAIAQL  1038
               ++G G       +  P     + +  + +      +E + +++  ++FV   + +A L
Sbjct  187   QYDDGVG-----GQLALPEFNGGNLLPSRDLPATPNTLETQSENLTTRQFVFDVSKMASL  241

Query  1037  RQDLTITGGSVQR--PSRVEALTALVWAAVINA-------TPTQTATLSCMVNLRRRMEP  885
             +  +    G VQ   P+ V+ + A++    I A       TP +   L  MVNLRRRM P
Sbjct  242   KAKIE---GVVQNFIPTNVQLVLAIILKCAIAASHNSKPGTPIRPTVLFQMVNLRRRMLP  298

Query  884   PLPPNCLGTLVDEAIVLCQEAKDGGTVVTAVELVQRIRDAFRAVKDGEARKVYGEGGWL-  708
              LP N +G      ++L +E +         ELV  +R       + +A +  G  G+L 
Sbjct  299   ELPQNAMGNWFWPLLILFKEDE-----TQLHELVSTMRKGLTDFINEKANRFKGVEGFLA  353

Query  707   --RAVIARGYELVRNRDSSTLYTSSLCRMAYYEVDFGWGKPRLVVNM--LDNSWVLFLDA  540
                 +  RG  L   +  +  + +SLC++  YE+DFGWGKP  V       N   L    
Sbjct  354   VFECIRERGQLLKSTKGINLYWATSLCKLPLYEMDFGWGKPTWVTGKGGYKNVIALLDTK  413

Query  539   INGAVEVWMKLPKQVMHTLTQDRHFLAYV  453
                 +E W+ L +Q M     D   LAY+
Sbjct  414   FCDGIEAWVTLDEQEMAIFESDEELLAYL  442



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5527233705326