BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c24344_g1_i9 len=4685 path=[1:0-508 510:509-553 29654:554-554
21147:555-644 21236:645-648 16866:649-990 6678:991-1196
16910:1197-1363 15688:1364-1368 29743:1369-1389 29764:1390-1394
21978:1395-1491 9541:1492-1495 9545:1496-4124 12174:4125-4151
28881:4152-4684]

Length=4685
                                                                      Score     E

ref|XP_009769639.1|  PREDICTED: uncharacterized protein LOC104220...    936   0.0      
ref|XP_009769637.1|  PREDICTED: uncharacterized protein LOC104220...    934   0.0      
ref|XP_009769635.1|  PREDICTED: uncharacterized protein LOC104220...    934   0.0      
ref|XP_009769638.1|  PREDICTED: uncharacterized protein LOC104220...    933   0.0      
ref|XP_009601822.1|  PREDICTED: uncharacterized protein LOC104097...    927   0.0      
ref|XP_009601825.1|  PREDICTED: uncharacterized protein LOC104097...    926   0.0      
ref|XP_009601827.1|  PREDICTED: uncharacterized protein LOC104097...    925   0.0      
ref|XP_009769636.1|  PREDICTED: uncharacterized protein LOC104220...    924   0.0      
ref|XP_009601826.1|  PREDICTED: uncharacterized protein LOC104097...    924   0.0      
ref|XP_009601824.1|  PREDICTED: uncharacterized protein LOC104097...    924   0.0      
ref|XP_009601823.1|  PREDICTED: uncharacterized protein LOC104097...    917   0.0      
ref|XP_006347602.1|  PREDICTED: uncharacterized protein LOC102589...    870   0.0      
ref|XP_006347606.1|  PREDICTED: uncharacterized protein LOC102589...    867   0.0      
ref|XP_006347603.1|  PREDICTED: uncharacterized protein LOC102589...    864   0.0      
ref|XP_006347601.1|  PREDICTED: uncharacterized protein LOC102589...    864   0.0      
ref|XP_006347600.1|  PREDICTED: uncharacterized protein LOC102589...    863   0.0      
ref|XP_010318293.1|  PREDICTED: uncharacterized protein LOC101244...    822   0.0      
ref|XP_010318298.1|  PREDICTED: uncharacterized protein LOC101244...    817   0.0      
ref|XP_004235271.1|  PREDICTED: uncharacterized protein LOC101244...    817   0.0      
ref|XP_010318294.1|  PREDICTED: uncharacterized protein LOC101244...    816   0.0      
ref|XP_010318292.1|  PREDICTED: uncharacterized protein LOC101244...    816   0.0      
ref|XP_010318291.1|  PREDICTED: uncharacterized protein LOC101244...    816   0.0      
ref|XP_002270307.3|  PREDICTED: uncharacterized protein LOC100261...    714   0.0      Vitis vinifera
ref|XP_010662093.1|  PREDICTED: uncharacterized protein LOC100261...    713   0.0      
ref|XP_010662091.1|  PREDICTED: uncharacterized protein LOC100261...    713   0.0      
emb|CAN63105.1|  hypothetical protein VITISV_029609                     709   0.0      Vitis vinifera
emb|CBI26469.3|  unnamed protein product                                697   0.0      
ref|XP_002319244.2|  hypothetical protein POPTR_0013s07550g             650   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_011044441.1|  PREDICTED: uncharacterized protein LOC105139...    642   0.0      
ref|XP_011044443.1|  PREDICTED: uncharacterized protein LOC105139...    641   0.0      
ref|XP_011044440.1|  PREDICTED: uncharacterized protein LOC105139...    642   0.0      
ref|XP_011044442.1|  PREDICTED: uncharacterized protein LOC105139...    641   0.0      
emb|CDP04918.1|  unnamed protein product                                610   0.0      
ref|XP_008234529.1|  PREDICTED: uncharacterized protein LOC103333...    614   0.0      
ref|XP_008234525.1|  PREDICTED: uncharacterized protein LOC103333...    614   0.0      
ref|XP_008234527.1|  PREDICTED: uncharacterized protein LOC103333...    613   0.0      
ref|XP_008234528.1|  PREDICTED: uncharacterized protein LOC103333...    609   0.0      
ref|XP_008234524.1|  PREDICTED: uncharacterized protein LOC103333...    610   0.0      
ref|XP_008234526.1|  PREDICTED: uncharacterized protein LOC103333...    609   0.0      
ref|XP_011012546.1|  PREDICTED: uncharacterized protein LOC105116...    588   5e-178   
ref|XP_009348940.1|  PREDICTED: uncharacterized protein LOC103940...    581   2e-176   
ref|XP_009348939.1|  PREDICTED: uncharacterized protein LOC103940...    574   6e-174   
ref|XP_009348938.1|  PREDICTED: uncharacterized protein LOC103940...    573   1e-173   
ref|XP_009361135.1|  PREDICTED: uncharacterized protein LOC103951...    570   9e-173   
ref|XP_002325874.2|  PHD finger family protein                          573   1e-172   Populus trichocarpa [western balsam poplar]
ref|XP_009361134.1|  PREDICTED: uncharacterized protein LOC103951...    570   3e-172   
ref|XP_009348941.1|  PREDICTED: uncharacterized protein LOC103940...    567   2e-171   
ref|XP_009348935.1|  PREDICTED: uncharacterized protein LOC103940...    567   3e-171   
ref|XP_010270010.1|  PREDICTED: uncharacterized protein LOC104606...    571   2e-170   
ref|XP_010270008.1|  PREDICTED: uncharacterized protein LOC104606...    570   5e-170   
gb|KDP39546.1|  hypothetical protein JCGZ_02566                         563   1e-169   
ref|XP_010270004.1|  PREDICTED: uncharacterized protein LOC104606...    569   2e-169   
ref|XP_010270007.1|  PREDICTED: uncharacterized protein LOC104606...    569   2e-169   
ref|XP_007029696.1|  RING/FYVE/PHD zinc finger superfamily protei...    555   3e-169   
ref|XP_007029690.1|  RING/FYVE/PHD zinc finger superfamily protei...    557   5e-168   
ref|XP_007029692.1|  RING/FYVE/PHD zinc finger superfamily protei...    557   6e-168   
ref|XP_007029695.1|  RING/FYVE/PHD zinc finger superfamily protei...    556   1e-167   
ref|XP_007029689.1|  RING/FYVE/PHD zinc finger superfamily protei...    557   2e-167   
ref|XP_007220350.1|  hypothetical protein PRUPE_ppa000413m1g            540   1e-165   
ref|XP_010275231.1|  PREDICTED: uncharacterized protein LOC104610...    555   3e-164   
ref|XP_006590425.1|  PREDICTED: uncharacterized protein LOC100806...    528   8e-157   
gb|KHN35157.1|  Bromodomain adjacent to zinc finger domain protei...    528   1e-156   
ref|XP_006572873.1|  PREDICTED: uncharacterized protein LOC100797...    526   5e-156   
gb|KHN34129.1|  Bromodomain adjacent to zinc finger domain protei...    525   1e-155   
gb|KDO47996.1|  hypothetical protein CISIN_1g000388mg                   521   2e-153   
ref|XP_006494938.1|  PREDICTED: uncharacterized protein LOC102623...    520   3e-153   
ref|XP_006494936.1|  PREDICTED: uncharacterized protein LOC102623...    521   3e-153   
ref|XP_006494937.1|  PREDICTED: uncharacterized protein LOC102623...    521   3e-153   
ref|XP_008459204.1|  PREDICTED: probable GPI-anchored adhesin-lik...    519   5e-153   
gb|KDO47995.1|  hypothetical protein CISIN_1g000388mg                   519   6e-153   
ref|XP_008459203.1|  PREDICTED: uncharacterized protein LOC103498...    519   9e-153   
ref|XP_008376934.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    516   1e-152   
ref|XP_007157085.1|  hypothetical protein PHAVU_002G041700g             511   2e-150   
gb|KGN61722.1|  hypothetical protein Csa_2G233010                       510   8e-150   
ref|XP_006437427.1|  hypothetical protein CICLE_v10033462mg             494   2e-149   
ref|XP_008382230.1|  PREDICTED: uncharacterized protein LOC103445...    503   4e-148   
ref|XP_008382216.1|  PREDICTED: uncharacterized protein LOC103445...    502   8e-148   
ref|XP_011084637.1|  PREDICTED: uncharacterized protein LOC105166844    502   1e-147   
ref|XP_009361136.1|  PREDICTED: uncharacterized protein LOC103951...    501   2e-147   
ref|XP_008382210.1|  PREDICTED: uncharacterized protein LOC103445...    502   2e-147   
ref|XP_004145410.1|  PREDICTED: uncharacterized protein LOC101208726    502   6e-147   
ref|XP_008459205.1|  PREDICTED: probable GPI-anchored adhesin-lik...    491   3e-145   
ref|XP_002535114.1|  hypothetical protein RCOM_2156040                  484   3e-144   Ricinus communis
ref|XP_006590866.1|  PREDICTED: uncharacterized protein LOC100784...    481   8e-141   
ref|XP_006590862.1|  PREDICTED: uncharacterized protein LOC100784...    482   8e-141   
ref|XP_006590863.1|  PREDICTED: uncharacterized protein LOC100784...    482   8e-141   
gb|KHN39855.1|  Bromodomain adjacent to zinc finger domain protei...    482   8e-141   
ref|XP_006590859.1|  PREDICTED: uncharacterized protein LOC100784...    482   1e-140   
ref|XP_010087452.1|  DnAJ-like protein                                  485   1e-139   
ref|XP_006592006.1|  PREDICTED: dentin sialophosphoprotein-like         473   7e-138   
gb|KHN46480.1|  Bromodomain adjacent to zinc finger domain protei...    473   1e-137   
gb|KCW90977.1|  hypothetical protein EUGRSUZ_A02991                     470   1e-136   
ref|XP_004307841.1|  PREDICTED: uncharacterized protein LOC101314703    466   1e-135   
ref|XP_007131494.1|  hypothetical protein PHAVU_011G017900g             466   4e-135   
ref|XP_007131491.1|  hypothetical protein PHAVU_011G017900g             466   4e-135   
ref|XP_007131489.1|  hypothetical protein PHAVU_011G017900g             463   5e-134   
ref|XP_007131492.1|  hypothetical protein PHAVU_011G017900g             462   7e-134   
gb|KEH17766.1|  RING/FYVE/PHD zinc finger protein, putative             456   4e-133   
gb|KEH17765.1|  RING/FYVE/PHD zinc finger protein, putative             457   3e-132   
gb|KEH17764.1|  RING/FYVE/PHD zinc finger protein, putative             457   7e-132   
ref|XP_004511404.1|  PREDICTED: serine-rich adhesin for platelets...    456   5e-131   
ref|XP_004511407.1|  PREDICTED: serine-rich adhesin for platelets...    455   2e-130   
ref|XP_004516586.1|  PREDICTED: serine-rich adhesin for platelets...    452   3e-130   
gb|KEH27368.1|  RING/FYVE/PHD zinc finger protein, putative             448   2e-128   
ref|XP_003610802.1|  Bromodomain adjacent to zinc finger domain p...    446   6e-128   
ref|XP_004154159.1|  PREDICTED: uncharacterized protein LOC101211560    437   3e-127   
ref|XP_010549856.1|  PREDICTED: uncharacterized protein LOC104820...    415   2e-117   
gb|KCW90978.1|  hypothetical protein EUGRSUZ_A02991                     408   4e-117   
ref|XP_010420369.1|  PREDICTED: uncharacterized protein LOC104705960    409   6e-116   
ref|XP_010453830.1|  PREDICTED: uncharacterized protein LOC104735701    407   1e-115   
emb|CDX70705.1|  BnaC03g07890D                                          404   4e-115   
ref|XP_010492581.1|  PREDICTED: uncharacterized protein LOC104769950    406   4e-115   
ref|XP_010525303.1|  PREDICTED: uncharacterized protein LOC104803125    407   6e-115   
ref|XP_010063523.1|  PREDICTED: uncharacterized protein LOC104450...    409   7e-115   
ref|XP_010063504.1|  PREDICTED: uncharacterized protein LOC104450...    410   7e-115   
gb|KCW90976.1|  hypothetical protein EUGRSUZ_A02991                     410   7e-115   
emb|CDY49643.1|  BnaC09g41210D                                          400   2e-113   
ref|XP_010671078.1|  PREDICTED: uncharacterized protein LOC104887...    394   4e-113   
ref|XP_009131554.1|  PREDICTED: uncharacterized protein LOC103856...    398   5e-113   
emb|CDX78703.1|  BnaA03g06150D                                          398   6e-113   
ref|NP_197170.3|  RING/FYVE/PHD zinc finger-containing protein          400   6e-113   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009131553.1|  PREDICTED: uncharacterized protein LOC103856...    398   1e-112   
ref|XP_010671077.1|  PREDICTED: uncharacterized protein LOC104887...    394   1e-112   
ref|XP_010671076.1|  PREDICTED: uncharacterized protein LOC104887...    394   3e-110   
ref|XP_006400205.1|  hypothetical protein EUTSA_v10012458mg             390   7e-110   
ref|XP_009121463.1|  PREDICTED: uncharacterized protein LOC103846310    390   1e-109   
ref|XP_006400206.1|  hypothetical protein EUTSA_v10012458mg             390   1e-109   
ref|XP_008796292.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    394   3e-109   
emb|CAC01832.1|  putative protein                                       384   1e-107   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010933485.1|  PREDICTED: uncharacterized protein LOC105053867    388   1e-107   
ref|XP_010935007.1|  PREDICTED: uncharacterized protein LOC105055018    380   1e-106   
ref|XP_010663576.1|  PREDICTED: uncharacterized protein LOC100243...    382   3e-106   
ref|XP_006289796.1|  hypothetical protein CARUB_v10003399mg             380   7e-106   
ref|XP_010663595.1|  PREDICTED: uncharacterized protein LOC100243...    380   2e-105   
ref|XP_010663589.1|  PREDICTED: uncharacterized protein LOC100243...    380   2e-105   
ref|XP_010663585.1|  PREDICTED: uncharacterized protein LOC100243...    379   4e-105   
ref|XP_010663573.1|  PREDICTED: uncharacterized protein LOC100243...    379   5e-105   
ref|XP_006408368.1|  hypothetical protein EUTSA_v10020044mg             364   5e-104   
emb|CDX69433.1|  BnaA10g17820D                                          370   8e-104   
ref|NP_186939.2|  RING/FYVE/PHD zinc finger-related protein             366   2e-103   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010663582.1|  PREDICTED: uncharacterized protein LOC100243...    373   3e-103   
emb|CAN64336.1|  hypothetical protein VITISV_001809                     369   5e-101   Vitis vinifera
gb|AAF26970.1|AC018363_15  unknown protein                              356   2e-100   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009392779.1|  PREDICTED: uncharacterized protein LOC103978...    358   4e-98    
ref|XP_010919892.1|  PREDICTED: uncharacterized protein LOC105043...    359   5e-98    
emb|CBI33889.3|  unnamed protein product                                357   5e-98    
ref|XP_009392773.1|  PREDICTED: uncharacterized protein LOC103978...    358   6e-98    
ref|XP_010919895.1|  PREDICTED: uncharacterized protein LOC105043...    358   7e-98    
ref|XP_009392778.1|  PREDICTED: uncharacterized protein LOC103978...    357   1e-97    
ref|XP_010270011.1|  PREDICTED: uncharacterized protein LOC104606...    357   1e-97    
ref|XP_002882257.1|  hypothetical protein ARALYDRAFT_477535             347   4e-97    
ref|XP_008788672.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    352   3e-96    
ref|XP_009418603.1|  PREDICTED: uncharacterized protein LOC103998...    350   3e-95    
ref|XP_010919891.1|  PREDICTED: uncharacterized protein LOC105043...    349   1e-94    
ref|XP_010919894.1|  PREDICTED: uncharacterized protein LOC105043...    348   1e-94    
ref|XP_010919893.1|  PREDICTED: uncharacterized protein LOC105043...    348   1e-94    
ref|XP_009418602.1|  PREDICTED: uncharacterized protein LOC103998...    348   2e-94    
ref|XP_010941238.1|  PREDICTED: uncharacterized protein LOC105059...    345   2e-94    
ref|XP_010941237.1|  PREDICTED: uncharacterized protein LOC105059...    345   3e-94    
ref|XP_010941235.1|  PREDICTED: uncharacterized protein LOC105059...    345   1e-93    
ref|XP_010941234.1|  PREDICTED: uncharacterized protein LOC105059...    345   1e-93    
ref|XP_010941236.1|  PREDICTED: uncharacterized protein LOC105059...    345   1e-93    
ref|XP_010463720.1|  PREDICTED: uncharacterized protein LOC104744...    335   4e-92    
ref|XP_010463721.1|  PREDICTED: uncharacterized protein LOC104744...    334   5e-92    
ref|XP_010485621.1|  PREDICTED: uncharacterized protein LOC104763913    333   2e-91    
ref|XP_006300137.1|  hypothetical protein CARUB_v10016366mg             331   9e-91    
ref|XP_010063514.1|  PREDICTED: uncharacterized protein LOC104450...    334   3e-90    
ref|XP_010502842.1|  PREDICTED: uncharacterized protein LOC104779...    320   8e-88    
ref|XP_008799388.1|  PREDICTED: uncharacterized protein LOC103714...    327   8e-88    
ref|XP_010502787.1|  PREDICTED: uncharacterized protein LOC104779...    319   1e-87    
ref|XP_010502637.1|  PREDICTED: uncharacterized protein LOC104779...    319   2e-87    
ref|XP_010502712.1|  PREDICTED: uncharacterized protein LOC104779...    319   2e-87    
ref|XP_008799387.1|  PREDICTED: uncharacterized protein LOC103714...    325   2e-87    
ref|XP_008799389.1|  PREDICTED: uncharacterized protein LOC103714...    325   2e-87    
ref|XP_008799384.1|  PREDICTED: uncharacterized protein LOC103714...    325   3e-87    
ref|XP_008799386.1|  PREDICTED: uncharacterized protein LOC103714...    325   3e-87    
ref|XP_010275228.1|  PREDICTED: uncharacterized protein LOC104610...    323   3e-86    
ref|XP_010275227.1|  PREDICTED: uncharacterized protein LOC104610...    323   3e-86    
ref|XP_010275224.1|  PREDICTED: uncharacterized protein LOC104610...    322   4e-86    
ref|XP_010275226.1|  PREDICTED: uncharacterized protein LOC104610...    322   4e-86    
ref|XP_010275225.1|  PREDICTED: uncharacterized protein LOC104610...    318   6e-85    
gb|EYU19754.1|  hypothetical protein MIMGU_mgv1a000792mg                309   3e-84    
ref|XP_006847740.1|  hypothetical protein AMTR_s00149p00102010          315   5e-84    
ref|XP_011012541.1|  PREDICTED: uncharacterized protein LOC105116...    306   5e-81    
ref|XP_011012542.1|  PREDICTED: uncharacterized protein LOC105116...    306   5e-81    
ref|XP_011012540.1|  PREDICTED: uncharacterized protein LOC105116...    306   6e-81    
ref|XP_011012543.1|  PREDICTED: uncharacterized protein LOC105116...    306   6e-81    
ref|XP_011012545.1|  PREDICTED: uncharacterized protein LOC105116...    300   2e-79    
ref|XP_010502985.1|  PREDICTED: dentin sialophosphoprotein-like i...    284   1e-76    
ref|XP_009397135.1|  PREDICTED: uncharacterized protein LOC103982...    282   2e-73    
ref|XP_007131493.1|  hypothetical protein PHAVU_011G017900g             278   4e-73    
ref|XP_007131490.1|  hypothetical protein PHAVU_011G017900g             278   4e-73    
gb|EPS73829.1|  hypothetical protein M569_00926                         240   6e-67    
ref|XP_010549857.1|  PREDICTED: uncharacterized protein LOC104820...    252   9e-65    
ref|XP_009395441.1|  PREDICTED: uncharacterized protein LOC103980...    237   6e-60    
ref|XP_009395440.1|  PREDICTED: uncharacterized protein LOC103980...    237   9e-60    
emb|CDY53750.1|  BnaAnng12780D                                          209   1e-51    
ref|XP_009118644.1|  PREDICTED: uncharacterized protein LOC103843647    210   2e-51    
ref|XP_006663990.1|  PREDICTED: uncharacterized protein LOC102710...    209   5e-51    
ref|XP_006663991.1|  PREDICTED: uncharacterized protein LOC102710...    208   5e-51    
ref|XP_006662092.1|  PREDICTED: uncharacterized protein LOC102719988    208   7e-51    
ref|XP_007039510.1|  Uncharacterized protein isoform 6                  204   3e-50    
ref|XP_007039506.1|  Uncharacterized protein isoform 2                  204   4e-50    
ref|XP_007039508.1|  Uncharacterized protein isoform 4                  204   4e-50    
ref|XP_007039507.1|  Uncharacterized protein isoform 3                  204   9e-50    
ref|XP_007208845.1|  hypothetical protein PRUPE_ppa025567mg             198   1e-49    
ref|XP_007039505.1|  Uncharacterized protein isoform 1                  203   1e-49    
ref|XP_007039509.1|  Uncharacterized protein isoform 5                  203   1e-49    
ref|XP_002464896.1|  hypothetical protein SORBIDRAFT_01g028420          201   1e-48    Sorghum bicolor [broomcorn]
gb|EEC69185.1|  hypothetical protein OsI_38169                          200   2e-48    Oryza sativa Indica Group [Indian rice]
ref|XP_002437705.1|  hypothetical protein SORBIDRAFT_10g001106          193   2e-48    Sorghum bicolor [broomcorn]
gb|ABA97690.2|  PHD-finger family protein, expressed                    199   5e-48    Oryza sativa Japonica Group [Japonica rice]
gb|EEE53135.1|  hypothetical protein OsJ_35943                          199   5e-48    Oryza sativa Japonica Group [Japonica rice]
ref|XP_008238272.1|  PREDICTED: uncharacterized protein LOC103336...    196   5e-48    
gb|AFW75260.1|  hypothetical protein ZEAMMB73_797679                    198   7e-48    
ref|XP_008648744.1|  PREDICTED: uncharacterized protein LOC103629...    198   7e-48    
ref|XP_008648742.1|  PREDICTED: uncharacterized protein LOC103629...    198   7e-48    
ref|XP_009389329.1|  PREDICTED: uncharacterized protein LOC103975...    199   7e-48    
ref|XP_009389331.1|  PREDICTED: uncharacterized protein LOC103975...    198   7e-48    
ref|XP_008238271.1|  PREDICTED: uncharacterized protein LOC103336...    196   8e-48    
ref|XP_009389328.1|  PREDICTED: uncharacterized protein LOC103975...    198   9e-48    
ref|XP_009389330.1|  PREDICTED: uncharacterized protein LOC103975...    198   1e-47    
gb|ABG66280.1|  expressed protein                                       197   2e-47    Oryza sativa Japonica Group [Japonica rice]
gb|EEC67485.1|  hypothetical protein OsI_34741                          197   2e-47    Oryza sativa Indica Group [Indian rice]
ref|XP_010235020.1|  PREDICTED: uncharacterized protein LOC100844587    197   2e-47    
gb|KHG02465.1|  Bromodomain adjacent to zinc finger domain 2A           196   3e-47    
gb|AAL86490.1|AC077693_29  putative DNA-binding protein, 5'-partial     194   3e-47    Oryza sativa Japonica Group [Japonica rice]
gb|EEE51448.1|  hypothetical protein OsJ_32548                          196   3e-47    Oryza sativa Japonica Group [Japonica rice]
ref|XP_008659918.1|  PREDICTED: uncharacterized protein LOC103638903    196   6e-47    
ref|XP_004956435.1|  PREDICTED: uncharacterized protein LOC101759...    193   3e-46    
ref|XP_004956434.1|  PREDICTED: uncharacterized protein LOC101759...    193   3e-46    
ref|XP_008658642.1|  PREDICTED: uncharacterized protein LOC103637710    193   3e-46    
tpg|DAA46436.1|  TPA: hypothetical protein ZEAMMB73_035751              193   3e-46    
ref|XP_010237286.1|  PREDICTED: uncharacterized protein LOC100846635    191   5e-46    
ref|XP_004983579.1|  PREDICTED: uncharacterized protein LOC101781733    192   7e-46    
ref|XP_009397137.1|  PREDICTED: uncharacterized protein LOC103982...    191   2e-45    
gb|EMS54694.1|  hypothetical protein TRIUR3_13451                       188   2e-44    
gb|EEC74340.1|  hypothetical protein OsI_09634                          182   3e-43    Oryza sativa Indica Group [Indian rice]
gb|EEE51986.1|  hypothetical protein OsJ_33669                          182   4e-43    Oryza sativa Japonica Group [Japonica rice]
gb|AAX96031.1|  PHD-finger, putative                                    182   5e-43    Oryza sativa Japonica Group [Japonica rice]
ref|XP_011028190.1|  PREDICTED: uncharacterized protein LOC105128...    182   5e-43    
ref|XP_011028191.1|  PREDICTED: uncharacterized protein LOC105128...    182   5e-43    
ref|XP_010237285.1|  PREDICTED: uncharacterized protein LOC100845...    181   7e-43    
ref|XP_010237283.1|  PREDICTED: uncharacterized protein LOC100845...    181   7e-43    
gb|EMT12217.1|  hypothetical protein F775_04667                         182   8e-43    
ref|NP_001067711.2|  Os11g0292000                                       180   1e-42    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006385645.1|  hypothetical protein POPTR_0003s08970g             180   2e-42    
ref|XP_006385644.1|  hypothetical protein POPTR_0003s08970g             180   3e-42    
ref|XP_004962559.1|  PREDICTED: uncharacterized protein LOC101777...    172   8e-41    
ref|XP_004962558.1|  PREDICTED: uncharacterized protein LOC101777...    172   9e-41    
ref|XP_004962557.1|  PREDICTED: uncharacterized protein LOC101777...    173   1e-40    
ref|XP_006663986.1|  PREDICTED: uncharacterized protein LOC102709...    174   2e-40    
ref|XP_006663987.1|  PREDICTED: uncharacterized protein LOC102709...    173   2e-40    
gb|EMT16754.1|  Bromodomain adjacent to zinc finger domain protei...    173   2e-40    
ref|XP_004511791.1|  PREDICTED: uncharacterized protein LOC101505...    171   4e-40    
ref|XP_004511792.1|  PREDICTED: uncharacterized protein LOC101505...    171   6e-40    
ref|XP_004511789.1|  PREDICTED: uncharacterized protein LOC101505...    171   8e-40    
ref|XP_004511790.1|  PREDICTED: uncharacterized protein LOC101505...    171   8e-40    
gb|EPS73830.1|  hypothetical protein M569_00927                         158   2e-38    
ref|XP_010677246.1|  PREDICTED: uncharacterized protein LOC104892920    167   3e-38    
gb|EMS58183.1|  Bromodomain adjacent to zinc finger domain protei...    165   8e-38    
gb|EMS56098.1|  Tyrosine-protein kinase BAZ1B                           162   1e-37    
gb|KHN13038.1|  hypothetical protein glysoja_027326                     160   2e-37    
ref|XP_006590609.1|  PREDICTED: uncharacterized protein LOC102669922    160   4e-37    
gb|EMT02054.1|  Tyrosine-protein kinase BAZ1B                           158   6e-36    
emb|CDP13021.1|  unnamed protein product                                146   1e-32    
ref|XP_003626460.1|  PHD-finger family protein expressed                132   6e-30    
ref|XP_002966498.1|  hypothetical protein SELMODRAFT_439529             137   4e-29    
ref|XP_002982340.1|  hypothetical protein SELMODRAFT_445123             137   4e-29    
ref|XP_010518858.1|  PREDICTED: uncharacterized protein LOC104798461    132   3e-28    
gb|AES82678.2|  hypothetical protein MTR_7g116160                       120   2e-26    
ref|XP_006385643.1|  hypothetical protein POPTR_0003s08970g             123   7e-25    
ref|XP_001765518.1|  predicted protein                                  123   1e-24    
ref|XP_007199125.1|  hypothetical protein PRUPE_ppa021510mg             115   1e-23    
ref|XP_001777945.1|  predicted protein                                  119   2e-23    
ref|XP_007019436.1|  Uncharacterized protein TCM_035488                 113   7e-23    
ref|XP_008237627.1|  PREDICTED: uncharacterized protein LOC103336371    112   1e-22    
ref|XP_006472951.1|  PREDICTED: uncharacterized protein LOC102625994    112   5e-22    
gb|KDO83660.1|  hypothetical protein CISIN_1g0089082mg                  111   9e-22    
ref|XP_011101606.1|  PREDICTED: uncharacterized protein LOC105179...    112   9e-22    
gb|KDO83661.1|  hypothetical protein CISIN_1g0089082mg                  111   9e-22    
ref|XP_011101614.1|  PREDICTED: uncharacterized protein LOC105179...    112   9e-22    
ref|XP_011101579.1|  PREDICTED: uncharacterized protein LOC105179...    112   9e-22    
ref|XP_011101598.1|  PREDICTED: uncharacterized protein LOC105179...    112   9e-22    
ref|XP_011101590.1|  PREDICTED: uncharacterized protein LOC105179...    112   9e-22    
gb|KDO83662.1|  hypothetical protein CISIN_1g0089082mg                  111   1e-21    
ref|XP_006434426.1|  hypothetical protein CICLE_v10000763mg             111   1e-21    
gb|KHN47277.1|  hypothetical protein glysoja_043087                     111   1e-21    
gb|KHN19657.1|  hypothetical protein glysoja_047067                     111   2e-21    
ref|XP_010319818.1|  PREDICTED: uncharacterized protein LOC101262104    108   2e-21    
ref|XP_006340480.1|  PREDICTED: uncharacterized protein LOC102581686    108   2e-21    
ref|XP_011101637.1|  PREDICTED: uncharacterized protein LOC105179...    110   2e-21    
ref|XP_011101633.1|  PREDICTED: uncharacterized protein LOC105179...    110   2e-21    
ref|XP_006587258.1|  PREDICTED: uncharacterized protein LOC102669160    110   4e-21    
ref|XP_011101626.1|  PREDICTED: uncharacterized protein LOC105179...    109   5e-21    
ref|XP_008373265.1|  PREDICTED: uncharacterized protein LOC103436597    105   7e-21    
ref|XP_006582126.1|  PREDICTED: uncharacterized protein LOC102667689    109   1e-20    
ref|XP_010664973.1|  PREDICTED: uncharacterized protein LOC104882...    106   1e-20    
ref|XP_009769945.1|  PREDICTED: uncharacterized protein LOC104220...    106   2e-20    
ref|XP_009769953.1|  PREDICTED: uncharacterized protein LOC104220...    106   2e-20    
ref|XP_009769952.1|  PREDICTED: uncharacterized protein LOC104220...    106   2e-20    
ref|XP_009769951.1|  PREDICTED: uncharacterized protein LOC104220...    106   2e-20    
ref|XP_010664972.1|  PREDICTED: uncharacterized protein LOC104882...    106   2e-20    
ref|XP_011074762.1|  PREDICTED: uncharacterized protein LOC105159...    106   2e-20    
ref|XP_010664971.1|  PREDICTED: uncharacterized protein LOC104882...    106   2e-20    
gb|KEH42606.1|  hypothetical protein MTR_1g070430                       108   2e-20    
ref|XP_011074763.1|  PREDICTED: uncharacterized protein LOC105159...    105   3e-20    
ref|XP_009620783.1|  PREDICTED: uncharacterized protein LOC104112...    105   5e-20    
ref|XP_009620782.1|  PREDICTED: uncharacterized protein LOC104112...    105   5e-20    
ref|XP_009620781.1|  PREDICTED: uncharacterized protein LOC104112...    105   5e-20    
ref|XP_009620780.1|  PREDICTED: uncharacterized protein LOC104112...    105   5e-20    
emb|CDP18279.1|  unnamed protein product                                106   6e-20    
ref|XP_009615962.1|  PREDICTED: uncharacterized protein LOC104108...    103   1e-19    
ref|XP_009615961.1|  PREDICTED: uncharacterized protein LOC104108...    103   2e-19    
ref|XP_009780942.1|  PREDICTED: uncharacterized protein LOC104229912    103   2e-19    
gb|KDP43027.1|  hypothetical protein JCGZ_25213                         103   2e-19    
ref|XP_009407037.1|  PREDICTED: uncharacterized protein LOC103989817    105   2e-19    
ref|XP_007152080.1|  hypothetical protein PHAVU_004G100400g             105   3e-19    
ref|XP_010319314.1|  PREDICTED: uncharacterized protein LOC101248...    101   4e-19    
ref|XP_004237166.1|  PREDICTED: uncharacterized protein LOC101248...    100   5e-19    
ref|XP_003592150.1|  hypothetical protein MTR_1g099270                  100   8e-19    
ref|XP_010680252.1|  PREDICTED: uncharacterized protein LOC104895438    100   8e-19    
ref|XP_008373583.1|  PREDICTED: uncharacterized protein LOC103436904  96.3    2e-18    
ref|XP_010461428.1|  PREDICTED: uncharacterized protein LOC104742151    100   3e-18    
ref|XP_009360762.1|  PREDICTED: uncharacterized protein LOC103951174  95.9    6e-18    
emb|CDP13023.1|  unnamed protein product                              92.4    7e-18    
ref|XP_006359315.1|  PREDICTED: uncharacterized protein LOC102599098  96.7    1e-17    
ref|XP_010245258.1|  PREDICTED: uncharacterized protein LOC104588...  96.3    1e-17    
ref|XP_004496494.1|  PREDICTED: uncharacterized protein LOC101501...  96.3    1e-17    
ref|XP_010245256.1|  PREDICTED: uncharacterized protein LOC104588...  96.7    1e-17    
ref|XP_009338913.1|  PREDICTED: uncharacterized protein LOC103931215  96.7    1e-17    
ref|XP_010245254.1|  PREDICTED: uncharacterized protein LOC104588...  96.7    1e-17    
ref|XP_010245255.1|  PREDICTED: uncharacterized protein LOC104588...  95.9    2e-17    
ref|XP_010245253.1|  PREDICTED: uncharacterized protein LOC104588...  95.9    2e-17    
ref|XP_010245257.1|  PREDICTED: uncharacterized protein LOC104588...  95.5    2e-17    
ref|XP_004496495.1|  PREDICTED: uncharacterized protein LOC101501...  95.5    2e-17    
ref|XP_010479666.1|  PREDICTED: histone-lysine N-methyltransferas...  98.2    3e-17    
ref|XP_010245252.1|  PREDICTED: uncharacterized protein LOC104588...  95.9    3e-17    
ref|XP_008461943.1|  PREDICTED: uncharacterized protein LOC103500...  95.5    3e-17    
ref|XP_008461941.1|  PREDICTED: uncharacterized protein LOC103500...  95.1    3e-17    
ref|XP_006362810.1|  PREDICTED: uncharacterized protein LOC102603...  96.7    3e-17    
ref|XP_006362811.1|  PREDICTED: uncharacterized protein LOC102603...  96.3    4e-17    
ref|XP_010259791.1|  PREDICTED: uncharacterized protein LOC104599...  97.4    4e-17    
ref|XP_009616695.1|  PREDICTED: uncharacterized protein LOC104109171  95.9    4e-17    
ref|XP_010259783.1|  PREDICTED: uncharacterized protein LOC104599...  97.1    5e-17    
gb|EYU17430.1|  hypothetical protein MIMGU_mgv1a026792mg              94.4    5e-17    
ref|XP_010259806.1|  PREDICTED: uncharacterized protein LOC104599...  96.3    6e-17    
gb|AES75422.2|  hypothetical protein MTR_6g044600                     97.4    7e-17    
ref|XP_008461944.1|  PREDICTED: uncharacterized protein LOC103500...  94.0    7e-17    
ref|XP_010259799.1|  PREDICTED: uncharacterized protein LOC104599...  96.3    8e-17    
ref|XP_002437706.1|  hypothetical protein SORBIDRAFT_10g001107        93.6    8e-17    
ref|XP_010530238.1|  PREDICTED: uncharacterized protein LOC104806851  94.0    1e-16    
ref|XP_003619204.1|  PHD-finger family protein expressed              96.7    1e-16    
ref|NP_001117432.1|  RING/FYVE/PHD zinc finger-containing protein     94.0    1e-16    
ref|XP_008806830.1|  PREDICTED: uncharacterized protein LOC103719390  95.9    2e-16    
ref|XP_004515116.1|  PREDICTED: uncharacterized protein LOC101510...  96.3    2e-16    
ref|XP_008799746.1|  PREDICTED: uncharacterized protein LOC103714318  95.1    2e-16    
ref|XP_006854608.1|  hypothetical protein AMTR_s00030p00140460        92.4    3e-16    
ref|NP_001065464.1|  Os10g0572500                                     94.7    3e-16    
gb|KEH25789.1|  hypothetical protein MTR_6g034375                     94.7    4e-16    
gb|KEH25788.1|  hypothetical protein MTR_6g034375                     94.7    4e-16    
ref|XP_006307521.1|  hypothetical protein CARUB_v10009144mg           92.8    4e-16    
ref|XP_010926918.1|  PREDICTED: uncharacterized protein LOC105049...  94.0    5e-16    
ref|XP_010926917.1|  PREDICTED: uncharacterized protein LOC105049...  94.4    5e-16    
gb|EYU17431.1|  hypothetical protein MIMGU_mgv1a008715mg              91.3    6e-16    
ref|XP_009769701.1|  PREDICTED: uncharacterized protein LOC104220515  92.0    7e-16    
ref|XP_006664360.1|  PREDICTED: uncharacterized protein LOC102708487  93.6    9e-16    
ref|XP_004956348.1|  PREDICTED: uncharacterized protein LOC101756415  92.0    2e-15    
gb|KGN44494.1|  hypothetical protein Csa_7G318450                     87.0    2e-15    
emb|CDY48869.1|  BnaA06g03130D                                        90.9    2e-15    
ref|XP_011023004.1|  PREDICTED: uncharacterized protein LOC105124611  88.6    4e-15    
emb|CDX70707.1|  BnaC03g07910D                                        87.8    5e-15    
ref|XP_010680257.1|  PREDICTED: uncharacterized protein LOC104895...  90.9    6e-15    
ref|XP_009147897.1|  PREDICTED: uncharacterized protein LOC103871...  90.5    6e-15    
ref|XP_002442853.1|  hypothetical protein SORBIDRAFT_08g003860        90.9    6e-15    
emb|CDP04750.1|  unnamed protein product                              89.7    7e-15    
ref|NP_001233912.1|  E4/E8 binding protein-1                          89.4    7e-15    
ref|XP_006351039.1|  PREDICTED: uncharacterized protein LOC102604199  89.4    9e-15    
ref|XP_009776426.1|  PREDICTED: uncharacterized protein LOC104226206  89.0    1e-14    
ref|XP_011100150.1|  PREDICTED: uncharacterized protein LOC105178383  89.0    1e-14    
gb|EEC68900.1|  hypothetical protein OsI_37561                        89.0    1e-14    
emb|CDY59127.1|  BnaCnng34380D                                        89.0    2e-14    
ref|XP_007143517.1|  hypothetical protein PHAVU_007G078100g           86.7    2e-14    
ref|XP_008461945.1|  PREDICTED: uncharacterized protein LOC103500...  86.3    2e-14    
ref|XP_004977330.1|  PREDICTED: uncharacterized protein LOC101784120  89.7    2e-14    
ref|XP_011072871.1|  PREDICTED: uncharacterized protein LOC105157...  88.6    2e-14    
ref|XP_011072870.1|  PREDICTED: uncharacterized protein LOC105157...  88.6    2e-14    
ref|XP_006393770.1|  hypothetical protein EUTSA_v10011612mg           86.3    2e-14    
ref|XP_011072869.1|  PREDICTED: uncharacterized protein LOC105157...  88.2    2e-14    
ref|XP_010931048.1|  PREDICTED: uncharacterized protein LOC105052052  87.8    3e-14    
ref|XP_008662494.1|  PREDICTED: uncharacterized protein LOC103640797  88.6    3e-14    
ref|XP_008661744.1|  PREDICTED: uncharacterized protein LOC100276...  88.6    3e-14    
ref|NP_001066219.1|  Os12g0161500                                     87.4    4e-14    
emb|CBI35492.3|  unnamed protein product                              83.6    4e-14    
ref|XP_011001423.1|  PREDICTED: uncharacterized protein LOC105108...  86.7    5e-14    
ref|XP_011001422.1|  PREDICTED: uncharacterized protein LOC105108...  86.3    5e-14    
ref|XP_004139676.1|  PREDICTED: uncharacterized protein LOC101213907  82.4    5e-14    
ref|XP_003619407.1|  hypothetical protein MTR_6g052260                84.7    6e-14    
dbj|BAF01275.1|  hypothetical protein                                 84.7    7e-14    
gb|KDP26133.1|  hypothetical protein JCGZ_22234                       84.7    8e-14    
gb|ABA96542.2|  expressed protein                                     86.7    8e-14    
ref|XP_010663250.1|  PREDICTED: uncharacterized protein LOC100854...  86.7    9e-14    
ref|XP_011012507.1|  PREDICTED: uncharacterized protein LOC105116...  85.9    1e-13    
ref|XP_009147898.1|  PREDICTED: uncharacterized protein LOC103871...  86.3    1e-13    
ref|XP_011001424.1|  PREDICTED: uncharacterized protein LOC105108...  85.9    1e-13    
ref|XP_004962560.1|  PREDICTED: uncharacterized protein LOC101777...  86.3    1e-13    
ref|XP_010663251.1|  PREDICTED: uncharacterized protein LOC100854...  86.3    1e-13    
ref|XP_010062139.1|  PREDICTED: uncharacterized protein LOC104449...  85.1    1e-13    
ref|XP_003634298.2|  PREDICTED: uncharacterized protein LOC100854...  86.3    1e-13    
ref|XP_010062138.1|  PREDICTED: uncharacterized protein LOC104449...  85.1    1e-13    
gb|KCW69205.1|  hypothetical protein EUGRSUZ_F02722                   84.7    1e-13    
ref|XP_002468281.1|  hypothetical protein SORBIDRAFT_01g042960        86.7    2e-13    
ref|XP_002309893.2|  hypothetical protein POPTR_0007s03750g           82.4    3e-13    
ref|XP_004978327.1|  PREDICTED: uncharacterized protein LOC101754677  84.7    3e-13    
ref|XP_002307485.1|  PHD finger family protein                        84.3    3e-13    
ref|XP_009406063.1|  PREDICTED: uncharacterized protein LOC103989049  83.2    3e-13    
ref|XP_006427808.1|  hypothetical protein CICLE_v10025832mg           82.4    4e-13    
ref|XP_002306612.2|  PHD finger family protein                        84.0    4e-13    
ref|XP_006464615.1|  PREDICTED: uncharacterized protein LOC102607...  82.8    4e-13    
ref|XP_006606157.1|  PREDICTED: uncharacterized protein LOC100796913  82.4    4e-13    
ref|XP_010312473.1|  PREDICTED: uncharacterized protein LOC101263...  84.0    5e-13    
gb|KDO58369.1|  hypothetical protein CISIN_1g0167792mg                82.8    5e-13    
gb|KHN16994.1|  hypothetical protein glysoja_011468                   82.0    5e-13    
gb|KEH43663.1|  hypothetical protein MTR_1g099270                     82.0    5e-13    
ref|XP_003536437.1|  PREDICTED: uncharacterized protein LOC100817...  82.0    6e-13    
ref|XP_010312474.1|  PREDICTED: uncharacterized protein LOC101263...  83.6    6e-13    
gb|EEE52811.1|  hypothetical protein OsJ_35311                        84.3    6e-13    
gb|ABA96546.1|  expressed protein                                     84.3    7e-13    
ref|XP_006427809.1|  hypothetical protein CICLE_v10025832mg           82.4    7e-13    
ref|XP_006464611.1|  PREDICTED: uncharacterized protein LOC102607...  82.4    8e-13    
ref|XP_010312472.1|  PREDICTED: uncharacterized protein LOC101263...  83.2    8e-13    
gb|KHN46431.1|  L-type lectin-domain containing receptor kinase S.6   82.4    9e-13    
ref|XP_010312471.1|  PREDICTED: uncharacterized protein LOC101263...  83.2    1e-12    
ref|XP_006437429.1|  hypothetical protein CICLE_v100331081mg          77.8    1e-12    
ref|XP_010247257.1|  PREDICTED: uncharacterized protein LOC104590...  82.4    2e-12    
ref|XP_010999805.1|  PREDICTED: uncharacterized protein LOC105107...  82.0    2e-12    
ref|XP_010999804.1|  PREDICTED: uncharacterized protein LOC105107...  81.6    2e-12    
ref|XP_010247256.1|  PREDICTED: uncharacterized protein LOC104590...  81.6    3e-12    
ref|NP_001049364.1|  Os03g0213600                                     82.0    4e-12    
gb|EEE58579.1|  hypothetical protein OsJ_09901                        82.0    4e-12    
ref|XP_009597716.1|  PREDICTED: uncharacterized protein LOC104093...  80.9    5e-12    
gb|EEC74754.1|  hypothetical protein OsI_10513                        81.3    6e-12    
ref|XP_006589501.1|  PREDICTED: uncharacterized protein LOC102666082  78.6    7e-12    
gb|KHN31130.1|  hypothetical protein glysoja_012780                   77.8    7e-12    
ref|XP_003567412.2|  PREDICTED: uncharacterized protein LOC100822533  80.5    8e-12    
ref|XP_009597717.1|  PREDICTED: uncharacterized protein LOC104093...  79.7    9e-12    
ref|XP_006578797.1|  PREDICTED: uncharacterized protein LOC102668229  78.2    1e-11    
ref|XP_009785077.1|  PREDICTED: uncharacterized protein LOC104233387  79.7    1e-11    
ref|XP_003618041.1|  hypothetical protein MTR_5g098320                77.0    1e-11    
ref|XP_004985204.1|  PREDICTED: uncharacterized protein LOC101776...  80.5    1e-11    
gb|KHN16995.1|  hypothetical protein glysoja_011469                   77.8    1e-11    
ref|XP_004295161.1|  PREDICTED: uncharacterized protein LOC101308361  77.8    1e-11    
ref|XP_006837134.1|  hypothetical protein AMTR_s00110p00135600        79.3    2e-11    
ref|XP_004985203.1|  PREDICTED: uncharacterized protein LOC101776...  79.0    3e-11    
ref|XP_007155778.1|  hypothetical protein PHAVU_003G230900g           77.4    3e-11    
ref|XP_010322713.1|  PREDICTED: uncharacterized protein LOC104648063  76.3    5e-11    
ref|XP_002442850.1|  hypothetical protein SORBIDRAFT_08g003830        77.4    8e-11    
gb|EYU23799.1|  hypothetical protein MIMGU_mgv1a023369mg              73.2    1e-10    
gb|AES72822.2|  RING/FYVE/PHD zinc finger protein, putative           74.7    1e-10    
ref|XP_003602571.1|  hypothetical protein MTR_3g095800                74.3    1e-10    
ref|XP_010680259.1|  PREDICTED: uncharacterized protein LOC104895446  76.3    1e-10    
ref|XP_004236499.1|  PREDICTED: uncharacterized protein LOC101268270  75.9    2e-10    
ref|XP_004984011.1|  PREDICTED: uncharacterized protein LOC101753925  75.1    2e-10    
ref|XP_010238691.1|  PREDICTED: uncharacterized protein LOC104584781  75.9    2e-10    
gb|ABG22377.1|  PHD-finger family protein, expressed                  72.8    2e-10    
ref|XP_002442855.1|  hypothetical protein SORBIDRAFT_08g003890        75.5    3e-10    
ref|XP_010318850.1|  PREDICTED: uncharacterized protein LOC104646591  74.3    3e-10    
gb|KHN01698.1|  hypothetical protein glysoja_013009                   72.8    3e-10    
ref|XP_008657008.1|  PREDICTED: uncharacterized protein LOC103636...  74.7    3e-10    
ref|XP_006579970.1|  PREDICTED: uncharacterized protein LOC100800...  72.4    3e-10    
ref|XP_002442856.1|  hypothetical protein SORBIDRAFT_08g003900        75.5    4e-10    
ref|XP_008657001.1|  PREDICTED: uncharacterized protein LOC103636...  74.3    4e-10    
gb|EMT33528.1|  hypothetical protein F775_06362                       74.7    5e-10    
gb|EEC67722.1|  hypothetical protein OsI_35207                        74.7    5e-10    
tpg|DAA44064.1|  TPA: hypothetical protein ZEAMMB73_585196            74.7    5e-10    
gb|EEE51692.1|  hypothetical protein OsJ_33055                        74.7    5e-10    
ref|NP_001065815.1|  Os11g0160100                                     74.7    5e-10    
ref|XP_003525888.2|  PREDICTED: uncharacterized protein LOC100800...  72.4    6e-10    
ref|XP_002891271.1|  predicted protein                                73.9    6e-10    
ref|XP_010239099.1|  PREDICTED: uncharacterized protein LOC104584949  73.6    6e-10    
gb|EMT09239.1|  hypothetical protein F775_08146                       74.3    7e-10    
gb|ABA91581.2|  PHD-finger family protein, expressed                  74.3    7e-10    
ref|XP_008645702.1|  PREDICTED: uncharacterized protein LOC100383...  74.3    8e-10    
ref|XP_008645697.1|  PREDICTED: uncharacterized protein LOC100383...  74.3    8e-10    
gb|EMT00025.1|  hypothetical protein F775_04899                       74.3    8e-10    
ref|XP_006664358.1|  PREDICTED: uncharacterized protein LOC102707638  70.5    9e-10    
gb|EMT25501.1|  hypothetical protein F775_04308                       72.8    2e-09    
gb|AES69204.2|  RING/FYVE/PHD zinc finger protein, putative           72.4    2e-09    
gb|EYU17432.1|  hypothetical protein MIMGU_mgv1a010590mg              70.1    3e-09    
ref|NP_001066220.1|  Os12g0161700                                     69.3    3e-09    
ref|XP_010680196.1|  PREDICTED: uncharacterized protein LOC104895...  71.2    6e-09    
ref|XP_010695205.1|  PREDICTED: uncharacterized protein LOC104907...  70.5    7e-09    
ref|XP_007137700.1|  hypothetical protein PHAVU_009G148400g           68.2    8e-09    
ref|XP_010680189.1|  PREDICTED: uncharacterized protein LOC104895...  70.9    1e-08    
gb|AFW56125.1|  hypothetical protein ZEAMMB73_505831                  67.0    1e-08    
ref|XP_010680181.1|  PREDICTED: uncharacterized protein LOC104895...  70.9    1e-08    
ref|XP_010680172.1|  PREDICTED: uncharacterized protein LOC104895...  70.9    1e-08    
ref|XP_010695206.1|  PREDICTED: uncharacterized protein LOC104907...  70.1    1e-08    
gb|EPS67045.1|  hypothetical protein M569_07731                       67.8    1e-08    
ref|XP_011087297.1|  PREDICTED: uncharacterized protein LOC105168...  69.3    1e-08    



>ref|XP_009769639.1| PREDICTED: uncharacterized protein LOC104220458 isoform X5 [Nicotiana 
sylvestris]
Length=1475

 Score =   936 bits (2418),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 600/1325 (45%), Positives = 814/1325 (61%), Gaps = 99/1325 (7%)
 Frame = +3

Query  684   GETCVENASSFSGTDVLPASKS--KKDFALEAKMEVSDSLEDHVVSLADKEGIDKVVNTT  857
             GET   NA S    D L  + S  K D A EA     D   D      D++ +   V++ 
Sbjct  171   GETSSRNAHSIG--DYLENNHSSIKNDVASEAS---GDLPADTCPEKDDQKSVGSPVSSD  225

Query  858   GLDLIASQIHQMeesddseivevdvkvCDICGAVGREHLLAICSRCTDGAEHTYCMQKML  1037
               D +  Q HQM+ S+DS+I E DVKVCDICG  GRE LLAIC +CTDGAEHTYCM++ML
Sbjct  226   TKDAL--QSHQMDGSEDSDIEEQDVKVCDICGDAGREDLLAICCKCTDGAEHTYCMREML  283

Query  1038  EKIPEGDWLCEECKFDQEMKNEHVN-SGRVNEKEKTSPSRRTTIAKSDHPLKMEQKTSDC  1214
             +K+PEGDW+CEECKFD+EMKN   + S + +   K+  + +T I  +   +K E K SD 
Sbjct  284   QKVPEGDWMCEECKFDEEMKNRKGDKSVKFDGYRKSYHTGQTAIDDTGVTIKTEAKPSDA  343

Query  1215  WGDKAVEERSYLKTSGKRCTDDSEVSSPTKRQRLELRS--PTAQIPNRVTSLSRESSFKN  1388
              G+ A    S  K SGKR  DDSEVSS  K+Q  E  S  P    PNR+T+LSRESSFKN
Sbjct  344   DGETA----SDTKISGKRRMDDSEVSSVAKKQAFEPASGSPKTLSPNRLTALSRESSFKN  399

Query  1389  LERGKVKPLNPFSSGSFAAKVPSSTGPQPQPPRGIFSKSNSFSSLIAKPKVKLVDEVFPA  1568
              ++GK+K +N  SSG  +     + GP+ Q  RG FSKSNSFSSL AK KV+LVDE F  
Sbjct  400   SDKGKLKSVNQISSGGLSVHDTPAWGPRLQTARGTFSKSNSFSSLAAKRKVQLVDEGFLP  459

Query  1569  KQKLSRETAFIESKEVAVRSMGKSMSFKPTTASRSNCTESKVKMFSPKFSHDQDVKWLRH  1748
             KQKL  E+A ++ KE ++RSM KSMSF+  + SR+N +E+KVKM SPKFS  QD K    
Sbjct  460   KQKLVNESAGLDVKESSIRSMSKSMSFRSISTSRNNVSEAKVKMLSPKFSPAQD-KGQMQ  518

Query  1749  KKDRSSFDRKNSLRSDRLAGGAISSPKSDNKPTPRGEPSSLSSLNTNRDYRALTSDNKPV  1928
              K+R+ F+RK+S RS+R +G ++ S K++ +   RG+PS L S + NRD R    D+KPV
Sbjct  519   TKERNPFERKSSFRSERSSGTSVPS-KTEQRSAFRGDPSPLFSSSNNRDSRPGQLDSKPV  577

Query  1929  TISNSTSGVAR----------EVLKQASVD----GVSSANRVSSSEENPSQAIPKEDSSS  2066
             ++  S+  VAR          E  KQ S+     GV +AN++SSS++ P+Q+  ++D SS
Sbjct  578   SLLKSSGAVARRTPEVSVHSDEAKKQISLTSISTGVPAANKISSSDQRPNQSNARDDPSS  637

Query  2067  SSCVAERPSWSSNEVLPDGLSQSKESKAFGDKTRESSASRSKQNSTASGKIVSCQKCKGN  2246
              S +AERP+ ++ E L DG+SQ +E+K  G++ RE+S  R K + T + K + CQ+CKG+
Sbjct  638   ISYIAERPTSNTGEGLLDGVSQQRETKNVGERIRENSGRRLKHSGTGT-KSLFCQRCKGS  696

Query  2247  GHLAQVCTADGPE-SSALGSPFKSSREATNGPSDLKAAIEAARLRKPGICRKNRVADQSE  2423
             GHL + CTADGP+ S++  S  K+S+EA NG SDLKAAIEAA LRKPGICRKNRV DQS+
Sbjct  697   GHLTESCTADGPDLSTSDVSAVKNSKEAPNGTSDLKAAIEAAMLRKPGICRKNRVFDQSD  756

Query  2424  DLSASNMKSEIASQDQMLSSTVRRNVNGAEE-----------AQKQETANNAKQLGIIA-  2567
             DL+ SN  SE  +QD    S+ RR +   EE           + KQE +N  +QL ++A 
Sbjct  757   DLAMSNTNSETTAQDLPSGSSGRRILPTNEEGYGLSSNSMTGSYKQEISN-MRQLSVLAA  815

Query  2568  EASARTRNAGHVVFSDVKHSVIDMERQTLVSMPVILKTAIPEYQYIWQGGFEVQKSGKAF  2747
             EA +R  NA  ++ SD K S++D++R +  ++ ++ +TAIPE++YIWQG FEVQK+G+  
Sbjct  816   EALSRAGNAVPILPSDEKSSLVDLDRYSQAAIAILSRTAIPEHEYIWQGAFEVQKNGRTL  875

Query  2748  NLYDGIQAHLSSCASPKVLDAVNKFPRKVILNEVPRLSSWPMQFKECGVSEDNVALFFFA  2927
             +L DGIQAHLSSCASPKVLD VNKFP+KV+ NEV RLS+WP+QF+E GV+EDN+ALFFFA
Sbjct  876   DLCDGIQAHLSSCASPKVLDTVNKFPQKVLFNEVSRLSTWPIQFQEYGVTEDNIALFFFA  935

Query  2928  KDIGSYEKSYKVLLGDMVKHDLALQGNIGDIELLIFPSNQLPEKFQRWNLMFFLWGVFRG  3107
             +DIGSYE+ YK LL +M+++D+AL+ N+  +ELLIFPSN+LPEK QRWN+MFFLWGVFR 
Sbjct  936   RDIGSYERCYKTLLENMIRNDMALKANLEGVELLIFPSNRLPEKSQRWNMMFFLWGVFRV  995

Query  3108  KRANSLQNFPGAEKP--LIQDIPTPATSLPENMFTPVPKLNSARGSAATNTEMSAVKESE  3281
             K+A+ +Q+     KP  L QDIP  +   PEN+    P  N+A  +   + E+ A KES 
Sbjct  996   KKASCVQHMQATGKPFPLPQDIPKSSMLFPENVRCLGPVDNAASDNVTMDVEVIASKESG  1055

Query  3282  SASLHKIVNGNCSIQSSSQVSRDKCSRINAEQNDKLDSSSMQNSEPKLGPDRRYFGV-PL  3458
                   +VNGN   ++S QV +     +N E  +    + +  S+    P RR +G+  +
Sbjct  1056  CP----LVNGNVDSKAS-QVCKGDSVAVNVEHLEPSSVTIVPTSQLNSSPGRRRYGIFQV  1110

Query  3459  GEAVH--------SSVQTAERVSSPNTSRPMSVHWAAPLDGEKLSMLSDETP-TMQEATS  3611
             G+A          SS   A   ++ + + P+ +   + +D ++ S   DE P  MQE  S
Sbjct  1111  GDAGQECKSELQSSSTPAANTWTNVSITEPVPMECGSLVDRQRPSHSVDEAPGRMQEKAS  1170

Query  3612  VGSTTKNLCGKDDVKIGRICLDNVSTEEATPLARHTSMEQTLNVISSFGVNPKKRSHSAE  3791
             +GST K     +  K      D    EEA+  +   + E T  V++S  +N  KR  S E
Sbjct  1171  MGSTEKGFGSTNGRKFEINLEDEYKDEEASETSGSATTEPTRKVLNSDMLNHLKRPRSVE  1230

Query  3792  TVLQsasssgtsqafssysNDDILVEEFCHKRVKLNSDRSYGCNDQTSCSKDGFLSEMGG  3971
             TV+QS  S       S   ND ++ +    K++K +   SYG ++QTSCS D FLS M G
Sbjct  1231  TVMQSVDSGVNLATRSFNDNDIVVEKAPYDKKLKTSVGGSYGNSEQTSCSSDDFLSRMHG  1290

Query  3972  TASQLSRQKNERDEALSKTAILETPGNAEMFFFPVDPHPVGNIGSNNSSMPWKVHPLEED  4151
             ++ +        DEALSK AI E  G+A  +FFPVDPHPV        S PW++H  + D
Sbjct  1291  SSYRPYLPDTGCDEALSKAAIPECSGSAARYFFPVDPHPV-----EARSAPWQMHHSDND  1345

Query  4152  QLHDKAPNLELALG---------------------------AKTKPLMSGIPSFLSGKVE  4250
             +L D+ PNLELALG                           A+T  L  GIP FL GKV+
Sbjct  1346  RLSDRVPNLELALGGESNLLTQGIPPFLVGKLDKKIIQDQGAETHSLTQGIPPFLVGKVD  1405

Query  4251  KKIIEENTSDNAATSANK-EDVsaslslslsFPFPEKEH--GTSSKPEQEDPRRRQANTS  4421
             K++I++ +S   A    + EDVSASLSLSLSFPFPEKE   G+ S+ EQ  P  ++ NT 
Sbjct  1406  KRVIQDPSSAKEAIRVEEVEDVSASLSLSLSFPFPEKEQQKGSVSQKEQAMPETKRGNTP  1465

Query  4422  LLLFG  4436
             LL FG
Sbjct  1466  LLFFG  1470



>ref|XP_009769637.1| PREDICTED: uncharacterized protein LOC104220458 isoform X3 [Nicotiana 
sylvestris]
Length=1535

 Score =   934 bits (2415),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 600/1325 (45%), Positives = 814/1325 (61%), Gaps = 99/1325 (7%)
 Frame = +3

Query  684   GETCVENASSFSGTDVLPASKS--KKDFALEAKMEVSDSLEDHVVSLADKEGIDKVVNTT  857
             GET   NA S    D L  + S  K D A EA     D   D      D++ +   V++ 
Sbjct  231   GETSSRNAHSIG--DYLENNHSSIKNDVASEAS---GDLPADTCPEKDDQKSVGSPVSSD  285

Query  858   GLDLIASQIHQMeesddseivevdvkvCDICGAVGREHLLAICSRCTDGAEHTYCMQKML  1037
               D +  Q HQM+ S+DS+I E DVKVCDICG  GRE LLAIC +CTDGAEHTYCM++ML
Sbjct  286   TKDAL--QSHQMDGSEDSDIEEQDVKVCDICGDAGREDLLAICCKCTDGAEHTYCMREML  343

Query  1038  EKIPEGDWLCEECKFDQEMKNEHVN-SGRVNEKEKTSPSRRTTIAKSDHPLKMEQKTSDC  1214
             +K+PEGDW+CEECKFD+EMKN   + S + +   K+  + +T I  +   +K E K SD 
Sbjct  344   QKVPEGDWMCEECKFDEEMKNRKGDKSVKFDGYRKSYHTGQTAIDDTGVTIKTEAKPSDA  403

Query  1215  WGDKAVEERSYLKTSGKRCTDDSEVSSPTKRQRLELRS--PTAQIPNRVTSLSRESSFKN  1388
              G+ A    S  K SGKR  DDSEVSS  K+Q  E  S  P    PNR+T+LSRESSFKN
Sbjct  404   DGETA----SDTKISGKRRMDDSEVSSVAKKQAFEPASGSPKTLSPNRLTALSRESSFKN  459

Query  1389  LERGKVKPLNPFSSGSFAAKVPSSTGPQPQPPRGIFSKSNSFSSLIAKPKVKLVDEVFPA  1568
              ++GK+K +N  SSG  +     + GP+ Q  RG FSKSNSFSSL AK KV+LVDE F  
Sbjct  460   SDKGKLKSVNQISSGGLSVHDTPAWGPRLQTARGTFSKSNSFSSLAAKRKVQLVDEGFLP  519

Query  1569  KQKLSRETAFIESKEVAVRSMGKSMSFKPTTASRSNCTESKVKMFSPKFSHDQDVKWLRH  1748
             KQKL  E+A ++ KE ++RSM KSMSF+  + SR+N +E+KVKM SPKFS  QD K    
Sbjct  520   KQKLVNESAGLDVKESSIRSMSKSMSFRSISTSRNNVSEAKVKMLSPKFSPAQD-KGQMQ  578

Query  1749  KKDRSSFDRKNSLRSDRLAGGAISSPKSDNKPTPRGEPSSLSSLNTNRDYRALTSDNKPV  1928
              K+R+ F+RK+S RS+R +G ++ S K++ +   RG+PS L S + NRD R    D+KPV
Sbjct  579   TKERNPFERKSSFRSERSSGTSVPS-KTEQRSAFRGDPSPLFSSSNNRDSRPGQLDSKPV  637

Query  1929  TISNSTSGVAR----------EVLKQASVD----GVSSANRVSSSEENPSQAIPKEDSSS  2066
             ++  S+  VAR          E  KQ S+     GV +AN++SSS++ P+Q+  ++D SS
Sbjct  638   SLLKSSGAVARRTPEVSVHSDEAKKQISLTSISTGVPAANKISSSDQRPNQSNARDDPSS  697

Query  2067  SSCVAERPSWSSNEVLPDGLSQSKESKAFGDKTRESSASRSKQNSTASGKIVSCQKCKGN  2246
              S +AERP+ ++ E L DG+SQ +E+K  G++ RE+S  R K + T + K + CQ+CKG+
Sbjct  698   ISYIAERPTSNTGEGLLDGVSQQRETKNVGERIRENSGRRLKHSGTGT-KSLFCQRCKGS  756

Query  2247  GHLAQVCTADGPE-SSALGSPFKSSREATNGPSDLKAAIEAARLRKPGICRKNRVADQSE  2423
             GHL + CTADGP+ S++  S  K+S+EA NG SDLKAAIEAA LRKPGICRKNRV DQS+
Sbjct  757   GHLTESCTADGPDLSTSDVSAVKNSKEAPNGTSDLKAAIEAAMLRKPGICRKNRVFDQSD  816

Query  2424  DLSASNMKSEIASQDQMLSSTVRRNVNGAEE-----------AQKQETANNAKQLGIIA-  2567
             DL+ SN  SE  +QD    S+ RR +   EE           + KQE +N  +QL ++A 
Sbjct  817   DLAMSNTNSETTAQDLPSGSSGRRILPTNEEGYGLSSNSMTGSYKQEISN-MRQLSVLAA  875

Query  2568  EASARTRNAGHVVFSDVKHSVIDMERQTLVSMPVILKTAIPEYQYIWQGGFEVQKSGKAF  2747
             EA +R  NA  ++ SD K S++D++R +  ++ ++ +TAIPE++YIWQG FEVQK+G+  
Sbjct  876   EALSRAGNAVPILPSDEKSSLVDLDRYSQAAIAILSRTAIPEHEYIWQGAFEVQKNGRTL  935

Query  2748  NLYDGIQAHLSSCASPKVLDAVNKFPRKVILNEVPRLSSWPMQFKECGVSEDNVALFFFA  2927
             +L DGIQAHLSSCASPKVLD VNKFP+KV+ NEV RLS+WP+QF+E GV+EDN+ALFFFA
Sbjct  936   DLCDGIQAHLSSCASPKVLDTVNKFPQKVLFNEVSRLSTWPIQFQEYGVTEDNIALFFFA  995

Query  2928  KDIGSYEKSYKVLLGDMVKHDLALQGNIGDIELLIFPSNQLPEKFQRWNLMFFLWGVFRG  3107
             +DIGSYE+ YK LL +M+++D+AL+ N+  +ELLIFPSN+LPEK QRWN+MFFLWGVFR 
Sbjct  996   RDIGSYERCYKTLLENMIRNDMALKANLEGVELLIFPSNRLPEKSQRWNMMFFLWGVFRV  1055

Query  3108  KRANSLQNFPGAEKP--LIQDIPTPATSLPENMFTPVPKLNSARGSAATNTEMSAVKESE  3281
             K+A+ +Q+     KP  L QDIP  +   PEN+    P  N+A  +   + E+ A KES 
Sbjct  1056  KKASCVQHMQATGKPFPLPQDIPKSSMLFPENVRCLGPVDNAASDNVTMDVEVIASKESG  1115

Query  3282  SASLHKIVNGNCSIQSSSQVSRDKCSRINAEQNDKLDSSSMQNSEPKLGPDRRYFGV-PL  3458
                   +VNGN   ++S QV +     +N E  +    + +  S+    P RR +G+  +
Sbjct  1116  CP----LVNGNVDSKAS-QVCKGDSVAVNVEHLEPSSVTIVPTSQLNSSPGRRRYGIFQV  1170

Query  3459  GEAVH--------SSVQTAERVSSPNTSRPMSVHWAAPLDGEKLSMLSDETP-TMQEATS  3611
             G+A          SS   A   ++ + + P+ +   + +D ++ S   DE P  MQE  S
Sbjct  1171  GDAGQECKSELQSSSTPAANTWTNVSITEPVPMECGSLVDRQRPSHSVDEAPGRMQEKAS  1230

Query  3612  VGSTTKNLCGKDDVKIGRICLDNVSTEEATPLARHTSMEQTLNVISSFGVNPKKRSHSAE  3791
             +GST K     +  K      D    EEA+  +   + E T  V++S  +N  KR  S E
Sbjct  1231  MGSTEKGFGSTNGRKFEINLEDEYKDEEASETSGSATTEPTRKVLNSDMLNHLKRPRSVE  1290

Query  3792  TVLQsasssgtsqafssysNDDILVEEFCHKRVKLNSDRSYGCNDQTSCSKDGFLSEMGG  3971
             TV+QS  S       S   ND ++ +    K++K +   SYG ++QTSCS D FLS M G
Sbjct  1291  TVMQSVDSGVNLATRSFNDNDIVVEKAPYDKKLKTSVGGSYGNSEQTSCSSDDFLSRMHG  1350

Query  3972  TASQLSRQKNERDEALSKTAILETPGNAEMFFFPVDPHPVGNIGSNNSSMPWKVHPLEED  4151
             ++ +        DEALSK AI E  G+A  +FFPVDPHPV        S PW++H  + D
Sbjct  1351  SSYRPYLPDTGCDEALSKAAIPECSGSAARYFFPVDPHPV-----EARSAPWQMHHSDND  1405

Query  4152  QLHDKAPNLELALG---------------------------AKTKPLMSGIPSFLSGKVE  4250
             +L D+ PNLELALG                           A+T  L  GIP FL GKV+
Sbjct  1406  RLSDRVPNLELALGGESNLLTQGIPPFLVGKLDKKIIQDQGAETHSLTQGIPPFLVGKVD  1465

Query  4251  KKIIEENTSDNAATSANK-EDVsaslslslsFPFPEKEH--GTSSKPEQEDPRRRQANTS  4421
             K++I++ +S   A    + EDVSASLSLSLSFPFPEKE   G+ S+ EQ  P  ++ NT 
Sbjct  1466  KRVIQDPSSAKEAIRVEEVEDVSASLSLSLSFPFPEKEQQKGSVSQKEQAMPETKRGNTP  1525

Query  4422  LLLFG  4436
             LL FG
Sbjct  1526  LLFFG  1530



>ref|XP_009769635.1| PREDICTED: uncharacterized protein LOC104220458 isoform X1 [Nicotiana 
sylvestris]
Length=1569

 Score =   934 bits (2413),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 600/1325 (45%), Positives = 814/1325 (61%), Gaps = 99/1325 (7%)
 Frame = +3

Query  684   GETCVENASSFSGTDVLPASKS--KKDFALEAKMEVSDSLEDHVVSLADKEGIDKVVNTT  857
             GET   NA S    D L  + S  K D A EA     D   D      D++ +   V++ 
Sbjct  265   GETSSRNAHSIG--DYLENNHSSIKNDVASEAS---GDLPADTCPEKDDQKSVGSPVSSD  319

Query  858   GLDLIASQIHQMeesddseivevdvkvCDICGAVGREHLLAICSRCTDGAEHTYCMQKML  1037
               D +  Q HQM+ S+DS+I E DVKVCDICG  GRE LLAIC +CTDGAEHTYCM++ML
Sbjct  320   TKDAL--QSHQMDGSEDSDIEEQDVKVCDICGDAGREDLLAICCKCTDGAEHTYCMREML  377

Query  1038  EKIPEGDWLCEECKFDQEMKNEHVN-SGRVNEKEKTSPSRRTTIAKSDHPLKMEQKTSDC  1214
             +K+PEGDW+CEECKFD+EMKN   + S + +   K+  + +T I  +   +K E K SD 
Sbjct  378   QKVPEGDWMCEECKFDEEMKNRKGDKSVKFDGYRKSYHTGQTAIDDTGVTIKTEAKPSDA  437

Query  1215  WGDKAVEERSYLKTSGKRCTDDSEVSSPTKRQRLELRS--PTAQIPNRVTSLSRESSFKN  1388
              G+ A    S  K SGKR  DDSEVSS  K+Q  E  S  P    PNR+T+LSRESSFKN
Sbjct  438   DGETA----SDTKISGKRRMDDSEVSSVAKKQAFEPASGSPKTLSPNRLTALSRESSFKN  493

Query  1389  LERGKVKPLNPFSSGSFAAKVPSSTGPQPQPPRGIFSKSNSFSSLIAKPKVKLVDEVFPA  1568
              ++GK+K +N  SSG  +     + GP+ Q  RG FSKSNSFSSL AK KV+LVDE F  
Sbjct  494   SDKGKLKSVNQISSGGLSVHDTPAWGPRLQTARGTFSKSNSFSSLAAKRKVQLVDEGFLP  553

Query  1569  KQKLSRETAFIESKEVAVRSMGKSMSFKPTTASRSNCTESKVKMFSPKFSHDQDVKWLRH  1748
             KQKL  E+A ++ KE ++RSM KSMSF+  + SR+N +E+KVKM SPKFS  QD K    
Sbjct  554   KQKLVNESAGLDVKESSIRSMSKSMSFRSISTSRNNVSEAKVKMLSPKFSPAQD-KGQMQ  612

Query  1749  KKDRSSFDRKNSLRSDRLAGGAISSPKSDNKPTPRGEPSSLSSLNTNRDYRALTSDNKPV  1928
              K+R+ F+RK+S RS+R +G ++ S K++ +   RG+PS L S + NRD R    D+KPV
Sbjct  613   TKERNPFERKSSFRSERSSGTSVPS-KTEQRSAFRGDPSPLFSSSNNRDSRPGQLDSKPV  671

Query  1929  TISNSTSGVAR----------EVLKQASVD----GVSSANRVSSSEENPSQAIPKEDSSS  2066
             ++  S+  VAR          E  KQ S+     GV +AN++SSS++ P+Q+  ++D SS
Sbjct  672   SLLKSSGAVARRTPEVSVHSDEAKKQISLTSISTGVPAANKISSSDQRPNQSNARDDPSS  731

Query  2067  SSCVAERPSWSSNEVLPDGLSQSKESKAFGDKTRESSASRSKQNSTASGKIVSCQKCKGN  2246
              S +AERP+ ++ E L DG+SQ +E+K  G++ RE+S  R K + T + K + CQ+CKG+
Sbjct  732   ISYIAERPTSNTGEGLLDGVSQQRETKNVGERIRENSGRRLKHSGTGT-KSLFCQRCKGS  790

Query  2247  GHLAQVCTADGPE-SSALGSPFKSSREATNGPSDLKAAIEAARLRKPGICRKNRVADQSE  2423
             GHL + CTADGP+ S++  S  K+S+EA NG SDLKAAIEAA LRKPGICRKNRV DQS+
Sbjct  791   GHLTESCTADGPDLSTSDVSAVKNSKEAPNGTSDLKAAIEAAMLRKPGICRKNRVFDQSD  850

Query  2424  DLSASNMKSEIASQDQMLSSTVRRNVNGAEE-----------AQKQETANNAKQLGIIA-  2567
             DL+ SN  SE  +QD    S+ RR +   EE           + KQE +N  +QL ++A 
Sbjct  851   DLAMSNTNSETTAQDLPSGSSGRRILPTNEEGYGLSSNSMTGSYKQEISN-MRQLSVLAA  909

Query  2568  EASARTRNAGHVVFSDVKHSVIDMERQTLVSMPVILKTAIPEYQYIWQGGFEVQKSGKAF  2747
             EA +R  NA  ++ SD K S++D++R +  ++ ++ +TAIPE++YIWQG FEVQK+G+  
Sbjct  910   EALSRAGNAVPILPSDEKSSLVDLDRYSQAAIAILSRTAIPEHEYIWQGAFEVQKNGRTL  969

Query  2748  NLYDGIQAHLSSCASPKVLDAVNKFPRKVILNEVPRLSSWPMQFKECGVSEDNVALFFFA  2927
             +L DGIQAHLSSCASPKVLD VNKFP+KV+ NEV RLS+WP+QF+E GV+EDN+ALFFFA
Sbjct  970   DLCDGIQAHLSSCASPKVLDTVNKFPQKVLFNEVSRLSTWPIQFQEYGVTEDNIALFFFA  1029

Query  2928  KDIGSYEKSYKVLLGDMVKHDLALQGNIGDIELLIFPSNQLPEKFQRWNLMFFLWGVFRG  3107
             +DIGSYE+ YK LL +M+++D+AL+ N+  +ELLIFPSN+LPEK QRWN+MFFLWGVFR 
Sbjct  1030  RDIGSYERCYKTLLENMIRNDMALKANLEGVELLIFPSNRLPEKSQRWNMMFFLWGVFRV  1089

Query  3108  KRANSLQNFPGAEKP--LIQDIPTPATSLPENMFTPVPKLNSARGSAATNTEMSAVKESE  3281
             K+A+ +Q+     KP  L QDIP  +   PEN+    P  N+A  +   + E+ A KES 
Sbjct  1090  KKASCVQHMQATGKPFPLPQDIPKSSMLFPENVRCLGPVDNAASDNVTMDVEVIASKESG  1149

Query  3282  SASLHKIVNGNCSIQSSSQVSRDKCSRINAEQNDKLDSSSMQNSEPKLGPDRRYFGV-PL  3458
                   +VNGN   ++S QV +     +N E  +    + +  S+    P RR +G+  +
Sbjct  1150  CP----LVNGNVDSKAS-QVCKGDSVAVNVEHLEPSSVTIVPTSQLNSSPGRRRYGIFQV  1204

Query  3459  GEAVH--------SSVQTAERVSSPNTSRPMSVHWAAPLDGEKLSMLSDETP-TMQEATS  3611
             G+A          SS   A   ++ + + P+ +   + +D ++ S   DE P  MQE  S
Sbjct  1205  GDAGQECKSELQSSSTPAANTWTNVSITEPVPMECGSLVDRQRPSHSVDEAPGRMQEKAS  1264

Query  3612  VGSTTKNLCGKDDVKIGRICLDNVSTEEATPLARHTSMEQTLNVISSFGVNPKKRSHSAE  3791
             +GST K     +  K      D    EEA+  +   + E T  V++S  +N  KR  S E
Sbjct  1265  MGSTEKGFGSTNGRKFEINLEDEYKDEEASETSGSATTEPTRKVLNSDMLNHLKRPRSVE  1324

Query  3792  TVLQsasssgtsqafssysNDDILVEEFCHKRVKLNSDRSYGCNDQTSCSKDGFLSEMGG  3971
             TV+QS  S       S   ND ++ +    K++K +   SYG ++QTSCS D FLS M G
Sbjct  1325  TVMQSVDSGVNLATRSFNDNDIVVEKAPYDKKLKTSVGGSYGNSEQTSCSSDDFLSRMHG  1384

Query  3972  TASQLSRQKNERDEALSKTAILETPGNAEMFFFPVDPHPVGNIGSNNSSMPWKVHPLEED  4151
             ++ +        DEALSK AI E  G+A  +FFPVDPHPV        S PW++H  + D
Sbjct  1385  SSYRPYLPDTGCDEALSKAAIPECSGSAARYFFPVDPHPV-----EARSAPWQMHHSDND  1439

Query  4152  QLHDKAPNLELALG---------------------------AKTKPLMSGIPSFLSGKVE  4250
             +L D+ PNLELALG                           A+T  L  GIP FL GKV+
Sbjct  1440  RLSDRVPNLELALGGESNLLTQGIPPFLVGKLDKKIIQDQGAETHSLTQGIPPFLVGKVD  1499

Query  4251  KKIIEENTSDNAATSANK-EDVsaslslslsFPFPEKEH--GTSSKPEQEDPRRRQANTS  4421
             K++I++ +S   A    + EDVSASLSLSLSFPFPEKE   G+ S+ EQ  P  ++ NT 
Sbjct  1500  KRVIQDPSSAKEAIRVEEVEDVSASLSLSLSFPFPEKEQQKGSVSQKEQAMPETKRGNTP  1559

Query  4422  LLLFG  4436
             LL FG
Sbjct  1560  LLFFG  1564



>ref|XP_009769638.1| PREDICTED: uncharacterized protein LOC104220458 isoform X4 [Nicotiana 
sylvestris]
Length=1506

 Score =   933 bits (2412),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 600/1325 (45%), Positives = 814/1325 (61%), Gaps = 99/1325 (7%)
 Frame = +3

Query  684   GETCVENASSFSGTDVLPASKS--KKDFALEAKMEVSDSLEDHVVSLADKEGIDKVVNTT  857
             GET   NA S    D L  + S  K D A EA     D   D      D++ +   V++ 
Sbjct  202   GETSSRNAHSIG--DYLENNHSSIKNDVASEAS---GDLPADTCPEKDDQKSVGSPVSSD  256

Query  858   GLDLIASQIHQMeesddseivevdvkvCDICGAVGREHLLAICSRCTDGAEHTYCMQKML  1037
               D +  Q HQM+ S+DS+I E DVKVCDICG  GRE LLAIC +CTDGAEHTYCM++ML
Sbjct  257   TKDAL--QSHQMDGSEDSDIEEQDVKVCDICGDAGREDLLAICCKCTDGAEHTYCMREML  314

Query  1038  EKIPEGDWLCEECKFDQEMKNEHVN-SGRVNEKEKTSPSRRTTIAKSDHPLKMEQKTSDC  1214
             +K+PEGDW+CEECKFD+EMKN   + S + +   K+  + +T I  +   +K E K SD 
Sbjct  315   QKVPEGDWMCEECKFDEEMKNRKGDKSVKFDGYRKSYHTGQTAIDDTGVTIKTEAKPSDA  374

Query  1215  WGDKAVEERSYLKTSGKRCTDDSEVSSPTKRQRLELRS--PTAQIPNRVTSLSRESSFKN  1388
              G+ A    S  K SGKR  DDSEVSS  K+Q  E  S  P    PNR+T+LSRESSFKN
Sbjct  375   DGETA----SDTKISGKRRMDDSEVSSVAKKQAFEPASGSPKTLSPNRLTALSRESSFKN  430

Query  1389  LERGKVKPLNPFSSGSFAAKVPSSTGPQPQPPRGIFSKSNSFSSLIAKPKVKLVDEVFPA  1568
              ++GK+K +N  SSG  +     + GP+ Q  RG FSKSNSFSSL AK KV+LVDE F  
Sbjct  431   SDKGKLKSVNQISSGGLSVHDTPAWGPRLQTARGTFSKSNSFSSLAAKRKVQLVDEGFLP  490

Query  1569  KQKLSRETAFIESKEVAVRSMGKSMSFKPTTASRSNCTESKVKMFSPKFSHDQDVKWLRH  1748
             KQKL  E+A ++ KE ++RSM KSMSF+  + SR+N +E+KVKM SPKFS  QD K    
Sbjct  491   KQKLVNESAGLDVKESSIRSMSKSMSFRSISTSRNNVSEAKVKMLSPKFSPAQD-KGQMQ  549

Query  1749  KKDRSSFDRKNSLRSDRLAGGAISSPKSDNKPTPRGEPSSLSSLNTNRDYRALTSDNKPV  1928
              K+R+ F+RK+S RS+R +G ++ S K++ +   RG+PS L S + NRD R    D+KPV
Sbjct  550   TKERNPFERKSSFRSERSSGTSVPS-KTEQRSAFRGDPSPLFSSSNNRDSRPGQLDSKPV  608

Query  1929  TISNSTSGVAR----------EVLKQASVD----GVSSANRVSSSEENPSQAIPKEDSSS  2066
             ++  S+  VAR          E  KQ S+     GV +AN++SSS++ P+Q+  ++D SS
Sbjct  609   SLLKSSGAVARRTPEVSVHSDEAKKQISLTSISTGVPAANKISSSDQRPNQSNARDDPSS  668

Query  2067  SSCVAERPSWSSNEVLPDGLSQSKESKAFGDKTRESSASRSKQNSTASGKIVSCQKCKGN  2246
              S +AERP+ ++ E L DG+SQ +E+K  G++ RE+S  R K + T + K + CQ+CKG+
Sbjct  669   ISYIAERPTSNTGEGLLDGVSQQRETKNVGERIRENSGRRLKHSGTGT-KSLFCQRCKGS  727

Query  2247  GHLAQVCTADGPE-SSALGSPFKSSREATNGPSDLKAAIEAARLRKPGICRKNRVADQSE  2423
             GHL + CTADGP+ S++  S  K+S+EA NG SDLKAAIEAA LRKPGICRKNRV DQS+
Sbjct  728   GHLTESCTADGPDLSTSDVSAVKNSKEAPNGTSDLKAAIEAAMLRKPGICRKNRVFDQSD  787

Query  2424  DLSASNMKSEIASQDQMLSSTVRRNVNGAEE-----------AQKQETANNAKQLGIIA-  2567
             DL+ SN  SE  +QD    S+ RR +   EE           + KQE +N  +QL ++A 
Sbjct  788   DLAMSNTNSETTAQDLPSGSSGRRILPTNEEGYGLSSNSMTGSYKQEISN-MRQLSVLAA  846

Query  2568  EASARTRNAGHVVFSDVKHSVIDMERQTLVSMPVILKTAIPEYQYIWQGGFEVQKSGKAF  2747
             EA +R  NA  ++ SD K S++D++R +  ++ ++ +TAIPE++YIWQG FEVQK+G+  
Sbjct  847   EALSRAGNAVPILPSDEKSSLVDLDRYSQAAIAILSRTAIPEHEYIWQGAFEVQKNGRTL  906

Query  2748  NLYDGIQAHLSSCASPKVLDAVNKFPRKVILNEVPRLSSWPMQFKECGVSEDNVALFFFA  2927
             +L DGIQAHLSSCASPKVLD VNKFP+KV+ NEV RLS+WP+QF+E GV+EDN+ALFFFA
Sbjct  907   DLCDGIQAHLSSCASPKVLDTVNKFPQKVLFNEVSRLSTWPIQFQEYGVTEDNIALFFFA  966

Query  2928  KDIGSYEKSYKVLLGDMVKHDLALQGNIGDIELLIFPSNQLPEKFQRWNLMFFLWGVFRG  3107
             +DIGSYE+ YK LL +M+++D+AL+ N+  +ELLIFPSN+LPEK QRWN+MFFLWGVFR 
Sbjct  967   RDIGSYERCYKTLLENMIRNDMALKANLEGVELLIFPSNRLPEKSQRWNMMFFLWGVFRV  1026

Query  3108  KRANSLQNFPGAEKP--LIQDIPTPATSLPENMFTPVPKLNSARGSAATNTEMSAVKESE  3281
             K+A+ +Q+     KP  L QDIP  +   PEN+    P  N+A  +   + E+ A KES 
Sbjct  1027  KKASCVQHMQATGKPFPLPQDIPKSSMLFPENVRCLGPVDNAASDNVTMDVEVIASKESG  1086

Query  3282  SASLHKIVNGNCSIQSSSQVSRDKCSRINAEQNDKLDSSSMQNSEPKLGPDRRYFGV-PL  3458
                   +VNGN   ++S QV +     +N E  +    + +  S+    P RR +G+  +
Sbjct  1087  CP----LVNGNVDSKAS-QVCKGDSVAVNVEHLEPSSVTIVPTSQLNSSPGRRRYGIFQV  1141

Query  3459  GEAVH--------SSVQTAERVSSPNTSRPMSVHWAAPLDGEKLSMLSDETP-TMQEATS  3611
             G+A          SS   A   ++ + + P+ +   + +D ++ S   DE P  MQE  S
Sbjct  1142  GDAGQECKSELQSSSTPAANTWTNVSITEPVPMECGSLVDRQRPSHSVDEAPGRMQEKAS  1201

Query  3612  VGSTTKNLCGKDDVKIGRICLDNVSTEEATPLARHTSMEQTLNVISSFGVNPKKRSHSAE  3791
             +GST K     +  K      D    EEA+  +   + E T  V++S  +N  KR  S E
Sbjct  1202  MGSTEKGFGSTNGRKFEINLEDEYKDEEASETSGSATTEPTRKVLNSDMLNHLKRPRSVE  1261

Query  3792  TVLQsasssgtsqafssysNDDILVEEFCHKRVKLNSDRSYGCNDQTSCSKDGFLSEMGG  3971
             TV+QS  S       S   ND ++ +    K++K +   SYG ++QTSCS D FLS M G
Sbjct  1262  TVMQSVDSGVNLATRSFNDNDIVVEKAPYDKKLKTSVGGSYGNSEQTSCSSDDFLSRMHG  1321

Query  3972  TASQLSRQKNERDEALSKTAILETPGNAEMFFFPVDPHPVGNIGSNNSSMPWKVHPLEED  4151
             ++ +        DEALSK AI E  G+A  +FFPVDPHPV        S PW++H  + D
Sbjct  1322  SSYRPYLPDTGCDEALSKAAIPECSGSAARYFFPVDPHPV-----EARSAPWQMHHSDND  1376

Query  4152  QLHDKAPNLELALG---------------------------AKTKPLMSGIPSFLSGKVE  4250
             +L D+ PNLELALG                           A+T  L  GIP FL GKV+
Sbjct  1377  RLSDRVPNLELALGGESNLLTQGIPPFLVGKLDKKIIQDQGAETHSLTQGIPPFLVGKVD  1436

Query  4251  KKIIEENTSDNAATSANK-EDVsaslslslsFPFPEKEH--GTSSKPEQEDPRRRQANTS  4421
             K++I++ +S   A    + EDVSASLSLSLSFPFPEKE   G+ S+ EQ  P  ++ NT 
Sbjct  1437  KRVIQDPSSAKEAIRVEEVEDVSASLSLSLSFPFPEKEQQKGSVSQKEQAMPETKRGNTP  1496

Query  4422  LLLFG  4436
             LL FG
Sbjct  1497  LLFFG  1501



>ref|XP_009601822.1| PREDICTED: uncharacterized protein LOC104097026 isoform X1 [Nicotiana 
tomentosiformis]
Length=1569

 Score =   927 bits (2395),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 599/1323 (45%), Positives = 810/1323 (61%), Gaps = 95/1323 (7%)
 Frame = +3

Query  684   GETCVENASSFSGTDVLPASKSKKDFALEAKMEVSDSLEDHVVSLADKEGIDKVVNTTGL  863
             GET   NA S         S  K D A EA     D   D      D++ +   V++   
Sbjct  265   GETSSRNAHSIGDYLENNHSSRKNDVAPEAS---GDLPADTCPEKDDQKSVGSPVSSDTK  321

Query  864   DLIASQIHQMeesddseivevdvkvCDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEK  1043
             D +  Q HQM+ S+DS+I E DVKVCDICG  GRE LLAIC +CTDGAEHTYCM++ML+K
Sbjct  322   DAL--QSHQMDGSEDSDIEEQDVKVCDICGDAGREDLLAICCKCTDGAEHTYCMREMLQK  379

Query  1044  IPEGDWLCEECKFDQEMKNEHVN-SGRVNEKEKTSPSRRTTIAKSDHPLKMEQKTSDCWG  1220
             +PEGDW+CEECKFD+EMKN   + S + +   K+  + +T I  +   +K E K SD  G
Sbjct  380   VPEGDWMCEECKFDEEMKNRKGDKSVKFDGYRKSYLTGQTAIDDTGVTIKTEAKPSDVDG  439

Query  1221  DKAVEERSYLKTSGKRCTDDSEVSSPTKRQRLELRS--PTAQIPNRVTSLSRESSFKNLE  1394
             + A    S  K SGKR  DDSEVSS  K+Q  E  S  P    PNR+ +LSRESSF N +
Sbjct  440   ETA----SDTKISGKRRMDDSEVSSVAKKQAFEPASGSPKTLSPNRLIALSRESSFNNSD  495

Query  1395  RGKVKPLNPFSSGSFAAKVPSSTGPQPQPPRGIFSKSNSFSSLIAKPKVKLVDEVFPAKQ  1574
             +GK+K +N  SSG  +     + G + Q  RG FSKSNSFSSL AK KV+LVDE F  KQ
Sbjct  496   KGKLKSINQISSGGLSVHDTLAWGSRLQTARGTFSKSNSFSSLAAKRKVQLVDEGFLPKQ  555

Query  1575  KLSRETAFIESKEVAVRSMGKSMSFKPTTASRSNCTESKVKMFSPKFSHDQDVKWLRHKK  1754
             KL RE+A +++KE ++RSM KSMSF+  + SR+N +E+KVKM SPKFS  QD K     K
Sbjct  556   KLDRESAGLDAKESSIRSMSKSMSFRSISTSRNNVSEAKVKMLSPKFSPAQD-KGQMQTK  614

Query  1755  DRSSFDRKNSLRSDRLAGGAISSPKSDNKPTPRGEPSSLSSLNTNRDYRALTSDNKPVTI  1934
             +R+ F+RK+S RS+R +G ++ S K++ +   RG+PS LSS + N D R    D+KPV++
Sbjct  615   ERNPFERKSSFRSERSSGTSVPS-KTEQRSAFRGDPSLLSSSSNNCDSRPGQLDSKPVSL  673

Query  1935  SNSTSGVAR----------EVLKQASVD----GVSSANRVSSSEENPSQAIPKEDSSSSS  2072
               S+  VAR          E  KQ S+     GVS+AN++SSS++ P+Q   + D SS+S
Sbjct  674   LKSSGAVARRTPEVSVHSDEAKKQISLTSISTGVSAANKISSSDQRPNQCNARGDPSSNS  733

Query  2073  CVAERPSWSSNEVLPDGLSQSKESKAFGDKTRESSASRSKQNSTASGKIVSCQKCKGNGH  2252
              +AERP+ ++ E L DG+SQ +E+K  G++ RE+S  R K + T + K + CQ+CKG+GH
Sbjct  734   YIAERPTSNAGEGLLDGVSQQRETKNVGERIRENSGRRLKHSGTGT-KSLFCQRCKGSGH  792

Query  2253  LAQVCTADGPE-SSALGSPFKSSREATNGPSDLKAAIEAARLRKPGICRKNRVADQSEDL  2429
             L + CTADGP+ S++  S  K+SREA NG SDLKAAIEAA LRKPGICRKNRV DQS+DL
Sbjct  793   LTESCTADGPDLSTSDVSAVKNSREAPNGTSDLKAAIEAAMLRKPGICRKNRVFDQSDDL  852

Query  2430  SASNMKSEIASQDQMLSSTVRRNVNGAEE-----------AQKQETANNAKQLGII-AEA  2573
             + SN  SE  +QD +  S+ RR +   EE           + KQE ++  +QL ++ AEA
Sbjct  853   AMSNTNSETMAQDLLSGSSGRRILPTNEEVYGVSSNSMAGSYKQEISS-MRQLSVLPAEA  911

Query  2574  SARTRNAGHVVFSDVKHSVIDMERQTLVSMPVILKTAIPEYQYIWQGGFEVQKSGKAFNL  2753
              +R  NA  ++ SD K S++D++R +  ++ ++ +TAIPE++YIWQG FEVQKSG+  +L
Sbjct  912   LSRAGNAVPILPSDEKSSLVDLDRYSQAAVTILSRTAIPEHEYIWQGAFEVQKSGRTLDL  971

Query  2754  YDGIQAHLSSCASPKVLDAVNKFPRKVILNEVPRLSSWPMQFKECGVSEDNVALFFFAKD  2933
              DGIQAHLSSCASPKVLD VNKFP+KV+ NEV RLS+WP+QF+E GV+EDN+ALFFFAKD
Sbjct  972   CDGIQAHLSSCASPKVLDTVNKFPQKVLFNEVSRLSTWPIQFQEYGVTEDNIALFFFAKD  1031

Query  2934  IGSYEKSYKVLLGDMVKHDLALQGNIGDIELLIFPSNQLPEKFQRWNLMFFLWGVFRGKR  3113
             IGSY++ YK+LL +M+++D+AL+ N+  +ELLIFPSN+LPEK QRWN+MFFLWGVFR K+
Sbjct  1032  IGSYKRCYKILLENMIRNDMALKANLEGVELLIFPSNRLPEKSQRWNMMFFLWGVFRVKK  1091

Query  3114  ANSLQNFPGAEKP--LIQDIPTPATSLPENMFTPVPKLNSARGSAATNTEMSAVKESESA  3287
             A+ +Q+     KP  + QDIP  +   PEN+    P  N+   + + + E+ A KES   
Sbjct  1092  ASCVQHMQATGKPFPVPQDIPKSSMPFPENVHCLGPVDNATSDNVSMDGEVIASKESGCP  1151

Query  3288  SLHKIVNGNCSIQSSSQVSRDKCSRINAEQNDKLDSSSMQNSEPKLGPDRRYFGV-PLGE  3464
                 +VNGN   ++S QV +     +N E  +      +  S     P RR +G+  +G+
Sbjct  1152  ----MVNGNVDSKAS-QVCKGDSVAVNVEHLEPSSVRIVPTSHLNSSPGRRRYGIFQVGD  1206

Query  3465  AVH--------SSVQTAERVSSPNTSRPMSVHWAAPLDGEKLSMLSDETP-TMQEATSVG  3617
             A          SS   A   ++ +T+ P+ +   + +D ++     D  P  MQE   +G
Sbjct  1207  AGQECKSELQSSSTPAANTWANVSTTEPVPMECGSLVDRQRPFHSVDAAPGRMQEKAYMG  1266

Query  3618  STTKNLCGKDDVKIGRICLDNVSTEEATPLARHTSMEQTLNVISSFGVNPKKRSHSAETV  3797
             ST K  C K+  K      D    EEA+  +   + E T  V++S  +N  KR  S ETV
Sbjct  1267  STEKGFCSKNGRKFEINLEDEYKDEEASETSGSATTEPTRKVLNSDMLNHLKRPRSVETV  1326

Query  3798  LQsasssgtsqafssysNDDILVEEFCHKRVKLNSDRSYGCNDQTSCSKDGFLSEMGGTA  3977
             +QS  S       S   ND ++ +    K++K +   SYG ++QTSCS D FLS M G++
Sbjct  1327  MQSVDSGVNLATRSFNDNDIVVEKAHYDKKLKTSIGGSYGNSEQTSCSSDDFLSRMHGSS  1386

Query  3978  SQLSRQKNERDEALSKTAILETPGNAEMFFFPVDPHPVGNIGSNNSSMPWKVHPLEEDQL  4157
                       DEALSK AI E  GNA  +FFPVDPHPV       SS+PW+ H  + D+L
Sbjct  1387  YGPYLPDTGCDEALSKAAIPECSGNAARYFFPVDPHPV-----EASSVPWQRHHSDNDRL  1441

Query  4158  HDKAPNLELALG---------------------------AKTKPLMSGIPSFLSGKVEKK  4256
              D+ PNLELALG                           A+T  L  GIP FL GKV+K+
Sbjct  1442  SDRVPNLELALGGESNSLTQGIPPFLVGKVDKKIIQDQGAETHLLTQGIPPFLVGKVDKR  1501

Query  4257  IIEENTSDNAATSANK-EDVsaslslslsFPFPEKEH--GTSSKPEQEDPRRRQANTSLL  4427
             +I++ +S   A    + EDVSASLSLSLSFPFPEKE   G+ S+ EQ  P  R+ NT LL
Sbjct  1502  VIQDPSSAKEAIRVEEVEDVSASLSLSLSFPFPEKEQQKGSVSQNEQAMPETRRGNTPLL  1561

Query  4428  LFG  4436
              FG
Sbjct  1562  FFG  1564



>ref|XP_009601825.1| PREDICTED: uncharacterized protein LOC104097026 isoform X4 [Nicotiana 
tomentosiformis]
Length=1475

 Score =   926 bits (2393),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 602/1326 (45%), Positives = 814/1326 (61%), Gaps = 101/1326 (8%)
 Frame = +3

Query  684   GETCVENASSFSGTDVLPASKSKKDFALEAKMEVSDSLEDHVVSLADKEGIDKVVNTTGL  863
             GET   NA S         S  K D A EA     D   D      D++ +   V++   
Sbjct  171   GETSSRNAHSIGDYLENNHSSRKNDVAPEAS---GDLPADTCPEKDDQKSVGSPVSSDTK  227

Query  864   DLIASQIHQMeesddseivevdvkvCDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEK  1043
             D +  Q HQM+ S+DS+I E DVKVCDICG  GRE LLAIC +CTDGAEHTYCM++ML+K
Sbjct  228   DAL--QSHQMDGSEDSDIEEQDVKVCDICGDAGREDLLAICCKCTDGAEHTYCMREMLQK  285

Query  1044  IPEGDWLCEECKFDQEMKNEHVN-SGRVNEKEKTSPSRRTTIAKSDHPLKMEQKTSDCWG  1220
             +PEGDW+CEECKFD+EMKN   + S + +   K+  + +T I  +   +K E K SD  G
Sbjct  286   VPEGDWMCEECKFDEEMKNRKGDKSVKFDGYRKSYLTGQTAIDDTGVTIKTEAKPSDVDG  345

Query  1221  DKAVEERSYLKTSGKRCTDDSEVSSPTKRQRLELRS--PTAQIPNRVTSLSRESSFKNLE  1394
             + A    S  K SGKR  DDSEVSS  K+Q  E  S  P    PNR+ +LSRESSF N +
Sbjct  346   ETA----SDTKISGKRRMDDSEVSSVAKKQAFEPASGSPKTLSPNRLIALSRESSFNNSD  401

Query  1395  RGKVKPLNPFSSGSFAAKVPSSTGPQPQPPRGIFSKSNSFSSLIAKPKVKLVDEVFPAKQ  1574
             +GK+K +N  SSG  +     + G + Q  RG FSKSNSFSSL AK KV+LVDE F  KQ
Sbjct  402   KGKLKSINQISSGGLSVHDTLAWGSRLQTARGTFSKSNSFSSLAAKRKVQLVDEGFLPKQ  461

Query  1575  KLSRETAFIESKEVAVRSMGKSMSFKPTTASRSNCTESKVKMFSPKFSHDQDVKWLRHKK  1754
             KL RE+A +++KE ++RSM KSMSF+  + SR+N +E+KVKM SPKFS  QD K     K
Sbjct  462   KLDRESAGLDAKESSIRSMSKSMSFRSISTSRNNVSEAKVKMLSPKFSPAQD-KGQMQTK  520

Query  1755  DRSSFDRKNSLRSDRLAGGAISSPKSDNKPTPRGEPSSLSSLNTNRDYRALTSDNKPVTI  1934
             +R+ F+RK+S RS+R +G ++ S K++ +   RG+PS LSS + N D R    D+KPV++
Sbjct  521   ERNPFERKSSFRSERSSGTSVPS-KTEQRSAFRGDPSLLSSSSNNCDSRPGQLDSKPVSL  579

Query  1935  SNSTSGVAR----------EVLKQASVD----GVSSANRVSSSEENPSQAIPKEDSSSSS  2072
               S+  VAR          E  KQ S+     GVS+AN++SSS++ P+Q   + D SS+S
Sbjct  580   LKSSGAVARRTPEVSVHSDEAKKQISLTSISTGVSAANKISSSDQRPNQCNARGDPSSNS  639

Query  2073  CVAERPSWSSNEVLPDGLSQSKESKAFGDKTRESSASRSKQNSTASGKIVSCQKCKGNGH  2252
              +AERP+ ++ E L DG+SQ +E+K  G++ RE+S  R K + T + K + CQ+CKG+GH
Sbjct  640   YIAERPTSNAGEGLLDGVSQQRETKNVGERIRENSGRRLKHSGTGT-KSLFCQRCKGSGH  698

Query  2253  LAQVCTADGPE-SSALGSPFKSSREATNGPSDLKAAIEAARLRKPGICRKNRVADQSEDL  2429
             L + CTADGP+ S++  S  K+SREA NG SDLKAAIEAA LRKPGICRKNRV DQS+DL
Sbjct  699   LTESCTADGPDLSTSDVSAVKNSREAPNGTSDLKAAIEAAMLRKPGICRKNRVFDQSDDL  758

Query  2430  SASNMKSEIASQDQMLSSTVRRNVNGAEE-----------AQKQETANNAKQLGII-AEA  2573
             + SN  SE  +QD +  S+ RR +   EE           + KQE ++  +QL ++ AEA
Sbjct  759   AMSNTNSETMAQDLLSGSSGRRILPTNEEVYGVSSNSMAGSYKQEISS-MRQLSVLPAEA  817

Query  2574  SARTRNAGHVVFSDVKHSVIDMERQTLVSMPVILKTAIPEYQYIWQGGFEVQKSGKAFNL  2753
              +R  NA  ++ SD K S++D++R +  ++ ++ +TAIPE++YIWQG FEVQKSG+  +L
Sbjct  818   LSRAGNAVPILPSDEKSSLVDLDRYSQAAVTILSRTAIPEHEYIWQGAFEVQKSGRTLDL  877

Query  2754  YDGIQAHLSSCASPKVLDAVNKFPRKVILNEVPRLSSWPMQFKECGVSEDNVALFFFAKD  2933
              DGIQAHLSSCASPKVLD VNKFP+KV+ NEV RLS+WP+QF+E GV+EDN+ALFFFAKD
Sbjct  878   CDGIQAHLSSCASPKVLDTVNKFPQKVLFNEVSRLSTWPIQFQEYGVTEDNIALFFFAKD  937

Query  2934  IGSYEKSYKVLLGDMVKHDLALQGNIGDIELLIFPSNQLPEKFQRWNLMFFLWGVFRGKR  3113
             IGSY++ YK+LL +M+++D+AL+ N+  +ELLIFPSN+LPEK QRWN+MFFLWGVFR K+
Sbjct  938   IGSYKRCYKILLENMIRNDMALKANLEGVELLIFPSNRLPEKSQRWNMMFFLWGVFRVKK  997

Query  3114  ANSLQNFPGAEKP--LIQDIPTPATSLPENMFTPVPKLNSARGSAATNTEMSAVKESESA  3287
             A+ +Q+     KP  + QDIP  +   PEN+    P  N+   + + + E+ A KES   
Sbjct  998   ASCVQHMQATGKPFPVPQDIPKSSMPFPENVHCLGPVDNATSDNVSMDGEVIASKESGCP  1057

Query  3288  SLHKIVNGNCSIQSSSQVSRDKCSRINAEQNDKLDSSSMQ---NSEPKLGPDRRYFGV-P  3455
                 +VNGN   ++S QV +     +N E    L+ SS++    S     P RR +G+  
Sbjct  1058  ----MVNGNVDSKAS-QVCKGDSVAVNVEH---LEPSSVRIVPTSHLNSSPGRRRYGIFQ  1109

Query  3456  LGEAVH--------SSVQTAERVSSPNTSRPMSVHWAAPLDGEKLSMLSDETP-TMQEAT  3608
             +G+A          SS   A   ++ +T+ P+ +   + +D ++     D  P  MQE  
Sbjct  1110  VGDAGQECKSELQSSSTPAANTWANVSTTEPVPMECGSLVDRQRPFHSVDAAPGRMQEKA  1169

Query  3609  SVGSTTKNLCGKDDVKIGRICLDNVSTEEATPLARHTSMEQTLNVISSFGVNPKKRSHSA  3788
              +GST K  C K+  K      D    EEA+  +   + E T  V++S  +N  KR  S 
Sbjct  1170  YMGSTEKGFCSKNGRKFEINLEDEYKDEEASETSGSATTEPTRKVLNSDMLNHLKRPRSV  1229

Query  3789  ETVLQsasssgtsqafssysNDDILVEEFCHKRVKLNSDRSYGCNDQTSCSKDGFLSEMG  3968
             ETV+QS  S       S   ND ++ +    K++K +   SYG ++QTSCS D FLS M 
Sbjct  1230  ETVMQSVDSGVNLATRSFNDNDIVVEKAHYDKKLKTSIGGSYGNSEQTSCSSDDFLSRMH  1289

Query  3969  GTASQLSRQKNERDEALSKTAILETPGNAEMFFFPVDPHPVGNIGSNNSSMPWKVHPLEE  4148
             G++          DEALSK AI E  GNA  +FFPVDPHPV       SS+PW+ H  + 
Sbjct  1290  GSSYGPYLPDTGCDEALSKAAIPECSGNAARYFFPVDPHPV-----EASSVPWQRHHSDN  1344

Query  4149  DQLHDKAPNLELALG---------------------------AKTKPLMSGIPSFLSGKV  4247
             D+L D+ PNLELALG                           A+T  L  GIP FL GKV
Sbjct  1345  DRLSDRVPNLELALGGESNSLTQGIPPFLVGKVDKKIIQDQGAETHLLTQGIPPFLVGKV  1404

Query  4248  EKKIIEENTSDNAATSANK-EDVsaslslslsFPFPEKEH--GTSSKPEQEDPRRRQANT  4418
             +K++I++ +S   A    + EDVSASLSLSLSFPFPEKE   G+ S+ EQ  P  R+ NT
Sbjct  1405  DKRVIQDPSSAKEAIRVEEVEDVSASLSLSLSFPFPEKEQQKGSVSQNEQAMPETRRGNT  1464

Query  4419  SLLLFG  4436
              LL FG
Sbjct  1465  PLLFFG  1470



>ref|XP_009601827.1| PREDICTED: uncharacterized protein LOC104097026 isoform X6 [Nicotiana 
tomentosiformis]
Length=1362

 Score =   925 bits (2390),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 599/1323 (45%), Positives = 810/1323 (61%), Gaps = 95/1323 (7%)
 Frame = +3

Query  684   GETCVENASSFSGTDVLPASKSKKDFALEAKMEVSDSLEDHVVSLADKEGIDKVVNTTGL  863
             GET   NA S         S  K D A EA     D   D      D++ +   V++   
Sbjct  58    GETSSRNAHSIGDYLENNHSSRKNDVAPEAS---GDLPADTCPEKDDQKSVGSPVSSDTK  114

Query  864   DLIASQIHQMeesddseivevdvkvCDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEK  1043
             D +  Q HQM+ S+DS+I E DVKVCDICG  GRE LLAIC +CTDGAEHTYCM++ML+K
Sbjct  115   DAL--QSHQMDGSEDSDIEEQDVKVCDICGDAGREDLLAICCKCTDGAEHTYCMREMLQK  172

Query  1044  IPEGDWLCEECKFDQEMKNEHVN-SGRVNEKEKTSPSRRTTIAKSDHPLKMEQKTSDCWG  1220
             +PEGDW+CEECKFD+EMKN   + S + +   K+  + +T I  +   +K E K SD  G
Sbjct  173   VPEGDWMCEECKFDEEMKNRKGDKSVKFDGYRKSYLTGQTAIDDTGVTIKTEAKPSDVDG  232

Query  1221  DKAVEERSYLKTSGKRCTDDSEVSSPTKRQRLELRS--PTAQIPNRVTSLSRESSFKNLE  1394
             + A    S  K SGKR  DDSEVSS  K+Q  E  S  P    PNR+ +LSRESSF N +
Sbjct  233   ETA----SDTKISGKRRMDDSEVSSVAKKQAFEPASGSPKTLSPNRLIALSRESSFNNSD  288

Query  1395  RGKVKPLNPFSSGSFAAKVPSSTGPQPQPPRGIFSKSNSFSSLIAKPKVKLVDEVFPAKQ  1574
             +GK+K +N  SSG  +     + G + Q  RG FSKSNSFSSL AK KV+LVDE F  KQ
Sbjct  289   KGKLKSINQISSGGLSVHDTLAWGSRLQTARGTFSKSNSFSSLAAKRKVQLVDEGFLPKQ  348

Query  1575  KLSRETAFIESKEVAVRSMGKSMSFKPTTASRSNCTESKVKMFSPKFSHDQDVKWLRHKK  1754
             KL RE+A +++KE ++RSM KSMSF+  + SR+N +E+KVKM SPKFS  QD K     K
Sbjct  349   KLDRESAGLDAKESSIRSMSKSMSFRSISTSRNNVSEAKVKMLSPKFSPAQD-KGQMQTK  407

Query  1755  DRSSFDRKNSLRSDRLAGGAISSPKSDNKPTPRGEPSSLSSLNTNRDYRALTSDNKPVTI  1934
             +R+ F+RK+S RS+R +G ++ S K++ +   RG+PS LSS + N D R    D+KPV++
Sbjct  408   ERNPFERKSSFRSERSSGTSVPS-KTEQRSAFRGDPSLLSSSSNNCDSRPGQLDSKPVSL  466

Query  1935  SNSTSGVAR----------EVLKQASVD----GVSSANRVSSSEENPSQAIPKEDSSSSS  2072
               S+  VAR          E  KQ S+     GVS+AN++SSS++ P+Q   + D SS+S
Sbjct  467   LKSSGAVARRTPEVSVHSDEAKKQISLTSISTGVSAANKISSSDQRPNQCNARGDPSSNS  526

Query  2073  CVAERPSWSSNEVLPDGLSQSKESKAFGDKTRESSASRSKQNSTASGKIVSCQKCKGNGH  2252
              +AERP+ ++ E L DG+SQ +E+K  G++ RE+S  R K + T + K + CQ+CKG+GH
Sbjct  527   YIAERPTSNAGEGLLDGVSQQRETKNVGERIRENSGRRLKHSGTGT-KSLFCQRCKGSGH  585

Query  2253  LAQVCTADGPE-SSALGSPFKSSREATNGPSDLKAAIEAARLRKPGICRKNRVADQSEDL  2429
             L + CTADGP+ S++  S  K+SREA NG SDLKAAIEAA LRKPGICRKNRV DQS+DL
Sbjct  586   LTESCTADGPDLSTSDVSAVKNSREAPNGTSDLKAAIEAAMLRKPGICRKNRVFDQSDDL  645

Query  2430  SASNMKSEIASQDQMLSSTVRRNVNGAEE-----------AQKQETANNAKQLGII-AEA  2573
             + SN  SE  +QD +  S+ RR +   EE           + KQE ++  +QL ++ AEA
Sbjct  646   AMSNTNSETMAQDLLSGSSGRRILPTNEEVYGVSSNSMAGSYKQEISS-MRQLSVLPAEA  704

Query  2574  SARTRNAGHVVFSDVKHSVIDMERQTLVSMPVILKTAIPEYQYIWQGGFEVQKSGKAFNL  2753
              +R  NA  ++ SD K S++D++R +  ++ ++ +TAIPE++YIWQG FEVQKSG+  +L
Sbjct  705   LSRAGNAVPILPSDEKSSLVDLDRYSQAAVTILSRTAIPEHEYIWQGAFEVQKSGRTLDL  764

Query  2754  YDGIQAHLSSCASPKVLDAVNKFPRKVILNEVPRLSSWPMQFKECGVSEDNVALFFFAKD  2933
              DGIQAHLSSCASPKVLD VNKFP+KV+ NEV RLS+WP+QF+E GV+EDN+ALFFFAKD
Sbjct  765   CDGIQAHLSSCASPKVLDTVNKFPQKVLFNEVSRLSTWPIQFQEYGVTEDNIALFFFAKD  824

Query  2934  IGSYEKSYKVLLGDMVKHDLALQGNIGDIELLIFPSNQLPEKFQRWNLMFFLWGVFRGKR  3113
             IGSY++ YK+LL +M+++D+AL+ N+  +ELLIFPSN+LPEK QRWN+MFFLWGVFR K+
Sbjct  825   IGSYKRCYKILLENMIRNDMALKANLEGVELLIFPSNRLPEKSQRWNMMFFLWGVFRVKK  884

Query  3114  ANSLQNFPGAEKP--LIQDIPTPATSLPENMFTPVPKLNSARGSAATNTEMSAVKESESA  3287
             A+ +Q+     KP  + QDIP  +   PEN+    P  N+   + + + E+ A KES   
Sbjct  885   ASCVQHMQATGKPFPVPQDIPKSSMPFPENVHCLGPVDNATSDNVSMDGEVIASKESGCP  944

Query  3288  SLHKIVNGNCSIQSSSQVSRDKCSRINAEQNDKLDSSSMQNSEPKLGPDRRYFGV-PLGE  3464
                 +VNGN   ++S QV +     +N E  +      +  S     P RR +G+  +G+
Sbjct  945   ----MVNGNVDSKAS-QVCKGDSVAVNVEHLEPSSVRIVPTSHLNSSPGRRRYGIFQVGD  999

Query  3465  AVH--------SSVQTAERVSSPNTSRPMSVHWAAPLDGEKLSMLSDETPT-MQEATSVG  3617
             A          SS   A   ++ +T+ P+ +   + +D ++     D  P  MQE   +G
Sbjct  1000  AGQECKSELQSSSTPAANTWANVSTTEPVPMECGSLVDRQRPFHSVDAAPGRMQEKAYMG  1059

Query  3618  STTKNLCGKDDVKIGRICLDNVSTEEATPLARHTSMEQTLNVISSFGVNPKKRSHSAETV  3797
             ST K  C K+  K      D    EEA+  +   + E T  V++S  +N  KR  S ETV
Sbjct  1060  STEKGFCSKNGRKFEINLEDEYKDEEASETSGSATTEPTRKVLNSDMLNHLKRPRSVETV  1119

Query  3798  LQsasssgtsqafssysNDDILVEEFCHKRVKLNSDRSYGCNDQTSCSKDGFLSEMGGTA  3977
             +QS  S       S   ND ++ +    K++K +   SYG ++QTSCS D FLS M G++
Sbjct  1120  MQSVDSGVNLATRSFNDNDIVVEKAHYDKKLKTSIGGSYGNSEQTSCSSDDFLSRMHGSS  1179

Query  3978  SQLSRQKNERDEALSKTAILETPGNAEMFFFPVDPHPVGNIGSNNSSMPWKVHPLEEDQL  4157
                       DEALSK AI E  GNA  +FFPVDPHPV       SS+PW+ H  + D+L
Sbjct  1180  YGPYLPDTGCDEALSKAAIPECSGNAARYFFPVDPHPV-----EASSVPWQRHHSDNDRL  1234

Query  4158  HDKAPNLELALG---------------------------AKTKPLMSGIPSFLSGKVEKK  4256
              D+ PNLELALG                           A+T  L  GIP FL GKV+K+
Sbjct  1235  SDRVPNLELALGGESNSLTQGIPPFLVGKVDKKIIQDQGAETHLLTQGIPPFLVGKVDKR  1294

Query  4257  IIEENTSDNAATSANK-EDVsaslslslsFPFPEKEH--GTSSKPEQEDPRRRQANTSLL  4427
             +I++ +S   A    + EDVSASLSLSLSFPFPEKE   G+ S+ EQ  P  R+ NT LL
Sbjct  1295  VIQDPSSAKEAIRVEEVEDVSASLSLSLSFPFPEKEQQKGSVSQNEQAMPETRRGNTPLL  1354

Query  4428  LFG  4436
              FG
Sbjct  1355  FFG  1357



>ref|XP_009769636.1| PREDICTED: uncharacterized protein LOC104220458 isoform X2 [Nicotiana 
sylvestris]
Length=1545

 Score =   924 bits (2389),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 598/1324 (45%), Positives = 805/1324 (61%), Gaps = 121/1324 (9%)
 Frame = +3

Query  684   GETCVENASSFSGTDVLPASKS--KKDFALEAKMEVSDSLEDHVVSLADKEGIDKVVNTT  857
             GET   NA S    D L  + S  K D A EA     D   D      D++ +   V++ 
Sbjct  265   GETSSRNAHSIG--DYLENNHSSIKNDVASEAS---GDLPADTCPEKDDQKSVGSPVSSD  319

Query  858   GLDLIASQIHQMeesddseivevdvkvCDICGAVGREHLLAICSRCTDGAEHTYCMQKML  1037
               D +  Q HQM+ S+DS+I E DVKVCDICG  GRE LLAIC +CTDGAEHTYCM++ML
Sbjct  320   TKDAL--QSHQMDGSEDSDIEEQDVKVCDICGDAGREDLLAICCKCTDGAEHTYCMREML  377

Query  1038  EKIPEGDWLCEECKFDQEMKNEHVNSGRVNEKEKTSPSRRTTIAKSDHPLKMEQKTSDCW  1217
             +K+PEGDW+CEECKFD+EMKN                 +  TI       K E K SD  
Sbjct  378   QKVPEGDWMCEECKFDEEMKNR----------------KGVTI-------KTEAKPSDAD  414

Query  1218  GDKAVEERSYLKTSGKRCTDDSEVSSPTKRQRLELRS--PTAQIPNRVTSLSRESSFKNL  1391
             G+ A    S  K SGKR  DDSEVSS  K+Q  E  S  P    PNR+T+LSRESSFKN 
Sbjct  415   GETA----SDTKISGKRRMDDSEVSSVAKKQAFEPASGSPKTLSPNRLTALSRESSFKNS  470

Query  1392  ERGKVKPLNPFSSGSFAAKVPSSTGPQPQPPRGIFSKSNSFSSLIAKPKVKLVDEVFPAK  1571
             ++GK+K +N  SSG  +     + GP+ Q  RG FSKSNSFSSL AK KV+LVDE F  K
Sbjct  471   DKGKLKSVNQISSGGLSVHDTPAWGPRLQTARGTFSKSNSFSSLAAKRKVQLVDEGFLPK  530

Query  1572  QKLSRETAFIESKEVAVRSMGKSMSFKPTTASRSNCTESKVKMFSPKFSHDQDVKWLRHK  1751
             QKL  E+A ++ KE ++RSM KSMSF+  + SR+N +E+KVKM SPKFS  QD K     
Sbjct  531   QKLVNESAGLDVKESSIRSMSKSMSFRSISTSRNNVSEAKVKMLSPKFSPAQD-KGQMQT  589

Query  1752  KDRSSFDRKNSLRSDRLAGGAISSPKSDNKPTPRGEPSSLSSLNTNRDYRALTSDNKPVT  1931
             K+R+ F+RK+S RS+R +G ++ S K++ +   RG+PS L S + NRD R    D+KPV+
Sbjct  590   KERNPFERKSSFRSERSSGTSVPS-KTEQRSAFRGDPSPLFSSSNNRDSRPGQLDSKPVS  648

Query  1932  ISNSTSGVAR----------EVLKQASVD----GVSSANRVSSSEENPSQAIPKEDSSSS  2069
             +  S+  VAR          E  KQ S+     GV +AN++SSS++ P+Q+  ++D SS 
Sbjct  649   LLKSSGAVARRTPEVSVHSDEAKKQISLTSISTGVPAANKISSSDQRPNQSNARDDPSSI  708

Query  2070  SCVAERPSWSSNEVLPDGLSQSKESKAFGDKTRESSASRSKQNSTASGKIVSCQKCKGNG  2249
             S +AERP+ ++ E L DG+SQ +E+K  G++ RE+S  R K + T + K + CQ+CKG+G
Sbjct  709   SYIAERPTSNTGEGLLDGVSQQRETKNVGERIRENSGRRLKHSGTGT-KSLFCQRCKGSG  767

Query  2250  HLAQVCTADGPE-SSALGSPFKSSREATNGPSDLKAAIEAARLRKPGICRKNRVADQSED  2426
             HL + CTADGP+ S++  S  K+S+EA NG SDLKAAIEAA LRKPGICRKNRV DQS+D
Sbjct  768   HLTESCTADGPDLSTSDVSAVKNSKEAPNGTSDLKAAIEAAMLRKPGICRKNRVFDQSDD  827

Query  2427  LSASNMKSEIASQDQMLSSTVRRNVNGAEE-----------AQKQETANNAKQLGIIA-E  2570
             L+ SN  SE  +QD    S+ RR +   EE           + KQE +N  +QL ++A E
Sbjct  828   LAMSNTNSETTAQDLPSGSSGRRILPTNEEGYGLSSNSMTGSYKQEISN-MRQLSVLAAE  886

Query  2571  ASARTRNAGHVVFSDVKHSVIDMERQTLVSMPVILKTAIPEYQYIWQGGFEVQKSGKAFN  2750
             A +R  NA  ++ SD K S++D++R +  ++ ++ +TAIPE++YIWQG FEVQK+G+  +
Sbjct  887   ALSRAGNAVPILPSDEKSSLVDLDRYSQAAIAILSRTAIPEHEYIWQGAFEVQKNGRTLD  946

Query  2751  LYDGIQAHLSSCASPKVLDAVNKFPRKVILNEVPRLSSWPMQFKECGVSEDNVALFFFAK  2930
             L DGIQAHLSSCASPKVLD VNKFP+KV+ NEV RLS+WP+QF+E GV+EDN+ALFFFA+
Sbjct  947   LCDGIQAHLSSCASPKVLDTVNKFPQKVLFNEVSRLSTWPIQFQEYGVTEDNIALFFFAR  1006

Query  2931  DIGSYEKSYKVLLGDMVKHDLALQGNIGDIELLIFPSNQLPEKFQRWNLMFFLWGVFRGK  3110
             DIGSYE+ YK LL +M+++D+AL+ N+  +ELLIFPSN+LPEK QRWN+MFFLWGVFR K
Sbjct  1007  DIGSYERCYKTLLENMIRNDMALKANLEGVELLIFPSNRLPEKSQRWNMMFFLWGVFRVK  1066

Query  3111  RANSLQNFPGAEKP--LIQDIPTPATSLPENMFTPVPKLNSARGSAATNTEMSAVKESES  3284
             +A+ +Q+     KP  L QDIP  +   PEN+    P  N+A  +   + E+ A KES  
Sbjct  1067  KASCVQHMQATGKPFPLPQDIPKSSMLFPENVRCLGPVDNAASDNVTMDVEVIASKESGC  1126

Query  3285  ASLHKIVNGNCSIQSSSQVSRDKCSRINAEQNDKLDSSSMQNSEPKLGPDRRYFGV-PLG  3461
                  +VNGN   ++S QV +     +N E  +    + +  S+    P RR +G+  +G
Sbjct  1127  P----LVNGNVDSKAS-QVCKGDSVAVNVEHLEPSSVTIVPTSQLNSSPGRRRYGIFQVG  1181

Query  3462  EAVH--------SSVQTAERVSSPNTSRPMSVHWAAPLDGEKLSMLSDETP-TMQEATSV  3614
             +A          SS   A   ++ + + P+ +   + +D ++ S   DE P  MQE  S+
Sbjct  1182  DAGQECKSELQSSSTPAANTWTNVSITEPVPMECGSLVDRQRPSHSVDEAPGRMQEKASM  1241

Query  3615  GSTTKNLCGKDDVKIGRICLDNVSTEEATPLARHTSMEQTLNVISSFGVNPKKRSHSAET  3794
             GST K     +  K      D    EEA+  +   + E T  V++S  +N  KR  S ET
Sbjct  1242  GSTEKGFGSTNGRKFEINLEDEYKDEEASETSGSATTEPTRKVLNSDMLNHLKRPRSVET  1301

Query  3795  VLQsasssgtsqafssysNDDILVEEFCHKRVKLNSDRSYGCNDQTSCSKDGFLSEMGGT  3974
             V+QS  S       S   ND ++ +    K++K +   SYG ++QTSCS D FLS M G+
Sbjct  1302  VMQSVDSGVNLATRSFNDNDIVVEKAPYDKKLKTSVGGSYGNSEQTSCSSDDFLSRMHGS  1361

Query  3975  ASQLSRQKNERDEALSKTAILETPGNAEMFFFPVDPHPVGNIGSNNSSMPWKVHPLEEDQ  4154
             + +        DEALSK AI E  G+A  +FFPVDPHPV        S PW++H  + D+
Sbjct  1362  SYRPYLPDTGCDEALSKAAIPECSGSAARYFFPVDPHPV-----EARSAPWQMHHSDNDR  1416

Query  4155  LHDKAPNLELALG---------------------------AKTKPLMSGIPSFLSGKVEK  4253
             L D+ PNLELALG                           A+T  L  GIP FL GKV+K
Sbjct  1417  LSDRVPNLELALGGESNLLTQGIPPFLVGKLDKKIIQDQGAETHSLTQGIPPFLVGKVDK  1476

Query  4254  KIIEENTSDNAATSANK-EDVsaslslslsFPFPEKEH--GTSSKPEQEDPRRRQANTSL  4424
             ++I++ +S   A    + EDVSASLSLSLSFPFPEKE   G+ S+ EQ  P  ++ NT L
Sbjct  1477  RVIQDPSSAKEAIRVEEVEDVSASLSLSLSFPFPEKEQQKGSVSQKEQAMPETKRGNTPL  1536

Query  4425  LLFG  4436
             L FG
Sbjct  1537  LFFG  1540



>ref|XP_009601826.1| PREDICTED: uncharacterized protein LOC104097026 isoform X5 [Nicotiana 
tomentosiformis]
Length=1454

 Score =   924 bits (2389),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 600/1323 (45%), Positives = 810/1323 (61%), Gaps = 95/1323 (7%)
 Frame = +3

Query  684   GETCVENASSFSGTDVLPASKSKKDFALEAKMEVSDSLEDHVVSLADKEGIDKVVNTTGL  863
             GET   NA S         S  K D A EA     D   D      D++ +   V++   
Sbjct  150   GETSSRNAHSIGDYLENNHSSRKNDVAPEAS---GDLPADTCPEKDDQKSVGSPVSSDTK  206

Query  864   DLIASQIHQMeesddseivevdvkvCDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEK  1043
             D  A Q HQM+ S+DS+I E DVKVCDICG  GRE LLAIC +CTDGAEHTYCM++ML+K
Sbjct  207   D--ALQSHQMDGSEDSDIEEQDVKVCDICGDAGREDLLAICCKCTDGAEHTYCMREMLQK  264

Query  1044  IPEGDWLCEECKFDQEMKNEHVN-SGRVNEKEKTSPSRRTTIAKSDHPLKMEQKTSDCWG  1220
             +PEGDW+CEECKFD+EMKN   + S + +   K+  + +T I  +   +K E K SD  G
Sbjct  265   VPEGDWMCEECKFDEEMKNRKGDKSVKFDGYRKSYLTGQTAIDDTGVTIKTEAKPSDVDG  324

Query  1221  DKAVEERSYLKTSGKRCTDDSEVSSPTKRQRLELRS--PTAQIPNRVTSLSRESSFKNLE  1394
             + A    S  K SGKR  DDSEVSS  K+Q  E  S  P    PNR+ +LSRESSF N +
Sbjct  325   ETA----SDTKISGKRRMDDSEVSSVAKKQAFEPASGSPKTLSPNRLIALSRESSFNNSD  380

Query  1395  RGKVKPLNPFSSGSFAAKVPSSTGPQPQPPRGIFSKSNSFSSLIAKPKVKLVDEVFPAKQ  1574
             +GK+K +N  SSG  +     + G + Q  RG FSKSNSFSSL AK KV+LVDE F  KQ
Sbjct  381   KGKLKSINQISSGGLSVHDTLAWGSRLQTARGTFSKSNSFSSLAAKRKVQLVDEGFLPKQ  440

Query  1575  KLSRETAFIESKEVAVRSMGKSMSFKPTTASRSNCTESKVKMFSPKFSHDQDVKWLRHKK  1754
             KL RE+A +++KE ++RSM KSMSF+  + SR+N +E+KVKM SPKFS  QD K     K
Sbjct  441   KLDRESAGLDAKESSIRSMSKSMSFRSISTSRNNVSEAKVKMLSPKFSPAQD-KGQMQTK  499

Query  1755  DRSSFDRKNSLRSDRLAGGAISSPKSDNKPTPRGEPSSLSSLNTNRDYRALTSDNKPVTI  1934
             +R+ F+RK+S RS+R +G ++ S K++ +   RG+PS LSS + N D R    D+KPV++
Sbjct  500   ERNPFERKSSFRSERSSGTSVPS-KTEQRSAFRGDPSLLSSSSNNCDSRPGQLDSKPVSL  558

Query  1935  SNSTSGVAR----------EVLKQASVD----GVSSANRVSSSEENPSQAIPKEDSSSSS  2072
               S+  VAR          E  KQ S+     GVS+AN++SSS++ P+Q   + D SS+S
Sbjct  559   LKSSGAVARRTPEVSVHSDEAKKQISLTSISTGVSAANKISSSDQRPNQCNARGDPSSNS  618

Query  2073  CVAERPSWSSNEVLPDGLSQSKESKAFGDKTRESSASRSKQNSTASGKIVSCQKCKGNGH  2252
              +AERP+ ++ E L DG+SQ +E+K  G++ RE+S  R K + T + K + CQ+CKG+GH
Sbjct  619   YIAERPTSNAGEGLLDGVSQQRETKNVGERIRENSGRRLKHSGTGT-KSLFCQRCKGSGH  677

Query  2253  LAQVCTADGPE-SSALGSPFKSSREATNGPSDLKAAIEAARLRKPGICRKNRVADQSEDL  2429
             L + CTADGP+ S++  S  K+SREA NG SDLKAAIEAA LRKPGICRKNRV DQS+DL
Sbjct  678   LTESCTADGPDLSTSDVSAVKNSREAPNGTSDLKAAIEAAMLRKPGICRKNRVFDQSDDL  737

Query  2430  SASNMKSEIASQDQMLSSTVRRNVNGAEE-----------AQKQETANNAKQLGII-AEA  2573
             + SN  SE  +QD +  S+ RR +   EE           + KQE ++  +QL ++ AEA
Sbjct  738   AMSNTNSETMAQDLLSGSSGRRILPTNEEVYGVSSNSMAGSYKQEISS-MRQLSVLPAEA  796

Query  2574  SARTRNAGHVVFSDVKHSVIDMERQTLVSMPVILKTAIPEYQYIWQGGFEVQKSGKAFNL  2753
              +R  NA  ++ SD K S++D++R +  ++ ++ +TAIPE++YIWQG FEVQKSG+  +L
Sbjct  797   LSRAGNAVPILPSDEKSSLVDLDRYSQAAVTILSRTAIPEHEYIWQGAFEVQKSGRTLDL  856

Query  2754  YDGIQAHLSSCASPKVLDAVNKFPRKVILNEVPRLSSWPMQFKECGVSEDNVALFFFAKD  2933
              DGIQAHLSSCASPKVLD VNKFP+KV+ NEV RLS+WP+QF+E GV+EDN+ALFFFAKD
Sbjct  857   CDGIQAHLSSCASPKVLDTVNKFPQKVLFNEVSRLSTWPIQFQEYGVTEDNIALFFFAKD  916

Query  2934  IGSYEKSYKVLLGDMVKHDLALQGNIGDIELLIFPSNQLPEKFQRWNLMFFLWGVFRGKR  3113
             IGSY++ YK+LL +M+++D+AL+ N+  +ELLIFPSN+LPEK QRWN+MFFLWGVFR K+
Sbjct  917   IGSYKRCYKILLENMIRNDMALKANLEGVELLIFPSNRLPEKSQRWNMMFFLWGVFRVKK  976

Query  3114  ANSLQNFPGAEKP--LIQDIPTPATSLPENMFTPVPKLNSARGSAATNTEMSAVKESESA  3287
             A+ +Q+     KP  + QDIP  +   PEN+    P  N+   + + + E+ A KES   
Sbjct  977   ASCVQHMQATGKPFPVPQDIPKSSMPFPENVHCLGPVDNATSDNVSMDGEVIASKESGCP  1036

Query  3288  SLHKIVNGNCSIQSSSQVSRDKCSRINAEQNDKLDSSSMQNSEPKLGPDRRYFGV-PLGE  3464
                 +VNGN   ++S QV +     +N E  +      +  S     P RR +G+  +G+
Sbjct  1037  ----MVNGNVDSKAS-QVCKGDSVAVNVEHLEPSSVRIVPTSHLNSSPGRRRYGIFQVGD  1091

Query  3465  AVH--------SSVQTAERVSSPNTSRPMSVHWAAPLDGEKLSMLSDETP-TMQEATSVG  3617
             A          SS   A   ++ +T+ P+ +   + +D ++     D  P  MQE   +G
Sbjct  1092  AGQECKSELQSSSTPAANTWANVSTTEPVPMECGSLVDRQRPFHSVDAAPGRMQEKAYMG  1151

Query  3618  STTKNLCGKDDVKIGRICLDNVSTEEATPLARHTSMEQTLNVISSFGVNPKKRSHSAETV  3797
             ST K  C K+  K      D    EEA+  +   + E T  V++S  +N  KR  S ETV
Sbjct  1152  STEKGFCSKNGRKFEINLEDEYKDEEASETSGSATTEPTRKVLNSDMLNHLKRPRSVETV  1211

Query  3798  LQsasssgtsqafssysNDDILVEEFCHKRVKLNSDRSYGCNDQTSCSKDGFLSEMGGTA  3977
             +QS  S       S   ND ++ +    K++K +   SYG ++QTSCS D FLS M G++
Sbjct  1212  MQSVDSGVNLATRSFNDNDIVVEKAHYDKKLKTSIGGSYGNSEQTSCSSDDFLSRMHGSS  1271

Query  3978  SQLSRQKNERDEALSKTAILETPGNAEMFFFPVDPHPVGNIGSNNSSMPWKVHPLEEDQL  4157
                       DEALSK AI E  GNA  +FFPVDPHPV       SS+PW+ H  + D+L
Sbjct  1272  YGPYLPDTGCDEALSKAAIPECSGNAARYFFPVDPHPV-----EASSVPWQRHHSDNDRL  1326

Query  4158  HDKAPNLELALG---------------------------AKTKPLMSGIPSFLSGKVEKK  4256
              D+ PNLELALG                           A+T  L  GIP FL GKV+K+
Sbjct  1327  SDRVPNLELALGGESNSLTQGIPPFLVGKVDKKIIQDQGAETHLLTQGIPPFLVGKVDKR  1386

Query  4257  IIEENTSDNAATSANK-EDVsaslslslsFPFPEKEH--GTSSKPEQEDPRRRQANTSLL  4427
             +I++ +S   A    + EDVSASLSLSLSFPFPEKE   G+ S+ EQ  P  R+ NT LL
Sbjct  1387  VIQDPSSAKEAIRVEEVEDVSASLSLSLSFPFPEKEQQKGSVSQNEQAMPETRRGNTPLL  1446

Query  4428  LFG  4436
              FG
Sbjct  1447  FFG  1449



>ref|XP_009601824.1| PREDICTED: uncharacterized protein LOC104097026 isoform X3 [Nicotiana 
tomentosiformis]
Length=1506

 Score =   924 bits (2388),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 599/1323 (45%), Positives = 810/1323 (61%), Gaps = 95/1323 (7%)
 Frame = +3

Query  684   GETCVENASSFSGTDVLPASKSKKDFALEAKMEVSDSLEDHVVSLADKEGIDKVVNTTGL  863
             GET   NA S         S  K D A EA     D   D      D++ +   V++   
Sbjct  202   GETSSRNAHSIGDYLENNHSSRKNDVAPEAS---GDLPADTCPEKDDQKSVGSPVSSDTK  258

Query  864   DLIASQIHQMeesddseivevdvkvCDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEK  1043
             D +  Q HQM+ S+DS+I E DVKVCDICG  GRE LLAIC +CTDGAEHTYCM++ML+K
Sbjct  259   DAL--QSHQMDGSEDSDIEEQDVKVCDICGDAGREDLLAICCKCTDGAEHTYCMREMLQK  316

Query  1044  IPEGDWLCEECKFDQEMKNEHVN-SGRVNEKEKTSPSRRTTIAKSDHPLKMEQKTSDCWG  1220
             +PEGDW+CEECKFD+EMKN   + S + +   K+  + +T I  +   +K E K SD  G
Sbjct  317   VPEGDWMCEECKFDEEMKNRKGDKSVKFDGYRKSYLTGQTAIDDTGVTIKTEAKPSDVDG  376

Query  1221  DKAVEERSYLKTSGKRCTDDSEVSSPTKRQRLELRS--PTAQIPNRVTSLSRESSFKNLE  1394
             + A    S  K SGKR  DDSEVSS  K+Q  E  S  P    PNR+ +LSRESSF N +
Sbjct  377   ETA----SDTKISGKRRMDDSEVSSVAKKQAFEPASGSPKTLSPNRLIALSRESSFNNSD  432

Query  1395  RGKVKPLNPFSSGSFAAKVPSSTGPQPQPPRGIFSKSNSFSSLIAKPKVKLVDEVFPAKQ  1574
             +GK+K +N  SSG  +     + G + Q  RG FSKSNSFSSL AK KV+LVDE F  KQ
Sbjct  433   KGKLKSINQISSGGLSVHDTLAWGSRLQTARGTFSKSNSFSSLAAKRKVQLVDEGFLPKQ  492

Query  1575  KLSRETAFIESKEVAVRSMGKSMSFKPTTASRSNCTESKVKMFSPKFSHDQDVKWLRHKK  1754
             KL RE+A +++KE ++RSM KSMSF+  + SR+N +E+KVKM SPKFS  QD K     K
Sbjct  493   KLDRESAGLDAKESSIRSMSKSMSFRSISTSRNNVSEAKVKMLSPKFSPAQD-KGQMQTK  551

Query  1755  DRSSFDRKNSLRSDRLAGGAISSPKSDNKPTPRGEPSSLSSLNTNRDYRALTSDNKPVTI  1934
             +R+ F+RK+S RS+R +G ++ S K++ +   RG+PS LSS + N D R    D+KPV++
Sbjct  552   ERNPFERKSSFRSERSSGTSVPS-KTEQRSAFRGDPSLLSSSSNNCDSRPGQLDSKPVSL  610

Query  1935  SNSTSGVAR----------EVLKQASVD----GVSSANRVSSSEENPSQAIPKEDSSSSS  2072
               S+  VAR          E  KQ S+     GVS+AN++SSS++ P+Q   + D SS+S
Sbjct  611   LKSSGAVARRTPEVSVHSDEAKKQISLTSISTGVSAANKISSSDQRPNQCNARGDPSSNS  670

Query  2073  CVAERPSWSSNEVLPDGLSQSKESKAFGDKTRESSASRSKQNSTASGKIVSCQKCKGNGH  2252
              +AERP+ ++ E L DG+SQ +E+K  G++ RE+S  R K + T + K + CQ+CKG+GH
Sbjct  671   YIAERPTSNAGEGLLDGVSQQRETKNVGERIRENSGRRLKHSGTGT-KSLFCQRCKGSGH  729

Query  2253  LAQVCTADGPE-SSALGSPFKSSREATNGPSDLKAAIEAARLRKPGICRKNRVADQSEDL  2429
             L + CTADGP+ S++  S  K+SREA NG SDLKAAIEAA LRKPGICRKNRV DQS+DL
Sbjct  730   LTESCTADGPDLSTSDVSAVKNSREAPNGTSDLKAAIEAAMLRKPGICRKNRVFDQSDDL  789

Query  2430  SASNMKSEIASQDQMLSSTVRRNVNGAEE-----------AQKQETANNAKQLGII-AEA  2573
             + SN  SE  +QD +  S+ RR +   EE           + KQE ++  +QL ++ AEA
Sbjct  790   AMSNTNSETMAQDLLSGSSGRRILPTNEEVYGVSSNSMAGSYKQEISS-MRQLSVLPAEA  848

Query  2574  SARTRNAGHVVFSDVKHSVIDMERQTLVSMPVILKTAIPEYQYIWQGGFEVQKSGKAFNL  2753
              +R  NA  ++ SD K S++D++R +  ++ ++ +TAIPE++YIWQG FEVQKSG+  +L
Sbjct  849   LSRAGNAVPILPSDEKSSLVDLDRYSQAAVTILSRTAIPEHEYIWQGAFEVQKSGRTLDL  908

Query  2754  YDGIQAHLSSCASPKVLDAVNKFPRKVILNEVPRLSSWPMQFKECGVSEDNVALFFFAKD  2933
              DGIQAHLSSCASPKVLD VNKFP+KV+ NEV RLS+WP+QF+E GV+EDN+ALFFFAKD
Sbjct  909   CDGIQAHLSSCASPKVLDTVNKFPQKVLFNEVSRLSTWPIQFQEYGVTEDNIALFFFAKD  968

Query  2934  IGSYEKSYKVLLGDMVKHDLALQGNIGDIELLIFPSNQLPEKFQRWNLMFFLWGVFRGKR  3113
             IGSY++ YK+LL +M+++D+AL+ N+  +ELLIFPSN+LPEK QRWN+MFFLWGVFR K+
Sbjct  969   IGSYKRCYKILLENMIRNDMALKANLEGVELLIFPSNRLPEKSQRWNMMFFLWGVFRVKK  1028

Query  3114  ANSLQNFPGAEKP--LIQDIPTPATSLPENMFTPVPKLNSARGSAATNTEMSAVKESESA  3287
             A+ +Q+     KP  + QDIP  +   PEN+    P  N+   + + + E+ A KES   
Sbjct  1029  ASCVQHMQATGKPFPVPQDIPKSSMPFPENVHCLGPVDNATSDNVSMDGEVIASKESGCP  1088

Query  3288  SLHKIVNGNCSIQSSSQVSRDKCSRINAEQNDKLDSSSMQNSEPKLGPDRRYFGV-PLGE  3464
                 +VNGN   ++S QV +     +N E  +      +  S     P RR +G+  +G+
Sbjct  1089  ----MVNGNVDSKAS-QVCKGDSVAVNVEHLEPSSVRIVPTSHLNSSPGRRRYGIFQVGD  1143

Query  3465  AVH--------SSVQTAERVSSPNTSRPMSVHWAAPLDGEKLSMLSDETP-TMQEATSVG  3617
             A          SS   A   ++ +T+ P+ +   + +D ++     D  P  MQE   +G
Sbjct  1144  AGQECKSELQSSSTPAANTWANVSTTEPVPMECGSLVDRQRPFHSVDAAPGRMQEKAYMG  1203

Query  3618  STTKNLCGKDDVKIGRICLDNVSTEEATPLARHTSMEQTLNVISSFGVNPKKRSHSAETV  3797
             ST K  C K+  K      D    EEA+  +   + E T  V++S  +N  KR  S ETV
Sbjct  1204  STEKGFCSKNGRKFEINLEDEYKDEEASETSGSATTEPTRKVLNSDMLNHLKRPRSVETV  1263

Query  3798  LQsasssgtsqafssysNDDILVEEFCHKRVKLNSDRSYGCNDQTSCSKDGFLSEMGGTA  3977
             +QS  S       S   ND ++ +    K++K +   SYG ++QTSCS D FLS M G++
Sbjct  1264  MQSVDSGVNLATRSFNDNDIVVEKAHYDKKLKTSIGGSYGNSEQTSCSSDDFLSRMHGSS  1323

Query  3978  SQLSRQKNERDEALSKTAILETPGNAEMFFFPVDPHPVGNIGSNNSSMPWKVHPLEEDQL  4157
                       DEALSK AI E  GNA  +FFPVDPHPV       SS+PW+ H  + D+L
Sbjct  1324  YGPYLPDTGCDEALSKAAIPECSGNAARYFFPVDPHPV-----EASSVPWQRHHSDNDRL  1378

Query  4158  HDKAPNLELALG---------------------------AKTKPLMSGIPSFLSGKVEKK  4256
              D+ PNLELALG                           A+T  L  GIP FL GKV+K+
Sbjct  1379  SDRVPNLELALGGESNSLTQGIPPFLVGKVDKKIIQDQGAETHLLTQGIPPFLVGKVDKR  1438

Query  4257  IIEENTSDNAATSANK-EDVsaslslslsFPFPEKEH--GTSSKPEQEDPRRRQANTSLL  4427
             +I++ +S   A    + EDVSASLSLSLSFPFPEKE   G+ S+ EQ  P  R+ NT LL
Sbjct  1439  VIQDPSSAKEAIRVEEVEDVSASLSLSLSFPFPEKEQQKGSVSQNEQAMPETRRGNTPLL  1498

Query  4428  LFG  4436
              FG
Sbjct  1499  FFG  1501



>ref|XP_009601823.1| PREDICTED: uncharacterized protein LOC104097026 isoform X2 [Nicotiana 
tomentosiformis]
Length=1545

 Score =   917 bits (2369),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 597/1322 (45%), Positives = 801/1322 (61%), Gaps = 117/1322 (9%)
 Frame = +3

Query  684   GETCVENASSFSGTDVLPASKSKKDFALEAKMEVSDSLEDHVVSLADKEGIDKVVNTTGL  863
             GET   NA S         S  K D A EA     D   D      D++ +   V++   
Sbjct  265   GETSSRNAHSIGDYLENNHSSRKNDVAPEAS---GDLPADTCPEKDDQKSVGSPVSSDTK  321

Query  864   DLIASQIHQMeesddseivevdvkvCDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEK  1043
             D +  Q HQM+ S+DS+I E DVKVCDICG  GRE LLAIC +CTDGAEHTYCM++ML+K
Sbjct  322   DAL--QSHQMDGSEDSDIEEQDVKVCDICGDAGREDLLAICCKCTDGAEHTYCMREMLQK  379

Query  1044  IPEGDWLCEECKFDQEMKNEHVNSGRVNEKEKTSPSRRTTIAKSDHPLKMEQKTSDCWGD  1223
             +PEGDW+CEECKFD+EMKN                 +  TI       K E K SD  G+
Sbjct  380   VPEGDWMCEECKFDEEMKNR----------------KGVTI-------KTEAKPSDVDGE  416

Query  1224  KAVEERSYLKTSGKRCTDDSEVSSPTKRQRLELRS--PTAQIPNRVTSLSRESSFKNLER  1397
              A    S  K SGKR  DDSEVSS  K+Q  E  S  P    PNR+ +LSRESSF N ++
Sbjct  417   TA----SDTKISGKRRMDDSEVSSVAKKQAFEPASGSPKTLSPNRLIALSRESSFNNSDK  472

Query  1398  GKVKPLNPFSSGSFAAKVPSSTGPQPQPPRGIFSKSNSFSSLIAKPKVKLVDEVFPAKQK  1577
             GK+K +N  SSG  +     + G + Q  RG FSKSNSFSSL AK KV+LVDE F  KQK
Sbjct  473   GKLKSINQISSGGLSVHDTLAWGSRLQTARGTFSKSNSFSSLAAKRKVQLVDEGFLPKQK  532

Query  1578  LSRETAFIESKEVAVRSMGKSMSFKPTTASRSNCTESKVKMFSPKFSHDQDVKWLRHKKD  1757
             L RE+A +++KE ++RSM KSMSF+  + SR+N +E+KVKM SPKFS  QD K     K+
Sbjct  533   LDRESAGLDAKESSIRSMSKSMSFRSISTSRNNVSEAKVKMLSPKFSPAQD-KGQMQTKE  591

Query  1758  RSSFDRKNSLRSDRLAGGAISSPKSDNKPTPRGEPSSLSSLNTNRDYRALTSDNKPVTIS  1937
             R+ F+RK+S RS+R +G ++ S K++ +   RG+PS LSS + N D R    D+KPV++ 
Sbjct  592   RNPFERKSSFRSERSSGTSVPS-KTEQRSAFRGDPSLLSSSSNNCDSRPGQLDSKPVSLL  650

Query  1938  NSTSGVAR----------EVLKQASVD----GVSSANRVSSSEENPSQAIPKEDSSSSSC  2075
              S+  VAR          E  KQ S+     GVS+AN++SSS++ P+Q   + D SS+S 
Sbjct  651   KSSGAVARRTPEVSVHSDEAKKQISLTSISTGVSAANKISSSDQRPNQCNARGDPSSNSY  710

Query  2076  VAERPSWSSNEVLPDGLSQSKESKAFGDKTRESSASRSKQNSTASGKIVSCQKCKGNGHL  2255
             +AERP+ ++ E L DG+SQ +E+K  G++ RE+S  R K + T + K + CQ+CKG+GHL
Sbjct  711   IAERPTSNAGEGLLDGVSQQRETKNVGERIRENSGRRLKHSGTGT-KSLFCQRCKGSGHL  769

Query  2256  AQVCTADGPE-SSALGSPFKSSREATNGPSDLKAAIEAARLRKPGICRKNRVADQSEDLS  2432
              + CTADGP+ S++  S  K+SREA NG SDLKAAIEAA LRKPGICRKNRV DQS+DL+
Sbjct  770   TESCTADGPDLSTSDVSAVKNSREAPNGTSDLKAAIEAAMLRKPGICRKNRVFDQSDDLA  829

Query  2433  ASNMKSEIASQDQMLSSTVRRNVNGAEE-----------AQKQETANNAKQLGII-AEAS  2576
              SN  SE  +QD +  S+ RR +   EE           + KQE ++  +QL ++ AEA 
Sbjct  830   MSNTNSETMAQDLLSGSSGRRILPTNEEVYGVSSNSMAGSYKQEISS-MRQLSVLPAEAL  888

Query  2577  ARTRNAGHVVFSDVKHSVIDMERQTLVSMPVILKTAIPEYQYIWQGGFEVQKSGKAFNLY  2756
             +R  NA  ++ SD K S++D++R +  ++ ++ +TAIPE++YIWQG FEVQKSG+  +L 
Sbjct  889   SRAGNAVPILPSDEKSSLVDLDRYSQAAVTILSRTAIPEHEYIWQGAFEVQKSGRTLDLC  948

Query  2757  DGIQAHLSSCASPKVLDAVNKFPRKVILNEVPRLSSWPMQFKECGVSEDNVALFFFAKDI  2936
             DGIQAHLSSCASPKVLD VNKFP+KV+ NEV RLS+WP+QF+E GV+EDN+ALFFFAKDI
Sbjct  949   DGIQAHLSSCASPKVLDTVNKFPQKVLFNEVSRLSTWPIQFQEYGVTEDNIALFFFAKDI  1008

Query  2937  GSYEKSYKVLLGDMVKHDLALQGNIGDIELLIFPSNQLPEKFQRWNLMFFLWGVFRGKRA  3116
             GSY++ YK+LL +M+++D+AL+ N+  +ELLIFPSN+LPEK QRWN+MFFLWGVFR K+A
Sbjct  1009  GSYKRCYKILLENMIRNDMALKANLEGVELLIFPSNRLPEKSQRWNMMFFLWGVFRVKKA  1068

Query  3117  NSLQNFPGAEKP--LIQDIPTPATSLPENMFTPVPKLNSARGSAATNTEMSAVKESESAS  3290
             + +Q+     KP  + QDIP  +   PEN+    P  N+   + + + E+ A KES    
Sbjct  1069  SCVQHMQATGKPFPVPQDIPKSSMPFPENVHCLGPVDNATSDNVSMDGEVIASKESGCP-  1127

Query  3291  LHKIVNGNCSIQSSSQVSRDKCSRINAEQNDKLDSSSMQNSEPKLGPDRRYFGV-PLGEA  3467
                +VNGN   ++S QV +     +N E  +      +  S     P RR +G+  +G+A
Sbjct  1128  ---MVNGNVDSKAS-QVCKGDSVAVNVEHLEPSSVRIVPTSHLNSSPGRRRYGIFQVGDA  1183

Query  3468  VH--------SSVQTAERVSSPNTSRPMSVHWAAPLDGEKLSMLSDETP-TMQEATSVGS  3620
                       SS   A   ++ +T+ P+ +   + +D ++     D  P  MQE   +GS
Sbjct  1184  GQECKSELQSSSTPAANTWANVSTTEPVPMECGSLVDRQRPFHSVDAAPGRMQEKAYMGS  1243

Query  3621  TTKNLCGKDDVKIGRICLDNVSTEEATPLARHTSMEQTLNVISSFGVNPKKRSHSAETVL  3800
             T K  C K+  K      D    EEA+  +   + E T  V++S  +N  KR  S ETV+
Sbjct  1244  TEKGFCSKNGRKFEINLEDEYKDEEASETSGSATTEPTRKVLNSDMLNHLKRPRSVETVM  1303

Query  3801  QsasssgtsqafssysNDDILVEEFCHKRVKLNSDRSYGCNDQTSCSKDGFLSEMGGTAS  3980
             QS  S       S   ND ++ +    K++K +   SYG ++QTSCS D FLS M G++ 
Sbjct  1304  QSVDSGVNLATRSFNDNDIVVEKAHYDKKLKTSIGGSYGNSEQTSCSSDDFLSRMHGSSY  1363

Query  3981  QLSRQKNERDEALSKTAILETPGNAEMFFFPVDPHPVGNIGSNNSSMPWKVHPLEEDQLH  4160
                      DEALSK AI E  GNA  +FFPVDPHPV       SS+PW+ H  + D+L 
Sbjct  1364  GPYLPDTGCDEALSKAAIPECSGNAARYFFPVDPHPV-----EASSVPWQRHHSDNDRLS  1418

Query  4161  DKAPNLELALG---------------------------AKTKPLMSGIPSFLSGKVEKKI  4259
             D+ PNLELALG                           A+T  L  GIP FL GKV+K++
Sbjct  1419  DRVPNLELALGGESNSLTQGIPPFLVGKVDKKIIQDQGAETHLLTQGIPPFLVGKVDKRV  1478

Query  4260  IEENTSDNAATSANK-EDVsaslslslsFPFPEKEH--GTSSKPEQEDPRRRQANTSLLL  4430
             I++ +S   A    + EDVSASLSLSLSFPFPEKE   G+ S+ EQ  P  R+ NT LL 
Sbjct  1479  IQDPSSAKEAIRVEEVEDVSASLSLSLSFPFPEKEQQKGSVSQNEQAMPETRRGNTPLLF  1538

Query  4431  FG  4436
             FG
Sbjct  1539  FG  1540



>ref|XP_006347602.1| PREDICTED: uncharacterized protein LOC102589655 isoform X3 [Solanum 
tuberosum]
Length=1714

 Score =   870 bits (2249),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 532/1152 (46%), Positives = 714/1152 (62%), Gaps = 56/1152 (5%)
 Frame = +3

Query  873   ASQIHQMeesddseivevdvkvCDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPE  1052
             A Q HQM+ES+DS+I E+DVKVCDICG  GRE LLAIC +CTDGAEHTYCM++ML+K+PE
Sbjct  263   ALQSHQMDESEDSDIEELDVKVCDICGDAGREDLLAICCKCTDGAEHTYCMREMLQKVPE  322

Query  1053  GDWLCEECKFDQEMKNEHVN-SGRVNEKEKTSPS-RRTTIAKSDHPLKMEQKTSDCWGDK  1226
             GDW+CEECKFD+EMKN   + S + +   K+ P+ ++  +  +   +K E K  D  GD 
Sbjct  323   GDWMCEECKFDEEMKNRKEDKSVKFDGNGKSYPTGKKIALGNTGLTIKTESKPPDFDGDI  382

Query  1227  AVEERSYLKTSGKRCTDDSEVSSPTKRQRLEL--RSPTAQIPNRVTSLSRESSFKNLERG  1400
             A    S  KT GKRC DD+EVSS  K+Q LE    SP    PN++ +LSRESSFKN ++G
Sbjct  383   A----SDPKTPGKRCMDDTEVSSAAKKQALEPVPASPKTLSPNKLPALSRESSFKNSDKG  438

Query  1401  KVKPLNPFSSGSFAAKVPSSTGPQPQPPRGIFSKSNSFSSLIAKPKVKLVDEVFPAKQKL  1580
             K+K  N  SSG  +     + G + Q  RG FSKSNSFSSL AK KV LVDE FP KQKL
Sbjct  439   KLKSANLISSGGLSVHDTPAWGSRLQTSRGTFSKSNSFSSLAAKRKVLLVDESFPPKQKL  498

Query  1581  SRETAFIESKEVAVRSMGKSMSFKPTTASRSNCTESKVKMFSPKFSHDQDVKWLRHKKDR  1760
              RE+  +++KE + RSM KSMSF+  + SR+N +ESKVKM SP+FS  QD K     K+R
Sbjct  499   VRESTGLDAKESSTRSMSKSMSFRSISTSRNNVSESKVKMLSPRFSPAQD-KAQMQTKER  557

Query  1761  SSFDRKNSLRSDRLAGGAISSPKSDNKPTPRGEPSSLSSLNTNRDYRALTSDNKPVTISN  1940
             + F+RKNS RS+R  G ++ S ++D +   RG+PS L S +  RD R    D+KP+++  
Sbjct  558   NQFERKNSFRSERSPGTSVPS-RTDQRSAFRGDPSPLPSSSNIRDSRTGQLDSKPMSLLK  616

Query  1941  STSGVAREVLKQASVDGVSSANRVSSSEENPSQAIPKEDSSSSSCVAERPSWSSNEVLPD  2120
             S+  VAR     + + G  +AN++SSS++ P Q+  ++DS  +S +AERP+ ++ E   D
Sbjct  617   SSGAVARRTQDLSVLSGAPAANKISSSDQRPDQSSARDDSLPNSYIAERPTSNTGEGPSD  676

Query  2121  GLSQSKESKAFGDKTRESSASRSKQNSTASGKIVSCQKCKGNGHLAQVCTADGPESSALG  2300
             GL Q  ESK  G++ +ESS  R K   T + K + CQKCKG+GHL   CT DG E  A  
Sbjct  677   GLPQPSESKNVGERIKESSGRRLKHTGTGT-KSLFCQKCKGSGHLTDSCTVDGSELVASD  735

Query  2301  -SPFKSSREATNGPSDLKAAIEAARLRKPGICRKNRVADQSEDLSASNMKSEIASQDQML  2477
              S  ++SREA NG S+LKAAIEAA L+KPG+C KNRV DQS+DL+ SN  +E  + D + 
Sbjct  736   VSAVRNSREAPNGTSNLKAAIEAAMLKKPGVCWKNRVVDQSDDLAVSNTNAETTAPDVLC  795

Query  2478  SSTVRRNVNGAEE-----------AQKQETANNAKQLGII-AEASARTRNAGHVVFSDVK  2621
              S+ RR ++  E+           + KQE  +  +QL ++ AEA     N   ++ SD K
Sbjct  796   GSSSRRMLSSNEDGHGVSLNSMTVSHKQEIGS-LRQLSVLPAEALTGAGNLVPILLSDGK  854

Query  2622  HSVIDMERQTLVSMPVILKTAIPEYQYIWQGGFEVQKSGKAFNLYDGIQAHLSSCASPKV  2801
              S++D+ R +  +M ++ KTA PE++YIWQG FEVQKSG++ +L DGIQAHLSSCASP V
Sbjct  855   SSLVDLHRYSQAAMSILSKTAFPEHEYIWQGAFEVQKSGRSLDLCDGIQAHLSSCASPNV  914

Query  2802  LDAVNKFPRKVILNEVPRLSSWPMQFKECGVSEDNVALFFFAKDIGSYEKSYKVLLGDMV  2981
             LDAV+KFP+KV+ NEV RLS+WP+QF+E GV EDN+ALFFFA+DIGSYE+ YK+LL +M+
Sbjct  915   LDAVHKFPQKVLFNEVSRLSTWPIQFQEYGVKEDNIALFFFAQDIGSYERCYKILLENMI  974

Query  2982  KHDLALQGNIGDIELLIFPSNQLPEKFQRWNLMFFLWGVFRGKRANSLQNFPGAEKPLIQ  3161
             ++D AL+ N+  +ELLIFPSN+LPEK QRWN+MFFLWGVFR K+  +    P     + Q
Sbjct  975   RNDTALKANLQGVELLIFPSNRLPEKSQRWNMMFFLWGVFRVKKVQATTGKPSL---VPQ  1031

Query  3162  DIPTPATSLPENMFTPVPKLNSARGSAATNTEMSAVKESESASLHKIVNGNCSIQSSSQV  3341
             D P      PEN+    P  N   G+ + + E++A K+S       +VNGN      +QV
Sbjct  1032  DTPKLIMPFPENIHCLGPVDNVTSGNVSMDGEVTASKKSSCP----LVNGNVD-SKGAQV  1086

Query  3342  SRDKCSRINAEQNDKLDSSSMQNSEPKLGPDRRYFGV--PLGEAVHSSVQTAERVSSPNT  3515
              +   +    E  +    SS+  S     P+RR FG+   +G+A        E +SS   
Sbjct  1087  CKGDSADTKVEHLEPRSMSSVPASHMDFTPERRQFGIFQVVGDAGREC--KVEVLSS---  1141

Query  3516  SRPMSVHWAAPLDGEKLSMLSDETPT-MQEATSVGSTTKNLCGKDDVKIGRICLDNVSTE  3692
                     +AP    + S   DE    MQ+ TSVGS  K  C  +  K      D    E
Sbjct  1142  --------SAPAANSQPSRSVDEAAGHMQDKTSVGSMEKGFCSTNGRKFEINLEDEYKDE  1193

Query  3693  EATPLARHTSMEQTLNVISSFGVNPKKRSHSAETVLQsasssgtsqafssysNDDILVEE  3872
             EA+  +   + E T  V++S   N  KR  S ETV+QSA S           N D+LVEE
Sbjct  1194  EASETSGSAATEPTWKVLNSDVSNHLKRPRSVETVMQSADSGVNRATRLFNDN-DLLVEE  1252

Query  3873  FCH-KRVKLNSDRSYGCNDQTSCSKDGFLSEMGGTASQLSRQKNERDEALSKTAILETPG  4049
               H K++K N   SYG ++QTSCS D FLS M G++          DEALSK  + E   
Sbjct  1253  AHHDKKLKTNIGGSYGNSEQTSCSSDDFLSRMRGSSYGPYLPDTGYDEALSKAPVPECSE  1312

Query  4050  NAEMFFFPVDPHPVGNIGSNNSSMPWKVHPLEEDQLHDKAPNLELALGAKTKPLMSGIPS  4229
             +AE +FFPVDP+PV       SSMPW++H  + D+L D+ PNLELALG ++     GIP 
Sbjct  1313  SAERYFFPVDPNPV-----KASSMPWQMHHPDNDRLSDRVPNLELALGGESNSQTRGIPP  1367

Query  4230  FLSGKVEKKIIE  4265
             FL GKV+KKII+
Sbjct  1368  FLVGKVDKKIIQ  1379


 Score = 67.4 bits (163),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 47/85 (55%), Positives = 59/85 (69%), Gaps = 3/85 (4%)
 Frame = +3

Query  4191  GAKTKPLMSGIPSFLSGKVEKKIIEENTSDNAATSANK-EDVsaslslslsFPFPEKEH-  4364
             G +T P   GIPSFL GKV+KK+ ++++S   A    + EDVSASLSLSLSFPFPEKE  
Sbjct  1625  GGETHPPTPGIPSFLVGKVDKKVSQDHSSAKEAVGVKEVEDVSASLSLSLSFPFPEKEQQ  1684

Query  4365  -GTSSKPEQEDPRRRQANTSLLLFG  4436
              G+ S+ EQ  P  R++NT LL FG
Sbjct  1685  KGSVSQTEQAIPETRRSNTPLLFFG  1709



>ref|XP_006347606.1| PREDICTED: uncharacterized protein LOC102589655 isoform X7 [Solanum 
tuberosum]
Length=1620

 Score =   867 bits (2240),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 538/1167 (46%), Positives = 721/1167 (62%), Gaps = 70/1167 (6%)
 Frame = +3

Query  873   ASQIHQMeesddseivevdvkvCDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPE  1052
             A Q HQM+ES+DS+I E+DVKVCDICG  GRE LLAIC +CTDGAEHTYCM++ML+K+PE
Sbjct  263   ALQSHQMDESEDSDIEELDVKVCDICGDAGREDLLAICCKCTDGAEHTYCMREMLQKVPE  322

Query  1053  GDWLCEECKFDQEMKNEHVN-SGRVNEKEKTSPS-RRTTIAKSDHPLKMEQKTSDCWGDK  1226
             GDW+CEECKFD+EMKN   + S + +   K+ P+ ++  +  +   +K E K  D  GD 
Sbjct  323   GDWMCEECKFDEEMKNRKEDKSVKFDGNGKSYPTGKKIALGNTGLTIKTESKPPDFDGDI  382

Query  1227  AVEERSYLKTSGKRCTDDSEVSSPTKRQRLEL--RSPTAQIPNRVTSLSRESSFKNLERG  1400
             A    S  KT GKRC DD+EVSS  K+Q LE    SP    PN++ +LSRESSFKN ++G
Sbjct  383   A----SDPKTPGKRCMDDTEVSSAAKKQALEPVPASPKTLSPNKLPALSRESSFKNSDKG  438

Query  1401  KVKPLNPFSSGSFAAKVPSSTGPQPQPPRGIFSKSNSFSSLIAKPKVKLVDEVFPAKQKL  1580
             K+K  N  SSG  +     + G + Q  RG FSKSNSFSSL AK KV LVDE FP KQKL
Sbjct  439   KLKSANLISSGGLSVHDTPAWGSRLQTSRGTFSKSNSFSSLAAKRKVLLVDESFPPKQKL  498

Query  1581  SRETAFIESKEVAVRSMGKSMSFKPTTASRSNCTESKVKMFSPKFSHDQDVKWLRHKKDR  1760
              RE+  +++KE + RSM KSMSF+  + SR+N +ESKVKM SP+FS  QD K     K+R
Sbjct  499   VRESTGLDAKESSTRSMSKSMSFRSISTSRNNVSESKVKMLSPRFSPAQD-KAQMQTKER  557

Query  1761  SSFDRKNSLRSDRLAGGAISSPKSDNKPTPRGEPSSLSSLNTNRDYRALTSDNKPVTISN  1940
             + F+RKNS RS+R  G ++ S ++D +   RG+PS L S +  RD R    D+KP+++  
Sbjct  558   NQFERKNSFRSERSPGTSVPS-RTDQRSAFRGDPSPLPSSSNIRDSRTGQLDSKPMSLLK  616

Query  1941  STSGVAR----------EVLKQASVDGVSS----ANRVSSSEENPSQAIPKEDSSSSSCV  2078
             S+  VAR          E  KQ S   +S+    AN++SSS++ P Q+  ++DS  +S +
Sbjct  617   SSGAVARRTQDLSVLSDEAKKQTSHTSISTGAPAANKISSSDQRPDQSSARDDSLPNSYI  676

Query  2079  AERPSWSSNEVLPDGLSQSKESKAFGDKTRESSASRSKQNSTASGKIVSCQKCKGNGHLA  2258
             AERP+ ++ E   DGL Q  ESK  G++ +ESS  R K   T + K + CQKCKG+GHL 
Sbjct  677   AERPTSNTGEGPSDGLPQPSESKNVGERIKESSGRRLKHTGTGT-KSLFCQKCKGSGHLT  735

Query  2259  QVCTADGPESSALG-SPFKSSREATNGPSDLKAAIEAARLRKPGICRKNRVADQSEDLSA  2435
               CT DG E  A   S  ++SREA NG S+LKAAIEAA L+KPG+C KNRV DQS+DL+ 
Sbjct  736   DSCTVDGSELVASDVSAVRNSREAPNGTSNLKAAIEAAMLKKPGVCWKNRVVDQSDDLAV  795

Query  2436  SNMKSEIASQDQMLSSTVRRNVNGAEE-----------AQKQETANNAKQLGII-AEASA  2579
             SN  +E  + D +  S+ RR ++  E+           + KQE  +  +QL ++ AEA  
Sbjct  796   SNTNAETTAPDVLCGSSSRRMLSSNEDGHGVSLNSMTVSHKQEIGS-LRQLSVLPAEALT  854

Query  2580  RTRNAGHVVFSDVKHSVIDMERQTLVSMPVILKTAIPEYQYIWQGGFEVQKSGKAFNLYD  2759
                N   ++ SD K S++D+ R +  +M ++ KTA PE++YIWQG FEVQKSG++ +L D
Sbjct  855   GAGNLVPILLSDGKSSLVDLHRYSQAAMSILSKTAFPEHEYIWQGAFEVQKSGRSLDLCD  914

Query  2760  GIQAHLSSCASPKVLDAVNKFPRKVILNEVPRLSSWPMQFKECGVSEDNVALFFFAKDIG  2939
             GIQAHLSSCASP VLDAV+KFP+KV+ NEV RLS+WP+QF+E GV EDN+ALFFFA+DIG
Sbjct  915   GIQAHLSSCASPNVLDAVHKFPQKVLFNEVSRLSTWPIQFQEYGVKEDNIALFFFAQDIG  974

Query  2940  SYEKSYKVLLGDMVKHDLALQGNIGDIELLIFPSNQLPEKFQRWNLMFFLWGVFRGKRAN  3119
             SYE+ YK+LL +M+++D AL+ N+  +ELLIFPSN+LPEK QRWN+MFFLWGVFR K+  
Sbjct  975   SYERCYKILLENMIRNDTALKANLQGVELLIFPSNRLPEKSQRWNMMFFLWGVFRVKK--  1032

Query  3120  SLQNFPGAEKPLIQDIPTPATSLPENMFTPVPKLNSARGSAATNTEMSAVKESESASLHK  3299
              +Q   G    + QD P      PEN+    P  N   G+ + + E++A K+S       
Sbjct  1033  -VQATTGKPSLVPQDTPKLIMPFPENIHCLGPVDNVTSGNVSMDGEVTASKKSSCP----  1087

Query  3300  IVNGNCSIQSSSQVSRDKCSRINAEQNDKLDSSSMQNSEPKLGPDRRYFGV--PLGEAVH  3473
             +VNGN   +  +QV +   +    E  +    SS+  S     P+RR FG+   +G+A  
Sbjct  1088  LVNGNVDSK-GAQVCKGDSADTKVEHLEPRSMSSVPASHMDFTPERRQFGIFQVVGDAGR  1146

Query  3474  SSVQTAERVSSPNTSRPMSVHWAAPLDGEKLSMLSDETPT-MQEATSVGSTTKNLCGKDD  3650
                   E +SS           +AP    + S   DE    MQ+ TSVGS  K  C  + 
Sbjct  1147  EC--KVEVLSS-----------SAPAANSQPSRSVDEAAGHMQDKTSVGSMEKGFCSTNG  1193

Query  3651  VKIGRICLDNVSTEEATPLARHTSMEQTLNVISSFGVNPKKRSHSAETVLQsasssgtsq  3830
              K      D    EEA+  +   + E T  V++S   N  KR  S ETV+QSA S     
Sbjct  1194  RKFEINLEDEYKDEEASETSGSAATEPTWKVLNSDVSNHLKRPRSVETVMQSADSGVNRA  1253

Query  3831  afssysNDDILVEEFCH-KRVKLNSDRSYGCNDQTSCSKDGFLSEMGGTASQLSRQKNER  4007
                   N D+LVEE  H K++K N   SYG ++QTSCS D FLS M G++          
Sbjct  1254  TRLFNDN-DLLVEEAHHDKKLKTNIGGSYGNSEQTSCSSDDFLSRMRGSSYGPYLPDTGY  1312

Query  4008  DEALSKTAILETPGNAEMFFFPVDPHPVGNIGSNNSSMPWKVHPLEEDQLHDKAPNLELA  4187
             DEALSK  + E   +AE +FFPVDP+PV       SSMPW++H  + D+L D+ PNLELA
Sbjct  1313  DEALSKAPVPECSESAERYFFPVDPNPV-----KASSMPWQMHHPDNDRLSDRVPNLELA  1367

Query  4188  LGAKTKPLMSGIPSFLSGKVEKKIIEE  4268
             LG ++     GIPSFL GKV+KKII++
Sbjct  1368  LGGESNSQTRGIPSFLVGKVDKKIIQD  1394


 Score = 67.4 bits (163),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 47/85 (55%), Positives = 59/85 (69%), Gaps = 3/85 (4%)
 Frame = +3

Query  4191  GAKTKPLMSGIPSFLSGKVEKKIIEENTSDNAATSANK-EDVsaslslslsFPFPEKEH-  4364
             G +T P   GIPSFL GKV+KK+ ++++S   A    + EDVSASLSLSLSFPFPEKE  
Sbjct  1531  GGETHPPTPGIPSFLVGKVDKKVSQDHSSAKEAVGVKEVEDVSASLSLSLSFPFPEKEQQ  1590

Query  4365  -GTSSKPEQEDPRRRQANTSLLLFG  4436
              G+ S+ EQ  P  R++NT LL FG
Sbjct  1591  KGSVSQTEQAIPETRRSNTPLLFFG  1615



>ref|XP_006347603.1| PREDICTED: uncharacterized protein LOC102589655 isoform X4 [Solanum 
tuberosum]
 ref|XP_006347604.1| PREDICTED: uncharacterized protein LOC102589655 isoform X5 [Solanum 
tuberosum]
 ref|XP_006347605.1| PREDICTED: uncharacterized protein LOC102589655 isoform X6 [Solanum 
tuberosum]
Length=1695

 Score =   864 bits (2232),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 537/1166 (46%), Positives = 719/1166 (62%), Gaps = 70/1166 (6%)
 Frame = +3

Query  873   ASQIHQMeesddseivevdvkvCDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPE  1052
             A Q HQM+ES+DS+I E+DVKVCDICG  GRE LLAIC +CTDGAEHTYCM++ML+K+PE
Sbjct  230   ALQSHQMDESEDSDIEELDVKVCDICGDAGREDLLAICCKCTDGAEHTYCMREMLQKVPE  289

Query  1053  GDWLCEECKFDQEMKNEHVN-SGRVNEKEKTSPS-RRTTIAKSDHPLKMEQKTSDCWGDK  1226
             GDW+CEECKFD+EMKN   + S + +   K+ P+ ++  +  +   +K E K  D  GD 
Sbjct  290   GDWMCEECKFDEEMKNRKEDKSVKFDGNGKSYPTGKKIALGNTGLTIKTESKPPDFDGDI  349

Query  1227  AVEERSYLKTSGKRCTDDSEVSSPTKRQRLEL--RSPTAQIPNRVTSLSRESSFKNLERG  1400
             A    S  KT GKRC DD+EVSS  K+Q LE    SP    PN++ +LSRESSFKN ++G
Sbjct  350   A----SDPKTPGKRCMDDTEVSSAAKKQALEPVPASPKTLSPNKLPALSRESSFKNSDKG  405

Query  1401  KVKPLNPFSSGSFAAKVPSSTGPQPQPPRGIFSKSNSFSSLIAKPKVKLVDEVFPAKQKL  1580
             K+K  N  SSG  +     + G + Q  RG FSKSNSFSSL AK KV LVDE FP KQKL
Sbjct  406   KLKSANLISSGGLSVHDTPAWGSRLQTSRGTFSKSNSFSSLAAKRKVLLVDESFPPKQKL  465

Query  1581  SRETAFIESKEVAVRSMGKSMSFKPTTASRSNCTESKVKMFSPKFSHDQDVKWLRHKKDR  1760
              RE+  +++KE + RSM KSMSF+  + SR+N +ESKVKM SP+FS  QD K     K+R
Sbjct  466   VRESTGLDAKESSTRSMSKSMSFRSISTSRNNVSESKVKMLSPRFSPAQD-KAQMQTKER  524

Query  1761  SSFDRKNSLRSDRLAGGAISSPKSDNKPTPRGEPSSLSSLNTNRDYRALTSDNKPVTISN  1940
             + F+RKNS RS+R  G ++ S ++D +   RG+PS L S +  RD R    D+KP+++  
Sbjct  525   NQFERKNSFRSERSPGTSVPS-RTDQRSAFRGDPSPLPSSSNIRDSRTGQLDSKPMSLLK  583

Query  1941  STSGVAR----------EVLKQASVDGVSS----ANRVSSSEENPSQAIPKEDSSSSSCV  2078
             S+  VAR          E  KQ S   +S+    AN++SSS++ P Q+  ++DS  +S +
Sbjct  584   SSGAVARRTQDLSVLSDEAKKQTSHTSISTGAPAANKISSSDQRPDQSSARDDSLPNSYI  643

Query  2079  AERPSWSSNEVLPDGLSQSKESKAFGDKTRESSASRSKQNSTASGKIVSCQKCKGNGHLA  2258
             AERP+ ++ E   DGL Q  ESK  G++ +ESS  R K   T + K + CQKCKG+GHL 
Sbjct  644   AERPTSNTGEGPSDGLPQPSESKNVGERIKESSGRRLKHTGTGT-KSLFCQKCKGSGHLT  702

Query  2259  QVCTADGPESSALG-SPFKSSREATNGPSDLKAAIEAARLRKPGICRKNRVADQSEDLSA  2435
               CT DG E  A   S  ++SREA NG S+LKAAIEAA L+KPG+C KNRV DQS+DL+ 
Sbjct  703   DSCTVDGSELVASDVSAVRNSREAPNGTSNLKAAIEAAMLKKPGVCWKNRVVDQSDDLAV  762

Query  2436  SNMKSEIASQDQMLSSTVRRNVNGAEE-----------AQKQETANNAKQLGII-AEASA  2579
             SN  +E  + D +  S+ RR ++  E+           + KQE  +  +QL ++ AEA  
Sbjct  763   SNTNAETTAPDVLCGSSSRRMLSSNEDGHGVSLNSMTVSHKQEIGS-LRQLSVLPAEALT  821

Query  2580  RTRNAGHVVFSDVKHSVIDMERQTLVSMPVILKTAIPEYQYIWQGGFEVQKSGKAFNLYD  2759
                N   ++ SD K S++D+ R +  +M ++ KTA PE++YIWQG FEVQKSG++ +L D
Sbjct  822   GAGNLVPILLSDGKSSLVDLHRYSQAAMSILSKTAFPEHEYIWQGAFEVQKSGRSLDLCD  881

Query  2760  GIQAHLSSCASPKVLDAVNKFPRKVILNEVPRLSSWPMQFKECGVSEDNVALFFFAKDIG  2939
             GIQAHLSSCASP VLDAV+KFP+KV+ NEV RLS+WP+QF+E GV EDN+ALFFFA+DIG
Sbjct  882   GIQAHLSSCASPNVLDAVHKFPQKVLFNEVSRLSTWPIQFQEYGVKEDNIALFFFAQDIG  941

Query  2940  SYEKSYKVLLGDMVKHDLALQGNIGDIELLIFPSNQLPEKFQRWNLMFFLWGVFRGKRAN  3119
             SYE+ YK+LL +M+++D AL+ N+  +ELLIFPSN+LPEK QRWN+MFFLWGVFR K+  
Sbjct  942   SYERCYKILLENMIRNDTALKANLQGVELLIFPSNRLPEKSQRWNMMFFLWGVFRVKK--  999

Query  3120  SLQNFPGAEKPLIQDIPTPATSLPENMFTPVPKLNSARGSAATNTEMSAVKESESASLHK  3299
              +Q   G    + QD P      PEN+    P  N   G+ + + E++A K+S       
Sbjct  1000  -VQATTGKPSLVPQDTPKLIMPFPENIHCLGPVDNVTSGNVSMDGEVTASKKSSCP----  1054

Query  3300  IVNGNCSIQSSSQVSRDKCSRINAEQNDKLDSSSMQNSEPKLGPDRRYFGV--PLGEAVH  3473
             +VNGN   +  +QV +   +    E  +    SS+  S     P+RR FG+   +G+A  
Sbjct  1055  LVNGNVDSK-GAQVCKGDSADTKVEHLEPRSMSSVPASHMDFTPERRQFGIFQVVGDAGR  1113

Query  3474  SSVQTAERVSSPNTSRPMSVHWAAPLDGEKLSMLSDETPT-MQEATSVGSTTKNLCGKDD  3650
                   E +SS           +AP    + S   DE    MQ+ TSVGS  K  C  + 
Sbjct  1114  EC--KVEVLSS-----------SAPAANSQPSRSVDEAAGHMQDKTSVGSMEKGFCSTNG  1160

Query  3651  VKIGRICLDNVSTEEATPLARHTSMEQTLNVISSFGVNPKKRSHSAETVLQsasssgtsq  3830
              K      D    EEA+  +   + E T  V++S   N  KR  S ETV+QSA S     
Sbjct  1161  RKFEINLEDEYKDEEASETSGSAATEPTWKVLNSDVSNHLKRPRSVETVMQSADSGVNRA  1220

Query  3831  afssysNDDILVEEFCH-KRVKLNSDRSYGCNDQTSCSKDGFLSEMGGTASQLSRQKNER  4007
                   N D+LVEE  H K++K N   SYG ++QTSCS D FLS M G++          
Sbjct  1221  TRLFNDN-DLLVEEAHHDKKLKTNIGGSYGNSEQTSCSSDDFLSRMRGSSYGPYLPDTGY  1279

Query  4008  DEALSKTAILETPGNAEMFFFPVDPHPVGNIGSNNSSMPWKVHPLEEDQLHDKAPNLELA  4187
             DEALSK  + E   +AE +FFPVDP+PV       SSMPW++H  + D+L D+ PNLELA
Sbjct  1280  DEALSKAPVPECSESAERYFFPVDPNPV-----KASSMPWQMHHPDNDRLSDRVPNLELA  1334

Query  4188  LGAKTKPLMSGIPSFLSGKVEKKIIE  4265
             LG ++     GIP FL GKV+KKII+
Sbjct  1335  LGGESNSQTRGIPPFLVGKVDKKIIQ  1360


 Score = 67.4 bits (163),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 47/85 (55%), Positives = 59/85 (69%), Gaps = 3/85 (4%)
 Frame = +3

Query  4191  GAKTKPLMSGIPSFLSGKVEKKIIEENTSDNAATSANK-EDVsaslslslsFPFPEKEH-  4364
             G +T P   GIPSFL GKV+KK+ ++++S   A    + EDVSASLSLSLSFPFPEKE  
Sbjct  1606  GGETHPPTPGIPSFLVGKVDKKVSQDHSSAKEAVGVKEVEDVSASLSLSLSFPFPEKEQQ  1665

Query  4365  -GTSSKPEQEDPRRRQANTSLLLFG  4436
              G+ S+ EQ  P  R++NT LL FG
Sbjct  1666  KGSVSQTEQAIPETRRSNTPLLFFG  1690



>ref|XP_006347601.1| PREDICTED: uncharacterized protein LOC102589655 isoform X2 [Solanum 
tuberosum]
Length=1725

 Score =   864 bits (2232),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 537/1166 (46%), Positives = 719/1166 (62%), Gaps = 70/1166 (6%)
 Frame = +3

Query  873   ASQIHQMeesddseivevdvkvCDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPE  1052
             A Q HQM+ES+DS+I E+DVKVCDICG  GRE LLAIC +CTDGAEHTYCM++ML+K+PE
Sbjct  260   ALQSHQMDESEDSDIEELDVKVCDICGDAGREDLLAICCKCTDGAEHTYCMREMLQKVPE  319

Query  1053  GDWLCEECKFDQEMKNEHVN-SGRVNEKEKTSPS-RRTTIAKSDHPLKMEQKTSDCWGDK  1226
             GDW+CEECKFD+EMKN   + S + +   K+ P+ ++  +  +   +K E K  D  GD 
Sbjct  320   GDWMCEECKFDEEMKNRKEDKSVKFDGNGKSYPTGKKIALGNTGLTIKTESKPPDFDGDI  379

Query  1227  AVEERSYLKTSGKRCTDDSEVSSPTKRQRLEL--RSPTAQIPNRVTSLSRESSFKNLERG  1400
             A    S  KT GKRC DD+EVSS  K+Q LE    SP    PN++ +LSRESSFKN ++G
Sbjct  380   A----SDPKTPGKRCMDDTEVSSAAKKQALEPVPASPKTLSPNKLPALSRESSFKNSDKG  435

Query  1401  KVKPLNPFSSGSFAAKVPSSTGPQPQPPRGIFSKSNSFSSLIAKPKVKLVDEVFPAKQKL  1580
             K+K  N  SSG  +     + G + Q  RG FSKSNSFSSL AK KV LVDE FP KQKL
Sbjct  436   KLKSANLISSGGLSVHDTPAWGSRLQTSRGTFSKSNSFSSLAAKRKVLLVDESFPPKQKL  495

Query  1581  SRETAFIESKEVAVRSMGKSMSFKPTTASRSNCTESKVKMFSPKFSHDQDVKWLRHKKDR  1760
              RE+  +++KE + RSM KSMSF+  + SR+N +ESKVKM SP+FS  QD K     K+R
Sbjct  496   VRESTGLDAKESSTRSMSKSMSFRSISTSRNNVSESKVKMLSPRFSPAQD-KAQMQTKER  554

Query  1761  SSFDRKNSLRSDRLAGGAISSPKSDNKPTPRGEPSSLSSLNTNRDYRALTSDNKPVTISN  1940
             + F+RKNS RS+R  G ++ S ++D +   RG+PS L S +  RD R    D+KP+++  
Sbjct  555   NQFERKNSFRSERSPGTSVPS-RTDQRSAFRGDPSPLPSSSNIRDSRTGQLDSKPMSLLK  613

Query  1941  STSGVAR----------EVLKQASVDGVSS----ANRVSSSEENPSQAIPKEDSSSSSCV  2078
             S+  VAR          E  KQ S   +S+    AN++SSS++ P Q+  ++DS  +S +
Sbjct  614   SSGAVARRTQDLSVLSDEAKKQTSHTSISTGAPAANKISSSDQRPDQSSARDDSLPNSYI  673

Query  2079  AERPSWSSNEVLPDGLSQSKESKAFGDKTRESSASRSKQNSTASGKIVSCQKCKGNGHLA  2258
             AERP+ ++ E   DGL Q  ESK  G++ +ESS  R K   T + K + CQKCKG+GHL 
Sbjct  674   AERPTSNTGEGPSDGLPQPSESKNVGERIKESSGRRLKHTGTGT-KSLFCQKCKGSGHLT  732

Query  2259  QVCTADGPESSALG-SPFKSSREATNGPSDLKAAIEAARLRKPGICRKNRVADQSEDLSA  2435
               CT DG E  A   S  ++SREA NG S+LKAAIEAA L+KPG+C KNRV DQS+DL+ 
Sbjct  733   DSCTVDGSELVASDVSAVRNSREAPNGTSNLKAAIEAAMLKKPGVCWKNRVVDQSDDLAV  792

Query  2436  SNMKSEIASQDQMLSSTVRRNVNGAEE-----------AQKQETANNAKQLGII-AEASA  2579
             SN  +E  + D +  S+ RR ++  E+           + KQE  +  +QL ++ AEA  
Sbjct  793   SNTNAETTAPDVLCGSSSRRMLSSNEDGHGVSLNSMTVSHKQEIGS-LRQLSVLPAEALT  851

Query  2580  RTRNAGHVVFSDVKHSVIDMERQTLVSMPVILKTAIPEYQYIWQGGFEVQKSGKAFNLYD  2759
                N   ++ SD K S++D+ R +  +M ++ KTA PE++YIWQG FEVQKSG++ +L D
Sbjct  852   GAGNLVPILLSDGKSSLVDLHRYSQAAMSILSKTAFPEHEYIWQGAFEVQKSGRSLDLCD  911

Query  2760  GIQAHLSSCASPKVLDAVNKFPRKVILNEVPRLSSWPMQFKECGVSEDNVALFFFAKDIG  2939
             GIQAHLSSCASP VLDAV+KFP+KV+ NEV RLS+WP+QF+E GV EDN+ALFFFA+DIG
Sbjct  912   GIQAHLSSCASPNVLDAVHKFPQKVLFNEVSRLSTWPIQFQEYGVKEDNIALFFFAQDIG  971

Query  2940  SYEKSYKVLLGDMVKHDLALQGNIGDIELLIFPSNQLPEKFQRWNLMFFLWGVFRGKRAN  3119
             SYE+ YK+LL +M+++D AL+ N+  +ELLIFPSN+LPEK QRWN+MFFLWGVFR K+  
Sbjct  972   SYERCYKILLENMIRNDTALKANLQGVELLIFPSNRLPEKSQRWNMMFFLWGVFRVKK--  1029

Query  3120  SLQNFPGAEKPLIQDIPTPATSLPENMFTPVPKLNSARGSAATNTEMSAVKESESASLHK  3299
              +Q   G    + QD P      PEN+    P  N   G+ + + E++A K+S       
Sbjct  1030  -VQATTGKPSLVPQDTPKLIMPFPENIHCLGPVDNVTSGNVSMDGEVTASKKSSCP----  1084

Query  3300  IVNGNCSIQSSSQVSRDKCSRINAEQNDKLDSSSMQNSEPKLGPDRRYFGV--PLGEAVH  3473
             +VNGN   +  +QV +   +    E  +    SS+  S     P+RR FG+   +G+A  
Sbjct  1085  LVNGNVDSK-GAQVCKGDSADTKVEHLEPRSMSSVPASHMDFTPERRQFGIFQVVGDAGR  1143

Query  3474  SSVQTAERVSSPNTSRPMSVHWAAPLDGEKLSMLSDETPT-MQEATSVGSTTKNLCGKDD  3650
                   E +SS           +AP    + S   DE    MQ+ TSVGS  K  C  + 
Sbjct  1144  EC--KVEVLSS-----------SAPAANSQPSRSVDEAAGHMQDKTSVGSMEKGFCSTNG  1190

Query  3651  VKIGRICLDNVSTEEATPLARHTSMEQTLNVISSFGVNPKKRSHSAETVLQsasssgtsq  3830
              K      D    EEA+  +   + E T  V++S   N  KR  S ETV+QSA S     
Sbjct  1191  RKFEINLEDEYKDEEASETSGSAATEPTWKVLNSDVSNHLKRPRSVETVMQSADSGVNRA  1250

Query  3831  afssysNDDILVEEFCH-KRVKLNSDRSYGCNDQTSCSKDGFLSEMGGTASQLSRQKNER  4007
                   N D+LVEE  H K++K N   SYG ++QTSCS D FLS M G++          
Sbjct  1251  TRLFNDN-DLLVEEAHHDKKLKTNIGGSYGNSEQTSCSSDDFLSRMRGSSYGPYLPDTGY  1309

Query  4008  DEALSKTAILETPGNAEMFFFPVDPHPVGNIGSNNSSMPWKVHPLEEDQLHDKAPNLELA  4187
             DEALSK  + E   +AE +FFPVDP+PV       SSMPW++H  + D+L D+ PNLELA
Sbjct  1310  DEALSKAPVPECSESAERYFFPVDPNPV-----KASSMPWQMHHPDNDRLSDRVPNLELA  1364

Query  4188  LGAKTKPLMSGIPSFLSGKVEKKIIE  4265
             LG ++     GIP FL GKV+KKII+
Sbjct  1365  LGGESNSQTRGIPPFLVGKVDKKIIQ  1390


 Score = 67.4 bits (163),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 47/85 (55%), Positives = 59/85 (69%), Gaps = 3/85 (4%)
 Frame = +3

Query  4191  GAKTKPLMSGIPSFLSGKVEKKIIEENTSDNAATSANK-EDVsaslslslsFPFPEKEH-  4364
             G +T P   GIPSFL GKV+KK+ ++++S   A    + EDVSASLSLSLSFPFPEKE  
Sbjct  1636  GGETHPPTPGIPSFLVGKVDKKVSQDHSSAKEAVGVKEVEDVSASLSLSLSFPFPEKEQQ  1695

Query  4365  -GTSSKPEQEDPRRRQANTSLLLFG  4436
              G+ S+ EQ  P  R++NT LL FG
Sbjct  1696  KGSVSQTEQAIPETRRSNTPLLFFG  1720



>ref|XP_006347600.1| PREDICTED: uncharacterized protein LOC102589655 isoform X1 [Solanum 
tuberosum]
Length=1728

 Score =   863 bits (2231),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 537/1166 (46%), Positives = 719/1166 (62%), Gaps = 70/1166 (6%)
 Frame = +3

Query  873   ASQIHQMeesddseivevdvkvCDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPE  1052
             A Q HQM+ES+DS+I E+DVKVCDICG  GRE LLAIC +CTDGAEHTYCM++ML+K+PE
Sbjct  263   ALQSHQMDESEDSDIEELDVKVCDICGDAGREDLLAICCKCTDGAEHTYCMREMLQKVPE  322

Query  1053  GDWLCEECKFDQEMKNEHVN-SGRVNEKEKTSPS-RRTTIAKSDHPLKMEQKTSDCWGDK  1226
             GDW+CEECKFD+EMKN   + S + +   K+ P+ ++  +  +   +K E K  D  GD 
Sbjct  323   GDWMCEECKFDEEMKNRKEDKSVKFDGNGKSYPTGKKIALGNTGLTIKTESKPPDFDGDI  382

Query  1227  AVEERSYLKTSGKRCTDDSEVSSPTKRQRLEL--RSPTAQIPNRVTSLSRESSFKNLERG  1400
             A    S  KT GKRC DD+EVSS  K+Q LE    SP    PN++ +LSRESSFKN ++G
Sbjct  383   A----SDPKTPGKRCMDDTEVSSAAKKQALEPVPASPKTLSPNKLPALSRESSFKNSDKG  438

Query  1401  KVKPLNPFSSGSFAAKVPSSTGPQPQPPRGIFSKSNSFSSLIAKPKVKLVDEVFPAKQKL  1580
             K+K  N  SSG  +     + G + Q  RG FSKSNSFSSL AK KV LVDE FP KQKL
Sbjct  439   KLKSANLISSGGLSVHDTPAWGSRLQTSRGTFSKSNSFSSLAAKRKVLLVDESFPPKQKL  498

Query  1581  SRETAFIESKEVAVRSMGKSMSFKPTTASRSNCTESKVKMFSPKFSHDQDVKWLRHKKDR  1760
              RE+  +++KE + RSM KSMSF+  + SR+N +ESKVKM SP+FS  QD K     K+R
Sbjct  499   VRESTGLDAKESSTRSMSKSMSFRSISTSRNNVSESKVKMLSPRFSPAQD-KAQMQTKER  557

Query  1761  SSFDRKNSLRSDRLAGGAISSPKSDNKPTPRGEPSSLSSLNTNRDYRALTSDNKPVTISN  1940
             + F+RKNS RS+R  G ++ S ++D +   RG+PS L S +  RD R    D+KP+++  
Sbjct  558   NQFERKNSFRSERSPGTSVPS-RTDQRSAFRGDPSPLPSSSNIRDSRTGQLDSKPMSLLK  616

Query  1941  STSGVAR----------EVLKQASVDGVSS----ANRVSSSEENPSQAIPKEDSSSSSCV  2078
             S+  VAR          E  KQ S   +S+    AN++SSS++ P Q+  ++DS  +S +
Sbjct  617   SSGAVARRTQDLSVLSDEAKKQTSHTSISTGAPAANKISSSDQRPDQSSARDDSLPNSYI  676

Query  2079  AERPSWSSNEVLPDGLSQSKESKAFGDKTRESSASRSKQNSTASGKIVSCQKCKGNGHLA  2258
             AERP+ ++ E   DGL Q  ESK  G++ +ESS  R K   T + K + CQKCKG+GHL 
Sbjct  677   AERPTSNTGEGPSDGLPQPSESKNVGERIKESSGRRLKHTGTGT-KSLFCQKCKGSGHLT  735

Query  2259  QVCTADGPESSALG-SPFKSSREATNGPSDLKAAIEAARLRKPGICRKNRVADQSEDLSA  2435
               CT DG E  A   S  ++SREA NG S+LKAAIEAA L+KPG+C KNRV DQS+DL+ 
Sbjct  736   DSCTVDGSELVASDVSAVRNSREAPNGTSNLKAAIEAAMLKKPGVCWKNRVVDQSDDLAV  795

Query  2436  SNMKSEIASQDQMLSSTVRRNVNGAEE-----------AQKQETANNAKQLGII-AEASA  2579
             SN  +E  + D +  S+ RR ++  E+           + KQE  +  +QL ++ AEA  
Sbjct  796   SNTNAETTAPDVLCGSSSRRMLSSNEDGHGVSLNSMTVSHKQEIGS-LRQLSVLPAEALT  854

Query  2580  RTRNAGHVVFSDVKHSVIDMERQTLVSMPVILKTAIPEYQYIWQGGFEVQKSGKAFNLYD  2759
                N   ++ SD K S++D+ R +  +M ++ KTA PE++YIWQG FEVQKSG++ +L D
Sbjct  855   GAGNLVPILLSDGKSSLVDLHRYSQAAMSILSKTAFPEHEYIWQGAFEVQKSGRSLDLCD  914

Query  2760  GIQAHLSSCASPKVLDAVNKFPRKVILNEVPRLSSWPMQFKECGVSEDNVALFFFAKDIG  2939
             GIQAHLSSCASP VLDAV+KFP+KV+ NEV RLS+WP+QF+E GV EDN+ALFFFA+DIG
Sbjct  915   GIQAHLSSCASPNVLDAVHKFPQKVLFNEVSRLSTWPIQFQEYGVKEDNIALFFFAQDIG  974

Query  2940  SYEKSYKVLLGDMVKHDLALQGNIGDIELLIFPSNQLPEKFQRWNLMFFLWGVFRGKRAN  3119
             SYE+ YK+LL +M+++D AL+ N+  +ELLIFPSN+LPEK QRWN+MFFLWGVFR K+  
Sbjct  975   SYERCYKILLENMIRNDTALKANLQGVELLIFPSNRLPEKSQRWNMMFFLWGVFRVKK--  1032

Query  3120  SLQNFPGAEKPLIQDIPTPATSLPENMFTPVPKLNSARGSAATNTEMSAVKESESASLHK  3299
              +Q   G    + QD P      PEN+    P  N   G+ + + E++A K+S       
Sbjct  1033  -VQATTGKPSLVPQDTPKLIMPFPENIHCLGPVDNVTSGNVSMDGEVTASKKSSCP----  1087

Query  3300  IVNGNCSIQSSSQVSRDKCSRINAEQNDKLDSSSMQNSEPKLGPDRRYFGV--PLGEAVH  3473
             +VNGN   +  +QV +   +    E  +    SS+  S     P+RR FG+   +G+A  
Sbjct  1088  LVNGNVDSK-GAQVCKGDSADTKVEHLEPRSMSSVPASHMDFTPERRQFGIFQVVGDAGR  1146

Query  3474  SSVQTAERVSSPNTSRPMSVHWAAPLDGEKLSMLSDETPT-MQEATSVGSTTKNLCGKDD  3650
                   E +SS           +AP    + S   DE    MQ+ TSVGS  K  C  + 
Sbjct  1147  EC--KVEVLSS-----------SAPAANSQPSRSVDEAAGHMQDKTSVGSMEKGFCSTNG  1193

Query  3651  VKIGRICLDNVSTEEATPLARHTSMEQTLNVISSFGVNPKKRSHSAETVLQsasssgtsq  3830
              K      D    EEA+  +   + E T  V++S   N  KR  S ETV+QSA S     
Sbjct  1194  RKFEINLEDEYKDEEASETSGSAATEPTWKVLNSDVSNHLKRPRSVETVMQSADSGVNRA  1253

Query  3831  afssysNDDILVEEFCH-KRVKLNSDRSYGCNDQTSCSKDGFLSEMGGTASQLSRQKNER  4007
                   N D+LVEE  H K++K N   SYG ++QTSCS D FLS M G++          
Sbjct  1254  TRLFNDN-DLLVEEAHHDKKLKTNIGGSYGNSEQTSCSSDDFLSRMRGSSYGPYLPDTGY  1312

Query  4008  DEALSKTAILETPGNAEMFFFPVDPHPVGNIGSNNSSMPWKVHPLEEDQLHDKAPNLELA  4187
             DEALSK  + E   +AE +FFPVDP+PV       SSMPW++H  + D+L D+ PNLELA
Sbjct  1313  DEALSKAPVPECSESAERYFFPVDPNPV-----KASSMPWQMHHPDNDRLSDRVPNLELA  1367

Query  4188  LGAKTKPLMSGIPSFLSGKVEKKIIE  4265
             LG ++     GIP FL GKV+KKII+
Sbjct  1368  LGGESNSQTRGIPPFLVGKVDKKIIQ  1393


 Score = 67.4 bits (163),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 47/85 (55%), Positives = 59/85 (69%), Gaps = 3/85 (4%)
 Frame = +3

Query  4191  GAKTKPLMSGIPSFLSGKVEKKIIEENTSDNAATSANK-EDVsaslslslsFPFPEKEH-  4364
             G +T P   GIPSFL GKV+KK+ ++++S   A    + EDVSASLSLSLSFPFPEKE  
Sbjct  1639  GGETHPPTPGIPSFLVGKVDKKVSQDHSSAKEAVGVKEVEDVSASLSLSLSFPFPEKEQQ  1698

Query  4365  -GTSSKPEQEDPRRRQANTSLLLFG  4436
              G+ S+ EQ  P  R++NT LL FG
Sbjct  1699  KGSVSQTEQAIPETRRSNTPLLFFG  1723



>ref|XP_010318293.1| PREDICTED: uncharacterized protein LOC101244850 isoform X3 [Solanum 
lycopersicum]
Length=1495

 Score =   822 bits (2124),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 509/1151 (44%), Positives = 702/1151 (61%), Gaps = 57/1151 (5%)
 Frame = +3

Query  873   ASQIHQMeesddseivevdvkvCDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPE  1052
             A Q HQM+ES++S++ E+DVKVCDICG  GRE LLAIC +CTDGAEHTYCM++ML+K+PE
Sbjct  263   ALQSHQMDESEESDVEELDVKVCDICGDAGREDLLAICCKCTDGAEHTYCMREMLQKVPE  322

Query  1053  GDWLCEECKFDQEMKNEHVN-SGRVNEKEKTSPS-RRTTIAKSDHPLKMEQKTSDCWGDK  1226
             GDW+CEECKFD+EM+N   + S + +   K+ P+ ++  +  +   +K E K  D  GD 
Sbjct  323   GDWMCEECKFDEEMRNRKEDKSVKFDGNGKSYPTGQKIAVGNTGLTIKTESKPPDFDGDI  382

Query  1227  AVEERSYLKTSGKRCTDDSEVSSPTKRQRLEL--RSPTAQIPNRVTSLSRESSFKNLERG  1400
             A +     KT GKR  DD+E S+  K+Q LE    SP    PN++ +LSRESSFKN ++G
Sbjct  383   ASDP----KTPGKRRMDDTEYSA-AKKQALEPVPASPKTLSPNKLPALSRESSFKNSDKG  437

Query  1401  KVKPLNPFSSGSFAAKVPSSTGPQPQPPRGIFSKSNSFSSLIAKPKVKLVDEVFPAKQKL  1580
             K+K  N  SSG  +     + G + Q  RG FSKSNSFSSL AK KV LVDE F  KQKL
Sbjct  438   KLKSANQISSGGLSVHDTPAWGSRLQTSRGTFSKSNSFSSLAAKRKVLLVDEGFLPKQKL  497

Query  1581  SRETAFIESKEVAVRSMGKSMSFKPTTASRSNCTESKVKMFSPKFSHDQDVKWLRHKKDR  1760
              RE+  ++ KE + RSM KSMSF+  + SR+N +ESKVKM SPKF   QD K     K+R
Sbjct  498   VRESTGLDVKESSTRSMNKSMSFRSISTSRNNVSESKVKMLSPKFPPAQD-KGQMQTKER  556

Query  1761  SSFDRKNSLRSDRLAGGAISSPKSDNKPTPRGEPSSLSSLNTNRDYRALTSDNKPVTISN  1940
             + F+RKNS RS+R  G ++ S ++D +   RG+PS L S +  RD R    D+KP+++  
Sbjct  557   NQFERKNSFRSERSPGTSVPS-RTDQRSAFRGDPSPLPSSSNIRDTRTGQLDSKPMSLLK  615

Query  1941  STSGVAREVLKQASVDGVSSANRVSSSEENPSQAIPKEDSSSSSCVAERPSWSSNEVLPD  2120
             S+  VAR     +   G  + N++SSS++ P Q+  ++DS  +S +AERP+ ++ E L D
Sbjct  616   SSGAVARRTQDISVHSGAPATNKISSSDQRPDQSSARDDSLPNSYIAERPTSNTGEGLSD  675

Query  2121  GLSQSKESKAFGDKTRESSASRSKQNSTASGKIVSCQKCKGNGHLAQVCTADGPE-SSAL  2297
             GL Q  ESK  G++T+ESS  R K   T + K + CQKCKG+GHL   CT +  E  S+ 
Sbjct  676   GLPQPSESKNVGERTKESSGRRLKHTGTGT-KSLFCQKCKGSGHLTDGCTVEVSELFSSD  734

Query  2298  GSPFKSSREATNGPSDLKAAIEAARLRKPGICRKNRVADQSEDLSASNMKSEIASQDQML  2477
              S  ++SREA NG S+LKAAIEAA L+KPG+C KNRV DQS+DL+ SN  +E  + D + 
Sbjct  735   VSAVRNSREAPNGTSNLKAAIEAAMLKKPGVCWKNRVVDQSDDLAVSNTNAETTAPDPLC  794

Query  2478  SSTVRRNVNGAEE-----------AQKQETANNAKQLGII-AEASARTRNAGHVVFSDVK  2621
              S+ RR ++  E+           + KQE  +  +QL ++ AEA     N   ++ SD K
Sbjct  795   GSSSRRMLSSNEDGHGVPLNSITGSHKQEIGS-LRQLSVLPAEALTGAGNLVPILLSDGK  853

Query  2622  HSVIDMERQTLVSMPVILKTAIPEYQYIWQGGFEVQKSGKAFNLYDGIQAHLSSCASPKV  2801
              S++D+ R +  +M ++ KTA PE++YIWQG FEVQKSG+  +L DGIQAHLSSCASP V
Sbjct  854   SSLVDLHRYSQAAMSILSKTAFPEHEYIWQGAFEVQKSGRTLDLCDGIQAHLSSCASPNV  913

Query  2802  LDAVNKFPRKVILNEVPRLSSWPMQFKECGVSEDNVALFFFAKDIGSYEKSYKVLLGDMV  2981
             LDAV+KFP+KV+ NEV R S+WP+QF+E GV EDN+ALFFFA+D+GSYE+ YK+LL +M+
Sbjct  914   LDAVHKFPQKVLFNEVSRSSTWPIQFQEYGVKEDNIALFFFAQDVGSYERCYKILLENMI  973

Query  2982  KHDLALQGNIGDIELLIFPSNQLPEKFQRWNLMFFLWGVFRGKRANSLQNFPGAEKPLIQ  3161
             ++D AL+ N+  +ELLIFPSN+LPEK QRWN+MFFLWGVFR K+   +Q   G    + Q
Sbjct  974   RNDTALKANLQGVELLIFPSNRLPEKSQRWNMMFFLWGVFRVKK---VQATTGKPSLVPQ  1030

Query  3162  DIPTPATSLPENMFTPVPKLNSARGSAATNTEMSAVKESESASLHKIVNGNCSIQSSSQV  3341
             D P      PEN+    P  N   G+   + E++  K+S       +VNGN     ++QV
Sbjct  1031  DTPKLIMPFPENIHCLGPVDNVTSGNVPMDVEVTTPKKSSCP----LVNGNVD-SIAAQV  1085

Query  3342  SRDKCSRINAEQNDKLDSSSMQNSEPKLGPDRRYFGV--PLGEAVHSSVQTAERVSSPNT  3515
              +   +  N E  +    SS+  S   + P+RR FG+   +G+A         +V  P+ 
Sbjct  1086  CKGDSAHTNLEHLEPRSMSSVPVSHMDVAPERRQFGIFQVVGDAGREC-----KVEVPSN  1140

Query  3516  SRPMSVHWAAPLDGEKLSMLSDETPTMQEATSVGSTTKNLCGKDDVKIGRICLDNVSTEE  3695
             S P +       + +    +++    MQE TSVGS  K  C  +  K      D    EE
Sbjct  1141  SAPAA-------NSQPSRSVNEAAGHMQEKTSVGSMEKGFCSTNGRKFEINLEDEYKDEE  1193

Query  3696  ATPLARHTSMEQTLNVISSFGVNPKKRSHSAETVLQsasssgtsqafssysNDDILVEEF  3875
             A+  +   + E T   +++   N  KR  S +TV+Q A S           ND   VEE 
Sbjct  1194  ASETSGSAATEPTRKELNNDVSNHLKRPRSVDTVMQYADSGVNRATRLFNDNDQ--VEEA  1251

Query  3876  CH-KRVKLNSDRSYGCNDQTSCSKDGFLSEMGGTASQLSRQKNERDEALSKTAILETPGN  4052
              H K++K +   SYG ++QTS S D FLS M G++          DE LSK  + E   +
Sbjct  1252  HHDKKLKTSIGGSYGNSEQTSSSDD-FLSRMRGSSYGPYLPDTGYDEVLSKAPVPECTES  1310

Query  4053  AEMFFFPVDPHPVGNIGSNNSSMPWKVHPLEEDQLHDKAPNLELALGAKTKPLMSGIPSF  4232
             AE +FFPVDP+P        SS PW++H  + D+L D+ PNLELALG ++     GIP F
Sbjct  1311  AERYFFPVDPNP-----GKASSTPWQMHHPDNDRLSDRVPNLELALGGESNSQTRGIPPF  1365

Query  4233  LSGKVEKKIIE  4265
             L GKV+KKII+
Sbjct  1366  LVGKVDKKIIQ  1376



>ref|XP_010318298.1| PREDICTED: uncharacterized protein LOC101244850 isoform X6 [Solanum 
lycopersicum]
 ref|XP_010318299.1| PREDICTED: uncharacterized protein LOC101244850 isoform X6 [Solanum 
lycopersicum]
 ref|XP_010318300.1| PREDICTED: uncharacterized protein LOC101244850 isoform X6 [Solanum 
lycopersicum]
Length=1416

 Score =   817 bits (2111),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 513/1165 (44%), Positives = 705/1165 (61%), Gaps = 71/1165 (6%)
 Frame = +3

Query  873   ASQIHQMeesddseivevdvkvCDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPE  1052
             A Q HQM+ES++S++ E+DVKVCDICG  GRE LLAIC +CTDGAEHTYCM++ML+K+PE
Sbjct  170   ALQSHQMDESEESDVEELDVKVCDICGDAGREDLLAICCKCTDGAEHTYCMREMLQKVPE  229

Query  1053  GDWLCEECKFDQEMKNEHVN-SGRVNEKEKTSPS-RRTTIAKSDHPLKMEQKTSDCWGDK  1226
             GDW+CEECKFD+EM+N   + S + +   K+ P+ ++  +  +   +K E K  D  GD 
Sbjct  230   GDWMCEECKFDEEMRNRKEDKSVKFDGNGKSYPTGQKIAVGNTGLTIKTESKPPDFDGDI  289

Query  1227  AVEERSYLKTSGKRCTDDSEVSSPTKRQRLEL--RSPTAQIPNRVTSLSRESSFKNLERG  1400
             A    S  KT GKR  DD+E S+  K+Q LE    SP    PN++ +LSRESSFKN ++G
Sbjct  290   A----SDPKTPGKRRMDDTEYSA-AKKQALEPVPASPKTLSPNKLPALSRESSFKNSDKG  344

Query  1401  KVKPLNPFSSGSFAAKVPSSTGPQPQPPRGIFSKSNSFSSLIAKPKVKLVDEVFPAKQKL  1580
             K+K  N  SSG  +     + G + Q  RG FSKSNSFSSL AK KV LVDE F  KQKL
Sbjct  345   KLKSANQISSGGLSVHDTPAWGSRLQTSRGTFSKSNSFSSLAAKRKVLLVDEGFLPKQKL  404

Query  1581  SRETAFIESKEVAVRSMGKSMSFKPTTASRSNCTESKVKMFSPKFSHDQDVKWLRHKKDR  1760
              RE+  ++ KE + RSM KSMSF+  + SR+N +ESKVKM SPKF   QD K     K+R
Sbjct  405   VRESTGLDVKESSTRSMNKSMSFRSISTSRNNVSESKVKMLSPKFPPAQD-KGQMQTKER  463

Query  1761  SSFDRKNSLRSDRLAGGAISSPKSDNKPTPRGEPSSLSSLNTNRDYRALTSDNKPVTISN  1940
             + F+RKNS RS+R  G ++ S ++D +   RG+PS L S +  RD R    D+KP+++  
Sbjct  464   NQFERKNSFRSERSPGTSVPS-RTDQRSAFRGDPSPLPSSSNIRDTRTGQLDSKPMSLLK  522

Query  1941  STSGVAR----------EVLKQAS----VDGVSSANRVSSSEENPSQAIPKEDSSSSSCV  2078
             S+  VAR          E  K+ S      G  + N++SSS++ P Q+  ++DS  +S +
Sbjct  523   SSGAVARRTQDISVHSDEAKKKTSHTSMSTGAPATNKISSSDQRPDQSSARDDSLPNSYI  582

Query  2079  AERPSWSSNEVLPDGLSQSKESKAFGDKTRESSASRSKQNSTASGKIVSCQKCKGNGHLA  2258
             AERP+ ++ E L DGL Q  ESK  G++T+ESS  R K   T + K + CQKCKG+GHL 
Sbjct  583   AERPTSNTGEGLSDGLPQPSESKNVGERTKESSGRRLKHTGTGT-KSLFCQKCKGSGHLT  641

Query  2259  QVCTADGPE-SSALGSPFKSSREATNGPSDLKAAIEAARLRKPGICRKNRVADQSEDLSA  2435
               CT +  E  S+  S  ++SREA NG S+LKAAIEAA L+KPG+C KNRV DQS+DL+ 
Sbjct  642   DGCTVEVSELFSSDVSAVRNSREAPNGTSNLKAAIEAAMLKKPGVCWKNRVVDQSDDLAV  701

Query  2436  SNMKSEIASQDQMLSSTVRRNVNGAEE-----------AQKQETANNAKQLGII-AEASA  2579
             SN  +E  + D +  S+ RR ++  E+           + KQE  +  +QL ++ AEA  
Sbjct  702   SNTNAETTAPDPLCGSSSRRMLSSNEDGHGVPLNSITGSHKQEIGS-LRQLSVLPAEALT  760

Query  2580  RTRNAGHVVFSDVKHSVIDMERQTLVSMPVILKTAIPEYQYIWQGGFEVQKSGKAFNLYD  2759
                N   ++ SD K S++D+ R +  +M ++ KTA PE++YIWQG FEVQKSG+  +L D
Sbjct  761   GAGNLVPILLSDGKSSLVDLHRYSQAAMSILSKTAFPEHEYIWQGAFEVQKSGRTLDLCD  820

Query  2760  GIQAHLSSCASPKVLDAVNKFPRKVILNEVPRLSSWPMQFKECGVSEDNVALFFFAKDIG  2939
             GIQAHLSSCASP VLDAV+KFP+KV+ NEV R S+WP+QF+E GV EDN+ALFFFA+D+G
Sbjct  821   GIQAHLSSCASPNVLDAVHKFPQKVLFNEVSRSSTWPIQFQEYGVKEDNIALFFFAQDVG  880

Query  2940  SYEKSYKVLLGDMVKHDLALQGNIGDIELLIFPSNQLPEKFQRWNLMFFLWGVFRGKRAN  3119
             SYE+ YK+LL +M+++D AL+ N+  +ELLIFPSN+LPEK QRWN+MFFLWGVFR K+  
Sbjct  881   SYERCYKILLENMIRNDTALKANLQGVELLIFPSNRLPEKSQRWNMMFFLWGVFRVKK--  938

Query  3120  SLQNFPGAEKPLIQDIPTPATSLPENMFTPVPKLNSARGSAATNTEMSAVKESESASLHK  3299
              +Q   G    + QD P      PEN+    P  N   G+   + E++  K+S       
Sbjct  939   -VQATTGKPSLVPQDTPKLIMPFPENIHCLGPVDNVTSGNVPMDVEVTTPKKSSCP----  993

Query  3300  IVNGNCSIQSSSQVSRDKCSRINAEQNDKLDSSSMQNSEPKLGPDRRYFGV--PLGEAVH  3473
             +VNGN     ++QV +   +  N E  +    SS+  S   + P+RR FG+   +G+A  
Sbjct  994   LVNGNVD-SIAAQVCKGDSAHTNLEHLEPRSMSSVPVSHMDVAPERRQFGIFQVVGDAGR  1052

Query  3474  SSVQTAERVSSPNTSRPMSVHWAAPLDGEKLSMLSDETPTMQEATSVGSTTKNLCGKDDV  3653
                    +V  P+ S P +       + +    +++    MQE TSVGS  K  C  +  
Sbjct  1053  EC-----KVEVPSNSAPAA-------NSQPSRSVNEAAGHMQEKTSVGSMEKGFCSTNGR  1100

Query  3654  KIGRICLDNVSTEEATPLARHTSMEQTLNVISSFGVNPKKRSHSAETVLQsasssgtsqa  3833
             K      D    EEA+  +   + E T   +++   N  KR  S +TV+Q A S      
Sbjct  1101  KFEINLEDEYKDEEASETSGSAATEPTRKELNNDVSNHLKRPRSVDTVMQYADSGVNRAT  1160

Query  3834  fssysNDDILVEEFCH-KRVKLNSDRSYGCNDQTSCSKDGFLSEMGGTASQLSRQKNERD  4010
                  ND   VEE  H K++K +   SYG ++QTS S D FLS M G++          D
Sbjct  1161  RLFNDNDQ--VEEAHHDKKLKTSIGGSYGNSEQTSSSDD-FLSRMRGSSYGPYLPDTGYD  1217

Query  4011  EALSKTAILETPGNAEMFFFPVDPHPVGNIGSNNSSMPWKVHPLEEDQLHDKAPNLELAL  4190
             E LSK  + E   +AE +FFPVDP+P        SS PW++H  + D+L D+ PNLELAL
Sbjct  1218  EVLSKAPVPECTESAERYFFPVDPNP-----GKASSTPWQMHHPDNDRLSDRVPNLELAL  1272

Query  4191  GAKTKPLMSGIPSFLSGKVEKKIIE  4265
             G ++     GIP FL GKV+KKII+
Sbjct  1273  GGESNSQTRGIPPFLVGKVDKKIIQ  1297



>ref|XP_004235271.1| PREDICTED: uncharacterized protein LOC101244850 isoform X5 [Solanum 
lycopersicum]
Length=1475

 Score =   817 bits (2111),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 513/1165 (44%), Positives = 705/1165 (61%), Gaps = 71/1165 (6%)
 Frame = +3

Query  873   ASQIHQMeesddseivevdvkvCDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPE  1052
             A Q HQM+ES++S++ E+DVKVCDICG  GRE LLAIC +CTDGAEHTYCM++ML+K+PE
Sbjct  229   ALQSHQMDESEESDVEELDVKVCDICGDAGREDLLAICCKCTDGAEHTYCMREMLQKVPE  288

Query  1053  GDWLCEECKFDQEMKNEHVN-SGRVNEKEKTSPS-RRTTIAKSDHPLKMEQKTSDCWGDK  1226
             GDW+CEECKFD+EM+N   + S + +   K+ P+ ++  +  +   +K E K  D  GD 
Sbjct  289   GDWMCEECKFDEEMRNRKEDKSVKFDGNGKSYPTGQKIAVGNTGLTIKTESKPPDFDGDI  348

Query  1227  AVEERSYLKTSGKRCTDDSEVSSPTKRQRLEL--RSPTAQIPNRVTSLSRESSFKNLERG  1400
             A    S  KT GKR  DD+E S+  K+Q LE    SP    PN++ +LSRESSFKN ++G
Sbjct  349   A----SDPKTPGKRRMDDTEYSA-AKKQALEPVPASPKTLSPNKLPALSRESSFKNSDKG  403

Query  1401  KVKPLNPFSSGSFAAKVPSSTGPQPQPPRGIFSKSNSFSSLIAKPKVKLVDEVFPAKQKL  1580
             K+K  N  SSG  +     + G + Q  RG FSKSNSFSSL AK KV LVDE F  KQKL
Sbjct  404   KLKSANQISSGGLSVHDTPAWGSRLQTSRGTFSKSNSFSSLAAKRKVLLVDEGFLPKQKL  463

Query  1581  SRETAFIESKEVAVRSMGKSMSFKPTTASRSNCTESKVKMFSPKFSHDQDVKWLRHKKDR  1760
              RE+  ++ KE + RSM KSMSF+  + SR+N +ESKVKM SPKF   QD K     K+R
Sbjct  464   VRESTGLDVKESSTRSMNKSMSFRSISTSRNNVSESKVKMLSPKFPPAQD-KGQMQTKER  522

Query  1761  SSFDRKNSLRSDRLAGGAISSPKSDNKPTPRGEPSSLSSLNTNRDYRALTSDNKPVTISN  1940
             + F+RKNS RS+R  G ++ S ++D +   RG+PS L S +  RD R    D+KP+++  
Sbjct  523   NQFERKNSFRSERSPGTSVPS-RTDQRSAFRGDPSPLPSSSNIRDTRTGQLDSKPMSLLK  581

Query  1941  STSGVAR----------EVLKQAS----VDGVSSANRVSSSEENPSQAIPKEDSSSSSCV  2078
             S+  VAR          E  K+ S      G  + N++SSS++ P Q+  ++DS  +S +
Sbjct  582   SSGAVARRTQDISVHSDEAKKKTSHTSMSTGAPATNKISSSDQRPDQSSARDDSLPNSYI  641

Query  2079  AERPSWSSNEVLPDGLSQSKESKAFGDKTRESSASRSKQNSTASGKIVSCQKCKGNGHLA  2258
             AERP+ ++ E L DGL Q  ESK  G++T+ESS  R K   T + K + CQKCKG+GHL 
Sbjct  642   AERPTSNTGEGLSDGLPQPSESKNVGERTKESSGRRLKHTGTGT-KSLFCQKCKGSGHLT  700

Query  2259  QVCTADGPE-SSALGSPFKSSREATNGPSDLKAAIEAARLRKPGICRKNRVADQSEDLSA  2435
               CT +  E  S+  S  ++SREA NG S+LKAAIEAA L+KPG+C KNRV DQS+DL+ 
Sbjct  701   DGCTVEVSELFSSDVSAVRNSREAPNGTSNLKAAIEAAMLKKPGVCWKNRVVDQSDDLAV  760

Query  2436  SNMKSEIASQDQMLSSTVRRNVNGAEE-----------AQKQETANNAKQLGII-AEASA  2579
             SN  +E  + D +  S+ RR ++  E+           + KQE  +  +QL ++ AEA  
Sbjct  761   SNTNAETTAPDPLCGSSSRRMLSSNEDGHGVPLNSITGSHKQEIGS-LRQLSVLPAEALT  819

Query  2580  RTRNAGHVVFSDVKHSVIDMERQTLVSMPVILKTAIPEYQYIWQGGFEVQKSGKAFNLYD  2759
                N   ++ SD K S++D+ R +  +M ++ KTA PE++YIWQG FEVQKSG+  +L D
Sbjct  820   GAGNLVPILLSDGKSSLVDLHRYSQAAMSILSKTAFPEHEYIWQGAFEVQKSGRTLDLCD  879

Query  2760  GIQAHLSSCASPKVLDAVNKFPRKVILNEVPRLSSWPMQFKECGVSEDNVALFFFAKDIG  2939
             GIQAHLSSCASP VLDAV+KFP+KV+ NEV R S+WP+QF+E GV EDN+ALFFFA+D+G
Sbjct  880   GIQAHLSSCASPNVLDAVHKFPQKVLFNEVSRSSTWPIQFQEYGVKEDNIALFFFAQDVG  939

Query  2940  SYEKSYKVLLGDMVKHDLALQGNIGDIELLIFPSNQLPEKFQRWNLMFFLWGVFRGKRAN  3119
             SYE+ YK+LL +M+++D AL+ N+  +ELLIFPSN+LPEK QRWN+MFFLWGVFR K+  
Sbjct  940   SYERCYKILLENMIRNDTALKANLQGVELLIFPSNRLPEKSQRWNMMFFLWGVFRVKK--  997

Query  3120  SLQNFPGAEKPLIQDIPTPATSLPENMFTPVPKLNSARGSAATNTEMSAVKESESASLHK  3299
              +Q   G    + QD P      PEN+    P  N   G+   + E++  K+S       
Sbjct  998   -VQATTGKPSLVPQDTPKLIMPFPENIHCLGPVDNVTSGNVPMDVEVTTPKKSSCP----  1052

Query  3300  IVNGNCSIQSSSQVSRDKCSRINAEQNDKLDSSSMQNSEPKLGPDRRYFGV--PLGEAVH  3473
             +VNGN     ++QV +   +  N E  +    SS+  S   + P+RR FG+   +G+A  
Sbjct  1053  LVNGNVD-SIAAQVCKGDSAHTNLEHLEPRSMSSVPVSHMDVAPERRQFGIFQVVGDAGR  1111

Query  3474  SSVQTAERVSSPNTSRPMSVHWAAPLDGEKLSMLSDETPTMQEATSVGSTTKNLCGKDDV  3653
                    +V  P+ S P +       + +    +++    MQE TSVGS  K  C  +  
Sbjct  1112  EC-----KVEVPSNSAPAA-------NSQPSRSVNEAAGHMQEKTSVGSMEKGFCSTNGR  1159

Query  3654  KIGRICLDNVSTEEATPLARHTSMEQTLNVISSFGVNPKKRSHSAETVLQsasssgtsqa  3833
             K      D    EEA+  +   + E T   +++   N  KR  S +TV+Q A S      
Sbjct  1160  KFEINLEDEYKDEEASETSGSAATEPTRKELNNDVSNHLKRPRSVDTVMQYADSGVNRAT  1219

Query  3834  fssysNDDILVEEFCH-KRVKLNSDRSYGCNDQTSCSKDGFLSEMGGTASQLSRQKNERD  4010
                  ND   VEE  H K++K +   SYG ++QTS S D FLS M G++          D
Sbjct  1220  RLFNDNDQ--VEEAHHDKKLKTSIGGSYGNSEQTSSSDD-FLSRMRGSSYGPYLPDTGYD  1276

Query  4011  EALSKTAILETPGNAEMFFFPVDPHPVGNIGSNNSSMPWKVHPLEEDQLHDKAPNLELAL  4190
             E LSK  + E   +AE +FFPVDP+P        SS PW++H  + D+L D+ PNLELAL
Sbjct  1277  EVLSKAPVPECTESAERYFFPVDPNP-----GKASSTPWQMHHPDNDRLSDRVPNLELAL  1331

Query  4191  GAKTKPLMSGIPSFLSGKVEKKIIE  4265
             G ++     GIP FL GKV+KKII+
Sbjct  1332  GGESNSQTRGIPPFLVGKVDKKIIQ  1356



>ref|XP_010318294.1| PREDICTED: uncharacterized protein LOC101244850 isoform X4 [Solanum 
lycopersicum]
 ref|XP_010318295.1| PREDICTED: uncharacterized protein LOC101244850 isoform X4 [Solanum 
lycopersicum]
 ref|XP_010318296.1| PREDICTED: uncharacterized protein LOC101244850 isoform X4 [Solanum 
lycopersicum]
 ref|XP_010318297.1| PREDICTED: uncharacterized protein LOC101244850 isoform X4 [Solanum 
lycopersicum]
Length=1476

 Score =   816 bits (2108),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 513/1165 (44%), Positives = 705/1165 (61%), Gaps = 71/1165 (6%)
 Frame = +3

Query  873   ASQIHQMeesddseivevdvkvCDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPE  1052
             A Q HQM+ES++S++ E+DVKVCDICG  GRE LLAIC +CTDGAEHTYCM++ML+K+PE
Sbjct  230   ALQSHQMDESEESDVEELDVKVCDICGDAGREDLLAICCKCTDGAEHTYCMREMLQKVPE  289

Query  1053  GDWLCEECKFDQEMKNEHVN-SGRVNEKEKTSPS-RRTTIAKSDHPLKMEQKTSDCWGDK  1226
             GDW+CEECKFD+EM+N   + S + +   K+ P+ ++  +  +   +K E K  D  GD 
Sbjct  290   GDWMCEECKFDEEMRNRKEDKSVKFDGNGKSYPTGQKIAVGNTGLTIKTESKPPDFDGDI  349

Query  1227  AVEERSYLKTSGKRCTDDSEVSSPTKRQRLEL--RSPTAQIPNRVTSLSRESSFKNLERG  1400
             A    S  KT GKR  DD+E S+  K+Q LE    SP    PN++ +LSRESSFKN ++G
Sbjct  350   A----SDPKTPGKRRMDDTEYSA-AKKQALEPVPASPKTLSPNKLPALSRESSFKNSDKG  404

Query  1401  KVKPLNPFSSGSFAAKVPSSTGPQPQPPRGIFSKSNSFSSLIAKPKVKLVDEVFPAKQKL  1580
             K+K  N  SSG  +     + G + Q  RG FSKSNSFSSL AK KV LVDE F  KQKL
Sbjct  405   KLKSANQISSGGLSVHDTPAWGSRLQTSRGTFSKSNSFSSLAAKRKVLLVDEGFLPKQKL  464

Query  1581  SRETAFIESKEVAVRSMGKSMSFKPTTASRSNCTESKVKMFSPKFSHDQDVKWLRHKKDR  1760
              RE+  ++ KE + RSM KSMSF+  + SR+N +ESKVKM SPKF   QD K     K+R
Sbjct  465   VRESTGLDVKESSTRSMNKSMSFRSISTSRNNVSESKVKMLSPKFPPAQD-KGQMQTKER  523

Query  1761  SSFDRKNSLRSDRLAGGAISSPKSDNKPTPRGEPSSLSSLNTNRDYRALTSDNKPVTISN  1940
             + F+RKNS RS+R  G ++ S ++D +   RG+PS L S +  RD R    D+KP+++  
Sbjct  524   NQFERKNSFRSERSPGTSVPS-RTDQRSAFRGDPSPLPSSSNIRDTRTGQLDSKPMSLLK  582

Query  1941  STSGVAR----------EVLKQAS----VDGVSSANRVSSSEENPSQAIPKEDSSSSSCV  2078
             S+  VAR          E  K+ S      G  + N++SSS++ P Q+  ++DS  +S +
Sbjct  583   SSGAVARRTQDISVHSDEAKKKTSHTSMSTGAPATNKISSSDQRPDQSSARDDSLPNSYI  642

Query  2079  AERPSWSSNEVLPDGLSQSKESKAFGDKTRESSASRSKQNSTASGKIVSCQKCKGNGHLA  2258
             AERP+ ++ E L DGL Q  ESK  G++T+ESS  R K   T + K + CQKCKG+GHL 
Sbjct  643   AERPTSNTGEGLSDGLPQPSESKNVGERTKESSGRRLKHTGTGT-KSLFCQKCKGSGHLT  701

Query  2259  QVCTADGPE-SSALGSPFKSSREATNGPSDLKAAIEAARLRKPGICRKNRVADQSEDLSA  2435
               CT +  E  S+  S  ++SREA NG S+LKAAIEAA L+KPG+C KNRV DQS+DL+ 
Sbjct  702   DGCTVEVSELFSSDVSAVRNSREAPNGTSNLKAAIEAAMLKKPGVCWKNRVVDQSDDLAV  761

Query  2436  SNMKSEIASQDQMLSSTVRRNVNGAEE-----------AQKQETANNAKQLGII-AEASA  2579
             SN  +E  + D +  S+ RR ++  E+           + KQE  +  +QL ++ AEA  
Sbjct  762   SNTNAETTAPDPLCGSSSRRMLSSNEDGHGVPLNSITGSHKQEIGS-LRQLSVLPAEALT  820

Query  2580  RTRNAGHVVFSDVKHSVIDMERQTLVSMPVILKTAIPEYQYIWQGGFEVQKSGKAFNLYD  2759
                N   ++ SD K S++D+ R +  +M ++ KTA PE++YIWQG FEVQKSG+  +L D
Sbjct  821   GAGNLVPILLSDGKSSLVDLHRYSQAAMSILSKTAFPEHEYIWQGAFEVQKSGRTLDLCD  880

Query  2760  GIQAHLSSCASPKVLDAVNKFPRKVILNEVPRLSSWPMQFKECGVSEDNVALFFFAKDIG  2939
             GIQAHLSSCASP VLDAV+KFP+KV+ NEV R S+WP+QF+E GV EDN+ALFFFA+D+G
Sbjct  881   GIQAHLSSCASPNVLDAVHKFPQKVLFNEVSRSSTWPIQFQEYGVKEDNIALFFFAQDVG  940

Query  2940  SYEKSYKVLLGDMVKHDLALQGNIGDIELLIFPSNQLPEKFQRWNLMFFLWGVFRGKRAN  3119
             SYE+ YK+LL +M+++D AL+ N+  +ELLIFPSN+LPEK QRWN+MFFLWGVFR K+  
Sbjct  941   SYERCYKILLENMIRNDTALKANLQGVELLIFPSNRLPEKSQRWNMMFFLWGVFRVKK--  998

Query  3120  SLQNFPGAEKPLIQDIPTPATSLPENMFTPVPKLNSARGSAATNTEMSAVKESESASLHK  3299
              +Q   G    + QD P      PEN+    P  N   G+   + E++  K+S       
Sbjct  999   -VQATTGKPSLVPQDTPKLIMPFPENIHCLGPVDNVTSGNVPMDVEVTTPKKSSCP----  1053

Query  3300  IVNGNCSIQSSSQVSRDKCSRINAEQNDKLDSSSMQNSEPKLGPDRRYFGV--PLGEAVH  3473
             +VNGN     ++QV +   +  N E  +    SS+  S   + P+RR FG+   +G+A  
Sbjct  1054  LVNGNVD-SIAAQVCKGDSAHTNLEHLEPRSMSSVPVSHMDVAPERRQFGIFQVVGDAGR  1112

Query  3474  SSVQTAERVSSPNTSRPMSVHWAAPLDGEKLSMLSDETPTMQEATSVGSTTKNLCGKDDV  3653
                    +V  P+ S P +       + +    +++    MQE TSVGS  K  C  +  
Sbjct  1113  EC-----KVEVPSNSAPAA-------NSQPSRSVNEAAGHMQEKTSVGSMEKGFCSTNGR  1160

Query  3654  KIGRICLDNVSTEEATPLARHTSMEQTLNVISSFGVNPKKRSHSAETVLQsasssgtsqa  3833
             K      D    EEA+  +   + E T   +++   N  KR  S +TV+Q A S      
Sbjct  1161  KFEINLEDEYKDEEASETSGSAATEPTRKELNNDVSNHLKRPRSVDTVMQYADSGVNRAT  1220

Query  3834  fssysNDDILVEEFCH-KRVKLNSDRSYGCNDQTSCSKDGFLSEMGGTASQLSRQKNERD  4010
                  ND   VEE  H K++K +   SYG ++QTS S D FLS M G++          D
Sbjct  1221  RLFNDNDQ--VEEAHHDKKLKTSIGGSYGNSEQTSSSDD-FLSRMRGSSYGPYLPDTGYD  1277

Query  4011  EALSKTAILETPGNAEMFFFPVDPHPVGNIGSNNSSMPWKVHPLEEDQLHDKAPNLELAL  4190
             E LSK  + E   +AE +FFPVDP+P        SS PW++H  + D+L D+ PNLELAL
Sbjct  1278  EVLSKAPVPECTESAERYFFPVDPNP-----GKASSTPWQMHHPDNDRLSDRVPNLELAL  1332

Query  4191  GAKTKPLMSGIPSFLSGKVEKKIIE  4265
             G ++     GIP FL GKV+KKII+
Sbjct  1333  GGESNSQTRGIPPFLVGKVDKKIIQ  1357



>ref|XP_010318292.1| PREDICTED: uncharacterized protein LOC101244850 isoform X2 [Solanum 
lycopersicum]
Length=1506

 Score =   816 bits (2109),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 512/1165 (44%), Positives = 705/1165 (61%), Gaps = 71/1165 (6%)
 Frame = +3

Query  873   ASQIHQMeesddseivevdvkvCDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPE  1052
             A Q HQM+ES++S++ E+DVKVCDICG  GRE LLAIC +CTDGAEHTYCM++ML+K+PE
Sbjct  260   ALQSHQMDESEESDVEELDVKVCDICGDAGREDLLAICCKCTDGAEHTYCMREMLQKVPE  319

Query  1053  GDWLCEECKFDQEMKNEHVN-SGRVNEKEKTSPS-RRTTIAKSDHPLKMEQKTSDCWGDK  1226
             GDW+CEECKFD+EM+N   + S + +   K+ P+ ++  +  +   +K E K  D  GD 
Sbjct  320   GDWMCEECKFDEEMRNRKEDKSVKFDGNGKSYPTGQKIAVGNTGLTIKTESKPPDFDGDI  379

Query  1227  AVEERSYLKTSGKRCTDDSEVSSPTKRQRLEL--RSPTAQIPNRVTSLSRESSFKNLERG  1400
             A +     KT GKR  DD+E S+  K+Q LE    SP    PN++ +LSRESSFKN ++G
Sbjct  380   ASDP----KTPGKRRMDDTEYSA-AKKQALEPVPASPKTLSPNKLPALSRESSFKNSDKG  434

Query  1401  KVKPLNPFSSGSFAAKVPSSTGPQPQPPRGIFSKSNSFSSLIAKPKVKLVDEVFPAKQKL  1580
             K+K  N  SSG  +     + G + Q  RG FSKSNSFSSL AK KV LVDE F  KQKL
Sbjct  435   KLKSANQISSGGLSVHDTPAWGSRLQTSRGTFSKSNSFSSLAAKRKVLLVDEGFLPKQKL  494

Query  1581  SRETAFIESKEVAVRSMGKSMSFKPTTASRSNCTESKVKMFSPKFSHDQDVKWLRHKKDR  1760
              RE+  ++ KE + RSM KSMSF+  + SR+N +ESKVKM SPKF   QD K     K+R
Sbjct  495   VRESTGLDVKESSTRSMNKSMSFRSISTSRNNVSESKVKMLSPKFPPAQD-KGQMQTKER  553

Query  1761  SSFDRKNSLRSDRLAGGAISSPKSDNKPTPRGEPSSLSSLNTNRDYRALTSDNKPVTISN  1940
             + F+RKNS RS+R  G ++ S ++D +   RG+PS L S +  RD R    D+KP+++  
Sbjct  554   NQFERKNSFRSERSPGTSVPS-RTDQRSAFRGDPSPLPSSSNIRDTRTGQLDSKPMSLLK  612

Query  1941  STSGVAR----------EVLKQAS----VDGVSSANRVSSSEENPSQAIPKEDSSSSSCV  2078
             S+  VAR          E  K+ S      G  + N++SSS++ P Q+  ++DS  +S +
Sbjct  613   SSGAVARRTQDISVHSDEAKKKTSHTSMSTGAPATNKISSSDQRPDQSSARDDSLPNSYI  672

Query  2079  AERPSWSSNEVLPDGLSQSKESKAFGDKTRESSASRSKQNSTASGKIVSCQKCKGNGHLA  2258
             AERP+ ++ E L DGL Q  ESK  G++T+ESS  R K   T + K + CQKCKG+GHL 
Sbjct  673   AERPTSNTGEGLSDGLPQPSESKNVGERTKESSGRRLKHTGTGT-KSLFCQKCKGSGHLT  731

Query  2259  QVCTADGPE-SSALGSPFKSSREATNGPSDLKAAIEAARLRKPGICRKNRVADQSEDLSA  2435
               CT +  E  S+  S  ++SREA NG S+LKAAIEAA L+KPG+C KNRV DQS+DL+ 
Sbjct  732   DGCTVEVSELFSSDVSAVRNSREAPNGTSNLKAAIEAAMLKKPGVCWKNRVVDQSDDLAV  791

Query  2436  SNMKSEIASQDQMLSSTVRRNVNGAEE-----------AQKQETANNAKQLGII-AEASA  2579
             SN  +E  + D +  S+ RR ++  E+           + KQE  +  +QL ++ AEA  
Sbjct  792   SNTNAETTAPDPLCGSSSRRMLSSNEDGHGVPLNSITGSHKQEIGS-LRQLSVLPAEALT  850

Query  2580  RTRNAGHVVFSDVKHSVIDMERQTLVSMPVILKTAIPEYQYIWQGGFEVQKSGKAFNLYD  2759
                N   ++ SD K S++D+ R +  +M ++ KTA PE++YIWQG FEVQKSG+  +L D
Sbjct  851   GAGNLVPILLSDGKSSLVDLHRYSQAAMSILSKTAFPEHEYIWQGAFEVQKSGRTLDLCD  910

Query  2760  GIQAHLSSCASPKVLDAVNKFPRKVILNEVPRLSSWPMQFKECGVSEDNVALFFFAKDIG  2939
             GIQAHLSSCASP VLDAV+KFP+KV+ NEV R S+WP+QF+E GV EDN+ALFFFA+D+G
Sbjct  911   GIQAHLSSCASPNVLDAVHKFPQKVLFNEVSRSSTWPIQFQEYGVKEDNIALFFFAQDVG  970

Query  2940  SYEKSYKVLLGDMVKHDLALQGNIGDIELLIFPSNQLPEKFQRWNLMFFLWGVFRGKRAN  3119
             SYE+ YK+LL +M+++D AL+ N+  +ELLIFPSN+LPEK QRWN+MFFLWGVFR K+  
Sbjct  971   SYERCYKILLENMIRNDTALKANLQGVELLIFPSNRLPEKSQRWNMMFFLWGVFRVKK--  1028

Query  3120  SLQNFPGAEKPLIQDIPTPATSLPENMFTPVPKLNSARGSAATNTEMSAVKESESASLHK  3299
              +Q   G    + QD P      PEN+    P  N   G+   + E++  K+S       
Sbjct  1029  -VQATTGKPSLVPQDTPKLIMPFPENIHCLGPVDNVTSGNVPMDVEVTTPKKSSCP----  1083

Query  3300  IVNGNCSIQSSSQVSRDKCSRINAEQNDKLDSSSMQNSEPKLGPDRRYFGV--PLGEAVH  3473
             +VNGN     ++QV +   +  N E  +    SS+  S   + P+RR FG+   +G+A  
Sbjct  1084  LVNGNVD-SIAAQVCKGDSAHTNLEHLEPRSMSSVPVSHMDVAPERRQFGIFQVVGDAGR  1142

Query  3474  SSVQTAERVSSPNTSRPMSVHWAAPLDGEKLSMLSDETPTMQEATSVGSTTKNLCGKDDV  3653
                    +V  P+ S P +       + +    +++    MQE TSVGS  K  C  +  
Sbjct  1143  EC-----KVEVPSNSAPAA-------NSQPSRSVNEAAGHMQEKTSVGSMEKGFCSTNGR  1190

Query  3654  KIGRICLDNVSTEEATPLARHTSMEQTLNVISSFGVNPKKRSHSAETVLQsasssgtsqa  3833
             K      D    EEA+  +   + E T   +++   N  KR  S +TV+Q A S      
Sbjct  1191  KFEINLEDEYKDEEASETSGSAATEPTRKELNNDVSNHLKRPRSVDTVMQYADSGVNRAT  1250

Query  3834  fssysNDDILVEEFCH-KRVKLNSDRSYGCNDQTSCSKDGFLSEMGGTASQLSRQKNERD  4010
                  ND   VEE  H K++K +   SYG ++QTS S D FLS M G++          D
Sbjct  1251  RLFNDNDQ--VEEAHHDKKLKTSIGGSYGNSEQTSSSDD-FLSRMRGSSYGPYLPDTGYD  1307

Query  4011  EALSKTAILETPGNAEMFFFPVDPHPVGNIGSNNSSMPWKVHPLEEDQLHDKAPNLELAL  4190
             E LSK  + E   +AE +FFPVDP+P        SS PW++H  + D+L D+ PNLELAL
Sbjct  1308  EVLSKAPVPECTESAERYFFPVDPNP-----GKASSTPWQMHHPDNDRLSDRVPNLELAL  1362

Query  4191  GAKTKPLMSGIPSFLSGKVEKKIIE  4265
             G ++     GIP FL GKV+KKII+
Sbjct  1363  GGESNSQTRGIPPFLVGKVDKKIIQ  1387



>ref|XP_010318291.1| PREDICTED: uncharacterized protein LOC101244850 isoform X1 [Solanum 
lycopersicum]
Length=1509

 Score =   816 bits (2109),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 512/1165 (44%), Positives = 705/1165 (61%), Gaps = 71/1165 (6%)
 Frame = +3

Query  873   ASQIHQMeesddseivevdvkvCDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPE  1052
             A Q HQM+ES++S++ E+DVKVCDICG  GRE LLAIC +CTDGAEHTYCM++ML+K+PE
Sbjct  263   ALQSHQMDESEESDVEELDVKVCDICGDAGREDLLAICCKCTDGAEHTYCMREMLQKVPE  322

Query  1053  GDWLCEECKFDQEMKNEHVN-SGRVNEKEKTSPS-RRTTIAKSDHPLKMEQKTSDCWGDK  1226
             GDW+CEECKFD+EM+N   + S + +   K+ P+ ++  +  +   +K E K  D  GD 
Sbjct  323   GDWMCEECKFDEEMRNRKEDKSVKFDGNGKSYPTGQKIAVGNTGLTIKTESKPPDFDGDI  382

Query  1227  AVEERSYLKTSGKRCTDDSEVSSPTKRQRLEL--RSPTAQIPNRVTSLSRESSFKNLERG  1400
             A +     KT GKR  DD+E S+  K+Q LE    SP    PN++ +LSRESSFKN ++G
Sbjct  383   ASDP----KTPGKRRMDDTEYSA-AKKQALEPVPASPKTLSPNKLPALSRESSFKNSDKG  437

Query  1401  KVKPLNPFSSGSFAAKVPSSTGPQPQPPRGIFSKSNSFSSLIAKPKVKLVDEVFPAKQKL  1580
             K+K  N  SSG  +     + G + Q  RG FSKSNSFSSL AK KV LVDE F  KQKL
Sbjct  438   KLKSANQISSGGLSVHDTPAWGSRLQTSRGTFSKSNSFSSLAAKRKVLLVDEGFLPKQKL  497

Query  1581  SRETAFIESKEVAVRSMGKSMSFKPTTASRSNCTESKVKMFSPKFSHDQDVKWLRHKKDR  1760
              RE+  ++ KE + RSM KSMSF+  + SR+N +ESKVKM SPKF   QD K     K+R
Sbjct  498   VRESTGLDVKESSTRSMNKSMSFRSISTSRNNVSESKVKMLSPKFPPAQD-KGQMQTKER  556

Query  1761  SSFDRKNSLRSDRLAGGAISSPKSDNKPTPRGEPSSLSSLNTNRDYRALTSDNKPVTISN  1940
             + F+RKNS RS+R  G ++ S ++D +   RG+PS L S +  RD R    D+KP+++  
Sbjct  557   NQFERKNSFRSERSPGTSVPS-RTDQRSAFRGDPSPLPSSSNIRDTRTGQLDSKPMSLLK  615

Query  1941  STSGVAR----------EVLKQAS----VDGVSSANRVSSSEENPSQAIPKEDSSSSSCV  2078
             S+  VAR          E  K+ S      G  + N++SSS++ P Q+  ++DS  +S +
Sbjct  616   SSGAVARRTQDISVHSDEAKKKTSHTSMSTGAPATNKISSSDQRPDQSSARDDSLPNSYI  675

Query  2079  AERPSWSSNEVLPDGLSQSKESKAFGDKTRESSASRSKQNSTASGKIVSCQKCKGNGHLA  2258
             AERP+ ++ E L DGL Q  ESK  G++T+ESS  R K   T + K + CQKCKG+GHL 
Sbjct  676   AERPTSNTGEGLSDGLPQPSESKNVGERTKESSGRRLKHTGTGT-KSLFCQKCKGSGHLT  734

Query  2259  QVCTADGPE-SSALGSPFKSSREATNGPSDLKAAIEAARLRKPGICRKNRVADQSEDLSA  2435
               CT +  E  S+  S  ++SREA NG S+LKAAIEAA L+KPG+C KNRV DQS+DL+ 
Sbjct  735   DGCTVEVSELFSSDVSAVRNSREAPNGTSNLKAAIEAAMLKKPGVCWKNRVVDQSDDLAV  794

Query  2436  SNMKSEIASQDQMLSSTVRRNVNGAEE-----------AQKQETANNAKQLGII-AEASA  2579
             SN  +E  + D +  S+ RR ++  E+           + KQE  +  +QL ++ AEA  
Sbjct  795   SNTNAETTAPDPLCGSSSRRMLSSNEDGHGVPLNSITGSHKQEIGS-LRQLSVLPAEALT  853

Query  2580  RTRNAGHVVFSDVKHSVIDMERQTLVSMPVILKTAIPEYQYIWQGGFEVQKSGKAFNLYD  2759
                N   ++ SD K S++D+ R +  +M ++ KTA PE++YIWQG FEVQKSG+  +L D
Sbjct  854   GAGNLVPILLSDGKSSLVDLHRYSQAAMSILSKTAFPEHEYIWQGAFEVQKSGRTLDLCD  913

Query  2760  GIQAHLSSCASPKVLDAVNKFPRKVILNEVPRLSSWPMQFKECGVSEDNVALFFFAKDIG  2939
             GIQAHLSSCASP VLDAV+KFP+KV+ NEV R S+WP+QF+E GV EDN+ALFFFA+D+G
Sbjct  914   GIQAHLSSCASPNVLDAVHKFPQKVLFNEVSRSSTWPIQFQEYGVKEDNIALFFFAQDVG  973

Query  2940  SYEKSYKVLLGDMVKHDLALQGNIGDIELLIFPSNQLPEKFQRWNLMFFLWGVFRGKRAN  3119
             SYE+ YK+LL +M+++D AL+ N+  +ELLIFPSN+LPEK QRWN+MFFLWGVFR K+  
Sbjct  974   SYERCYKILLENMIRNDTALKANLQGVELLIFPSNRLPEKSQRWNMMFFLWGVFRVKK--  1031

Query  3120  SLQNFPGAEKPLIQDIPTPATSLPENMFTPVPKLNSARGSAATNTEMSAVKESESASLHK  3299
              +Q   G    + QD P      PEN+    P  N   G+   + E++  K+S       
Sbjct  1032  -VQATTGKPSLVPQDTPKLIMPFPENIHCLGPVDNVTSGNVPMDVEVTTPKKSSCP----  1086

Query  3300  IVNGNCSIQSSSQVSRDKCSRINAEQNDKLDSSSMQNSEPKLGPDRRYFGV--PLGEAVH  3473
             +VNGN     ++QV +   +  N E  +    SS+  S   + P+RR FG+   +G+A  
Sbjct  1087  LVNGNVD-SIAAQVCKGDSAHTNLEHLEPRSMSSVPVSHMDVAPERRQFGIFQVVGDAGR  1145

Query  3474  SSVQTAERVSSPNTSRPMSVHWAAPLDGEKLSMLSDETPTMQEATSVGSTTKNLCGKDDV  3653
                    +V  P+ S P +       + +    +++    MQE TSVGS  K  C  +  
Sbjct  1146  EC-----KVEVPSNSAPAA-------NSQPSRSVNEAAGHMQEKTSVGSMEKGFCSTNGR  1193

Query  3654  KIGRICLDNVSTEEATPLARHTSMEQTLNVISSFGVNPKKRSHSAETVLQsasssgtsqa  3833
             K      D    EEA+  +   + E T   +++   N  KR  S +TV+Q A S      
Sbjct  1194  KFEINLEDEYKDEEASETSGSAATEPTRKELNNDVSNHLKRPRSVDTVMQYADSGVNRAT  1253

Query  3834  fssysNDDILVEEFCH-KRVKLNSDRSYGCNDQTSCSKDGFLSEMGGTASQLSRQKNERD  4010
                  ND   VEE  H K++K +   SYG ++QTS S D FLS M G++          D
Sbjct  1254  RLFNDNDQ--VEEAHHDKKLKTSIGGSYGNSEQTSSSDD-FLSRMRGSSYGPYLPDTGYD  1310

Query  4011  EALSKTAILETPGNAEMFFFPVDPHPVGNIGSNNSSMPWKVHPLEEDQLHDKAPNLELAL  4190
             E LSK  + E   +AE +FFPVDP+P        SS PW++H  + D+L D+ PNLELAL
Sbjct  1311  EVLSKAPVPECTESAERYFFPVDPNP-----GKASSTPWQMHHPDNDRLSDRVPNLELAL  1365

Query  4191  GAKTKPLMSGIPSFLSGKVEKKIIE  4265
             G ++     GIP FL GKV+KKII+
Sbjct  1366  GGESNSQTRGIPPFLVGKVDKKIIQ  1390



>ref|XP_002270307.3| PREDICTED: uncharacterized protein LOC100261463 isoform X3 [Vitis 
vinifera]
Length=1581

 Score =   714 bits (1842),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 503/1257 (40%), Positives = 699/1257 (56%), Gaps = 134/1257 (11%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNEHVNSG  1118
             CDICG  GRE LLAICSRC+DGAEHTYCM++ML+K+PEG+W+CEEC+F++E++N+     
Sbjct  364   CDICGDAGREDLLAICSRCSDGAEHTYCMREMLDKVPEGNWMCEECRFEKEIENQKQVKV  423

Query  1119  RVNEKEKTSPSRRTTIAKSDHPLKMEQKTSDCWGDKAVEERSYLKTSGKRCTDDSEVSSP  1298
              +   EK   S +     +D  +K++ K SD  G+   +  S  + SGKR  +++EV   
Sbjct  424   EMEGTEKNQLSGQANAVNADVLVKLDTKDSDVEGNSTHKVVSGTQVSGKRHAENTEVGPV  483

Query  1299  TKRQRLELRSPTAQIPN--RVTSLSRESSFKNLERGKVKPLNPFSSGSFAAKVP-SSTGP  1469
              KRQ +EL S + +  +  R+ +LSR  SFKN ++GKV+P++  SS + ++ +P ++  P
Sbjct  484   VKRQAVELSSGSPKSSSPSRIAALSRNGSFKNSDKGKVRPVHQTSSTTHSSDIPETARSP  543

Query  1470  QPQP---PRGIFSKSNSFSSLIAKPKVKLVDEVFPAKQKLSRETAFIESKEVAVRSMGKS  1640
                P   PRG   KSNSFS+   KPKVK V+EV P KQK  RE A ++ KE   + MGKS
Sbjct  544   TAGPRLTPRGALLKSNSFSTSNTKPKVKPVEEVLPEKQKRVREPASLDMKEGVSKMMGKS  603

Query  1641  MSFKPTTASRSNCTESKVKMFSPKFSHDQDVKWLRHKKDRSSFDRKNSLRSDR------L  1802
             MSFK  ++ R N TESKVKM SP FSH Q+ K L+   +R+SFDRKNS +S+R      +
Sbjct  604   MSFK--SSGRLNATESKVKMLSPNFSHVQNPKGLKQAIERNSFDRKNSFKSERTLGSSAM  661

Query  1803  AGGAISSPKSDNKPTPRGEPSSLSSLNTNRDYRALTSDNKPVTISNSTSGVAR-------  1961
             AG ++S+PK D KP  RGE  SLSS++ NRD +A+ SD K +T    T   +R       
Sbjct  662   AGSSVSTPKPDQKPASRGESVSLSSISNNRDSKAVQSDGK-LTSPKPTCHPSRKGSEIPV  720

Query  1962  ---EVLKQASVDGVSSANRVSSSEENPSQAIPKEDSSSSSCVAERPSWSSNEVLPDGLSQ  2132
                EV +Q+S    S+    SSSE+ P+ A  K++ SS+S   E+ S  +NE   DG   
Sbjct  721   TLGEVKRQSSS---STNGTCSSSEQKPNHASLKDEPSSNSWNTEK-SVHANETPQDGSPW  776

Query  2133  SKESKAFGDKTRESSASRSKQNSTASGKIVSCQKCKGNGHLAQVCTADGPESSAL-GSPF  2309
             S+ES   G+KTRE+S +R KQ+ST  G+ + C+KCK  GH +Q CT   P  S +  S  
Sbjct  777   SRESTNQGEKTRETSVNRPKQSSTTGGRNLPCEKCKEIGHSSQSCTTRSPRPSTVDASAA  836

Query  2310  KSSREATNGPSDLKAAIEAARLRKPGICRKNRVADQSED--LSASNMKSEIASQDQMLSS  2483
             KSS+E  N  + LKAAIEAA L++PGI ++N+V DQS++  LS++++  ++ASQDQ+  S
Sbjct  837   KSSKELMNKGNKLKAAIEAAMLKRPGIYKRNKVLDQSDEASLSSTDLNGQMASQDQLSIS  896

Query  2484  TVRRNVNGAE--------------EAQKQETANNAKQLGIIAEASARTRNAGHV---VFS  2612
             +  +N+  AE              ++ KQ   NN KQL ++   S  +   G V   V +
Sbjct  897   SSTKNMVSAEGMDEGKAIVQNYTVDSSKQTAVNNLKQLSVLPTGSVFSSKVGEVDSIVPA  956

Query  2613  DVKHSVIDMERQTLVSMPVILKT-AIPEYQYIWQGGFEVQKSGKAFNLYDGIQAHLSSCA  2789
             DVK S+ D+      +  V+ K   IPE++YIWQG FEV +SGK  +L  G+QAHLS+CA
Sbjct  957   DVKPSMRDISSDASTAANVLWKMPVIPEHEYIWQGVFEVHRSGKVPDLCGGVQAHLSTCA  1016

Query  2790  SPKVLDAVNKFPRKVILNEVPRLSSWPMQFKECGVSEDNVALFFFAKDIGSYEKSYKVLL  2969
             SPKVL+  NKFP KV+LNEVPR S WP QF++C V EDN+ L+FFAKD+ SYE++Y+ LL
Sbjct  1017  SPKVLEVANKFPHKVLLNEVPRSSMWPAQFQDCSVKEDNIGLYFFAKDLESYERNYRSLL  1076

Query  2970  GDMVKHDLALQGNIGDIELLIFPSNQLPEKFQRWNLMFFLWGVFRGKRANSLQNFPGAEK  3149
               M+K+DLAL+GNI  +ELLIFPSNQLPEK QRWN+MFFLWGVF+G+R N  +   G+ K
Sbjct  1077  ESMMKNDLALKGNIDGVELLIFPSNQLPEKSQRWNMMFFLWGVFKGRRLNCSEQTSGSSK  1136

Query  3150  ----------PLIQDIPTPATSLPENMFTP---VPKLNSARGSAATN--TEMSAVKESES  3284
                       P   DIP+ A +  EN  +P      +N+   S   +  +   A+ +   
Sbjct  1137  VVCIPSLNTVPEDDDIPSIAMTSSENTCSPERMAKDVNTCDRSCDVDLSSMAPALVDIPF  1196

Query  3285  ASLHKIVNGNCSIQSSSQVSRDKC--SRINAEQND-KLDS---SSMQNSEPKLGPDRRYF  3446
              S  + VNGN + ++ S    DKC  S+   EQ + KLD    S +     +L P+ R  
Sbjct  1197  VSSSETVNGNHNTKTPS--CDDKCLGSQEKMEQQETKLDVHFLSRIPTGSSQLCPEVRCT  1254

Query  3447  GVPLGE----------AVHSSVQTAERVSSPNTSRPMSVHWAAPLDGEK--------LSM  3572
                L E           +  SV   +  S  N    + VH AA LD +         L +
Sbjct  1255  STSLKERSDPDGKLESKLQPSVPLIKIGSGSNRVEKLPVHRAASLDRQDVLHHPFKMLPI  1314

Query  3573  LSDETPTMQEATS--VGSTTKNLCGKDDVKIGRICLDNVSTEEATPLARHTSMEQTLNVI  3746
              S E   M+  +   +     ++  +   +I  +  D V   EA                
Sbjct  1315  GSQEVGVMRSISEEKLHDRMSSITSRAKFEIVLMDEDRVMDTEADG--------------  1360

Query  3747  SSFGVNPKK-RSHSAETVLQsasssgtsqafssysNDDILVEEFCHKRVKLNSDRSYGCN  3923
               +  N K+ RS   ETV Q +S+  +     +  N  ++  E   K++K +   ++ CN
Sbjct  1361  EGWQFNTKRPRSDPTETVSQPSSTGTSQGLPWNTGNSILVDGESERKKLKTSYTGAFVCN  1420

Query  3924  D--QTSCSKDGFLSEMGGTASQLSRQKNERDEALSKTAILETPGNAEMFFFPVDPHPVGN  4097
                 TS   DGF S +   A  +                   P   E  FFPVD HPV N
Sbjct  1421  SSRNTSSLSDGFASPINDPAPVV-------------------PPINEKRFFPVDLHPVRN  1461

Query  4098  IGSNNSSMPWKVH-PLEEDQLHDKAPNLELALGAKTKPLMSGIPSFLSGKVEKKIIEENT  4274
                 + SMP K   P  ED+LHD  PNLELALGA+ KP   GI  +  G  +KK  ++  
Sbjct  1462  FLLGDDSMPRKAFSPEYEDRLHDTVPNLELALGAEKKPSKQGILPWYLGSADKKTEQDKP  1521

Query  4275  SDNAATSANKEDVsaslslslsFPFPEKEHGTSSKP--EQEDPRRRQANTSLLLFGR  4439
              D    +  ++D +ASLSLSLSFP PEKE      P  EQ  P R   NTS LLFGR
Sbjct  1522  PD--MVTIKEDDDAASLSLSLSFPIPEKERAVKPVPRTEQLLPERPNVNTSFLLFGR  1576



>ref|XP_010662093.1| PREDICTED: uncharacterized protein LOC100261463 isoform X2 [Vitis 
vinifera]
Length=1626

 Score =   713 bits (1841),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 503/1257 (40%), Positives = 699/1257 (56%), Gaps = 134/1257 (11%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNEHVNSG  1118
             CDICG  GRE LLAICSRC+DGAEHTYCM++ML+K+PEG+W+CEEC+F++E++N+     
Sbjct  409   CDICGDAGREDLLAICSRCSDGAEHTYCMREMLDKVPEGNWMCEECRFEKEIENQKQVKV  468

Query  1119  RVNEKEKTSPSRRTTIAKSDHPLKMEQKTSDCWGDKAVEERSYLKTSGKRCTDDSEVSSP  1298
              +   EK   S +     +D  +K++ K SD  G+   +  S  + SGKR  +++EV   
Sbjct  469   EMEGTEKNQLSGQANAVNADVLVKLDTKDSDVEGNSTHKVVSGTQVSGKRHAENTEVGPV  528

Query  1299  TKRQRLELRSPTAQIPN--RVTSLSRESSFKNLERGKVKPLNPFSSGSFAAKVP-SSTGP  1469
              KRQ +EL S + +  +  R+ +LSR  SFKN ++GKV+P++  SS + ++ +P ++  P
Sbjct  529   VKRQAVELSSGSPKSSSPSRIAALSRNGSFKNSDKGKVRPVHQTSSTTHSSDIPETARSP  588

Query  1470  QPQP---PRGIFSKSNSFSSLIAKPKVKLVDEVFPAKQKLSRETAFIESKEVAVRSMGKS  1640
                P   PRG   KSNSFS+   KPKVK V+EV P KQK  RE A ++ KE   + MGKS
Sbjct  589   TAGPRLTPRGALLKSNSFSTSNTKPKVKPVEEVLPEKQKRVREPASLDMKEGVSKMMGKS  648

Query  1641  MSFKPTTASRSNCTESKVKMFSPKFSHDQDVKWLRHKKDRSSFDRKNSLRSDR------L  1802
             MSFK  ++ R N TESKVKM SP FSH Q+ K L+   +R+SFDRKNS +S+R      +
Sbjct  649   MSFK--SSGRLNATESKVKMLSPNFSHVQNPKGLKQAIERNSFDRKNSFKSERTLGSSAM  706

Query  1803  AGGAISSPKSDNKPTPRGEPSSLSSLNTNRDYRALTSDNKPVTISNSTSGVAR-------  1961
             AG ++S+PK D KP  RGE  SLSS++ NRD +A+ SD K +T    T   +R       
Sbjct  707   AGSSVSTPKPDQKPASRGESVSLSSISNNRDSKAVQSDGK-LTSPKPTCHPSRKGSEIPV  765

Query  1962  ---EVLKQASVDGVSSANRVSSSEENPSQAIPKEDSSSSSCVAERPSWSSNEVLPDGLSQ  2132
                EV +Q+S    S+    SSSE+ P+ A  K++ SS+S   E+ S  +NE   DG   
Sbjct  766   TLGEVKRQSSS---STNGTCSSSEQKPNHASLKDEPSSNSWNTEK-SVHANETPQDGSPW  821

Query  2133  SKESKAFGDKTRESSASRSKQNSTASGKIVSCQKCKGNGHLAQVCTADGPESSAL-GSPF  2309
             S+ES   G+KTRE+S +R KQ+ST  G+ + C+KCK  GH +Q CT   P  S +  S  
Sbjct  822   SRESTNQGEKTRETSVNRPKQSSTTGGRNLPCEKCKEIGHSSQSCTTRSPRPSTVDASAA  881

Query  2310  KSSREATNGPSDLKAAIEAARLRKPGICRKNRVADQSED--LSASNMKSEIASQDQMLSS  2483
             KSS+E  N  + LKAAIEAA L++PGI ++N+V DQS++  LS++++  ++ASQDQ+  S
Sbjct  882   KSSKELMNKGNKLKAAIEAAMLKRPGIYKRNKVLDQSDEASLSSTDLNGQMASQDQLSIS  941

Query  2484  TVRRNVNGAE--------------EAQKQETANNAKQLGIIAEASARTRNAGHV---VFS  2612
             +  +N+  AE              ++ KQ   NN KQL ++   S  +   G V   V +
Sbjct  942   SSTKNMVSAEGMDEGKAIVQNYTVDSSKQTAVNNLKQLSVLPTGSVFSSKVGEVDSIVPA  1001

Query  2613  DVKHSVIDMERQTLVSMPVILKT-AIPEYQYIWQGGFEVQKSGKAFNLYDGIQAHLSSCA  2789
             DVK S+ D+      +  V+ K   IPE++YIWQG FEV +SGK  +L  G+QAHLS+CA
Sbjct  1002  DVKPSMRDISSDASTAANVLWKMPVIPEHEYIWQGVFEVHRSGKVPDLCGGVQAHLSTCA  1061

Query  2790  SPKVLDAVNKFPRKVILNEVPRLSSWPMQFKECGVSEDNVALFFFAKDIGSYEKSYKVLL  2969
             SPKVL+  NKFP KV+LNEVPR S WP QF++C V EDN+ L+FFAKD+ SYE++Y+ LL
Sbjct  1062  SPKVLEVANKFPHKVLLNEVPRSSMWPAQFQDCSVKEDNIGLYFFAKDLESYERNYRSLL  1121

Query  2970  GDMVKHDLALQGNIGDIELLIFPSNQLPEKFQRWNLMFFLWGVFRGKRANSLQNFPGAEK  3149
               M+K+DLAL+GNI  +ELLIFPSNQLPEK QRWN+MFFLWGVF+G+R N  +   G+ K
Sbjct  1122  ESMMKNDLALKGNIDGVELLIFPSNQLPEKSQRWNMMFFLWGVFKGRRLNCSEQTSGSSK  1181

Query  3150  ----------PLIQDIPTPATSLPENMFTP---VPKLNSARGSAATN--TEMSAVKESES  3284
                       P   DIP+ A +  EN  +P      +N+   S   +  +   A+ +   
Sbjct  1182  VVCIPSLNTVPEDDDIPSIAMTSSENTCSPERMAKDVNTCDRSCDVDLSSMAPALVDIPF  1241

Query  3285  ASLHKIVNGNCSIQSSSQVSRDKC--SRINAEQND-KLDS---SSMQNSEPKLGPDRRYF  3446
              S  + VNGN + ++ S    DKC  S+   EQ + KLD    S +     +L P+ R  
Sbjct  1242  VSSSETVNGNHNTKTPS--CDDKCLGSQEKMEQQETKLDVHFLSRIPTGSSQLCPEVRCT  1299

Query  3447  GVPLGE----------AVHSSVQTAERVSSPNTSRPMSVHWAAPLDGEK--------LSM  3572
                L E           +  SV   +  S  N    + VH AA LD +         L +
Sbjct  1300  STSLKERSDPDGKLESKLQPSVPLIKIGSGSNRVEKLPVHRAASLDRQDVLHHPFKMLPI  1359

Query  3573  LSDETPTMQEATS--VGSTTKNLCGKDDVKIGRICLDNVSTEEATPLARHTSMEQTLNVI  3746
              S E   M+  +   +     ++  +   +I  +  D V   EA                
Sbjct  1360  GSQEVGVMRSISEEKLHDRMSSITSRAKFEIVLMDEDRVMDTEADG--------------  1405

Query  3747  SSFGVNPKK-RSHSAETVLQsasssgtsqafssysNDDILVEEFCHKRVKLNSDRSYGCN  3923
               +  N K+ RS   ETV Q +S+  +     +  N  ++  E   K++K +   ++ CN
Sbjct  1406  EGWQFNTKRPRSDPTETVSQPSSTGTSQGLPWNTGNSILVDGESERKKLKTSYTGAFVCN  1465

Query  3924  D--QTSCSKDGFLSEMGGTASQLSRQKNERDEALSKTAILETPGNAEMFFFPVDPHPVGN  4097
                 TS   DGF S +   A  +                   P   E  FFPVD HPV N
Sbjct  1466  SSRNTSSLSDGFASPINDPAPVV-------------------PPINEKRFFPVDLHPVRN  1506

Query  4098  IGSNNSSMPWKVH-PLEEDQLHDKAPNLELALGAKTKPLMSGIPSFLSGKVEKKIIEENT  4274
                 + SMP K   P  ED+LHD  PNLELALGA+ KP   GI  +  G  +KK  ++  
Sbjct  1507  FLLGDDSMPRKAFSPEYEDRLHDTVPNLELALGAEKKPSKQGILPWYLGSADKKTEQDKP  1566

Query  4275  SDNAATSANKEDVsaslslslsFPFPEKEHGTSSKP--EQEDPRRRQANTSLLLFGR  4439
              D    +  ++D +ASLSLSLSFP PEKE      P  EQ  P R   NTS LLFGR
Sbjct  1567  PD--MVTIKEDDDAASLSLSLSFPIPEKERAVKPVPRTEQLLPERPNVNTSFLLFGR  1621



>ref|XP_010662091.1| PREDICTED: uncharacterized protein LOC100261463 isoform X1 [Vitis 
vinifera]
 ref|XP_010662092.1| PREDICTED: uncharacterized protein LOC100261463 isoform X1 [Vitis 
vinifera]
Length=1659

 Score =   713 bits (1841),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 503/1257 (40%), Positives = 699/1257 (56%), Gaps = 134/1257 (11%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNEHVNSG  1118
             CDICG  GRE LLAICSRC+DGAEHTYCM++ML+K+PEG+W+CEEC+F++E++N+     
Sbjct  442   CDICGDAGREDLLAICSRCSDGAEHTYCMREMLDKVPEGNWMCEECRFEKEIENQKQVKV  501

Query  1119  RVNEKEKTSPSRRTTIAKSDHPLKMEQKTSDCWGDKAVEERSYLKTSGKRCTDDSEVSSP  1298
              +   EK   S +     +D  +K++ K SD  G+   +  S  + SGKR  +++EV   
Sbjct  502   EMEGTEKNQLSGQANAVNADVLVKLDTKDSDVEGNSTHKVVSGTQVSGKRHAENTEVGPV  561

Query  1299  TKRQRLELRSPTAQIPN--RVTSLSRESSFKNLERGKVKPLNPFSSGSFAAKVP-SSTGP  1469
              KRQ +EL S + +  +  R+ +LSR  SFKN ++GKV+P++  SS + ++ +P ++  P
Sbjct  562   VKRQAVELSSGSPKSSSPSRIAALSRNGSFKNSDKGKVRPVHQTSSTTHSSDIPETARSP  621

Query  1470  QPQP---PRGIFSKSNSFSSLIAKPKVKLVDEVFPAKQKLSRETAFIESKEVAVRSMGKS  1640
                P   PRG   KSNSFS+   KPKVK V+EV P KQK  RE A ++ KE   + MGKS
Sbjct  622   TAGPRLTPRGALLKSNSFSTSNTKPKVKPVEEVLPEKQKRVREPASLDMKEGVSKMMGKS  681

Query  1641  MSFKPTTASRSNCTESKVKMFSPKFSHDQDVKWLRHKKDRSSFDRKNSLRSDR------L  1802
             MSFK  ++ R N TESKVKM SP FSH Q+ K L+   +R+SFDRKNS +S+R      +
Sbjct  682   MSFK--SSGRLNATESKVKMLSPNFSHVQNPKGLKQAIERNSFDRKNSFKSERTLGSSAM  739

Query  1803  AGGAISSPKSDNKPTPRGEPSSLSSLNTNRDYRALTSDNKPVTISNSTSGVAR-------  1961
             AG ++S+PK D KP  RGE  SLSS++ NRD +A+ SD K +T    T   +R       
Sbjct  740   AGSSVSTPKPDQKPASRGESVSLSSISNNRDSKAVQSDGK-LTSPKPTCHPSRKGSEIPV  798

Query  1962  ---EVLKQASVDGVSSANRVSSSEENPSQAIPKEDSSSSSCVAERPSWSSNEVLPDGLSQ  2132
                EV +Q+S    S+    SSSE+ P+ A  K++ SS+S   E+ S  +NE   DG   
Sbjct  799   TLGEVKRQSSS---STNGTCSSSEQKPNHASLKDEPSSNSWNTEK-SVHANETPQDGSPW  854

Query  2133  SKESKAFGDKTRESSASRSKQNSTASGKIVSCQKCKGNGHLAQVCTADGPESSAL-GSPF  2309
             S+ES   G+KTRE+S +R KQ+ST  G+ + C+KCK  GH +Q CT   P  S +  S  
Sbjct  855   SRESTNQGEKTRETSVNRPKQSSTTGGRNLPCEKCKEIGHSSQSCTTRSPRPSTVDASAA  914

Query  2310  KSSREATNGPSDLKAAIEAARLRKPGICRKNRVADQSED--LSASNMKSEIASQDQMLSS  2483
             KSS+E  N  + LKAAIEAA L++PGI ++N+V DQS++  LS++++  ++ASQDQ+  S
Sbjct  915   KSSKELMNKGNKLKAAIEAAMLKRPGIYKRNKVLDQSDEASLSSTDLNGQMASQDQLSIS  974

Query  2484  TVRRNVNGAE--------------EAQKQETANNAKQLGIIAEASARTRNAGHV---VFS  2612
             +  +N+  AE              ++ KQ   NN KQL ++   S  +   G V   V +
Sbjct  975   SSTKNMVSAEGMDEGKAIVQNYTVDSSKQTAVNNLKQLSVLPTGSVFSSKVGEVDSIVPA  1034

Query  2613  DVKHSVIDMERQTLVSMPVILKT-AIPEYQYIWQGGFEVQKSGKAFNLYDGIQAHLSSCA  2789
             DVK S+ D+      +  V+ K   IPE++YIWQG FEV +SGK  +L  G+QAHLS+CA
Sbjct  1035  DVKPSMRDISSDASTAANVLWKMPVIPEHEYIWQGVFEVHRSGKVPDLCGGVQAHLSTCA  1094

Query  2790  SPKVLDAVNKFPRKVILNEVPRLSSWPMQFKECGVSEDNVALFFFAKDIGSYEKSYKVLL  2969
             SPKVL+  NKFP KV+LNEVPR S WP QF++C V EDN+ L+FFAKD+ SYE++Y+ LL
Sbjct  1095  SPKVLEVANKFPHKVLLNEVPRSSMWPAQFQDCSVKEDNIGLYFFAKDLESYERNYRSLL  1154

Query  2970  GDMVKHDLALQGNIGDIELLIFPSNQLPEKFQRWNLMFFLWGVFRGKRANSLQNFPGAEK  3149
               M+K+DLAL+GNI  +ELLIFPSNQLPEK QRWN+MFFLWGVF+G+R N  +   G+ K
Sbjct  1155  ESMMKNDLALKGNIDGVELLIFPSNQLPEKSQRWNMMFFLWGVFKGRRLNCSEQTSGSSK  1214

Query  3150  ----------PLIQDIPTPATSLPENMFTP---VPKLNSARGSAATN--TEMSAVKESES  3284
                       P   DIP+ A +  EN  +P      +N+   S   +  +   A+ +   
Sbjct  1215  VVCIPSLNTVPEDDDIPSIAMTSSENTCSPERMAKDVNTCDRSCDVDLSSMAPALVDIPF  1274

Query  3285  ASLHKIVNGNCSIQSSSQVSRDKC--SRINAEQND-KLDS---SSMQNSEPKLGPDRRYF  3446
              S  + VNGN + ++ S    DKC  S+   EQ + KLD    S +     +L P+ R  
Sbjct  1275  VSSSETVNGNHNTKTPS--CDDKCLGSQEKMEQQETKLDVHFLSRIPTGSSQLCPEVRCT  1332

Query  3447  GVPLGE----------AVHSSVQTAERVSSPNTSRPMSVHWAAPLDGEK--------LSM  3572
                L E           +  SV   +  S  N    + VH AA LD +         L +
Sbjct  1333  STSLKERSDPDGKLESKLQPSVPLIKIGSGSNRVEKLPVHRAASLDRQDVLHHPFKMLPI  1392

Query  3573  LSDETPTMQEATS--VGSTTKNLCGKDDVKIGRICLDNVSTEEATPLARHTSMEQTLNVI  3746
              S E   M+  +   +     ++  +   +I  +  D V   EA                
Sbjct  1393  GSQEVGVMRSISEEKLHDRMSSITSRAKFEIVLMDEDRVMDTEADG--------------  1438

Query  3747  SSFGVNPKK-RSHSAETVLQsasssgtsqafssysNDDILVEEFCHKRVKLNSDRSYGCN  3923
               +  N K+ RS   ETV Q +S+  +     +  N  ++  E   K++K +   ++ CN
Sbjct  1439  EGWQFNTKRPRSDPTETVSQPSSTGTSQGLPWNTGNSILVDGESERKKLKTSYTGAFVCN  1498

Query  3924  D--QTSCSKDGFLSEMGGTASQLSRQKNERDEALSKTAILETPGNAEMFFFPVDPHPVGN  4097
                 TS   DGF S +   A  +                   P   E  FFPVD HPV N
Sbjct  1499  SSRNTSSLSDGFASPINDPAPVV-------------------PPINEKRFFPVDLHPVRN  1539

Query  4098  IGSNNSSMPWKVH-PLEEDQLHDKAPNLELALGAKTKPLMSGIPSFLSGKVEKKIIEENT  4274
                 + SMP K   P  ED+LHD  PNLELALGA+ KP   GI  +  G  +KK  ++  
Sbjct  1540  FLLGDDSMPRKAFSPEYEDRLHDTVPNLELALGAEKKPSKQGILPWYLGSADKKTEQDKP  1599

Query  4275  SDNAATSANKEDVsaslslslsFPFPEKEHGTSSKP--EQEDPRRRQANTSLLLFGR  4439
              D    +  ++D +ASLSLSLSFP PEKE      P  EQ  P R   NTS LLFGR
Sbjct  1600  PD--MVTIKEDDDAASLSLSLSFPIPEKERAVKPVPRTEQLLPERPNVNTSFLLFGR  1654



>emb|CAN63105.1| hypothetical protein VITISV_029609 [Vitis vinifera]
Length=1761

 Score =   709 bits (1829),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 505/1256 (40%), Positives = 701/1256 (56%), Gaps = 129/1256 (10%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNEHVNSG  1118
             CDICG  GRE LLAICSRC+DGAEHTYCM++ML+K+PEG+W+CEEC+F++E++N+     
Sbjct  541   CDICGDAGREDLLAICSRCSDGAEHTYCMREMLDKVPEGNWMCEECRFEKEIENQKQVKV  600

Query  1119  RVNEKEKTSPSRR---TTIAKSDHPLKMEQKTSDCWGDKAVEERSYLKTSGKRCTDDSEV  1289
              +   EK   S +        +D  +K++ K SD  G+   +  S  + SGKR  +++EV
Sbjct  601   EMEGTEKNQLSGQANAVNAVNADVLVKLDTKDSDVEGNSTHKVVSGTQVSGKRHAENTEV  660

Query  1290  SSPTKRQRLELRSPTAQIPN--RVTSLSRESSFKNLERGKVKPLNPFSSGSFAAKVP-SS  1460
                 KRQ +EL S + +  +  R+ +LSR  SFKN ++GKV+P++  SS + ++ +P ++
Sbjct  661   GPVVKRQAVELSSGSPKSSSPSRIAALSRNGSFKNSDKGKVRPVHQTSSTTHSSDIPETA  720

Query  1461  TGPQPQP---PRGIFSKSNSFSSLIAKPKVKLVDEVFPAKQKLSRETAFIESKEVAVRSM  1631
               P   P   PRG   KSNSFS+   KPKVK V+EV P KQK  RE A ++ KE   + M
Sbjct  721   RSPTAGPRLTPRGALLKSNSFSTSNTKPKVKPVEEVLPEKQKRVREPASLDMKEGVSKMM  780

Query  1632  GKSMSFKPTTASRSNCTESKVKMFSPKFSHDQDVKWLRHKKDRSSFDRKNSLRSDR----  1799
             GKSMSFK  ++ R N TESKVKM SP FSH Q+ K L+   +R+SFDRKNS +S+R    
Sbjct  781   GKSMSFK--SSGRLNATESKVKMLSPNFSHVQNPKGLKQAIERNSFDRKNSFKSERTLGS  838

Query  1800  --LAGGAISSPKSDNKPTPRGEPSSLSSLNTNRDYRALTSDNKPVTISNSTSGVAR----  1961
               +AG ++S+PK D KP  RGE  SLSS++ NRD +A+ SD K +T    T   +R    
Sbjct  839   SAMAGSSVSTPKPDQKPASRGESVSLSSISNNRDSKAVQSDGK-LTSPKPTCHPSRKGSE  897

Query  1962  ------EVLKQASVDGVSSANRVSSSEENPSQAIPKEDSSSSSCVAERPSWSSNEVLPDG  2123
                   EV +Q+S    S+    SSSE+ P+ A  K++ SS+S   E+ S  +NE   DG
Sbjct  898   IPVTLGEVKRQSSS---STNGTCSSSEQKPNHASLKDEPSSNSWNTEK-SVHANETPQDG  953

Query  2124  LSQSKESKAFGDKTRESSASRSKQNSTASGKIVSCQKCKGNGHLAQVCTADGPESSAL-G  2300
                S+ES   G+KTRE+S +R KQ+ST  G+ + C+KCK  GH +Q CT   P  S +  
Sbjct  954   SPWSRESTNQGEKTRETSVNRPKQSSTXGGRNLPCEKCKEIGHSSQSCTTXSPRPSTVDA  1013

Query  2301  SPFKSSREATNGPSDLKAAIEAARLRKPGICRKNRVADQSED--LSASNMKSEIASQDQM  2474
             S  KSS+E  N  + LKAAIEAA L++PGI ++N+V DQS++  LS++++  ++ASQDQ+
Sbjct  1014  SAAKSSKELMNKGNKLKAAIEAAMLKRPGIYKRNKVLDQSDEASLSSTDLNGQMASQDQL  1073

Query  2475  LSSTVRRNVNGAE--------------EAQKQETANNAKQLGIIAEASARTRNAGHV---  2603
               S+  +N+  AE              ++ KQ   NN KQL ++   S  +   G V   
Sbjct  1074  SISSSTKNMVSAEGMDEGKAIVQNYTVDSSKQTAVNNLKQLSVLPTGSVFSSKVGEVDSI  1133

Query  2604  VFSDVKHSVIDMERQTLVSMPVILKT-AIPEYQYIWQGGFEVQKSGKAFNLYDGIQAHLS  2780
             V +DVK S+ D+      +  V+ K   IPE++YIWQG FEV +SGK  +L  G+QAHLS
Sbjct  1134  VPADVKPSMRDISSDASTAANVLWKMPVIPEHEYIWQGVFEVHRSGKVPDLCGGVQAHLS  1193

Query  2781  SCASPKVLDAVNKFPRKVILNEVPRLSSWPMQFKECGVSEDNVALFFFAKDIGSYEKSYK  2960
             +CASPKVL+  NKFP KV+LNEVPR S WP QF++C V EDN+ L+FFAKD+ SYE++Y+
Sbjct  1194  TCASPKVLEVANKFPHKVLLNEVPRSSMWPAQFQDCSVKEDNIGLYFFAKDLESYERNYR  1253

Query  2961  VLLGDMVKHDLALQGNIGDIELLIFPSNQLPEKFQRWNLMFFLWGVFRGKRANSLQNFPG  3140
              LL  M+K+DLAL+GNI  +ELLIFPSNQLPEK QRWN+MFFLWGVF+G+R N  +   G
Sbjct  1254  SLLESMMKNDLALKGNIDGVELLIFPSNQLPEKSQRWNMMFFLWGVFKGRRLNCSEQTSG  1313

Query  3141  AEK----------PLIQDIPTPATSLPENMFTP---VPKLNSARGSAATN--TEMSAVKE  3275
             + K          P   DIP+ A +  EN  +P      +N+   S   +  +   A+ +
Sbjct  1314  SSKVVCIPSLNTVPEDDDIPSIAMTSSENTCSPERMAKDVNTCDRSCDVDLSSMAPALVD  1373

Query  3276  SESASLHKIVNGNCSIQSSSQVSRDKC--SRINAEQND-KLDS---SSMQNSEPKLGPDR  3437
                 S  + VNGN + ++ S    DKC  S+   EQ + KLD    S +     +L P+ 
Sbjct  1374  IPFVSSSETVNGNHNTKTPS--CDDKCLGSQEKMEQQETKLDVHFLSRIPTGSSQLCPEV  1431

Query  3438  RYFGVPLGE----------AVHSSVQTAERVSSPNTSRPMSVHWAAPLDGEKL-----SM  3572
             R     L E           +  SV   +  S  N    + VH AA LD + +      M
Sbjct  1432  RCTSTSLKERSDPDGKLESKLQPSVPLTKIGSGSNRVEKLPVHRAASLDRQDVLHHPFKM  1491

Query  3573  LSDETPTMQEATSVGSTT-KNLCGKDDVKIGRICLDNVSTEEATPLARHTSMEQTLNVIS  3749
             L   +   QE   +GS + + L  +      R   + V  +E   +      E       
Sbjct  1492  LPIGS---QEVGVMGSISEEKLHDRMSSITSRAKFEIVLMDEDRVMDTEADGE-------  1541

Query  3750  SFGVNPKK-RSHSAETVLQsasssgtsqafssysNDDILVEEFCHKRVKLNSDRSYGCND  3926
              +  N K+ RS   ETV Q +S+  +     +  N  ++  E   K++K +   ++ CN 
Sbjct  1542  GWQFNTKRPRSDPTETVSQPSSTGTSQGLPWNTGNSILVDGESERKKLKTSYTGAFVCNS  1601

Query  3927  --QTSCSKDGFLSEMGGTASQLSRQKNERDEALSKTAILETPGNAEMFFFPVDPHPVGNI  4100
                TS   DGF S +   A  +                   P   E  FFPVD HPV N 
Sbjct  1602  SRNTSSLSDGFASPINDPAPVV-------------------PPINEKRFFPVDLHPVRNF  1642

Query  4101  GSNNSSMPWKVH-PLEEDQLHDKAPNLELALGAKTKPLMSGIPSFLSGKVEKKIIEENTS  4277
                + SMP K   P  ED+LHD  PNLELALGA+ KP   GI  +  G  +KK  ++   
Sbjct  1643  LLGDDSMPRKAFSPEYEDRLHDTVPNLELALGAEKKPSKQGILPWYLGSADKKTEQDKPP  1702

Query  4278  DNAATSANKEDVsaslslslsFPFPEKEHGTSSKP--EQEDPRRRQANTSLLLFGR  4439
             D    +  ++D +ASLSLSLSFP PEKE      P  EQ  P R   NTS LLFGR
Sbjct  1703  D--MVTIKEDDDAASLSLSLSFPIPEKERAVKPVPRTEQLLPERPNVNTSFLLFGR  1756



>emb|CBI26469.3| unnamed protein product [Vitis vinifera]
Length=1382

 Score =   697 bits (1799),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 543/1375 (39%), Positives = 746/1375 (54%), Gaps = 187/1375 (14%)
 Frame = +3

Query  642   IGQSTMGSKVDELSGETCVENA-SSFSGTDVLPASKSK-----KDFALEAKMEVS-----  788
               Q+ MGSK DE S E C  NA S +S  DV P  KS+     ++ A E    VS     
Sbjct  81    FNQALMGSKSDESSDENCRGNAVSQYSVNDVQPPFKSRTCDNLQNTASEISNLVSANSSH  140

Query  789   DSLEDHVVSLA--DKEGIDK-VVNTTGLDLI-----ASQIHQMeesddseivevdvkvCD  944
             DS  ++  S A  D   I + VV  +GL        + Q   ++ESD+S++VE DVKVCD
Sbjct  141   DSFCENAQSQAALDAMMIQRLVVFGSGLPSCNPKKPSLQSQLVDESDESDVVEHDVKVCD  200

Query  945   ICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNEHVNSGRV  1124
             ICG  GRE LLAICSRC+DGAEHTYCM++ML+K+PEG+W+CEEC+F++E++N+    G  
Sbjct  201   ICGDAGREDLLAICSRCSDGAEHTYCMREMLDKVPEGNWMCEECRFEKEIENQKQVKG--  258

Query  1125  NEKEKTSPSRRTTIAKSDHPLKMEQKTSDCWGDKAVEERSYLKTSGKRCTDDSEVSSPTK  1304
                             S H              K V   S  + SGKR  +++EV    K
Sbjct  259   ---------------NSTH--------------KVV---SGTQVSGKRHAENTEVGPVVK  286

Query  1305  RQRLELRSPTAQIPN--RVTSLSRESSFKNLERGKVKPLNPFSSGSFAAKVP-SSTGPQP  1475
             RQ +EL S + +  +  R+ +LSR  SFKN ++GKV+P++  SS + ++ +P ++  P  
Sbjct  287   RQAVELSSGSPKSSSPSRIAALSRNGSFKNSDKGKVRPVHQTSSTTHSSDIPETARSPTA  346

Query  1476  QP---PRGIFSKSNSFSSLIAKPKVKLVDEVFPAKQKLSRETAFIESKEVAVRSMGKSMS  1646
              P   PRG   KSNSFS+   KPKVK V+EV P KQK  RE A ++ KE   + MGKSMS
Sbjct  347   GPRLTPRGALLKSNSFSTSNTKPKVKPVEEVLPEKQKRVREPASLDMKEGVSKMMGKSMS  406

Query  1647  FKPTTASRSNCTESKVKMFSPKFSHDQDVKWLRHKKDRSSFDRKNSLRSDR------LAG  1808
             FK  ++ R N TESKVKM SP FSH Q+ K L+   +R+SFDRKNS +S+R      +AG
Sbjct  407   FK--SSGRLNATESKVKMLSPNFSHVQNPKGLKQAIERNSFDRKNSFKSERTLGSSAMAG  464

Query  1809  GAISSPKSDNKPTPRGEPSSLSSLNTNRDYRALTSDNKPVTISNSTSGVAR---------  1961
              ++S+PK D KP  RGE  SLSS++ NRD +A+ SD K +T    T   +R         
Sbjct  465   SSVSTPKPDQKPASRGESVSLSSISNNRDSKAVQSDGK-LTSPKPTCHPSRKGSEIPVTL  523

Query  1962  -EVLKQASVDGVSSANRVSSSEENPSQAIPKEDSSSSSCVAERPSWSSNEVLPDGLSQSK  2138
              EV +Q+S    S+    SSSE+ P+ A  K++ SS+S   E+ S  +NE   DG   S+
Sbjct  524   GEVKRQSSS---STNGTCSSSEQKPNHASLKDEPSSNSWNTEK-SVHANETPQDGSPWSR  579

Query  2139  ESKAFGDKTRESSASRSKQNSTASGKIVSCQKCKGNGHLAQVCTADGPESSAL-GSPFKS  2315
             ES   G+KTRE+S +R KQ+ST  G+ + C+KCK  GH +Q CT   P  S +  S  KS
Sbjct  580   ESTNQGEKTRETSVNRPKQSSTTGGRNLPCEKCKEIGHSSQSCTTRSPRPSTVDASAAKS  639

Query  2316  SREATNGPSDLKAAIEAARLRKPGICRKNRVADQSED--LSASNMKSEIASQDQMLSSTV  2489
             S+E  N  + LKAAIEAA L++PGI ++N+V DQS++  LS++++  ++ASQDQ+  S+ 
Sbjct  640   SKELMNKGNKLKAAIEAAMLKRPGIYKRNKVLDQSDEASLSSTDLNGQMASQDQLSISSS  699

Query  2490  RRNVNGAE--------------EAQKQETANNAKQLGIIAEASARTRNAGHV---VFSDV  2618
              +N+  AE              ++ KQ   NN KQL ++   S  +   G V   V +DV
Sbjct  700   TKNMVSAEGMDEGKAIVQNYTVDSSKQTAVNNLKQLSVLPTGSVFSSKVGEVDSIVPADV  759

Query  2619  KHSVIDMERQTLVSMPVILKT-AIPEYQYIWQGGFEVQKSGKAFNLYDGIQAHLSSCASP  2795
             K S+ D+      +  V+ K   IPE++YIWQG FEV +SGK  +L  G+QAHLS+CASP
Sbjct  760   KPSMRDISSDASTAANVLWKMPVIPEHEYIWQGVFEVHRSGKVPDLCGGVQAHLSTCASP  819

Query  2796  KVLDAVNKFPRKVILNEVPRLSSWPMQFKECGVSEDNVALFFFAKDIGSYEKSYKVLLGD  2975
             KVL+  NKFP KV+LNEVPR S WP QF++C V EDN+ L+FFAKD+ SYE++Y+ LL  
Sbjct  820   KVLEVANKFPHKVLLNEVPRSSMWPAQFQDCSVKEDNIGLYFFAKDLESYERNYRSLLES  879

Query  2976  MVKHDLALQGNIGDIELLIFPSNQLPEKFQRWNLMFFLWGVFRGKRANSLQNFPGAEK--  3149
             M+K+DLAL+GNI  +ELLIFPSNQLPEK QRWN+MFFLWGVF+G+R N  +   G+ K  
Sbjct  880   MMKNDLALKGNIDGVELLIFPSNQLPEKSQRWNMMFFLWGVFKGRRLNCSEQTSGSSKVV  939

Query  3150  --------PLIQDIPTPATSLPENMFTP---VPKLNSARGSAATN--TEMSAVKESESAS  3290
                     P   DIP+ A +  EN  +P      +N+   S   +  +   A+ +    S
Sbjct  940   CIPSLNTVPEDDDIPSIAMTSSENTCSPERMAKDVNTCDRSCDVDLSSMAPALVDIPFVS  999

Query  3291  LHKIVNGNCSIQSSSQVSRDKC--SRINAEQND-KLDS---SSMQNSEPKLGPDRRYFGV  3452
               + VNGN + ++ S    DKC  S+   EQ + KLD    S +     +L P+ R    
Sbjct  1000  SSETVNGNHNTKTPS--CDDKCLGSQEKMEQQETKLDVHFLSRIPTGSSQLCPEVRCTST  1057

Query  3453  PLGE----------AVHSSVQTAERVSSPNTSRPMSVHWAAPLDGEK--------LSMLS  3578
              L E           +  SV   +  S  N    + VH AA LD +         L + S
Sbjct  1058  SLKERSDPDGKLESKLQPSVPLIKIGSGSNRVEKLPVHRAASLDRQDVLHHPFKMLPIGS  1117

Query  3579  DETPTMQEATS--VGSTTKNLCGKDDVKIGRICLDNVSTEEATPLARHTSMEQTLNVISS  3752
              E   M+  +   +     ++  +   +I  +  D V   EA                  
Sbjct  1118  QEVGVMRSISEEKLHDRMSSITSRAKFEIVLMDEDRVMDTEADG--------------EG  1163

Query  3753  FGVNPKK-RSHSAETVLQsasssgtsqafssysNDDILVEEFCHKRVKLNSDRSYGCND-  3926
             +  N K+ RS   ETV Q +S+  +     +  N  ++  E   K++K +   ++ CN  
Sbjct  1164  WQFNTKRPRSDPTETVSQPSSTGTSQGLPWNTGNSILVDGESERKKLKTSYTGAFVCNSS  1223

Query  3927  -QTSCSKDGFLSEMGGTASQLSRQKNERDEALSKTAILETPGNAEMFFFPVDPHPVGNIG  4103
               TS   DGF S +   A  +                   P   E  FFPVD HPV N  
Sbjct  1224  RNTSSLSDGFASPINDPAPVV-------------------PPINEKRFFPVDLHPVRNFL  1264

Query  4104  SNNSSMPWKVH-PLEEDQLHDKAPNLELALGAKTKPLMSGIPSFLSGKVEKKIIEENTSD  4280
               + SMP K   P  ED+LHD  PNLELALGA+ KP   GI  +  G  +KK  ++   D
Sbjct  1265  LGDDSMPRKAFSPEYEDRLHDTVPNLELALGAEKKPSKQGILPWYLGSADKKTEQDKPPD  1324

Query  4281  NAATSANKEDVsaslslslsFPFPEKEHGTSSKP--EQEDPRRRQANTSLLLFGR  4439
                 +  ++D +ASLSLSLSFP PEKE      P  EQ  P R   NTS LLFGR
Sbjct  1325  --MVTIKEDDDAASLSLSLSFPIPEKERAVKPVPRTEQLLPERPNVNTSFLLFGR  1377



>ref|XP_002319244.2| hypothetical protein POPTR_0013s07550g [Populus trichocarpa]
 gb|EEE95167.2| hypothetical protein POPTR_0013s07550g [Populus trichocarpa]
Length=1586

 Score =   650 bits (1676),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 492/1244 (40%), Positives = 649/1244 (52%), Gaps = 169/1244 (14%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNEHVNSG  1118
             CDICG  GRE LLAICSRCTDGAEHTYCM+ ML+K+PEGDWLCEECK  +E +N+     
Sbjct  429   CDICGDAGREDLLAICSRCTDGAEHTYCMRDMLQKVPEGDWLCEECKLAEETENQ-----  483

Query  1119  RVNEKEKTSPSRRTTIAKSDHPLKMEQKTSDCWGDKAVEERSYLKTSGKRCTDDSEVSSP  1298
                              K D   K    T               ++SGKR  +  E+   
Sbjct  484   -----------------KPDAEEKRMNST---------------QSSGKRQAETIELVPV  511

Query  1299  TKRQRLE--LRSPTAQIPNRVTSLSRESSFKNLERGKVKPL------NPFSSGSFAAKVP  1454
              KRQ  E  L SP +  P+R+ +LSR++SFK+L++GKVK        N  S        P
Sbjct  512   PKRQATESSLASPKSCSPSRIAALSRDTSFKSLDKGKVKIAHQTYFGNRLSIDIRETAHP  571

Query  1455  SSTGPQPQPPRGIFSKSNSFSSLIAKPKVKLVDEVFPAKQKLSRETAFIESKEVAVRSMG  1634
             S  G + Q P+G   KSNSF+++ +KPKVKLV+E FP K K +RE++ ++ KE   R M 
Sbjct  572   SLNGSRVQTPKGTLLKSNSFNTVNSKPKVKLVNE-FPQKHKGTRESS-LDMKERPARMMS  629

Query  1635  KSMSFKPTTASRSNCTESKVKMFSPKFSHDQDVKWLRHKKDRSSFDRKNSLRSDRLAGG-  1811
             KSMSFK   + RS   ESK KM S K+SH QD + L+  KD+++ DRKN LR DR  G  
Sbjct  630   KSMSFKSVNSGRSVTIESKGKMISSKYSHTQDARGLKQVKDQNAIDRKNLLRLDRPLGSS  689

Query  1812  ----AISSPKSDNKPTPRGEPSSLSSLNTNRDYRALTSDNKPVTISNSTSGVAREVLKQA  1979
                 A+S+PK D + TPRGE +  SS + NR+ ++  SD K  T+S STS V R   K A
Sbjct  690   MPNSAVSTPKVDQRITPRGESAIASSPSINRELKSTQSDGKLGTLSRSTS-VGR---KSA  745

Query  1980  SVDGVS------SANRVSSSEENPSQAIPKEDSSSSSCVAERPSWSSNEVLPDGLSQSKE  2141
              + G S           SS E+  +Q  PK++ SSSS  AER   ++NE L DGL QS+E
Sbjct  746   DIPGTSVRVSSTHGISSSSVEQKSNQISPKDEPSSSSWNAERQLNNANENLQDGLPQSRE  805

Query  2142  SKAFGDKTRESSASRSKQNSTASGKIVSCQKCKGNGHLAQVCTADGPESSALGSPF-KSS  2318
             S   G+K RESS S  +   T   KIV+CQKCK  GH  + CT   P +S    P  +++
Sbjct  806   SSNQGEKVRESSVSHLRPAGTTGLKIVTCQKCKEVGHATENCTVVSPMASGTDLPISRTA  865

Query  2319  REATNGPSDLKAAIEAARLRKPGICRKNRVADQSEDLSASNMKSEIASQDQ------MLS  2480
             RE  +  S LKAAIE A L++PGI RK + +DQS+ +S  N+ +    QDQ      M  
Sbjct  866   REGMSKGSKLKAAIEVAMLKRPGIYRKKKESDQSDGVSLLNVDASSEIQDQFSVLNKMNE  925

Query  2481  STVRRNVN---GAEEAQKQETANNAKQLGIIAEASARTRNAGHVVFSDVKHSVIDMERQT  2651
              T+ R  N    + E  K    NN KQL    E S  T     V   D     +     T
Sbjct  926   GTLERQANHGASSSEFSKSTNINNVKQLN---EHSTDTVYPSKVGQLDFIAPYLGKPAHT  982

Query  2652  LVSMPVILK-TAIPEYQYIWQGGFEVQKSGKAFNLYDGIQAHLSSCASPKVLDAVNKFPR  2828
              V   V++K +AIPE++YIWQG  EV +S K  +LY GIQAHLS+CASPKV D VNKFP+
Sbjct  983   SVEKSVLMKMSAIPEHEYIWQGVLEVHRSEKFIDLYGGIQAHLSTCASPKVHDMVNKFPQ  1042

Query  2829  KVILNEVPRLSSWPMQFKECGVSEDNVALFFFAKDIGSYEKSYKVLLGDMVKHDLALQGN  3008
              + L+EVPRLS+WP QF   G  E+N+AL+FFAKD  SYE +YK LL +M+K DLAL+G+
Sbjct  1043  NINLDEVPRLSTWPRQFHISGAKEENIALYFFAKDFESYE-NYKGLLDNMIKKDLALKGS  1101

Query  3009  IGDIELLIFPSNQLPEKFQRWNLMFFLWGVFRGKR--ANSLQNF--PGAE-KPLIQDIPT  3173
              G +E  IFPS QLPE  QRWN+++FLWGVFRG+R  +NS +    P     P  +DIP 
Sbjct  1102  FGGVEFFIFPSTQLPENSQRWNMLYFLWGVFRGRRSESNSFKKLVIPSLNVVPRDKDIPA  1161

Query  3174  PATSLPENMFTP--VPKLNSARGSAATNTEMSAVKESESASLHKIVNGNCSIQSSSQVSR  3347
                S PEN+     + K  SA  S+      S   E    SL++  N +  + +S     
Sbjct  1162  AVLSSPENLCPSECIVKETSACDSSCDVPLTSNAPEKPCVSLNR--NSDNKVFNSQT---  1216

Query  3348  DKCSRINAEQNDKLDSSSMQNSEPKLGPDRRYFGVPLGEAVHSSVQTAERVSSPNTSRPM  3527
                  I   Q+ KLDS S+    PK+         P    V  S  + E V  P  S  +
Sbjct  1217  -----IQESQDGKLDSKSV----PKIPGS----NTPWCPEVRRSSSSLEEVGHPECSMDV  1263

Query  3528  SVHWAAPLDG-------------EKLSMLSDETPTMQ-----EATSVGSTT--------K  3629
                  A + G             E  S   +  P+++        S G TT        +
Sbjct  1264  EFKSCAEVTGTNSSSDVVEIQMHEGTSCFGEGMPSLKIFGVGSQDSGGRTTFGEEKIVDR  1323

Query  3630  NLCGKDDVKI------GRICLDNVSTEEATPLAR-HTSMEQTLNVISSFGVNPKKRSHSA  3788
               C +++VK+        + LD  ++ E TP  R +  + +T  + SS G      +H A
Sbjct  1324  TYCDRNNVKVETDLNEENVNLDVEASSEKTPRKRPYIDLSETAPLTSSSG------THKA  1377

Query  3789  ETVLQsasssgtsqafssysNDDILVEEFCHKRVKLNSDRSYGCNDQTSCSKDG------  3950
                            ++   N+ ++  E   K++K      YG     S S+DG      
Sbjct  1378  --------------LWNKADNNKLVDGESIRKKLKTGFRELYG----GSGSRDGNSLSGS  1419

Query  3951  FLSEMGGTASQLSRQKNERDEALSKTAILETPGNAEMFFFPVDPHPVGNIGSNNSSMPWK  4130
             F S+     S  S ++   D+A  +  ILE  G +E FFFPVD H V +I    +SMPW 
Sbjct  1420  FTSQQCDLGSSSSIEEKSYDKASDEKVILEDLGTSERFFFPVDSHRVKDIWLPGNSMPWN  1479

Query  4131  VHPLEEDQLHDKAPNLELALGAKTKPLMSGIPSFLSGKVEKKIIEENTSDNAATSANKED  4310
                 +ED++HD  PNLELALGA+TK    GI  F  G VEK   +    D        + 
Sbjct  1480  SSN-DEDKVHDGIPNLELALGAETKSPNKGILPFF-GLVEKNDNQNKPPDKVLNKEEDDG  1537

Query  4311  VsaslslslsFPFPEKEHGTS--SKPEQEDPRRRQANTSLLLFG  4436
             VSASLSLSLSFPFP+KE      SK EQ  P RR  NTSLLLFG
Sbjct  1538  VSASLSLSLSFPFPDKEQTVKPVSKTEQLVPERRHVNTSLLLFG  1581



>ref|XP_011044441.1| PREDICTED: uncharacterized protein LOC105139633 isoform X2 [Populus 
euphratica]
Length=1580

 Score =   642 bits (1656),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 489/1241 (39%), Positives = 653/1241 (53%), Gaps = 165/1241 (13%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNEHVNSG  1118
             CDICG  GRE LLAICSRCTDGAEHTYCM+ ML+K+PEGDWLCEECK  +E +N+     
Sbjct  425   CDICGDAGREDLLAICSRCTDGAEHTYCMRDMLQKVPEGDWLCEECKLAEETENQ-----  479

Query  1119  RVNEKEKTSPSRRTTIAKSDHPLKMEQKTSDCWGDKAVEERSYLKTSGKRCTDDSEVSSP  1298
                              K D   K    T               ++SGKR  +  E+ S 
Sbjct  480   -----------------KQDAEEKRMNST---------------QSSGKRQAETMELVSV  507

Query  1299  TKRQRLE--LRSPTAQIPNRVTSLSRESSFKNLERGKVKPLNPFSSGSFAA------KVP  1454
             +KRQ  E  L SP +  P+R+ ++SR++SFK+L++GKVK  +    GS  +        P
Sbjct  508   SKRQATESSLASPKSCSPSRIAAVSRDTSFKSLDKGKVKIAHQTYFGSRCSVDIRETAHP  567

Query  1455  SSTGPQPQPPRGIFSKSNSFSSLIAKPKVKLVDEVFPAKQKLSRETAFIESKEVAVRSMG  1634
             S  G + Q P+G   KSNSF+++ +KPKVKLV+E FP K K +RE++ ++ KE   R M 
Sbjct  568   SLNGSRVQTPKGTLLKSNSFNTVNSKPKVKLVNE-FPQKHKGTRESS-LDMKERPARMMS  625

Query  1635  KSMSFKPTTASRSNCTESKVKMFSPKFSHDQDVKWLRHKKDRSSFDRKNSLRSDRLAG--  1808
             KSMSFK   + RS   ESK KM S K+SH QD   L+  KD+++ DRK  L  DR  G  
Sbjct  626   KSMSFKSVNSGRSVAIESKGKMISSKYSHTQDAIGLKQVKDQNAVDRKTLLGLDRPLGSS  685

Query  1809  ---GAISSPKSDNKPTPRGEPSSLSSLNTNRDYRALTSDNKPVTISNSTSGVAREV----  1967
                 A+S+PK D + TPR E +  SS + NR+ ++  SD K  T+S STS V R+     
Sbjct  686   MPNSAVSTPKVDQRITPRVESAIASSTSINRELKSTQSDGKLGTLSRSTSSVGRKSADIP  745

Query  1968  LKQASVDGVSSANRVSSSEENPSQAIPKEDSSSSSCVAERPSWSSNEVLPDGLSQSKESK  2147
             ++ +S  G+SSA    S E+  +Q  PK +  SSS  AER   ++ E L DGL QS+ES 
Sbjct  746   VRVSSTHGISSA----SGEQKSNQISPKYEPLSSSLNAERQLNNAIENLQDGLPQSRESS  801

Query  2148  AFGDKTRESSASRSKQNSTASGKIVSCQKCKGNGHLAQVCTADGPESSALGSPF-KSSRE  2324
               G+K RESS S  +   T   KIV+CQKCK  GH  + CT   P +S    P  ++SRE
Sbjct  802   NQGEKVRESSVSHLRPAGTTGLKIVTCQKCKEVGHATENCTVVSPMASGSDVPISRTSRE  861

Query  2325  ATNGPSDLKAAIEAARLRKPGICRKNRVADQSEDLSASNMKSEIASQDQ------MLSST  2486
               +  S LKAAIEAA L++PGI RK + +DQS+ LS  N+ +    QDQ      M   T
Sbjct  862   GMSKGSKLKAAIEAAMLKRPGIYRKKKESDQSDGLSLLNVDASSEIQDQFSVLNKMNEGT  921

Query  2487  VRRNVN-GAEEAQ--KQETANNAKQLGIIAEASARTRNAGHVVFSDVKHSVIDMERQTLV  2657
             + R  N GA  ++  K    NN KQL    E S  T     V   D     +     T V
Sbjct  922   LERQANHGASSSELCKSTNINNVKQLN---EHSTDTVCPSKVGQLDSIAPYLGKPAHTSV  978

Query  2658  SMPVILK-TAIPEYQYIWQGGFEVQKSGKAFNLYDGIQAHLSSCASPKVLDAVNKFPRKV  2834
                V+ K +AIPE++YIWQG  EV +S K  +LY GIQAHLS+CASPKV D VNKFP+ +
Sbjct  979   EKSVLTKMSAIPEHEYIWQGVLEVHRSEKFIDLYGGIQAHLSTCASPKVHDMVNKFPQNI  1038

Query  2835  ILNEVPRLSSWPMQFKECGVSEDNVALFFFAKDIGSYEKSYKVLLGDMVKHDLALQGNIG  3014
              L+EVPRLS+WP QF   G  E+N+AL+FFAKD  SYE +YK LL +M++ DLAL+G+ G
Sbjct  1039  NLDEVPRLSTWPRQFHISGAKEENIALYFFAKDFESYE-NYKGLLDNMIRKDLALKGSFG  1097

Query  3015  DIELLIFPSNQLPEKFQRWNLMFFLWGVFRGKRANSLQNFPGAEKPLIQ------DIPTP  3176
              +E  IFPS QLPE  QRWN+++FLWGVFRG+R++S  +F     P +       DIP  
Sbjct  1098  GVEFFIFPSTQLPENSQRWNMLYFLWGVFRGRRSDS-NSFKKLVIPSLNVVPRDTDIPAA  1156

Query  3177  ATSLPENMFTP--VPKLNSARGSAATNTEMSAVKESESASLHKIVNGNCSIQSSSQVSRD  3350
               S PEN+     + K  SA  S+      S   E    SL++  N +  + +S      
Sbjct  1157  VLSSPENLCPSENIVKETSACDSSCNVPLTSNAPEKPCVSLNR--NSDNKVFNSQT----  1210

Query  3351  KCSRINAEQNDKLDSSSMQNSEPKL-------GPDRRYFGVPLGEAVH------SSVQTA  3491
                 I   Q+ KLDS SM    PK+        P+ R     L E  H         ++ 
Sbjct  1211  ----IQESQDGKLDSKSM----PKIPGSNTPWCPEARCSSSSLEEVDHPECSMDVEFKSC  1262

Query  3492  ERVSSPNTSR---PMSVHWAAPLDGEKLSMLSDETPTMQEATSVGSTT--------KNLC  3638
               V+  N+S     + +H      GE   M S +   +    S G TT        +  C
Sbjct  1263  AEVTGTNSSSDVVEIQMHEGTSCFGE--GMPSFKIFGVGNQDSGGRTTFGEEKIVDRTYC  1320

Query  3639  GKDDVKIGR------ICLDNVSTEEATPLAR-HTSMEQTLNVISSFGVNPKKRSHSAETV  3797
               ++VK+ R      + LD  ++ E TP  R +  + +T  + SS  V  K   + A+  
Sbjct  1321  DINNVKVERDLNEENVILDVEASSEKTPRKRPYIDLSETAPLTSS-SVTHKALWNKAD--  1377

Query  3798  LQsasssgtsqafssysNDDILVEEFCHKRVKLNSDRSYGCNDQTSCSKDG------FLS  3959
                              N+ ++  E   K++K      YG     S S+DG      F S
Sbjct  1378  -----------------NNKLVDGESIGKKLKTGFRELYG----GSVSRDGNSLSGSFTS  1416

Query  3960  EMGGTASQLSRQKNERDEALSKTAILETPGNAEMFFFPVDPHPVGNIGSNNSSMPWKVHP  4139
             +     S  S ++   D+A  +  ILE  G +E +FFPVD H V +I    +SMPW    
Sbjct  1417  QTCDLGSSSSIEEKSYDKASDEKVILEDLGTSERYFFPVDSHHVKDIWLPGNSMPWNSSN  1476

Query  4140  LEEDQLHDKAPNLELALGAKTKPLMSGIPSFLSGKVEKKIIEENTSDNAATSANKEDVsa  4319
              +ED++ D  PNLELALGA+TK    GI  F  G V+K   +    D        + VSA
Sbjct  1477  -DEDKVRDGIPNLELALGAETKSPSKGILPFF-GLVDKNDNQNKPPDKVLNKEEDDGVSA  1534

Query  4320  slslslsFPFPEKEHGTS--SKPEQEDPRRRQANTSLLLFG  4436
             SLSLSLSFPFP+KE      SK EQ  P RR  NTSLLLFG
Sbjct  1535  SLSLSLSFPFPDKEQTVKPVSKTEQLVPERRHVNTSLLLFG  1575



>ref|XP_011044443.1| PREDICTED: uncharacterized protein LOC105139633 isoform X4 [Populus 
euphratica]
Length=1549

 Score =   641 bits (1653),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 489/1244 (39%), Positives = 653/1244 (52%), Gaps = 168/1244 (14%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNEHVNSG  1118
             CDICG  GRE LLAICSRCTDGAEHTYCM+ ML+K+PEGDWLCEECK  +E +N+     
Sbjct  391   CDICGDAGREDLLAICSRCTDGAEHTYCMRDMLQKVPEGDWLCEECKLAEETENQ-----  445

Query  1119  RVNEKEKTSPSRRTTIAKSDHPLKMEQKTSDCWGDKAVEERSYLKTSGKRCTDDSEVSSP  1298
                              K D   K    T               ++SGKR  +  E+ S 
Sbjct  446   -----------------KQDAEEKRMNST---------------QSSGKRQAETMELVSV  473

Query  1299  TKRQRLE--LRSPTAQIPNRVTSLSRESSFKNLERGKVKPLNPFSSGSFAA------KVP  1454
             +KRQ  E  L SP +  P+R+ ++SR++SFK+L++GKVK  +    GS  +        P
Sbjct  474   SKRQATESSLASPKSCSPSRIAAVSRDTSFKSLDKGKVKIAHQTYFGSRCSVDIRETAHP  533

Query  1455  SSTGPQPQPPRGIFSKSNSFSSLIAKPKVKLVDEVFPAKQKLSRETAFIESKEVAVRSMG  1634
             S  G + Q P+G   KSNSF+++ +KPKVKLV+E FP K K +RE++ ++ KE   R M 
Sbjct  534   SLNGSRVQTPKGTLLKSNSFNTVNSKPKVKLVNE-FPQKHKGTRESS-LDMKERPARMMS  591

Query  1635  KSMSFKPTTASRSNCTESKVKMFSPKFSHDQDVKWLRHKKDRSSFDRKNSLRSDRLAG--  1808
             KSMSFK   + RS   ESK KM S K+SH QD   L+  KD+++ DRK  L  DR  G  
Sbjct  592   KSMSFKSVNSGRSVAIESKGKMISSKYSHTQDAIGLKQVKDQNAVDRKTLLGLDRPLGSS  651

Query  1809  ---GAISSPKSDNKPTPRGEPSSLSSLNTNRDYRALTSDNKPVTISNSTSGVARE-----  1964
                 A+S+PK D + TPR E +  SS + NR+ ++  SD K  T+S STS V R+     
Sbjct  652   MPNSAVSTPKVDQRITPRVESAIASSTSINRELKSTQSDGKLGTLSRSTSSVGRKSADIP  711

Query  1965  --VLKQASVDGVSSANRVSSSEENPSQAIPKEDSSSSSCVAERPSWSSNEVLPDGLSQSK  2138
                ++ +S  G+SSA    S E+  +Q  PK +  SSS  AER   ++ E L DGL QS+
Sbjct  712   GTSVRVSSTHGISSA----SGEQKSNQISPKYEPLSSSLNAERQLNNAIENLQDGLPQSR  767

Query  2139  ESKAFGDKTRESSASRSKQNSTASGKIVSCQKCKGNGHLAQVCTADGPESSALGSPF-KS  2315
             ES   G+K RESS S  +   T   KIV+CQKCK  GH  + CT   P +S    P  ++
Sbjct  768   ESSNQGEKVRESSVSHLRPAGTTGLKIVTCQKCKEVGHATENCTVVSPMASGSDVPISRT  827

Query  2316  SREATNGPSDLKAAIEAARLRKPGICRKNRVADQSEDLSASNMKSEIASQDQ------ML  2477
             SRE  +  S LKAAIEAA L++PGI RK + +DQS+ LS  N+ +    QDQ      M 
Sbjct  828   SREGMSKGSKLKAAIEAAMLKRPGIYRKKKESDQSDGLSLLNVDASSEIQDQFSVLNKMN  887

Query  2478  SSTVRRNVN-GAEEAQ--KQETANNAKQLGIIAEASARTRNAGHVVFSDVKHSVIDMERQ  2648
               T+ R  N GA  ++  K    NN KQL    E S  T     V   D     +     
Sbjct  888   EGTLERQANHGASSSELCKSTNINNVKQLN---EHSTDTVCPSKVGQLDSIAPYLGKPAH  944

Query  2649  TLVSMPVILK-TAIPEYQYIWQGGFEVQKSGKAFNLYDGIQAHLSSCASPKVLDAVNKFP  2825
             T V   V+ K +AIPE++YIWQG  EV +S K  +LY GIQAHLS+CASPKV D VNKFP
Sbjct  945   TSVEKSVLTKMSAIPEHEYIWQGVLEVHRSEKFIDLYGGIQAHLSTCASPKVHDMVNKFP  1004

Query  2826  RKVILNEVPRLSSWPMQFKECGVSEDNVALFFFAKDIGSYEKSYKVLLGDMVKHDLALQG  3005
             + + L+EVPRLS+WP QF   G  E+N+AL+FFAKD  SYE +YK LL +M++ DLAL+G
Sbjct  1005  QNINLDEVPRLSTWPRQFHISGAKEENIALYFFAKDFESYE-NYKGLLDNMIRKDLALKG  1063

Query  3006  NIGDIELLIFPSNQLPEKFQRWNLMFFLWGVFRGKRANSLQNFPGAEKPLIQ------DI  3167
             + G +E  IFPS QLPE  QRWN+++FLWGVFRG+R++S  +F     P +       DI
Sbjct  1064  SFGGVEFFIFPSTQLPENSQRWNMLYFLWGVFRGRRSDS-NSFKKLVIPSLNVVPRDTDI  1122

Query  3168  PTPATSLPENMFTP--VPKLNSARGSAATNTEMSAVKESESASLHKIVNGNCSIQSSSQV  3341
             P    S PEN+     + K  SA  S+      S   E    SL++  N +  + +S   
Sbjct  1123  PAAVLSSPENLCPSENIVKETSACDSSCNVPLTSNAPEKPCVSLNR--NSDNKVFNSQT-  1179

Query  3342  SRDKCSRINAEQNDKLDSSSMQNSEPKL-------GPDRRYFGVPLGEAVH------SSV  3482
                    I   Q+ KLDS SM    PK+        P+ R     L E  H         
Sbjct  1180  -------IQESQDGKLDSKSM----PKIPGSNTPWCPEARCSSSSLEEVDHPECSMDVEF  1228

Query  3483  QTAERVSSPNTSR---PMSVHWAAPLDGEKLSMLSDETPTMQEATSVGSTT--------K  3629
             ++   V+  N+S     + +H      GE   M S +   +    S G TT        +
Sbjct  1229  KSCAEVTGTNSSSDVVEIQMHEGTSCFGE--GMPSFKIFGVGNQDSGGRTTFGEEKIVDR  1286

Query  3630  NLCGKDDVKIGR------ICLDNVSTEEATPLAR-HTSMEQTLNVISSFGVNPKKRSHSA  3788
               C  ++VK+ R      + LD  ++ E TP  R +  + +T  + SS  V  K   + A
Sbjct  1287  TYCDINNVKVERDLNEENVILDVEASSEKTPRKRPYIDLSETAPLTSS-SVTHKALWNKA  1345

Query  3789  ETVLQsasssgtsqafssysNDDILVEEFCHKRVKLNSDRSYGCNDQTSCSKDG------  3950
             +                   N+ ++  E   K++K      YG     S S+DG      
Sbjct  1346  D-------------------NNKLVDGESIGKKLKTGFRELYG----GSVSRDGNSLSGS  1382

Query  3951  FLSEMGGTASQLSRQKNERDEALSKTAILETPGNAEMFFFPVDPHPVGNIGSNNSSMPWK  4130
             F S+     S  S ++   D+A  +  ILE  G +E +FFPVD H V +I    +SMPW 
Sbjct  1383  FTSQTCDLGSSSSIEEKSYDKASDEKVILEDLGTSERYFFPVDSHHVKDIWLPGNSMPWN  1442

Query  4131  VHPLEEDQLHDKAPNLELALGAKTKPLMSGIPSFLSGKVEKKIIEENTSDNAATSANKED  4310
                 +ED++ D  PNLELALGA+TK    GI  F  G V+K   +    D        + 
Sbjct  1443  SSN-DEDKVRDGIPNLELALGAETKSPSKGILPFF-GLVDKNDNQNKPPDKVLNKEEDDG  1500

Query  4311  VsaslslslsFPFPEKEHGTS--SKPEQEDPRRRQANTSLLLFG  4436
             VSASLSLSLSFPFP+KE      SK EQ  P RR  NTSLLLFG
Sbjct  1501  VSASLSLSLSFPFPDKEQTVKPVSKTEQLVPERRHVNTSLLLFG  1544



>ref|XP_011044440.1| PREDICTED: uncharacterized protein LOC105139633 isoform X1 [Populus 
euphratica]
Length=1583

 Score =   642 bits (1655),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 489/1244 (39%), Positives = 653/1244 (52%), Gaps = 168/1244 (14%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNEHVNSG  1118
             CDICG  GRE LLAICSRCTDGAEHTYCM+ ML+K+PEGDWLCEECK  +E +N+     
Sbjct  425   CDICGDAGREDLLAICSRCTDGAEHTYCMRDMLQKVPEGDWLCEECKLAEETENQ-----  479

Query  1119  RVNEKEKTSPSRRTTIAKSDHPLKMEQKTSDCWGDKAVEERSYLKTSGKRCTDDSEVSSP  1298
                              K D   K    T               ++SGKR  +  E+ S 
Sbjct  480   -----------------KQDAEEKRMNST---------------QSSGKRQAETMELVSV  507

Query  1299  TKRQRLE--LRSPTAQIPNRVTSLSRESSFKNLERGKVKPLNPFSSGSFAA------KVP  1454
             +KRQ  E  L SP +  P+R+ ++SR++SFK+L++GKVK  +    GS  +        P
Sbjct  508   SKRQATESSLASPKSCSPSRIAAVSRDTSFKSLDKGKVKIAHQTYFGSRCSVDIRETAHP  567

Query  1455  SSTGPQPQPPRGIFSKSNSFSSLIAKPKVKLVDEVFPAKQKLSRETAFIESKEVAVRSMG  1634
             S  G + Q P+G   KSNSF+++ +KPKVKLV+E FP K K +RE++ ++ KE   R M 
Sbjct  568   SLNGSRVQTPKGTLLKSNSFNTVNSKPKVKLVNE-FPQKHKGTRESS-LDMKERPARMMS  625

Query  1635  KSMSFKPTTASRSNCTESKVKMFSPKFSHDQDVKWLRHKKDRSSFDRKNSLRSDRLAG--  1808
             KSMSFK   + RS   ESK KM S K+SH QD   L+  KD+++ DRK  L  DR  G  
Sbjct  626   KSMSFKSVNSGRSVAIESKGKMISSKYSHTQDAIGLKQVKDQNAVDRKTLLGLDRPLGSS  685

Query  1809  ---GAISSPKSDNKPTPRGEPSSLSSLNTNRDYRALTSDNKPVTISNSTSGVARE-----  1964
                 A+S+PK D + TPR E +  SS + NR+ ++  SD K  T+S STS V R+     
Sbjct  686   MPNSAVSTPKVDQRITPRVESAIASSTSINRELKSTQSDGKLGTLSRSTSSVGRKSADIP  745

Query  1965  --VLKQASVDGVSSANRVSSSEENPSQAIPKEDSSSSSCVAERPSWSSNEVLPDGLSQSK  2138
                ++ +S  G+SSA    S E+  +Q  PK +  SSS  AER   ++ E L DGL QS+
Sbjct  746   GTSVRVSSTHGISSA----SGEQKSNQISPKYEPLSSSLNAERQLNNAIENLQDGLPQSR  801

Query  2139  ESKAFGDKTRESSASRSKQNSTASGKIVSCQKCKGNGHLAQVCTADGPESSALGSPF-KS  2315
             ES   G+K RESS S  +   T   KIV+CQKCK  GH  + CT   P +S    P  ++
Sbjct  802   ESSNQGEKVRESSVSHLRPAGTTGLKIVTCQKCKEVGHATENCTVVSPMASGSDVPISRT  861

Query  2316  SREATNGPSDLKAAIEAARLRKPGICRKNRVADQSEDLSASNMKSEIASQDQ------ML  2477
             SRE  +  S LKAAIEAA L++PGI RK + +DQS+ LS  N+ +    QDQ      M 
Sbjct  862   SREGMSKGSKLKAAIEAAMLKRPGIYRKKKESDQSDGLSLLNVDASSEIQDQFSVLNKMN  921

Query  2478  SSTVRRNVN-GAEEAQ--KQETANNAKQLGIIAEASARTRNAGHVVFSDVKHSVIDMERQ  2648
               T+ R  N GA  ++  K    NN KQL    E S  T     V   D     +     
Sbjct  922   EGTLERQANHGASSSELCKSTNINNVKQLN---EHSTDTVCPSKVGQLDSIAPYLGKPAH  978

Query  2649  TLVSMPVILK-TAIPEYQYIWQGGFEVQKSGKAFNLYDGIQAHLSSCASPKVLDAVNKFP  2825
             T V   V+ K +AIPE++YIWQG  EV +S K  +LY GIQAHLS+CASPKV D VNKFP
Sbjct  979   TSVEKSVLTKMSAIPEHEYIWQGVLEVHRSEKFIDLYGGIQAHLSTCASPKVHDMVNKFP  1038

Query  2826  RKVILNEVPRLSSWPMQFKECGVSEDNVALFFFAKDIGSYEKSYKVLLGDMVKHDLALQG  3005
             + + L+EVPRLS+WP QF   G  E+N+AL+FFAKD  SYE +YK LL +M++ DLAL+G
Sbjct  1039  QNINLDEVPRLSTWPRQFHISGAKEENIALYFFAKDFESYE-NYKGLLDNMIRKDLALKG  1097

Query  3006  NIGDIELLIFPSNQLPEKFQRWNLMFFLWGVFRGKRANSLQNFPGAEKPLIQ------DI  3167
             + G +E  IFPS QLPE  QRWN+++FLWGVFRG+R++S  +F     P +       DI
Sbjct  1098  SFGGVEFFIFPSTQLPENSQRWNMLYFLWGVFRGRRSDS-NSFKKLVIPSLNVVPRDTDI  1156

Query  3168  PTPATSLPENMFTP--VPKLNSARGSAATNTEMSAVKESESASLHKIVNGNCSIQSSSQV  3341
             P    S PEN+     + K  SA  S+      S   E    SL++  N +  + +S   
Sbjct  1157  PAAVLSSPENLCPSENIVKETSACDSSCNVPLTSNAPEKPCVSLNR--NSDNKVFNSQT-  1213

Query  3342  SRDKCSRINAEQNDKLDSSSMQNSEPKL-------GPDRRYFGVPLGEAVH------SSV  3482
                    I   Q+ KLDS SM    PK+        P+ R     L E  H         
Sbjct  1214  -------IQESQDGKLDSKSM----PKIPGSNTPWCPEARCSSSSLEEVDHPECSMDVEF  1262

Query  3483  QTAERVSSPNTSR---PMSVHWAAPLDGEKLSMLSDETPTMQEATSVGSTT--------K  3629
             ++   V+  N+S     + +H      GE   M S +   +    S G TT        +
Sbjct  1263  KSCAEVTGTNSSSDVVEIQMHEGTSCFGE--GMPSFKIFGVGNQDSGGRTTFGEEKIVDR  1320

Query  3630  NLCGKDDVKIGR------ICLDNVSTEEATPLAR-HTSMEQTLNVISSFGVNPKKRSHSA  3788
               C  ++VK+ R      + LD  ++ E TP  R +  + +T  + SS  V  K   + A
Sbjct  1321  TYCDINNVKVERDLNEENVILDVEASSEKTPRKRPYIDLSETAPLTSS-SVTHKALWNKA  1379

Query  3789  ETVLQsasssgtsqafssysNDDILVEEFCHKRVKLNSDRSYGCNDQTSCSKDG------  3950
             +                   N+ ++  E   K++K      YG     S S+DG      
Sbjct  1380  D-------------------NNKLVDGESIGKKLKTGFRELYG----GSVSRDGNSLSGS  1416

Query  3951  FLSEMGGTASQLSRQKNERDEALSKTAILETPGNAEMFFFPVDPHPVGNIGSNNSSMPWK  4130
             F S+     S  S ++   D+A  +  ILE  G +E +FFPVD H V +I    +SMPW 
Sbjct  1417  FTSQTCDLGSSSSIEEKSYDKASDEKVILEDLGTSERYFFPVDSHHVKDIWLPGNSMPWN  1476

Query  4131  VHPLEEDQLHDKAPNLELALGAKTKPLMSGIPSFLSGKVEKKIIEENTSDNAATSANKED  4310
                 +ED++ D  PNLELALGA+TK    GI  F  G V+K   +    D        + 
Sbjct  1477  SSN-DEDKVRDGIPNLELALGAETKSPSKGILPFF-GLVDKNDNQNKPPDKVLNKEEDDG  1534

Query  4311  VsaslslslsFPFPEKEHGTS--SKPEQEDPRRRQANTSLLLFG  4436
             VSASLSLSLSFPFP+KE      SK EQ  P RR  NTSLLLFG
Sbjct  1535  VSASLSLSLSFPFPDKEQTVKPVSKTEQLVPERRHVNTSLLLFG  1578



>ref|XP_011044442.1| PREDICTED: uncharacterized protein LOC105139633 isoform X3 [Populus 
euphratica]
Length=1560

 Score =   641 bits (1653),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 489/1244 (39%), Positives = 653/1244 (52%), Gaps = 168/1244 (14%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNEHVNSG  1118
             CDICG  GRE LLAICSRCTDGAEHTYCM+ ML+K+PEGDWLCEECK  +E +N+     
Sbjct  402   CDICGDAGREDLLAICSRCTDGAEHTYCMRDMLQKVPEGDWLCEECKLAEETENQ-----  456

Query  1119  RVNEKEKTSPSRRTTIAKSDHPLKMEQKTSDCWGDKAVEERSYLKTSGKRCTDDSEVSSP  1298
                              K D   K    T               ++SGKR  +  E+ S 
Sbjct  457   -----------------KQDAEEKRMNST---------------QSSGKRQAETMELVSV  484

Query  1299  TKRQRLE--LRSPTAQIPNRVTSLSRESSFKNLERGKVKPLNPFSSGSFAA------KVP  1454
             +KRQ  E  L SP +  P+R+ ++SR++SFK+L++GKVK  +    GS  +        P
Sbjct  485   SKRQATESSLASPKSCSPSRIAAVSRDTSFKSLDKGKVKIAHQTYFGSRCSVDIRETAHP  544

Query  1455  SSTGPQPQPPRGIFSKSNSFSSLIAKPKVKLVDEVFPAKQKLSRETAFIESKEVAVRSMG  1634
             S  G + Q P+G   KSNSF+++ +KPKVKLV+E FP K K +RE++ ++ KE   R M 
Sbjct  545   SLNGSRVQTPKGTLLKSNSFNTVNSKPKVKLVNE-FPQKHKGTRESS-LDMKERPARMMS  602

Query  1635  KSMSFKPTTASRSNCTESKVKMFSPKFSHDQDVKWLRHKKDRSSFDRKNSLRSDRLAG--  1808
             KSMSFK   + RS   ESK KM S K+SH QD   L+  KD+++ DRK  L  DR  G  
Sbjct  603   KSMSFKSVNSGRSVAIESKGKMISSKYSHTQDAIGLKQVKDQNAVDRKTLLGLDRPLGSS  662

Query  1809  ---GAISSPKSDNKPTPRGEPSSLSSLNTNRDYRALTSDNKPVTISNSTSGVARE-----  1964
                 A+S+PK D + TPR E +  SS + NR+ ++  SD K  T+S STS V R+     
Sbjct  663   MPNSAVSTPKVDQRITPRVESAIASSTSINRELKSTQSDGKLGTLSRSTSSVGRKSADIP  722

Query  1965  --VLKQASVDGVSSANRVSSSEENPSQAIPKEDSSSSSCVAERPSWSSNEVLPDGLSQSK  2138
                ++ +S  G+SSA    S E+  +Q  PK +  SSS  AER   ++ E L DGL QS+
Sbjct  723   GTSVRVSSTHGISSA----SGEQKSNQISPKYEPLSSSLNAERQLNNAIENLQDGLPQSR  778

Query  2139  ESKAFGDKTRESSASRSKQNSTASGKIVSCQKCKGNGHLAQVCTADGPESSALGSPF-KS  2315
             ES   G+K RESS S  +   T   KIV+CQKCK  GH  + CT   P +S    P  ++
Sbjct  779   ESSNQGEKVRESSVSHLRPAGTTGLKIVTCQKCKEVGHATENCTVVSPMASGSDVPISRT  838

Query  2316  SREATNGPSDLKAAIEAARLRKPGICRKNRVADQSEDLSASNMKSEIASQDQ------ML  2477
             SRE  +  S LKAAIEAA L++PGI RK + +DQS+ LS  N+ +    QDQ      M 
Sbjct  839   SREGMSKGSKLKAAIEAAMLKRPGIYRKKKESDQSDGLSLLNVDASSEIQDQFSVLNKMN  898

Query  2478  SSTVRRNVN-GAEEAQ--KQETANNAKQLGIIAEASARTRNAGHVVFSDVKHSVIDMERQ  2648
               T+ R  N GA  ++  K    NN KQL    E S  T     V   D     +     
Sbjct  899   EGTLERQANHGASSSELCKSTNINNVKQLN---EHSTDTVCPSKVGQLDSIAPYLGKPAH  955

Query  2649  TLVSMPVILK-TAIPEYQYIWQGGFEVQKSGKAFNLYDGIQAHLSSCASPKVLDAVNKFP  2825
             T V   V+ K +AIPE++YIWQG  EV +S K  +LY GIQAHLS+CASPKV D VNKFP
Sbjct  956   TSVEKSVLTKMSAIPEHEYIWQGVLEVHRSEKFIDLYGGIQAHLSTCASPKVHDMVNKFP  1015

Query  2826  RKVILNEVPRLSSWPMQFKECGVSEDNVALFFFAKDIGSYEKSYKVLLGDMVKHDLALQG  3005
             + + L+EVPRLS+WP QF   G  E+N+AL+FFAKD  SYE +YK LL +M++ DLAL+G
Sbjct  1016  QNINLDEVPRLSTWPRQFHISGAKEENIALYFFAKDFESYE-NYKGLLDNMIRKDLALKG  1074

Query  3006  NIGDIELLIFPSNQLPEKFQRWNLMFFLWGVFRGKRANSLQNFPGAEKPLIQ------DI  3167
             + G +E  IFPS QLPE  QRWN+++FLWGVFRG+R++S  +F     P +       DI
Sbjct  1075  SFGGVEFFIFPSTQLPENSQRWNMLYFLWGVFRGRRSDS-NSFKKLVIPSLNVVPRDTDI  1133

Query  3168  PTPATSLPENMFTP--VPKLNSARGSAATNTEMSAVKESESASLHKIVNGNCSIQSSSQV  3341
             P    S PEN+     + K  SA  S+      S   E    SL++  N +  + +S   
Sbjct  1134  PAAVLSSPENLCPSENIVKETSACDSSCNVPLTSNAPEKPCVSLNR--NSDNKVFNSQT-  1190

Query  3342  SRDKCSRINAEQNDKLDSSSMQNSEPKL-------GPDRRYFGVPLGEAVH------SSV  3482
                    I   Q+ KLDS SM    PK+        P+ R     L E  H         
Sbjct  1191  -------IQESQDGKLDSKSM----PKIPGSNTPWCPEARCSSSSLEEVDHPECSMDVEF  1239

Query  3483  QTAERVSSPNTSR---PMSVHWAAPLDGEKLSMLSDETPTMQEATSVGSTT--------K  3629
             ++   V+  N+S     + +H      GE   M S +   +    S G TT        +
Sbjct  1240  KSCAEVTGTNSSSDVVEIQMHEGTSCFGE--GMPSFKIFGVGNQDSGGRTTFGEEKIVDR  1297

Query  3630  NLCGKDDVKIGR------ICLDNVSTEEATPLAR-HTSMEQTLNVISSFGVNPKKRSHSA  3788
               C  ++VK+ R      + LD  ++ E TP  R +  + +T  + SS  V  K   + A
Sbjct  1298  TYCDINNVKVERDLNEENVILDVEASSEKTPRKRPYIDLSETAPLTSS-SVTHKALWNKA  1356

Query  3789  ETVLQsasssgtsqafssysNDDILVEEFCHKRVKLNSDRSYGCNDQTSCSKDG------  3950
             +                   N+ ++  E   K++K      YG     S S+DG      
Sbjct  1357  D-------------------NNKLVDGESIGKKLKTGFRELYG----GSVSRDGNSLSGS  1393

Query  3951  FLSEMGGTASQLSRQKNERDEALSKTAILETPGNAEMFFFPVDPHPVGNIGSNNSSMPWK  4130
             F S+     S  S ++   D+A  +  ILE  G +E +FFPVD H V +I    +SMPW 
Sbjct  1394  FTSQTCDLGSSSSIEEKSYDKASDEKVILEDLGTSERYFFPVDSHHVKDIWLPGNSMPWN  1453

Query  4131  VHPLEEDQLHDKAPNLELALGAKTKPLMSGIPSFLSGKVEKKIIEENTSDNAATSANKED  4310
                 +ED++ D  PNLELALGA+TK    GI  F  G V+K   +    D        + 
Sbjct  1454  SSN-DEDKVRDGIPNLELALGAETKSPSKGILPFF-GLVDKNDNQNKPPDKVLNKEEDDG  1511

Query  4311  VsaslslslsFPFPEKEHGTS--SKPEQEDPRRRQANTSLLLFG  4436
             VSASLSLSLSFPFP+KE      SK EQ  P RR  NTSLLLFG
Sbjct  1512  VSASLSLSLSFPFPDKEQTVKPVSKTEQLVPERRHVNTSLLLFG  1555



>emb|CDP04918.1| unnamed protein product [Coffea canephora]
Length=1277

 Score =   610 bits (1573),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/817 (46%), Positives = 510/817 (62%), Gaps = 94/817 (12%)
 Frame = +3

Query  834   IDKVVNTTGL-DLIASQI--HQMeesddseivevdvkvCDICGAVGREHLLAICSRCTDG  1004
             IDKV+ +  + D + +    H M+ESDDS++VE DVKVCDICG  GRE LLAIC RC+DG
Sbjct  269   IDKVMRSRSVHDAVENSFESHPMDESDDSDMVEHDVKVCDICGDAGREDLLAICCRCSDG  328

Query  1005  AEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNEHVNSGRVNEKEKTSPSRRTTIAKSDHP  1184
             AEHTYCM++M++K+PEGDWLCEEC+ + EMKN                            
Sbjct  329   AEHTYCMKEMVDKVPEGDWLCEECRLEAEMKNP---------------------------  361

Query  1185  LKMEQKTSDCWGDKAVEERSYLKTSGKRCTDDSEVSSPTKRQRLE--LRSPTAQIPNRVT  1358
                 Q+     G+K   +   +K  GKR +DD+EV    K++ LE  + S  A   +   
Sbjct  362   ---RQEKVYVVGNKIANDPPSVKILGKRQSDDAEVFCAVKKRVLESDIGSAKASTSSGTA  418

Query  1359  SLSRESSFKNLERGKVKPLNPFSSGSFAAK--VPSSTGPQPQPPRGIFSKSNSFSSLIAK  1532
             ++SR+SSFK L+RGK KP    SS +  A     S +G +    +G+F KSNSF+SL  K
Sbjct  419   AISRDSSFKLLDRGKAKPTQHSSSVTERAHDTATSPSGSRLHTSQGLFIKSNSFNSLTMK  478

Query  1533  PKVKLVDEVFPAKQKLSRETAFIESKEVAVRSMGKSMSFKPTTASRSNCTESKVKMFSPK  1712
             PK+KLVD+  P KQ+  + +  ++ KE A RS+ KS SF+ T + R N  ESKVKM SPK
Sbjct  479   PKIKLVDDFVPQKQRSVKSSVSLDKKEGAARSISKSSSFRLTNSGRPNIGESKVKMISPK  538

Query  1713  FSHDQDVKWLRHKKDRSSFDRKNSLRSDRLAG-------GAISSPKSDNKPTPRGEPSSL  1871
             FS  Q+ K  +H KDR+ F++KNS  S +++G       GA++  K+D KP    EP+SL
Sbjct  539   FSRIQETKGSKHTKDRNLFEKKNSFTSQKVSGSLPMANPGALAV-KNDQKPVSSAEPTSL  597

Query  1872  SSLNTNRDYRALTSDNKPVTISNSTSGVAR----------EVLKQASVD--GVSSANRVS  2015
             SS     D +A+ S+++ + +S S+S   R          E+ +QAS +  GVSS N  S
Sbjct  598   SSARNFHDTKAIQSESRSMILSKSSSFAVRTGSEPPVSLGELKRQASTNSFGVSSLNGNS  657

Query  2016  SSEENPSQAIPKEDSSSSSCVAERPSWSSNEVLPDGL---SQSKESKAFGDKTRESSASR  2186
               +  P+Q  P E+ SS+S   ER   + NE LPD L   S+ +E   FG++T++ S ++
Sbjct  658   GHDVKPNQGSP-EEYSSNSLSGERQPCNLNEGLPDSLCRASRPRELINFGERTKDGSWTQ  716

Query  2187  SKQNSTASGKIVSCQKCKGNGHLAQVCTADGPESSALGS-PFKSSREATNGPSDLKAAIE  2363
             S+QNS  SG+ +SC+KCK  GHL+Q CTAD P S A  +   K+ RE       LKAAIE
Sbjct  717   SRQNSMISGRTLSCRKCKEIGHLSQSCTADHPGSPASDTTAAKNPREMVECKDKLKAAIE  776

Query  2364  AARLRKPGICRKNRVADQSEDLSASNMKSEIASQDQMLSSTVRRNV--------------  2501
             AA LRKPGI RK+RV+D S+D S   M SEIA+QDQ+L S+ + N+              
Sbjct  777   AAVLRKPGIYRKHRVSDHSDDASLLKMNSEIATQDQVLDSSNQGNLCSSGEMQEGYIILG  836

Query  2502  NGAEEAQKQETANN-AKQLGIIAEASARTRNAGHVVFSDVKHSVIDMERQTLV-------  2657
             N   ++ KQET ++  +Q   ++  ++ +R AG  VF      ++ +ER +L        
Sbjct  837   NSTTDSSKQETVDDIVQQFPNLSVEASTSRTAG--VFP-----IVPLERSSLARDVPNGV  889

Query  2658  --SMPVILKT-AIPEYQYIWQGGFEVQKSGKAFNLYDGIQAHLSSCASPKVLDAVNKFPR  2828
               +   +LKT AIP+++YIWQG FEV + G+  N++DGIQAHLS+CASP+VL+AVNKF  
Sbjct  890   SPATSTLLKTLAIPDHEYIWQGVFEVNRIGEPLNVFDGIQAHLSTCASPRVLEAVNKFAN  949

Query  2829  KVILNEVPRLSSWPMQFKECGVSEDNVALFFFAKDIGSYEKSYKVLLGDMVKHDLALQGN  3008
             KV+LNEVPRL+ WP+QF++ GV EDNVALFFFAKD+ SYEKSYKVLL +M+K+DLAL+G+
Sbjct  950   KVVLNEVPRLTMWPVQFQDNGVKEDNVALFFFAKDLASYEKSYKVLLDNMMKNDLALKGS  1009

Query  3009  IGDIELLIFPSNQLPEKFQRWNLMFFLWGVFRGKRAN  3119
                 EL+IFPSNQLPEK QRWN +FFLWGVFRGKR +
Sbjct  1010  FDGFELMIFPSNQLPEKSQRWNALFFLWGVFRGKRTD  1046



>ref|XP_008234529.1| PREDICTED: uncharacterized protein LOC103333472 isoform X6 [Prunus 
mume]
Length=1491

 Score =   614 bits (1583),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 478/1247 (38%), Positives = 655/1247 (53%), Gaps = 140/1247 (11%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNEHVNSG  1118
             CDICG  GRE +LA+CSRC+DGAEH YCM+KML ++P+  WLCEECKF +E  N+   S 
Sbjct  301   CDICGDAGREDMLAMCSRCSDGAEHIYCMRKMLRRVPKAQWLCEECKFAEEADNQKQGS-  359

Query  1119  RVNEKEKTSPSRRTTIAKSDHPLKMEQKTSDCWGDKAVEERSYLKTSGKRCTDDSEVSSP  1298
                                     ME K      DKA+    +   S KR  ++ EV+  
Sbjct  360   -----------------------DMEGKKM----DKAILNTQF---SHKRLAENIEVAPA  389

Query  1299  TKRQRLELR--SPTAQIPNRVTSLSRESSFKNLERGKVKPLNPFSSG----SFAAKVPSS  1460
              KRQ LE+R  SP    P R+ +LSRESSFK++++ +++     S      S  A+ PSS
Sbjct  390   AKRQALEIRVGSPRPSSPKRMGALSRESSFKSIDKDRLRSTYQSSQSINDISETARSPSS  449

Query  1461  TGPQPQPPRGIFSKSNSFSSLIAKPKVKLVDEVFPAKQKLSRETAFIESKEVAVRSMGKS  1640
              G + Q  +G   KSNSF++L +KP+VK VD+V P KQK S+E + ++ KE   R MGKS
Sbjct  450   -GIRLQTTKGTLLKSNSFNTLTSKPRVKTVDDV-PQKQKGSKEHSSLDMKERVARMMGKS  507

Query  1641  MSFKPTTASRSNCTESKVKMFSPKFSHDQDVKWLRHKKDRSSFDRKNSLRSDR------L  1802
             +SFK   + RSN +ESKVKM S KFSH QD+K L+  K+RS+ +RKN  + DR       
Sbjct  508   VSFKSANSGRSNVSESKVKMLSSKFSHVQDLKGLKQAKERSTVERKNLSKLDRPLASFPA  567

Query  1803  AGGAISSPKSDNKPTPRGEPSSLSSLNTNRDYRALTSDNKPVTISNSTSGVAREVL--KQ  1976
             A   +S+PK D  P  RGE S LSS++ NR+ + +  D K  TI+ S   + R+ +  + 
Sbjct  568   ASPIVSTPKID--PASRGETSLLSSVSNNRESKVVLPDGKLSTIAKSIGNLTRKGVEPQN  625

Query  1977  ASVDGVSSANRVSSSEENPSQAIPKEDS--SSSSCVAERPSWSSNEVLPDGLSQSKESKA  2150
             ASV G S+    +S+ E  S  +  +D   SS S + E+P  + +E L D   QS E  +
Sbjct  626   ASVGGSSTNGICNSASEQKSNQVSSKDEPLSSYSGIVEKPCSNVDETLEDVFPQSVEMTS  685

Query  2151  FGDKTRESSASRSKQNSTASGKIVSCQKCKGNGHLAQVCTADGPESSAL--GSPFKSSRE  2324
               DKTRESSA R +   TAS       KCK  GH A+ C A   ++S     +P  SSRE
Sbjct  686   QADKTRESSA-RCRPTVTAS------PKCKDIGHTAEFCRAGISQTSGTDASTPI-SSRE  737

Query  2325  ATNGPSDLKAAIEAARLRKPGICRKNRVADQSEDLSASN--MKSEIASQDQMLSSTVRRN  2498
                  + LK AI AA LRKP I RK RV D S++LS SN  +  E+ASQ+Q L S    N
Sbjct  738   DMPRGNRLKDAIHAALLRKPEIYRKKRVFDPSDELSTSNVDLSYEVASQEQSLISNKLNN  797

Query  2499  VNGAE--------------EAQKQETANNAKQLGIIAEAS---ARTRNAGHVVFSDVKHS  2627
             +  +E              ++ K  T NN KQ  +    S   ++  ++  VV    K +
Sbjct  798   ITCSEGSHDGQTVLGTSTSDSYKNTTVNNLKQHTVQPIDSVFPSKVTDSVSVVPYLGKST  857

Query  2628  VIDMERQTLVSMPVILK-TAIPEYQYIWQGGFEVQKSGKAFNLYDGIQAHLSSCASPKVL  2804
             V D+     V+M V+ K TAIPEY+YIWQG FEVQ+ G   +L  G+QAHLS+CASPKVL
Sbjct  858   VKDLHSHASVAMYVLAKTTAIPEYEYIWQGSFEVQRGGNYLDLCGGVQAHLSTCASPKVL  917

Query  2805  DAVNKFPRKVILNEVPRLSSWPMQFKECGVSEDNVALFFFAKDIGSYEKSYKVLLGDMVK  2984
             + VNKF  KV L+EVPRLS WP  F + G  EDN+AL+FFAKD+ SYE+ YK+LL  M+K
Sbjct  918   EVVNKFQFKVPLSEVPRLSVWPSHFHQSGAKEDNIALYFFAKDLESYERDYKILLDAMIK  977

Query  2985  HDLALQGNIGDIELLIFPSNQLPEKFQRWNLMFFLWGVFRGKRANSLQNFPGAEKPLIQD  3164
             +DLAL+GN   +ELLIFPSNQLPE+ QRWN++FFLWGVFR  R + L        P + +
Sbjct  978   NDLALKGNFDGVELLIFPSNQLPERSQRWNMLFFLWGVFRTTRVHRLDFTKETCVPSLSN  1037

Query  3165  IPTPATSLPENMFTPVPKLNSARGSAATNTEMSAVKESESASLHKIVNGNCSIQSSSQVS  3344
                   +L EN+  P   ++    S       SA     ++ LH          S   VS
Sbjct  1038  SLDKYGTLSENLCIP-KHIDEFSASDKCRDVASAA----NSLLHM-----GPTVSKDHVS  1087

Query  3345  RDKC-------SRIN-AEQNDKLDSSSMQNS--------EPKLGPDRRYFGVPLGEAVHS  3476
             +D         S++N   QN +LDS++  N+           L  +    G  LG  + S
Sbjct  1088  KDTYPEEVRSGSKVNLMVQNSRLDSNTTNNAGLSEGVPCTASLQQEICLRGSGLGTEIKS  1147

Query  3477  SVQTAERVSSPNTSRPMSVHWAAPLDGEKLSMLSDETPTMQEATSVGSTTKNLC------  3638
             S+      SS    +   VHW    D E    L     + QE    GS  +         
Sbjct  1148  SIPITGSNSSIKGEK-RQVHWVTSGDREGAESLKIRPISNQEVAIAGSVAEETIPDRKKR  1206

Query  3639  -----GKDDVKIGRICLDNVSTEEATPLAR---HTSMEQTL-----NVISSFGVNPKKRS  3779
                  G ++V +  + +++V  ++   L R   +  +E  L       ++SF  + +K  
Sbjct  1207  VGLAGGVEEVILDGVNIESVECKQDKELKRDYGYKEIEAALVRDLTAKVNSFQSSKRKHP  1266

Query  3780  HSA--ETVLQsasssgtsqafssysNDDILVEEFCHKRVKLNSDRSYG--CNDQTSCSKD  3947
             H A  ET   +A++   S    + +  D    E   K+ K+ S   YG   +  T+   D
Sbjct  1267  HIALSETAASAATNQEMSWNEVNSTQID---GEGDSKKPKIGSSGLYGRSTSRGTNAVDD  1323

Query  3948  GFLSEMGGTASQLSRQKNERDEALSKTAILETPGNAEMFFFPVDPHPVGNIGSNNSSMPW  4127
             GF+S        L  ++    EA  +  I E  G  E +FFPVD   V +  + ++S+PW
Sbjct  1324  GFVSHNDMGPCSLVEKRCV--EACEEKVIPEDLGTTERYFFPVDSRHVQHFHTVDNSVPW  1381

Query  4128  K-VHPLEEDQLHDKAPNLELALGAKTKPLMSGIPSFLSGKVEKKIIEENTSDNAATSANK  4304
             K     +ED+  D  P+LELALGA+TKP   GI  F  G  ++K  ++   D A      
Sbjct  1382  KGSSSGDEDKSRDGFPSLELALGAETKPQNKGILPFFVGLADEKNNQDKPLD-AVVDEKD  1440

Query  4305  EDVsaslslslsFPFPEKEHGTS--SKPEQEDPRRRQANTSLLLFGR  4439
             +D SASLSLSLSFPFP+KE      SK EQ  P R   NTSLLLFGR
Sbjct  1441  DDASASLSLSLSFPFPDKEQPVKPVSKSEQLLPERHHVNTSLLLFGR  1487



>ref|XP_008234525.1| PREDICTED: uncharacterized protein LOC103333472 isoform X2 [Prunus 
mume]
Length=1520

 Score =   614 bits (1583),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 478/1247 (38%), Positives = 655/1247 (53%), Gaps = 140/1247 (11%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNEHVNSG  1118
             CDICG  GRE +LA+CSRC+DGAEH YCM+KML ++P+  WLCEECKF +E  N+   S 
Sbjct  330   CDICGDAGREDMLAMCSRCSDGAEHIYCMRKMLRRVPKAQWLCEECKFAEEADNQKQGS-  388

Query  1119  RVNEKEKTSPSRRTTIAKSDHPLKMEQKTSDCWGDKAVEERSYLKTSGKRCTDDSEVSSP  1298
                                     ME K      DKA+    +   S KR  ++ EV+  
Sbjct  389   -----------------------DMEGKKM----DKAILNTQF---SHKRLAENIEVAPA  418

Query  1299  TKRQRLELR--SPTAQIPNRVTSLSRESSFKNLERGKVKPLNPFSSG----SFAAKVPSS  1460
              KRQ LE+R  SP    P R+ +LSRESSFK++++ +++     S      S  A+ PSS
Sbjct  419   AKRQALEIRVGSPRPSSPKRMGALSRESSFKSIDKDRLRSTYQSSQSINDISETARSPSS  478

Query  1461  TGPQPQPPRGIFSKSNSFSSLIAKPKVKLVDEVFPAKQKLSRETAFIESKEVAVRSMGKS  1640
              G + Q  +G   KSNSF++L +KP+VK VD+V P KQK S+E + ++ KE   R MGKS
Sbjct  479   -GIRLQTTKGTLLKSNSFNTLTSKPRVKTVDDV-PQKQKGSKEHSSLDMKERVARMMGKS  536

Query  1641  MSFKPTTASRSNCTESKVKMFSPKFSHDQDVKWLRHKKDRSSFDRKNSLRSDR------L  1802
             +SFK   + RSN +ESKVKM S KFSH QD+K L+  K+RS+ +RKN  + DR       
Sbjct  537   VSFKSANSGRSNVSESKVKMLSSKFSHVQDLKGLKQAKERSTVERKNLSKLDRPLASFPA  596

Query  1803  AGGAISSPKSDNKPTPRGEPSSLSSLNTNRDYRALTSDNKPVTISNSTSGVAREVL--KQ  1976
             A   +S+PK D  P  RGE S LSS++ NR+ + +  D K  TI+ S   + R+ +  + 
Sbjct  597   ASPIVSTPKID--PASRGETSLLSSVSNNRESKVVLPDGKLSTIAKSIGNLTRKGVEPQN  654

Query  1977  ASVDGVSSANRVSSSEENPSQAIPKEDS--SSSSCVAERPSWSSNEVLPDGLSQSKESKA  2150
             ASV G S+    +S+ E  S  +  +D   SS S + E+P  + +E L D   QS E  +
Sbjct  655   ASVGGSSTNGICNSASEQKSNQVSSKDEPLSSYSGIVEKPCSNVDETLEDVFPQSVEMTS  714

Query  2151  FGDKTRESSASRSKQNSTASGKIVSCQKCKGNGHLAQVCTADGPESSAL--GSPFKSSRE  2324
               DKTRESSA R +   TAS       KCK  GH A+ C A   ++S     +P  SSRE
Sbjct  715   QADKTRESSA-RCRPTVTAS------PKCKDIGHTAEFCRAGISQTSGTDASTPI-SSRE  766

Query  2325  ATNGPSDLKAAIEAARLRKPGICRKNRVADQSEDLSASN--MKSEIASQDQMLSSTVRRN  2498
                  + LK AI AA LRKP I RK RV D S++LS SN  +  E+ASQ+Q L S    N
Sbjct  767   DMPRGNRLKDAIHAALLRKPEIYRKKRVFDPSDELSTSNVDLSYEVASQEQSLISNKLNN  826

Query  2499  VNGAE--------------EAQKQETANNAKQLGIIAEAS---ARTRNAGHVVFSDVKHS  2627
             +  +E              ++ K  T NN KQ  +    S   ++  ++  VV    K +
Sbjct  827   ITCSEGSHDGQTVLGTSTSDSYKNTTVNNLKQHTVQPIDSVFPSKVTDSVSVVPYLGKST  886

Query  2628  VIDMERQTLVSMPVILK-TAIPEYQYIWQGGFEVQKSGKAFNLYDGIQAHLSSCASPKVL  2804
             V D+     V+M V+ K TAIPEY+YIWQG FEVQ+ G   +L  G+QAHLS+CASPKVL
Sbjct  887   VKDLHSHASVAMYVLAKTTAIPEYEYIWQGSFEVQRGGNYLDLCGGVQAHLSTCASPKVL  946

Query  2805  DAVNKFPRKVILNEVPRLSSWPMQFKECGVSEDNVALFFFAKDIGSYEKSYKVLLGDMVK  2984
             + VNKF  KV L+EVPRLS WP  F + G  EDN+AL+FFAKD+ SYE+ YK+LL  M+K
Sbjct  947   EVVNKFQFKVPLSEVPRLSVWPSHFHQSGAKEDNIALYFFAKDLESYERDYKILLDAMIK  1006

Query  2985  HDLALQGNIGDIELLIFPSNQLPEKFQRWNLMFFLWGVFRGKRANSLQNFPGAEKPLIQD  3164
             +DLAL+GN   +ELLIFPSNQLPE+ QRWN++FFLWGVFR  R + L        P + +
Sbjct  1007  NDLALKGNFDGVELLIFPSNQLPERSQRWNMLFFLWGVFRTTRVHRLDFTKETCVPSLSN  1066

Query  3165  IPTPATSLPENMFTPVPKLNSARGSAATNTEMSAVKESESASLHKIVNGNCSIQSSSQVS  3344
                   +L EN+  P   ++    S       SA     ++ LH          S   VS
Sbjct  1067  SLDKYGTLSENLCIP-KHIDEFSASDKCRDVASAA----NSLLHM-----GPTVSKDHVS  1116

Query  3345  RDKC-------SRIN-AEQNDKLDSSSMQNS--------EPKLGPDRRYFGVPLGEAVHS  3476
             +D         S++N   QN +LDS++  N+           L  +    G  LG  + S
Sbjct  1117  KDTYPEEVRSGSKVNLMVQNSRLDSNTTNNAGLSEGVPCTASLQQEICLRGSGLGTEIKS  1176

Query  3477  SVQTAERVSSPNTSRPMSVHWAAPLDGEKLSMLSDETPTMQEATSVGSTTKNLC------  3638
             S+      SS    +   VHW    D E    L     + QE    GS  +         
Sbjct  1177  SIPITGSNSSIKGEK-RQVHWVTSGDREGAESLKIRPISNQEVAIAGSVAEETIPDRKKR  1235

Query  3639  -----GKDDVKIGRICLDNVSTEEATPLAR---HTSMEQTL-----NVISSFGVNPKKRS  3779
                  G ++V +  + +++V  ++   L R   +  +E  L       ++SF  + +K  
Sbjct  1236  VGLAGGVEEVILDGVNIESVECKQDKELKRDYGYKEIEAALVRDLTAKVNSFQSSKRKHP  1295

Query  3780  HSA--ETVLQsasssgtsqafssysNDDILVEEFCHKRVKLNSDRSYG--CNDQTSCSKD  3947
             H A  ET    AS++   +   +  N   +  E   K+ K+ S   YG   +  T+   D
Sbjct  1296  HIALSETA---ASAATNQEMSWNEVNSTQIDGEGDSKKPKIGSSGLYGRSTSRGTNAVDD  1352

Query  3948  GFLSEMGGTASQLSRQKNERDEALSKTAILETPGNAEMFFFPVDPHPVGNIGSNNSSMPW  4127
             GF+S        L  ++    EA  +  I E  G  E +FFPVD   V +  + ++S+PW
Sbjct  1353  GFVSHNDMGPCSLVEKRCV--EACEEKVIPEDLGTTERYFFPVDSRHVQHFHTVDNSVPW  1410

Query  4128  K-VHPLEEDQLHDKAPNLELALGAKTKPLMSGIPSFLSGKVEKKIIEENTSDNAATSANK  4304
             K     +ED+  D  P+LELALGA+TKP   GI  F  G  ++K  ++   D A      
Sbjct  1411  KGSSSGDEDKSRDGFPSLELALGAETKPQNKGILPFFVGLADEKNNQDKPLD-AVVDEKD  1469

Query  4305  EDVsaslslslsFPFPEKEHGTS--SKPEQEDPRRRQANTSLLLFGR  4439
             +D SASLSLSLSFPFP+KE      SK EQ  P R   NTSLLLFGR
Sbjct  1470  DDASASLSLSLSFPFPDKEQPVKPVSKSEQLLPERHHVNTSLLLFGR  1516



>ref|XP_008234527.1| PREDICTED: uncharacterized protein LOC103333472 isoform X4 [Prunus 
mume]
Length=1518

 Score =   613 bits (1581),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 479/1247 (38%), Positives = 656/1247 (53%), Gaps = 142/1247 (11%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNEHVNSG  1118
             CDICG  GRE +LA+CSRC+DGAEH YCM+KML ++P+  WLCEECKF +E  N+     
Sbjct  330   CDICGDAGREDMLAMCSRCSDGAEHIYCMRKMLRRVPKAQWLCEECKFAEEADNQ-----  384

Query  1119  RVNEKEKTSPSRRTTIAKSDHPLKMEQKTSDCWGDKAVEERSYLKTSGKRCTDDSEVSSP  1298
                              K D    ME K      DKA+    +   S KR  ++ EV+  
Sbjct  385   -----------------KQD----MEGKKM----DKAILNTQF---SHKRLAENIEVAPA  416

Query  1299  TKRQRLELR--SPTAQIPNRVTSLSRESSFKNLERGKVKPLNPFSSG----SFAAKVPSS  1460
              KRQ LE+R  SP    P R+ +LSRESSFK++++ +++     S      S  A+ PSS
Sbjct  417   AKRQALEIRVGSPRPSSPKRMGALSRESSFKSIDKDRLRSTYQSSQSINDISETARSPSS  476

Query  1461  TGPQPQPPRGIFSKSNSFSSLIAKPKVKLVDEVFPAKQKLSRETAFIESKEVAVRSMGKS  1640
              G + Q  +G   KSNSF++L +KP+VK VD+V P KQK S+E + ++ KE   R MGKS
Sbjct  477   -GIRLQTTKGTLLKSNSFNTLTSKPRVKTVDDV-PQKQKGSKEHSSLDMKERVARMMGKS  534

Query  1641  MSFKPTTASRSNCTESKVKMFSPKFSHDQDVKWLRHKKDRSSFDRKNSLRSDR------L  1802
             +SFK   + RSN +ESKVKM S KFSH QD+K L+  K+RS+ +RKN  + DR       
Sbjct  535   VSFKSANSGRSNVSESKVKMLSSKFSHVQDLKGLKQAKERSTVERKNLSKLDRPLASFPA  594

Query  1803  AGGAISSPKSDNKPTPRGEPSSLSSLNTNRDYRALTSDNKPVTISNSTSGVAREVL--KQ  1976
             A   +S+PK D  P  RGE S LSS++ NR+ + +  D K  TI+ S   + R+ +  + 
Sbjct  595   ASPIVSTPKID--PASRGETSLLSSVSNNRESKVVLPDGKLSTIAKSIGNLTRKGVEPQN  652

Query  1977  ASVDGVSSANRVSSSEENPSQAIPKEDS--SSSSCVAERPSWSSNEVLPDGLSQSKESKA  2150
             ASV G S+    +S+ E  S  +  +D   SS S + E+P  + +E L D   QS E  +
Sbjct  653   ASVGGSSTNGICNSASEQKSNQVSSKDEPLSSYSGIVEKPCSNVDETLEDVFPQSVEMTS  712

Query  2151  FGDKTRESSASRSKQNSTASGKIVSCQKCKGNGHLAQVCTADGPESSAL--GSPFKSSRE  2324
               DKTRESSA R +   TAS       KCK  GH A+ C A   ++S     +P  SSRE
Sbjct  713   QADKTRESSA-RCRPTVTAS------PKCKDIGHTAEFCRAGISQTSGTDASTPI-SSRE  764

Query  2325  ATNGPSDLKAAIEAARLRKPGICRKNRVADQSEDLSASN--MKSEIASQDQMLSSTVRRN  2498
                  + LK AI AA LRKP I RK RV D S++LS SN  +  E+ASQ+Q L S    N
Sbjct  765   DMPRGNRLKDAIHAALLRKPEIYRKKRVFDPSDELSTSNVDLSYEVASQEQSLISNKLNN  824

Query  2499  VNGAE--------------EAQKQETANNAKQLGIIAEAS---ARTRNAGHVVFSDVKHS  2627
             +  +E              ++ K  T NN KQ  +    S   ++  ++  VV    K +
Sbjct  825   ITCSEGSHDGQTVLGTSTSDSYKNTTVNNLKQHTVQPIDSVFPSKVTDSVSVVPYLGKST  884

Query  2628  VIDMERQTLVSMPVILK-TAIPEYQYIWQGGFEVQKSGKAFNLYDGIQAHLSSCASPKVL  2804
             V D+     V+M V+ K TAIPEY+YIWQG FEVQ+ G   +L  G+QAHLS+CASPKVL
Sbjct  885   VKDLHSHASVAMYVLAKTTAIPEYEYIWQGSFEVQRGGNYLDLCGGVQAHLSTCASPKVL  944

Query  2805  DAVNKFPRKVILNEVPRLSSWPMQFKECGVSEDNVALFFFAKDIGSYEKSYKVLLGDMVK  2984
             + VNKF  KV L+EVPRLS WP  F + G  EDN+AL+FFAKD+ SYE+ YK+LL  M+K
Sbjct  945   EVVNKFQFKVPLSEVPRLSVWPSHFHQSGAKEDNIALYFFAKDLESYERDYKILLDAMIK  1004

Query  2985  HDLALQGNIGDIELLIFPSNQLPEKFQRWNLMFFLWGVFRGKRANSLQNFPGAEKPLIQD  3164
             +DLAL+GN   +ELLIFPSNQLPE+ QRWN++FFLWGVFR  R + L        P + +
Sbjct  1005  NDLALKGNFDGVELLIFPSNQLPERSQRWNMLFFLWGVFRTTRVHRLDFTKETCVPSLSN  1064

Query  3165  IPTPATSLPENMFTPVPKLNSARGSAATNTEMSAVKESESASLHKIVNGNCSIQSSSQVS  3344
                   +L EN+  P   ++    S       SA     ++ LH          S   VS
Sbjct  1065  SLDKYGTLSENLCIP-KHIDEFSASDKCRDVASAA----NSLLHM-----GPTVSKDHVS  1114

Query  3345  RDKC-------SRIN-AEQNDKLDSSSMQNS--------EPKLGPDRRYFGVPLGEAVHS  3476
             +D         S++N   QN +LDS++  N+           L  +    G  LG  + S
Sbjct  1115  KDTYPEEVRSGSKVNLMVQNSRLDSNTTNNAGLSEGVPCTASLQQEICLRGSGLGTEIKS  1174

Query  3477  SVQTAERVSSPNTSRPMSVHWAAPLDGEKLSMLSDETPTMQEATSVGSTTKNLC------  3638
             S+      SS    +   VHW    D E    L     + QE    GS  +         
Sbjct  1175  SIPITGSNSSIKGEK-RQVHWVTSGDREGAESLKIRPISNQEVAIAGSVAEETIPDRKKR  1233

Query  3639  -----GKDDVKIGRICLDNVSTEEATPLAR---HTSMEQTL-----NVISSFGVNPKKRS  3779
                  G ++V +  + +++V  ++   L R   +  +E  L       ++SF  + +K  
Sbjct  1234  VGLAGGVEEVILDGVNIESVECKQDKELKRDYGYKEIEAALVRDLTAKVNSFQSSKRKHP  1293

Query  3780  HSA--ETVLQsasssgtsqafssysNDDILVEEFCHKRVKLNSDRSYG--CNDQTSCSKD  3947
             H A  ET    AS++   +   +  N   +  E   K+ K+ S   YG   +  T+   D
Sbjct  1294  HIALSETA---ASAATNQEMSWNEVNSTQIDGEGDSKKPKIGSSGLYGRSTSRGTNAVDD  1350

Query  3948  GFLSEMGGTASQLSRQKNERDEALSKTAILETPGNAEMFFFPVDPHPVGNIGSNNSSMPW  4127
             GF+S        L  ++    EA  +  I E  G  E +FFPVD   V +  + ++S+PW
Sbjct  1351  GFVSHNDMGPCSLVEKRCV--EACEEKVIPEDLGTTERYFFPVDSRHVQHFHTVDNSVPW  1408

Query  4128  K-VHPLEEDQLHDKAPNLELALGAKTKPLMSGIPSFLSGKVEKKIIEENTSDNAATSANK  4304
             K     +ED+  D  P+LELALGA+TKP   GI  F  G  ++K  ++   D A      
Sbjct  1409  KGSSSGDEDKSRDGFPSLELALGAETKPQNKGILPFFVGLADEKNNQDKPLD-AVVDEKD  1467

Query  4305  EDVsaslslslsFPFPEKEHGTS--SKPEQEDPRRRQANTSLLLFGR  4439
             +D SASLSLSLSFPFP+KE      SK EQ  P R   NTSLLLFGR
Sbjct  1468  DDASASLSLSLSFPFPDKEQPVKPVSKSEQLLPERHHVNTSLLLFGR  1514



>ref|XP_008234528.1| PREDICTED: uncharacterized protein LOC103333472 isoform X5 [Prunus 
mume]
Length=1492

 Score =   609 bits (1571),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 478/1248 (38%), Positives = 656/1248 (53%), Gaps = 141/1248 (11%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEH-TYCMQKMLEKIPEGDWLCEECKFDQEMKNEHVNS  1115
             CDICG  GRE +LA+CSRC+DGAEH +YCM+KML ++P+  WLCEECKF +E  N+   S
Sbjct  301   CDICGDAGREDMLAMCSRCSDGAEHISYCMRKMLRRVPKAQWLCEECKFAEEADNQKQGS  360

Query  1116  GRVNEKEKTSPSRRTTIAKSDHPLKMEQKTSDCWGDKAVEERSYLKTSGKRCTDDSEVSS  1295
                                      ME K      DKA+    +   S KR  ++ EV+ 
Sbjct  361   ------------------------DMEGKKM----DKAILNTQF---SHKRLAENIEVAP  389

Query  1296  PTKRQRLELR--SPTAQIPNRVTSLSRESSFKNLERGKVKPLNPFSSG----SFAAKVPS  1457
               KRQ LE+R  SP    P R+ +LSRESSFK++++ +++     S      S  A+ PS
Sbjct  390   AAKRQALEIRVGSPRPSSPKRMGALSRESSFKSIDKDRLRSTYQSSQSINDISETARSPS  449

Query  1458  STGPQPQPPRGIFSKSNSFSSLIAKPKVKLVDEVFPAKQKLSRETAFIESKEVAVRSMGK  1637
             S G + Q  +G   KSNSF++L +KP+VK VD+V P KQK S+E + ++ KE   R MGK
Sbjct  450   S-GIRLQTTKGTLLKSNSFNTLTSKPRVKTVDDV-PQKQKGSKEHSSLDMKERVARMMGK  507

Query  1638  SMSFKPTTASRSNCTESKVKMFSPKFSHDQDVKWLRHKKDRSSFDRKNSLRSDR------  1799
             S+SFK   + RSN +ESKVKM S KFSH QD+K L+  K+RS+ +RKN  + DR      
Sbjct  508   SVSFKSANSGRSNVSESKVKMLSSKFSHVQDLKGLKQAKERSTVERKNLSKLDRPLASFP  567

Query  1800  LAGGAISSPKSDNKPTPRGEPSSLSSLNTNRDYRALTSDNKPVTISNSTSGVAREVL--K  1973
              A   +S+PK D  P  RGE S LSS++ NR+ + +  D K  TI+ S   + R+ +  +
Sbjct  568   AASPIVSTPKID--PASRGETSLLSSVSNNRESKVVLPDGKLSTIAKSIGNLTRKGVEPQ  625

Query  1974  QASVDGVSSANRVSSSEENPSQAIPKEDS--SSSSCVAERPSWSSNEVLPDGLSQSKESK  2147
              ASV G S+    +S+ E  S  +  +D   SS S + E+P  + +E L D   QS E  
Sbjct  626   NASVGGSSTNGICNSASEQKSNQVSSKDEPLSSYSGIVEKPCSNVDETLEDVFPQSVEMT  685

Query  2148  AFGDKTRESSASRSKQNSTASGKIVSCQKCKGNGHLAQVCTADGPESSAL--GSPFKSSR  2321
             +  DKTRESSA R +   TAS       KCK  GH A+ C A   ++S     +P  SSR
Sbjct  686   SQADKTRESSA-RCRPTVTAS------PKCKDIGHTAEFCRAGISQTSGTDASTPI-SSR  737

Query  2322  EATNGPSDLKAAIEAARLRKPGICRKNRVADQSEDLSASN--MKSEIASQDQMLSSTVRR  2495
             E     + LK AI AA LRKP I RK RV D S++LS SN  +  E+ASQ+Q L S    
Sbjct  738   EDMPRGNRLKDAIHAALLRKPEIYRKKRVFDPSDELSTSNVDLSYEVASQEQSLISNKLN  797

Query  2496  NVNGAE--------------EAQKQETANNAKQLGIIAEAS---ARTRNAGHVVFSDVKH  2624
             N+  +E              ++ K  T NN KQ  +    S   ++  ++  VV    K 
Sbjct  798   NITCSEGSHDGQTVLGTSTSDSYKNTTVNNLKQHTVQPIDSVFPSKVTDSVSVVPYLGKS  857

Query  2625  SVIDMERQTLVSMPVILK-TAIPEYQYIWQGGFEVQKSGKAFNLYDGIQAHLSSCASPKV  2801
             +V D+     V+M V+ K TAIPEY+YIWQG FEVQ+ G   +L  G+QAHLS+CASPKV
Sbjct  858   TVKDLHSHASVAMYVLAKTTAIPEYEYIWQGSFEVQRGGNYLDLCGGVQAHLSTCASPKV  917

Query  2802  LDAVNKFPRKVILNEVPRLSSWPMQFKECGVSEDNVALFFFAKDIGSYEKSYKVLLGDMV  2981
             L+ VNKF  KV L+EVPRLS WP  F + G  EDN+AL+FFAKD+ SYE+ YK+LL  M+
Sbjct  918   LEVVNKFQFKVPLSEVPRLSVWPSHFHQSGAKEDNIALYFFAKDLESYERDYKILLDAMI  977

Query  2982  KHDLALQGNIGDIELLIFPSNQLPEKFQRWNLMFFLWGVFRGKRANSLQNFPGAEKPLIQ  3161
             K+DLAL+GN   +ELLIFPSNQLPE+ QRWN++FFLWGVFR  R + L        P + 
Sbjct  978   KNDLALKGNFDGVELLIFPSNQLPERSQRWNMLFFLWGVFRTTRVHRLDFTKETCVPSLS  1037

Query  3162  DIPTPATSLPENMFTPVPKLNSARGSAATNTEMSAVKESESASLHKIVNGNCSIQSSSQV  3341
             +      +L EN+  P   ++    S       SA     ++ LH          S   V
Sbjct  1038  NSLDKYGTLSENLCIP-KHIDEFSASDKCRDVASAA----NSLLHM-----GPTVSKDHV  1087

Query  3342  SRDKC-------SRIN-AEQNDKLDSSSMQNS--------EPKLGPDRRYFGVPLGEAVH  3473
             S+D         S++N   QN +LDS++  N+           L  +    G  LG  + 
Sbjct  1088  SKDTYPEEVRSGSKVNLMVQNSRLDSNTTNNAGLSEGVPCTASLQQEICLRGSGLGTEIK  1147

Query  3474  SSVQTAERVSSPNTSRPMSVHWAAPLDGEKLSMLSDETPTMQEATSVGSTTKNLC-----  3638
             SS+      SS    +   VHW    D E    L     + QE    GS  +        
Sbjct  1148  SSIPITGSNSSIKGEK-RQVHWVTSGDREGAESLKIRPISNQEVAIAGSVAEETIPDRKK  1206

Query  3639  ------GKDDVKIGRICLDNVSTEEATPLAR---HTSMEQTL-----NVISSFGVNPKKR  3776
                   G ++V +  + +++V  ++   L R   +  +E  L       ++SF  + +K 
Sbjct  1207  RVGLAGGVEEVILDGVNIESVECKQDKELKRDYGYKEIEAALVRDLTAKVNSFQSSKRKH  1266

Query  3777  SHSA--ETVLQsasssgtsqafssysNDDILVEEFCHKRVKLNSDRSYG--CNDQTSCSK  3944
              H A  ET   +A++   S    + +  D    E   K+ K+ S   YG   +  T+   
Sbjct  1267  PHIALSETAASAATNQEMSWNEVNSTQID---GEGDSKKPKIGSSGLYGRSTSRGTNAVD  1323

Query  3945  DGFLSEMGGTASQLSRQKNERDEALSKTAILETPGNAEMFFFPVDPHPVGNIGSNNSSMP  4124
             DGF+S        L  ++    EA  +  I E  G  E +FFPVD   V +  + ++S+P
Sbjct  1324  DGFVSHNDMGPCSLVEKRCV--EACEEKVIPEDLGTTERYFFPVDSRHVQHFHTVDNSVP  1381

Query  4125  WK-VHPLEEDQLHDKAPNLELALGAKTKPLMSGIPSFLSGKVEKKIIEENTSDNAATSAN  4301
             WK     +ED+  D  P+LELALGA+TKP   GI  F  G  ++K  ++   D A     
Sbjct  1382  WKGSSSGDEDKSRDGFPSLELALGAETKPQNKGILPFFVGLADEKNNQDKPLD-AVVDEK  1440

Query  4302  KEDVsaslslslsFPFPEKEHGTS--SKPEQEDPRRRQANTSLLLFGR  4439
              +D SASLSLSLSFPFP+KE      SK EQ  P R   NTSLLLFGR
Sbjct  1441  DDDASASLSLSLSFPFPDKEQPVKPVSKSEQLLPERHHVNTSLLLFGR  1488



>ref|XP_008234524.1| PREDICTED: uncharacterized protein LOC103333472 isoform X1 [Prunus 
mume]
Length=1521

 Score =   610 bits (1573),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 478/1248 (38%), Positives = 656/1248 (53%), Gaps = 141/1248 (11%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEH-TYCMQKMLEKIPEGDWLCEECKFDQEMKNEHVNS  1115
             CDICG  GRE +LA+CSRC+DGAEH +YCM+KML ++P+  WLCEECKF +E  N+   S
Sbjct  330   CDICGDAGREDMLAMCSRCSDGAEHISYCMRKMLRRVPKAQWLCEECKFAEEADNQKQGS  389

Query  1116  GRVNEKEKTSPSRRTTIAKSDHPLKMEQKTSDCWGDKAVEERSYLKTSGKRCTDDSEVSS  1295
                                      ME K      DKA+    +   S KR  ++ EV+ 
Sbjct  390   ------------------------DMEGKKM----DKAILNTQF---SHKRLAENIEVAP  418

Query  1296  PTKRQRLELR--SPTAQIPNRVTSLSRESSFKNLERGKVKPLNPFSSG----SFAAKVPS  1457
               KRQ LE+R  SP    P R+ +LSRESSFK++++ +++     S      S  A+ PS
Sbjct  419   AAKRQALEIRVGSPRPSSPKRMGALSRESSFKSIDKDRLRSTYQSSQSINDISETARSPS  478

Query  1458  STGPQPQPPRGIFSKSNSFSSLIAKPKVKLVDEVFPAKQKLSRETAFIESKEVAVRSMGK  1637
             S G + Q  +G   KSNSF++L +KP+VK VD+V P KQK S+E + ++ KE   R MGK
Sbjct  479   S-GIRLQTTKGTLLKSNSFNTLTSKPRVKTVDDV-PQKQKGSKEHSSLDMKERVARMMGK  536

Query  1638  SMSFKPTTASRSNCTESKVKMFSPKFSHDQDVKWLRHKKDRSSFDRKNSLRSDR------  1799
             S+SFK   + RSN +ESKVKM S KFSH QD+K L+  K+RS+ +RKN  + DR      
Sbjct  537   SVSFKSANSGRSNVSESKVKMLSSKFSHVQDLKGLKQAKERSTVERKNLSKLDRPLASFP  596

Query  1800  LAGGAISSPKSDNKPTPRGEPSSLSSLNTNRDYRALTSDNKPVTISNSTSGVAREVL--K  1973
              A   +S+PK D  P  RGE S LSS++ NR+ + +  D K  TI+ S   + R+ +  +
Sbjct  597   AASPIVSTPKID--PASRGETSLLSSVSNNRESKVVLPDGKLSTIAKSIGNLTRKGVEPQ  654

Query  1974  QASVDGVSSANRVSSSEENPSQAIPKEDS--SSSSCVAERPSWSSNEVLPDGLSQSKESK  2147
              ASV G S+    +S+ E  S  +  +D   SS S + E+P  + +E L D   QS E  
Sbjct  655   NASVGGSSTNGICNSASEQKSNQVSSKDEPLSSYSGIVEKPCSNVDETLEDVFPQSVEMT  714

Query  2148  AFGDKTRESSASRSKQNSTASGKIVSCQKCKGNGHLAQVCTADGPESSAL--GSPFKSSR  2321
             +  DKTRESSA R +   TAS       KCK  GH A+ C A   ++S     +P  SSR
Sbjct  715   SQADKTRESSA-RCRPTVTAS------PKCKDIGHTAEFCRAGISQTSGTDASTPI-SSR  766

Query  2322  EATNGPSDLKAAIEAARLRKPGICRKNRVADQSEDLSASN--MKSEIASQDQMLSSTVRR  2495
             E     + LK AI AA LRKP I RK RV D S++LS SN  +  E+ASQ+Q L S    
Sbjct  767   EDMPRGNRLKDAIHAALLRKPEIYRKKRVFDPSDELSTSNVDLSYEVASQEQSLISNKLN  826

Query  2496  NVNGAE--------------EAQKQETANNAKQLGIIAEAS---ARTRNAGHVVFSDVKH  2624
             N+  +E              ++ K  T NN KQ  +    S   ++  ++  VV    K 
Sbjct  827   NITCSEGSHDGQTVLGTSTSDSYKNTTVNNLKQHTVQPIDSVFPSKVTDSVSVVPYLGKS  886

Query  2625  SVIDMERQTLVSMPVILK-TAIPEYQYIWQGGFEVQKSGKAFNLYDGIQAHLSSCASPKV  2801
             +V D+     V+M V+ K TAIPEY+YIWQG FEVQ+ G   +L  G+QAHLS+CASPKV
Sbjct  887   TVKDLHSHASVAMYVLAKTTAIPEYEYIWQGSFEVQRGGNYLDLCGGVQAHLSTCASPKV  946

Query  2802  LDAVNKFPRKVILNEVPRLSSWPMQFKECGVSEDNVALFFFAKDIGSYEKSYKVLLGDMV  2981
             L+ VNKF  KV L+EVPRLS WP  F + G  EDN+AL+FFAKD+ SYE+ YK+LL  M+
Sbjct  947   LEVVNKFQFKVPLSEVPRLSVWPSHFHQSGAKEDNIALYFFAKDLESYERDYKILLDAMI  1006

Query  2982  KHDLALQGNIGDIELLIFPSNQLPEKFQRWNLMFFLWGVFRGKRANSLQNFPGAEKPLIQ  3161
             K+DLAL+GN   +ELLIFPSNQLPE+ QRWN++FFLWGVFR  R + L        P + 
Sbjct  1007  KNDLALKGNFDGVELLIFPSNQLPERSQRWNMLFFLWGVFRTTRVHRLDFTKETCVPSLS  1066

Query  3162  DIPTPATSLPENMFTPVPKLNSARGSAATNTEMSAVKESESASLHKIVNGNCSIQSSSQV  3341
             +      +L EN+  P   ++    S       SA     ++ LH          S   V
Sbjct  1067  NSLDKYGTLSENLCIP-KHIDEFSASDKCRDVASAA----NSLLHM-----GPTVSKDHV  1116

Query  3342  SRDKC-------SRIN-AEQNDKLDSSSMQNS--------EPKLGPDRRYFGVPLGEAVH  3473
             S+D         S++N   QN +LDS++  N+           L  +    G  LG  + 
Sbjct  1117  SKDTYPEEVRSGSKVNLMVQNSRLDSNTTNNAGLSEGVPCTASLQQEICLRGSGLGTEIK  1176

Query  3474  SSVQTAERVSSPNTSRPMSVHWAAPLDGEKLSMLSDETPTMQEATSVGSTTKNLC-----  3638
             SS+      SS    +   VHW    D E    L     + QE    GS  +        
Sbjct  1177  SSIPITGSNSSIKGEK-RQVHWVTSGDREGAESLKIRPISNQEVAIAGSVAEETIPDRKK  1235

Query  3639  ------GKDDVKIGRICLDNVSTEEATPLAR---HTSMEQTL-----NVISSFGVNPKKR  3776
                   G ++V +  + +++V  ++   L R   +  +E  L       ++SF  + +K 
Sbjct  1236  RVGLAGGVEEVILDGVNIESVECKQDKELKRDYGYKEIEAALVRDLTAKVNSFQSSKRKH  1295

Query  3777  SHSA--ETVLQsasssgtsqafssysNDDILVEEFCHKRVKLNSDRSYG--CNDQTSCSK  3944
              H A  ET    AS++   +   +  N   +  E   K+ K+ S   YG   +  T+   
Sbjct  1296  PHIALSETA---ASAATNQEMSWNEVNSTQIDGEGDSKKPKIGSSGLYGRSTSRGTNAVD  1352

Query  3945  DGFLSEMGGTASQLSRQKNERDEALSKTAILETPGNAEMFFFPVDPHPVGNIGSNNSSMP  4124
             DGF+S        L  ++    EA  +  I E  G  E +FFPVD   V +  + ++S+P
Sbjct  1353  DGFVSHNDMGPCSLVEKRCV--EACEEKVIPEDLGTTERYFFPVDSRHVQHFHTVDNSVP  1410

Query  4125  WK-VHPLEEDQLHDKAPNLELALGAKTKPLMSGIPSFLSGKVEKKIIEENTSDNAATSAN  4301
             WK     +ED+  D  P+LELALGA+TKP   GI  F  G  ++K  ++   D A     
Sbjct  1411  WKGSSSGDEDKSRDGFPSLELALGAETKPQNKGILPFFVGLADEKNNQDKPLD-AVVDEK  1469

Query  4302  KEDVsaslslslsFPFPEKEHGTS--SKPEQEDPRRRQANTSLLLFGR  4439
              +D SASLSLSLSFPFP+KE      SK EQ  P R   NTSLLLFGR
Sbjct  1470  DDDASASLSLSLSFPFPDKEQPVKPVSKSEQLLPERHHVNTSLLLFGR  1517



>ref|XP_008234526.1| PREDICTED: uncharacterized protein LOC103333472 isoform X3 [Prunus 
mume]
Length=1519

 Score =   609 bits (1570),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 479/1248 (38%), Positives = 657/1248 (53%), Gaps = 143/1248 (11%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEH-TYCMQKMLEKIPEGDWLCEECKFDQEMKNEHVNS  1115
             CDICG  GRE +LA+CSRC+DGAEH +YCM+KML ++P+  WLCEECKF +E  N+    
Sbjct  330   CDICGDAGREDMLAMCSRCSDGAEHISYCMRKMLRRVPKAQWLCEECKFAEEADNQ----  385

Query  1116  GRVNEKEKTSPSRRTTIAKSDHPLKMEQKTSDCWGDKAVEERSYLKTSGKRCTDDSEVSS  1295
                               K D    ME K      DKA+    +   S KR  ++ EV+ 
Sbjct  386   ------------------KQD----MEGKKM----DKAILNTQF---SHKRLAENIEVAP  416

Query  1296  PTKRQRLELR--SPTAQIPNRVTSLSRESSFKNLERGKVKPLNPFSSG----SFAAKVPS  1457
               KRQ LE+R  SP    P R+ +LSRESSFK++++ +++     S      S  A+ PS
Sbjct  417   AAKRQALEIRVGSPRPSSPKRMGALSRESSFKSIDKDRLRSTYQSSQSINDISETARSPS  476

Query  1458  STGPQPQPPRGIFSKSNSFSSLIAKPKVKLVDEVFPAKQKLSRETAFIESKEVAVRSMGK  1637
             S G + Q  +G   KSNSF++L +KP+VK VD+V P KQK S+E + ++ KE   R MGK
Sbjct  477   S-GIRLQTTKGTLLKSNSFNTLTSKPRVKTVDDV-PQKQKGSKEHSSLDMKERVARMMGK  534

Query  1638  SMSFKPTTASRSNCTESKVKMFSPKFSHDQDVKWLRHKKDRSSFDRKNSLRSDR------  1799
             S+SFK   + RSN +ESKVKM S KFSH QD+K L+  K+RS+ +RKN  + DR      
Sbjct  535   SVSFKSANSGRSNVSESKVKMLSSKFSHVQDLKGLKQAKERSTVERKNLSKLDRPLASFP  594

Query  1800  LAGGAISSPKSDNKPTPRGEPSSLSSLNTNRDYRALTSDNKPVTISNSTSGVAREVL--K  1973
              A   +S+PK D  P  RGE S LSS++ NR+ + +  D K  TI+ S   + R+ +  +
Sbjct  595   AASPIVSTPKID--PASRGETSLLSSVSNNRESKVVLPDGKLSTIAKSIGNLTRKGVEPQ  652

Query  1974  QASVDGVSSANRVSSSEENPSQAIPKEDS--SSSSCVAERPSWSSNEVLPDGLSQSKESK  2147
              ASV G S+    +S+ E  S  +  +D   SS S + E+P  + +E L D   QS E  
Sbjct  653   NASVGGSSTNGICNSASEQKSNQVSSKDEPLSSYSGIVEKPCSNVDETLEDVFPQSVEMT  712

Query  2148  AFGDKTRESSASRSKQNSTASGKIVSCQKCKGNGHLAQVCTADGPESSAL--GSPFKSSR  2321
             +  DKTRESSA R +   TAS       KCK  GH A+ C A   ++S     +P  SSR
Sbjct  713   SQADKTRESSA-RCRPTVTAS------PKCKDIGHTAEFCRAGISQTSGTDASTPI-SSR  764

Query  2322  EATNGPSDLKAAIEAARLRKPGICRKNRVADQSEDLSASN--MKSEIASQDQMLSSTVRR  2495
             E     + LK AI AA LRKP I RK RV D S++LS SN  +  E+ASQ+Q L S    
Sbjct  765   EDMPRGNRLKDAIHAALLRKPEIYRKKRVFDPSDELSTSNVDLSYEVASQEQSLISNKLN  824

Query  2496  NVNGAE--------------EAQKQETANNAKQLGIIAEAS---ARTRNAGHVVFSDVKH  2624
             N+  +E              ++ K  T NN KQ  +    S   ++  ++  VV    K 
Sbjct  825   NITCSEGSHDGQTVLGTSTSDSYKNTTVNNLKQHTVQPIDSVFPSKVTDSVSVVPYLGKS  884

Query  2625  SVIDMERQTLVSMPVILK-TAIPEYQYIWQGGFEVQKSGKAFNLYDGIQAHLSSCASPKV  2801
             +V D+     V+M V+ K TAIPEY+YIWQG FEVQ+ G   +L  G+QAHLS+CASPKV
Sbjct  885   TVKDLHSHASVAMYVLAKTTAIPEYEYIWQGSFEVQRGGNYLDLCGGVQAHLSTCASPKV  944

Query  2802  LDAVNKFPRKVILNEVPRLSSWPMQFKECGVSEDNVALFFFAKDIGSYEKSYKVLLGDMV  2981
             L+ VNKF  KV L+EVPRLS WP  F + G  EDN+AL+FFAKD+ SYE+ YK+LL  M+
Sbjct  945   LEVVNKFQFKVPLSEVPRLSVWPSHFHQSGAKEDNIALYFFAKDLESYERDYKILLDAMI  1004

Query  2982  KHDLALQGNIGDIELLIFPSNQLPEKFQRWNLMFFLWGVFRGKRANSLQNFPGAEKPLIQ  3161
             K+DLAL+GN   +ELLIFPSNQLPE+ QRWN++FFLWGVFR  R + L        P + 
Sbjct  1005  KNDLALKGNFDGVELLIFPSNQLPERSQRWNMLFFLWGVFRTTRVHRLDFTKETCVPSLS  1064

Query  3162  DIPTPATSLPENMFTPVPKLNSARGSAATNTEMSAVKESESASLHKIVNGNCSIQSSSQV  3341
             +      +L EN+  P   ++    S       SA     ++ LH          S   V
Sbjct  1065  NSLDKYGTLSENLCIP-KHIDEFSASDKCRDVASAA----NSLLHM-----GPTVSKDHV  1114

Query  3342  SRDKC-------SRIN-AEQNDKLDSSSMQNS--------EPKLGPDRRYFGVPLGEAVH  3473
             S+D         S++N   QN +LDS++  N+           L  +    G  LG  + 
Sbjct  1115  SKDTYPEEVRSGSKVNLMVQNSRLDSNTTNNAGLSEGVPCTASLQQEICLRGSGLGTEIK  1174

Query  3474  SSVQTAERVSSPNTSRPMSVHWAAPLDGEKLSMLSDETPTMQEATSVGSTTKNLC-----  3638
             SS+      SS    +   VHW    D E    L     + QE    GS  +        
Sbjct  1175  SSIPITGSNSSIKGEK-RQVHWVTSGDREGAESLKIRPISNQEVAIAGSVAEETIPDRKK  1233

Query  3639  ------GKDDVKIGRICLDNVSTEEATPLAR---HTSMEQTL-----NVISSFGVNPKKR  3776
                   G ++V +  + +++V  ++   L R   +  +E  L       ++SF  + +K 
Sbjct  1234  RVGLAGGVEEVILDGVNIESVECKQDKELKRDYGYKEIEAALVRDLTAKVNSFQSSKRKH  1293

Query  3777  SHSA--ETVLQsasssgtsqafssysNDDILVEEFCHKRVKLNSDRSYG--CNDQTSCSK  3944
              H A  ET    AS++   +   +  N   +  E   K+ K+ S   YG   +  T+   
Sbjct  1294  PHIALSETA---ASAATNQEMSWNEVNSTQIDGEGDSKKPKIGSSGLYGRSTSRGTNAVD  1350

Query  3945  DGFLSEMGGTASQLSRQKNERDEALSKTAILETPGNAEMFFFPVDPHPVGNIGSNNSSMP  4124
             DGF+S        L  ++    EA  +  I E  G  E +FFPVD   V +  + ++S+P
Sbjct  1351  DGFVSHNDMGPCSLVEKRCV--EACEEKVIPEDLGTTERYFFPVDSRHVQHFHTVDNSVP  1408

Query  4125  WK-VHPLEEDQLHDKAPNLELALGAKTKPLMSGIPSFLSGKVEKKIIEENTSDNAATSAN  4301
             WK     +ED+  D  P+LELALGA+TKP   GI  F  G  ++K  ++   D A     
Sbjct  1409  WKGSSSGDEDKSRDGFPSLELALGAETKPQNKGILPFFVGLADEKNNQDKPLD-AVVDEK  1467

Query  4302  KEDVsaslslslsFPFPEKEHGTS--SKPEQEDPRRRQANTSLLLFGR  4439
              +D SASLSLSLSFPFP+KE      SK EQ  P R   NTSLLLFGR
Sbjct  1468  DDDASASLSLSLSFPFPDKEQPVKPVSKSEQLLPERHHVNTSLLLFGR  1515



>ref|XP_011012546.1| PREDICTED: uncharacterized protein LOC105116774 isoform X6 [Populus 
euphratica]
Length=1555

 Score =   588 bits (1515),  Expect = 5e-178, Method: Compositional matrix adjust.
 Identities = 474/1251 (38%), Positives = 662/1251 (53%), Gaps = 182/1251 (15%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNEHVNSG  1118
             CDICG  GRE  LAICSRC DGAEH YCM++ML+K+PEGDWLCEECK  +E +N+     
Sbjct  395   CDICGDAGREDFLAICSRCADGAEHIYCMREMLQKLPEGDWLCEECKLAEEAENQ-----  449

Query  1119  RVNEKEKTSPSRRTTIAKSDHPLKMEQKTSDCWGDKAVEERSYLKTSGKRCTDDSEVSSP  1298
                  ++ +  +R  +A +                         ++SGKR  +  E++  
Sbjct  450   -----KQDAEEKRMNVAST-------------------------QSSGKRHAEHMELALA  479

Query  1299  TKRQRLE--LRSPTAQIPNRVTSLSRESSFKNLERGKVKPLNPFSSGSFA------AKVP  1454
              KRQ  E  L SP +  P+R+ ++SR++SFK+L++GKVK  +  S G+ +         P
Sbjct  480   PKRQATETSLASPKSCSPSRIAAVSRDTSFKSLDKGKVKIAHQTSFGNRSNIDLPEIARP  539

Query  1455  SSTGPQPQPPRGIFSKSNSFSSLIAKPKVKLVDEVFPAKQKLSRETAFIESKEVAVRSMG  1634
             S  GP  Q P+G   KSNSF++L +K KVKLVDEV P K K +RE++ ++ KE   R M 
Sbjct  540   SVNGPHVQTPKGALLKSNSFNTLNSKMKVKLVDEV-PQKHKGARESS-LDMKEGTARMMR  597

Query  1635  KSMSFKPTTASRSNCTESKVKMFSPKFSHDQDVKWLRHKKDRSSFDRKNSLRSDRLAG--  1808
             KSMSFK  ++ RS+  E KVKM S KFSH QD + L+  KDR + DRK  LR  R  G  
Sbjct  598   KSMSFKSASSGRSSTNELKVKMLSSKFSHIQDSRGLKQVKDRDAVDRKKLLRLGRPPGSS  657

Query  1809  ----GAISSPKSDNKPTPRGEPSSLSSLNTNRDYRALTSDNKPVTISNSTS-----GVAR  1961
                   +S+PK D   T RGE    SS   NR+ ++  S+ K  T+S STS     G   
Sbjct  658   MTSSAVVSTPKVDQGFT-RGESVIASSTGNNRELKSAQSNGKLGTLSRSTSSAGCKGADT  716

Query  1962  EV--LKQASVDGVSSANRVSSSEENPSQAIPKEDSSSSSCVAERPSWSSNEVLPDGLSQS  2135
              V  ++ +S +G+SS    +S+E+  +Q  PK++ SSS   +   + ++ E L DGL +S
Sbjct  717   PVTSVQASSKNGISS----NSAEQKLNQINPKDEPSSS---SWNAASNATENLQDGLPRS  769

Query  2136  KESKAFGDKTRESSASRSKQNSTASGKIVSCQKCKGNGHLAQVCTADGPESSALGSPFKS  2315
             +ES   G+K RE+S SR +       K V+CQKCK   H  + CT   P +S  G+   +
Sbjct  770   RESSNQGEKARENSLSRLRPAGITGLKNVTCQKCKEICHATENCTVVSPLAS--GTDVSA  827

Query  2316  SR---EATNGPSDLKAAIEAA-RLRKPGICRKNRVADQSEDLSASNMK--SEIASQDQML  2477
             SR   E  +    LKAAIEAA  L+KPGI RK +  DQS+ LS+SN+    EIASQDQ+ 
Sbjct  828   SRIPKEEMSKGRKLKAAIEAAAMLKKPGIYRKKKEIDQSDGLSSSNVDESGEIASQDQL-  886

Query  2478  SSTVRRNVNGAEEAQ-----------KQETANNAKQLGIIA-EASARTRNAGHVVFSDVK  2621
              S + +   G +E Q           K    NN KQL   + +A    +     +   + 
Sbjct  887   -SVLNKMSEGTDEGQANISASSSDFCKSTIINNVKQLNEHSNDAVCPFKVGSDSIAPYLG  945

Query  2622  HSVID-MERQTLVSMPVILKTAIPEYQYIWQGGFEVQKSGKAFNLYDGIQAHLSSCASPK  2798
               V D  E+  L  M     +AIPE++YIWQG FEV ++ K  +LYDGIQAHLS+CASPK
Sbjct  946   KPVHDSAEKSVLTKM-----SAIPEHEYIWQGVFEVHRAEKVIDLYDGIQAHLSTCASPK  1000

Query  2799  VLDAVNKFPRKVILNEVPRLSSWPMQFKECGVSEDNVALFFFAKDIGSYEKSYKVLLGDM  2978
             VLD V+KFP+K+ L+EVP +S+WP QF   GV E+N+AL+FFAK+  SYE +YK LL +M
Sbjct  1001  VLDVVSKFPQKIKLDEVPCISTWPRQFLVTGVKEENIALYFFAKNFESYE-NYKRLLDNM  1059

Query  2979  VKHDLALQGNIGDIELLIFPSNQLPEKFQRWNLMFFLWGVFRGKRANSLQNFPGAEKPLI  3158
             +K DLAL+G+   +E  IFPS QLPE  QRWN+++FLWGVFRG+R++   +F     P +
Sbjct  1060  IKKDLALKGSFEGVEFFIFPSTQLPENSQRWNMLYFLWGVFRGRRSDCSDSFKKLVMPSL  1119

Query  3159  ------QDIPTPATSLPENMFTP--VPKLNSARGSAATNTEMSAVKESESASLHKIVNGN  3314
                   +DIP    +  EN+F P  + K  SA  S  ++    A    E  S+   +NGN
Sbjct  1120  NGVPRDKDIPAAVMTSSENIFVPECIVKNTSACDSPCSSDVHLAANAPEKPSVS--LNGN  1177

Query  3315  CSIQSSSQVSRDKC--SRINAEQND-KLDSSSMQN----SEP-------------KLGPD  3434
                      S DK   S+ N E+ D K+DS S+ N    S P             ++GP 
Sbjct  1178  ---------SDDKVFNSQTNLEKQDGKVDSRSLTNIRGSSNPWCPEARCSSPCLEEVGPP  1228

Query  3435  RRYFGV---PLGEAVHSSVQTAERVSSPNTSRPMSVHWAAPLDGEKLSMLSDETPTMQ--  3599
             R    V   P  E          R +S +  + + +H       E  S L ++ P+ +  
Sbjct  1229  RCSLDVDPKPCTEVT--------RTNSVSDVKEIQIH-------EGGSCLGEDMPSFKIF  1273

Query  3600  EATSVGSTTKNLCGKDDVKIGRICLDNVSTEEATPLARHTSMEQTLNV-ISSF-GVNPKK  3773
                S  S  + + G+D +      +D   +++   +      +  +N+ + +F G  P+K
Sbjct  1274  GVGSQNSGCRRIFGEDTI------VDRTFSDKDNIIVERDLNDDNVNMDVETFSGKGPRK  1327

Query  3774  R-----SHSAETVLQsasssgtsqafssysNDDILVE-EFCHKRVKLNSDRSYG---CND  3926
             R     S SA  +      S +   ++   N++ LV+ E   K++K      YG     D
Sbjct  1328  RPFLYLSDSAPLI------SSSMTPWNKADNNNTLVDGESISKKLKTGFSGRYGGSGSRD  1381

Query  3927  QTSCSKDGFLSEMGGTASQLSRQKNERDEALSKTAILETPGNAEMFFFPVDPHPVGNIGS  4106
             + S S   F S+     S  S ++   D+A ++  ILE  G +E +FFPVD H V +   
Sbjct  1382  ENSLS-GSFTSQTCDLGSSSSVEERSYDKASAEKVILEGLGTSERYFFPVDSHHVKDSRF  1440

Query  4107  NNSSMPWKVHPLEEDQLHDKAPNLELALGAKTKPLMSGIPSFLSGKVEKKIIEENTSDNA  4286
                SMPW     +ED + D  PNLELALGA+TK    GI  F  G  EK  I+    D  
Sbjct  1441  PAISMPWNSSN-DEDPVIDGIPNLELALGAETKSPNKGILPFF-GMAEKNRIQNKPPDKV  1498

Query  4287  ATSANKEDVsaslslslsFPFPEKEHGTS--SKPEQEDPRRRQANTSLLLF  4433
                   + VSASLSLSLSFPFP+KE      SK EQ  P R   NTSLLLF
Sbjct  1499  MNKEEDDGVSASLSLSLSFPFPDKEQTVKPVSKTEQLVPERCHVNTSLLLF  1549



>ref|XP_009348940.1| PREDICTED: uncharacterized protein LOC103940526 isoform X4 [Pyrus 
x bretschneideri]
Length=1454

 Score =   581 bits (1497),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 472/1231 (38%), Positives = 645/1231 (52%), Gaps = 140/1231 (11%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNEHVNSG  1118
             CDICG  GRE +LA+CSRC+DGAEH YCM+KML ++P+G WLCEECKF +E  N+   S 
Sbjct  296   CDICGDAGREDMLAMCSRCSDGAEHIYCMRKMLRRVPKGPWLCEECKFTEETDNQKQGS-  354

Query  1119  RVNEKEKTSPSRRTTIAKSDHPLKMEQKTSDCWGDKAVEERSYLKTSGKRCTDDSEVSSP  1298
                                     ME K  +    KA+    +   S KR  ++ EV+  
Sbjct  355   -----------------------DMEVKRKE----KAIMSTQF---SNKRLAENIEVAPS  384

Query  1299  TKRQRLELR--SPTAQIPNRVTSLSRESSFKNLERGKVKPLNPFSSGSFAAKVPSSTGPQ  1472
              KRQ LE+R  SP    P R+ +LSRESSFK+L++ +++P    S G+      + +   
Sbjct  385   VKRQGLEMRVGSPKPSSPKRMGALSRESSFKSLDKDRLRPAYQTSQGTNNISETARSPSN  444

Query  1473  PQPPRGIFSKSNSFSSLIAKPKVKLVDEVFPAKQKLSRETAFIESKEVAV-RSMGKSMSF  1649
                 +G FSKSNSF++L +KPKVK VDEV P KQK  +E A ++ KE  V R MGKS+SF
Sbjct  445   GIGAKGTFSKSNSFNTLNSKPKVKHVDEVVPHKQKGFKEHASLDMKERVVPRIMGKSVSF  504

Query  1650  KPTTASRSNCTESKVKMFSPKFSHDQDVKWLRHKKDRSSFDRKNSLRSDR------LAGG  1811
             K  ++ RSN +ESKVKM S KFSH  D+K L+  K+RS+ +RKN  + DR       A  
Sbjct  505   KSASSGRSNVSESKVKMLSSKFSHVSDLKGLKQAKERSAVERKNLSKLDRPMANFTTANS  564

Query  1812  AISSPKSDNKPTPRGEPSSLSSLNTNRDYRALTSDNKPVTISNSTSGVAREVLKQ---AS  1982
              +S+PKSD     RGE S LSS+ +NR+ +    D K   +S S S V RE       + 
Sbjct  565   IVSTPKSD--LASRGETSLLSSV-SNREPKVALPDGK---LSTSKSSVTREGFDTQITSG  618

Query  1983  VDGVSSANRVSSSEENPSQAIPKEDSSSSSCVAERPSWSSNEVLPDGLSQSKESKAFGDK  2162
                  +    S+SE+  +    K++S SSS   E+   + +    D L QS E     DK
Sbjct  619   GGSSMNGMSSSASEQKLNHVSFKDESLSSSVTVEKLHCNVDGTSEDVLPQSGEMIDQDDK  678

Query  2163  TRESSASRSKQNSTASGKIVSCQKCKGNGHLAQ-----VCTADGPESSALGSPFKSSREA  2327
              RESS          +  +V+  KCK  G  A+     +  A G ++SA   P  S  E 
Sbjct  679   ARESSV-------RCTPAVVASPKCKEIGINAEFGRPVISQASGTDASA---PRGSKEEI  728

Query  2328  TNGPSDLKAAIEAARLRKPGICRKNRVADQSEDLSASNMKS--EIASQDQMLSSTVRRNV  2501
               G + LK AI AA LRK  I RK RV DQS++ S  NM S  E+A+Q+Q   S   R +
Sbjct  729   QRG-NRLKDAIHAAVLRKSEIYRKKRVFDQSDESSTPNMDSSYEVAAQEQ---SPDGRAI  784

Query  2502  NGAE--EAQKQETANNAKQLGII-AEASARTRNAGHVVFSDVKHSVIDMERQTLVSMPVI  2672
              G    ++ K  T NN KQL +   ++   ++ A  V     K +V D+      +M V+
Sbjct  785   LGTSTSDSSKNTTVNNLKQLTVQPIDSGFPSKVAYSVSVVPGKPTVKDLHNHASGAMSVL  844

Query  2673  LKT-AIPEYQYIWQGGFEVQKSGKAFNLYDGIQAHLSSCASPKVLDAVNKFPRKVILNEV  2849
             +KT AIPEY+YIWQG FEVQ+SG   +L  GIQAHLS+CASPKV + VNKFP KV LNEV
Sbjct  845   VKTTAIPEYEYIWQGSFEVQRSGNFMDLCGGIQAHLSTCASPKVPEVVNKFPHKVSLNEV  904

Query  2850  PRLSSWPMQFKECGVSEDNVALFFFAKDIGSYEKSYKVLLGDMVKHDLALQGNIGDIELL  3029
             PRLS WP QF++ G  EDN+AL+FFAKD+ SYE+ Y  LL  MVK+DLAL+GN   +ELL
Sbjct  905   PRLSVWPSQFRQSGAKEDNIALYFFAKDLDSYERHYNSLLDAMVKNDLALKGNFDGVELL  964

Query  3030  IFPSNQLPEKFQRWNLMFFLWGVFRGKRANSLQNFPGAEKPLIQD----IPTPATSLPEN  3197
             IFPSNQLPEK QRWN++FFLWGVFR  R + L +F     P + +     PT   +L EN
Sbjct  965   IFPSNQLPEKSQRWNMLFFLWGVFRTMRVHCL-DFTETCVPSLSNSFHKAPTDGMTLSEN  1023

Query  3198  MFTPVPKLNSARGSAATNTEMSAVKESESASLHK--IVNGNCSIQSSSQVSRDKCSRIN-  3368
             +  P     S+    + +     V  + +ASLH    V  +C  + +        S++N 
Sbjct  1024  ICIPKHIDESSPSDRSFD-----VPSASNASLHMGPTVTKDCENKDTYPEEVRLGSKVNL  1078

Query  3369  AEQNDKLDSSSMQNSEPKLGPDRRYFGVP-----------LGEAVHSSVQTAERVSSPNT  3515
             A Q+ ++DS++  N+    G +   +  P           +G+ + SS+ T    SS N 
Sbjct  1079  AVQDCRVDSNTTNNAGLSEGVE---YITPCLQESCLRESRVGKEIKSSIPTTGSNSS-NK  1134

Query  3516  SRPMSVHWAAPLDGEKLSMLSDETPTMQEAT---SVGST--------TKNLCGKDDVKIG  3662
                  VHW   +D E    L     + +E     SVG               G ++V + 
Sbjct  1135  GEKRQVHWVTSVDREDADSLEIRLVSSREVAVSRSVGDDRFPDRKKRVGIAGGVEEVILD  1194

Query  3663  RICLDNVSTEEATPLAR---HTSMEQTLNVISSFGVN---PKKRSHSAETVLQsasssgt  3824
             R+ +D    ++   L R   +   E  L    +  VN   P  R H    + +  +S+ T
Sbjct  1195  RVRMDKAHFKQERELRRDYGYKESEAALVRDLTARVNSCQPSDRKHPDIPISERTTSAAT  1254

Query  3825  sqafs-sysNDDILVEEFCHKRVKLNSDRSYGCNDQTSCSKDGFLSEMGGTASQLSRQKN  4001
             +Q    +  N   +  E   K+ K+ S    GC            S   GT + +   K+
Sbjct  1255  TQEMPWNEVNITQMDVEIDRKKPKIGSSGFDGC------------STSRGTEAVV---KD  1299

Query  4002  ER-DEALSKTAILETPGNAEMFFFPVDPHPVGNIGSNNSSMPWK-VHPLEEDQLHDKAPN  4175
             +R  EA  +  I E  GN E +FFP+D   V + G   +S+PWK       D+  +  P+
Sbjct  1300  KRCFEACEEKVIPEDLGNTERYFFPLDSRHVQHFGPVGNSVPWKDFSSGYVDKTREGFPS  1359

Query  4176  LELALGAKTKPLMSGIPSFLSGKVEKKIIEENTSDNAATSANK-EDVsaslslslsFPFP  4352
             LELALG +TKP   GI  F  G  ++K+  ++    AA    K +DVSASLSLSLSFPFP
Sbjct  1360  LELALGGETKPQNKGILPFFVGLADEKVNNQDKPLEAAVVDEKDDDVSASLSLSLSFPFP  1419

Query  4353  EKEHGTS--SKPEQEDPRRRQANTSLLLFGR  4439
             +KE      SKPEQ  P R   NTSLLLFGR
Sbjct  1420  DKEQPGKPVSKPEQLLPERHHVNTSLLLFGR  1450



>ref|XP_009348939.1| PREDICTED: uncharacterized protein LOC103940526 isoform X3 [Pyrus 
x bretschneideri]
Length=1461

 Score =   574 bits (1480),  Expect = 6e-174, Method: Compositional matrix adjust.
 Identities = 472/1238 (38%), Positives = 645/1238 (52%), Gaps = 147/1238 (12%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNEHVNSG  1118
             CDICG  GRE +LA+CSRC+DGAEH YCM+KML ++P+G WLCEECKF +E  N+   S 
Sbjct  296   CDICGDAGREDMLAMCSRCSDGAEHIYCMRKMLRRVPKGPWLCEECKFTEETDNQKQGS-  354

Query  1119  RVNEKEKTSPSRRTTIAKSDHPLKMEQKTSDCWGDKAVEERSYLKTSGKRCTDDSEVSSP  1298
                                     ME K  +    KA+    +   S KR  ++ EV+  
Sbjct  355   -----------------------DMEVKRKE----KAIMSTQF---SNKRLAENIEVAPS  384

Query  1299  TKRQRLELR--SPTAQIPNRVTSLSRESSFKNLERGKVKPLNPFSSGSFAAKVPSSTGPQ  1472
              KRQ LE+R  SP    P R+ +LSRESSFK+L++ +++P    S G+      + +   
Sbjct  385   VKRQGLEMRVGSPKPSSPKRMGALSRESSFKSLDKDRLRPAYQTSQGTNNISETARSPSN  444

Query  1473  PQPPRGIFSKSNSFSSLIAKPKVKLVDEVFPAKQKLSRETAFIESKEVAV-RSMGKSMSF  1649
                 +G FSKSNSF++L +KPKVK VDEV P KQK  +E A ++ KE  V R MGKS+SF
Sbjct  445   GIGAKGTFSKSNSFNTLNSKPKVKHVDEVVPHKQKGFKEHASLDMKERVVPRIMGKSVSF  504

Query  1650  KPTTASRSNCTESKVKMFSPKFSHDQDVKWLRHKKDRSSFDRKNSLRSDR------LAGG  1811
             K  ++ RSN +ESKVKM S KFSH  D+K L+  K+RS+ +RKN  + DR       A  
Sbjct  505   KSASSGRSNVSESKVKMLSSKFSHVSDLKGLKQAKERSAVERKNLSKLDRPMANFTTANS  564

Query  1812  AISSPKSDNKPTPRGEPSSLSSLNTNRDYRALTSDNKPVTISNSTSGVAREVLKQ---AS  1982
              +S+PKSD     RGE S LSS+ +NR+ +    D K   +S S S V RE       + 
Sbjct  565   IVSTPKSD--LASRGETSLLSSV-SNREPKVALPDGK---LSTSKSSVTREGFDTQITSG  618

Query  1983  VDGVSSANRVSSSEENPSQAIPKEDSSSSSCVAERPSWSSNEVLPDGLSQSKESKAFGDK  2162
                  +    S+SE+  +    K++S SSS   E+   + +    D L QS E     DK
Sbjct  619   GGSSMNGMSSSASEQKLNHVSFKDESLSSSVTVEKLHCNVDGTSEDVLPQSGEMIDQDDK  678

Query  2163  TRESSASRSKQNSTASGKIVSCQKCKGNGHLAQ-----VCTADGPESSALGSPFKSSREA  2327
              RESS          +  +V+  KCK  G  A+     +  A G ++SA   P  S  E 
Sbjct  679   ARESSVR-------CTPAVVASPKCKEIGINAEFGRPVISQASGTDASA---PRGSKEEI  728

Query  2328  TNGPSDLKAAIEAARLRKPGICRKNRVADQSEDLSASNMKS--EIASQDQMLSSTVRRNV  2501
               G + LK AI AA LRK  I RK RV DQS++ S  NM S  E+A+Q+Q   S   R +
Sbjct  729   QRG-NRLKDAIHAAVLRKSEIYRKKRVFDQSDESSTPNMDSSYEVAAQEQ---SPDGRAI  784

Query  2502  NGAE--EAQKQETANNAKQLGII-AEASARTRNAGHVVFSDVKHSVIDMERQTLVSMPVI  2672
              G    ++ K  T NN KQL +   ++   ++ A  V     K +V D+      +M V+
Sbjct  785   LGTSTSDSSKNTTVNNLKQLTVQPIDSGFPSKVAYSVSVVPGKPTVKDLHNHASGAMSVL  844

Query  2673  LKT-AIPEYQYIWQ-------GGFEVQKSGKAFNLYDGIQAHLSSCASPKVLDAVNKFPR  2828
             +KT AIPEY+YIWQ       G FEVQ+SG   +L  GIQAHLS+CASPKV + VNKFP 
Sbjct  845   VKTTAIPEYEYIWQLILFSCRGSFEVQRSGNFMDLCGGIQAHLSTCASPKVPEVVNKFPH  904

Query  2829  KVILNEVPRLSSWPMQFKECGVSEDNVALFFFAKDIGSYEKSYKVLLGDMVKHDLALQGN  3008
             KV LNEVPRLS WP QF++ G  EDN+AL+FFAKD+ SYE+ Y  LL  MVK+DLAL+GN
Sbjct  905   KVSLNEVPRLSVWPSQFRQSGAKEDNIALYFFAKDLDSYERHYNSLLDAMVKNDLALKGN  964

Query  3009  IGDIELLIFPSNQLPEKFQRWNLMFFLWGVFRGKRANSLQNFPGAEKPLIQD----IPTP  3176
                +ELLIFPSNQLPEK QRWN++FFLWGVFR  R + L +F     P + +     PT 
Sbjct  965   FDGVELLIFPSNQLPEKSQRWNMLFFLWGVFRTMRVHCL-DFTETCVPSLSNSFHKAPTD  1023

Query  3177  ATSLPENMFTPVPKLNSARGSAATNTEMSAVKESESASLHK--IVNGNCSIQSSSQVSRD  3350
               +L EN+  P     S+    + +     V  + +ASLH    V  +C  + +      
Sbjct  1024  GMTLSENICIPKHIDESSPSDRSFD-----VPSASNASLHMGPTVTKDCENKDTYPEEVR  1078

Query  3351  KCSRIN-AEQNDKLDSSSMQNSEPKLGPDRRYFGVP-----------LGEAVHSSVQTAE  3494
               S++N A Q+ ++DS++  N+    G +   +  P           +G+ + SS+ T  
Sbjct  1079  LGSKVNLAVQDCRVDSNTTNNAGLSEGVE---YITPCLQESCLRESRVGKEIKSSIPTTG  1135

Query  3495  RVSSPNTSRPMSVHWAAPLDGEKLSMLSDETPTMQEAT---SVGST--------TKNLCG  3641
               SS N      VHW   +D E    L     + +E     SVG               G
Sbjct  1136  SNSS-NKGEKRQVHWVTSVDREDADSLEIRLVSSREVAVSRSVGDDRFPDRKKRVGIAGG  1194

Query  3642  KDDVKIGRICLDNVSTEEATPLAR---HTSMEQTLNVISSFGVN---PKKRSHSAETVLQ  3803
              ++V + R+ +D    ++   L R   +   E  L    +  VN   P  R H    + +
Sbjct  1195  VEEVILDRVRMDKAHFKQERELRRDYGYKESEAALVRDLTARVNSCQPSDRKHPDIPISE  1254

Query  3804  sasssgtsqafs-sysNDDILVEEFCHKRVKLNSDRSYGCNDQTSCSKDGFLSEMGGTAS  3980
               +S+ T+Q    +  N   +  E   K+ K+ S    GC            S   GT +
Sbjct  1255  RTTSAATTQEMPWNEVNITQMDVEIDRKKPKIGSSGFDGC------------STSRGTEA  1302

Query  3981  QLSRQKNER-DEALSKTAILETPGNAEMFFFPVDPHPVGNIGSNNSSMPWK-VHPLEEDQ  4154
              +   K++R  EA  +  I E  GN E +FFP+D   V + G   +S+PWK       D+
Sbjct  1303  VV---KDKRCFEACEEKVIPEDLGNTERYFFPLDSRHVQHFGPVGNSVPWKDFSSGYVDK  1359

Query  4155  LHDKAPNLELALGAKTKPLMSGIPSFLSGKVEKKIIEENTSDNAATSANK-EDVsaslsl  4331
               +  P+LELALG +TKP   GI  F  G  ++K+  ++    AA    K +DVSASLSL
Sbjct  1360  TREGFPSLELALGGETKPQNKGILPFFVGLADEKVNNQDKPLEAAVVDEKDDDVSASLSL  1419

Query  4332  slsFPFPEKEHGTS--SKPEQEDPRRRQANTSLLLFGR  4439
             SLSFPFP+KE      SKPEQ  P R   NTSLLLFGR
Sbjct  1420  SLSFPFPDKEQPGKPVSKPEQLLPERHHVNTSLLLFGR  1457



>ref|XP_009348938.1| PREDICTED: uncharacterized protein LOC103940526 isoform X2 [Pyrus 
x bretschneideri]
Length=1461

 Score =   573 bits (1478),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 472/1238 (38%), Positives = 645/1238 (52%), Gaps = 147/1238 (12%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNEHVNSG  1118
             CDICG  GRE +LA+CSRC+DGAEH YCM+KML ++P+G WLCEECKF +E  N+   S 
Sbjct  296   CDICGDAGREDMLAMCSRCSDGAEHIYCMRKMLRRVPKGPWLCEECKFTEETDNQKQGS-  354

Query  1119  RVNEKEKTSPSRRTTIAKSDHPLKMEQKTSDCWGDKAVEERSYLKTSGKRCTDDSEVSSP  1298
                                     ME K  +    KA+    +   S KR  ++ EV+  
Sbjct  355   -----------------------DMEVKRKE----KAIMSTQF---SNKRLAENIEVAPS  384

Query  1299  TKRQRLELR--SPTAQIPNRVTSLSRESSFKNLERGKVKPLNPFSSGSFAAKVPSSTGPQ  1472
              KRQ LE+R  SP    P R+ +LSRESSFK+L++ +++P    S G+      + +   
Sbjct  385   VKRQGLEMRVGSPKPSSPKRMGALSRESSFKSLDKDRLRPAYQTSQGTNNISETARSPSN  444

Query  1473  PQPPRGIFSKSNSFSSLIAKPKVKLVDEVFPAKQKLSRETAFIESKEVAV-RSMGKSMSF  1649
                 +G FSKSNSF++L +KPKVK VDEV P KQK  +E A ++ KE  V R MGKS+SF
Sbjct  445   GIGAKGTFSKSNSFNTLNSKPKVKHVDEVVPHKQKGFKEHASLDMKERVVPRIMGKSVSF  504

Query  1650  KPTTASRSNCTESKVKMFSPKFSHDQDVKWLRHKKDRSSFDRKNSLRSDR------LAGG  1811
             K  ++ RSN +ESKVKM S KFSH  D+K L+  K+RS+ +RKN  + DR       A  
Sbjct  505   KSASSGRSNVSESKVKMLSSKFSHVSDLKGLKQAKERSAVERKNLSKLDRPMANFTTANS  564

Query  1812  AISSPKSDNKPTPRGEPSSLSSLNTNRDYRALTSDNKPVTISNSTSGVAREVLKQ---AS  1982
              +S+PKSD     RGE S LSS+ +NR+ +    D K   +S S S V RE       + 
Sbjct  565   IVSTPKSD--LASRGETSLLSSV-SNREPKVALPDGK---LSTSKSSVTREGFDTQITSG  618

Query  1983  VDGVSSANRVSSSEENPSQAIPKEDSSSSSCVAERPSWSSNEVLPDGLSQSKESKAFGDK  2162
                  +    S+SE+  +    K++S SSS   E+   + +    D L QS E     DK
Sbjct  619   GGSSMNGMSSSASEQKLNHVSFKDESLSSSVTVEKLHCNVDGTSEDVLPQSGEMIDQDDK  678

Query  2163  TRESSASRSKQNSTASGKIVSCQKCKGNGHLAQ-----VCTADGPESSALGSPFKSSREA  2327
              RESS          +  +V+  KCK  G  A+     +  A G ++SA   P  S  E 
Sbjct  679   ARESSVR-------CTPAVVASPKCKEIGINAEFGRPVISQASGTDASA---PRGSKEEI  728

Query  2328  TNGPSDLKAAIEAARLRKPGICRKNRVADQSEDLSASNMKS--EIASQDQMLSSTVRRNV  2501
               G + LK AI AA LRK  I RK RV DQS++ S  NM S  E+A+Q+Q   S   R +
Sbjct  729   QRG-NRLKDAIHAAVLRKSEIYRKKRVFDQSDESSTPNMDSSYEVAAQEQ---SPDGRAI  784

Query  2502  NGAE--EAQKQETANNAKQLGII-AEASARTRNAGHVVFSDVKHSVIDMERQTLVSMPVI  2672
              G    ++ K  T NN KQL +   ++   ++ A  V     K +V D+      +M V+
Sbjct  785   LGTSTSDSSKNTTVNNLKQLTVQPIDSGFPSKVAYSVSVVPGKPTVKDLHNHASGAMSVL  844

Query  2673  LKT-AIPEYQYIWQGGFEVQKSGKAFNLYDGIQAHLSSCASPKVLDAVNKFPRKVILNEV  2849
             +KT AIPEY+YIWQG FEVQ+SG   +L  GIQAHLS+CASPKV + VNKFP KV LNEV
Sbjct  845   VKTTAIPEYEYIWQGSFEVQRSGNFMDLCGGIQAHLSTCASPKVPEVVNKFPHKVSLNEV  904

Query  2850  PRLSSWPMQFKECGVSEDNVALFFFAKDIG-------SYEKSYKVLLGDMVKHDLALQGN  3008
             PRLS WP QF++ G  EDN+AL+FFAKD+        SYE+ Y  LL  MVK+DLAL+GN
Sbjct  905   PRLSVWPSQFRQSGAKEDNIALYFFAKDLDSRFNFRCSYERHYNSLLDAMVKNDLALKGN  964

Query  3009  IGDIELLIFPSNQLPEKFQRWNLMFFLWGVFRGKRANSLQNFPGAEKPLIQD----IPTP  3176
                +ELLIFPSNQLPEK QRWN++FFLWGVFR  R + L +F     P + +     PT 
Sbjct  965   FDGVELLIFPSNQLPEKSQRWNMLFFLWGVFRTMRVHCL-DFTETCVPSLSNSFHKAPTD  1023

Query  3177  ATSLPENMFTPVPKLNSARGSAATNTEMSAVKESESASLHK--IVNGNCSIQSSSQVSRD  3350
               +L EN+  P     S+    + +     V  + +ASLH    V  +C  + +      
Sbjct  1024  GMTLSENICIPKHIDESSPSDRSFD-----VPSASNASLHMGPTVTKDCENKDTYPEEVR  1078

Query  3351  KCSRIN-AEQNDKLDSSSMQNSEPKLGPDRRYFGVP-----------LGEAVHSSVQTAE  3494
               S++N A Q+ ++DS++  N+    G +   +  P           +G+ + SS+ T  
Sbjct  1079  LGSKVNLAVQDCRVDSNTTNNAGLSEGVE---YITPCLQESCLRESRVGKEIKSSIPTTG  1135

Query  3495  RVSSPNTSRPMSVHWAAPLDGEKLSMLSDETPTMQEAT---SVGST--------TKNLCG  3641
               SS N      VHW   +D E    L     + +E     SVG               G
Sbjct  1136  SNSS-NKGEKRQVHWVTSVDREDADSLEIRLVSSREVAVSRSVGDDRFPDRKKRVGIAGG  1194

Query  3642  KDDVKIGRICLDNVSTEEATPLAR---HTSMEQTLNVISSFGVN---PKKRSHSAETVLQ  3803
              ++V + R+ +D    ++   L R   +   E  L    +  VN   P  R H    + +
Sbjct  1195  VEEVILDRVRMDKAHFKQERELRRDYGYKESEAALVRDLTARVNSCQPSDRKHPDIPISE  1254

Query  3804  sasssgtsqafs-sysNDDILVEEFCHKRVKLNSDRSYGCNDQTSCSKDGFLSEMGGTAS  3980
               +S+ T+Q    +  N   +  E   K+ K+ S    GC            S   GT +
Sbjct  1255  RTTSAATTQEMPWNEVNITQMDVEIDRKKPKIGSSGFDGC------------STSRGTEA  1302

Query  3981  QLSRQKNER-DEALSKTAILETPGNAEMFFFPVDPHPVGNIGSNNSSMPWK-VHPLEEDQ  4154
              +   K++R  EA  +  I E  GN E +FFP+D   V + G   +S+PWK       D+
Sbjct  1303  VV---KDKRCFEACEEKVIPEDLGNTERYFFPLDSRHVQHFGPVGNSVPWKDFSSGYVDK  1359

Query  4155  LHDKAPNLELALGAKTKPLMSGIPSFLSGKVEKKIIEENTSDNAATSANK-EDVsaslsl  4331
               +  P+LELALG +TKP   GI  F  G  ++K+  ++    AA    K +DVSASLSL
Sbjct  1360  TREGFPSLELALGGETKPQNKGILPFFVGLADEKVNNQDKPLEAAVVDEKDDDVSASLSL  1419

Query  4332  slsFPFPEKEHGTS--SKPEQEDPRRRQANTSLLLFGR  4439
             SLSFPFP+KE      SKPEQ  P R   NTSLLLFGR
Sbjct  1420  SLSFPFPDKEQPGKPVSKPEQLLPERHHVNTSLLLFGR  1457



>ref|XP_009361135.1| PREDICTED: uncharacterized protein LOC103951480 isoform X2 [Pyrus 
x bretschneideri]
Length=1439

 Score =   570 bits (1470),  Expect = 9e-173, Method: Compositional matrix adjust.
 Identities = 458/1227 (37%), Positives = 630/1227 (51%), Gaps = 134/1227 (11%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNEHVNSG  1118
             CDICG  GRE +LA+CSRC+DGAEH YCM+KML ++P+G WLCEECKF +E  N+   S 
Sbjct  283   CDICGDAGREDMLAMCSRCSDGAEHIYCMRKMLRRVPKGRWLCEECKFAEETDNQKQGSD  342

Query  1119  -RVNEKEKTSPSRRTTIAKSDHPLKMEQKTSDCWGDKAVEERSYLKTSGKRCTDDSEVSS  1295
               V   EK   S                                 + S KR  +  EV+ 
Sbjct  343   VEVKRMEKVITS--------------------------------TQISNKRLAESVEVAP  370

Query  1296  PTKRQRLELR--SPTAQIPNRVTSLSRESSFKNLERGKVKPLNPFSSGSFAAKVPSSTGP  1469
               KRQ LE+R  SP A  P R+ +LSRESSFK+L++ +++   P S  +      + +  
Sbjct  371   SVKRQALEMRVGSPKASSPKRMGALSRESSFKSLDKDRLRSAYPISQSTNDISETARSPS  430

Query  1470  QPQPPRGIFSKSNSFSSLIAKPKVKLVDEVFPAKQKLSRETAFIESKE-VAVRSMGKSMS  1646
                  +G FSKSNSF++LI+KPKVKLVDEV P KQK S+E A  + KE V  R MG+S+S
Sbjct  431   NGLRAKGTFSKSNSFNTLISKPKVKLVDEVVPQKQKGSKEHASFDMKERVVSRMMGRSVS  490

Query  1647  FKPTTASRSNCTESKVKMFSPKFSHDQDVKWLRHKKDRSSFDRKNSLRSDR------LAG  1808
             FK  ++ RSN +E+KVKM S KFSH  D+K L+  K+ S+ +RKN  + DR       A 
Sbjct  491   FKSASSGRSNVSETKVKMLSSKFSHVPDLKGLKQAKEWSTVERKNLSKLDRPKANLITAS  550

Query  1809  GAISSPKSDNKPTPRGEPSSLSSLNTNRDYRALTSDNKPVTISNSTS---GVAREVLKQA  1979
                S+PKSD     R E S LSS+ +NR+ +    D K  T S S+    GV  +V    
Sbjct  551   PIFSTPKSD--LASRCETSLLSSV-SNREPKVALPDGKLSTSSKSSLTRKGVDTQVASGG  607

Query  1980  SVDGVSSANRVSSSEENPSQAIPKEDS-SSSSCVAERPSWSSNEVLPDGLSQSKESKAFG  2156
                   +    S+SE+  +Q   K++S SS S   E    + +  L D L QS E     
Sbjct  608   GS--SMNGMSSSASEQRSNQVSSKDESLSSYSGTVETSRCNLDGTLEDVLPQSGEMADQD  665

Query  2157  DKTRESSASRSKQNSTASGKIVSCQKCKGNGHL---AQVCTADGPESSALGSPFKSSREA  2327
             DK RESS  R +    AS K     K +GN      A +    G ++ A     +SSRE 
Sbjct  666   DKARESSV-RCRPAVVASPKF----KERGNNTEFGGAGISQTSGTDACAP----RSSREE  716

Query  2328  TNGPSDLKAAIEAARLRKPGICRKNRVADQSEDLSASNM--KSEIASQDQ------MLSS  2483
                 + LK AI AA LRKP I RK RV DQS++LS  NM    E+A+Q+Q      +L +
Sbjct  717   MQRGNRLKNAIHAALLRKPEIYRKKRVLDQSDELSTLNMDLSYEVATQEQSPDGHAILGT  776

Query  2484  TVRRNVNGAEEAQKQETANNAKQLG---IIAEASARTRNAGHVVFSDVKHSVIDMERQTL  2654
             +   + N         T NN KQ+    I +   ++  ++  VV S  K +V D      
Sbjct  777   SPSDSYNNT-------TVNNLKQITGQPIDSGFPSKVADSFSVVHSLGKPTVKDFHNHAS  829

Query  2655  VSMPVILK-TAIPEYQYIWQGGFEVQKSGKAFNLYDGIQAHLSSCASPKVLDAVNKFPRK  2831
              +M V++K TAIPEY+YIWQGGFEVQ+ G   +L  G+QAHLS+CASPKVL+ VNKFP K
Sbjct  830   GAMSVLVKTTAIPEYEYIWQGGFEVQRGGNFLDLCGGVQAHLSTCASPKVLEVVNKFPHK  889

Query  2832  VILNEVPRLSSWPMQFKECGVSEDNVALFFFAKDIGSYEKSYKVLLGDMVKHDLALQGNI  3011
             + LNEVPRLS WP QF + G  EDN+AL+FFAKD+ SYE+ YK LL  MVK+DLAL+GN 
Sbjct  890   IPLNEVPRLSVWPSQFHQSGAKEDNIALYFFAKDLDSYERHYKSLLDAMVKNDLALKGNF  949

Query  3012  GDIELLIFPSNQLPEKFQRWNLMFFLWGVFRGKRANSLQNFPGAEKPLIQD----IPTPA  3179
               +ELLIFPSNQLPEK QRWN++FFLWGVFR  R + L +F     P +++     PT  
Sbjct  950   DGVELLIFPSNQLPEKSQRWNMLFFLWGVFRTMRVHCL-DFTETCVPSLRNSFNKAPTDG  1008

Query  3180  TSLPENMFTPVPKLNSARGSAATNTEMSAVKESESASLHK--IVNGNCSIQSSSQVSRDK  3353
              +L E+    +PK       +  + ++    +   A LH    V+ +   + +       
Sbjct  1009  MTLSESENICIPKHIDESSPSDRSCDVPCASK---APLHMGPTVSKDRENKDTYPEEMRS  1065

Query  3354  CSRIN-AEQNDKLDSSSMQNSEPKLGPDRRYFGVP--------LGEAVHSSVQTAERVSS  3506
              S++N   Q+ +LDS++  N+    G +R    +         +G  + S + T    SS
Sbjct  1066  GSKVNLVVQDCRLDSNTTNNTGLSEGVERITSCLQESCIRESRVGTEIKSFIPTTGSNSS  1125

Query  3507  PNTSRPMSVHWAAPLDGEKLSMLSDETPTMQEATSVGSTTKNLC-----------GKDDV  3653
              N      VHW   ++ E    +     + QE    GS  +              G ++V
Sbjct  1126  -NKGEKRQVHWVTSVEREDTDSVEIHPVSSQEVAVAGSVGQERFPDRKKRVGIARGVEEV  1184

Query  3654  KIGRICLDNVSTEEATPLAR-HTSMEQTLNVISSFGVNPKKRSHSAETVLQsasssgtsq  3830
              + R+ +D    ++   L R H   E     ++S    P  R H    +    +S+ + +
Sbjct  1185  ILDRVNMDKADFKQERELGRDHGYKEPEAARVNS--CQPSDRKHPDIPISDRTTSAASQE  1242

Query  3831  afssysNDDILVEEFCHKRVKLNSDRSYGCNDQTSCSKDGFLSEMGGTASQLSRQKNERD  4010
                +  N   +  +   K+ K+ S               GF S      +    ++    
Sbjct  1243  MPWNEVNITQMDAKIGSKKPKIGS--------------SGFDSCSTSRGTNTVVEEKRCF  1288

Query  4011  EALSKTAILETPGNAEMFFFPVDPHPVGNIGSNNSSMPWK-VHPLEEDQLHDKAPNLELA  4187
             EA  +  I E  GN E +FFP+D   V + G  + S+PWK      ED+  +  P+LELA
Sbjct  1289  EACEEKVIPEDLGNTERYFFPLDSRHVHHFGPVDHSVPWKEFSSGYEDKSREGFPSLELA  1348

Query  4188  LGAKTKPLMSGIPSFLSGKVEKKIIEENTSDNAATSANK-EDVsaslslslsFPFPEKEH  4364
             LG +TKP   G+  F  G  +KK   ++    AA    K +DVSASLSLSLSFPFP+KE 
Sbjct  1349  LGGETKPQNKGMLPFFVGSADKKDNNQDEPLEAAVVDEKDDDVSASLSLSLSFPFPDKEQ  1408

Query  4365  GTS--SKPEQEDPRRRQANTSLLLFGR  4439
                  SKPEQ  P R   NTSLLLFGR
Sbjct  1409  PGKPVSKPEQLLPERHHVNTSLLLFGR  1435



>ref|XP_002325874.2| PHD finger family protein [Populus trichocarpa]
 gb|EEF00256.2| PHD finger family protein [Populus trichocarpa]
Length=1539

 Score =   573 bits (1476),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 451/1217 (37%), Positives = 640/1217 (53%), Gaps = 165/1217 (14%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNEHVNSG  1118
             CDICG  GRE  LAICSRC DGAEH YCM++ML+K+PEGDWLCEECK  +E +N+     
Sbjct  410   CDICGDAGREDFLAICSRCADGAEHIYCMREMLQKLPEGDWLCEECKLAEEAENQ-----  464

Query  1119  RVNEKEKTSPSRRTTIAKSDHPLKMEQKTSDCWGDKAVEERSYLKTSGKRCTDDSEVSSP  1298
                  ++ +  +R  +A +                         ++SGKR  +  E++S 
Sbjct  465   -----KQDAEEKRMNVAST-------------------------QSSGKRHAEHMELASA  494

Query  1299  TKRQRLE--LRSPTAQIPNRVTSLSRESSFKNLERGKVKPLNPFSSGSFA------AKVP  1454
              KRQ  E  L SP +  P+R+ ++SR++SFK+L++GKVK  +  S G+ +         P
Sbjct  495   PKRQATESSLASPKSCSPSRIAAVSRDTSFKSLDKGKVKIAHQTSFGNRSNIDIPEIARP  554

Query  1455  SSTGPQPQPPRGIFSKSNSFSSLIAKPKVKLVDEVFPAKQKLSRETAFIESKEVAVRSMG  1634
             S  GP  Q P+G   KS SF++L +K KVKLVDEV P K K +RE++ ++ KE A R M 
Sbjct  555   SVNGPHVQTPKGALLKSKSFNTLNSKMKVKLVDEV-PQKHKGARESS-LDMKEGAARMMR  612

Query  1635  KSMSFKPTTASRSNCTESKVKMFSPKFSHDQDVKWLRHKKDRSSFDRKNSLRSDRLAG--  1808
             KSMSFK  ++ RS+  E KVKM S KFSH QD + L+  KD  + DRK  LR  R  G  
Sbjct  613   KSMSFKSASSGRSSTNELKVKMLSSKFSHIQDSRGLKQVKDWDAVDRKKMLRLGRPPGSS  672

Query  1809  ----GAISSPKSDNKPTPRGEPSSLSSLNTNRDYRALTSDNKPVTISNSTSGVARE----  1964
                   +S+PK D   TPRGE    SS   NR+ ++  S+ K  T+S STS V  +    
Sbjct  673   MTSSAVVSTPKVDQGFTPRGESVIASSTGNNRELKSAQSNGKLGTLSRSTSNVGCKGADT  732

Query  1965  ---VLKQASVDGVSSANRVSSSEENPSQAIPKEDSSSSSCVAERPSWSSNEVLPDGLSQS  2135
                 ++ +S +G+SS    +S+E+  +Q  PK++ SSS   +   + ++ E L DGL +S
Sbjct  733   SVTSVQASSKNGISS----NSAEQKLNQISPKDEPSSS---SWNAASNATENLQDGLPRS  785

Query  2136  KESKAFGDKTRESSASRSKQNSTASGKIVSCQKCKGNGHLAQVCTADGPESSALG-SPFK  2312
             +ES   G+K RE+S SR +       K V CQKCK   H  + CT   P +S    S  +
Sbjct  786   RESSNQGEKARENSLSRLRPTGITGLKNVPCQKCKEICHATENCTVVSPLASGTDVSASR  845

Query  2313  SSREATNGPSDLKAAIE-AARLRKPGICRKNRVADQSEDLSASNM--KSEIASQDQMLSS  2483
               RE  +    LKAAIE AA L+KPGI RK +  DQS+ LS+SN+    E+ASQDQ+  S
Sbjct  846   IPREEMSKGRKLKAAIEAAAMLKKPGIYRKKKEIDQSDGLSSSNVDESGEMASQDQL--S  903

Query  2484  TVRRNVNGAEEAQ-----------KQETANNAKQLGIIAEASARTRNAGHVVFSDVKHSV  2630
              + +   G +E Q           K    NN KQL   +  +      G    +    + 
Sbjct  904   VLNKLSEGTDEGQANIGASSSEFCKSTIINNVKQLNEHSNDAVCPFKVGSDSIAPYLGTS  963

Query  2631  I--DMERQTLVSMPVILKTAIPEYQYIWQGGFEVQKSGKAFNLYDGIQAHLSSCASPKVL  2804
             +    E+  L  M     +AIPE++YIWQG FEV ++ K  +LYDGIQAHLS+CASPKVL
Sbjct  964   VHASAEKSVLTKM-----SAIPEHEYIWQGVFEVHRAEKVVDLYDGIQAHLSTCASPKVL  1018

Query  2805  DAVNKFPRKVILNEVPRLSSWPMQFKECGVSEDNVALFFFAKDIGSYEKSYKVLLGDMVK  2984
             D V+KFP+K+ L+EVPR+S+WP QF   G  E+N+AL+FFAK+  SYE +YK LL +M+K
Sbjct  1019  DVVSKFPQKIKLDEVPRISTWPRQFLVTGAKEENIALYFFAKNFESYE-NYKRLLDNMIK  1077

Query  2985  HDLALQGNIGDIELLIFPSNQLPEKFQRWNLMFFLWGVFRGKRANSLQNFPGAEKPLI--  3158
              DLAL+G+   +E  IFPS QLPE  QRWN+++FLWGVFRG+R++   +F     P +  
Sbjct  1078  KDLALKGSFEGVEFFIFPSTQLPENSQRWNMLYFLWGVFRGRRSDCSDSFKKLVMPSLNG  1137

Query  3159  ----QDIPTPATSLPENMFTP--VPKLNSARGSAATNTEMSAVKESESASLHKIVNGNCS  3320
                 +DIP    +  EN+  P  + K  SA  S  ++    A    E  S+   +NGN  
Sbjct  1138  VPRDKDIPAAVMTSSENLCVPECIVKNTSACDSPCSSDVHLAANAPEKPSVS--LNGN--  1193

Query  3321  IQSSSQVSRDKC--SRINAEQND-KLDSSSMQN--------------SEPKL---GPDRR  3440
                    S DK   S+ N E+ D K+DS S+                S P L   GP R 
Sbjct  1194  -------SDDKVFNSQTNLEKQDGKVDSRSLTKIRGSSTPWCPEARCSSPSLEEVGPPRC  1246

Query  3441  YFGV---PLGEAVHSSVQTAERVSSPNTSRPMSVHWAAPLDGEKLSMLSDETPTMQEATS  3611
                V   P  E          R +S +  + + +H  A   GE +         +    S
Sbjct  1247  SLDVDPKPCTEVT--------RTNSVSDVKEIQIHEGASCLGEDMPF------KIFGVGS  1292

Query  3612  VGSTTKNLCGKDDVKIGRICLDNVSTEEATPLARHTSMEQTLNV-ISSF-GVNPKKRS--  3779
               S  + + G+D +      +D   +++   +      E  +N+ + +F G  P+KR   
Sbjct  1293  QNSGCRRIFGEDKI------VDRTFSDKDNIIVERDLNEDNVNIDVETFSGKGPRKRPFL  1346

Query  3780  HSAETVLQsasssgtsqafssysNDDILVE-EFCHKRVKLNSDRSY---GCNDQTSCSKD  3947
             + ++T    +SS      ++   N++ LV+ E   K++K      Y   G  ++ S S  
Sbjct  1347  YLSDTAPLISSSMTQKAPWNKADNNNTLVDGESISKKLKTGFSGLYGGSGSREENSLS-G  1405

Query  3948  GFLSEMGGTASQLSRQKNERDEALSKTAILETPGNAEMFFFPVDPHPVGNIGSNNSSMPW  4127
              F S+     S  S ++   D+A ++  ILE  G +E +FFPVD H V +       MPW
Sbjct  1406  SFTSQTCDLGSSSSVEERSYDKASAEKVILEGLGTSERYFFPVDSHHVKDSRLPAIFMPW  1465

Query  4128  KVHPLEEDQLHDKAPNLELALGAKTK-PLMSGIPSFLSGKVEKKIIEENTSDNAATSANK  4304
                  +ED++ D  PNLELALGA+TK P    +P F  G  EK  I+    D       +
Sbjct  1466  NSSN-DEDRVRDGIPNLELALGAETKSPNKRILPFF--GMAEKNHIQNKPPDKVMNKEEE  1522

Query  4305  EDVsaslslslsFPFPE  4355
             + VSASLSLSLSFPFP+
Sbjct  1523  DGVSASLSLSLSFPFPD  1539



>ref|XP_009361134.1| PREDICTED: uncharacterized protein LOC103951480 isoform X1 [Pyrus 
x bretschneideri]
Length=1463

 Score =   570 bits (1469),  Expect = 3e-172, Method: Compositional matrix adjust.
 Identities = 458/1227 (37%), Positives = 630/1227 (51%), Gaps = 134/1227 (11%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNEHVNSG  1118
             CDICG  GRE +LA+CSRC+DGAEH YCM+KML ++P+G WLCEECKF +E  N+   S 
Sbjct  307   CDICGDAGREDMLAMCSRCSDGAEHIYCMRKMLRRVPKGRWLCEECKFAEETDNQKQGSD  366

Query  1119  -RVNEKEKTSPSRRTTIAKSDHPLKMEQKTSDCWGDKAVEERSYLKTSGKRCTDDSEVSS  1295
               V   EK   S                                 + S KR  +  EV+ 
Sbjct  367   VEVKRMEKVITS--------------------------------TQISNKRLAESVEVAP  394

Query  1296  PTKRQRLELR--SPTAQIPNRVTSLSRESSFKNLERGKVKPLNPFSSGSFAAKVPSSTGP  1469
               KRQ LE+R  SP A  P R+ +LSRESSFK+L++ +++   P S  +      + +  
Sbjct  395   SVKRQALEMRVGSPKASSPKRMGALSRESSFKSLDKDRLRSAYPISQSTNDISETARSPS  454

Query  1470  QPQPPRGIFSKSNSFSSLIAKPKVKLVDEVFPAKQKLSRETAFIESKE-VAVRSMGKSMS  1646
                  +G FSKSNSF++LI+KPKVKLVDEV P KQK S+E A  + KE V  R MG+S+S
Sbjct  455   NGLRAKGTFSKSNSFNTLISKPKVKLVDEVVPQKQKGSKEHASFDMKERVVSRMMGRSVS  514

Query  1647  FKPTTASRSNCTESKVKMFSPKFSHDQDVKWLRHKKDRSSFDRKNSLRSDR------LAG  1808
             FK  ++ RSN +E+KVKM S KFSH  D+K L+  K+ S+ +RKN  + DR       A 
Sbjct  515   FKSASSGRSNVSETKVKMLSSKFSHVPDLKGLKQAKEWSTVERKNLSKLDRPKANLITAS  574

Query  1809  GAISSPKSDNKPTPRGEPSSLSSLNTNRDYRALTSDNKPVTISNSTS---GVAREVLKQA  1979
                S+PKSD     R E S LSS+ +NR+ +    D K  T S S+    GV  +V    
Sbjct  575   PIFSTPKSD--LASRCETSLLSSV-SNREPKVALPDGKLSTSSKSSLTRKGVDTQVASGG  631

Query  1980  SVDGVSSANRVSSSEENPSQAIPKEDS-SSSSCVAERPSWSSNEVLPDGLSQSKESKAFG  2156
                   +    S+SE+  +Q   K++S SS S   E    + +  L D L QS E     
Sbjct  632   GS--SMNGMSSSASEQRSNQVSSKDESLSSYSGTVETSRCNLDGTLEDVLPQSGEMADQD  689

Query  2157  DKTRESSASRSKQNSTASGKIVSCQKCKGNGHL---AQVCTADGPESSALGSPFKSSREA  2327
             DK RESS  R +    AS K     K +GN      A +    G ++ A     +SSRE 
Sbjct  690   DKARESSV-RCRPAVVASPKF----KERGNNTEFGGAGISQTSGTDACAP----RSSREE  740

Query  2328  TNGPSDLKAAIEAARLRKPGICRKNRVADQSEDLSASNMK--SEIASQDQ------MLSS  2483
                 + LK AI AA LRKP I RK RV DQS++LS  NM    E+A+Q+Q      +L +
Sbjct  741   MQRGNRLKNAIHAALLRKPEIYRKKRVLDQSDELSTLNMDLSYEVATQEQSPDGHAILGT  800

Query  2484  TVRRNVNGAEEAQKQETANNAKQLG---IIAEASARTRNAGHVVFSDVKHSVIDMERQTL  2654
             +   + N         T NN KQ+    I +   ++  ++  VV S  K +V D      
Sbjct  801   SPSDSYNNT-------TVNNLKQITGQPIDSGFPSKVADSFSVVHSLGKPTVKDFHNHAS  853

Query  2655  VSMPVILK-TAIPEYQYIWQGGFEVQKSGKAFNLYDGIQAHLSSCASPKVLDAVNKFPRK  2831
              +M V++K TAIPEY+YIWQGGFEVQ+ G   +L  G+QAHLS+CASPKVL+ VNKFP K
Sbjct  854   GAMSVLVKTTAIPEYEYIWQGGFEVQRGGNFLDLCGGVQAHLSTCASPKVLEVVNKFPHK  913

Query  2832  VILNEVPRLSSWPMQFKECGVSEDNVALFFFAKDIGSYEKSYKVLLGDMVKHDLALQGNI  3011
             + LNEVPRLS WP QF + G  EDN+AL+FFAKD+ SYE+ YK LL  MVK+DLAL+GN 
Sbjct  914   IPLNEVPRLSVWPSQFHQSGAKEDNIALYFFAKDLDSYERHYKSLLDAMVKNDLALKGNF  973

Query  3012  GDIELLIFPSNQLPEKFQRWNLMFFLWGVFRGKRANSLQNFPGAEKPLIQD----IPTPA  3179
               +ELLIFPSNQLPEK QRWN++FFLWGVFR  R + L +F     P +++     PT  
Sbjct  974   DGVELLIFPSNQLPEKSQRWNMLFFLWGVFRTMRVHCL-DFTETCVPSLRNSFNKAPTDG  1032

Query  3180  TSLPENMFTPVPKLNSARGSAATNTEMSAVKESESASLHK--IVNGNCSIQSSSQVSRDK  3353
              +L E+    +PK       +  + ++    +   A LH    V+ +   + +       
Sbjct  1033  MTLSESENICIPKHIDESSPSDRSCDVPCASK---APLHMGPTVSKDRENKDTYPEEMRS  1089

Query  3354  CSRIN-AEQNDKLDSSSMQNSEPKLGPDRRYFGVP--------LGEAVHSSVQTAERVSS  3506
              S++N   Q+ +LDS++  N+    G +R    +         +G  + S + T    SS
Sbjct  1090  GSKVNLVVQDCRLDSNTTNNTGLSEGVERITSCLQESCIRESRVGTEIKSFIPTTGSNSS  1149

Query  3507  PNTSRPMSVHWAAPLDGEKLSMLSDETPTMQEATSVGSTTKNLC-----------GKDDV  3653
              N      VHW   ++ E    +     + QE    GS  +              G ++V
Sbjct  1150  -NKGEKRQVHWVTSVEREDTDSVEIHPVSSQEVAVAGSVGQERFPDRKKRVGIARGVEEV  1208

Query  3654  KIGRICLDNVSTEEATPLAR-HTSMEQTLNVISSFGVNPKKRSHSAETVLQsasssgtsq  3830
              + R+ +D    ++   L R H   E     ++S    P  R H    +    +S+ + +
Sbjct  1209  ILDRVNMDKADFKQERELGRDHGYKEPEAARVNS--CQPSDRKHPDIPISDRTTSAASQE  1266

Query  3831  afssysNDDILVEEFCHKRVKLNSDRSYGCNDQTSCSKDGFLSEMGGTASQLSRQKNERD  4010
                +  N   +  +   K+ K+ S               GF S      +    ++    
Sbjct  1267  MPWNEVNITQMDAKIGSKKPKIGS--------------SGFDSCSTSRGTNTVVEEKRCF  1312

Query  4011  EALSKTAILETPGNAEMFFFPVDPHPVGNIGSNNSSMPWK-VHPLEEDQLHDKAPNLELA  4187
             EA  +  I E  GN E +FFP+D   V + G  + S+PWK      ED+  +  P+LELA
Sbjct  1313  EACEEKVIPEDLGNTERYFFPLDSRHVHHFGPVDHSVPWKEFSSGYEDKSREGFPSLELA  1372

Query  4188  LGAKTKPLMSGIPSFLSGKVEKKIIEENTSDNAATSANK-EDVsaslslslsFPFPEKEH  4364
             LG +TKP   G+  F  G  +KK   ++    AA    K +DVSASLSLSLSFPFP+KE 
Sbjct  1373  LGGETKPQNKGMLPFFVGSADKKDNNQDEPLEAAVVDEKDDDVSASLSLSLSFPFPDKEQ  1432

Query  4365  GTS--SKPEQEDPRRRQANTSLLLFGR  4439
                  SKPEQ  P R   NTSLLLFGR
Sbjct  1433  PGKPVSKPEQLLPERHHVNTSLLLFGR  1459



>ref|XP_009348941.1| PREDICTED: uncharacterized protein LOC103940526 isoform X5 [Pyrus 
x bretschneideri]
Length=1430

 Score =   567 bits (1461),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 472/1245 (38%), Positives = 645/1245 (52%), Gaps = 154/1245 (12%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNEHVNSG  1118
             CDICG  GRE +LA+CSRC+DGAEH YCM+KML ++P+G WLCEECKF +E  N+   S 
Sbjct  258   CDICGDAGREDMLAMCSRCSDGAEHIYCMRKMLRRVPKGPWLCEECKFTEETDNQKQGS-  316

Query  1119  RVNEKEKTSPSRRTTIAKSDHPLKMEQKTSDCWGDKAVEERSYLKTSGKRCTDDSEVSSP  1298
                                     ME K  +    KA+    +   S KR  ++ EV+  
Sbjct  317   -----------------------DMEVKRKE----KAIMSTQF---SNKRLAENIEVAPS  346

Query  1299  TKRQRLELR--SPTAQIPNRVTSLSRESSFKNLERGKVKPLNPFSSGSFAAKVPSSTGPQ  1472
              KRQ LE+R  SP    P R+ +LSRESSFK+L++ +++P    S G+      + +   
Sbjct  347   VKRQGLEMRVGSPKPSSPKRMGALSRESSFKSLDKDRLRPAYQTSQGTNNISETARSPSN  406

Query  1473  PQPPRGIFSKSNSFSSLIAKPKVKLVDEVFPAKQKLSRETAFIESKEVAV-RSMGKSMSF  1649
                 +G FSKSNSF++L +KPKVK VDEV P KQK  +E A ++ KE  V R MGKS+SF
Sbjct  407   GIGAKGTFSKSNSFNTLNSKPKVKHVDEVVPHKQKGFKEHASLDMKERVVPRIMGKSVSF  466

Query  1650  KPTTASRSNCTESKVKMFSPKFSHDQDVKWLRHKKDRSSFDRKNSLRSDR------LAGG  1811
             K  ++ RSN +ESKVKM S KFSH  D+K L+  K+RS+ +RKN  + DR       A  
Sbjct  467   KSASSGRSNVSESKVKMLSSKFSHVSDLKGLKQAKERSAVERKNLSKLDRPMANFTTANS  526

Query  1812  AISSPKSDNKPTPRGEPSSLSSLNTNRDYRALTSDNKPVTISNSTSGVAREVLKQ---AS  1982
              +S+PKSD     RGE S LSS+ +NR+ +    D K   +S S S V RE       + 
Sbjct  527   IVSTPKSD--LASRGETSLLSSV-SNREPKVALPDGK---LSTSKSSVTREGFDTQITSG  580

Query  1983  VDGVSSANRVSSSEENPSQAIPKEDSSSSSCVAERPSWSSNEVLPDGLSQSKESKAFGDK  2162
                  +    S+SE+  +    K++S SSS   E+   + +    D L QS E     DK
Sbjct  581   GGSSMNGMSSSASEQKLNHVSFKDESLSSSVTVEKLHCNVDGTSEDVLPQSGEMIDQDDK  640

Query  2163  TRESSASRSKQNSTASGKIVSCQKCKGNGHLAQ-----VCTADGPESSALGSPFKSSREA  2327
              RESS          +  +V+  KCK  G  A+     +  A G ++SA   P  S  E 
Sbjct  641   ARESSVR-------CTPAVVASPKCKEIGINAEFGRPVISQASGTDASA---PRGSKEEI  690

Query  2328  TNGPSDLKAAIEAARLRKPGICRKNRVADQSEDLSASNMKS--EIASQDQMLSSTVRRNV  2501
               G + LK AI AA LRK  I RK RV DQS++ S  NM S  E+A+Q+Q   S   R +
Sbjct  691   QRG-NRLKDAIHAAVLRKSEIYRKKRVFDQSDESSTPNMDSSYEVAAQEQ---SPDGRAI  746

Query  2502  NGAE--EAQKQETANNAKQLGII-AEASARTRNAGHVVFSDVKHSVIDMERQTLVSMPVI  2672
              G    ++ K  T NN KQL +   ++   ++ A  V     K +V D+      +M V+
Sbjct  747   LGTSTSDSSKNTTVNNLKQLTVQPIDSGFPSKVAYSVSVVPGKPTVKDLHNHASGAMSVL  806

Query  2673  LKT-AIPEYQYIWQ-------GGFEVQKSGKAFNLYDGIQAHLSSCASPKVLDAVNKFPR  2828
             +KT AIPEY+YIWQ       G FEVQ+SG   +L  GIQAHLS+CASPKV + VNKFP 
Sbjct  807   VKTTAIPEYEYIWQLILFSCRGSFEVQRSGNFMDLCGGIQAHLSTCASPKVPEVVNKFPH  866

Query  2829  KVILNEVPRLSSWPMQFKECGVSEDNVALFFFAKDIG-------SYEKSYKVLLGDMVKH  2987
             KV LNEVPRLS WP QF++ G  EDN+AL+FFAKD+        SYE+ Y  LL  MVK+
Sbjct  867   KVSLNEVPRLSVWPSQFRQSGAKEDNIALYFFAKDLDSRFNFRCSYERHYNSLLDAMVKN  926

Query  2988  DLALQGNIGDIELLIFPSNQLPEKFQRWNLMFFLWGVFRGKRANSLQNFPGAEKPLIQD-  3164
             DLAL+GN   +ELLIFPSNQLPEK QRWN++FFLWGVFR  R + L +F     P + + 
Sbjct  927   DLALKGNFDGVELLIFPSNQLPEKSQRWNMLFFLWGVFRTMRVHCL-DFTETCVPSLSNS  985

Query  3165  ---IPTPATSLPENMFTPVPKLNSARGSAATNTEMSAVKESESASLHK--IVNGNCSIQS  3329
                 PT   +L EN+  P     S+    + +     V  + +ASLH    V  +C  + 
Sbjct  986   FHKAPTDGMTLSENICIPKHIDESSPSDRSFD-----VPSASNASLHMGPTVTKDCENKD  1040

Query  3330  SSQVSRDKCSRIN-AEQNDKLDSSSMQNSEPKLGPDRRYFGVP-----------LGEAVH  3473
             +        S++N A Q+ ++DS++  N+    G +   +  P           +G+ + 
Sbjct  1041  TYPEEVRLGSKVNLAVQDCRVDSNTTNNAGLSEGVE---YITPCLQESCLRESRVGKEIK  1097

Query  3474  SSVQTAERVSSPNTSRPMSVHWAAPLDGEKLSMLSDETPTMQEAT---SVGST-------  3623
             SS+ T    SS N      VHW   +D E    L     + +E     SVG         
Sbjct  1098  SSIPTTGSNSS-NKGEKRQVHWVTSVDREDADSLEIRLVSSREVAVSRSVGDDRFPDRKK  1156

Query  3624  -TKNLCGKDDVKIGRICLDNVSTEEATPLAR---HTSMEQTLNVISSFGVN---PKKRSH  3782
                   G ++V + R+ +D    ++   L R   +   E  L    +  VN   P  R H
Sbjct  1157  RVGIAGGVEEVILDRVRMDKAHFKQERELRRDYGYKESEAALVRDLTARVNSCQPSDRKH  1216

Query  3783  SAETVLQsasssgtsqafs-sysNDDILVEEFCHKRVKLNSDRSYGCNDQTSCSKDGFLS  3959
                 + +  +S+ T+Q    +  N   +  E   K+ K+ S    GC            S
Sbjct  1217  PDIPISERTTSAATTQEMPWNEVNITQMDVEIDRKKPKIGSSGFDGC------------S  1264

Query  3960  EMGGTASQLSRQKNER-DEALSKTAILETPGNAEMFFFPVDPHPVGNIGSNNSSMPWK-V  4133
                GT + +   K++R  EA  +  I E  GN E +FFP+D   V + G   +S+PWK  
Sbjct  1265  TSRGTEAVV---KDKRCFEACEEKVIPEDLGNTERYFFPLDSRHVQHFGPVGNSVPWKDF  1321

Query  4134  HPLEEDQLHDKAPNLELALGAKTKPLMSGIPSFLSGKVEKKIIEENTSDNAATSANK-ED  4310
                  D+  +  P+LELALG +TKP   GI  F  G  ++K+  ++    AA    K +D
Sbjct  1322  SSGYVDKTREGFPSLELALGGETKPQNKGILPFFVGLADEKVNNQDKPLEAAVVDEKDDD  1381

Query  4311  VsaslslslsFPFPEKEHGTS--SKPEQEDPRRRQANTSLLLFGR  4439
             VSASLSLSLSFPFP+KE      SKPEQ  P R   NTSLLLFGR
Sbjct  1382  VSASLSLSLSFPFPDKEQPGKPVSKPEQLLPERHHVNTSLLLFGR  1426



>ref|XP_009348935.1| PREDICTED: uncharacterized protein LOC103940526 isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009348936.1| PREDICTED: uncharacterized protein LOC103940526 isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009348937.1| PREDICTED: uncharacterized protein LOC103940526 isoform X1 [Pyrus 
x bretschneideri]
Length=1468

 Score =   567 bits (1462),  Expect = 3e-171, Method: Compositional matrix adjust.
 Identities = 472/1245 (38%), Positives = 645/1245 (52%), Gaps = 154/1245 (12%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNEHVNSG  1118
             CDICG  GRE +LA+CSRC+DGAEH YCM+KML ++P+G WLCEECKF +E  N+   S 
Sbjct  296   CDICGDAGREDMLAMCSRCSDGAEHIYCMRKMLRRVPKGPWLCEECKFTEETDNQKQGS-  354

Query  1119  RVNEKEKTSPSRRTTIAKSDHPLKMEQKTSDCWGDKAVEERSYLKTSGKRCTDDSEVSSP  1298
                                     ME K  +    KA+    +   S KR  ++ EV+  
Sbjct  355   -----------------------DMEVKRKE----KAIMSTQF---SNKRLAENIEVAPS  384

Query  1299  TKRQRLELR--SPTAQIPNRVTSLSRESSFKNLERGKVKPLNPFSSGSFAAKVPSSTGPQ  1472
              KRQ LE+R  SP    P R+ +LSRESSFK+L++ +++P    S G+      + +   
Sbjct  385   VKRQGLEMRVGSPKPSSPKRMGALSRESSFKSLDKDRLRPAYQTSQGTNNISETARSPSN  444

Query  1473  PQPPRGIFSKSNSFSSLIAKPKVKLVDEVFPAKQKLSRETAFIESKEVAV-RSMGKSMSF  1649
                 +G FSKSNSF++L +KPKVK VDEV P KQK  +E A ++ KE  V R MGKS+SF
Sbjct  445   GIGAKGTFSKSNSFNTLNSKPKVKHVDEVVPHKQKGFKEHASLDMKERVVPRIMGKSVSF  504

Query  1650  KPTTASRSNCTESKVKMFSPKFSHDQDVKWLRHKKDRSSFDRKNSLRSDR------LAGG  1811
             K  ++ RSN +ESKVKM S KFSH  D+K L+  K+RS+ +RKN  + DR       A  
Sbjct  505   KSASSGRSNVSESKVKMLSSKFSHVSDLKGLKQAKERSAVERKNLSKLDRPMANFTTANS  564

Query  1812  AISSPKSDNKPTPRGEPSSLSSLNTNRDYRALTSDNKPVTISNSTSGVAREVLKQ---AS  1982
              +S+PKSD     RGE S LSS+ +NR+ +    D K   +S S S V RE       + 
Sbjct  565   IVSTPKSD--LASRGETSLLSSV-SNREPKVALPDGK---LSTSKSSVTREGFDTQITSG  618

Query  1983  VDGVSSANRVSSSEENPSQAIPKEDSSSSSCVAERPSWSSNEVLPDGLSQSKESKAFGDK  2162
                  +    S+SE+  +    K++S SSS   E+   + +    D L QS E     DK
Sbjct  619   GGSSMNGMSSSASEQKLNHVSFKDESLSSSVTVEKLHCNVDGTSEDVLPQSGEMIDQDDK  678

Query  2163  TRESSASRSKQNSTASGKIVSCQKCKGNGHLAQ-----VCTADGPESSALGSPFKSSREA  2327
              RESS          +  +V+  KCK  G  A+     +  A G ++SA   P  S  E 
Sbjct  679   ARESSVR-------CTPAVVASPKCKEIGINAEFGRPVISQASGTDASA---PRGSKEEI  728

Query  2328  TNGPSDLKAAIEAARLRKPGICRKNRVADQSEDLSASNMKS--EIASQDQMLSSTVRRNV  2501
               G + LK AI AA LRK  I RK RV DQS++ S  NM S  E+A+Q+Q   S   R +
Sbjct  729   QRG-NRLKDAIHAAVLRKSEIYRKKRVFDQSDESSTPNMDSSYEVAAQEQ---SPDGRAI  784

Query  2502  NGAE--EAQKQETANNAKQLGII-AEASARTRNAGHVVFSDVKHSVIDMERQTLVSMPVI  2672
              G    ++ K  T NN KQL +   ++   ++ A  V     K +V D+      +M V+
Sbjct  785   LGTSTSDSSKNTTVNNLKQLTVQPIDSGFPSKVAYSVSVVPGKPTVKDLHNHASGAMSVL  844

Query  2673  LKT-AIPEYQYIWQ-------GGFEVQKSGKAFNLYDGIQAHLSSCASPKVLDAVNKFPR  2828
             +KT AIPEY+YIWQ       G FEVQ+SG   +L  GIQAHLS+CASPKV + VNKFP 
Sbjct  845   VKTTAIPEYEYIWQLILFSCRGSFEVQRSGNFMDLCGGIQAHLSTCASPKVPEVVNKFPH  904

Query  2829  KVILNEVPRLSSWPMQFKECGVSEDNVALFFFAKDIG-------SYEKSYKVLLGDMVKH  2987
             KV LNEVPRLS WP QF++ G  EDN+AL+FFAKD+        SYE+ Y  LL  MVK+
Sbjct  905   KVSLNEVPRLSVWPSQFRQSGAKEDNIALYFFAKDLDSRFNFRCSYERHYNSLLDAMVKN  964

Query  2988  DLALQGNIGDIELLIFPSNQLPEKFQRWNLMFFLWGVFRGKRANSLQNFPGAEKPLIQD-  3164
             DLAL+GN   +ELLIFPSNQLPEK QRWN++FFLWGVFR  R + L +F     P + + 
Sbjct  965   DLALKGNFDGVELLIFPSNQLPEKSQRWNMLFFLWGVFRTMRVHCL-DFTETCVPSLSNS  1023

Query  3165  ---IPTPATSLPENMFTPVPKLNSARGSAATNTEMSAVKESESASLHK--IVNGNCSIQS  3329
                 PT   +L EN+  P     S+    + +     V  + +ASLH    V  +C  + 
Sbjct  1024  FHKAPTDGMTLSENICIPKHIDESSPSDRSFD-----VPSASNASLHMGPTVTKDCENKD  1078

Query  3330  SSQVSRDKCSRIN-AEQNDKLDSSSMQNSEPKLGPDRRYFGVP-----------LGEAVH  3473
             +        S++N A Q+ ++DS++  N+    G +   +  P           +G+ + 
Sbjct  1079  TYPEEVRLGSKVNLAVQDCRVDSNTTNNAGLSEGVE---YITPCLQESCLRESRVGKEIK  1135

Query  3474  SSVQTAERVSSPNTSRPMSVHWAAPLDGEKLSMLSDETPTMQEAT---SVGST-------  3623
             SS+ T    SS N      VHW   +D E    L     + +E     SVG         
Sbjct  1136  SSIPTTGSNSS-NKGEKRQVHWVTSVDREDADSLEIRLVSSREVAVSRSVGDDRFPDRKK  1194

Query  3624  -TKNLCGKDDVKIGRICLDNVSTEEATPLAR---HTSMEQTLNVISSFGVN---PKKRSH  3782
                   G ++V + R+ +D    ++   L R   +   E  L    +  VN   P  R H
Sbjct  1195  RVGIAGGVEEVILDRVRMDKAHFKQERELRRDYGYKESEAALVRDLTARVNSCQPSDRKH  1254

Query  3783  SAETVLQsasssgtsqafs-sysNDDILVEEFCHKRVKLNSDRSYGCNDQTSCSKDGFLS  3959
                 + +  +S+ T+Q    +  N   +  E   K+ K+ S    GC            S
Sbjct  1255  PDIPISERTTSAATTQEMPWNEVNITQMDVEIDRKKPKIGSSGFDGC------------S  1302

Query  3960  EMGGTASQLSRQKNER-DEALSKTAILETPGNAEMFFFPVDPHPVGNIGSNNSSMPWK-V  4133
                GT + +   K++R  EA  +  I E  GN E +FFP+D   V + G   +S+PWK  
Sbjct  1303  TSRGTEAVV---KDKRCFEACEEKVIPEDLGNTERYFFPLDSRHVQHFGPVGNSVPWKDF  1359

Query  4134  HPLEEDQLHDKAPNLELALGAKTKPLMSGIPSFLSGKVEKKIIEENTSDNAATSANK-ED  4310
                  D+  +  P+LELALG +TKP   GI  F  G  ++K+  ++    AA    K +D
Sbjct  1360  SSGYVDKTREGFPSLELALGGETKPQNKGILPFFVGLADEKVNNQDKPLEAAVVDEKDDD  1419

Query  4311  VsaslslslsFPFPEKEHGTS--SKPEQEDPRRRQANTSLLLFGR  4439
             VSASLSLSLSFPFP+KE      SKPEQ  P R   NTSLLLFGR
Sbjct  1420  VSASLSLSLSFPFPDKEQPGKPVSKPEQLLPERHHVNTSLLLFGR  1464



>ref|XP_010270010.1| PREDICTED: uncharacterized protein LOC104606480 isoform X4 [Nelumbo 
nucifera]
Length=1733

 Score =   571 bits (1471),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 470/1305 (36%), Positives = 673/1305 (52%), Gaps = 166/1305 (13%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNE-----  1103
             CDICG  GRE LLA CSRC+DGAEHTYCM+ ML+K+PEGDW+CEECK  ++ + +     
Sbjct  451   CDICGDAGREDLLAFCSRCSDGAEHTYCMRLMLDKVPEGDWMCEECKLKEDTEKQKQDEV  510

Query  1104  HVNSGRVNE---KEKTSPSRRTTIAKSDHPLKMEQKTSDCWGDKAVEERSYLKTSGKRCT  1274
                SG   E    E++  S   +   S   +K+E K  D  G+++ +  S    S KR  
Sbjct  511   ETTSGFSKEPYLSERSQNSGGASTVSSKMMMKVELKAPDSEGNRSAKVISSSLLSVKRHL  570

Query  1275  DDSEVSSPTKRQRLE--LRSPTAQIPNRVTSLSRESSFKNLERGKVKPLNPFSS-GS-FA  1442
             D+SEV+S  KRQ  +  + SP A  P++   LSRESSFK+L++GKVK ++  +S GS FA
Sbjct  571   DNSEVASAEKRQAFDTSVGSPKASSPSKKPLLSRESSFKSLDKGKVKTIHKVASFGSHFA  630

Query  1443  ------AKVPSSTGPQP-------QPPRGIFSKSNSFSSLIAKPKVKLVDEVFPAKQKLS  1583
                   A  P++TGP P       Q PRG   KS SF+ L  K KVKLV E    K+K++
Sbjct  631   NNSHEIAHSPTTTGPNPSRIQSRLQSPRGTLLKSKSFNMLNLKSKVKLVQEDVSQKKKVA  690

Query  1584  RETAFIE-SKEVAVRSMGKSMSFKPTTASRSNCTESKVKMFSPKFSHDQDVKWLRHKKDR  1760
                   +  KE  VR++GKSMSFK       N TESKVK+ SP  S  +++K L+  K++
Sbjct  691   GNCVIGDMKKEGLVRTLGKSMSFKSENLGCLNVTESKVKILSPNLSRVEELKGLKQAKEQ  750

Query  1761  SSFDRKNSLRSDR------LAGGAISSPKSDNKPTPRGEPSSLSSLNTN-RDYRALTSD-  1916
             +  +RKNS +SDR       A  ++S+ K+D K   R E +S  S  TN RD +   +D 
Sbjct  751   NLIERKNSFKSDRPLVSSPRAVSSMSTLKNDQKINSRAENASFLSSATNFRDPKPAQADG  810

Query  1917  -----NKPVTISNSTSGV------AREVLKQASVDGVSSANRVSSSEENPSQAIPKEDSS  2063
                  +KP  ++N  S +      + EV +Q+ V  +SS  R SS+E+ PSQ  PK++ +
Sbjct  811   KLKTSSKPANLANKGSDIRNALAASNEVKRQSVVGALSSNGRCSSTEQKPSQVSPKDEPT  870

Query  2064  SSSCV-AERPSWSSNEVLPDGLSQSKESKAFGDKTRES-SASRSKQNSTASGKIVSCQKC  2237
             SSS V A+R     + +L DGL QS+ES   G K+RE      S+Q+ +  G+   CQKC
Sbjct  871   SSSSVSADRACGKHDTLLQDGLPQSRESLNQGAKSREPPHLGHSRQSISVGGQSARCQKC  930

Query  2238  KGNGHLAQVCTADGPESSAL-GSPFKSSREATNGPSDLKAAIEAARLRKPGICRKNRVAD  2414
             KG GH+AQ C       S L  S  K S+E  +    LK A+E   L++PGICRKNR  +
Sbjct  931   KGMGHVAQSCPVSNSRVSVLEASAEKISKEMMDKSCKLKEAVEPKILKRPGICRKNRSPE  990

Query  2415  QSEDLSAS--NMKSEIASQDQML--SSTVRRNV------------NGAEEAQKQETANNA  2546
             Q ++LS S  ++ +E+ S+DQ+   SS +R N             N A +  +  T +N 
Sbjct  991   QLDELSMSSTDLSTEV-SKDQLSASSSCLRNNSSQGTSDGQEIVRNSAADISRITTVDNV  1049

Query  2547  KQLGIIAEASARTRNAGHVVFSDVKHSV-IDMERQTLVSMPVILKTA--------IPEYQ  2699
             KQ  I       +  AG    SD   SV  +    ++ ++P +  +         IPE+ 
Sbjct  1050  KQYAIHLREEIISPQAGE---SDPSFSVDANKTSSSIRNLPFLESSVAAPSGISVIPEHD  1106

Query  2700  YIWQGGFEVQKSGKAFNLYDGIQAHLSSCASPKVLDAVNKFPRKVILNEVPRLSSWPMQF  2879
             ++WQG FEVQ++G   +L DGIQAHLS+CASPKV + V KFP KV+L EVP LS+WP QF
Sbjct  1107  FLWQGCFEVQRNGILPDLCDGIQAHLSTCASPKVPEVVKKFPSKVLLEEVPCLSTWPRQF  1166

Query  2880  KECGVSEDNVALFFFAKDIGSYEKSYKVLLGDMVKHDLALQGNIGDIELLIFPSNQLPEK  3059
              +   +EDNVAL+FFAKDI SYE+ YK L+  M+++DLAL+GN    ELLIFPSN+LP+K
Sbjct  1167  DDNHATEDNVALYFFAKDIESYERYYKCLVDKMIRNDLALKGNFDGTELLIFPSNKLPDK  1226

Query  3060  FQRWNLMFFLWGVFRGKRANSL---------------------QNFPGAEKPLIQDIPTP  3176
              QRWN++FFLWGVFRG+R N L                     QN P + +P+ + +  P
Sbjct  1227  SQRWNMLFFLWGVFRGRRPNCLEQTPGPQKKVSQANLDTVFAHQNLPASVQPVHKQLHLP  1286

Query  3177  A----TSLPENMF-----------TPVPKLNSARGSAATNTEMSAVKESESASLHKIVNG  3311
                   S     F             +P L+S R        +S++    ++S HK  + 
Sbjct  1287  GQMEDLSASNKSFCGPEADKSTASVELPFLSSGRLDGDCEPNISSLDHKYTSS-HKNFD-  1344

Query  3312  NCSIQSSSQVSRDKCSRINAEQNDKLDSSSMQNSEPKLGPDRRYFGVPLGEAVHSSVQTA  3491
                 Q  S +  +  SRI+   +++L + S  N+   L       G+  G+     +QT 
Sbjct  1345  ----QQGSGLDNNSMSRIHT-GDEQLSTKSNSNT---LKEQTNKEGMQEGK-----IQTC  1391

Query  3492  ERVSSPNTS----RPMSVHWAAPLDGEKLSMLSDETPTMQEATSVGSTTKNLCGKDDVKI  3659
              + ++ N +    + + V     LD +  S  S +TP    + S G     + G D  KI
Sbjct  1392  TQATTQNGNLYKGKSVPVELNNSLDRQDDSSCSLKTPPFSTSLSQGFGV--VGGTDKQKI  1449

Query  3660  GRICLDNVSTEE---------------ATPLARHTSMEQTLNVISSFGVNPKKRSH--SA  3788
                  D +  E                 T L R    E       ++  N +KR H  SA
Sbjct  1450  PERMQDEIRDEMKIQKEMMSPDGLMDIGTALKRTLKSESLDKGNCNWESNSRKRLHMDSA  1509

Query  3789  ETVLQsasssgtsqafss--ysNDDILVE-EFCHKRVKLNSDRSYGCND--QTSCSKDGF  3953
               + Q +  + +S++ ++     D +LV  E   K++K  S   YGCN   + +   + F
Sbjct  1510  LMIQQVSGETSSSRSRATLWMGEDHLLVGGESEMKKIKRCSSVVYGCNSSSEQNSFNERF  1569

Query  3954  LSEMGGTASQLSRQKNERDEALSKTAILETPGNAEMFFFPVDPHPVGNIGSNNSSMPWKV  4133
               ++   AS      NE+ +       +E     E  FFP+D   V +    ++S+  ++
Sbjct  1570  PPQVHDVASGFP--INEQQQYGEPYERMENLRTTERHFFPLDLGSVKDCKPRDTSVSSQI  1627

Query  4134  -HPLEEDQLHDKAPNLELALGAKTKPLMSGIPSFLSGKVEKKIIEENTSDNAATSANKED  4310
                  ED L  +APNLELALGA+ +P   G+  +L G  +K+    NT D  A     +D
Sbjct  1628  LSSNNEDLLGSEAPNLELALGAERRPPKQGMLPWLVGTADKR----NTRDPVANKKVDDD  1683

Query  4311  -VsaslslslsFPFPEKEHGTS--SKPEQEDPRRRQANTSLLLFG  4436
              VSASLSLSL+FPF  KEH     S  EQ  P   + NTSL LFG
Sbjct  1684  GVSASLSLSLAFPFSSKEHTVKPVSITEQLLPEAHRVNTSLFLFG  1728



>ref|XP_010270008.1| PREDICTED: uncharacterized protein LOC104606480 isoform X3 [Nelumbo 
nucifera]
 ref|XP_010270009.1| PREDICTED: uncharacterized protein LOC104606480 isoform X3 [Nelumbo 
nucifera]
Length=1746

 Score =   570 bits (1469),  Expect = 5e-170, Method: Compositional matrix adjust.
 Identities = 470/1305 (36%), Positives = 673/1305 (52%), Gaps = 166/1305 (13%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNE-----  1103
             CDICG  GRE LLA CSRC+DGAEHTYCM+ ML+K+PEGDW+CEECK  ++ + +     
Sbjct  464   CDICGDAGREDLLAFCSRCSDGAEHTYCMRLMLDKVPEGDWMCEECKLKEDTEKQKQDEV  523

Query  1104  HVNSGRVNE---KEKTSPSRRTTIAKSDHPLKMEQKTSDCWGDKAVEERSYLKTSGKRCT  1274
                SG   E    E++  S   +   S   +K+E K  D  G+++ +  S    S KR  
Sbjct  524   ETTSGFSKEPYLSERSQNSGGASTVSSKMMMKVELKAPDSEGNRSAKVISSSLLSVKRHL  583

Query  1275  DDSEVSSPTKRQRLE--LRSPTAQIPNRVTSLSRESSFKNLERGKVKPLNPFSS-GS-FA  1442
             D+SEV+S  KRQ  +  + SP A  P++   LSRESSFK+L++GKVK ++  +S GS FA
Sbjct  584   DNSEVASAEKRQAFDTSVGSPKASSPSKKPLLSRESSFKSLDKGKVKTIHKVASFGSHFA  643

Query  1443  ------AKVPSSTGPQP-------QPPRGIFSKSNSFSSLIAKPKVKLVDEVFPAKQKLS  1583
                   A  P++TGP P       Q PRG   KS SF+ L  K KVKLV E    K+K++
Sbjct  644   NNSHEIAHSPTTTGPNPSRIQSRLQSPRGTLLKSKSFNMLNLKSKVKLVQEDVSQKKKVA  703

Query  1584  RETAFIE-SKEVAVRSMGKSMSFKPTTASRSNCTESKVKMFSPKFSHDQDVKWLRHKKDR  1760
                   +  KE  VR++GKSMSFK       N TESKVK+ SP  S  +++K L+  K++
Sbjct  704   GNCVIGDMKKEGLVRTLGKSMSFKSENLGCLNVTESKVKILSPNLSRVEELKGLKQAKEQ  763

Query  1761  SSFDRKNSLRSDR------LAGGAISSPKSDNKPTPRGEPSSLSSLNTN-RDYRALTSD-  1916
             +  +RKNS +SDR       A  ++S+ K+D K   R E +S  S  TN RD +   +D 
Sbjct  764   NLIERKNSFKSDRPLVSSPRAVSSMSTLKNDQKINSRAENASFLSSATNFRDPKPAQADG  823

Query  1917  -----NKPVTISNSTSGV------AREVLKQASVDGVSSANRVSSSEENPSQAIPKEDSS  2063
                  +KP  ++N  S +      + EV +Q+ V  +SS  R SS+E+ PSQ  PK++ +
Sbjct  824   KLKTSSKPANLANKGSDIRNALAASNEVKRQSVVGALSSNGRCSSTEQKPSQVSPKDEPT  883

Query  2064  SSSCV-AERPSWSSNEVLPDGLSQSKESKAFGDKTRES-SASRSKQNSTASGKIVSCQKC  2237
             SSS V A+R     + +L DGL QS+ES   G K+RE      S+Q+ +  G+   CQKC
Sbjct  884   SSSSVSADRACGKHDTLLQDGLPQSRESLNQGAKSREPPHLGHSRQSISVGGQSARCQKC  943

Query  2238  KGNGHLAQVCTADGPESSAL-GSPFKSSREATNGPSDLKAAIEAARLRKPGICRKNRVAD  2414
             KG GH+AQ C       S L  S  K S+E  +    LK A+E   L++PGICRKNR  +
Sbjct  944   KGMGHVAQSCPVSNSRVSVLEASAEKISKEMMDKSCKLKEAVEPKILKRPGICRKNRSPE  1003

Query  2415  QSEDLSAS--NMKSEIASQDQML--SSTVRRNV------------NGAEEAQKQETANNA  2546
             Q ++LS S  ++ +E+ S+DQ+   SS +R N             N A +  +  T +N 
Sbjct  1004  QLDELSMSSTDLSTEV-SKDQLSASSSCLRNNSSQGTSDGQEIVRNSAADISRITTVDNV  1062

Query  2547  KQLGIIAEASARTRNAGHVVFSDVKHSV-IDMERQTLVSMPVILKTA--------IPEYQ  2699
             KQ  I       +  AG    SD   SV  +    ++ ++P +  +         IPE+ 
Sbjct  1063  KQYAIHLREEIISPQAGE---SDPSFSVDANKTSSSIRNLPFLESSVAAPSGISVIPEHD  1119

Query  2700  YIWQGGFEVQKSGKAFNLYDGIQAHLSSCASPKVLDAVNKFPRKVILNEVPRLSSWPMQF  2879
             ++WQG FEVQ++G   +L DGIQAHLS+CASPKV + V KFP KV+L EVP LS+WP QF
Sbjct  1120  FLWQGCFEVQRNGILPDLCDGIQAHLSTCASPKVPEVVKKFPSKVLLEEVPCLSTWPRQF  1179

Query  2880  KECGVSEDNVALFFFAKDIGSYEKSYKVLLGDMVKHDLALQGNIGDIELLIFPSNQLPEK  3059
              +   +EDNVAL+FFAKDI SYE+ YK L+  M+++DLAL+GN    ELLIFPSN+LP+K
Sbjct  1180  DDNHATEDNVALYFFAKDIESYERYYKCLVDKMIRNDLALKGNFDGTELLIFPSNKLPDK  1239

Query  3060  FQRWNLMFFLWGVFRGKRANSL---------------------QNFPGAEKPLIQDIPTP  3176
              QRWN++FFLWGVFRG+R N L                     QN P + +P+ + +  P
Sbjct  1240  SQRWNMLFFLWGVFRGRRPNCLEQTPGPQKKVSQANLDTVFAHQNLPASVQPVHKQLHLP  1299

Query  3177  A----TSLPENMF-----------TPVPKLNSARGSAATNTEMSAVKESESASLHKIVNG  3311
                   S     F             +P L+S R        +S++    ++S HK  + 
Sbjct  1300  GQMEDLSASNKSFCGPEADKSTASVELPFLSSGRLDGDCEPNISSLDHKYTSS-HKNFD-  1357

Query  3312  NCSIQSSSQVSRDKCSRINAEQNDKLDSSSMQNSEPKLGPDRRYFGVPLGEAVHSSVQTA  3491
                 Q  S +  +  SRI+   +++L + S  N+   L       G+  G+     +QT 
Sbjct  1358  ----QQGSGLDNNSMSRIHT-GDEQLSTKSNSNT---LKEQTNKEGMQEGK-----IQTC  1404

Query  3492  ERVSSPNTS----RPMSVHWAAPLDGEKLSMLSDETPTMQEATSVGSTTKNLCGKDDVKI  3659
              + ++ N +    + + V     LD +  S  S +TP    + S G     + G D  KI
Sbjct  1405  TQATTQNGNLYKGKSVPVELNNSLDRQDDSSCSLKTPPFSTSLSQGFGV--VGGTDKQKI  1462

Query  3660  GRICLDNVSTEE---------------ATPLARHTSMEQTLNVISSFGVNPKKRSH--SA  3788
                  D +  E                 T L R    E       ++  N +KR H  SA
Sbjct  1463  PERMQDEIRDEMKIQKEMMSPDGLMDIGTALKRTLKSESLDKGNCNWESNSRKRLHMDSA  1522

Query  3789  ETVLQsasssgtsqafss--ysNDDILVE-EFCHKRVKLNSDRSYGCND--QTSCSKDGF  3953
               + Q +  + +S++ ++     D +LV  E   K++K  S   YGCN   + +   + F
Sbjct  1523  LMIQQVSGETSSSRSRATLWMGEDHLLVGGESEMKKIKRCSSVVYGCNSSSEQNSFNERF  1582

Query  3954  LSEMGGTASQLSRQKNERDEALSKTAILETPGNAEMFFFPVDPHPVGNIGSNNSSMPWKV  4133
               ++   AS      NE+ +       +E     E  FFP+D   V +    ++S+  ++
Sbjct  1583  PPQVHDVASGFP--INEQQQYGEPYERMENLRTTERHFFPLDLGSVKDCKPRDTSVSSQI  1640

Query  4134  -HPLEEDQLHDKAPNLELALGAKTKPLMSGIPSFLSGKVEKKIIEENTSDNAATSANKED  4310
                  ED L  +APNLELALGA+ +P   G+  +L G  +K+    NT D  A     +D
Sbjct  1641  LSSNNEDLLGSEAPNLELALGAERRPPKQGMLPWLVGTADKR----NTRDPVANKKVDDD  1696

Query  4311  -VsaslslslsFPFPEKEHGTS--SKPEQEDPRRRQANTSLLLFG  4436
              VSASLSLSL+FPF  KEH     S  EQ  P   + NTSL LFG
Sbjct  1697  GVSASLSLSLAFPFSSKEHTVKPVSITEQLLPEAHRVNTSLFLFG  1741



>gb|KDP39546.1| hypothetical protein JCGZ_02566 [Jatropha curcas]
Length=1488

 Score =   563 bits (1452),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 346/773 (45%), Positives = 474/773 (61%), Gaps = 99/773 (13%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNEHVNSG  1118
             CDICG  GRE LLAICS+C+DGAEHTYCM++ML+K+PEGDWLCEECK  +E +N      
Sbjct  347   CDICGDAGREDLLAICSKCSDGAEHTYCMREMLQKVPEGDWLCEECKLAEETEN------  400

Query  1119  RVNEKEKTSPSRRTTIAKSDHPLKMEQKTSDCWGDKAVEERSYLKTSGKRCTDDSEVSSP  1298
                                      +++ SD  G K+   R+  ++S KR  +  EV+S 
Sbjct  401   -------------------------QKQGSDAEGKKS--SRAGAQSSSKRLFETIEVASA  433

Query  1299  TKRQRLE--LRSPTAQIPNRVTSLSRESSFKNLERGKVKPLNPFSSGSFA-------AKV  1451
             +KR  ++    SP +  P+++ +LSR+SSFK L++GKVKP +  S  + +       A+ 
Sbjct  434   SKRLAIDTSFGSPKSSSPSKIAALSRDSSFKGLDKGKVKPAHQTSLANHSTIDSPEIARS  493

Query  1452  PSSTGPQPQPPRGIFSKSNSFSSLIAKPKVKLVDEVFPAKQKLSRETAFIESKEVAVRSM  1631
             P   GP+ + P+G   KSNSFS++ +KPKVKLVD+V P KQK +RE   ++ KE   R+M
Sbjct  494   P--IGPRLRTPKGTLLKSNSFSTINSKPKVKLVDDV-PQKQKGNRE---LDMKEGTARTM  547

Query  1632  GKSMSFKPTTASRSNCTESKVKMFSPKFSHDQDVKWLRHKKDRSSFDRKNSLRSDRLAGG  1811
              KSMSF+    SRS  TESKVKM S K+S  QD+K L+  K+R++ + K   + DR  G 
Sbjct  548   SKSMSFRSVNPSRSGATESKVKMLSSKYSQAQDIKALKQVKERNASESKTLAKLDRPVGS  607

Query  1812  A------ISSPKSDNKPTPRGEPSSLSSLNTNRDYRALTSDNKPVTISNSTSGVARE---  1964
             +      IS+ K + K TPRG+  ++SS + N++ +AL SD K   +  STS +AR+   
Sbjct  608   SGTTNSHISTLKVNQKLTPRGDNVAVSSTSNNKEPKALQSDGKLGGLLRSTSSIARKSAE  667

Query  1965  ----VLKQASVDGVSSANRVSSSEENPSQAIPKED-SSSSSCVAERPSWSSNEVLPDGLS  2129
                  ++ ++++G+SSA    S E+  +Q IPK++ SSSSS  AER S + +E L  GLS
Sbjct  668   LPITSVRSSAMNGMSSA----SIEQKSNQVIPKDEPSSSSSWNAERQSHNIDENL-QGLS  722

Query  2130  QSKESKAFGDKTRESSASRSKQNSTASGKIVSCQKCKGNGHLAQVCTADGPESSALG-SP  2306
             +S+ES    +KTRESS +R +   TA  K V+CQKCK  GH A+ CT   P  S    S 
Sbjct  723   RSRESSDQSEKTRESSVTRLRPAVTAGLKSVTCQKCKEIGHAAEFCTICSPRPSGTDTSA  782

Query  2307  FKSSREATNGPSDLKAAIEAARLRKPGICRKNRVADQSEDLSASNMK--SEIASQDQMLS  2480
              +  RE  +  S LKAAIEAA LRKPGI RK +  DQS+ L +SN+   SE AS DQ   
Sbjct  783   ARIVREDMSKGSKLKAAIEAAMLRKPGIFRKKKEIDQSDGLLSSNVDVTSEAASHDQFSV  842

Query  2481  STVRRNV---NGAEEAQ-----------KQETANNAKQLGIIAEASARTRNAGHVVF---  2609
             S   RN+    G +E Q           KQ   NN KQL +         N+  +V    
Sbjct  843   SNKLRNMISDEGTDEGQANIGLSSSESCKQMNINNVKQLNV---------NSADIVLPLK  893

Query  2610  --SDVKHSVIDMERQTLVSMPVILKT-AIPEYQYIWQGGFEVQKSGKAFNLYDGIQAHLS  2780
                D           +L + P+  K   IPE++YIWQG FEV++ G+  +L+DGIQAHLS
Sbjct  894   VGEDTMVPSGGKPCHSLTATPLFSKMLTIPEHEYIWQGAFEVRRGGRLLDLHDGIQAHLS  953

Query  2781  SCASPKVLDAVNKFPRKVILNEVPRLSSWPMQFKECGVSEDNVALFFFAKDIGSYEKSYK  2960
             +CASPKVL+ +N+FP+K+ ++EVPRLS+WP QF E G  EDN+AL+FFAKD+ SYEKSYK
Sbjct  954   TCASPKVLEVMNQFPQKITVDEVPRLSTWPRQFHELGAKEDNIALYFFAKDLESYEKSYK  1013

Query  2961  VLLGDMVKHDLALQGNIGDIELLIFPSNQLPEKFQRWNLMFFLWGVFRGKRAN  3119
              LL +M++ DLAL+G  G +E LIFPS QLPEK QRWN++FFLWGVFRG+++N
Sbjct  1014  NLLDNMIRGDLALKGYFGGVEFLIFPSTQLPEKSQRWNMLFFLWGVFRGRKSN  1066



>ref|XP_010270004.1| PREDICTED: uncharacterized protein LOC104606480 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010270006.1| PREDICTED: uncharacterized protein LOC104606480 isoform X1 [Nelumbo 
nucifera]
Length=1792

 Score =   569 bits (1467),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 468/1301 (36%), Positives = 670/1301 (51%), Gaps = 158/1301 (12%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNE-----  1103
             CDICG  GRE LLA CSRC+DGAEHTYCM+ ML+K+PEGDW+CEECK  ++ + +     
Sbjct  510   CDICGDAGREDLLAFCSRCSDGAEHTYCMRLMLDKVPEGDWMCEECKLKEDTEKQKQDEV  569

Query  1104  HVNSGRVNE---KEKTSPSRRTTIAKSDHPLKMEQKTSDCWGDKAVEERSYLKTSGKRCT  1274
                SG   E    E++  S   +   S   +K+E K  D  G+++ +  S    S KR  
Sbjct  570   ETTSGFSKEPYLSERSQNSGGASTVSSKMMMKVELKAPDSEGNRSAKVISSSLLSVKRHL  629

Query  1275  DDSEVSSPTKRQRLE--LRSPTAQIPNRVTSLSRESSFKNLERGKVKPLNPFSS-GS-FA  1442
             D+SEV+S  KRQ  +  + SP A  P++   LSRESSFK+L++GKVK ++  +S GS FA
Sbjct  630   DNSEVASAEKRQAFDTSVGSPKASSPSKKPLLSRESSFKSLDKGKVKTIHKVASFGSHFA  689

Query  1443  ------AKVPSSTGPQP-------QPPRGIFSKSNSFSSLIAKPKVKLVDEVFPAKQKLS  1583
                   A  P++TGP P       Q PRG   KS SF+ L  K KVKLV E    K+K++
Sbjct  690   NNSHEIAHSPTTTGPNPSRIQSRLQSPRGTLLKSKSFNMLNLKSKVKLVQEDVSQKKKVA  749

Query  1584  RETAFIE-SKEVAVRSMGKSMSFKPTTASRSNCTESKVKMFSPKFSHDQDVKWLRHKKDR  1760
                   +  KE  VR++GKSMSFK       N TESKVK+ SP  S  +++K L+  K++
Sbjct  750   GNCVIGDMKKEGLVRTLGKSMSFKSENLGCLNVTESKVKILSPNLSRVEELKGLKQAKEQ  809

Query  1761  SSFDRKNSLRSDR------LAGGAISSPKSDNKPTPRGEPSSLSSLNTN-RDYRALTSD-  1916
             +  +RKNS +SDR       A  ++S+ K+D K   R E +S  S  TN RD +   +D 
Sbjct  810   NLIERKNSFKSDRPLVSSPRAVSSMSTLKNDQKINSRAENASFLSSATNFRDPKPAQADG  869

Query  1917  -----NKPVTISNSTSGV------AREVLKQASVDGVSSANRVSSSEENPSQAIPKEDSS  2063
                  +KP  ++N  S +      + EV +Q+ V  +SS  R SS+E+ PSQ  PK++ +
Sbjct  870   KLKTSSKPANLANKGSDIRNALAASNEVKRQSVVGALSSNGRCSSTEQKPSQVSPKDEPT  929

Query  2064  SSSCV-AERPSWSSNEVLPDGLSQSKESKAFGDKTRES-SASRSKQNSTASGKIVSCQKC  2237
             SSS V A+R     + +L DGL QS+ES   G K+RE      S+Q+ +  G+   CQKC
Sbjct  930   SSSSVSADRACGKHDTLLQDGLPQSRESLNQGAKSREPPHLGHSRQSISVGGQSARCQKC  989

Query  2238  KGNGHLAQVCTADGPESSAL-GSPFKSSREATNGPSDLKAAIEAARLRKPGICRKNRVAD  2414
             KG GH+AQ C       S L  S  K S+E  +    LK A+E   L++PGICRKNR  +
Sbjct  990   KGMGHVAQSCPVSNSRVSVLEASAEKISKEMMDKSCKLKEAVEPKILKRPGICRKNRSPE  1049

Query  2415  QSEDLSAS--NMKSEIASQDQML--SSTVRRNV------------NGAEEAQKQETANNA  2546
             Q ++LS S  ++ +E+ S+DQ+   SS +R N             N A +  +  T +N 
Sbjct  1050  QLDELSMSSTDLSTEV-SKDQLSASSSCLRNNSSQGTSDGQEIVRNSAADISRITTVDNV  1108

Query  2547  KQLGIIAEASARTRNAGHVVFSDVKHSV-IDMERQTLVSMPVILKTA--------IPEYQ  2699
             KQ  I       +  AG    SD   SV  +    ++ ++P +  +         IPE+ 
Sbjct  1109  KQYAIHLREEIISPQAGE---SDPSFSVDANKTSSSIRNLPFLESSVAAPSGISVIPEHD  1165

Query  2700  YIWQGGFEVQKSGKAFNLYDGIQAHLSSCASPKVLDAVNKFPRKVILNEVPRLSSWPMQF  2879
             ++WQG FEVQ++G   +L DGIQAHLS+CASPKV + V KFP KV+L EVP LS+WP QF
Sbjct  1166  FLWQGCFEVQRNGILPDLCDGIQAHLSTCASPKVPEVVKKFPSKVLLEEVPCLSTWPRQF  1225

Query  2880  KECGVSEDNVALFFFAKDIGSYEKSYKVLLGDMVKHDLALQGNIGDIELLIFPSNQLPEK  3059
              +   +EDNVAL+FFAKDI SYE+ YK L+  M+++DLAL+GN    ELLIFPSN+LP+K
Sbjct  1226  DDNHATEDNVALYFFAKDIESYERYYKCLVDKMIRNDLALKGNFDGTELLIFPSNKLPDK  1285

Query  3060  FQRWNLMFFLWGVFRGKRANSL---------------------QNFPGAEKPLIQDIPTP  3176
              QRWN++FFLWGVFRG+R N L                     QN P + +P+ + +  P
Sbjct  1286  SQRWNMLFFLWGVFRGRRPNCLEQTPGPQKKVSQANLDTVFAHQNLPASVQPVHKQLHLP  1345

Query  3177  A----TSLPENMF-----------TPVPKLNSARGSAATNTEMSAVKESESASLHKIVNG  3311
                   S     F             +P L+S R        +S++    ++S HK  + 
Sbjct  1346  GQMEDLSASNKSFCGPEADKSTASVELPFLSSGRLDGDCEPNISSLDHKYTSS-HKNFD-  1403

Query  3312  NCSIQSSSQVSRDKCSRINAEQNDKLDSSSMQNSEPKLGPDRRYFGVPLGEAVHSSVQTA  3491
                 Q  S +  +  SRI+   +++L + S  N+   L       G+  G+ + +  Q  
Sbjct  1404  ----QQGSGLDNNSMSRIHT-GDEQLSTKSNSNT---LKEQTNKEGMQEGK-IQTCTQAT  1454

Query  3492  ERVSSPNTSRPMSVHWAAPLDGEKLSMLSDETPTMQEATSVGSTTKNLCGKDDVKIGRIC  3671
              +  +    + + V     LD +  S  S +TP    + S G     + G D  KI    
Sbjct  1455  TQNGNLYKGKSVPVELNNSLDRQDDSSCSLKTPPFSTSLSQGFGV--VGGTDKQKIPERM  1512

Query  3672  LDNVSTEE---------------ATPLARHTSMEQTLNVISSFGVNPKKRSH--SAETVL  3800
              D +  E                 T L R    E       ++  N +KR H  SA  + 
Sbjct  1513  QDEIRDEMKIQKEMMSPDGLMDIGTALKRTLKSESLDKGNCNWESNSRKRLHMDSALMIQ  1572

Query  3801  Qsasssgtsqafss--ysNDDILVE-EFCHKRVKLNSDRSYGCND--QTSCSKDGFLSEM  3965
             Q +  + +S++ ++     D +LV  E   K++K  S   YGCN   + +   + F  ++
Sbjct  1573  QVSGETSSSRSRATLWMGEDHLLVGGESEMKKIKRCSSVVYGCNSSSEQNSFNERFPPQV  1632

Query  3966  GGTASQLSRQKNERDEALSKTAILETPGNAEMFFFPVDPHPVGNIGSNNSSMPWKV-HPL  4142
                AS      NE+ +       +E     E  FFP+D   V +    ++S+  ++    
Sbjct  1633  HDVASGFP--INEQQQYGEPYERMENLRTTERHFFPLDLGSVKDCKPRDTSVSSQILSSN  1690

Query  4143  EEDQLHDKAPNLELALGAKTKPLMSGIPSFLSGKVEKKIIEENTSDNAATSANKED-Vsa  4319
              ED L  +APNLELALGA+ +P   G+  +L G  +K+    NT D  A     +D VSA
Sbjct  1691  NEDLLGSEAPNLELALGAERRPPKQGMLPWLVGTADKR----NTRDPVANKKVDDDGVSA  1746

Query  4320  slslslsFPFPEKEHGTS--SKPEQEDPRRRQANTSLLLFG  4436
             SLSLSL+FPF  KEH     S  EQ  P   + NTSL LFG
Sbjct  1747  SLSLSLAFPFSSKEHTVKPVSITEQLLPEAHRVNTSLFLFG  1787



>ref|XP_010270007.1| PREDICTED: uncharacterized protein LOC104606480 isoform X2 [Nelumbo 
nucifera]
Length=1790

 Score =   569 bits (1466),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 468/1301 (36%), Positives = 670/1301 (51%), Gaps = 158/1301 (12%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNE-----  1103
             CDICG  GRE LLA CSRC+DGAEHTYCM+ ML+K+PEGDW+CEECK  ++ + +     
Sbjct  508   CDICGDAGREDLLAFCSRCSDGAEHTYCMRLMLDKVPEGDWMCEECKLKEDTEKQKQDEV  567

Query  1104  HVNSGRVNE---KEKTSPSRRTTIAKSDHPLKMEQKTSDCWGDKAVEERSYLKTSGKRCT  1274
                SG   E    E++  S   +   S   +K+E K  D  G+++ +  S    S KR  
Sbjct  568   ETTSGFSKEPYLSERSQNSGGASTVSSKMMMKVELKAPDSEGNRSAKVISSSLLSVKRHL  627

Query  1275  DDSEVSSPTKRQRLE--LRSPTAQIPNRVTSLSRESSFKNLERGKVKPLNPFSS-GS-FA  1442
             D+SEV+S  KRQ  +  + SP A  P++   LSRESSFK+L++GKVK ++  +S GS FA
Sbjct  628   DNSEVASAEKRQAFDTSVGSPKASSPSKKPLLSRESSFKSLDKGKVKTIHKVASFGSHFA  687

Query  1443  ------AKVPSSTGPQP-------QPPRGIFSKSNSFSSLIAKPKVKLVDEVFPAKQKLS  1583
                   A  P++TGP P       Q PRG   KS SF+ L  K KVKLV E    K+K++
Sbjct  688   NNSHEIAHSPTTTGPNPSRIQSRLQSPRGTLLKSKSFNMLNLKSKVKLVQEDVSQKKKVA  747

Query  1584  RETAFIE-SKEVAVRSMGKSMSFKPTTASRSNCTESKVKMFSPKFSHDQDVKWLRHKKDR  1760
                   +  KE  VR++GKSMSFK       N TESKVK+ SP  S  +++K L+  K++
Sbjct  748   GNCVIGDMKKEGLVRTLGKSMSFKSENLGCLNVTESKVKILSPNLSRVEELKGLKQAKEQ  807

Query  1761  SSFDRKNSLRSDR------LAGGAISSPKSDNKPTPRGEPSSLSSLNTN-RDYRALTSD-  1916
             +  +RKNS +SDR       A  ++S+ K+D K   R E +S  S  TN RD +   +D 
Sbjct  808   NLIERKNSFKSDRPLVSSPRAVSSMSTLKNDQKINSRAENASFLSSATNFRDPKPAQADG  867

Query  1917  -----NKPVTISNSTSGV------AREVLKQASVDGVSSANRVSSSEENPSQAIPKEDSS  2063
                  +KP  ++N  S +      + EV +Q+ V  +SS  R SS+E+ PSQ  PK++ +
Sbjct  868   KLKTSSKPANLANKGSDIRNALAASNEVKRQSVVGALSSNGRCSSTEQKPSQVSPKDEPT  927

Query  2064  SSSCV-AERPSWSSNEVLPDGLSQSKESKAFGDKTRES-SASRSKQNSTASGKIVSCQKC  2237
             SSS V A+R     + +L DGL QS+ES   G K+RE      S+Q+ +  G+   CQKC
Sbjct  928   SSSSVSADRACGKHDTLLQDGLPQSRESLNQGAKSREPPHLGHSRQSISVGGQSARCQKC  987

Query  2238  KGNGHLAQVCTADGPESSAL-GSPFKSSREATNGPSDLKAAIEAARLRKPGICRKNRVAD  2414
             KG GH+AQ C       S L  S  K S+E  +    LK A+E   L++PGICRKNR  +
Sbjct  988   KGMGHVAQSCPVSNSRVSVLEASAEKISKEMMDKSCKLKEAVEPKILKRPGICRKNRSPE  1047

Query  2415  QSEDLSAS--NMKSEIASQDQML--SSTVRRNV------------NGAEEAQKQETANNA  2546
             Q ++LS S  ++ +E+ S+DQ+   SS +R N             N A +  +  T +N 
Sbjct  1048  QLDELSMSSTDLSTEV-SKDQLSASSSCLRNNSSQGTSDGQEIVRNSAADISRITTVDNV  1106

Query  2547  KQLGIIAEASARTRNAGHVVFSDVKHSV-IDMERQTLVSMPVILKTA--------IPEYQ  2699
             KQ  I       +  AG    SD   SV  +    ++ ++P +  +         IPE+ 
Sbjct  1107  KQYAIHLREEIISPQAGE---SDPSFSVDANKTSSSIRNLPFLESSVAAPSGISVIPEHD  1163

Query  2700  YIWQGGFEVQKSGKAFNLYDGIQAHLSSCASPKVLDAVNKFPRKVILNEVPRLSSWPMQF  2879
             ++WQG FEVQ++G   +L DGIQAHLS+CASPKV + V KFP KV+L EVP LS+WP QF
Sbjct  1164  FLWQGCFEVQRNGILPDLCDGIQAHLSTCASPKVPEVVKKFPSKVLLEEVPCLSTWPRQF  1223

Query  2880  KECGVSEDNVALFFFAKDIGSYEKSYKVLLGDMVKHDLALQGNIGDIELLIFPSNQLPEK  3059
              +   +EDNVAL+FFAKDI SYE+ YK L+  M+++DLAL+GN    ELLIFPSN+LP+K
Sbjct  1224  DDNHATEDNVALYFFAKDIESYERYYKCLVDKMIRNDLALKGNFDGTELLIFPSNKLPDK  1283

Query  3060  FQRWNLMFFLWGVFRGKRANSL---------------------QNFPGAEKPLIQDIPTP  3176
              QRWN++FFLWGVFRG+R N L                     QN P + +P+ + +  P
Sbjct  1284  SQRWNMLFFLWGVFRGRRPNCLEQTPGPQKKVSQANLDTVFAHQNLPASVQPVHKQLHLP  1343

Query  3177  AT----SLPENMF-----------TPVPKLNSARGSAATNTEMSAVKESESASLHKIVNG  3311
                   S     F             +P L+S R        +S++    ++S HK  + 
Sbjct  1344  GQMEDLSASNKSFCGPEADKSTASVELPFLSSGRLDGDCEPNISSLDHKYTSS-HKNFD-  1401

Query  3312  NCSIQSSSQVSRDKCSRINAEQNDKLDSSSMQNSEPKLGPDRRYFGVPLGEAVHSSVQTA  3491
                 Q  S +  +  SRI+   +++L + S  N+   L       G+  G+ + +  Q  
Sbjct  1402  ----QQGSGLDNNSMSRIHT-GDEQLSTKSNSNT---LKEQTNKEGMQEGK-IQTCTQAT  1452

Query  3492  ERVSSPNTSRPMSVHWAAPLDGEKLSMLSDETPTMQEATSVGSTTKNLCGKDDVKIGRIC  3671
              +  +    + + V     LD +  S  S +TP    + S G     + G D  KI    
Sbjct  1453  TQNGNLYKGKSVPVELNNSLDRQDDSSCSLKTPPFSTSLSQGFGV--VGGTDKQKIPERM  1510

Query  3672  LDNVSTEE---------------ATPLARHTSMEQTLNVISSFGVNPKKRSH--SAETVL  3800
              D +  E                 T L R    E       ++  N +KR H  SA  + 
Sbjct  1511  QDEIRDEMKIQKEMMSPDGLMDIGTALKRTLKSESLDKGNCNWESNSRKRLHMDSALMIQ  1570

Query  3801  Qsasssgtsqafss--ysNDDILVE-EFCHKRVKLNSDRSYGCND--QTSCSKDGFLSEM  3965
             Q +  + +S++ ++     D +LV  E   K++K  S   YGCN   + +   + F  ++
Sbjct  1571  QVSGETSSSRSRATLWMGEDHLLVGGESEMKKIKRCSSVVYGCNSSSEQNSFNERFPPQV  1630

Query  3966  GGTASQLSRQKNERDEALSKTAILETPGNAEMFFFPVDPHPVGNIGSNNSSMPWKV-HPL  4142
                AS      NE+ +       +E     E  FFP+D   V +    ++S+  ++    
Sbjct  1631  HDVASGFP--INEQQQYGEPYERMENLRTTERHFFPLDLGSVKDCKPRDTSVSSQILSSN  1688

Query  4143  EEDQLHDKAPNLELALGAKTKPLMSGIPSFLSGKVEKKIIEENTSDNAATSANKED-Vsa  4319
              ED L  +APNLELALGA+ +P   G+  +L G  +K+    NT D  A     +D VSA
Sbjct  1689  NEDLLGSEAPNLELALGAERRPPKQGMLPWLVGTADKR----NTRDPVANKKVDDDGVSA  1744

Query  4320  slslslsFPFPEKEHGTS--SKPEQEDPRRRQANTSLLLFG  4436
             SLSLSL+FPF  KEH     S  EQ  P   + NTSL LFG
Sbjct  1745  SLSLSLAFPFSSKEHTVKPVSITEQLLPEAHRVNTSLFLFG  1785



>ref|XP_007029696.1| RING/FYVE/PHD zinc finger superfamily protein, putative isoform 
8 [Theobroma cacao]
 gb|EOY10198.1| RING/FYVE/PHD zinc finger superfamily protein, putative isoform 
8 [Theobroma cacao]
Length=1209

 Score =   555 bits (1430),  Expect = 3e-169, Method: Compositional matrix adjust.
 Identities = 356/777 (46%), Positives = 466/777 (60%), Gaps = 89/777 (11%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNEHVNSG  1118
             CDICG  GRE LLAICS+C DGAEHTYCM++ML+K+PEGDWLCEECK  +E ++      
Sbjct  91    CDICGDAGREDLLAICSKCADGAEHTYCMREMLQKVPEGDWLCEECKLAEETES------  144

Query  1119  RVNEKEKTSPSRRTTIAKSDHPLKMEQKTSDCWGDKAVEERSYLKTSGKRCTDDSEVSSP  1298
                                      +++ SD  G +A +  S  ++ GKR  ++ E SS 
Sbjct  145   -------------------------QKQGSDAEGKRANKLSSGTQSLGKRHAENQEGSSA  179

Query  1299  TKRQRLE--LRSPTAQIPNRVTSLSRESSFKNLERGKVKPLNPFSSGSFA-------AKV  1451
              KRQ +E  + SP +  P+RV +LSRE SFKNL++GK++P    S G+ +       A+ 
Sbjct  180   PKRQAVETNMASPKSLSPSRVAALSREGSFKNLDKGKMRPSPQISLGNHSGSDMPETARS  239

Query  1452  PSSTGPQPQPPRGIFSKSNSFSSLIAKPKVKLVDEVFPAKQKLSRETAFIESKEVAVRSM  1631
             P+S GP+ Q P+G   KSNSF++L  KPKVKLVDEV   KQK +RE A ++SKE + R M
Sbjct  240   PTS-GPRLQTPKGTLLKSNSFNNLNIKPKVKLVDEVVLQKQKGAREHASLDSKEESARMM  298

Query  1632  GKSMSFKPTTASRSNCTESKVKMFSPKFSHDQDVKWLRHKKDRSSFDRKNSLRSDRLAGG  1811
             GKSMSFK T + R N  ESK KM S K+SH QD+K L+  K+R S +RKN  + DR +  
Sbjct  299   GKSMSFKSTNSGRLNTGESKFKMLSSKYSHVQDLKGLKQVKERISLERKNFSKLDR-SSS  357

Query  1812  AISSPKSDNKPTPRGEPSSLSSLNTNRDYRALTSDNKPVTISNSTSGVAREVLKQA--SV  1985
              +S+PK D K TPR +  S SS + NR+ + + SD KP T+S STS +AR+V++ A  S 
Sbjct  358   TVSTPKVDQKQTPRADTISNSSASNNRESKVVQSDGKPSTLSRSTSSLARKVVENAVTSA  417

Query  1986  DGVSSAN-RVSSSEENPSQAIPKEDSSSSSCVAERPSWSSNEVLPDGLSQSKESKAFGDK  2162
              GVSS N R+SS ++    +  +E SSSSS  AER   + N V+ DGLS+S +S    +K
Sbjct  418   VGVSSTNGRISSEQKLNLVSPKEEPSSSSSWTAERQPNNVNGVMSDGLSRSLDSTNQSEK  477

Query  2163  TRESSASRSKQNSTASGKIVSCQKCKGNGHLAQVCTADGPESSALGSPFKSSREATNGPS  2342
             +RESS  RS+         V C KCK  GH A+ C+     ++ + +P ++SRE  N  +
Sbjct  478   SRESSVGRSRS--------VPCLKCKEMGHTAEYCSVPQVSAADMSAP-RTSREEINKGN  528

Query  2343  DLKAAIEAARLRKPGICRKNRVADQSEDLSASNMKSEIASQDQMLSSTVRRN---VNGAE  2513
              LKAAIEAA   +PGIC                   E   QDQ   S   +N   V GA 
Sbjct  529   KLKAAIEAAIRMRPGIC-------------------ERPPQDQSPFSNKAKNMIAVEGAH  569

Query  2514  EAQKQETANNAKQLGIIAEASARTRNAGHVVFSDVKHSVIDMERQTLVSMPVILK-TAIP  2690
             EAQ      N   +G     ++ + +A  VV S    S+ D+    L ++  I K +AIP
Sbjct  570   EAQT--NVQNQASIGNQKLLNSHSTDAVSVVSSVGNLSMRDISVPLLATVSAITKMSAIP  627

Query  2691  EYQYIWQGGFEVQKSGKAFNLYDGIQAHLSSCASPKVLDAVNKFPRKVILNEVPRLSSWP  2870
             E++YIWQG FEV KSGK  +   GIQAHLS+ ASPKVL+ VN FP KV LNEVPRLS+WP
Sbjct  628   EHEYIWQGAFEVHKSGKLPDFCGGIQAHLSTLASPKVLEVVNTFPHKVSLNEVPRLSTWP  687

Query  2871  MQFKECGVSEDNVALFFFAKDIGSYEKSYKVLLGDMVKHDLALQGNIGDIELLIFPSNQL  3050
              QF + G  EDN+AL+FFAKD  SYEK+YKVLL  MVK+DLAL+GN   +ELLIFPSN L
Sbjct  688   AQFHDSGPKEDNIALYFFAKDPESYEKNYKVLLETMVKNDLALKGNFEGVELLIFPSNLL  747

Query  3051  PEKFQRWNLMFFLWGVFRGKRANSLQN-----FPGA-----EKPLIQDIPTPATSLP  3191
             PE  QRWN +FFLWGVF+G+R N   +      P A     E  +  DIP P  + P
Sbjct  748   PENCQRWNTLFFLWGVFKGRRVNCSNSSKSACIPDASMVRLEGEVSTDIPQPVENEP  804


 Score =   100 bits (249),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 70/146 (48%), Positives = 85/146 (58%), Gaps = 3/146 (2%)
 Frame = +3

Query  4008  DEALSKTAILETPGNAEMFFFPVDPHPVGNIGSNNSSMPWK-VHPLEEDQLHDKAPNLEL  4184
             D A  +  I E  G++E FFFP+D H        ++S PWK     +EDQ HD  PNLEL
Sbjct  1059  DIACVEKVIPEDLGSSERFFFPMDSHHGREFRLVDNSKPWKEFSAKDEDQAHDVFPNLEL  1118

Query  4185  ALGAKTKPLMSGIPSFLSGKVEKKIIEENTSDNAATSANKEDVsaslslslsFPFPEKEH  4364
             ALGA+T+P   GI  F  G V+K   ++   D       ++DV ASLSLSLSFPFPEKE 
Sbjct  1119  ALGAETRPPNKGILPFFVGTVDKNSNQDRPLDKVRGKEEEDDVPASLSLSLSFPFPEKEQ  1178

Query  4365  G--TSSKPEQEDPRRRQANTSLLLFG  4436
                + SK EQ  P R   NTSLLLFG
Sbjct  1179  SLKSVSKTEQLLPERHPVNTSLLLFG  1204



>ref|XP_007029690.1| RING/FYVE/PHD zinc finger superfamily protein, putative isoform 
2 [Theobroma cacao]
 ref|XP_007029691.1| RING/FYVE/PHD zinc finger superfamily protein, putative isoform 
2 [Theobroma cacao]
 ref|XP_007029693.1| RING/FYVE/PHD zinc finger superfamily protein, putative isoform 
2 [Theobroma cacao]
 ref|XP_007029694.1| RING/FYVE/PHD zinc finger superfamily protein, putative isoform 
2 [Theobroma cacao]
 gb|EOY10192.1| RING/FYVE/PHD zinc finger superfamily protein, putative isoform 
2 [Theobroma cacao]
 gb|EOY10193.1| RING/FYVE/PHD zinc finger superfamily protein, putative isoform 
2 [Theobroma cacao]
 gb|EOY10195.1| RING/FYVE/PHD zinc finger superfamily protein, putative isoform 
2 [Theobroma cacao]
 gb|EOY10196.1| RING/FYVE/PHD zinc finger superfamily protein, putative isoform 
2 [Theobroma cacao]
Length=1403

 Score =   557 bits (1435),  Expect = 5e-168, Method: Compositional matrix adjust.
 Identities = 356/777 (46%), Positives = 466/777 (60%), Gaps = 89/777 (11%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNEHVNSG  1118
             CDICG  GRE LLAICS+C DGAEHTYCM++ML+K+PEGDWLCEECK  +E ++      
Sbjct  285   CDICGDAGREDLLAICSKCADGAEHTYCMREMLQKVPEGDWLCEECKLAEETES------  338

Query  1119  RVNEKEKTSPSRRTTIAKSDHPLKMEQKTSDCWGDKAVEERSYLKTSGKRCTDDSEVSSP  1298
                                      +++ SD  G +A +  S  ++ GKR  ++ E SS 
Sbjct  339   -------------------------QKQGSDAEGKRANKLSSGTQSLGKRHAENQEGSSA  373

Query  1299  TKRQRLE--LRSPTAQIPNRVTSLSRESSFKNLERGKVKPLNPFSSGSFA-------AKV  1451
              KRQ +E  + SP +  P+RV +LSRE SFKNL++GK++P    S G+ +       A+ 
Sbjct  374   PKRQAVETNMASPKSLSPSRVAALSREGSFKNLDKGKMRPSPQISLGNHSGSDMPETARS  433

Query  1452  PSSTGPQPQPPRGIFSKSNSFSSLIAKPKVKLVDEVFPAKQKLSRETAFIESKEVAVRSM  1631
             P+S GP+ Q P+G   KSNSF++L  KPKVKLVDEV   KQK +RE A ++SKE + R M
Sbjct  434   PTS-GPRLQTPKGTLLKSNSFNNLNIKPKVKLVDEVVLQKQKGAREHASLDSKEESARMM  492

Query  1632  GKSMSFKPTTASRSNCTESKVKMFSPKFSHDQDVKWLRHKKDRSSFDRKNSLRSDRLAGG  1811
             GKSMSFK T + R N  ESK KM S K+SH QD+K L+  K+R S +RKN  + DR +  
Sbjct  493   GKSMSFKSTNSGRLNTGESKFKMLSSKYSHVQDLKGLKQVKERISLERKNFSKLDR-SSS  551

Query  1812  AISSPKSDNKPTPRGEPSSLSSLNTNRDYRALTSDNKPVTISNSTSGVAREVLKQA--SV  1985
              +S+PK D K TPR +  S SS + NR+ + + SD KP T+S STS +AR+V++ A  S 
Sbjct  552   TVSTPKVDQKQTPRADTISNSSASNNRESKVVQSDGKPSTLSRSTSSLARKVVENAVTSA  611

Query  1986  DGVSSAN-RVSSSEENPSQAIPKEDSSSSSCVAERPSWSSNEVLPDGLSQSKESKAFGDK  2162
              GVSS N R+SS ++    +  +E SSSSS  AER   + N V+ DGLS+S +S    +K
Sbjct  612   VGVSSTNGRISSEQKLNLVSPKEEPSSSSSWTAERQPNNVNGVMSDGLSRSLDSTNQSEK  671

Query  2163  TRESSASRSKQNSTASGKIVSCQKCKGNGHLAQVCTADGPESSALGSPFKSSREATNGPS  2342
             +RESS  RS+         V C KCK  GH A+ C+     ++ + +P ++SRE  N  +
Sbjct  672   SRESSVGRSRS--------VPCLKCKEMGHTAEYCSVPQVSAADMSAP-RTSREEINKGN  722

Query  2343  DLKAAIEAARLRKPGICRKNRVADQSEDLSASNMKSEIASQDQMLSSTVRRN---VNGAE  2513
              LKAAIEAA   +PGIC                   E   QDQ   S   +N   V GA 
Sbjct  723   KLKAAIEAAIRMRPGIC-------------------ERPPQDQSPFSNKAKNMIAVEGAH  763

Query  2514  EAQKQETANNAKQLGIIAEASARTRNAGHVVFSDVKHSVIDMERQTLVSMPVILK-TAIP  2690
             EAQ      N   +G     ++ + +A  VV S    S+ D+    L ++  I K +AIP
Sbjct  764   EAQT--NVQNQASIGNQKLLNSHSTDAVSVVSSVGNLSMRDISVPLLATVSAITKMSAIP  821

Query  2691  EYQYIWQGGFEVQKSGKAFNLYDGIQAHLSSCASPKVLDAVNKFPRKVILNEVPRLSSWP  2870
             E++YIWQG FEV KSGK  +   GIQAHLS+ ASPKVL+ VN FP KV LNEVPRLS+WP
Sbjct  822   EHEYIWQGAFEVHKSGKLPDFCGGIQAHLSTLASPKVLEVVNTFPHKVSLNEVPRLSTWP  881

Query  2871  MQFKECGVSEDNVALFFFAKDIGSYEKSYKVLLGDMVKHDLALQGNIGDIELLIFPSNQL  3050
              QF + G  EDN+AL+FFAKD  SYEK+YKVLL  MVK+DLAL+GN   +ELLIFPSN L
Sbjct  882   AQFHDSGPKEDNIALYFFAKDPESYEKNYKVLLETMVKNDLALKGNFEGVELLIFPSNLL  941

Query  3051  PEKFQRWNLMFFLWGVFRGKRANSLQN-----FPGA-----EKPLIQDIPTPATSLP  3191
             PE  QRWN +FFLWGVF+G+R N   +      P A     E  +  DIP P  + P
Sbjct  942   PENCQRWNTLFFLWGVFKGRRVNCSNSSKSACIPDASMVRLEGEVSTDIPQPVENEP  998


 Score =   100 bits (250),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 70/146 (48%), Positives = 85/146 (58%), Gaps = 3/146 (2%)
 Frame = +3

Query  4008  DEALSKTAILETPGNAEMFFFPVDPHPVGNIGSNNSSMPWK-VHPLEEDQLHDKAPNLEL  4184
             D A  +  I E  G++E FFFP+D H        ++S PWK     +EDQ HD  PNLEL
Sbjct  1253  DIACVEKVIPEDLGSSERFFFPMDSHHGREFRLVDNSKPWKEFSAKDEDQAHDVFPNLEL  1312

Query  4185  ALGAKTKPLMSGIPSFLSGKVEKKIIEENTSDNAATSANKEDVsaslslslsFPFPEKEH  4364
             ALGA+T+P   GI  F  G V+K   ++   D       ++DV ASLSLSLSFPFPEKE 
Sbjct  1313  ALGAETRPPNKGILPFFVGTVDKNSNQDRPLDKVRGKEEEDDVPASLSLSLSFPFPEKEQ  1372

Query  4365  G--TSSKPEQEDPRRRQANTSLLLFG  4436
                + SK EQ  P R   NTSLLLFG
Sbjct  1373  SLKSVSKTEQLLPERHPVNTSLLLFG  1398



>ref|XP_007029692.1| RING/FYVE/PHD zinc finger superfamily protein, putative isoform 
4 [Theobroma cacao]
 gb|EOY10194.1| RING/FYVE/PHD zinc finger superfamily protein, putative isoform 
4 [Theobroma cacao]
Length=1432

 Score =   557 bits (1436),  Expect = 6e-168, Method: Compositional matrix adjust.
 Identities = 356/777 (46%), Positives = 466/777 (60%), Gaps = 89/777 (11%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNEHVNSG  1118
             CDICG  GRE LLAICS+C DGAEHTYCM++ML+K+PEGDWLCEECK  +E ++      
Sbjct  314   CDICGDAGREDLLAICSKCADGAEHTYCMREMLQKVPEGDWLCEECKLAEETES------  367

Query  1119  RVNEKEKTSPSRRTTIAKSDHPLKMEQKTSDCWGDKAVEERSYLKTSGKRCTDDSEVSSP  1298
                                      +++ SD  G +A +  S  ++ GKR  ++ E SS 
Sbjct  368   -------------------------QKQGSDAEGKRANKLSSGTQSLGKRHAENQEGSSA  402

Query  1299  TKRQRLE--LRSPTAQIPNRVTSLSRESSFKNLERGKVKPLNPFSSGSFA-------AKV  1451
              KRQ +E  + SP +  P+RV +LSRE SFKNL++GK++P    S G+ +       A+ 
Sbjct  403   PKRQAVETNMASPKSLSPSRVAALSREGSFKNLDKGKMRPSPQISLGNHSGSDMPETARS  462

Query  1452  PSSTGPQPQPPRGIFSKSNSFSSLIAKPKVKLVDEVFPAKQKLSRETAFIESKEVAVRSM  1631
             P+S GP+ Q P+G   KSNSF++L  KPKVKLVDEV   KQK +RE A ++SKE + R M
Sbjct  463   PTS-GPRLQTPKGTLLKSNSFNNLNIKPKVKLVDEVVLQKQKGAREHASLDSKEESARMM  521

Query  1632  GKSMSFKPTTASRSNCTESKVKMFSPKFSHDQDVKWLRHKKDRSSFDRKNSLRSDRLAGG  1811
             GKSMSFK T + R N  ESK KM S K+SH QD+K L+  K+R S +RKN  + DR +  
Sbjct  522   GKSMSFKSTNSGRLNTGESKFKMLSSKYSHVQDLKGLKQVKERISLERKNFSKLDR-SSS  580

Query  1812  AISSPKSDNKPTPRGEPSSLSSLNTNRDYRALTSDNKPVTISNSTSGVAREVLKQA--SV  1985
              +S+PK D K TPR +  S SS + NR+ + + SD KP T+S STS +AR+V++ A  S 
Sbjct  581   TVSTPKVDQKQTPRADTISNSSASNNRESKVVQSDGKPSTLSRSTSSLARKVVENAVTSA  640

Query  1986  DGVSSAN-RVSSSEENPSQAIPKEDSSSSSCVAERPSWSSNEVLPDGLSQSKESKAFGDK  2162
              GVSS N R+SS ++    +  +E SSSSS  AER   + N V+ DGLS+S +S    +K
Sbjct  641   VGVSSTNGRISSEQKLNLVSPKEEPSSSSSWTAERQPNNVNGVMSDGLSRSLDSTNQSEK  700

Query  2163  TRESSASRSKQNSTASGKIVSCQKCKGNGHLAQVCTADGPESSALGSPFKSSREATNGPS  2342
             +RESS  RS+         V C KCK  GH A+ C+     ++ + +P ++SRE  N  +
Sbjct  701   SRESSVGRSRS--------VPCLKCKEMGHTAEYCSVPQVSAADMSAP-RTSREEINKGN  751

Query  2343  DLKAAIEAARLRKPGICRKNRVADQSEDLSASNMKSEIASQDQMLSSTVRRN---VNGAE  2513
              LKAAIEAA   +PGIC                   E   QDQ   S   +N   V GA 
Sbjct  752   KLKAAIEAAIRMRPGIC-------------------ERPPQDQSPFSNKAKNMIAVEGAH  792

Query  2514  EAQKQETANNAKQLGIIAEASARTRNAGHVVFSDVKHSVIDMERQTLVSMPVILK-TAIP  2690
             EAQ      N   +G     ++ + +A  VV S    S+ D+    L ++  I K +AIP
Sbjct  793   EAQT--NVQNQASIGNQKLLNSHSTDAVSVVSSVGNLSMRDISVPLLATVSAITKMSAIP  850

Query  2691  EYQYIWQGGFEVQKSGKAFNLYDGIQAHLSSCASPKVLDAVNKFPRKVILNEVPRLSSWP  2870
             E++YIWQG FEV KSGK  +   GIQAHLS+ ASPKVL+ VN FP KV LNEVPRLS+WP
Sbjct  851   EHEYIWQGAFEVHKSGKLPDFCGGIQAHLSTLASPKVLEVVNTFPHKVSLNEVPRLSTWP  910

Query  2871  MQFKECGVSEDNVALFFFAKDIGSYEKSYKVLLGDMVKHDLALQGNIGDIELLIFPSNQL  3050
              QF + G  EDN+AL+FFAKD  SYEK+YKVLL  MVK+DLAL+GN   +ELLIFPSN L
Sbjct  911   AQFHDSGPKEDNIALYFFAKDPESYEKNYKVLLETMVKNDLALKGNFEGVELLIFPSNLL  970

Query  3051  PEKFQRWNLMFFLWGVFRGKRANSLQN-----FPGA-----EKPLIQDIPTPATSLP  3191
             PE  QRWN +FFLWGVF+G+R N   +      P A     E  +  DIP P  + P
Sbjct  971   PENCQRWNTLFFLWGVFKGRRVNCSNSSKSACIPDASMVRLEGEVSTDIPQPVENEP  1027


 Score =   100 bits (250),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 70/146 (48%), Positives = 85/146 (58%), Gaps = 3/146 (2%)
 Frame = +3

Query  4008  DEALSKTAILETPGNAEMFFFPVDPHPVGNIGSNNSSMPWK-VHPLEEDQLHDKAPNLEL  4184
             D A  +  I E  G++E FFFP+D H        ++S PWK     +EDQ HD  PNLEL
Sbjct  1282  DIACVEKVIPEDLGSSERFFFPMDSHHGREFRLVDNSKPWKEFSAKDEDQAHDVFPNLEL  1341

Query  4185  ALGAKTKPLMSGIPSFLSGKVEKKIIEENTSDNAATSANKEDVsaslslslsFPFPEKEH  4364
             ALGA+T+P   GI  F  G V+K   ++   D       ++DV ASLSLSLSFPFPEKE 
Sbjct  1342  ALGAETRPPNKGILPFFVGTVDKNSNQDRPLDKVRGKEEEDDVPASLSLSLSFPFPEKEQ  1401

Query  4365  G--TSSKPEQEDPRRRQANTSLLLFG  4436
                + SK EQ  P R   NTSLLLFG
Sbjct  1402  SLKSVSKTEQLLPERHPVNTSLLLFG  1427



>ref|XP_007029695.1| RING/FYVE/PHD zinc finger superfamily protein, putative isoform 
7 [Theobroma cacao]
 gb|EOY10197.1| RING/FYVE/PHD zinc finger superfamily protein, putative isoform 
7 [Theobroma cacao]
Length=1404

 Score =   556 bits (1432),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 356/777 (46%), Positives = 466/777 (60%), Gaps = 89/777 (11%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNEHVNSG  1118
             CDICG  GRE LLAICS+C DGAEHTYCM++ML+K+PEGDWLCEECK  +E ++      
Sbjct  286   CDICGDAGREDLLAICSKCADGAEHTYCMREMLQKVPEGDWLCEECKLAEETES------  339

Query  1119  RVNEKEKTSPSRRTTIAKSDHPLKMEQKTSDCWGDKAVEERSYLKTSGKRCTDDSEVSSP  1298
                                      +++ SD  G +A +  S  ++ GKR  ++ E SS 
Sbjct  340   -------------------------QKQGSDAEGKRANKLSSGTQSLGKRHAENQEGSSA  374

Query  1299  TKRQRLE--LRSPTAQIPNRVTSLSRESSFKNLERGKVKPLNPFSSGSFA-------AKV  1451
              KRQ +E  + SP +  P+RV +LSRE SFKNL++GK++P    S G+ +       A+ 
Sbjct  375   PKRQAVETNMASPKSLSPSRVAALSREGSFKNLDKGKMRPSPQISLGNHSGSDMPETARS  434

Query  1452  PSSTGPQPQPPRGIFSKSNSFSSLIAKPKVKLVDEVFPAKQKLSRETAFIESKEVAVRSM  1631
             P+S GP+ Q P+G   KSNSF++L  KPKVKLVDEV   KQK +RE A ++SKE + R M
Sbjct  435   PTS-GPRLQTPKGTLLKSNSFNNLNIKPKVKLVDEVVLQKQKGAREHASLDSKEESARMM  493

Query  1632  GKSMSFKPTTASRSNCTESKVKMFSPKFSHDQDVKWLRHKKDRSSFDRKNSLRSDRLAGG  1811
             GKSMSFK T + R N  ESK KM S K+SH QD+K L+  K+R S +RKN  + DR +  
Sbjct  494   GKSMSFKSTNSGRLNTGESKFKMLSSKYSHVQDLKGLKQVKERISLERKNFSKLDR-SSS  552

Query  1812  AISSPKSDNKPTPRGEPSSLSSLNTNRDYRALTSDNKPVTISNSTSGVAREVLKQA--SV  1985
              +S+PK D K TPR +  S SS + NR+ + + SD KP T+S STS +AR+V++ A  S 
Sbjct  553   TVSTPKVDQKQTPRADTISNSSASNNRESKVVQSDGKPSTLSRSTSSLARKVVENAVTSA  612

Query  1986  DGVSSAN-RVSSSEENPSQAIPKEDSSSSSCVAERPSWSSNEVLPDGLSQSKESKAFGDK  2162
              GVSS N R+SS ++    +  +E SSSSS  AER   + N V+ DGLS+S +S    +K
Sbjct  613   VGVSSTNGRISSEQKLNLVSPKEEPSSSSSWTAERQPNNVNGVMSDGLSRSLDSTNQSEK  672

Query  2163  TRESSASRSKQNSTASGKIVSCQKCKGNGHLAQVCTADGPESSALGSPFKSSREATNGPS  2342
             +RESS  RS+         V C KCK  GH A+ C+     ++ + +P ++SRE  N  +
Sbjct  673   SRESSVGRSRS--------VPCLKCKEMGHTAEYCSVPQVSAADMSAP-RTSREEINKGN  723

Query  2343  DLKAAIEAARLRKPGICRKNRVADQSEDLSASNMKSEIASQDQMLSSTVRRN---VNGAE  2513
              LKAAIEAA   +PGIC                   E   QDQ   S   +N   V GA 
Sbjct  724   KLKAAIEAAIRMRPGIC-------------------ERPPQDQSPFSNKAKNMIAVEGAH  764

Query  2514  EAQKQETANNAKQLGIIAEASARTRNAGHVVFSDVKHSVIDMERQTLVSMPVILK-TAIP  2690
             EAQ      N   +G     ++ + +A  VV S    S+ D+    L ++  I K +AIP
Sbjct  765   EAQT--NVQNQASIGNQKLLNSHSTDAVSVVSSVGNLSMRDISVPLLATVSAITKMSAIP  822

Query  2691  EYQYIWQGGFEVQKSGKAFNLYDGIQAHLSSCASPKVLDAVNKFPRKVILNEVPRLSSWP  2870
             E++YIWQG FEV KSGK  +   GIQAHLS+ ASPKVL+ VN FP KV LNEVPRLS+WP
Sbjct  823   EHEYIWQGAFEVHKSGKLPDFCGGIQAHLSTLASPKVLEVVNTFPHKVSLNEVPRLSTWP  882

Query  2871  MQFKECGVSEDNVALFFFAKDIGSYEKSYKVLLGDMVKHDLALQGNIGDIELLIFPSNQL  3050
              QF + G  EDN+AL+FFAKD  SYEK+YKVLL  MVK+DLAL+GN   +ELLIFPSN L
Sbjct  883   AQFHDSGPKEDNIALYFFAKDPESYEKNYKVLLETMVKNDLALKGNFEGVELLIFPSNLL  942

Query  3051  PEKFQRWNLMFFLWGVFRGKRANSLQN-----FPGA-----EKPLIQDIPTPATSLP  3191
             PE  QRWN +FFLWGVF+G+R N   +      P A     E  +  DIP P  + P
Sbjct  943   PENCQRWNTLFFLWGVFKGRRVNCSNSSKSACIPDASMVRLEGEVSTDIPQPVENEP  999


 Score =   100 bits (250),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 70/146 (48%), Positives = 85/146 (58%), Gaps = 3/146 (2%)
 Frame = +3

Query  4008  DEALSKTAILETPGNAEMFFFPVDPHPVGNIGSNNSSMPWK-VHPLEEDQLHDKAPNLEL  4184
             D A  +  I E  G++E FFFP+D H        ++S PWK     +EDQ HD  PNLEL
Sbjct  1254  DIACVEKVIPEDLGSSERFFFPMDSHHGREFRLVDNSKPWKEFSAKDEDQAHDVFPNLEL  1313

Query  4185  ALGAKTKPLMSGIPSFLSGKVEKKIIEENTSDNAATSANKEDVsaslslslsFPFPEKEH  4364
             ALGA+T+P   GI  F  G V+K   ++   D       ++DV ASLSLSLSFPFPEKE 
Sbjct  1314  ALGAETRPPNKGILPFFVGTVDKNSNQDRPLDKVRGKEEEDDVPASLSLSLSFPFPEKEQ  1373

Query  4365  G--TSSKPEQEDPRRRQANTSLLLFG  4436
                + SK EQ  P R   NTSLLLFG
Sbjct  1374  SLKSVSKTEQLLPERHPVNTSLLLFG  1399



>ref|XP_007029689.1| RING/FYVE/PHD zinc finger superfamily protein, putative isoform 
1 [Theobroma cacao]
 gb|EOY10191.1| RING/FYVE/PHD zinc finger superfamily protein, putative isoform 
1 [Theobroma cacao]
Length=1474

 Score =   557 bits (1435),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 356/777 (46%), Positives = 466/777 (60%), Gaps = 89/777 (11%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNEHVNSG  1118
             CDICG  GRE LLAICS+C DGAEHTYCM++ML+K+PEGDWLCEECK  +E ++      
Sbjct  356   CDICGDAGREDLLAICSKCADGAEHTYCMREMLQKVPEGDWLCEECKLAEETES------  409

Query  1119  RVNEKEKTSPSRRTTIAKSDHPLKMEQKTSDCWGDKAVEERSYLKTSGKRCTDDSEVSSP  1298
                                      +++ SD  G +A +  S  ++ GKR  ++ E SS 
Sbjct  410   -------------------------QKQGSDAEGKRANKLSSGTQSLGKRHAENQEGSSA  444

Query  1299  TKRQRLE--LRSPTAQIPNRVTSLSRESSFKNLERGKVKPLNPFSSGSFA-------AKV  1451
              KRQ +E  + SP +  P+RV +LSRE SFKNL++GK++P    S G+ +       A+ 
Sbjct  445   PKRQAVETNMASPKSLSPSRVAALSREGSFKNLDKGKMRPSPQISLGNHSGSDMPETARS  504

Query  1452  PSSTGPQPQPPRGIFSKSNSFSSLIAKPKVKLVDEVFPAKQKLSRETAFIESKEVAVRSM  1631
             P+S GP+ Q P+G   KSNSF++L  KPKVKLVDEV   KQK +RE A ++SKE + R M
Sbjct  505   PTS-GPRLQTPKGTLLKSNSFNNLNIKPKVKLVDEVVLQKQKGAREHASLDSKEESARMM  563

Query  1632  GKSMSFKPTTASRSNCTESKVKMFSPKFSHDQDVKWLRHKKDRSSFDRKNSLRSDRLAGG  1811
             GKSMSFK T + R N  ESK KM S K+SH QD+K L+  K+R S +RKN  + DR +  
Sbjct  564   GKSMSFKSTNSGRLNTGESKFKMLSSKYSHVQDLKGLKQVKERISLERKNFSKLDR-SSS  622

Query  1812  AISSPKSDNKPTPRGEPSSLSSLNTNRDYRALTSDNKPVTISNSTSGVAREVLKQA--SV  1985
              +S+PK D K TPR +  S SS + NR+ + + SD KP T+S STS +AR+V++ A  S 
Sbjct  623   TVSTPKVDQKQTPRADTISNSSASNNRESKVVQSDGKPSTLSRSTSSLARKVVENAVTSA  682

Query  1986  DGVSSAN-RVSSSEENPSQAIPKEDSSSSSCVAERPSWSSNEVLPDGLSQSKESKAFGDK  2162
              GVSS N R+SS ++    +  +E SSSSS  AER   + N V+ DGLS+S +S    +K
Sbjct  683   VGVSSTNGRISSEQKLNLVSPKEEPSSSSSWTAERQPNNVNGVMSDGLSRSLDSTNQSEK  742

Query  2163  TRESSASRSKQNSTASGKIVSCQKCKGNGHLAQVCTADGPESSALGSPFKSSREATNGPS  2342
             +RESS  RS+         V C KCK  GH A+ C+     ++ + +P ++SRE  N  +
Sbjct  743   SRESSVGRSRS--------VPCLKCKEMGHTAEYCSVPQVSAADMSAP-RTSREEINKGN  793

Query  2343  DLKAAIEAARLRKPGICRKNRVADQSEDLSASNMKSEIASQDQMLSSTVRRN---VNGAE  2513
              LKAAIEAA   +PGIC                   E   QDQ   S   +N   V GA 
Sbjct  794   KLKAAIEAAIRMRPGIC-------------------ERPPQDQSPFSNKAKNMIAVEGAH  834

Query  2514  EAQKQETANNAKQLGIIAEASARTRNAGHVVFSDVKHSVIDMERQTLVSMPVILK-TAIP  2690
             EAQ      N   +G     ++ + +A  VV S    S+ D+    L ++  I K +AIP
Sbjct  835   EAQT--NVQNQASIGNQKLLNSHSTDAVSVVSSVGNLSMRDISVPLLATVSAITKMSAIP  892

Query  2691  EYQYIWQGGFEVQKSGKAFNLYDGIQAHLSSCASPKVLDAVNKFPRKVILNEVPRLSSWP  2870
             E++YIWQG FEV KSGK  +   GIQAHLS+ ASPKVL+ VN FP KV LNEVPRLS+WP
Sbjct  893   EHEYIWQGAFEVHKSGKLPDFCGGIQAHLSTLASPKVLEVVNTFPHKVSLNEVPRLSTWP  952

Query  2871  MQFKECGVSEDNVALFFFAKDIGSYEKSYKVLLGDMVKHDLALQGNIGDIELLIFPSNQL  3050
              QF + G  EDN+AL+FFAKD  SYEK+YKVLL  MVK+DLAL+GN   +ELLIFPSN L
Sbjct  953   AQFHDSGPKEDNIALYFFAKDPESYEKNYKVLLETMVKNDLALKGNFEGVELLIFPSNLL  1012

Query  3051  PEKFQRWNLMFFLWGVFRGKRANSLQN-----FPGA-----EKPLIQDIPTPATSLP  3191
             PE  QRWN +FFLWGVF+G+R N   +      P A     E  +  DIP P  + P
Sbjct  1013  PENCQRWNTLFFLWGVFKGRRVNCSNSSKSACIPDASMVRLEGEVSTDIPQPVENEP  1069


 Score =   100 bits (250),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 70/146 (48%), Positives = 85/146 (58%), Gaps = 3/146 (2%)
 Frame = +3

Query  4008  DEALSKTAILETPGNAEMFFFPVDPHPVGNIGSNNSSMPWK-VHPLEEDQLHDKAPNLEL  4184
             D A  +  I E  G++E FFFP+D H        ++S PWK     +EDQ HD  PNLEL
Sbjct  1324  DIACVEKVIPEDLGSSERFFFPMDSHHGREFRLVDNSKPWKEFSAKDEDQAHDVFPNLEL  1383

Query  4185  ALGAKTKPLMSGIPSFLSGKVEKKIIEENTSDNAATSANKEDVsaslslslsFPFPEKEH  4364
             ALGA+T+P   GI  F  G V+K   ++   D       ++DV ASLSLSLSFPFPEKE 
Sbjct  1384  ALGAETRPPNKGILPFFVGTVDKNSNQDRPLDKVRGKEEEDDVPASLSLSLSFPFPEKEQ  1443

Query  4365  G--TSSKPEQEDPRRRQANTSLLLFG  4436
                + SK EQ  P R   NTSLLLFG
Sbjct  1444  SLKSVSKTEQLLPERHPVNTSLLLFG  1469



>ref|XP_007220350.1| hypothetical protein PRUPE_ppa000413m1g, partial [Prunus persica]
 gb|EMJ21549.1| hypothetical protein PRUPE_ppa000413m1g, partial [Prunus persica]
Length=1002

 Score =   540 bits (1390),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 345/789 (44%), Positives = 460/789 (58%), Gaps = 83/789 (11%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNEHVNSG  1118
             CDICG  GRE +LA+CSRC+DGAEH YCM+KML ++P+G WLCEECKF +E  N+     
Sbjct  187   CDICGDAGREDMLAMCSRCSDGAEHIYCMRKMLRRVPKGQWLCEECKFAEEADNQ-----  241

Query  1119  RVNEKEKTSPSRRTTIAKSDHPLKMEQKTSDCWGDKAVEERSYLKTSGKRCTDDSEVSSP  1298
                              K D    ME K      DKA+    +   S KR  ++ EV+  
Sbjct  242   -----------------KQD----MEGKKM----DKAILSTQF---SNKRLAENIEVAPA  273

Query  1299  TKRQRLELR--SPTAQIPNRVTSLSRESSFKNLERGKVKPLNPFSSG----SFAAKVPSS  1460
              KRQ LE+R  SP    P R+ +LSRESSFK++++ +++     S      S  A+ PSS
Sbjct  274   AKRQALEIRVGSPRPSSPKRMGALSRESSFKSIDKERLRSTYQSSQSINDISETARSPSS  333

Query  1461  TGPQPQPPRGIFSKSNSFSSLIAKPKVKLVDEVFPAKQKLSRETAFIESKEVAVRSMGKS  1640
              G + Q  +G   KSNSF++L +KP+VK VD+V P KQK S+E + ++ KE   R MGKS
Sbjct  334   -GIRLQTTKGTLLKSNSFNTLTSKPRVKTVDDV-PQKQKGSKEHSSLDMKERVARMMGKS  391

Query  1641  MSFKPTTASRSNCTESKVKMFSPKFSHDQDVKWLRHKKDRSSFDRKNSLRSDR-LAGGAI  1817
             +SFK   + RSN +ESKVKM S KFSH QD+K L+  K+RS+ +RKN  + DR LA    
Sbjct  392   VSFKSANSGRSNVSESKVKMLSSKFSHVQDLKGLKQAKERSTIERKNLSKLDRPLA----  447

Query  1818  SSPKSDNKPTPRGEPSSLSSLNTNRDYRALTSDNKPVTISNSTSGVAREVLKQASVDGVS  1997
             S P +    T RGE S LSS++ NR+ + +  D K  T++ S   + R     A   G S
Sbjct  448   SFPAA----TSRGETSLLSSVSNNRESKVVLPDGKLSTVTKSIGNLTRMTNVFAVAVGGS  503

Query  1998  SANRV--SSSEENPSQAIPKEDS-SSSSCVAERPSWSSNEVLPDGLSQSKESKAFGDKTR  2168
             S N +  S+SE+  +Q   K++  SS S + E+P  + +E L D   QS E  +  DKTR
Sbjct  504   STNGICNSASEQKSNQVSSKDEPLSSYSGIVEKPCSNVDETLEDAFPQSVEMTSQADKTR  563

Query  2169  ESSASRSKQNSTASGKIVSCQKCKGNGHLAQVCTADGPESSAL--GSPFKSSREATNGPS  2342
             ESSA R +    AS       KCK  GH A+ C     ++S     +P  SSRE     +
Sbjct  564   ESSA-RCRPTVAAS------PKCKDIGHTAEFCRVGISQTSGTDASTPI-SSREDMPRGN  615

Query  2343  DLKAAIEAARLRKPGICRKNRVADQSEDLSASN--MKSEIASQDQMLSSTVRRNVNGAE-  2513
              LK AI AA LRKP I RK RV D S++LS SN  +  E+ASQ+Q L S    N+  +E 
Sbjct  616   RLKDAIHAALLRKPEIYRKKRVFDPSDELSTSNVDLSYEVASQEQSLISNKLNNITCSEG  675

Query  2514  -------------EAQKQETANNAKQLGIIAEAS---ARTRNAGHVVFSDVKHSVIDMER  2645
                          ++ K  T NN KQ  +    S   ++  ++  VV S  K +V D+  
Sbjct  676   SHDGQTVLGTSTSDSYKNTTVNNLKQHTVQPIDSVFPSKVTDSVSVVPSLGKSTVKDLHS  735

Query  2646  QTLVSMPVILK-TAIPEYQYIWQGGFEVQKSGKAFNLYDGIQAHLSSCASPKVLDAVNKF  2822
                V+M V+ K TAIPEY+YIWQG FEVQ+ G   +L  G+QAHLS+CASP+VL+ VNKF
Sbjct  736   HASVAMYVLAKTTAIPEYEYIWQGSFEVQRGGNYLDLCGGVQAHLSTCASPRVLEVVNKF  795

Query  2823  PRKVILNEVPRLSSWPMQFKECGVSEDNVALFFFAKDIGSYEKSYKVLLGDMVKHDLALQ  3002
               KV L+EVPRLS WP  F + G  EDN+AL+FFAKD+ SYE+ YK+LL  M+K+DLAL+
Sbjct  796   QFKVPLSEVPRLSVWPSHFHQSGAKEDNIALYFFAKDLESYERDYKILLDAMIKNDLALK  855

Query  3003  GNIGDIELLIFPSNQLPEKFQRWNLMFFLWGVFRGKRANSLQNFPGAEKPLIQDIPTPAT  3182
             GN   +ELLIFPSNQLPE+ QRWN++FFLWGVFR  R + L        P + +      
Sbjct  856   GNFDGVELLIFPSNQLPERSQRWNMLFFLWGVFRTTRVHRLDFTKETCVPSLSNSLDKYG  915

Query  3183  SLPENMFTP  3209
             +L EN+  P
Sbjct  916   TLSENLCIP  924



>ref|XP_010275231.1| PREDICTED: uncharacterized protein LOC104610357 isoform X6 [Nelumbo 
nucifera]
Length=1782

 Score =   555 bits (1429),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 381/922 (41%), Positives = 528/922 (57%), Gaps = 106/922 (11%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNEHVNSG  1118
             CDICG  GRE LLA CSRC+DGAEHTYCMQ ML+K+PEGDWLCEECK  +E +N+  +  
Sbjct  481   CDICGDAGREELLAFCSRCSDGAEHTYCMQVMLDKVPEGDWLCEECKIKEETENQKQDKV  540

Query  1119  RV----------NEKEKTSPSRRTTIAKSDHPLKMEQKTSDCWGDKAVEERSYLKTSGKR  1268
              +          NEK + +P    T++ S   LK++ K +D  G++  +  S    S KR
Sbjct  541   EIVLGSSKAPYLNEKTQ-NPGGIDTVS-SKVSLKLDVKETDTEGNRITKVSSSSFGSVKR  598

Query  1269  CTDDSEVSSPTKRQRLE--LRSPTAQIPNRV-TSLSRESSFKNLERGKVKPLNPF-----  1424
              +D+ E +SP KRQ LE  + SP    P++    LSRESSFK+L++GKVK  +       
Sbjct  599   HSDNLEAASPAKRQMLETSVASPKTSSPDKKPVLLSRESSFKSLDKGKVKTPHQLGLPSS  658

Query  1425  -SSGSFAAKVPS-STGP-------QPQPPRGIFSKSNSFSSLIAKPKVKLVDEVFPAKQK  1577
              S+ S    V S +TGP       Q Q PRG   KSNSF++L +KPKVKLV E    K+K
Sbjct  659   HSANSSHENVHSPTTGPSSSKNQSQLQSPRGNLLKSNSFNTLNSKPKVKLVQEDVSQKKK  718

Query  1578  LSRETAFIESK-EVAVRSMGKSMSFKPTTASRSNCTESKVKMFSPKFSHDQDVKWLRHKK  1754
             ++R+T   ++K E  VR +GKS+SFK  ++ R N TESKVKM S   S  +++K L+  K
Sbjct  719   VARDTVINDAKKEGPVRMIGKSISFKTPSSGRFNVTESKVKMLSHNLSCVEELKGLKQAK  778

Query  1755  DRSSFDRKNSLRSDR------LAGGAISSPKSDNKPTPRGEP-SSLSSLNTNRDYRALTS  1913
             +    +RKNS +SDR       A  ++S+PK+D K T RGE  SSL+S    RD +++ +
Sbjct  779   EWGLIERKNSFKSDRPLISSPTAVSSVSTPKTDQKVTSRGETTSSLTSATNCRDMKSVQA  838

Query  1914  DNK------PVTISNSTS------GVAREVLKQASVDGVSSANRVSSSEENPSQAIPKED  2057
             D K      P +++N  S        + EV +Q+ V   SS  R SS+E+ P Q   ++ 
Sbjct  839   DGKLNTSAKPTSLANKGSENRNVLAGSSEVKRQSVVGTPSSNGRCSSTEQKPIQVSTQDG  898

Query  2058  SSSSSCVAERPSWSSNEVLP-DGLSQSKESKAFGDKTRE-SSASRSKQNSTASGKIVSCQ  2231
             ++SSS  A++ SWS ++ +P DGL QS ES     K RE     R KQ  +  G+ + C 
Sbjct  899   TTSSSWTADK-SWSKHDAVPHDGLPQSPESLNQDAKARELFPTGRPKQGVSVGGQSIRCH  957

Query  2232  KCKGNGHLAQVCTADGPESSALGSPFKSSREATNGPSDLKAAIEAARLRKPGICRKNRVA  2411
             KCK  GH AQ C      S    S  KSS+E T     LK A++A  L+ PG+ RKNR+ 
Sbjct  958   KCKELGHTAQSCPVTKV-SVFEASAEKSSKEVTGKSFKLKEAVKAIMLKPPGMSRKNRLP  1016

Query  2412  DQSEDLSAS--NMKSEIASQDQM-LSSTVRRNVNGAE---------------EAQKQETA  2537
             +  ++LS S  ++  E+ S+DQ+  +S   RN+N  E               +  K  T 
Sbjct  1017  EWLDELSMSSADLSCEV-SKDQLPTTSNCSRNLNSGEVTNDDGQEIVRSSAADISKTTTV  1075

Query  2538  NNAKQ-LGIIAEASARTRNAGHVVFSDVK-------HSVIDMER-QTLVSMPVILKTAIP  2690
             NN KQ +    EA+   R A  V  S +         S+ D+ R ++ V++P  + +AIP
Sbjct  1076  NNLKQDILKSTEATCSPRGASDVTISPISLDENKPSSSITDLPRVESSVAIPSRI-SAIP  1134

Query  2691  EYQYIWQGGFEVQKSGKAFNLYDGIQAHLSSCASPKVLDAVNKFPRKVILNEVPRLSSWP  2870
             E+ YIWQGGFEVQ+SG   +L DGIQA+LS+CASPK+ + V K PRKV+L EVPRLS+WP
Sbjct  1135  EHDYIWQGGFEVQRSGILADLCDGIQAYLSTCASPKIPEVVKKLPRKVLLEEVPRLSTWP  1194

Query  2871  MQFKECGVSEDNVALFFFAKDIGSYEKSYKVLLGDMVKHDLALQGNIGDIELLIFPSNQL  3050
              QF E   +EDNVAL+FFAKD+ SYE+ YK LL  M+K+DLAL+GN   IELLIFPSNQL
Sbjct  1195  RQFDENRATEDNVALYFFAKDLESYERYYKGLLDKMIKNDLALKGNFNGIELLIFPSNQL  1254

Query  3051  PEKFQRWNLMFFLWGVFRGKRANSLQNFPGAEKPL----------IQDIPTPATSLPENM  3200
             PEK QRWN++FFLWGVFRG+R+N  +   GA+K +           Q      TS+ + +
Sbjct  1255  PEKSQRWNMLFFLWGVFRGRRSNCSEQILGAQKKVSRSNPDVTIAYQGFAAGVTSVSQKV  1314

Query  3201  F--------TPVPKLNSARGSAATNTEMSAVKESE-----SASLHKIVNGNCSIQSSSQV  3341
             +         P+P +  A   +++  E+S    S      S+S     NGNC    SS  
Sbjct  1315  YLPGHKEDPNPLPSVMPAFTGSSSGMEVSKSMASMELPFISSSGKLNGNGNCDSNMSSID  1374

Query  3342  SRDKCSRINAEQN-DKLDSSSM  3404
              ++  S+ N  Q+ + LDS  +
Sbjct  1375  YKNLSSQTNFNQHGNGLDSDPL  1396


 Score = 70.1 bits (170),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 56/130 (43%), Positives = 71/130 (55%), Gaps = 4/130 (3%)
 Frame = +3

Query  4056  EMFFFPVDPHPVGNIGSNNSSMPWKV-HPLEEDQLHDKAPNLELALGAKTKPLMSGIPSF  4232
             E  FFP+D  P  +  S  +  P +V     ED +  + PNLELALGA+ +P    I  +
Sbjct  1649  ERHFFPIDLGPAKDCKSRGTLEPLQVLSSTNEDIMGSEVPNLELALGAEKRPRKQAIFPW  1708

Query  4233  LSGKVEKKIIEENTSDNAATSANKEDVsaslslslsFPFPEKEHGTS--SKPEQEDPRRR  4406
             L G  +K+   +   D   T+ N +DVSASLSLSL+FPF  KE      SK EQ  P  R
Sbjct  1709  LVGIADKRNNRDKFPD-PVTNNNDDDVSASLSLSLAFPFSNKEQTVKPVSKTEQLLPDAR  1767

Query  4407  QANTSLLLFG  4436
               NTSL LFG
Sbjct  1768  HVNTSLFLFG  1777



>ref|XP_006590425.1| PREDICTED: uncharacterized protein LOC100806639 isoform X1 [Glycine 
max]
 ref|XP_006590426.1| PREDICTED: uncharacterized protein LOC100806639 isoform X2 [Glycine 
max]
 ref|XP_006590427.1| PREDICTED: uncharacterized protein LOC100806639 isoform X3 [Glycine 
max]
 ref|XP_006590428.1| PREDICTED: uncharacterized protein LOC100806639 isoform X4 [Glycine 
max]
 ref|XP_006590429.1| PREDICTED: uncharacterized protein LOC100806639 isoform X5 [Glycine 
max]
 ref|XP_006590430.1| PREDICTED: uncharacterized protein LOC100806639 isoform X6 [Glycine 
max]
 ref|XP_006590431.1| PREDICTED: uncharacterized protein LOC100806639 isoform X7 [Glycine 
max]
Length=1476

 Score =   528 bits (1360),  Expect = 8e-157, Method: Compositional matrix adjust.
 Identities = 351/864 (41%), Positives = 485/864 (56%), Gaps = 115/864 (13%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNEHVNSG  1118
             CDICG  GRE LLAICSRC+DGAEHTYCM++MLEK+PEGDWLCEECK  +E         
Sbjct  252   CDICGDAGREDLLAICSRCSDGAEHTYCMREMLEKVPEGDWLCEECKDAEE---------  302

Query  1119  RVNEKEKTSPSRRTTIAKSDHPLKMEQKTSDCWGDKAVEERSYLKTSGKRCTDDSEVSSP  1298
               NEK++               L ++ K       K VE  S  + SGKR +D+ EV+  
Sbjct  303   --NEKKR---------------LDVDDK-------KMVEVSSTSQVSGKRLSDNIEVAPA  338

Query  1299  TKRQRLE--LRSPTAQIPNRVTSLSRESSFKNLERGKVKP--LNPF--SSGSFAAKVPS-  1457
              KRQ LE    SP    P R+  +SRESSFK+L++ KVKP  L P    SG +  ++   
Sbjct  339   AKRQALESSTGSPKTSSPKRLVPVSRESSFKSLDKSKVKPGLLMPIRNHSGCYDTEIARS  398

Query  1458  -STGPQPQPPRGIFSKSNSFSSLIAKPKVKLVDEVFPAKQKLSRETAFIESKEVAVRSMG  1634
              S G + Q P+G+  KSNSF++L +KP+VKLVDEV P KQK   E    ++ E+  R  G
Sbjct  399   PSIGSRGQNPKGMLLKSNSFNNLNSKPRVKLVDEVVPQKQKGGNEHTS-KNMEMPARVTG  457

Query  1635  KSMSFKPTTASRSNCTESKVKMFSPKFSHDQDVKWLRHKKDRSSFDRKNSLRSDR-LAGG  1811
             KS  FK ++  RSN TESKVKM SPK +  QD+K  RH K+  +FDRK   R DR +A  
Sbjct  458   KSTLFKSSSLGRSNATESKVKMLSPKSATTQDLKGSRHLKESGAFDRKFPSRIDRPVASS  517

Query  1812  AISSPKSDNKPTPRGEPSSLSSLNTNRDYRALTSDNKPVTISNSTSGVAREVLKQASVDG  1991
              +SSPK D K TP  E +  S++N NR+ + +  D K   +S S S ++R+ L+      
Sbjct  518   VVSSPKGDQKLTPHAESNKASAMNNNRELK-VNQDGKSSALSRSMSNISRKSLEP-----  571

Query  1992  VSSANRVSSSEENPSQAIPKEDSSSSSCVAERPSWSSNEVLPDGLSQSKESKAFGDKTRE  2171
                  +VSS                     ER S   +E   D L +S+E+    +K+R 
Sbjct  572   -----QVSS---------------------ERTSTRVDETQQDVLPRSRETANQVEKSRN  605

Query  2172  SSASRSKQNSTASGKIVSCQKCKGNGHLAQVCTA-----DGPESSALGSPFKSSREATNG  2336
             SS+ R +  +  + K   CQKCK  GH  + CTA      G E S   S   SS+E  + 
Sbjct  606   SSSDRGRP-AVPTSKNQFCQKCKEFGHALECCTAVSTQESGAEISVTAS--SSSKEEMHK  662

Query  2337  PSDLKAAIEAARLRKPGICRKNRVADQSEDLS--ASNMKSEIASQDQMLSSTVRRNVNGA  2510
              + LKAAI+AA LR+P I +K  V++Q++++S   + +  E+ S+DQ+L S+  +N   A
Sbjct  663   DNTLKAAIQAALLRRPEIYKKKEVSNQTDEVSTAGTELNCEVTSRDQVLVSSTLKNSISA  722

Query  2511  EEAQKQET-------------ANNAKQLGII-AEASARTRNAGHVVFSDVKHSVIDMERQ  2648
             +E Q++E              AN  KQL     +  ++   +  +  +  K  V D+  +
Sbjct  723   DETQEREILENSTSDSSKCSSANGLKQLNSCPTDFRSQPGKSDSIGLATGKPVVRDLSNK  782

Query  2649  TLVSMPVILKT-AIPEYQYIWQGGFEVQKSGKAFNLYDGIQAHLSSCASPKVLDAVNKFP  2825
              L    V LK  A PEY+Y WQG FEV ++GK  ++Y G+QAHLSSCASPKVL  VNKF 
Sbjct  783   ALTMSSVPLKMLAFPEYEYTWQGVFEVHRNGKPPDIYTGLQAHLSSCASPKVLGVVNKFL  842

Query  2826  RKVILNEVPRLSSWPMQFKECGVSEDNVALFFFAKDIGSYEKSYKVLLGDMVKHDLALQG  3005
              KV L+E+ RLS WP QF   GVS+DN+AL+FFA+D+ SYE+ YK LL  M+++DLAL+G
Sbjct  843   PKVSLSEISRLSMWPSQFHHGGVSDDNIALYFFARDVESYERHYKGLLDHMIRNDLALKG  902

Query  3006  NIGDIELLIFPSNQLPEKFQRWNLMFFLWGVFRGKRANSLQNFPGAEKPLIQDIP-----  3170
             +   +ELLIFPSNQLPE  QRWN++FFLWGVFRG+R N   +      P +  +P     
Sbjct  903   DFDGVELLIFPSNQLPENSQRWNMLFFLWGVFRGRRINHSDSAKKISIPSLNVMPVEEKS  962

Query  3171  -TPATSLPENMFTPVPKLNSARGSAATNTEMSAVKESESASLHKI-----VNGNCSIQSS  3332
              T   ++PE   +P  K      S+  +   +A+  S S   H+      V+ N      
Sbjct  963   STAVLTMPETHCSPQCK---DEESSDCDKACNALLPSTSIDQHQTTGSRNVDVNDQTHLG  1019

Query  3333  SQVSRDKC-SRINAEQNDKLDSSS  3401
             SQVS +K  SRI+++   ++ +SS
Sbjct  1020  SQVSLEKLDSRIDSKSTSRVPTSS  1043


 Score = 64.3 bits (155),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 58/147 (39%), Positives = 73/147 (50%), Gaps = 9/147 (6%)
 Frame = +3

Query  4008  DEALSKTAILETPGNAEMFFFPVDPHPVGNIGSNNSSMPWKVHPLEEDQLHDKAPNLELA  4187
             +EA  +  I E  G  E  FFPV    + N  S   SM  K     ++   D  PNLELA
Sbjct  1335  EEACDEKIIQEDLGTLERTFFPVGTLNITNSLSVMDSMSTKGVGEYDEGFQDGIPNLELA  1394

Query  4188  LGAKTKP---LMSGIPSFLSGKVEKKIIEENTSDNAATSANKEDVsaslslslsFPFPEK  4358
             LG KTKP      G+  FL G V++   + N  DN       E V+ASLSLSLSFP P K
Sbjct  1395  LGGKTKPPPAAPKGMLPFLVGAVDR---QNNHPDNLGDRQEDEGVAASLSLSLSFPSPNK  1451

Query  4359  EHGTSSKPEQEDPRRRQANTSLLLFGR  4439
             EH  +++     P  ++ N    LFGR
Sbjct  1452  EHTNAAELL---PDGQRVNNPFFLFGR  1475



>gb|KHN35157.1| Bromodomain adjacent to zinc finger domain protein 1A [Glycine 
soja]
Length=1476

 Score =   528 bits (1359),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 352/864 (41%), Positives = 485/864 (56%), Gaps = 115/864 (13%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNEHVNSG  1118
             CDICG  GRE LLAICSRC+DGAEHTYCM++MLEK+PEGDWLCEECK  +E         
Sbjct  252   CDICGDAGREDLLAICSRCSDGAEHTYCMREMLEKVPEGDWLCEECKDAEE---------  302

Query  1119  RVNEKEKTSPSRRTTIAKSDHPLKMEQKTSDCWGDKAVEERSYLKTSGKRCTDDSEVSSP  1298
               NEK++               L ++ K       K VE  S  + SGKR +D+ EV+  
Sbjct  303   --NEKKR---------------LDVDDK-------KMVEVSSTSQVSGKRLSDNIEVAPA  338

Query  1299  TKRQRLE--LRSPTAQIPNRVTSLSRESSFKNLERGKVKP--LNPF--SSGSFAAKVPS-  1457
              KRQ LE    SP    P R+  +SRESSFK+L++ KVKP  L P    SG +  ++   
Sbjct  339   AKRQALESSTGSPKTSSPKRLAPVSRESSFKSLDKSKVKPGLLMPIRNHSGCYDTEIARS  398

Query  1458  -STGPQPQPPRGIFSKSNSFSSLIAKPKVKLVDEVFPAKQKLSRETAFIESKEVAVRSMG  1634
              S G + Q P+G+  KSNSF++L +KP+VKLVDEV P KQK   E    ++ E+  R  G
Sbjct  399   PSIGSRGQNPKGMLLKSNSFNNLNSKPRVKLVDEVVPQKQKGGNEHTS-KNMEMPARVTG  457

Query  1635  KSMSFKPTTASRSNCTESKVKMFSPKFSHDQDVKWLRHKKDRSSFDRKNSLRSDR-LAGG  1811
             KS  FK ++  RSN TESKVKM SPK +  QD+K  RH K+  +FDRK   R DR +A  
Sbjct  458   KSTLFKSSSLGRSNATESKVKMLSPKSATTQDLKGSRHLKESGAFDRKFPSRIDRPVASS  517

Query  1812  AISSPKSDNKPTPRGEPSSLSSLNTNRDYRALTSDNKPVTISNSTSGVAREVLKQASVDG  1991
              +SSPK D K TP  E +  S++N NR+ + +  D K   +S S S ++R+ L+      
Sbjct  518   VVSSPKGDQKLTPHAESNKASAMNNNRELK-VNQDGKSSALSRSMSNISRKSLEP-----  571

Query  1992  VSSANRVSSSEENPSQAIPKEDSSSSSCVAERPSWSSNEVLPDGLSQSKESKAFGDKTRE  2171
                  +VSS                     ER S   +E   D L +S+E+    +K+R 
Sbjct  572   -----QVSS---------------------ERTSTRVDETQQDVLPRSRETANQVEKSRN  605

Query  2172  SSASRSKQNSTASGKIVSCQKCKGNGHLAQVCTA-----DGPESSALGSPFKSSREATNG  2336
             SS+ R +  +  + K   CQKCK  GH  + CTA      G E S   S   SS+E  + 
Sbjct  606   SSSDRGRP-AVPTSKNQFCQKCKEFGHALECCTAVSTQESGAEISVTAS--SSSKEEMHK  662

Query  2337  PSDLKAAIEAARLRKPGICRKNRVADQSEDLS--ASNMKSEIASQDQMLSSTVRRNVNGA  2510
              + LKAAI+AA LR+P I +K  V++Q++++S   + +  E+ S+DQ+L S+  +N   A
Sbjct  663   DNTLKAAIQAALLRRPEIYKKKEVSNQTDEVSTAGTELNCEVTSRDQVLVSSTLKNSISA  722

Query  2511  EEAQKQET-------------ANNAKQLGII-AEASARTRNAGHVVFSDVKHSVIDMERQ  2648
             +E Q++E              AN  KQL     +  ++   +  +  +  K  V D+  +
Sbjct  723   DETQEREILENSTSDSSKCSSANGLKQLNSCPTDFRSQPGKSDSIGLATGKPVVRDLSNK  782

Query  2649  TLVSMPVILKT-AIPEYQYIWQGGFEVQKSGKAFNLYDGIQAHLSSCASPKVLDAVNKFP  2825
              L    V LK  A PEY+Y WQG FEV ++GK  ++Y G+QAHLSSCASPKVL  VNKF 
Sbjct  783   ALTMSSVPLKMLAFPEYEYTWQGVFEVHRNGKPPDIYTGLQAHLSSCASPKVLGVVNKFL  842

Query  2826  RKVILNEVPRLSSWPMQFKECGVSEDNVALFFFAKDIGSYEKSYKVLLGDMVKHDLALQG  3005
              KV L+EV RLS WP QF   GVS+DN+AL+FFA+D+ SYE+ YK LL  M+++DLAL+G
Sbjct  843   PKVSLSEVSRLSMWPSQFLHGGVSDDNIALYFFARDVESYERHYKGLLDHMIRNDLALKG  902

Query  3006  NIGDIELLIFPSNQLPEKFQRWNLMFFLWGVFRGKRANSLQNFPGAEKPLIQDIP-----  3170
             +   +ELLIFPSNQLPE  QRWN++FFLWGVFRG+R N   +      P +  +P     
Sbjct  903   DFDGVELLIFPSNQLPENSQRWNMLFFLWGVFRGRRINHSDSAKKISIPSLNVMPVEEKS  962

Query  3171  -TPATSLPENMFTPVPKLNSARGSAATNTEMSAVKESESASLHKI-----VNGNCSIQSS  3332
              T   ++PE   +P  K      S+  +   +A+  S S   H+      V+ N      
Sbjct  963   STAVLTMPETHCSPQCK---DEESSDCDKACNALLPSTSIDQHQTTGSRNVDVNDQTHLG  1019

Query  3333  SQVSRDKC-SRINAEQNDKLDSSS  3401
             SQVS +K  SRI+++   ++ +SS
Sbjct  1020  SQVSLEKLDSRIDSKSTSRVPTSS  1043


 Score = 66.6 bits (161),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 59/147 (40%), Positives = 74/147 (50%), Gaps = 9/147 (6%)
 Frame = +3

Query  4008  DEALSKTAILETPGNAEMFFFPVDPHPVGNIGSNNSSMPWKVHPLEEDQLHDKAPNLELA  4187
             +EA  +  I E  G  E  FFPV    + N  S   SM  K     ++   D  PNLELA
Sbjct  1335  EEACDEKIIQEDLGTLERTFFPVGTLNITNSLSVMDSMSTKGVGEYDEGFQDGIPNLELA  1394

Query  4188  LGAKTKP---LMSGIPSFLSGKVEKKIIEENTSDNAATSANKEDVsaslslslsFPFPEK  4358
             LG KTKP      G+  FL G V++   + N SDN       E V+ASLSLSLSFP P K
Sbjct  1395  LGGKTKPPPAAPKGMLPFLVGAVDR---QNNRSDNLGDRQEDEGVAASLSLSLSFPSPNK  1451

Query  4359  EHGTSSKPEQEDPRRRQANTSLLLFGR  4439
             EH  +++     P  ++ N    LFGR
Sbjct  1452  EHTNAAELL---PDGQRVNNPFFLFGR  1475



>ref|XP_006572873.1| PREDICTED: uncharacterized protein LOC100797363 isoform X1 [Glycine 
max]
 ref|XP_006572874.1| PREDICTED: uncharacterized protein LOC100797363 isoform X2 [Glycine 
max]
Length=1479

 Score =   526 bits (1354),  Expect = 5e-156, Method: Compositional matrix adjust.
 Identities = 327/765 (43%), Positives = 443/765 (58%), Gaps = 113/765 (15%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNEHVNSG  1118
             CDICG  GRE LLAICSRC+DGAEHTYCM++MLEK+PEGDWLCEECK  +E +N+ ++  
Sbjct  254   CDICGDAGREDLLAICSRCSDGAEHTYCMREMLEKVPEGDWLCEECKDAEENENKRLD--  311

Query  1119  RVNEKEKTSPSRRTTIAKSDHPLKMEQKTSDCWGDKAVEERSYLKTSGKRCTDDSEVSSP  1298
              V++K                              K VE  S  + SGKR +D+ EV+  
Sbjct  312   -VDDK------------------------------KMVEVSSTSQVSGKRLSDNIEVAPA  340

Query  1299  TKRQRLE--LRSPTAQIPNRVTSLSRESSFKNLERGKVKP--LNPF--SSGSFAAKVPS-  1457
              KRQ LE  + SP    P R+  LSRESSFK+L++ KVKP  L P    SG    ++   
Sbjct  341   AKRQALESSIGSPKTSSPKRLVPLSRESSFKSLDKSKVKPGLLMPIRNHSGGIDTEIARS  400

Query  1458  -STGPQPQPPRGIFSKSNSFSSLIAKPKVKLVDEVFPAKQKLSRETAFIESKEVAVRSMG  1634
              S GP+ Q P+G+  KSNSF++L +KP+VKLVDEV P  +K   E    ++ E+  R  G
Sbjct  401   PSIGPRGQNPKGMLLKSNSFNNLNSKPRVKLVDEVVPPPKKGGNEHTS-KNMEMPARVTG  459

Query  1635  KSMSFKPTTASRSNCTESKVKMFSPKFSHDQDVKWLRHKKDRSSFDRKNSLRSDR-LAGG  1811
             KS  FK ++  RSN TESKVKM SPK +  QD+K  RH K+  +FDRK   R DR +A  
Sbjct  460   KSTLFKSSSLGRSNATESKVKMLSPKSATTQDLKGSRHLKESGAFDRKFPSRIDRPVASL  519

Query  1812  AISSPKSDNKPTPRGEPSSLSSLNTNRDYRALTSDNKPVTISNSTSGVAREVLKQASVDG  1991
              +S+PK D K TP  E S  S++N NR+ + +  D K   +  S S ++R+ L+      
Sbjct  520   VVSTPKGDQKLTPHAESSKASAMNNNRELK-VNQDGKSCALPRSMSNISRKSLEP-----  573

Query  1992  VSSANRVSSSEENPSQAIPKEDSSSSSCVAERPSWSSNEVLPDGLSQSKESKAFGDKTRE  2171
                  +VSS                     ER S   +E   D LSQS+E+    +++R+
Sbjct  574   -----QVSS---------------------ERTSTRVDETQQDVLSQSRETANQVERSRD  607

Query  2172  SSASRSKQNSTASGKIVSCQKCKGNGHLAQVCTA-----DGPESSALGSPFKSSREATNG  2336
             SS+ R +  +  + K   CQKCK  GH  + CTA      G E S   S   SS+E  + 
Sbjct  608   SSSDRGRP-AVPTSKNPLCQKCKEFGHALECCTAGSTQESGAEISVTAS--SSSKEEMHK  664

Query  2337  PSDLKAAIEAARLRKPGICRKNRVADQSEDLSASN--MKSEIASQDQMLSSTVRRNVNGA  2510
              + LK AI+AA LR+P I +K  V+ Q++++S S   +  E+ S+DQ+L S+  +N   A
Sbjct  665   DNILKVAIQAALLRRPEIYKKKEVSYQTDEVSTSGTELNCEVTSKDQVLVSSTLKNSISA  724

Query  2511  EEAQKQE--------------TANNAKQLGII--------AEASARTRNAGHVVFSDVKH  2624
             +E Q+Q+              +AN+ KQL            ++ +    AG  V  D+  
Sbjct  725   DETQEQQEILENSTSDSSKCSSANDLKQLNSCPTDFRSKPGKSDSIGLAAGKPVVRDLSD  784

Query  2625  SVIDMERQTLVSMPVILKTAIPEYQYIWQGGFEVQKSGKAFNLYDGIQAHLSSCASPKVL  2804
               +     T+ S+P+ +  A PEY+Y WQG FEV ++GK  +LY G QAHLSSCASPKVL
Sbjct  785   KAV-----TMSSVPLKM-LAFPEYEYTWQGVFEVHRNGKPPDLYTGFQAHLSSCASPKVL  838

Query  2805  DAVNKFPRKVILNEVPRLSSWPMQFKECGVSEDNVALFFFAKDIGSYEKSYKVLLGDMVK  2984
               VNKF  KV L+EV RLS WP QF   GVS+DN+AL+FFA+D+ SYE+ YK LL  M++
Sbjct  839   GVVNKFLPKVSLSEVSRLSMWPSQFLHGGVSDDNIALYFFARDVESYERHYKGLLDHMIR  898

Query  2985  HDLALQGNIGDIELLIFPSNQLPEKFQRWNLMFFLWGVFRGKRAN  3119
             +DLAL+GN   ++LLIFPSNQLPE  QRWN++FFLWGVFRG+R N
Sbjct  899   NDLALKGNFDGVQLLIFPSNQLPENSQRWNMLFFLWGVFRGRRIN  943


 Score = 67.0 bits (162),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 60/147 (41%), Positives = 74/147 (50%), Gaps = 9/147 (6%)
 Frame = +3

Query  4008  DEALSKTAILETPGNAEMFFFPVDPHPVGNIGSNNSSMPWKVHPLEEDQLHDKAPNLELA  4187
             +EA  +  I E  G  E  FFPV    + N  S   SM  K     ++   D  PNLELA
Sbjct  1338  EEACDEKIIREDLGTLERTFFPVGTQNITNSLSVMDSMSTKGVGEYDEGFQDGIPNLELA  1397

Query  4188  LGAKTKP---LMSGIPSFLSGKVEKKIIEENTSDNAATSANKEDVsaslslslsFPFPEK  4358
             LG KTKP      G+  FL G V++   + N SDN       E V+ASLSLSLSFP P K
Sbjct  1398  LGGKTKPPPAAPKGMLPFLVGAVDR---QNNRSDNLGDRQEDEGVAASLSLSLSFPSPIK  1454

Query  4359  EHGTSSKPEQEDPRRRQANTSLLLFGR  4439
             E    +K  +  P  ++ N S  LFGR
Sbjct  1455  EQ---TKAAELLPDGQRVNNSFFLFGR  1478



>gb|KHN34129.1| Bromodomain adjacent to zinc finger domain protein 1A [Glycine 
soja]
Length=1479

 Score =   525 bits (1351),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 326/765 (43%), Positives = 443/765 (58%), Gaps = 113/765 (15%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNEHVNSG  1118
             CDICG  GRE LLAICSRC+DGAEHTYCM++MLEK+PEGDWLCEECK  +E +N+ ++  
Sbjct  254   CDICGDAGREDLLAICSRCSDGAEHTYCMREMLEKVPEGDWLCEECKDAEENENKRLD--  311

Query  1119  RVNEKEKTSPSRRTTIAKSDHPLKMEQKTSDCWGDKAVEERSYLKTSGKRCTDDSEVSSP  1298
              V++K                              K VE  S  + SGKR +D+ EV+  
Sbjct  312   -VDDK------------------------------KMVEVSSTSQASGKRLSDNIEVAPA  340

Query  1299  TKRQRLE--LRSPTAQIPNRVTSLSRESSFKNLERGKVKP--LNPF--SSGSFAAKVPS-  1457
              KRQ LE  + SP    P R+  LSRESSFK+L++ KVKP  L P    SG    ++   
Sbjct  341   AKRQALESSIGSPKTSSPKRLVPLSRESSFKSLDKSKVKPGLLMPIRNHSGGIDTEIARS  400

Query  1458  -STGPQPQPPRGIFSKSNSFSSLIAKPKVKLVDEVFPAKQKLSRETAFIESKEVAVRSMG  1634
              S GP+ Q P+G+  KSNSF++L +KP+VKLVDEV P  +K   E    ++ E+  R  G
Sbjct  401   PSIGPRGQNPKGMLLKSNSFNNLNSKPRVKLVDEVVPPPKKGGNEHTS-KNMEMPARVTG  459

Query  1635  KSMSFKPTTASRSNCTESKVKMFSPKFSHDQDVKWLRHKKDRSSFDRKNSLRSDR-LAGG  1811
             KS  FK ++  RSN TESKVKM SPK +  QD+K  RH K+  +FDRK   R DR +A  
Sbjct  460   KSTLFKSSSLGRSNATESKVKMLSPKSATTQDLKGSRHLKESGAFDRKFPSRIDRPVASL  519

Query  1812  AISSPKSDNKPTPRGEPSSLSSLNTNRDYRALTSDNKPVTISNSTSGVAREVLKQASVDG  1991
              +S+PK D K TP  E S  S++N NR+ + +  D K   +  S S ++R+ L+      
Sbjct  520   VVSTPKGDQKLTPHAESSKASAMNNNRELK-VNQDGKSCALPRSMSNISRKSLEP-----  573

Query  1992  VSSANRVSSSEENPSQAIPKEDSSSSSCVAERPSWSSNEVLPDGLSQSKESKAFGDKTRE  2171
                  +VSS                     ER S   +E   D LSQS+E+    +++R+
Sbjct  574   -----QVSS---------------------ERTSTRVDETQQDVLSQSRETANQVERSRD  607

Query  2172  SSASRSKQNSTASGKIVSCQKCKGNGHLAQVCTA-----DGPESSALGSPFKSSREATNG  2336
             SS+ R +  +  + K   CQKCK  GH  + CTA      G E S   S   SS+E  + 
Sbjct  608   SSSDRGRP-AVPTSKNPLCQKCKEFGHALECCTAGSTQESGAEISVTAS--SSSKEEMHK  664

Query  2337  PSDLKAAIEAARLRKPGICRKNRVADQSEDLSASN--MKSEIASQDQMLSSTVRRNVNGA  2510
              + LK AI+AA LR+P I +K  ++ Q++++S S   +  E+ S+DQ+L S+  +N   A
Sbjct  665   DNILKVAIQAALLRRPEIYKKKEISYQTDEVSTSGTELNCEVTSKDQVLVSSTLKNSISA  724

Query  2511  EEAQKQE--------------TANNAKQLGII--------AEASARTRNAGHVVFSDVKH  2624
             +E Q+Q+              +AN+ KQL            ++ +    AG  V  D+  
Sbjct  725   DETQEQQEILENSTSDSSKCSSANDLKQLNSCPTDFRSKPGKSDSIGLAAGKPVVRDLSD  784

Query  2625  SVIDMERQTLVSMPVILKTAIPEYQYIWQGGFEVQKSGKAFNLYDGIQAHLSSCASPKVL  2804
               +     T+ S+P+ +  A PEY+Y WQG FEV ++GK  +LY G QAHLSSCASPKVL
Sbjct  785   KAV-----TMSSVPLKM-LAFPEYEYTWQGVFEVHRNGKPPDLYTGFQAHLSSCASPKVL  838

Query  2805  DAVNKFPRKVILNEVPRLSSWPMQFKECGVSEDNVALFFFAKDIGSYEKSYKVLLGDMVK  2984
               VNKF  KV L+EV RLS WP QF   GVS+DN+AL+FFA+D+ SYE+ YK LL  M++
Sbjct  839   GVVNKFLPKVSLSEVSRLSMWPSQFLHGGVSDDNIALYFFARDVESYERHYKGLLDHMIR  898

Query  2985  HDLALQGNIGDIELLIFPSNQLPEKFQRWNLMFFLWGVFRGKRAN  3119
             +DLAL+GN   ++LLIFPSNQLPE  QRWN++FFLWGVFRG+R N
Sbjct  899   NDLALKGNFDGVQLLIFPSNQLPENSQRWNMLFFLWGVFRGRRIN  943


 Score = 66.6 bits (161),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 60/147 (41%), Positives = 74/147 (50%), Gaps = 9/147 (6%)
 Frame = +3

Query  4008  DEALSKTAILETPGNAEMFFFPVDPHPVGNIGSNNSSMPWKVHPLEEDQLHDKAPNLELA  4187
             +EA  +  I E  G  E  FFPV    + N  S   SM  K     ++   D  PNLELA
Sbjct  1338  EEACDEKIIREDLGTLERTFFPVGTQNITNSLSVMDSMSTKGVGEYDEGFQDGIPNLELA  1397

Query  4188  LGAKTKP---LMSGIPSFLSGKVEKKIIEENTSDNAATSANKEDVsaslslslsFPFPEK  4358
             LG KTKP      G+  FL G V++   + N SDN       E V+ASLSLSLSFP P K
Sbjct  1398  LGGKTKPPPAAPKGMLPFLVGAVDR---QNNRSDNLGDRQEDEGVAASLSLSLSFPSPIK  1454

Query  4359  EHGTSSKPEQEDPRRRQANTSLLLFGR  4439
             E    +K  +  P  ++ N S  LFGR
Sbjct  1455  EQ---TKAAELLPDGQRVNNSFFLFGR  1478



>gb|KDO47996.1| hypothetical protein CISIN_1g000388mg [Citrus sinensis]
Length=1587

 Score =   521 bits (1341),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 347/845 (41%), Positives = 485/845 (57%), Gaps = 107/845 (13%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNEHVNSG  1118
             CDICG  GRE LLAICSRC+DGAEHTYCM++ML+K+PEGDWLCEECKF +E         
Sbjct  318   CDICGDAGREDLLAICSRCSDGAEHTYCMKEMLQKVPEGDWLCEECKFAEE---------  368

Query  1119  RVNEKEKTSPSRRTTIAKSDHPLKMEQKTSDCWGDKAVEERSYLKTSGKRCTDDSEVSSP  1298
                EK+K                    + SD  G +  ++ +  ++SGKR  ++ + +  
Sbjct  369   --TEKQK--------------------QGSDIEGKRTNKQSTSTQSSGKRHAENLDAAPA  406

Query  1299  TKRQRLELR--SPTAQIPNRVTSLSRESSFKNLERGKVKPL--NPFSSGSFAAKVPSSTG  1466
              KRQ +E     P    P++  +LSR+SSFK+L++GKV+P+     SS        S  G
Sbjct  407   AKRQAIETSPGYPKPLSPSKAAALSRDSSFKSLDKGKVRPVTFGNNSSNDVVETARSPGG  466

Query  1467  PQPQPPRGIFSKSNSFSSLIAKPKVKLVDEVFPAKQKLSRETAFIESKEVAVRSMGKSMS  1646
               PQ  +G   KS+SFS+L +K KVKLVDEV P KQK +R+ A ++ KE   R MGKSMS
Sbjct  467   LLPQTTKGTLLKSSSFSTLNSKAKVKLVDEVVPQKQKATRDQASLDVKEGPSRVMGKSMS  526

Query  1647  FKPTTASRSNCTESKVKMFSPKFSHDQDVKWLRHKKDRSSFDRKNSLRSDR------LAG  1808
             FK T++ RS+  ESK++  SP+ S   D+K L+  K+R++F+RK+  R DR      +A 
Sbjct  527   FKSTSSGRSSAGESKLRALSPRPSRLHDLKGLKQVKERNAFERKSLSRLDRSLTVSSMAT  586

Query  1809  GAISSPKSDNKPTPRGEPSSLSSLNTNRDYRALTSDNKPVTISNSTSGVAREVLKQAS--  1982
              A S+PK+D K TPRGE  S SS + NR+ + + S+ K  T++ S S + R+ L+ +   
Sbjct  587   PA-STPKADQKLTPRGEAVSFSSASNNREAKVVKSEGKGSTLTKSNSTLPRKGLEVSGTP  645

Query  1983  VDGVSSANRVSSSEENPSQAIPKEDSSSSSCVAERPSWSSNEVLPDGLSQSKESKAFGDK  2162
             V  +S++   SSS E     +  ++  SSS   +  +   NE++ DGL +S ES   G+K
Sbjct  646   VGALSTSAMCSSSVEQKPNLVSPKEEPSSSSSEKPSTIV-NELVQDGLPRSVESTNQGEK  704

Query  2163  TRESSASRSKQNSTASGKIVSCQKCKGNGHLAQVCTADGPESSALG-SPFKSSREATNGP  2339
                SS+ RS+   TA  K V CQKCK  GH  + C     + S +  S  ++ RE     
Sbjct  705   ---SSSCRSRPTLTAGSKGVLCQKCKEVGHDVESCPLGSTQVSGIDVSAGRNCREGMIKG  761

Query  2340  SDLKAAIEAARLRKPGICRKNRVADQSEDLSASNM--KSEIASQDQMLSSTVRRNVNGAE  2513
             + LKAAIEAA  + PG   +N+V DQ + L  +NM    E +SQDQ    +V   + GA+
Sbjct  762   NKLKAAIEAAMHKLPGTYGRNKVNDQLDGLGITNMDLNCERSSQDQF---SVSNKMKGAQ  818

Query  2514  EA--QKQETANNAKQLGIIAEASARTRNAGHVVFSDVKHSVIDMERQTLVSMPVILK-TA  2684
             E    KQ T N  K                                      P +LK +A
Sbjct  819   EVLINKQTTINQLK--------------------------------------PALLKISA  840

Query  2685  IPEYQYIWQGGFEVQKSGKAFNLYDGIQAHLSSCASPKVLDAVNKFPRKVILNEVPRLSS  2864
             +PE++YIWQGGFEV +  K  NL DGIQAHLSSCAS KVL+ V+KFP+++ L EVPR+S+
Sbjct  841   VPEHEYIWQGGFEVHRGEKLPNLCDGIQAHLSSCASSKVLEVVSKFPQRIRLKEVPRVST  900

Query  2865  WPMQFKECGVSEDNVALFFFAKDIGSYEKSYKVLLGDMVKHDLALQGNIGDIELLIFPSN  3044
             WP  F E G  E+N+AL+FFAKD  SY ++YK+L+  M+K+DLAL GN+  IELLIFPSN
Sbjct  901   WPTMFHESGAKEENIALYFFAKDFESYGRNYKILVDSMMKNDLALMGNLDGIELLIFPSN  960

Query  3045  QLPEKFQRWNLMFFLWGVFRGKRANSLQN-----FPGAEK-PLIQDIPTPATSLPENMFT  3206
             QLPE  QRWNL+FFLWGVFR ++ N   +     F G++  PL + I T   SL +N+  
Sbjct  961   QLPENCQRWNLLFFLWGVFRVRKVNCSNSTKHSCFAGSKMVPLDRVITTDNLSLSQNI--  1018

Query  3207  PVPKLNSARGSAATNTEMSAVKESESASLHKI-VNGNCSIQSSSQVSRDKCSRINAEQND  3383
              +PK ++ + SAA +T  + V  S       + +N NC  ++SS       S+ N+ Q+D
Sbjct  1019  -LPK-HADKDSAACDTSHNIVPGSYGPDGTCVTLNENCDNKASSVQLTSLGSQSNSIQHD  1076

Query  3384  -KLDS  3395
              + DS
Sbjct  1077  GRFDS  1081


 Score =   107 bits (267),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 96/265 (36%), Positives = 136/265 (51%), Gaps = 12/265 (5%)
 Frame = +3

Query  3675  DNVSTEEATPLARHTSMEQTLNVISSF-GVNPKKRSHSAE---TVLQsasssgtsqafss  3842
             D +  E      R+ + E +L+   +F G+N ++  H       ++++A++S    +   
Sbjct  1319  DQIDLERDLKEGRYMNAETSLDRNLNFKGLNHQQFHHGNSPHLDLMETAAASSCGTSQKM  1378

Query  3843  ysNDDILVEEFCHKRVKLNSDRSYGCN---DQTSCSKDGFLSEMGGTASQLSRQKNERDE  4013
               N+  L  E   K++K      Y C+   D  SCS DGF S         S Q+   +E
Sbjct  1379  PWNEAFLDGESSSKKLKTGFAGPYECSSSRDGDSCS-DGFSSRRDDLCPSSSNQEKISEE  1437

Query  4014  ALSKTAILETPGNAEMFFFPVDPHPVGNIGSNNSSMPWK-VHPLEEDQLHDKAPNLELAL  4190
              L +  IL+   + E +FF VD H   +     +SMPWK +   +ED+L D  PNL LAL
Sbjct  1438  LLDRKVILKDLESPERYFFHVDSHRENDCRLGANSMPWKELSSKDEDELLDTVPNLNLAL  1497

Query  4191  GAKTKPLMSGIPSFLSGKVEKKIIEENTSDNAATSANKEDVsaslslslsFPFPEKEHGT  4370
             GA TK    G+  F  G +EK   ++   D  A    +ED+SASLSLSLSFPFP+KE  +
Sbjct  1498  GADTKQPNKGMLPFFVGPLEKNNNQDRPPDKGADKGAEEDISASLSLSLSFPFPDKEQTS  1557

Query  4371  ---SSKPEQEDPRRRQANTSLLLFG  4436
                +SK EQ  P RR  NTSLLLFG
Sbjct  1558  VKPASKTEQLLPERRHVNTSLLLFG  1582



>ref|XP_006494938.1| PREDICTED: uncharacterized protein LOC102623421 isoform X3 [Citrus 
sinensis]
Length=1587

 Score =   520 bits (1340),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 347/845 (41%), Positives = 484/845 (57%), Gaps = 107/845 (13%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNEHVNSG  1118
             CDICG  GRE LLAICSRC+DGAEHTYCM++ML+K+PEGDWLCEECKF +E         
Sbjct  318   CDICGDAGREDLLAICSRCSDGAEHTYCMKEMLQKVPEGDWLCEECKFAEE---------  368

Query  1119  RVNEKEKTSPSRRTTIAKSDHPLKMEQKTSDCWGDKAVEERSYLKTSGKRCTDDSEVSSP  1298
                EK+K                    + SD  G +  ++ +  ++SGKR  ++ + +  
Sbjct  369   --TEKQK--------------------QGSDIEGKRTNKQSTSTQSSGKRHAENLDAAPA  406

Query  1299  TKRQRLELR--SPTAQIPNRVTSLSRESSFKNLERGKVKPL--NPFSSGSFAAKVPSSTG  1466
              KRQ +E     P    P++  +LSR+SSFK+L++GKV+P+     SS        S  G
Sbjct  407   AKRQAIETSPGYPKPLSPSKAAALSRDSSFKSLDKGKVRPVTFGNNSSNDVVETARSPGG  466

Query  1467  PQPQPPRGIFSKSNSFSSLIAKPKVKLVDEVFPAKQKLSRETAFIESKEVAVRSMGKSMS  1646
               PQ  +G   KS+SFS+L +K KVKLVDEV P KQK +R+ A ++ KE   R MGKSMS
Sbjct  467   LLPQTTKGTLLKSSSFSTLNSKAKVKLVDEVVPQKQKATRDQASLDVKEGPSRVMGKSMS  526

Query  1647  FKPTTASRSNCTESKVKMFSPKFSHDQDVKWLRHKKDRSSFDRKNSLRSDR------LAG  1808
             FK T++ RS+  ESK++  SP+ S   D+K L+  K+R++F+RK+  R DR      +A 
Sbjct  527   FKSTSSGRSSAGESKLRALSPRPSRLHDLKGLKQVKERNAFERKSLSRLDRSLTVSSMAT  586

Query  1809  GAISSPKSDNKPTPRGEPSSLSSLNTNRDYRALTSDNKPVTISNSTSGVAREVLKQAS--  1982
              A S+PK+D K TPRGE  S SS + NR+ + + S+ K  T++ S S + R+ L+ +   
Sbjct  587   PA-STPKADQKLTPRGEAVSFSSASNNREAKVVKSEGKGSTLTKSNSTLPRKGLEVSGTP  645

Query  1983  VDGVSSANRVSSSEENPSQAIPKEDSSSSSCVAERPSWSSNEVLPDGLSQSKESKAFGDK  2162
             V  +S++   SSS E     +  ++  SSS   +  +   NE++ DGL +S ES   G+K
Sbjct  646   VGALSTSAMCSSSVEQKPNLVSPKEEPSSSSSEKPSTIV-NELVQDGLPRSVESTNQGEK  704

Query  2163  TRESSASRSKQNSTASGKIVSCQKCKGNGHLAQVCTADGPESSALG-SPFKSSREATNGP  2339
                SS+ RS+   TA  K V CQKCK  GH  + C     + S +  S  ++ RE     
Sbjct  705   ---SSSCRSRPTLTAGSKGVLCQKCKEVGHDVESCPLGSTQVSGIDVSAGRNCREGMIKG  761

Query  2340  SDLKAAIEAARLRKPGICRKNRVADQSEDLSASNM--KSEIASQDQMLSSTVRRNVNGAE  2513
             + LKAAIEAA  + PG   +N+V DQ + L  +NM    E +SQDQ    +V   + GA+
Sbjct  762   NKLKAAIEAAMHKLPGTYGRNKVNDQLDGLGITNMDLNCERSSQDQF---SVSNKMKGAQ  818

Query  2514  EA--QKQETANNAKQLGIIAEASARTRNAGHVVFSDVKHSVIDMERQTLVSMPVILK-TA  2684
             E    KQ T N  K                                      P +LK +A
Sbjct  819   EVLINKQTTINQLK--------------------------------------PALLKISA  840

Query  2685  IPEYQYIWQGGFEVQKSGKAFNLYDGIQAHLSSCASPKVLDAVNKFPRKVILNEVPRLSS  2864
             +PE++YIWQGGFEV +  K  NL DGIQAHLSSCAS KVL+ V+KFP+++ L EVPR+S+
Sbjct  841   VPEHEYIWQGGFEVHRGEKLPNLCDGIQAHLSSCASSKVLEVVSKFPQRIRLKEVPRVST  900

Query  2865  WPMQFKECGVSEDNVALFFFAKDIGSYEKSYKVLLGDMVKHDLALQGNIGDIELLIFPSN  3044
             WP  F E G  E+N+AL+FFAKD  SY ++YK+L+  M+K+DLAL GN+  IELLIFPSN
Sbjct  901   WPTMFHESGAKEENIALYFFAKDFESYGRNYKILVDSMMKNDLALMGNLDGIELLIFPSN  960

Query  3045  QLPEKFQRWNLMFFLWGVFRGKRANSLQN-----FPGAEK-PLIQDIPTPATSLPENMFT  3206
             QLPE  QRWNL+FFLWGVFR ++ N   +     F G++  PL   I T   SL +N+  
Sbjct  961   QLPENCQRWNLLFFLWGVFRVRKVNCSNSTKHSCFAGSKMVPLDSLITTDNLSLSQNI--  1018

Query  3207  PVPKLNSARGSAATNTEMSAVKESESASLHKI-VNGNCSIQSSSQVSRDKCSRINAEQND  3383
              +PK ++ + SAA +T  + V  S       + +N NC  ++SS       S+ N+ Q+D
Sbjct  1019  -LPK-HADKDSAACDTSHNIVPGSYGPDGTCVTLNENCDNKASSVQQTSLGSQSNSIQHD  1076

Query  3384  -KLDS  3395
              + DS
Sbjct  1077  GRFDS  1081


 Score =   107 bits (266),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 99/275 (36%), Positives = 137/275 (50%), Gaps = 20/275 (7%)
 Frame = +3

Query  3642  KDDVKIGRICLDNVSTEEATPLARHTSMEQTLNVISSFGVNPKKRSHSAETVLQsasssg  3821
             +D + +GR        +E   +   TS+++ LN     G+N ++  H     L    ++ 
Sbjct  1318  RDQIDLGR------DLKEGRYMNAETSLDRNLNFK---GLNHQQFHHGNSPHLDLTETAA  1368

Query  3822  tsqafssys---NDDILVEEFCHKRVKLNSDRSYGCN---DQTSCSKDGFLSEMGGTASQ  3983
              S   +S     N+  L  E   K++K      Y C+   D  SCS DGF S        
Sbjct  1369  ASSCGTSQKMPWNEAFLDGESSSKKLKTGFAGPYECSSSRDGDSCS-DGFSSRRDDLCPS  1427

Query  3984  LSRQKNERDEALSKTAILETPGNAEMFFFPVDPHPVGNIGSNNSSMPWK-VHPLEEDQLH  4160
              S Q+   +E L +  IL+   + E +FF VD H   +     +SMPWK +   +ED+L 
Sbjct  1428  SSNQEKISEELLDRKVILKDLESPERYFFHVDSHRENDCRLGANSMPWKELSSKDEDELP  1487

Query  4161  DKAPNLELALGAKTKPLMSGIPSFLSGKVEKKIIEENTSDNAATSANKEDVsaslslsls  4340
             D  PNL LALGA TK    G+  F  G +EK   ++   D  A    +ED+SASLSLSLS
Sbjct  1488  DTVPNLNLALGADTKQPSKGMLPFFVGPLEKNNNQDRPPDKGADKGVEEDISASLSLSLS  1547

Query  4341  FPFPEKEHGT---SSKPEQEDPRRRQANTSLLLFG  4436
             FPFP+KE  +   +SK EQ  P RR  NTSLLLFG
Sbjct  1548  FPFPDKEQTSVKPASKTEQLLPERRHVNTSLLLFG  1582



>ref|XP_006494936.1| PREDICTED: uncharacterized protein LOC102623421 isoform X1 [Citrus 
sinensis]
Length=1658

 Score =   521 bits (1343),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 347/845 (41%), Positives = 484/845 (57%), Gaps = 107/845 (13%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNEHVNSG  1118
             CDICG  GRE LLAICSRC+DGAEHTYCM++ML+K+PEGDWLCEECKF +E         
Sbjct  389   CDICGDAGREDLLAICSRCSDGAEHTYCMKEMLQKVPEGDWLCEECKFAEE---------  439

Query  1119  RVNEKEKTSPSRRTTIAKSDHPLKMEQKTSDCWGDKAVEERSYLKTSGKRCTDDSEVSSP  1298
                EK+K                    + SD  G +  ++ +  ++SGKR  ++ + +  
Sbjct  440   --TEKQK--------------------QGSDIEGKRTNKQSTSTQSSGKRHAENLDAAPA  477

Query  1299  TKRQRLELR--SPTAQIPNRVTSLSRESSFKNLERGKVKPL--NPFSSGSFAAKVPSSTG  1466
              KRQ +E     P    P++  +LSR+SSFK+L++GKV+P+     SS        S  G
Sbjct  478   AKRQAIETSPGYPKPLSPSKAAALSRDSSFKSLDKGKVRPVTFGNNSSNDVVETARSPGG  537

Query  1467  PQPQPPRGIFSKSNSFSSLIAKPKVKLVDEVFPAKQKLSRETAFIESKEVAVRSMGKSMS  1646
               PQ  +G   KS+SFS+L +K KVKLVDEV P KQK +R+ A ++ KE   R MGKSMS
Sbjct  538   LLPQTTKGTLLKSSSFSTLNSKAKVKLVDEVVPQKQKATRDQASLDVKEGPSRVMGKSMS  597

Query  1647  FKPTTASRSNCTESKVKMFSPKFSHDQDVKWLRHKKDRSSFDRKNSLRSDR------LAG  1808
             FK T++ RS+  ESK++  SP+ S   D+K L+  K+R++F+RK+  R DR      +A 
Sbjct  598   FKSTSSGRSSAGESKLRALSPRPSRLHDLKGLKQVKERNAFERKSLSRLDRSLTVSSMAT  657

Query  1809  GAISSPKSDNKPTPRGEPSSLSSLNTNRDYRALTSDNKPVTISNSTSGVAREVLKQAS--  1982
              A S+PK+D K TPRGE  S SS + NR+ + + S+ K  T++ S S + R+ L+ +   
Sbjct  658   PA-STPKADQKLTPRGEAVSFSSASNNREAKVVKSEGKGSTLTKSNSTLPRKGLEVSGTP  716

Query  1983  VDGVSSANRVSSSEENPSQAIPKEDSSSSSCVAERPSWSSNEVLPDGLSQSKESKAFGDK  2162
             V  +S++   SSS E     +  ++  SSS   +  +   NE++ DGL +S ES   G+K
Sbjct  717   VGALSTSAMCSSSVEQKPNLVSPKEEPSSSSSEKPSTIV-NELVQDGLPRSVESTNQGEK  775

Query  2163  TRESSASRSKQNSTASGKIVSCQKCKGNGHLAQVCTADGPESSALG-SPFKSSREATNGP  2339
                SS+ RS+   TA  K V CQKCK  GH  + C     + S +  S  ++ RE     
Sbjct  776   ---SSSCRSRPTLTAGSKGVLCQKCKEVGHDVESCPLGSTQVSGIDVSAGRNCREGMIKG  832

Query  2340  SDLKAAIEAARLRKPGICRKNRVADQSEDLSASNM--KSEIASQDQMLSSTVRRNVNGAE  2513
             + LKAAIEAA  + PG   +N+V DQ + L  +NM    E +SQDQ    +V   + GA+
Sbjct  833   NKLKAAIEAAMHKLPGTYGRNKVNDQLDGLGITNMDLNCERSSQDQF---SVSNKMKGAQ  889

Query  2514  EA--QKQETANNAKQLGIIAEASARTRNAGHVVFSDVKHSVIDMERQTLVSMPVILK-TA  2684
             E    KQ T N  K                                      P +LK +A
Sbjct  890   EVLINKQTTINQLK--------------------------------------PALLKISA  911

Query  2685  IPEYQYIWQGGFEVQKSGKAFNLYDGIQAHLSSCASPKVLDAVNKFPRKVILNEVPRLSS  2864
             +PE++YIWQGGFEV +  K  NL DGIQAHLSSCAS KVL+ V+KFP+++ L EVPR+S+
Sbjct  912   VPEHEYIWQGGFEVHRGEKLPNLCDGIQAHLSSCASSKVLEVVSKFPQRIRLKEVPRVST  971

Query  2865  WPMQFKECGVSEDNVALFFFAKDIGSYEKSYKVLLGDMVKHDLALQGNIGDIELLIFPSN  3044
             WP  F E G  E+N+AL+FFAKD  SY ++YK+L+  M+K+DLAL GN+  IELLIFPSN
Sbjct  972   WPTMFHESGAKEENIALYFFAKDFESYGRNYKILVDSMMKNDLALMGNLDGIELLIFPSN  1031

Query  3045  QLPEKFQRWNLMFFLWGVFRGKRANSLQN-----FPGAEK-PLIQDIPTPATSLPENMFT  3206
             QLPE  QRWNL+FFLWGVFR ++ N   +     F G++  PL   I T   SL +N+  
Sbjct  1032  QLPENCQRWNLLFFLWGVFRVRKVNCSNSTKHSCFAGSKMVPLDSLITTDNLSLSQNI--  1089

Query  3207  PVPKLNSARGSAATNTEMSAVKESESASLHKI-VNGNCSIQSSSQVSRDKCSRINAEQND  3383
              +PK ++ + SAA +T  + V  S       + +N NC  ++SS       S+ N+ Q+D
Sbjct  1090  -LPK-HADKDSAACDTSHNIVPGSYGPDGTCVTLNENCDNKASSVQQTSLGSQSNSIQHD  1147

Query  3384  -KLDS  3395
              + DS
Sbjct  1148  GRFDS  1152


 Score =   107 bits (267),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 99/275 (36%), Positives = 137/275 (50%), Gaps = 20/275 (7%)
 Frame = +3

Query  3642  KDDVKIGRICLDNVSTEEATPLARHTSMEQTLNVISSFGVNPKKRSHSAETVLQsasssg  3821
             +D + +GR        +E   +   TS+++ LN     G+N ++  H     L    ++ 
Sbjct  1389  RDQIDLGR------DLKEGRYMNAETSLDRNLNFK---GLNHQQFHHGNSPHLDLTETAA  1439

Query  3822  tsqafssys---NDDILVEEFCHKRVKLNSDRSYGCN---DQTSCSKDGFLSEMGGTASQ  3983
              S   +S     N+  L  E   K++K      Y C+   D  SCS DGF S        
Sbjct  1440  ASSCGTSQKMPWNEAFLDGESSSKKLKTGFAGPYECSSSRDGDSCS-DGFSSRRDDLCPS  1498

Query  3984  LSRQKNERDEALSKTAILETPGNAEMFFFPVDPHPVGNIGSNNSSMPWK-VHPLEEDQLH  4160
              S Q+   +E L +  IL+   + E +FF VD H   +     +SMPWK +   +ED+L 
Sbjct  1499  SSNQEKISEELLDRKVILKDLESPERYFFHVDSHRENDCRLGANSMPWKELSSKDEDELP  1558

Query  4161  DKAPNLELALGAKTKPLMSGIPSFLSGKVEKKIIEENTSDNAATSANKEDVsaslslsls  4340
             D  PNL LALGA TK    G+  F  G +EK   ++   D  A    +ED+SASLSLSLS
Sbjct  1559  DTVPNLNLALGADTKQPSKGMLPFFVGPLEKNNNQDRPPDKGADKGVEEDISASLSLSLS  1618

Query  4341  FPFPEKEHGT---SSKPEQEDPRRRQANTSLLLFG  4436
             FPFP+KE  +   +SK EQ  P RR  NTSLLLFG
Sbjct  1619  FPFPDKEQTSVKPASKTEQLLPERRHVNTSLLLFG  1653



>ref|XP_006494937.1| PREDICTED: uncharacterized protein LOC102623421 isoform X2 [Citrus 
sinensis]
Length=1616

 Score =   521 bits (1341),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 347/845 (41%), Positives = 484/845 (57%), Gaps = 107/845 (13%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNEHVNSG  1118
             CDICG  GRE LLAICSRC+DGAEHTYCM++ML+K+PEGDWLCEECKF +E         
Sbjct  347   CDICGDAGREDLLAICSRCSDGAEHTYCMKEMLQKVPEGDWLCEECKFAEE---------  397

Query  1119  RVNEKEKTSPSRRTTIAKSDHPLKMEQKTSDCWGDKAVEERSYLKTSGKRCTDDSEVSSP  1298
                EK+K                    + SD  G +  ++ +  ++SGKR  ++ + +  
Sbjct  398   --TEKQK--------------------QGSDIEGKRTNKQSTSTQSSGKRHAENLDAAPA  435

Query  1299  TKRQRLELR--SPTAQIPNRVTSLSRESSFKNLERGKVKPL--NPFSSGSFAAKVPSSTG  1466
              KRQ +E     P    P++  +LSR+SSFK+L++GKV+P+     SS        S  G
Sbjct  436   AKRQAIETSPGYPKPLSPSKAAALSRDSSFKSLDKGKVRPVTFGNNSSNDVVETARSPGG  495

Query  1467  PQPQPPRGIFSKSNSFSSLIAKPKVKLVDEVFPAKQKLSRETAFIESKEVAVRSMGKSMS  1646
               PQ  +G   KS+SFS+L +K KVKLVDEV P KQK +R+ A ++ KE   R MGKSMS
Sbjct  496   LLPQTTKGTLLKSSSFSTLNSKAKVKLVDEVVPQKQKATRDQASLDVKEGPSRVMGKSMS  555

Query  1647  FKPTTASRSNCTESKVKMFSPKFSHDQDVKWLRHKKDRSSFDRKNSLRSDR------LAG  1808
             FK T++ RS+  ESK++  SP+ S   D+K L+  K+R++F+RK+  R DR      +A 
Sbjct  556   FKSTSSGRSSAGESKLRALSPRPSRLHDLKGLKQVKERNAFERKSLSRLDRSLTVSSMAT  615

Query  1809  GAISSPKSDNKPTPRGEPSSLSSLNTNRDYRALTSDNKPVTISNSTSGVAREVLKQAS--  1982
              A S+PK+D K TPRGE  S SS + NR+ + + S+ K  T++ S S + R+ L+ +   
Sbjct  616   PA-STPKADQKLTPRGEAVSFSSASNNREAKVVKSEGKGSTLTKSNSTLPRKGLEVSGTP  674

Query  1983  VDGVSSANRVSSSEENPSQAIPKEDSSSSSCVAERPSWSSNEVLPDGLSQSKESKAFGDK  2162
             V  +S++   SSS E     +  ++  SSS   +  +   NE++ DGL +S ES   G+K
Sbjct  675   VGALSTSAMCSSSVEQKPNLVSPKEEPSSSSSEKPSTIV-NELVQDGLPRSVESTNQGEK  733

Query  2163  TRESSASRSKQNSTASGKIVSCQKCKGNGHLAQVCTADGPESSALG-SPFKSSREATNGP  2339
                SS+ RS+   TA  K V CQKCK  GH  + C     + S +  S  ++ RE     
Sbjct  734   ---SSSCRSRPTLTAGSKGVLCQKCKEVGHDVESCPLGSTQVSGIDVSAGRNCREGMIKG  790

Query  2340  SDLKAAIEAARLRKPGICRKNRVADQSEDLSASNM--KSEIASQDQMLSSTVRRNVNGAE  2513
             + LKAAIEAA  + PG   +N+V DQ + L  +NM    E +SQDQ    +V   + GA+
Sbjct  791   NKLKAAIEAAMHKLPGTYGRNKVNDQLDGLGITNMDLNCERSSQDQF---SVSNKMKGAQ  847

Query  2514  EA--QKQETANNAKQLGIIAEASARTRNAGHVVFSDVKHSVIDMERQTLVSMPVILK-TA  2684
             E    KQ T N  K                                      P +LK +A
Sbjct  848   EVLINKQTTINQLK--------------------------------------PALLKISA  869

Query  2685  IPEYQYIWQGGFEVQKSGKAFNLYDGIQAHLSSCASPKVLDAVNKFPRKVILNEVPRLSS  2864
             +PE++YIWQGGFEV +  K  NL DGIQAHLSSCAS KVL+ V+KFP+++ L EVPR+S+
Sbjct  870   VPEHEYIWQGGFEVHRGEKLPNLCDGIQAHLSSCASSKVLEVVSKFPQRIRLKEVPRVST  929

Query  2865  WPMQFKECGVSEDNVALFFFAKDIGSYEKSYKVLLGDMVKHDLALQGNIGDIELLIFPSN  3044
             WP  F E G  E+N+AL+FFAKD  SY ++YK+L+  M+K+DLAL GN+  IELLIFPSN
Sbjct  930   WPTMFHESGAKEENIALYFFAKDFESYGRNYKILVDSMMKNDLALMGNLDGIELLIFPSN  989

Query  3045  QLPEKFQRWNLMFFLWGVFRGKRANSLQN-----FPGAEK-PLIQDIPTPATSLPENMFT  3206
             QLPE  QRWNL+FFLWGVFR ++ N   +     F G++  PL   I T   SL +N+  
Sbjct  990   QLPENCQRWNLLFFLWGVFRVRKVNCSNSTKHSCFAGSKMVPLDSLITTDNLSLSQNI--  1047

Query  3207  PVPKLNSARGSAATNTEMSAVKESESASLHKI-VNGNCSIQSSSQVSRDKCSRINAEQND  3383
              +PK ++ + SAA +T  + V  S       + +N NC  ++SS       S+ N+ Q+D
Sbjct  1048  -LPK-HADKDSAACDTSHNIVPGSYGPDGTCVTLNENCDNKASSVQQTSLGSQSNSIQHD  1105

Query  3384  -KLDS  3395
              + DS
Sbjct  1106  GRFDS  1110


 Score =   107 bits (267),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 99/275 (36%), Positives = 137/275 (50%), Gaps = 20/275 (7%)
 Frame = +3

Query  3642  KDDVKIGRICLDNVSTEEATPLARHTSMEQTLNVISSFGVNPKKRSHSAETVLQsasssg  3821
             +D + +GR        +E   +   TS+++ LN     G+N ++  H     L    ++ 
Sbjct  1347  RDQIDLGR------DLKEGRYMNAETSLDRNLNFK---GLNHQQFHHGNSPHLDLTETAA  1397

Query  3822  tsqafssys---NDDILVEEFCHKRVKLNSDRSYGCN---DQTSCSKDGFLSEMGGTASQ  3983
              S   +S     N+  L  E   K++K      Y C+   D  SCS DGF S        
Sbjct  1398  ASSCGTSQKMPWNEAFLDGESSSKKLKTGFAGPYECSSSRDGDSCS-DGFSSRRDDLCPS  1456

Query  3984  LSRQKNERDEALSKTAILETPGNAEMFFFPVDPHPVGNIGSNNSSMPWK-VHPLEEDQLH  4160
              S Q+   +E L +  IL+   + E +FF VD H   +     +SMPWK +   +ED+L 
Sbjct  1457  SSNQEKISEELLDRKVILKDLESPERYFFHVDSHRENDCRLGANSMPWKELSSKDEDELP  1516

Query  4161  DKAPNLELALGAKTKPLMSGIPSFLSGKVEKKIIEENTSDNAATSANKEDVsaslslsls  4340
             D  PNL LALGA TK    G+  F  G +EK   ++   D  A    +ED+SASLSLSLS
Sbjct  1517  DTVPNLNLALGADTKQPSKGMLPFFVGPLEKNNNQDRPPDKGADKGVEEDISASLSLSLS  1576

Query  4341  FPFPEKEHGT---SSKPEQEDPRRRQANTSLLLFG  4436
             FPFP+KE  +   +SK EQ  P RR  NTSLLLFG
Sbjct  1577  FPFPDKEQTSVKPASKTEQLLPERRHVNTSLLLFG  1611



>ref|XP_008459204.1| PREDICTED: probable GPI-anchored adhesin-like protein PGA55 isoform 
X2 [Cucumis melo]
Length=1553

 Score =   519 bits (1336),  Expect = 5e-153, Method: Compositional matrix adjust.
 Identities = 416/1201 (35%), Positives = 587/1201 (49%), Gaps = 170/1201 (14%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNEH--VN  1112
             CDICG  GRE LLAICSRCTDGAEHTYCM++ L+++PEGDWLCEECK  +E +N+   V 
Sbjct  376   CDICGDAGREDLLAICSRCTDGAEHTYCMRERLDEVPEGDWLCEECKSAEENENQKQDVE  435

Query  1113  SGRVNEKEKTSPSRRTTIAKSDHPLKMEQKTSDCWGDKAVEERSYLKTSGKRCTDDSEVS  1292
                    ++    RR  I  S        + SD  G K   + S ++  GK+  D+ +VS
Sbjct  436   GKSYISYKRKDEGRRPNIVSS------STQVSDTEGKKVSRDGSSIRKFGKKNLDNVDVS  489

Query  1293  SPTKRQRLELRSPTAQI--PNRVTSLSRESSFKNLERGKV-----KPLNPFSSGSF--AA  1445
                KRQ LE    + +   P R   LSR+SS K+L++GK      K L    S      A
Sbjct  490   VAAKRQVLETNKGSTKTSSPGRSIGLSRDSSSKSLDKGKSMLSQSKCLGDQCSNDVLEMA  549

Query  1446  KVPSSTGPQPQPPRGIFSKSNSFSSLIAKPKVKLVDEVFPAKQKLSRETAFIESKEVAVR  1625
             + PS  G +    +G   KSNSF++L +KPKVKLVDE  P K +  RE   +E KE + R
Sbjct  550   RSPS-VGSRLHTLKGTLLKSNSFNTLNSKPKVKLVDEFIPQKPRGPREHTSLEVKEGSSR  608

Query  1626  SMGKSMSFKPTTASRSNCTESKVKMFSPKFSHDQDVKWLRHKKDRSSFDRKNSLRSDR--  1799
             ++GKS SFK  +  R++ +E+KVKM   KF H QD K ++  KDR+  DRKN  + DR  
Sbjct  609   ALGKSQSFKTPSFGRASMSEAKVKMIPSKFPHVQDPKGIKQGKDRNVLDRKNPSKVDRSW  668

Query  1800  ----LAGGAISSPKSDNKPTPRGEPSSLSSLNTNRDYRALTSDNKPVTISNSTSGVAREV  1967
                     A+S+ K + K + RGE    ++   NRD + + SD     IS ST   +R  
Sbjct  669   ISSVTTSSAVSTSKVEQKLSSRGE----TNFGNNRDQKIIQSDG----IS-STHPKSRSS  719

Query  1968  LKQASVDGVSSANRV--------SSSEENPSQAIPKEDSSSSSCVAERPSWSSNEVLPDG  2123
             L    VD   S  R         SS ++  +  IPKE+  SSS   ERP ++ N      
Sbjct  720   LVHMGVDNPLSPARALLTNGTCSSSVDQKINHLIPKEEPLSSSLTVERPPYNDN------  773

Query  2124  LSQSKESKAFGDKTRESSASRSKQNSTASGKIVSCQKCKGNGHLAQVCTADGPESSALGS  2303
               +S+E     +K +ESSA+  K     S K   C KCKG  H  + C         +GS
Sbjct  774   -GRSREMTGLDEKNKESSANPLKPTVATSPKSGHCLKCKGTEHATESCI--------IGS  824

Query  2304  PFKS------SREATNGPSDLKAAIEAARLRKPGICRKNRVAD--QSEDLSASNMKSEIA  2459
             P+ S      SRE T   + LKAAI+AA LR+P IC+K + +D       S++   SEI 
Sbjct  825   PYVSDNNIISSREETCEENKLKAAIQAALLRRPEICKKRKFSDPSDEVSSSSTVSNSEIV  884

Query  2460  SQDQMLSSTVRRNVNGAEEAQKQET------ANNAKQLGIIAEASARTRNAGHVV---FS  2612
              QDQ   S   +N   +E A + +T      AN  +Q            N    V     
Sbjct  885   HQDQFSFSNKLKNELSSERAYEGKTIVCSSAANFHRQPAASIPKLPVLPNLDTPVPSHLE  944

Query  2613  DVKHSVIDMERQTLVSMP-------VILKTAIPEYQYIWQGGFEVQKSGKAFNLYDGIQA  2771
             D   + I +E+  +  +        ++LK  IPEY+YIWQGGFE+ + GK  +  DGIQA
Sbjct  945   DTDSTAIPVEKVRMKDLSGHASTNSLLLKIVIPEYEYIWQGGFELHRCGKLPDFCDGIQA  1004

Query  2772  HLSSCASPKVLDAVNKFPRKVILNEVPRLSSWPMQFKECGVSEDNVALFFFAKDIGSYEK  2951
             HLS+CASPKV++  +K P  + L EVPRLS+WP QF +CGV EDN+AL+FFA+DI SYE+
Sbjct  1005  HLSTCASPKVIEVASKLPHNISLKEVPRLSTWPSQFHDCGVKEDNIALYFFARDISSYER  1064

Query  2952  SYKVLLGDMVKHDLALQGNIGDIELLIFPSNQLPEKFQRWNLMFFLWGVFRGKRANSLQ-  3128
             +Y+ L+  M K+DLAL+GN+  +ELLIF SNQLPE  QRWN++FFLWGVFRGK+AN L  
Sbjct  1065  NYRGLVDHMTKNDLALKGNLDGVELLIFSSNQLPENSQRWNMLFFLWGVFRGKKANCLNA  1124

Query  3129  ----NFPGAEK-PLIQDIPTPATSLPENM---------FTPV--PKLNSARGSA-----A  3245
                 N    E  PL +++P    +  +++           P   PKL  A  SA      
Sbjct  1125  LKISNIRSTEAVPLDKNLPEITATNSDDVCLAKCANGEILPCYSPKLGKASSSADQMSDT  1184

Query  3246  TNTEMSAVKES-ESASLHKIVNGNCSI-QSSSQVSRDKCSRINAEQNDKLDSSSMQNSEP  3419
             T+TE    + S   A L+ + N  C + Q  ++ S    + +   Q     S+SM+ S  
Sbjct  1185  TSTECHKCESSVYQAPLNSLENSGCQVHQFETKASSVLATSMEFCQG-TTTSASMKES--  1241

Query  3420  KLGPDRRYFGVPLGEAVHSSVQTAERVSSPNTSRPMSVHWAAPLDGEKLSMLSDETPTMQ  3599
                  RR   +  GE    S+Q  E V   N ++   + +++    E++  L   T  M+
Sbjct  1242  -----RRLESIQ-GEQFEPSIQVKEIVGV-NDNKKAKLDFSST---EEMPPLIKTTDDMK  1291

Query  3600  EATSVGSTTKNLCGKDDVKIGRICLDN----------VSTEEATPLARHTSMEQTLNVIS  3749
             + ++       L  + +  + R    N          ++TE    L  H    + ++++ 
Sbjct  1292  KTSACEKIVDRLVCEGERAVLRTAEGNSDSEGLLKRDLNTEGINCLESHHRKRRQIDILE  1351

Query  3750  -----SFGVNPKKRSHSAETVLQsasssgtsqafssysNDDILVEEFCHKRVKLNSDRSY  3914
                  S G N + R    + +                    +L EE   K+ +     SY
Sbjct  1352  SAALVSIGANNRPRDEEVDCI--------------------VLDEENVRKKTRTGFGNSY  1391

Query  3915  GCNDQTSCS-------KDGFLSEMGGTASQLSRQKNERDEALSKTAILETPGNAEMFFFP  4073
                 + SCS        D ++S           QK   D+      I E    AE  FFP
Sbjct  1392  ----ENSCSTVGINSQSDPYISPRNDIGPTFLFQKKGSDKVCDVNVIPEDFEMAEKHFFP  1447

Query  4074  VDPHPVGNIGSNNSSMPWKVHPLEEDQLHDKAPNLELALGAKTKPLMSGIPSFLSGKVEK  4253
             V  H   +   ++  +P K    +EDQ HD  PNLELALGA+TK     +  FL   V+ 
Sbjct  1448  VGSHQQED---HHLPLPAK----DEDQYHDAVPNLELALGAETKLQKKSMIPFLVDLVDD  1500

Query  4254  K  4256
             K
Sbjct  1501  K  1501



>gb|KDO47995.1| hypothetical protein CISIN_1g000388mg [Citrus sinensis]
Length=1585

 Score =   519 bits (1337),  Expect = 6e-153, Method: Compositional matrix adjust.
 Identities = 344/845 (41%), Positives = 482/845 (57%), Gaps = 109/845 (13%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNEHVNSG  1118
             CDICG  GRE LLAICSRC+DGAEHTYCM++ML+K+PEGDWLCEECKF +E         
Sbjct  318   CDICGDAGREDLLAICSRCSDGAEHTYCMKEMLQKVPEGDWLCEECKFAEET--------  369

Query  1119  RVNEKEKTSPSRRTTIAKSDHPLKMEQKTSDCWGDKAVEERSYLKTSGKRCTDDSEVSSP  1298
                                      E++  D  G +  ++ +  ++SGKR  ++ + +  
Sbjct  370   -------------------------EKQKQDIEGKRTNKQSTSTQSSGKRHAENLDAAPA  404

Query  1299  TKRQRLELR--SPTAQIPNRVTSLSRESSFKNLERGKVKPL--NPFSSGSFAAKVPSSTG  1466
              KRQ +E     P    P++  +LSR+SSFK+L++GKV+P+     SS        S  G
Sbjct  405   AKRQAIETSPGYPKPLSPSKAAALSRDSSFKSLDKGKVRPVTFGNNSSNDVVETARSPGG  464

Query  1467  PQPQPPRGIFSKSNSFSSLIAKPKVKLVDEVFPAKQKLSRETAFIESKEVAVRSMGKSMS  1646
               PQ  +G   KS+SFS+L +K KVKLVDEV P KQK +R+ A ++ KE   R MGKSMS
Sbjct  465   LLPQTTKGTLLKSSSFSTLNSKAKVKLVDEVVPQKQKATRDQASLDVKEGPSRVMGKSMS  524

Query  1647  FKPTTASRSNCTESKVKMFSPKFSHDQDVKWLRHKKDRSSFDRKNSLRSDR------LAG  1808
             FK T++ RS+  ESK++  SP+ S   D+K L+  K+R++F+RK+  R DR      +A 
Sbjct  525   FKSTSSGRSSAGESKLRALSPRPSRLHDLKGLKQVKERNAFERKSLSRLDRSLTVSSMAT  584

Query  1809  GAISSPKSDNKPTPRGEPSSLSSLNTNRDYRALTSDNKPVTISNSTSGVAREVLKQAS--  1982
              A S+PK+D K TPRGE  S SS + NR+ + + S+ K  T++ S S + R+ L+ +   
Sbjct  585   PA-STPKADQKLTPRGEAVSFSSASNNREAKVVKSEGKGSTLTKSNSTLPRKGLEVSGTP  643

Query  1983  VDGVSSANRVSSSEENPSQAIPKEDSSSSSCVAERPSWSSNEVLPDGLSQSKESKAFGDK  2162
             V  +S++   SSS E     +  ++  SSS   +  +   NE++ DGL +S ES   G+K
Sbjct  644   VGALSTSAMCSSSVEQKPNLVSPKEEPSSSSSEKPSTIV-NELVQDGLPRSVESTNQGEK  702

Query  2163  TRESSASRSKQNSTASGKIVSCQKCKGNGHLAQVCTADGPESSALG-SPFKSSREATNGP  2339
                SS+ RS+   TA  K V CQKCK  GH  + C     + S +  S  ++ RE     
Sbjct  703   ---SSSCRSRPTLTAGSKGVLCQKCKEVGHDVESCPLGSTQVSGIDVSAGRNCREGMIKG  759

Query  2340  SDLKAAIEAARLRKPGICRKNRVADQSEDLSASNM--KSEIASQDQMLSSTVRRNVNGAE  2513
             + LKAAIEAA  + PG   +N+V DQ + L  +NM    E +SQDQ    +V   + GA+
Sbjct  760   NKLKAAIEAAMHKLPGTYGRNKVNDQLDGLGITNMDLNCERSSQDQF---SVSNKMKGAQ  816

Query  2514  EA--QKQETANNAKQLGIIAEASARTRNAGHVVFSDVKHSVIDMERQTLVSMPVILK-TA  2684
             E    KQ T N  K                                      P +LK +A
Sbjct  817   EVLINKQTTINQLK--------------------------------------PALLKISA  838

Query  2685  IPEYQYIWQGGFEVQKSGKAFNLYDGIQAHLSSCASPKVLDAVNKFPRKVILNEVPRLSS  2864
             +PE++YIWQGGFEV +  K  NL DGIQAHLSSCAS KVL+ V+KFP+++ L EVPR+S+
Sbjct  839   VPEHEYIWQGGFEVHRGEKLPNLCDGIQAHLSSCASSKVLEVVSKFPQRIRLKEVPRVST  898

Query  2865  WPMQFKECGVSEDNVALFFFAKDIGSYEKSYKVLLGDMVKHDLALQGNIGDIELLIFPSN  3044
             WP  F E G  E+N+AL+FFAKD  SY ++YK+L+  M+K+DLAL GN+  IELLIFPSN
Sbjct  899   WPTMFHESGAKEENIALYFFAKDFESYGRNYKILVDSMMKNDLALMGNLDGIELLIFPSN  958

Query  3045  QLPEKFQRWNLMFFLWGVFRGKRANSLQN-----FPGAEK-PLIQDIPTPATSLPENMFT  3206
             QLPE  QRWNL+FFLWGVFR ++ N   +     F G++  PL + I T   SL +N+  
Sbjct  959   QLPENCQRWNLLFFLWGVFRVRKVNCSNSTKHSCFAGSKMVPLDRVITTDNLSLSQNI--  1016

Query  3207  PVPKLNSARGSAATNTEMSAVKESESASLHKI-VNGNCSIQSSSQVSRDKCSRINAEQND  3383
              +PK ++ + SAA +T  + V  S       + +N NC  ++SS       S+ N+ Q+D
Sbjct  1017  -LPK-HADKDSAACDTSHNIVPGSYGPDGTCVTLNENCDNKASSVQLTSLGSQSNSIQHD  1074

Query  3384  -KLDS  3395
              + DS
Sbjct  1075  GRFDS  1079


 Score =   107 bits (268),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 96/265 (36%), Positives = 136/265 (51%), Gaps = 12/265 (5%)
 Frame = +3

Query  3675  DNVSTEEATPLARHTSMEQTLNVISSF-GVNPKKRSHSAE---TVLQsasssgtsqafss  3842
             D +  E      R+ + E +L+   +F G+N ++  H       ++++A++S    +   
Sbjct  1317  DQIDLERDLKEGRYMNAETSLDRNLNFKGLNHQQFHHGNSPHLDLMETAAASSCGTSQKM  1376

Query  3843  ysNDDILVEEFCHKRVKLNSDRSYGCN---DQTSCSKDGFLSEMGGTASQLSRQKNERDE  4013
               N+  L  E   K++K      Y C+   D  SCS DGF S         S Q+   +E
Sbjct  1377  PWNEAFLDGESSSKKLKTGFAGPYECSSSRDGDSCS-DGFSSRRDDLCPSSSNQEKISEE  1435

Query  4014  ALSKTAILETPGNAEMFFFPVDPHPVGNIGSNNSSMPWK-VHPLEEDQLHDKAPNLELAL  4190
              L +  IL+   + E +FF VD H   +     +SMPWK +   +ED+L D  PNL LAL
Sbjct  1436  LLDRKVILKDLESPERYFFHVDSHRENDCRLGANSMPWKELSSKDEDELLDTVPNLNLAL  1495

Query  4191  GAKTKPLMSGIPSFLSGKVEKKIIEENTSDNAATSANKEDVsaslslslsFPFPEKEHGT  4370
             GA TK    G+  F  G +EK   ++   D  A    +ED+SASLSLSLSFPFP+KE  +
Sbjct  1496  GADTKQPNKGMLPFFVGPLEKNNNQDRPPDKGADKGAEEDISASLSLSLSFPFPDKEQTS  1555

Query  4371  ---SSKPEQEDPRRRQANTSLLLFG  4436
                +SK EQ  P RR  NTSLLLFG
Sbjct  1556  VKPASKTEQLLPERRHVNTSLLLFG  1580



>ref|XP_008459203.1| PREDICTED: uncharacterized protein LOC103498397 isoform X1 [Cucumis 
melo]
Length=1603

 Score =   519 bits (1337),  Expect = 9e-153, Method: Compositional matrix adjust.
 Identities = 416/1201 (35%), Positives = 587/1201 (49%), Gaps = 170/1201 (14%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNEH--VN  1112
             CDICG  GRE LLAICSRCTDGAEHTYCM++ L+++PEGDWLCEECK  +E +N+   V 
Sbjct  426   CDICGDAGREDLLAICSRCTDGAEHTYCMRERLDEVPEGDWLCEECKSAEENENQKQDVE  485

Query  1113  SGRVNEKEKTSPSRRTTIAKSDHPLKMEQKTSDCWGDKAVEERSYLKTSGKRCTDDSEVS  1292
                    ++    RR  I  S        + SD  G K   + S ++  GK+  D+ +VS
Sbjct  486   GKSYISYKRKDEGRRPNIVSS------STQVSDTEGKKVSRDGSSIRKFGKKNLDNVDVS  539

Query  1293  SPTKRQRLELRSPTAQI--PNRVTSLSRESSFKNLERGKV-----KPLNPFSSGSF--AA  1445
                KRQ LE    + +   P R   LSR+SS K+L++GK      K L    S      A
Sbjct  540   VAAKRQVLETNKGSTKTSSPGRSIGLSRDSSSKSLDKGKSMLSQSKCLGDQCSNDVLEMA  599

Query  1446  KVPSSTGPQPQPPRGIFSKSNSFSSLIAKPKVKLVDEVFPAKQKLSRETAFIESKEVAVR  1625
             + PS  G +    +G   KSNSF++L +KPKVKLVDE  P K +  RE   +E KE + R
Sbjct  600   RSPS-VGSRLHTLKGTLLKSNSFNTLNSKPKVKLVDEFIPQKPRGPREHTSLEVKEGSSR  658

Query  1626  SMGKSMSFKPTTASRSNCTESKVKMFSPKFSHDQDVKWLRHKKDRSSFDRKNSLRSDR--  1799
             ++GKS SFK  +  R++ +E+KVKM   KF H QD K ++  KDR+  DRKN  + DR  
Sbjct  659   ALGKSQSFKTPSFGRASMSEAKVKMIPSKFPHVQDPKGIKQGKDRNVLDRKNPSKVDRSW  718

Query  1800  ----LAGGAISSPKSDNKPTPRGEPSSLSSLNTNRDYRALTSDNKPVTISNSTSGVAREV  1967
                     A+S+ K + K + RGE    ++   NRD + + SD     IS ST   +R  
Sbjct  719   ISSVTTSSAVSTSKVEQKLSSRGE----TNFGNNRDQKIIQSDG----IS-STHPKSRSS  769

Query  1968  LKQASVDGVSSANRV--------SSSEENPSQAIPKEDSSSSSCVAERPSWSSNEVLPDG  2123
             L    VD   S  R         SS ++  +  IPKE+  SSS   ERP ++ N      
Sbjct  770   LVHMGVDNPLSPARALLTNGTCSSSVDQKINHLIPKEEPLSSSLTVERPPYNDN------  823

Query  2124  LSQSKESKAFGDKTRESSASRSKQNSTASGKIVSCQKCKGNGHLAQVCTADGPESSALGS  2303
               +S+E     +K +ESSA+  K     S K   C KCKG  H  + C         +GS
Sbjct  824   -GRSREMTGLDEKNKESSANPLKPTVATSPKSGHCLKCKGTEHATESCI--------IGS  874

Query  2304  PFKS------SREATNGPSDLKAAIEAARLRKPGICRKNRVAD--QSEDLSASNMKSEIA  2459
             P+ S      SRE T   + LKAAI+AA LR+P IC+K + +D       S++   SEI 
Sbjct  875   PYVSDNNIISSREETCEENKLKAAIQAALLRRPEICKKRKFSDPSDEVSSSSTVSNSEIV  934

Query  2460  SQDQMLSSTVRRNVNGAEEAQKQET------ANNAKQLGIIAEASARTRNAGHVV---FS  2612
              QDQ   S   +N   +E A + +T      AN  +Q            N    V     
Sbjct  935   HQDQFSFSNKLKNELSSERAYEGKTIVCSSAANFHRQPAASIPKLPVLPNLDTPVPSHLE  994

Query  2613  DVKHSVIDMERQTLVSMP-------VILKTAIPEYQYIWQGGFEVQKSGKAFNLYDGIQA  2771
             D   + I +E+  +  +        ++LK  IPEY+YIWQGGFE+ + GK  +  DGIQA
Sbjct  995   DTDSTAIPVEKVRMKDLSGHASTNSLLLKIVIPEYEYIWQGGFELHRCGKLPDFCDGIQA  1054

Query  2772  HLSSCASPKVLDAVNKFPRKVILNEVPRLSSWPMQFKECGVSEDNVALFFFAKDIGSYEK  2951
             HLS+CASPKV++  +K P  + L EVPRLS+WP QF +CGV EDN+AL+FFA+DI SYE+
Sbjct  1055  HLSTCASPKVIEVASKLPHNISLKEVPRLSTWPSQFHDCGVKEDNIALYFFARDISSYER  1114

Query  2952  SYKVLLGDMVKHDLALQGNIGDIELLIFPSNQLPEKFQRWNLMFFLWGVFRGKRANSLQ-  3128
             +Y+ L+  M K+DLAL+GN+  +ELLIF SNQLPE  QRWN++FFLWGVFRGK+AN L  
Sbjct  1115  NYRGLVDHMTKNDLALKGNLDGVELLIFSSNQLPENSQRWNMLFFLWGVFRGKKANCLNA  1174

Query  3129  ----NFPGAEK-PLIQDIPTPATSLPENM---------FTPV--PKLNSARGSA-----A  3245
                 N    E  PL +++P    +  +++           P   PKL  A  SA      
Sbjct  1175  LKISNIRSTEAVPLDKNLPEITATNSDDVCLAKCANGEILPCYSPKLGKASSSADQMSDT  1234

Query  3246  TNTEMSAVKES-ESASLHKIVNGNCSI-QSSSQVSRDKCSRINAEQNDKLDSSSMQNSEP  3419
             T+TE    + S   A L+ + N  C + Q  ++ S    + +   Q     S+SM+ S  
Sbjct  1235  TSTECHKCESSVYQAPLNSLENSGCQVHQFETKASSVLATSMEFCQG-TTTSASMKES--  1291

Query  3420  KLGPDRRYFGVPLGEAVHSSVQTAERVSSPNTSRPMSVHWAAPLDGEKLSMLSDETPTMQ  3599
                  RR   +  GE    S+Q  E V   N ++   + +++    E++  L   T  M+
Sbjct  1292  -----RRLESIQ-GEQFEPSIQVKEIVGV-NDNKKAKLDFSST---EEMPPLIKTTDDMK  1341

Query  3600  EATSVGSTTKNLCGKDDVKIGRICLDN----------VSTEEATPLARHTSMEQTLNVIS  3749
             + ++       L  + +  + R    N          ++TE    L  H    + ++++ 
Sbjct  1342  KTSACEKIVDRLVCEGERAVLRTAEGNSDSEGLLKRDLNTEGINCLESHHRKRRQIDILE  1401

Query  3750  -----SFGVNPKKRSHSAETVLQsasssgtsqafssysNDDILVEEFCHKRVKLNSDRSY  3914
                  S G N + R    + +                    +L EE   K+ +     SY
Sbjct  1402  SAALVSIGANNRPRDEEVDCI--------------------VLDEENVRKKTRTGFGNSY  1441

Query  3915  GCNDQTSCS-------KDGFLSEMGGTASQLSRQKNERDEALSKTAILETPGNAEMFFFP  4073
                 + SCS        D ++S           QK   D+      I E    AE  FFP
Sbjct  1442  ----ENSCSTVGINSQSDPYISPRNDIGPTFLFQKKGSDKVCDVNVIPEDFEMAEKHFFP  1497

Query  4074  VDPHPVGNIGSNNSSMPWKVHPLEEDQLHDKAPNLELALGAKTKPLMSGIPSFLSGKVEK  4253
             V  H   +   ++  +P K    +EDQ HD  PNLELALGA+TK     +  FL   V+ 
Sbjct  1498  VGSHQQED---HHLPLPAK----DEDQYHDAVPNLELALGAETKLQKKSMIPFLVDLVDD  1550

Query  4254  K  4256
             K
Sbjct  1551  K  1551



>ref|XP_008376934.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103440032 
[Malus domestica]
Length=1459

 Score =   516 bits (1328),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 349/790 (44%), Positives = 459/790 (58%), Gaps = 81/790 (10%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNEHVNSG  1118
             CDICG  GRE +LA+CSRC+DGAEH YCM+KML ++P+G WLCEECKF +E  N+   S 
Sbjct  305   CDICGDAGREDMLAMCSRCSDGAEHIYCMRKMLRRVPKGPWLCEECKFAEETDNQKQGS-  363

Query  1119  RVNEKEKTSPSRRTTIAKSDHPLKMEQKTSDCWGDKAVEERSYLKTSGKRCTDDSEVSSP  1298
                                     ME K  D    KA+   +  + S KR  ++ EV+  
Sbjct  364   -----------------------DMEVKRMD----KAI---TSTQISNKRLAENVEVAPS  393

Query  1299  TKRQRLELR--SPTAQIPNRVTSLSRESSFKNLERGKVKPLNPFSSG----SFAAKVPSS  1460
              KRQ LE+R  SP A  P R+ +LSRESSFK+L++ +++   P S      S  A+ PS+
Sbjct  394   AKRQALEMRVGSPKASSPKRMGALSRESSFKSLDKDRLRSAYPISQSTNDLSETARSPSN  453

Query  1461  TGPQPQPPRGIFSKSNSFSSLIAKPKVKLVDEVFPAKQKLSRETAFIESKE-VAVRSMGK  1637
                     +G FSKSNSF++LI+KPKVKLVDEV P KQK S+E A ++ KE V  R MG+
Sbjct  454   G----LRAKGTFSKSNSFNTLISKPKVKLVDEVVPQKQKGSKEHASLDMKERVVSRMMGR  509

Query  1638  SMSFKPTTASRSNCTESKVKMFSPKFSHDQDVKWLRHKKDRSSFDRKNSLRSDR------  1799
             S+SFK  ++ RSN +ESKVKM S KFSH  D+K L+  K+ S+ +RKN  + DR      
Sbjct  510   SVSFKSASSGRSNVSESKVKMLSSKFSHVPDLKGLKQAKEWSTVERKNLSKLDRPKANLI  569

Query  1800  LAGGAISSPKSDNKPTPRGEPSSLSSLNTNRDYRALTSDNKPVTISNSTS---GVAREVL  1970
              A    S+PKSD     RGE S LSS+ +NR+ +    D K  T S S+    GV   V 
Sbjct  570   TASPIFSTPKSD--LASRGETSLLSSV-SNREPKVALPDGKLSTSSKSSLTRKGVDTRVA  626

Query  1971  KQASVDGVSSANRVSSSEENPSQAIPKEDS-SSSSCVAERPSWSSNEVLPDGLSQSKESK  2147
                      +    S+SE+  +Q   K++S SS S   E    + +  L D L QS E  
Sbjct  627   SGGGS--SMNGMSSSASEQRSNQVCSKDESLSSYSGTVETSHCNVDGTLEDVLPQSGEMA  684

Query  2148  AFGDKTRESSASRSKQNSTASGKIVSCQKCKGNGH---LAQVCTADGPESSALGSPFKSS  2318
                DK RESS  R +    AS K     K +GN      A +  A G ++ A     +SS
Sbjct  685   DQDDKARESSV-RCRPAVVASPKF----KERGNNAEFGRAGISQASGTDACAP----RSS  735

Query  2319  REATNGPSDLKAAIEAARLRKPGICRKNRVADQSEDLSASNMK--SEIASQDQMLSSTVR  2492
             RE     + LK AI AA LRKP I RK RV DQS++LS SNM    E+A+Q+Q       
Sbjct  736   REEMQRGNRLKNAIHAALLRKPEIYRKKRVLDQSDELSMSNMDLSYEVATQEQSPDGHAI  795

Query  2493  RNVNGAEEAQKQETANNAKQLG---IIAEASARTRNAGHVVFSDVKHSVIDMERQTLVSM  2663
                + ++ + K  T NN KQL    I +   ++  ++  VV S  K +V D+      +M
Sbjct  796   LGTSPSD-SYKNTTVNNLKQLAGQPIDSGFPSKVADSFSVVHSPGKPTVKDLHNHASGAM  854

Query  2664  PVILKT-AIPEYQYIWQGGFEVQKSGKAFNLYDGIQAHLSSCASPKVLDAVNKFPRKVIL  2840
              V++KT AIPEY+Y+WQG FEVQ+ G   +L  G+QAHLS+CASPKVL+ VNKFP K+ L
Sbjct  855   SVLVKTTAIPEYEYVWQGSFEVQRGGNFLDLCGGVQAHLSTCASPKVLEVVNKFPHKIPL  914

Query  2841  NEVPRLSSWPMQFKECGVSEDNVALFFFAKDIGSYEKSYKVLLGDMVKHDLALQGNIGDI  3020
             NEVPRLS WP QF + G  EDN+AL+FFAKD+ SYE+ YK LL  MVK+DLAL+GN   +
Sbjct  915   NEVPRLSVWPSQFHQSGAKEDNIALYFFAKDLDSYERHYKSLLDAMVKNDLALKGNFDGV  974

Query  3021  ELLIFPSNQLPEKFQRWNLMFFLWGVFRGKRANSLQNFPGAEKPLIQD----IPTPATSL  3188
             ELLIFPSNQLPEK QRWN++FFLWGVFR  R + L +F     P +++     PT   +L
Sbjct  975   ELLIFPSNQLPEKSQRWNMLFFLWGVFRTMRVHCL-DFTEKCVPSLRNSFNKAPTDGMTL  1033

Query  3189  PENMFTPVPK  3218
              E+    +PK
Sbjct  1034  SESENICIPK  1043



>ref|XP_007157085.1| hypothetical protein PHAVU_002G041700g [Phaseolus vulgaris]
 gb|ESW29079.1| hypothetical protein PHAVU_002G041700g [Phaseolus vulgaris]
Length=1486

 Score =   511 bits (1315),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 323/760 (43%), Positives = 428/760 (56%), Gaps = 102/760 (13%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNEHVNSG  1118
             CDICG  GRE LLAICSRC+DGAEHTYCM++MLEK+PEGDWLCEECK  +E +N      
Sbjct  259   CDICGDAGREDLLAICSRCSDGAEHTYCMREMLEKVPEGDWLCEECKDAEENEN------  312

Query  1119  RVNEKEKTSPSRRTTIAKSDHPLKMEQKTSDCWGDKAVEERSYLKTSGKRCTDDSEVSSP  1298
                                        K  D    K VE  S  + SGKR +D+ EV+  
Sbjct  313   ---------------------------KKPDVEDKKIVEVSSTSQVSGKRLSDNIEVAPA  345

Query  1299  TKRQRLE--LRSPTAQIPNRVTSLSRESSFKNLERGKVK---PL----NPFSSGSFAAKV  1451
              KRQ LE    SP    P R+  LSRESSFK L + KVK   P+    N   S +  A+ 
Sbjct  346   AKRQALESSTGSPKTSSPKRLVPLSRESSFKTLNKSKVKTGLPIPSRNNSGGSDTETARS  405

Query  1452  PSSTGPQPQPPRGIFSKSNSFSSLIAKPKVKLVDEVFPAKQKLSRETAFIESKEVAVRSM  1631
             P S GP+ Q P+G   KSNSF+++ +KP+VKLVDEV P K K   E A  ++ E+  R  
Sbjct  406   P-SIGPRGQTPKGTLLKSNSFNNVNSKPRVKLVDEVVPPKSKGGNEHAS-KNMEMPARMT  463

Query  1632  GKSMSFKPTTASRSNCTESKVKMFSPKFSHDQDVKWLRHKKDRSSFDRKNSLRSDR-LAG  1808
             GKS  FK  +  R+N TESKVKM SPK +  QD+K  RH K+  + DRK   R DR +  
Sbjct  464   GKSTLFKSQSLGRTNATESKVKMLSPKSAAMQDLKGSRHLKESGALDRKFPSRIDRPVVS  523

Query  1809  GAISSPKSDNKPTPRGEPSSLSSLNTNRDYRALTSDNKPVTISNSTSGVAREVLKQASVD  1988
               +SSPK D + TPR E S  S++N NR+ + +  D K   +S S S + R+ L+     
Sbjct  524   SVVSSPKGDQRLTPRAESSKPSAVNNNREVKVI-QDGKASALSRSMSSINRKSLE-----  577

Query  1989  GVSSANRVSSSEENPSQAIPKEDSSSSSCVAERPSWSSNEVLPDGLSQSKESKAFGDKTR  2168
                                          ++ER S   +E   D L +++E+    +K+R
Sbjct  578   --------------------------PQIISERTSTRVDEAQQDVLPRTRETANQIEKSR  611

Query  2169  ESSASRSKQNSTASGKIVSCQKCKGNGHLAQVCTA-----DGPESSALGSPFKSSREATN  2333
             +SS+ R +     S K   CQKCK  GH  + CTA      G E S   S   SS++  +
Sbjct  612   DSSSDRVRPVVPTSSKGPFCQKCKEFGHAIECCTAGTTQESGAEISVTTS--SSSKDEMH  669

Query  2334  GPSDLKAAIEAARLRKPGICRKNRVADQSEDLSAS--NMKSEIASQDQMLSSTVRRNVNG  2507
               + LKAAI+AA LR+P I +K  V++Q++++S S  ++  E+ S D +L S+  +N   
Sbjct  670   KGNILKAAIQAALLRRPEIYKKKEVSNQTDEVSTSGTDLNCEVTSNDPILVSSTPKNSMS  729

Query  2508  AEEAQKQE--------------TANNAKQL-GIIAEASARTRNAGHVVFSDVKHSVIDME  2642
              EE  +Q+              +AN+ KQL     +  ++    G +  +  K  V DM 
Sbjct  730   VEETPEQQEILENSTSDSSKCSSANDFKQLKSCPTDFRSQPGKLGSICLAAGKPVVRDMS  789

Query  2643  RQTLVSMPVILKT-AIPEYQYIWQGGFEVQKSGKAFNLYDGIQAHLSSCASPKVLDAVNK  2819
              + +    +  KT A PEY+YIWQG FEV ++GK  +LY G+QAHLSSCASPKVL AVNK
Sbjct  790   DKAMTLSILPSKTLAFPEYEYIWQGVFEVHRNGKPPDLYTGLQAHLSSCASPKVLGAVNK  849

Query  2820  FPRKVILNEVPRLSSWPMQFKECGVSEDNVALFFFAKDIGSYEKSYKVLLGDMVKHDLAL  2999
             F  KV  NE  R S WP QF   GVSEDN+AL+FFA D+ SYEK YK LL  M+++DLAL
Sbjct  850   FLPKVSFNEASRTSLWPSQFHHGGVSEDNIALYFFASDVESYEKHYKGLLDRMIRNDLAL  909

Query  3000  QGNIGDIELLIFPSNQLPEKFQRWNLMFFLWGVFRGKRAN  3119
             +GN  D+ELLIFPSNQLPE  QRWN++FFLWG+FRG++ N
Sbjct  910   KGNFEDVELLIFPSNQLPENSQRWNMLFFLWGIFRGRKMN  949


 Score = 66.6 bits (161),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 61/149 (41%), Positives = 77/149 (52%), Gaps = 12/149 (8%)
 Frame = +3

Query  4011  EALSKTAILETPGNAEMFFFPVDPHPVGNIGSNNSSMPWKVHPLEEDQ-LHDKAPNLELA  4187
             EA  +  I E  G  E  FFPV  H + N  S  +S+  K    E D+   D  PNLELA
Sbjct  1343  EACDEKIIREDLGTMERTFFPVGTHNISNSVSVLNSLSTKGVVGEYDKGFQDGIPNLELA  1402

Query  4188  LGAKTKPLMS-----GIPSFLSGKVEKKIIEENTSDNAATSANKEDVsaslslslsFPFP  4352
             LG KTK L +     G+  FL G VE+   + N  ++       + V+ASLSLSLSFP P
Sbjct  1403  LGGKTKALPTPSAPKGMLPFLVGPVER---QNNRPESLGEVQEDDGVAASLSLSLSFPSP  1459

Query  4353  EKEHGTSSKPEQEDPRRRQANTSLLLFGR  4439
              KEH    KP +  P  ++ N S  LFGR
Sbjct  1460  NKEH---IKPAELLPDGQRMNNSFFLFGR  1485



>gb|KGN61722.1| hypothetical protein Csa_2G233010 [Cucumis sativus]
Length=1546

 Score =   510 bits (1313),  Expect = 8e-150, Method: Compositional matrix adjust.
 Identities = 408/1195 (34%), Positives = 593/1195 (50%), Gaps = 165/1195 (14%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNEHVNSG  1118
             CDICG  GRE LLAICSRCTDGAEHTYCM++ L+++PEGDWLCEECK  +E +N+  +  
Sbjct  376   CDICGDAGREDLLAICSRCTDGAEHTYCMRERLDEVPEGDWLCEECKSAEENENQKQD--  433

Query  1119  RVNEKEKTSPSRRTTIAKSDHPLKMEQKTSDCWGDKAVEERSYLKTSGKRCTDDSEVSSP  1298
              +  K   S  R+    +  + +    + SD  G +   + S ++  GK+  D+ +VS  
Sbjct  434   -IEGKSYISYKRKDE-GRKPNIVSPSTQVSDTEGKRVSRDGSSMRNFGKKNVDNVDVSVA  491

Query  1299  TKRQRLELR--SPTAQIPNRVTSLSRESSFKNLERGKVKPLNPFSSG-------SFAAKV  1451
              KRQ LE    S  A  P R   LSR+SS K+L++GK         G       S  A+ 
Sbjct  492   AKRQVLETNKGSTKASSPGRSIGLSRDSSSKSLDKGKSMLSQSKCLGDQCNNDVSEMARS  551

Query  1452  PSSTGPQPQPPRGIFSKSNSFSSLIAKPKVKLVDEVFPAKQKLSRETAFIESKEVAVRSM  1631
             PS  G +    +G   KSNSF++L +KPKV+LVD+  P K +  RE   +E KE   R++
Sbjct  552   PS-VGSRLHSLKGTLLKSNSFNTLNSKPKVRLVDDFIPQKPRGPREHTSLEVKEGPSRAL  610

Query  1632  GKSMSFKPTTASRSNCTESKVKMFSPKFSHDQDVKWLRHKKDRSSFDRKNSLRSDR----  1799
             GKS SFK  +  R++ +E+KVKM   KF H QD K ++  KDR+  DRKN  + DR    
Sbjct  611   GKSQSFKTPSFGRASMSEAKVKMIPSKFPHVQDPKGIKQGKDRNVLDRKNPSKVDRSWIS  670

Query  1800  --LAGGAISSPKSDNKPTPRGEPSSLSSLNTNRDYRALTSDNKPVTISNSTSGVAREVLK  1973
                   A+S+ K ++K + RGE    ++   NRD + + SD     IS ST   +R  L 
Sbjct  671   SVTTSSAVSTSKIESKLSSRGE----TNFGNNRDQKIIQSDG----IS-STHPKSRSSLV  721

Query  1974  QASVDGVSSANRV--------SSSEENPSQAIPKEDSSSSSCVAERPSWSSNEVLPDGLS  2129
                VD   S  R         SS ++  +  IPKE+  SSS   ER S++ N        
Sbjct  722   HKGVDSPLSPARALSTNGTCSSSVDQKINHVIPKEEPLSSSLTVERVSYNDN-------G  774

Query  2130  QSKESKAFGDKTRESSASRSKQNSTASGKIVSCQKCKGNGHLAQVCTADGPESSALGSPF  2309
             +S+E     +K RESSA+ SK     S K   C KCKG  H  + C +  P  S   +  
Sbjct  775   RSREMTGLDEKNRESSANPSKPTVATSPKSGHCLKCKGTEHATESCISGSPYVS--DNNI  832

Query  2310  KSSREATNGPSDLKAAIEAARLRKPGICRKNRVADQSE-------------------DLS  2432
              SSRE T   + LKAAI+AA L++P IC+K + +D S+                     S
Sbjct  833   ISSREDTCEENKLKAAIQAALLKRPEICKKRKFSDPSDEVSSSSTVSNSDIVHQDQFSFS  892

Query  2433  ASN-MKSEIASQDQMLSSTVRRNVNGAEEAQKQETANNAKQLGIIAEASARTRNAGHVVF  2609
              SN +K+E++S+      T+   VN +     ++  ++  +L ++    A   +      
Sbjct  893   FSNKLKTELSSERAHEGKTI---VNSSATNFHRQPVSSIPKLPVLPNLDAPVPSQSE---  946

Query  2610  SDVKHSVIDMERQTLVSMPVILKTAIPEYQYIWQGGFEVQKSGKAFNLYDGIQAHLSSCA  2789
              D   + I +E+  + S+  +LK  IPEY+YIWQGGFE+ + GK  +  DGIQAHLS+CA
Sbjct  947   -DTDSTSIPVEKVWMSSL--LLKIVIPEYEYIWQGGFELHRCGKLPDFCDGIQAHLSTCA  1003

Query  2790  SPKVLDAVNKFPRKVILNEVPRLSSWPMQFKECGVSEDNVALFFFAKDIGSYEKSYKVLL  2969
             SP+V++  +K P+ + L EVPRLS+WP QF +CGV EDN+AL+FFA+DI SYE++Y+ LL
Sbjct  1004  SPRVIEVASKLPQNISLKEVPRLSTWPSQFHDCGVKEDNIALYFFARDIHSYERNYRGLL  1063

Query  2970  GDMVKHDLALQGNIGDIELLIFPSNQLPEKFQRWNLMFFLWGVFRGKRANSLQ-----NF  3134
               M K+DLAL+GN+  +ELLIF SNQLPEK QRWN++FFLWGVFRGK+ N L      N 
Sbjct  1064  DHMTKNDLALKGNLDGVELLIFSSNQLPEKSQRWNMLFFLWGVFRGKKTNCLNALKISNI  1123

Query  3135  PGAEK-PLIQDIPTPATSLPENM---------FTPV--PKLNSARGSA--ATNTEMSAVK  3272
                E  PL +++P    +  +++           P   PKL  A  SA   ++T  +   
Sbjct  1124  RSTEAVPLDKNLPDITATKSDDVCLAKCANGEIFPCYSPKLGKASSSADQMSDTTSTDCH  1183

Query  3273  ESES----ASLHKIVNGNCSI-QSSSQVSRDKCSRINAEQNDKLDSSSMQNSEPKLGPDR  3437
             + ES    A L+ + N  C + Q  ++ S    S +   Q     S+SM+ S       R
Sbjct  1184  KCESSVYQAPLNSLENSGCQVHQFETKASSVLASSMEFCQGTTT-SASMKES-------R  1235

Query  3438  RYFGVPLGEAVHSSVQTAERVSSPNTSRPMSVHWAAPLDGEKLSMLSDETPTMQEATSVG  3617
             R   +  GE    S+Q  E V   N ++   V +++    E++  L   T  M++ ++  
Sbjct  1236  RLESIH-GEHFEPSIQVKEIVGV-NDNKKAKVDFSST---EEMPPLIKTTDDMKKTSTGE  1290

Query  3618  STTKNLCGKDDVKIGRICLDN----------VSTEEATPLARHTSMEQTLNVISS-----  3752
                  L  + +  + R    N          ++TE    L  H    + ++++ S     
Sbjct  1291  KIVDRLVCEGEKAVLRTAEGNSDSEGLLKRDLNTEGINCLESHHRKRRQVDILESAALVS  1350

Query  3753  FGVNPKKRSHSAETVLQsasssgtsqafssysNDDILVEEFCHKRVKLNSDRSYGCNDQT  3932
                N + R    + +                    +L EE   K+ +     SY    + 
Sbjct  1351  ISANNRPRDEEVDCI--------------------VLDEENVRKKTRTGFGNSY----EN  1386

Query  3933  SCSKDG-------FLSEMGGTASQLSRQKNERDEALSKTAILETPGNAEMFFFPVDPHPV  4091
             SCS  G       ++S           QK   D+      I E    AE  FFPV  H  
Sbjct  1387  SCSTGGINSQSDPYISPRTDIGPTFLFQKKGGDKVCDVNVIPEDFEMAEKHFFPVGSHQQ  1446

Query  4092  GNIGSNNSSMPWKVHPLEEDQLHDKAPNLELALGAKTKPLMSGIPSFLSGKVEKK  4256
              +   +  ++P K    +EDQ HD  PNLELALGA+TK     +  FL   V+ K
Sbjct  1447  ED---HYLALPAK----DEDQYHDAVPNLELALGAETKLQKKSMIPFLMDLVDDK  1494



>ref|XP_006437427.1| hypothetical protein CICLE_v10033462mg, partial [Citrus clementina]
 gb|ESR50667.1| hypothetical protein CICLE_v10033462mg, partial [Citrus clementina]
Length=977

 Score =   494 bits (1273),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 331/839 (39%), Positives = 466/839 (56%), Gaps = 131/839 (16%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNEHVNSG  1118
             CDICG  GRE LLAICSRC+DGAEHTYCM++ML+K+PEGDWLCEECKF +E         
Sbjct  246   CDICGDAGREDLLAICSRCSDGAEHTYCMKEMLQKVPEGDWLCEECKFAEE---------  296

Query  1119  RVNEKEKTSPSRRTTIAKSDHPLKMEQKTSDCWGDKAVEERSYLKTSGKRCTDDSEVSSP  1298
                EK+K                    + SD  G +  ++ +  ++SGKR  ++ + +  
Sbjct  297   --TEKQK--------------------QGSDIEGKRTNKQSTSTQSSGKRHAENLDAAPA  334

Query  1299  TKRQRLELR--SPTAQIPNRVTSLSRESSFKNLERGKVKPLNPFSSGSFAAKVPSSTGPQ  1472
              KRQ +E     P    P++  +LSR+SSFK+L++GKV+P+      +F     +     
Sbjct  335   AKRQAIETSPGYPKPLSPSKAAALSRDSSFKSLDKGKVRPV------TFGNNSSNDVVET  388

Query  1473  PQPPRGIFSKSNSFSSLIAKPKVKLVDEVFPAKQKLSRETAFIESKEVAVRSMGKSMSFK  1652
              + P G   KS+SFS+L +K KVKLVDEV P KQK +R+ A ++ KE   R MGKSMSFK
Sbjct  389   ARSPGGTLLKSSSFSTLNSKAKVKLVDEVVPQKQKATRDQASLDVKEGPSRVMGKSMSFK  448

Query  1653  PTTASRSNCTESKVKMFSPKFSHDQDVKWLRHKKDRSSFDRKNSLRSDR------LAGGA  1814
              T++ RS+  ESK++  SP+ S   D+K L+  K+R++F+RK+  R DR      +A  A
Sbjct  449   STSSGRSSAGESKLRALSPRPSRLHDLKGLKQVKERNAFERKSLSRLDRSLTVSSMATPA  508

Query  1815  ISSPKSDNKPTPRGEPSSLSSLNTNRDYRALTSDNKPVTISNSTSGVAREVLKQASVDGV  1994
              S+PK+D K TPRGE  S SS + NR+ + + S+ K  T++ S S + R+ L+ +   G+
Sbjct  509   -STPKADQKLTPRGEAVSFSSASNNREAKVVKSEGKGSTLTKSNSTLPRKGLEVSGTPGM  567

Query  1995  SSANRVSSSEENPSQAIPKEDSSSSSCVAERPSWSSNEVLPDGLSQSKESKAFGDKTRES  2174
             +  N+V     N S  +                   NE++ DGL +S ES   G+K   S
Sbjct  568   ALLNKVK--HINASTIV-------------------NELVQDGLPRSVESTNQGEK---S  603

Query  2175  SASRSKQNSTASGKIVSCQKCKGNGHLAQVCTADGPESSALG-SPFKSSREATNGPSDLK  2351
             S+ RS+   TA  K V CQKCK  GH  + C     + S +  S  ++ RE     + LK
Sbjct  604   SSCRSRPTLTAGSKGVLCQKCKEVGHDVESCPLGSTQVSGIDVSAGRNCREGMIKGNKLK  663

Query  2352  AAIEAARLRKPGICRKNRVADQSEDLSASNM--KSEIASQDQMLSSTVRRNVNGAEEA--  2519
             AAIEAA  + PG   +N+V DQ + L  +NM    E +SQDQ    +V   + GA+E   
Sbjct  664   AAIEAAMHKLPGTYGRNKVNDQLDGLGITNMDLNCERSSQDQF---SVSNKMKGAQEVPI  720

Query  2520  QKQETANNAKQLGIIAEASARTRNAGHVVFSDVKHSVIDMERQTLVSMPVILK-TAIPEY  2696
              KQ T N  K                                      P +LK +A+PE+
Sbjct  721   NKQTTINQLK--------------------------------------PALLKISAVPEH  742

Query  2697  QYIWQGGF---EVQKSGKAFNLYDGIQAHLSSCASPKVLDAVNKFPRKVILNEVPRLSSW  2867
             + IW   +    V +  K  NL DGIQAHLSSCAS KVL+ V+KFP+++ L EVPR+S+W
Sbjct  743   ENIWHFSWWLCPVHRGEKLPNLCDGIQAHLSSCASSKVLEVVSKFPQRICLKEVPRVSTW  802

Query  2868  PMQFKECGVSEDNVALFFFAKDIGSYEKSYKVLLGDMVKHDLALQGNIGDIELLIFPSNQ  3047
             P  F E G  E+N+AL+FFAKD  SY ++YK+L+  M+K+DLAL GN+  IELLIFPSNQ
Sbjct  803   PTMFHESGAKEENIALYFFAKDFESYGRNYKILVDSMMKNDLALMGNLDGIELLIFPSNQ  862

Query  3048  LPEKFQRWNLMFFLWGVFRGKRANSLQN-----FPGAEK-PLIQDIPTPATSLPENMFTP  3209
             LPE  QRWNL+FFLWGVFR ++ N   +     F G++  PL   I T   SL +N+   
Sbjct  863   LPENCQRWNLLFFLWGVFRVRKVNCSNSTKHSCFAGSKMVPLDSLITTDNLSLSQNI---  919

Query  3210  VPKLNSARGSAATNTEMSAVKESESASLHKI-VNGNCSIQSSSQVSRDKCSRINAEQND  3383
             +PK ++ + SAA +T  + V  S       + +N NC  ++SS       S+ N+ Q+D
Sbjct  920   LPK-HADKDSAACDTSHNIVPGSYGPDGTCVTLNENCDNKASSVQQTSLGSQSNSIQHD  977



>ref|XP_008382230.1| PREDICTED: uncharacterized protein LOC103445016 isoform X3 [Malus 
domestica]
Length=1416

 Score =   503 bits (1294),  Expect = 4e-148, Method: Compositional matrix adjust.
 Identities = 361/914 (39%), Positives = 494/914 (54%), Gaps = 90/914 (10%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNEHVNSG  1118
             CDICG  GRE +LA+CSRC DGAEH YCM+KML ++P+G WLCEECKF +E  N+   S 
Sbjct  258   CDICGDAGREDMLAMCSRCIDGAEHIYCMRKMLRRVPKGPWLCEECKFTEETDNQKQGS-  316

Query  1119  RVNEKEKTSPSRRTTIAKSDHPLKMEQKTSDCWGDKAVEERSYLKTSGKRCTDDSEVSSP  1298
                                     +E K      +KA+    +   S KR  ++ EV+  
Sbjct  317   -----------------------DIEVKRM----EKAIMSTQF---SNKRLAENIEVAPS  346

Query  1299  TKRQRLELR--SPTAQIPNRVTSLSRESSFKNLERGKVKPLNPFSSGSFAAKVPSSTGPQ  1472
              KRQ LE+R  SP    P R+ +LSRESSFK++++ +++P    S G+      + +   
Sbjct  347   AKRQGLEMRVGSPKPSSPKRMGALSRESSFKSIDKDRLRPAYQTSQGTNNISETARSPSN  406

Query  1473  PQPPRGIFSKSNSFSSLIAKPKVKLVDEVFPAKQKLSRETAFIESKEVAV-RSMGKSMSF  1649
                 +G FSKSNSF++L +KPKVK VDEV P KQK  +E A ++ KE  V R MGKS+SF
Sbjct  407   GIGAKGTFSKSNSFNTLNSKPKVKHVDEVVPQKQKGFKEHASLDMKERVVPRIMGKSVSF  466

Query  1650  KPTTASRSNCTESKVKMFSPKFSHDQDVKWLRHKKDRSSFDRKNSLRSDR------LAGG  1811
             K  ++ RSN +ESKVKM S KFSH  D+K L+  K+RS  +RK   + DR       A  
Sbjct  467   KSASSGRSNVSESKVKMLSSKFSHVPDLKALKQAKERSVVERKILSKLDRPMANFTTANS  526

Query  1812  AISSPKSDNKPTPRGEPSSLSSLNTNRDYRALTSDNKPVTISNSTSGVAREVLK---QAS  1982
              +S PKSD     RGE S LSS+ +NR+ +    D K   +S S S V R+       + 
Sbjct  527   TVSIPKSD--LASRGETSLLSSV-SNREPKVALPDGK---LSTSKSSVTRKGFDTQITSG  580

Query  1983  VDGVSSANRVSSSEENPSQAIPKEDSSSSSCVAERPSWSSNEVLPDGLSQSKESKAFGDK  2162
                  +    S+SE+       K++S SSS   E+   + +    D L QS E     DK
Sbjct  581   GGSSMNGMSSSASEQKLYHVSFKDESLSSSVTVEKSHCNVDGTSEDVLPQSGEMIDQDDK  640

Query  2163  TRESSASRSKQNSTASGKIVSCQKCKGNGHLAQVCTADGPESSALG-SPFKSSREATNGP  2339
              RESS          +  +V+  KCK  G  A+       ++S  G S  + SRE     
Sbjct  641   ARESSV-------RCAPAVVASPKCKELGINAEFGRPVISQASGTGASAPRGSREEMQRG  693

Query  2340  SDLKAAIEAARLRKPGICRKNRVADQSEDLSASNMKS--EIASQDQMLSSTVRRNVNGAE  2513
             + LK AI AA +RK  I RK RV DQS++ S  NM S  E+A+Q+Q          + + 
Sbjct  694   NRLKDAIHAALVRKSEIYRKKRVFDQSDESSTPNMDSSYEVAAQEQSPDGHAILGTSTS-  752

Query  2514  EAQKQETANNAKQLGII-AEASARTRNAGHVVFSDVKHSVIDMERQTLVSMPVILK-TAI  2687
             ++ K  T NN KQL +   ++   ++ A  V     K +V D+      +M V++K TAI
Sbjct  753   DSYKNATVNNLKQLTVQPIDSGFPSKVAYSVSVVPGKPTVKDLHNHASGAMSVLVKTTAI  812

Query  2688  PEYQYIWQGGFEVQKSGKAFNLYDGIQAHLSSCASPKVLDAVNKFPRKVILNEVPRLSSW  2867
             PEY+YIWQG FEVQ+ G   +L  G+QAHLS+CASPKV + VNKFP KV LNEVPRLS W
Sbjct  813   PEYEYIWQGSFEVQRGGNFMDLCGGVQAHLSTCASPKVPEVVNKFPHKVSLNEVPRLSVW  872

Query  2868  PMQFKECGVSEDNVALFFFAKDIGSYEKSYKVLLGDMVKHDLALQGNIGDIELLIFPSNQ  3047
             P QF + G  EDN+AL+FFAKD+ SYE+ Y  LL  MVK+DLAL+GN   +ELLIFPSNQ
Sbjct  873   PSQFHQSGAKEDNIALYFFAKDLDSYERHYNSLLDAMVKNDLALKGNFDGVELLIFPSNQ  932

Query  3048  LPEKFQRWNLMFFLWGVFRGKRANSLQNFPGAEKPLI----QDIPTPATSLPENMFTPVP  3215
             LPEK QRWN++FFLWGVFR  R + L +F     P +    Q  PT   +L EN+  P  
Sbjct  933   LPEKSQRWNMLFFLWGVFRTMRVHCL-DFTKTCVPSLSNSFQKAPTDGMTLSENICIPKH  991

Query  3216  KLNSARGSAATNTEMSAVKESESASLHK--IVNGNCSIQSSSQVSRDKCSRIN-AEQNDK  3386
                S+    + +     V  + +ASLH    V+ +C  + +        S++N A Q+ +
Sbjct  992   IDESSPSDRSCD-----VPSASNASLHMGPTVSKDCENKDTYPEEVRLGSKVNSAVQDCR  1046

Query  3387  LDSSSMQNSEPKLGPDRRYFGVP-----------LGEAVHSSVQTAERVSSPNTSRPMSV  3533
             +DS++  N+    G +   +G P           +G+ + SS+ T    SS N      V
Sbjct  1047  VDSNTTNNAGLSEGVE---YGTPCLQESCLRESRVGKEIKSSIPTTGSNSS-NKGEKRQV  1102

Query  3534  HWAAPLDGEKLSML  3575
             HW   +D E    L
Sbjct  1103  HWVTSVDREDTDSL  1116


 Score = 90.1 bits (222),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 67/147 (46%), Positives = 84/147 (57%), Gaps = 4/147 (3%)
 Frame = +3

Query  4011  EALSKTAILETPGNAEMFFFPVDPHPVGNIGSNNSSMPWK-VHPLEEDQLHDKAPNLELA  4187
             EA  +  I E  GN E +FFP+D     + G   +S+PWK       D+  +  P+LELA
Sbjct  1266  EACEEKVIPEDLGNTERYFFPLDSRHFQHFGPVGNSVPWKDFSSGYVDKTREGFPSLELA  1325

Query  4188  LGAKTKPLMSGIPSFLSGKVEKKIIEENTSDNAATSANKED-VsaslslslsFPFPEKEH  4364
             LG +TKP   G+  F  G  ++K   ++    AA    K+D VSASLSLSLSFPFP+KE 
Sbjct  1326  LGGETKPQNKGMLPFFVGLADEKGNNQDKPLEAAVVDEKDDDVSASLSLSLSFPFPDKEQ  1385

Query  4365  GTS--SKPEQEDPRRRQANTSLLLFGR  4439
                  SKPEQ  P R   NTSLLLFGR
Sbjct  1386  PGKPVSKPEQLVPERHHVNTSLLLFGR  1412



>ref|XP_008382216.1| PREDICTED: uncharacterized protein LOC103445016 isoform X2 [Malus 
domestica]
 ref|XP_008382220.1| PREDICTED: uncharacterized protein LOC103445016 isoform X2 [Malus 
domestica]
 ref|XP_008382225.1| PREDICTED: uncharacterized protein LOC103445016 isoform X2 [Malus 
domestica]
Length=1454

 Score =   502 bits (1293),  Expect = 8e-148, Method: Compositional matrix adjust.
 Identities = 361/914 (39%), Positives = 494/914 (54%), Gaps = 90/914 (10%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNEHVNSG  1118
             CDICG  GRE +LA+CSRC DGAEH YCM+KML ++P+G WLCEECKF +E  N+   S 
Sbjct  296   CDICGDAGREDMLAMCSRCIDGAEHIYCMRKMLRRVPKGPWLCEECKFTEETDNQKQGS-  354

Query  1119  RVNEKEKTSPSRRTTIAKSDHPLKMEQKTSDCWGDKAVEERSYLKTSGKRCTDDSEVSSP  1298
                                     +E K      +KA+    +   S KR  ++ EV+  
Sbjct  355   -----------------------DIEVKRM----EKAIMSTQF---SNKRLAENIEVAPS  384

Query  1299  TKRQRLELR--SPTAQIPNRVTSLSRESSFKNLERGKVKPLNPFSSGSFAAKVPSSTGPQ  1472
              KRQ LE+R  SP    P R+ +LSRESSFK++++ +++P    S G+      + +   
Sbjct  385   AKRQGLEMRVGSPKPSSPKRMGALSRESSFKSIDKDRLRPAYQTSQGTNNISETARSPSN  444

Query  1473  PQPPRGIFSKSNSFSSLIAKPKVKLVDEVFPAKQKLSRETAFIESKEVAV-RSMGKSMSF  1649
                 +G FSKSNSF++L +KPKVK VDEV P KQK  +E A ++ KE  V R MGKS+SF
Sbjct  445   GIGAKGTFSKSNSFNTLNSKPKVKHVDEVVPQKQKGFKEHASLDMKERVVPRIMGKSVSF  504

Query  1650  KPTTASRSNCTESKVKMFSPKFSHDQDVKWLRHKKDRSSFDRKNSLRSDR------LAGG  1811
             K  ++ RSN +ESKVKM S KFSH  D+K L+  K+RS  +RK   + DR       A  
Sbjct  505   KSASSGRSNVSESKVKMLSSKFSHVPDLKALKQAKERSVVERKILSKLDRPMANFTTANS  564

Query  1812  AISSPKSDNKPTPRGEPSSLSSLNTNRDYRALTSDNKPVTISNSTSGVAREVLK---QAS  1982
              +S PKSD     RGE S LSS+ +NR+ +    D K   +S S S V R+       + 
Sbjct  565   TVSIPKSD--LASRGETSLLSSV-SNREPKVALPDGK---LSTSKSSVTRKGFDTQITSG  618

Query  1983  VDGVSSANRVSSSEENPSQAIPKEDSSSSSCVAERPSWSSNEVLPDGLSQSKESKAFGDK  2162
                  +    S+SE+       K++S SSS   E+   + +    D L QS E     DK
Sbjct  619   GGSSMNGMSSSASEQKLYHVSFKDESLSSSVTVEKSHCNVDGTSEDVLPQSGEMIDQDDK  678

Query  2163  TRESSASRSKQNSTASGKIVSCQKCKGNGHLAQVCTADGPESSALG-SPFKSSREATNGP  2339
              RESS          +  +V+  KCK  G  A+       ++S  G S  + SRE     
Sbjct  679   ARESSV-------RCAPAVVASPKCKELGINAEFGRPVISQASGTGASAPRGSREEMQRG  731

Query  2340  SDLKAAIEAARLRKPGICRKNRVADQSEDLSASNMKS--EIASQDQMLSSTVRRNVNGAE  2513
             + LK AI AA +RK  I RK RV DQS++ S  NM S  E+A+Q+Q          + + 
Sbjct  732   NRLKDAIHAALVRKSEIYRKKRVFDQSDESSTPNMDSSYEVAAQEQSPDGHAILGTSTS-  790

Query  2514  EAQKQETANNAKQLGII-AEASARTRNAGHVVFSDVKHSVIDMERQTLVSMPVILK-TAI  2687
             ++ K  T NN KQL +   ++   ++ A  V     K +V D+      +M V++K TAI
Sbjct  791   DSYKNATVNNLKQLTVQPIDSGFPSKVAYSVSVVPGKPTVKDLHNHASGAMSVLVKTTAI  850

Query  2688  PEYQYIWQGGFEVQKSGKAFNLYDGIQAHLSSCASPKVLDAVNKFPRKVILNEVPRLSSW  2867
             PEY+YIWQG FEVQ+ G   +L  G+QAHLS+CASPKV + VNKFP KV LNEVPRLS W
Sbjct  851   PEYEYIWQGSFEVQRGGNFMDLCGGVQAHLSTCASPKVPEVVNKFPHKVSLNEVPRLSVW  910

Query  2868  PMQFKECGVSEDNVALFFFAKDIGSYEKSYKVLLGDMVKHDLALQGNIGDIELLIFPSNQ  3047
             P QF + G  EDN+AL+FFAKD+ SYE+ Y  LL  MVK+DLAL+GN   +ELLIFPSNQ
Sbjct  911   PSQFHQSGAKEDNIALYFFAKDLDSYERHYNSLLDAMVKNDLALKGNFDGVELLIFPSNQ  970

Query  3048  LPEKFQRWNLMFFLWGVFRGKRANSLQNFPGAEKPLI----QDIPTPATSLPENMFTPVP  3215
             LPEK QRWN++FFLWGVFR  R + L +F     P +    Q  PT   +L EN+  P  
Sbjct  971   LPEKSQRWNMLFFLWGVFRTMRVHCL-DFTKTCVPSLSNSFQKAPTDGMTLSENICIPKH  1029

Query  3216  KLNSARGSAATNTEMSAVKESESASLHK--IVNGNCSIQSSSQVSRDKCSRIN-AEQNDK  3386
                S+    + +     V  + +ASLH    V+ +C  + +        S++N A Q+ +
Sbjct  1030  IDESSPSDRSCD-----VPSASNASLHMGPTVSKDCENKDTYPEEVRLGSKVNSAVQDCR  1084

Query  3387  LDSSSMQNSEPKLGPDRRYFGVP-----------LGEAVHSSVQTAERVSSPNTSRPMSV  3533
             +DS++  N+    G +   +G P           +G+ + SS+ T    SS N      V
Sbjct  1085  VDSNTTNNAGLSEGVE---YGTPCLQESCLRESRVGKEIKSSIPTTGSNSS-NKGEKRQV  1140

Query  3534  HWAAPLDGEKLSML  3575
             HW   +D E    L
Sbjct  1141  HWVTSVDREDTDSL  1154


 Score = 90.5 bits (223),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 67/147 (46%), Positives = 84/147 (57%), Gaps = 4/147 (3%)
 Frame = +3

Query  4011  EALSKTAILETPGNAEMFFFPVDPHPVGNIGSNNSSMPWK-VHPLEEDQLHDKAPNLELA  4187
             EA  +  I E  GN E +FFP+D     + G   +S+PWK       D+  +  P+LELA
Sbjct  1304  EACEEKVIPEDLGNTERYFFPLDSRHFQHFGPVGNSVPWKDFSSGYVDKTREGFPSLELA  1363

Query  4188  LGAKTKPLMSGIPSFLSGKVEKKIIEENTSDNAATSANKED-VsaslslslsFPFPEKEH  4364
             LG +TKP   G+  F  G  ++K   ++    AA    K+D VSASLSLSLSFPFP+KE 
Sbjct  1364  LGGETKPQNKGMLPFFVGLADEKGNNQDKPLEAAVVDEKDDDVSASLSLSLSFPFPDKEQ  1423

Query  4365  GTS--SKPEQEDPRRRQANTSLLLFGR  4439
                  SKPEQ  P R   NTSLLLFGR
Sbjct  1424  PGKPVSKPEQLVPERHHVNTSLLLFGR  1450



>ref|XP_011084637.1| PREDICTED: uncharacterized protein LOC105166844 [Sesamum indicum]
Length=1453

 Score =   502 bits (1292),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 341/829 (41%), Positives = 489/829 (59%), Gaps = 118/829 (14%)
 Frame = +3

Query  864   DLIASQIHQMeesddseivevdvkvCDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEK  1043
             D +  ++H ++E+DDS++VE DVKVCDICG  GRE LLAIC RC+DGAEHTYCM++M+EK
Sbjct  313   DEMEVEVHPVDETDDSDMVEHDVKVCDICGDAGREDLLAICCRCSDGAEHTYCMREMMEK  372

Query  1044  IPEGDWLCEECK-FDQEMKNEHVNSGRVNEKEKTSPSRRTTIAKSDHPLKMEQKTSDCWG  1220
             +PEG+WLCEECK  DQE       +G ++E EK + S +   A S++        SD  G
Sbjct  373   VPEGEWLCEECKTMDQEGVGRQEKNGGMDENEKNNSSGQ---ASSEY-----VNGSDVEG  424

Query  1221  DKAVEERSYLKTSGKRCTDD--SEVSSPTKRQRLE--LRSPTAQIPNRVTSLSRESSFKN  1388
              +    + Y++   KR  DD  SEVSS  K+  LE  +RSP     +++ +LSRE+S K 
Sbjct  425   PRT---KGYMRIPCKRHRDDADSEVSSIAKKPALEPTVRSPKTSSSSKLAALSRENSLKY  481

Query  1389  LERGKVKPLNPFSSGSFAAK-----VPSSTGPQPQPPRGIFSKSNSFSSLIAKPKVKLVD  1553
              ++G+++  +  SS +           S++  +    RG FSKS SF+SL +KPKVKLVD
Sbjct  482   TDKGRLQSSHHSSSDTVPVNDTTESASSASNLRVNTSRGTFSKSKSFNSLNSKPKVKLVD  541

Query  1554  EVFPAKQKLSRETAFIESKEVAVRSMGKSMSFKPTTASRSNCTESKVKMFSPKFSHDQDV  1733
             +V   +QK ++E      KE  VR++GKSMSFK T + RS   ESK+KM SP+ +H QD 
Sbjct  542   QVVIQRQKSAKEHGSFRLKEGVVRAIGKSMSFKCTNSMRS---ESKLKMLSPRPTHSQDS  598

Query  1734  KWLRHKKDRSSFDRKNSLRSDRLAGGAI------SSPKSDNKPTPRGEPSSLSSLNTNRD  1895
             K     K R+ F+R +S +++  +   I      S+ + + K   R E SSL+++  + D
Sbjct  599   K---STKQRTPFERHHSFKAELPSANPIMGTSMSSTSRIEKKQASRAESSSLATVANHHD  655

Query  1896  YRALTSDNKPVTISNSTSGVAREV---------LKQASV---DGVSSANRVSSSEENPSQ  2039
              + + +D +   ++ S+   AR            K+ SV    GVSSA  V++ E+  ++
Sbjct  656   MKPVQTDGRSAALTRSSGLAARRTAELSSSQGEFKRPSVYGNHGVSSAGGVNNIEQKSNR  715

Query  2040  AIPKEDSSSSSCVAERPSWSSNEVLPDGLSQSKESKAFGDKTRESSASRSKQNSTASGKI  2219
                KED++SS  VA+RP  S++EVLPDG  +  +  + G++ +E S+SR  Q+S      
Sbjct  716   TSLKEDAASS-VVADRPPLSASEVLPDGSPRPGDLTSSGERMKEYSSSRFGQSSV-----  769

Query  2220  VSCQKCKGNGHLAQVCTADGPESSALGSPFKSSREATNGPSDLKAAIEAARLRKPGICRK  2399
                                           KS R+ ++   +LKAAIEAA LRKPG+ RK
Sbjct  770   ------------------------------KSLRDESD---NLKAAIEAAVLRKPGVYRK  796

Query  2400  NRVADQSEDLSASNMKSEIASQDQMLSSTV--RRNVNGAEEAQ----------KQETANN  2543
             +R   QS++ S S++  E+AS    +SS+   ++  + AE ++          KQET ++
Sbjct  797   HRALGQSDESSISSVACEVASHHDHISSSAGNKKLASNAELSEVSRNSTPDHLKQETISS  856

Query  2544  AKQ--LGIIAEASARTRNAGHV------VFSDVKHSVIDMERQTLVSMPVILKT-AIPEY  2696
              KQ  L  +       R+  H       VFS+   +V           P  LK  AIPE+
Sbjct  857   VKQSLLVPVEGLPFGARDGVHNGPFSRDVFSNAPAAV-----------PAFLKYLAIPEH  905

Query  2697  QYIWQGGFEVQKSGKAFNLYDGIQAHLSSCASPKVLDAVNKFPRKVILNEVPRLSSWPMQ  2876
             ++IWQG FE+ +S + F+ +DGIQAHLS+ ASPKV+ AVNKF  +++L EVPR S+WP+Q
Sbjct  906   EHIWQGSFEICRSDETFDSWDGIQAHLSTSASPKVIKAVNKFKSRIVLYEVPRKSTWPIQ  965

Query  2877  FKECGVSEDNVALFFFAKDIGSYEKSYKVLLGDMVKHDLALQGNIGDIELLIFPSNQLPE  3056
             F+ECGV EDN+ALFFFAKD+ SYEK YKVLL +M+K DLAL+GN+  +ELLIF SNQLP+
Sbjct  966   FQECGVREDNIALFFFAKDLESYEKIYKVLLDNMMKKDLALRGNVNGVELLIFASNQLPD  1025

Query  3057  KFQRWNLMFFLWGVFRGKRANSLQNFPGAEKPLI--QDIPTPATSLPEN  3197
             K QRWN++FFLWGVFRGK+ + LQ  P +       +DIP P  SLPEN
Sbjct  1026  KSQRWNMLFFLWGVFRGKKESCLQKMPESLNQCCAPRDIPPPIMSLPEN  1074


 Score =   109 bits (272),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 79/174 (45%), Positives = 100/174 (57%), Gaps = 4/174 (2%)
 Frame = +3

Query  3921  NDQTSCSKDGFLSEMGGTASQLSRQKNERDEALSKTAILETPGNAEMFFFPVDPHPVGNI  4100
             ND       G L ++    S      N   E   +T I     +AE  FFP++  PV  +
Sbjct  1277  NDDARNETCGVLEKINHVPSGSYALHNRHQEVCVETLIPGFNEHAERRFFPIE-QPVKGV  1335

Query  4101  GSNNSSMPWKVHPLEEDQLHDKAPNLELALGAKTKPLMSGIPSFLSGKVEKKIIEENTSD  4280
              S + S PWK+H LE D+L+D+APNLELALGA  KPL  G  S L  KV++ + EE+  +
Sbjct  1336  QSADGSTPWKMHQLEPDRLNDRAPNLELALGADIKPLSLGTRSVLVSKVDQTVNEEHIRE  1395

Query  4281  NAATSANKEDVsaslslslsFPFPEKEHGTSSKP--EQEDPRRRQANTSLLLFG  4436
               A S  ++DVSASLSLSLSFPFPEKE  T   P  EQ    R + NTS+LLFG
Sbjct  1396  E-ARSKTEDDVSASLSLSLSFPFPEKEFSTKPAPKTEQLVSERERVNTSMLLFG  1448



>ref|XP_009361136.1| PREDICTED: uncharacterized protein LOC103951480 isoform X3 [Pyrus 
x bretschneideri]
Length=1426

 Score =   501 bits (1289),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 345/797 (43%), Positives = 452/797 (57%), Gaps = 95/797 (12%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNEHVNSG  1118
             CDICG  GRE +LA+CSRC+DGAEH YCM+KML ++P+G WLCEECKF +E  N+   S 
Sbjct  307   CDICGDAGREDMLAMCSRCSDGAEHIYCMRKMLRRVPKGRWLCEECKFAEETDNQKQGSD  366

Query  1119  -RVNEKEKTSPSRRTTIAKSDHPLKMEQKTSDCWGDKAVEERSYLKTSGKRCTDDSEVSS  1295
               V   EK   S                                 + S KR  +  EV+ 
Sbjct  367   VEVKRMEKVITS--------------------------------TQISNKRLAESVEVAP  394

Query  1296  PTKRQRLELR--SPTAQIPNRVTSLSRESSFKNLERGKVKPLNPFSSG----SFAAKVPS  1457
               KRQ LE+R  SP A  P R+ +LSRESSFK+L++ +++   P S      S  A+ PS
Sbjct  395   SVKRQALEMRVGSPKASSPKRMGALSRESSFKSLDKDRLRSAYPISQSTNDISETARSPS  454

Query  1458  STGPQPQPPRGIFSKSNSFSSLIAKPKVKLVDEVFPAKQKLSRETAFIESKE-VAVRSMG  1634
             +        +G FSKSNSF++LI+KPKVKLVDEV P KQK S+E A  + KE V  R MG
Sbjct  455   NG----LRAKGTFSKSNSFNTLISKPKVKLVDEVVPQKQKGSKEHASFDMKERVVSRMMG  510

Query  1635  KSMSFKPTTASRSNCTESKVKMFSPKFSHDQDVKWLRHKKDRSSFDRKNSLRSDR-----  1799
             +S+SFK  ++ RSN +E+KVKM S KFSH  D+K L+  K+ S+ +RKN  + DR     
Sbjct  511   RSVSFKSASSGRSNVSETKVKMLSSKFSHVPDLKGLKQAKEWSTVERKNLSKLDRPKANL  570

Query  1800  -LAGGAISSPKSDNKPTPRGEPSSLSSLNTNRDYRALTSDNKPVTISNSTS---GVAREV  1967
               A    S+PKSD     R E S LSS+ +NR+ +    D K  T S S+    GV  +V
Sbjct  571   ITASPIFSTPKSD--LASRCETSLLSSV-SNREPKVALPDGKLSTSSKSSLTRKGVDTQV  627

Query  1968  LKQASVDGVSSANRVSSSEENPSQAIPKEDS-SSSSCVAERPSWSSNEVLPDGLSQSKES  2144
                       +    S+SE+  +Q   K++S SS S   E    + +  L D L QS E 
Sbjct  628   ASGGGS--SMNGMSSSASEQRSNQVSSKDESLSSYSGTVETSRCNLDGTLEDVLPQSGEM  685

Query  2145  KAFGDKTRESSASRSKQNSTASGKIVSCQKCKGNGHL---AQVCTADGPESSALGSPFKS  2315
                 DK RESS  R +    AS K     K +GN      A +    G ++ A     +S
Sbjct  686   ADQDDKARESSV-RCRPAVVASPKF----KERGNNTEFGGAGISQTSGTDACAP----RS  736

Query  2316  SREATNGPSDLKAAIEAARLRKPGICRKNRVADQSEDLSASNM--KSEIASQDQ------  2471
             SRE     + LK AI AA LRKP I RK RV DQS++LS  NM    E+A+Q+Q      
Sbjct  737   SREEMQRGNRLKNAIHAALLRKPEIYRKKRVLDQSDELSTLNMDLSYEVATQEQSPDGHA  796

Query  2472  MLSSTVRRNVNGAEEAQKQETANNAKQLG---IIAEASARTRNAGHVVFSDVKHSVIDME  2642
             +L ++   + N         T NN KQ+    I +   ++  ++  VV S  K +V D  
Sbjct  797   ILGTSPSDSYNNT-------TVNNLKQITGQPIDSGFPSKVADSFSVVHSLGKPTVKDFH  849

Query  2643  RQTLVSMPVILK-TAIPEYQYIWQGGFEVQKSGKAFNLYDGIQAHLSSCASPKVLDAVNK  2819
                  +M V++K TAIPEY+YIWQGGFEVQ+ G   +L  G+QAHLS+CASPKVL+ VNK
Sbjct  850   NHASGAMSVLVKTTAIPEYEYIWQGGFEVQRGGNFLDLCGGVQAHLSTCASPKVLEVVNK  909

Query  2820  FPRKVILNEVPRLSSWPMQFKECGVSEDNVALFFFAKDIGSYEKSYKVLLGDMVKHDLAL  2999
             FP K+ LNEVPRLS WP QF + G  EDN+AL+FFAKD+ SYE+ YK LL  MVK+DLAL
Sbjct  910   FPHKIPLNEVPRLSVWPSQFHQSGAKEDNIALYFFAKDLDSYERHYKSLLDAMVKNDLAL  969

Query  3000  QGNIGDIELLIFPSNQLPEKFQRWNLMFFLWGVFRGKRANSLQNFPGAEKPLIQD----I  3167
             +GN   +ELLIFPSNQLPEK QRWN++FFLWGVFR  R + L +F     P +++     
Sbjct  970   KGNFDGVELLIFPSNQLPEKSQRWNMLFFLWGVFRTMRVHCL-DFTETCVPSLRNSFNKA  1028

Query  3168  PTPATSLPENMFTPVPK  3218
             PT   +L E+    +PK
Sbjct  1029  PTDGMTLSESENICIPK  1045


 Score = 97.1 bits (240),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 70/147 (48%), Positives = 86/147 (59%), Gaps = 4/147 (3%)
 Frame = +3

Query  4011  EALSKTAILETPGNAEMFFFPVDPHPVGNIGSNNSSMPWK-VHPLEEDQLHDKAPNLELA  4187
             EA  +  I E  GN E +FFP+D   V + G  + S+PWK      ED+  +  P+LELA
Sbjct  1276  EACEEKVIPEDLGNTERYFFPLDSRHVHHFGPVDHSVPWKEFSSGYEDKSREGFPSLELA  1335

Query  4188  LGAKTKPLMSGIPSFLSGKVEKKIIEENTSDNAATSANK-EDVsaslslslsFPFPEKEH  4364
             LG +TKP   G+  F  G  +KK   ++    AA    K +DVSASLSLSLSFPFP+KE 
Sbjct  1336  LGGETKPQNKGMLPFFVGSADKKDNNQDEPLEAAVVDEKDDDVSASLSLSLSFPFPDKEQ  1395

Query  4365  GTS--SKPEQEDPRRRQANTSLLLFGR  4439
                  SKPEQ  P R   NTSLLLFGR
Sbjct  1396  PGKPVSKPEQLLPERHHVNTSLLLFGR  1422



>ref|XP_008382210.1| PREDICTED: uncharacterized protein LOC103445016 isoform X1 [Malus 
domestica]
Length=1478

 Score =   502 bits (1292),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 361/914 (39%), Positives = 494/914 (54%), Gaps = 90/914 (10%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNEHVNSG  1118
             CDICG  GRE +LA+CSRC DGAEH YCM+KML ++P+G WLCEECKF +E  N+   S 
Sbjct  320   CDICGDAGREDMLAMCSRCIDGAEHIYCMRKMLRRVPKGPWLCEECKFTEETDNQKQGS-  378

Query  1119  RVNEKEKTSPSRRTTIAKSDHPLKMEQKTSDCWGDKAVEERSYLKTSGKRCTDDSEVSSP  1298
                                     +E K      +KA+    +   S KR  ++ EV+  
Sbjct  379   -----------------------DIEVKRM----EKAIMSTQF---SNKRLAENIEVAPS  408

Query  1299  TKRQRLELR--SPTAQIPNRVTSLSRESSFKNLERGKVKPLNPFSSGSFAAKVPSSTGPQ  1472
              KRQ LE+R  SP    P R+ +LSRESSFK++++ +++P    S G+      + +   
Sbjct  409   AKRQGLEMRVGSPKPSSPKRMGALSRESSFKSIDKDRLRPAYQTSQGTNNISETARSPSN  468

Query  1473  PQPPRGIFSKSNSFSSLIAKPKVKLVDEVFPAKQKLSRETAFIESKEVAV-RSMGKSMSF  1649
                 +G FSKSNSF++L +KPKVK VDEV P KQK  +E A ++ KE  V R MGKS+SF
Sbjct  469   GIGAKGTFSKSNSFNTLNSKPKVKHVDEVVPQKQKGFKEHASLDMKERVVPRIMGKSVSF  528

Query  1650  KPTTASRSNCTESKVKMFSPKFSHDQDVKWLRHKKDRSSFDRKNSLRSDR------LAGG  1811
             K  ++ RSN +ESKVKM S KFSH  D+K L+  K+RS  +RK   + DR       A  
Sbjct  529   KSASSGRSNVSESKVKMLSSKFSHVPDLKALKQAKERSVVERKILSKLDRPMANFTTANS  588

Query  1812  AISSPKSDNKPTPRGEPSSLSSLNTNRDYRALTSDNKPVTISNSTSGVAREVLK---QAS  1982
              +S PKSD     RGE S LSS+ +NR+ +    D K   +S S S V R+       + 
Sbjct  589   TVSIPKSD--LASRGETSLLSSV-SNREPKVALPDGK---LSTSKSSVTRKGFDTQITSG  642

Query  1983  VDGVSSANRVSSSEENPSQAIPKEDSSSSSCVAERPSWSSNEVLPDGLSQSKESKAFGDK  2162
                  +    S+SE+       K++S SSS   E+   + +    D L QS E     DK
Sbjct  643   GGSSMNGMSSSASEQKLYHVSFKDESLSSSVTVEKSHCNVDGTSEDVLPQSGEMIDQDDK  702

Query  2163  TRESSASRSKQNSTASGKIVSCQKCKGNGHLAQVCTADGPESSALG-SPFKSSREATNGP  2339
              RESS          +  +V+  KCK  G  A+       ++S  G S  + SRE     
Sbjct  703   ARESSV-------RCAPAVVASPKCKELGINAEFGRPVISQASGTGASAPRGSREEMQRG  755

Query  2340  SDLKAAIEAARLRKPGICRKNRVADQSEDLSASNMKS--EIASQDQMLSSTVRRNVNGAE  2513
             + LK AI AA +RK  I RK RV DQS++ S  NM S  E+A+Q+Q          + + 
Sbjct  756   NRLKDAIHAALVRKSEIYRKKRVFDQSDESSTPNMDSSYEVAAQEQSPDGHAILGTSTS-  814

Query  2514  EAQKQETANNAKQLGII-AEASARTRNAGHVVFSDVKHSVIDMERQTLVSMPVILK-TAI  2687
             ++ K  T NN KQL +   ++   ++ A  V     K +V D+      +M V++K TAI
Sbjct  815   DSYKNATVNNLKQLTVQPIDSGFPSKVAYSVSVVPGKPTVKDLHNHASGAMSVLVKTTAI  874

Query  2688  PEYQYIWQGGFEVQKSGKAFNLYDGIQAHLSSCASPKVLDAVNKFPRKVILNEVPRLSSW  2867
             PEY+YIWQG FEVQ+ G   +L  G+QAHLS+CASPKV + VNKFP KV LNEVPRLS W
Sbjct  875   PEYEYIWQGSFEVQRGGNFMDLCGGVQAHLSTCASPKVPEVVNKFPHKVSLNEVPRLSVW  934

Query  2868  PMQFKECGVSEDNVALFFFAKDIGSYEKSYKVLLGDMVKHDLALQGNIGDIELLIFPSNQ  3047
             P QF + G  EDN+AL+FFAKD+ SYE+ Y  LL  MVK+DLAL+GN   +ELLIFPSNQ
Sbjct  935   PSQFHQSGAKEDNIALYFFAKDLDSYERHYNSLLDAMVKNDLALKGNFDGVELLIFPSNQ  994

Query  3048  LPEKFQRWNLMFFLWGVFRGKRANSLQNFPGAEKPLI----QDIPTPATSLPENMFTPVP  3215
             LPEK QRWN++FFLWGVFR  R + L +F     P +    Q  PT   +L EN+  P  
Sbjct  995   LPEKSQRWNMLFFLWGVFRTMRVHCL-DFTKTCVPSLSNSFQKAPTDGMTLSENICIPKH  1053

Query  3216  KLNSARGSAATNTEMSAVKESESASLHK--IVNGNCSIQSSSQVSRDKCSRIN-AEQNDK  3386
                S+    + +     V  + +ASLH    V+ +C  + +        S++N A Q+ +
Sbjct  1054  IDESSPSDRSCD-----VPSASNASLHMGPTVSKDCENKDTYPEEVRLGSKVNSAVQDCR  1108

Query  3387  LDSSSMQNSEPKLGPDRRYFGVP-----------LGEAVHSSVQTAERVSSPNTSRPMSV  3533
             +DS++  N+    G +   +G P           +G+ + SS+ T    SS N      V
Sbjct  1109  VDSNTTNNAGLSEGVE---YGTPCLQESCLRESRVGKEIKSSIPTTGSNSS-NKGEKRQV  1164

Query  3534  HWAAPLDGEKLSML  3575
             HW   +D E    L
Sbjct  1165  HWVTSVDREDTDSL  1178


 Score = 90.1 bits (222),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 67/147 (46%), Positives = 84/147 (57%), Gaps = 4/147 (3%)
 Frame = +3

Query  4011  EALSKTAILETPGNAEMFFFPVDPHPVGNIGSNNSSMPWK-VHPLEEDQLHDKAPNLELA  4187
             EA  +  I E  GN E +FFP+D     + G   +S+PWK       D+  +  P+LELA
Sbjct  1328  EACEEKVIPEDLGNTERYFFPLDSRHFQHFGPVGNSVPWKDFSSGYVDKTREGFPSLELA  1387

Query  4188  LGAKTKPLMSGIPSFLSGKVEKKIIEENTSDNAATSANKED-VsaslslslsFPFPEKEH  4364
             LG +TKP   G+  F  G  ++K   ++    AA    K+D VSASLSLSLSFPFP+KE 
Sbjct  1388  LGGETKPQNKGMLPFFVGLADEKGNNQDKPLEAAVVDEKDDDVSASLSLSLSFPFPDKEQ  1447

Query  4365  GTS--SKPEQEDPRRRQANTSLLLFGR  4439
                  SKPEQ  P R   NTSLLLFGR
Sbjct  1448  PGKPVSKPEQLVPERHHVNTSLLLFGR  1474



>ref|XP_004145410.1| PREDICTED: uncharacterized protein LOC101208726 [Cucumis sativus]
 ref|XP_004164797.1| PREDICTED: uncharacterized LOC101211560 [Cucumis sativus]
Length=1567

 Score =   502 bits (1293),  Expect = 6e-147, Method: Compositional matrix adjust.
 Identities = 406/1195 (34%), Positives = 583/1195 (49%), Gaps = 194/1195 (16%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNEHVNSG  1118
             CDICG  GRE LLAICSRCTDGAEHTYCM++ L+++PEGDWLCEECK  +E         
Sbjct  426   CDICGDAGREDLLAICSRCTDGAEHTYCMRERLDEVPEGDWLCEECKSAEE---------  476

Query  1119  RVNEKEKTSPSRRTTIAKSDHPLKMEQKTSDCWGDKAVEERSYLKTSGKRCTDDSEVSSP  1298
               NE +K                       D  G +   + S ++  GK+  D+ +VS  
Sbjct  477   --NENQK----------------------QDTEGKRVSRDGSSMRNFGKKNVDNVDVSVA  512

Query  1299  TKRQRLELR--SPTAQIPNRVTSLSRESSFKNLERGKVKPLNPFSSG-------SFAAKV  1451
              KRQ LE    S  A  P R   LSR+SS K+L++GK         G       S  A+ 
Sbjct  513   AKRQVLETNKGSTKASSPGRSIGLSRDSSSKSLDKGKSMLSQSKCLGDQCNNDVSEMARS  572

Query  1452  PSSTGPQPQPPRGIFSKSNSFSSLIAKPKVKLVDEVFPAKQKLSRETAFIESKEVAVRSM  1631
             PS  G +    +G   KSNSF++L +KPKV+LVD+  P K +  RE   +E KE   R++
Sbjct  573   PS-VGSRLHSLKGTLLKSNSFNTLNSKPKVRLVDDFIPQKPRGPREHTSLEVKEGPSRAL  631

Query  1632  GKSMSFKPTTASRSNCTESKVKMFSPKFSHDQDVKWLRHKKDRSSFDRKNSLRSDR----  1799
             GKS SFK  +  R++ +E+KVKM   KF H QD K ++  KDR+  DRKN  + DR    
Sbjct  632   GKSQSFKTPSFGRASMSEAKVKMIPSKFPHVQDPKGIKQGKDRNVLDRKNPSKVDRSWIS  691

Query  1800  --LAGGAISSPKSDNKPTPRGEPSSLSSLNTNRDYRALTSDNKPVTISNSTSGVAREVLK  1973
                   A+S+ K ++K + RGE    ++   NRD + + SD     IS ST   +R  L 
Sbjct  692   SVTTSSAVSTSKIESKLSSRGE----TNFGNNRDQKIIQSDG----IS-STHPKSRSSLV  742

Query  1974  QASVDGVSSANRV--------SSSEENPSQAIPKEDSSSSSCVAERPSWSSNEVLPDGLS  2129
                VD   S  R         SS ++  +  IPKE+  SSS   ER S++ N        
Sbjct  743   HKGVDSPLSPARALSTNGTCSSSVDQKINHVIPKEEPLSSSLTVERVSYNDN-------G  795

Query  2130  QSKESKAFGDKTRESSASRSKQNSTASGKIVSCQKCKGNGHLAQVCTADGPESSALGSPF  2309
             +S+E     +K RESSA+ SK     S K   C KCKG  H  + C +  P  S   +  
Sbjct  796   RSREMTGLDEKNRESSANPSKPTVATSPKSGHCLKCKGTEHATESCISGSPYVS--DNNI  853

Query  2310  KSSREATNGPSDLKAAIEAARLRKPGICRKNRVADQSE-------------------DLS  2432
              SSRE T   + LKAAI+AA L++P IC+K + +D S+                     S
Sbjct  854   ISSREDTCEENKLKAAIQAALLKRPEICKKRKFSDPSDEVSSSSTVSNSDIVHQDQFSFS  913

Query  2433  ASN-MKSEIASQDQMLSSTVRRNVNGAEEAQKQETANNAKQLGIIAEASARTRNAGHVVF  2609
              SN +K+E++S+      T+   VN +     ++  ++  +L ++    A   +      
Sbjct  914   FSNKLKTELSSERAHEGKTI---VNSSATNFHRQPVSSIPKLPVLPNLDAPVPSQSE---  967

Query  2610  SDVKHSVIDMERQTLVSMPVILKTAIPEYQYIWQGGFEVQKSGKAFNLYDGIQAHLSSCA  2789
              D   + I +E+  + S+  +LK  IPEY+YIWQGGFE+ + GK  +  DGIQAHLS+CA
Sbjct  968   -DTDSTSIPVEKVWMSSL--LLKIVIPEYEYIWQGGFELHRCGKLPDFCDGIQAHLSTCA  1024

Query  2790  SPKVLDAVNKFPRKVILNEVPRLSSWPMQFKECGVSEDNVALFFFAKDIGSYEKSYKVLL  2969
             SP+V++  +K P+ + L EVPRLS+WP QF +CGV EDN+AL+FFA+DI SYE++Y+ LL
Sbjct  1025  SPRVIEVASKLPQNISLKEVPRLSTWPSQFHDCGVKEDNIALYFFARDIHSYERNYRGLL  1084

Query  2970  GDMVKHDLALQGNIGDIELLIFPSNQLPEKFQRWNLMFFLWGVFRGKRANSLQ-----NF  3134
               M K+DLAL+GN+  +ELLIF SNQLPEK QRWN++FFLWGVFRGK+ N L      N 
Sbjct  1085  DHMTKNDLALKGNLDGVELLIFSSNQLPEKSQRWNMLFFLWGVFRGKKTNCLNALKISNI  1144

Query  3135  PGAEK-PLIQDIPTPATSLPENM---------FTPV--PKLNSARGSA--ATNTEMSAVK  3272
                E  PL +++P    +  +++           P   PKL  A  SA   ++T  +   
Sbjct  1145  RSTEAVPLDKNLPDITATKSDDVCLAKCANGEIFPCYSPKLGKASSSADQMSDTTSTDCH  1204

Query  3273  ESES----ASLHKIVNGNCSI-QSSSQVSRDKCSRINAEQNDKLDSSSMQNSEPKLGPDR  3437
             + ES    A L+ + N  C + Q  ++ S    S +   Q     S+SM+ S       R
Sbjct  1205  KCESSVYQAPLNSLENSGCQVHQFETKASSVLASSMEFCQGTTT-SASMKES-------R  1256

Query  3438  RYFGVPLGEAVHSSVQTAERVSSPNTSRPMSVHWAAPLDGEKLSMLSDETPTMQEATSVG  3617
             R   +  GE    S+Q  E V   N ++   V +++    E++  L   T  M++ ++  
Sbjct  1257  RLESIH-GEHFEPSIQVKEIVGV-NDNKKAKVDFSST---EEMPPLIKTTDDMKKTSTGE  1311

Query  3618  STTKNLCGKDDVKIGRICLDN----------VSTEEATPLARHTSMEQTLNVISS-----  3752
                  L  + +  + R    N          ++TE    L  H    + ++++ S     
Sbjct  1312  KIVDRLVCEGEKAVLRTAEGNSDSEGLLKRDLNTEGINCLESHHRKRRQVDILESAALVS  1371

Query  3753  FGVNPKKRSHSAETVLQsasssgtsqafssysNDDILVEEFCHKRVKLNSDRSYGCNDQT  3932
                N + R    + +                    +L EE   K+ +     SY    + 
Sbjct  1372  ISANNRPRDEEVDCI--------------------VLDEENVRKKTRTGFGNSY----EN  1407

Query  3933  SCSKDG-------FLSEMGGTASQLSRQKNERDEALSKTAILETPGNAEMFFFPVDPHPV  4091
             SCS  G       ++S           QK   D+      I E    AE  FFPV  H  
Sbjct  1408  SCSTGGINSQSDPYISPRTDIGPTFLFQKKGGDKVCDVNVIPEDFEMAEKHFFPVGSHQQ  1467

Query  4092  GNIGSNNSSMPWKVHPLEEDQLHDKAPNLELALGAKTKPLMSGIPSFLSGKVEKK  4256
              +   +  ++P K    +EDQ HD  PNLELALGA+TK     +  FL   V+ K
Sbjct  1468  ED---HYLALPAK----DEDQYHDAVPNLELALGAETKLQKKSMIPFLMDLVDDK  1515



>ref|XP_008459205.1| PREDICTED: probable GPI-anchored adhesin-like protein PGA55 isoform 
X3 [Cucumis melo]
Length=1291

 Score =   491 bits (1265),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 320/778 (41%), Positives = 431/778 (55%), Gaps = 80/778 (10%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNEH--VN  1112
             CDICG  GRE LLAICSRCTDGAEHTYCM++ L+++PEGDWLCEECK  +E +N+   V 
Sbjct  426   CDICGDAGREDLLAICSRCTDGAEHTYCMRERLDEVPEGDWLCEECKSAEENENQKQDVE  485

Query  1113  SGRVNEKEKTSPSRRTTIAKSDHPLKMEQKTSDCWGDKAVEERSYLKTSGKRCTDDSEVS  1292
                    ++    RR  I  S        + SD  G K   + S ++  GK+  D+ +VS
Sbjct  486   GKSYISYKRKDEGRRPNIVSS------STQVSDTEGKKVSRDGSSIRKFGKKNLDNVDVS  539

Query  1293  SPTKRQRLELRSPTAQI--PNRVTSLSRESSFKNLERGKV-----KPLNPFSSGSF--AA  1445
                KRQ LE    + +   P R   LSR+SS K+L++GK      K L    S      A
Sbjct  540   VAAKRQVLETNKGSTKTSSPGRSIGLSRDSSSKSLDKGKSMLSQSKCLGDQCSNDVLEMA  599

Query  1446  KVPSSTGPQPQPPRGIFSKSNSFSSLIAKPKVKLVDEVFPAKQKLSRETAFIESKEVAVR  1625
             + PS  G +    +G   KSNSF++L +KPKVKLVDE  P K +  RE   +E KE + R
Sbjct  600   RSPS-VGSRLHTLKGTLLKSNSFNTLNSKPKVKLVDEFIPQKPRGPREHTSLEVKEGSSR  658

Query  1626  SMGKSMSFKPTTASRSNCTESKVKMFSPKFSHDQDVKWLRHKKDRSSFDRKNSLRSDR--  1799
             ++GKS SFK  +  R++ +E+KVKM   KF H QD K ++  KDR+  DRKN  + DR  
Sbjct  659   ALGKSQSFKTPSFGRASMSEAKVKMIPSKFPHVQDPKGIKQGKDRNVLDRKNPSKVDRSW  718

Query  1800  ----LAGGAISSPKSDNKPTPRGEPSSLSSLNTNRDYRALTSDNKPVTISNSTSGVAREV  1967
                     A+S+ K + K + RGE    ++   NRD + + SD     IS ST   +R  
Sbjct  719   ISSVTTSSAVSTSKVEQKLSSRGE----TNFGNNRDQKIIQSDG----IS-STHPKSRSS  769

Query  1968  LKQASVDGVSSANRV--------SSSEENPSQAIPKEDSSSSSCVAERPSWSSNEVLPDG  2123
             L    VD   S  R         SS ++  +  IPKE+  SSS   ERP ++ N      
Sbjct  770   LVHMGVDNPLSPARALLTNGTCSSSVDQKINHLIPKEEPLSSSLTVERPPYNDN------  823

Query  2124  LSQSKESKAFGDKTRESSASRSKQNSTASGKIVSCQKCKGNGHLAQVCTADGPESSALGS  2303
               +S+E     +K +ESSA+  K     S K   C KCKG  H  + C         +GS
Sbjct  824   -GRSREMTGLDEKNKESSANPLKPTVATSPKSGHCLKCKGTEHATESCI--------IGS  874

Query  2304  PFKS------SREATNGPSDLKAAIEAARLRKPGICRKNRVAD--QSEDLSASNMKSEIA  2459
             P+ S      SRE T   + LKAAI+AA LR+P IC+K + +D       S++   SEI 
Sbjct  875   PYVSDNNIISSREETCEENKLKAAIQAALLRRPEICKKRKFSDPSDEVSSSSTVSNSEIV  934

Query  2460  SQDQMLSSTVRRNVNGAEEAQKQET------ANNAKQLGIIAEASARTRNAGHVV---FS  2612
              QDQ   S   +N   +E A + +T      AN  +Q            N    V     
Sbjct  935   HQDQFSFSNKLKNELSSERAYEGKTIVCSSAANFHRQPAASIPKLPVLPNLDTPVPSHLE  994

Query  2613  DVKHSVIDMERQTLVSMP-------VILKTAIPEYQYIWQGGFEVQKSGKAFNLYDGIQA  2771
             D   + I +E+  +  +        ++LK  IPEY+YIWQGGFE+ + GK  +  DGIQA
Sbjct  995   DTDSTAIPVEKVRMKDLSGHASTNSLLLKIVIPEYEYIWQGGFELHRCGKLPDFCDGIQA  1054

Query  2772  HLSSCASPKVLDAVNKFPRKVILNEVPRLSSWPMQFKECGVSEDNVALFFFAKDIGSYEK  2951
             HLS+CASPKV++  +K P  + L EVPRLS+WP QF +CGV EDN+AL+FFA+DI SYE+
Sbjct  1055  HLSTCASPKVIEVASKLPHNISLKEVPRLSTWPSQFHDCGVKEDNIALYFFARDISSYER  1114

Query  2952  SYKVLLGDMVKHDLALQGNIGDIELLIFPSNQLPEKFQRWNLMFFLWGVFRGKRANSL  3125
             +Y+ L+  M K+DLAL+GN+  +ELLIF SNQLPE  QRWN++FFLWGVFRGK+AN L
Sbjct  1115  NYRGLVDHMTKNDLALKGNLDGVELLIFSSNQLPENSQRWNMLFFLWGVFRGKKANCL  1172



>ref|XP_002535114.1| hypothetical protein RCOM_2156040 [Ricinus communis]
 gb|EEF27270.1| hypothetical protein RCOM_2156040 [Ricinus communis]
Length=1087

 Score =   484 bits (1245),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 310/732 (42%), Positives = 427/732 (58%), Gaps = 100/732 (14%)
 Frame = +3

Query  1032  MLEKIPEGDWLCEECKFDQEMKNEHVNS-GRVNEKEKTSPSRRTTIAKSDHPLKMEQKTS  1208
             ML+K+PEGDWLCEECK  +E +N+  ++ GR   KE                        
Sbjct  1     MLQKVPEGDWLCEECKLAEETENQKQDAEGRRMNKES-----------------------  37

Query  1209  DCWGDKAVEERSYLKTSGKRCTDDSEVSSPTKRQRLE--LRSPTAQIPNRVTSLSRESSF  1382
                          +++S KR  +  EV+  +KRQ +E    SP +  P R  +LSR+SSF
Sbjct  38    -------------IQSSMKRPAETIEVALASKRQAIESSFGSPKSSSPTRTAALSRDSSF  84

Query  1383  KNLERGKVKPLNPFSSGSFAAKVPSSTG------PQPQPPRGIFSKSNSFSSLIAKPKVK  1544
             K L++GKVK  +  +S + ++   S T       P+ Q  +G   KSNSF++  +KPKVK
Sbjct  85    KGLDKGKVKLAHQTASANHSSMDISETARSSYIVPRLQTTKGTLLKSNSFNTFNSKPKVK  144

Query  1545  LVDEVFPAKQKLSRETAFIESKEVAVRSMGKSMSFKPTTASRSNCTESKVKMFSPKFSHD  1724
             LVDEV P KQK +R+   +E KE   R M KSMSF+   + RSN  ESKVKM S KFS  
Sbjct  145   LVDEV-PQKQKGNRD---LEMKEGTARMMSKSMSFRSVNSGRSNVAESKVKMLSSKFSQG  200

Query  1725  QDVKWLRHKKDRSSFDRKNSLRSDRLAGGAI------SSPKSDNKPTPRGEPSSLSSLNT  1886
             QD+K L+  K+R++ + K+  + +R  G ++      S PK + K TPRGE   +SS   
Sbjct  201   QDIKGLKQVKERNALEHKSLSKLERPLGSSVTTSSNASGPKVNQKLTPRGEGVMVSSACN  260

Query  1887  NRDYRALTSDNKPVTISNSTSGVAREVLKQASVDGVSSANRVSSSEENPSQAI-PKED-S  2060
             N D +A  SD K   +  STS +AR+                    E P+ ++ PK++ S
Sbjct  261   NSDSKASLSDGKSGGLLRSTSSLARK------------------GAEIPASSVSPKDEPS  302

Query  2061  SSSSCVAERPSWSSNEVLPDGLSQSKESKAFGDKTRESSASRSKQNSTASGKIVSCQKCK  2240
             SSSS  AERPS + ++ L DGLS+S+ES    +K+RESS +RS+ + T   K V+C KCK
Sbjct  303   SSSSWTAERPSNNIDDNLQDGLSRSRESSNQSEKSRESSVNRSRPSVTGL-KTVACLKCK  361

Query  2241  GNGHLAQVCTADGPESSALGSPFKSSREATNGPSDLKAAIEAARLRKPGICRKNRVADQS  2420
               GH A+ C+   P +S   +  +S RE     S LKAAIEAA L+KPGI RK + +D+S
Sbjct  362   EIGHTAEFCSIVSPRASGADTSARSVREDMGKGSKLKAAIEAAMLKKPGIFRKKKESDES  421

Query  2421  EDLSASNMK--SEIASQDQ-----MLSSTVRRNVN--GAEEAQ-----------KQETAN  2540
             + LS+SN+   SEIAS DQ      +S+  R  ++  G +E Q           KQ  +N
Sbjct  422   DGLSSSNVDVTSEIASHDQSHDQFSVSNKTRYMISDEGRDEGQANLGSSSSETSKQMYSN  481

Query  2541  NAKQLGIIAEASARTRNAGHVVFSDVKHSVIDMERQTLVSMPVI-LKTAIPEYQYIWQGG  2717
             N KQL I    S    N+  V  ++     I    + L + P+  +   IPE++YIWQG 
Sbjct  482   NVKQLNI---HSTDAINSFKVADTNSLVPSIGKPDRALTAKPLFSMMLTIPEHEYIWQGA  538

Query  2718  FEVQKSGKAFNLYDGIQAHLSSCASPKVLDAVNKFPRKVILNEVPRLSSWPMQFKECGVS  2897
              EV++ GK  +LY+GIQAHLS+CASPKVL+ VN+FP K+ ++EVPRLS+WP QF E G  
Sbjct  539   LEVRRCGKILDLYNGIQAHLSTCASPKVLEVVNQFPHKITVDEVPRLSTWPRQFHENGAK  598

Query  2898  EDNVALFFFAKDIGSYEKSYKVLLGDMVKHDLALQGNIGDIELLIFPSNQLPEKFQRWNL  3077
             EDN+AL+ FAKD+ SYEKSY+ LL +M+K DLAL+ +   +E LIFPS QLPE  QRWN+
Sbjct  599   EDNIALYLFAKDLESYEKSYRNLLDNMIKRDLALKVSFDGVEFLIFPSTQLPEDSQRWNM  658

Query  3078  MFFLWGVFRGKR  3113
             +FFLWGVFRG+R
Sbjct  659   LFFLWGVFRGRR  670


 Score =   112 bits (281),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 82/181 (45%), Positives = 101/181 (56%), Gaps = 7/181 (4%)
 Frame = +3

Query  3912  YGC---NDQTSCSKDGFLSEMGGTASQLSRQKNERDEALSKTAILETPGNAEMFFFPVDP  4082
             Y C    D TS + DGF S++    S  S +    +    +  I E  G AE +FFPV+ 
Sbjct  903   YSCISMRDGTSLT-DGFASQIRDLGSSSSAEGKSCERPADEKVIHEDLGTAERYFFPVES  961

Query  4083  HPVGNIGSNNSSMPWKVHPL-EEDQLHDKAPNLELALGAKTKPLMSGIPSFLSGKVEKKI  4259
               V +I    +S+PWK +   +E+Q  D  PNLELALGA+TKP   GI  F  G VEK  
Sbjct  962   RRVKDIRMGANSVPWKEYSSNDENQFRDVVPNLELALGAETKPPNKGIVPFFVGMVEKNN  1021

Query  4260  IEENTSDNAATSANKEDVsaslslslsFPFPEKEHGTS--SKPEQEDPRRRQANTSLLLF  4433
              +  TSD       ++ VSASLSLSLSFPFP+KE      SK EQ  P RR  NTSLLLF
Sbjct  1022  TQNKTSDKVTDKEEEDGVSASLSLSLSFPFPDKEQTVKPVSKTEQLLPERRHVNTSLLLF  1081

Query  4434  G  4436
             G
Sbjct  1082  G  1082



>ref|XP_006590866.1| PREDICTED: uncharacterized protein LOC100784908 isoform X8 [Glycine 
max]
Length=1387

 Score =   481 bits (1239),  Expect = 8e-141, Method: Compositional matrix adjust.
 Identities = 316/801 (39%), Positives = 435/801 (54%), Gaps = 113/801 (14%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNEHVNSG  1118
             CDICG  GRE LLAICSRC+DGAEHTYCM++MLEK+PEGDWLCEECK  +E  N  ++  
Sbjct  250   CDICGDAGREDLLAICSRCSDGAEHTYCMREMLEKVPEGDWLCEECKCAEETANRKLD--  307

Query  1119  RVNEKEKTSPSRRTTIAKSDHPLKMEQKTSDCWGDKAVEERSYLKTSGKRCTDDSEVSSP  1298
              + EK+    S  + I                              SGKR +   E+++ 
Sbjct  308   -IEEKKNHKVSSTSQI------------------------------SGKRPSQSMEIATA  336

Query  1299  TKRQRLE--LRSPTAQIPNRVTSLSRESSFKNLERGKVK------PLNPFSSGSFAAKVP  1454
              KRQ LE    SP A  P R+  LSRESSFK++++ K+K      P++    G       
Sbjct  337   AKRQALESSTGSPKASSPKRIVPLSRESSFKSMDKEKMKSGQQKIPMHNHLGGDDTELAR  396

Query  1455  S-STGPQPQPPRGIFSKSNSFSSLIAKPKVKLVDEVFPAKQKLSRETAFIESKEVAVRSM  1631
             S S GP+ Q  R    KSNSF++  +KP+VKLVDEV P KQK   E    ++ E     +
Sbjct  397   SLSAGPRSQNARSTLLKSNSFNN-NSKPRVKLVDEVVPQKQKGVVE-HISKNMETPAGMI  454

Query  1632  GKSMSFKPTTASRSNCTESKVKMFSPKFSHDQDVKWLRHKKDRSSFDRKNSLRSDR----  1799
              KSMSFK +   RSN  ESKVKM S K    QD+K  RH KD +SFDRK   + DR    
Sbjct  455   SKSMSFKLSNLGRSNAVESKVKMISSKPGTTQDLKASRHAKDSASFDRKFLSKIDRPVIC  514

Query  1800  --LAGGAISSPKSDNKPTPRGEPSSLSSLNTNRDYRALTSDNKPVTISNSTSGVAREVLK  1973
               +    +S+ K D K TP GE +  S++N NR+++ +  D K  ++S S +        
Sbjct  515   STMVSSVVSTSKGDPKLTPHGETAKPSTVNNNREFK-VNQDGKLYSLSKSMN--------  565

Query  1974  QASVDGVSSANRVSSSEENPSQAIPKEDSSSSSCVAERPSWSSNEVLPDGLSQSKESKAF  2153
                               N S   P+   SS     +R S S +E   D L +S+++   
Sbjct  566   ------------------NTSSKSPEPQVSS-----DRTSTSVDETQQDKLPRSQDTANQ  602

Query  2154  GDKTRESSASRSKQNSTASGKIVSCQKCKGNGHLAQVCTADG-----PESSALGSPFKSS  2318
              DK ++SS        T + K   C+KCK  GH  + CT  G      ESS + +   SS
Sbjct  603   VDKAKDSSIDHVMSGVTNASKSSFCRKCKDFGHATECCTVSGTQEFGAESSVIAT--SSS  660

Query  2319  REATNGPSDLKAAIEAARLRKPGICRKNRVADQSEDL--SASNMKSEIASQDQML-SSTV  2489
             +E  +  + LKAAI+AA LR+P I ++    DQ+ +   S++ +K E+ SQ Q+L SST+
Sbjct  661   KEEMHEGNRLKAAIQAALLRRPEIHKRKEAPDQTNEFPTSSTGLKREVTSQKQVLVSSTL  720

Query  2490  RRNVNGAEEAQKQE-------------TANNAKQLGII-AEASARTRNAGHVVFSDVKHS  2627
             + +++  E   KQE             +AN+ KQ+     +  ++ R +  V  +  K  
Sbjct  721   KNSISAEESNMKQEIIVNSTVETSKCPSANDLKQVKFCRTDFCSQLRKSDSVGPTSGKPV  780

Query  2628  VIDMERQTLVSMPVILK-TAIPEYQYIWQGGFEVQKSGKAFNLYDGIQAHLSSCASPKVL  2804
             V D+    +    ++ K + IPEY+YIWQG F+V ++G   +LY GIQAHLS+CASPKV 
Sbjct  781   VRDLPNNAMEISSILSKMSVIPEYEYIWQGVFKVHRNGMPPDLYTGIQAHLSACASPKVH  840

Query  2805  DAVNKFPRKVILNEVPRLSSWPMQFKECGVSEDNVALFFFAKDIGSYEKSYKVLLGDMVK  2984
             + V KF  +V LNEV RLS WP QF + G  EDN+AL+FFAKDI SYE+ YK LL  M++
Sbjct  841   EVVKKFLPEVSLNEVSRLSIWPSQFHQGGAKEDNIALYFFAKDIESYERYYKGLLDHMIR  900

Query  2985  HDLALQGNIGDIELLIFPSNQLPEKFQRWNLMFFLWGVFRGKRANSLQNFPGAEKPLI--  3158
             +DLAL+G    +ELLIF SNQLPE  QRWN++FFLWG+FRG+R N L +      P +  
Sbjct  901   NDLALRGTSDGVELLIFASNQLPEDSQRWNMLFFLWGIFRGRRINHLDSTKKICIPSLNV  960

Query  3159  ----QDIPTPATSLPENMFTP  3209
                 +D PT   +L E   +P
Sbjct  961   MPNEKDFPTAVMTLSETRCSP  981


 Score = 55.1 bits (131),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 66/184 (36%), Positives = 86/184 (47%), Gaps = 22/184 (12%)
 Frame = +3

Query  3912  YGCNDQTSCSKDGF-------LSEMGGTAS-QLSRQKNERDEALSKTAILETPGNAEMFF  4067
             +GC D  S +++ F       ++++G  +S +  R K   DE +    I E  G  E  F
Sbjct  1214  HGCYD--SGARESFNGSFASLVNDLGSCSSGENKRCKKPCDEKI----IHEDLGAMERTF  1267

Query  4068  FPVDPHPVGNIGSNNSSMPWKVHPLEEDQLHDKAPNLELALGAKTKPLMSGIPSFLSGKV  4247
             FPVD          +S M         DQ     PNLEL LG +TKP   G+  F  G V
Sbjct  1268  FPVDTRK-----KKDSGMVLNEPRAYVDQFQVGIPNLELGLGGETKPSHKGMLPFFVGAV  1322

Query  4248  EKKIIEENTSDNAATSANKEDVsaslslslsFPFPEKEHGTSSKPEQEDPRRRQANTSLL  4427
             +KK  +E T D        E+V+ASLSLSLSFP   KEH    KP  +       N+  L
Sbjct  1323  DKKNSQEKTPDILTDEREDENVAASLSLSLSFPSSNKEH---VKPVTKAEDGHNVNSPYL  1379

Query  4428  LFGR  4439
             LFGR
Sbjct  1380  LFGR  1383



>ref|XP_006590862.1| PREDICTED: uncharacterized protein LOC100784908 isoform X4 [Glycine 
max]
Length=1409

 Score =   482 bits (1240),  Expect = 8e-141, Method: Compositional matrix adjust.
 Identities = 316/801 (39%), Positives = 435/801 (54%), Gaps = 113/801 (14%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNEHVNSG  1118
             CDICG  GRE LLAICSRC+DGAEHTYCM++MLEK+PEGDWLCEECK  +E  N  ++  
Sbjct  272   CDICGDAGREDLLAICSRCSDGAEHTYCMREMLEKVPEGDWLCEECKCAEETANRKLD--  329

Query  1119  RVNEKEKTSPSRRTTIAKSDHPLKMEQKTSDCWGDKAVEERSYLKTSGKRCTDDSEVSSP  1298
              + EK+    S  + I                              SGKR +   E+++ 
Sbjct  330   -IEEKKNHKVSSTSQI------------------------------SGKRPSQSMEIATA  358

Query  1299  TKRQRLE--LRSPTAQIPNRVTSLSRESSFKNLERGKVK------PLNPFSSGSFAAKVP  1454
              KRQ LE    SP A  P R+  LSRESSFK++++ K+K      P++    G       
Sbjct  359   AKRQALESSTGSPKASSPKRIVPLSRESSFKSMDKEKMKSGQQKIPMHNHLGGDDTELAR  418

Query  1455  S-STGPQPQPPRGIFSKSNSFSSLIAKPKVKLVDEVFPAKQKLSRETAFIESKEVAVRSM  1631
             S S GP+ Q  R    KSNSF++  +KP+VKLVDEV P KQK   E    ++ E     +
Sbjct  419   SLSAGPRSQNARSTLLKSNSFNN-NSKPRVKLVDEVVPQKQKGVVE-HISKNMETPAGMI  476

Query  1632  GKSMSFKPTTASRSNCTESKVKMFSPKFSHDQDVKWLRHKKDRSSFDRKNSLRSDR----  1799
              KSMSFK +   RSN  ESKVKM S K    QD+K  RH KD +SFDRK   + DR    
Sbjct  477   SKSMSFKLSNLGRSNAVESKVKMISSKPGTTQDLKASRHAKDSASFDRKFLSKIDRPVIC  536

Query  1800  --LAGGAISSPKSDNKPTPRGEPSSLSSLNTNRDYRALTSDNKPVTISNSTSGVAREVLK  1973
               +    +S+ K D K TP GE +  S++N NR+++ +  D K  ++S S +        
Sbjct  537   STMVSSVVSTSKGDPKLTPHGETAKPSTVNNNREFK-VNQDGKLYSLSKSMN--------  587

Query  1974  QASVDGVSSANRVSSSEENPSQAIPKEDSSSSSCVAERPSWSSNEVLPDGLSQSKESKAF  2153
                               N S   P+   SS     +R S S +E   D L +S+++   
Sbjct  588   ------------------NTSSKSPEPQVSS-----DRTSTSVDETQQDKLPRSQDTANQ  624

Query  2154  GDKTRESSASRSKQNSTASGKIVSCQKCKGNGHLAQVCTADG-----PESSALGSPFKSS  2318
              DK ++SS        T + K   C+KCK  GH  + CT  G      ESS + +   SS
Sbjct  625   VDKAKDSSIDHVMSGVTNASKSSFCRKCKDFGHATECCTVSGTQEFGAESSVIAT--SSS  682

Query  2319  REATNGPSDLKAAIEAARLRKPGICRKNRVADQSEDL--SASNMKSEIASQDQML-SSTV  2489
             +E  +  + LKAAI+AA LR+P I ++    DQ+ +   S++ +K E+ SQ Q+L SST+
Sbjct  683   KEEMHEGNRLKAAIQAALLRRPEIHKRKEAPDQTNEFPTSSTGLKREVTSQKQVLVSSTL  742

Query  2490  RRNVNGAEEAQKQE-------------TANNAKQLGII-AEASARTRNAGHVVFSDVKHS  2627
             + +++  E   KQE             +AN+ KQ+     +  ++ R +  V  +  K  
Sbjct  743   KNSISAEESNMKQEIIVNSTVETSKCPSANDLKQVKFCRTDFCSQLRKSDSVGPTSGKPV  802

Query  2628  VIDMERQTLVSMPVILK-TAIPEYQYIWQGGFEVQKSGKAFNLYDGIQAHLSSCASPKVL  2804
             V D+    +    ++ K + IPEY+YIWQG F+V ++G   +LY GIQAHLS+CASPKV 
Sbjct  803   VRDLPNNAMEISSILSKMSVIPEYEYIWQGVFKVHRNGMPPDLYTGIQAHLSACASPKVH  862

Query  2805  DAVNKFPRKVILNEVPRLSSWPMQFKECGVSEDNVALFFFAKDIGSYEKSYKVLLGDMVK  2984
             + V KF  +V LNEV RLS WP QF + G  EDN+AL+FFAKDI SYE+ YK LL  M++
Sbjct  863   EVVKKFLPEVSLNEVSRLSIWPSQFHQGGAKEDNIALYFFAKDIESYERYYKGLLDHMIR  922

Query  2985  HDLALQGNIGDIELLIFPSNQLPEKFQRWNLMFFLWGVFRGKRANSLQNFPGAEKPLI--  3158
             +DLAL+G    +ELLIF SNQLPE  QRWN++FFLWG+FRG+R N L +      P +  
Sbjct  923   NDLALRGTSDGVELLIFASNQLPEDSQRWNMLFFLWGIFRGRRINHLDSTKKICIPSLNV  982

Query  3159  ----QDIPTPATSLPENMFTP  3209
                 +D PT   +L E   +P
Sbjct  983   MPNEKDFPTAVMTLSETRCSP  1003


 Score = 55.5 bits (132),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 66/184 (36%), Positives = 86/184 (47%), Gaps = 22/184 (12%)
 Frame = +3

Query  3912  YGCNDQTSCSKDGF-------LSEMGGTAS-QLSRQKNERDEALSKTAILETPGNAEMFF  4067
             +GC D  S +++ F       ++++G  +S +  R K   DE +    I E  G  E  F
Sbjct  1236  HGCYD--SGARESFNGSFASLVNDLGSCSSGENKRCKKPCDEKI----IHEDLGAMERTF  1289

Query  4068  FPVDPHPVGNIGSNNSSMPWKVHPLEEDQLHDKAPNLELALGAKTKPLMSGIPSFLSGKV  4247
             FPVD          +S M         DQ     PNLEL LG +TKP   G+  F  G V
Sbjct  1290  FPVDTRK-----KKDSGMVLNEPRAYVDQFQVGIPNLELGLGGETKPSHKGMLPFFVGAV  1344

Query  4248  EKKIIEENTSDNAATSANKEDVsaslslslsFPFPEKEHGTSSKPEQEDPRRRQANTSLL  4427
             +KK  +E T D        E+V+ASLSLSLSFP   KEH    KP  +       N+  L
Sbjct  1345  DKKNSQEKTPDILTDEREDENVAASLSLSLSFPSSNKEH---VKPVTKAEDGHNVNSPYL  1401

Query  4428  LFGR  4439
             LFGR
Sbjct  1402  LFGR  1405



>ref|XP_006590863.1| PREDICTED: uncharacterized protein LOC100784908 isoform X5 [Glycine 
max]
 ref|XP_006590864.1| PREDICTED: uncharacterized protein LOC100784908 isoform X6 [Glycine 
max]
 ref|XP_006590865.1| PREDICTED: uncharacterized protein LOC100784908 isoform X7 [Glycine 
max]
Length=1405

 Score =   482 bits (1240),  Expect = 8e-141, Method: Compositional matrix adjust.
 Identities = 316/801 (39%), Positives = 435/801 (54%), Gaps = 113/801 (14%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNEHVNSG  1118
             CDICG  GRE LLAICSRC+DGAEHTYCM++MLEK+PEGDWLCEECK  +E  N  ++  
Sbjct  268   CDICGDAGREDLLAICSRCSDGAEHTYCMREMLEKVPEGDWLCEECKCAEETANRKLD--  325

Query  1119  RVNEKEKTSPSRRTTIAKSDHPLKMEQKTSDCWGDKAVEERSYLKTSGKRCTDDSEVSSP  1298
              + EK+    S  + I                              SGKR +   E+++ 
Sbjct  326   -IEEKKNHKVSSTSQI------------------------------SGKRPSQSMEIATA  354

Query  1299  TKRQRLE--LRSPTAQIPNRVTSLSRESSFKNLERGKVK------PLNPFSSGSFAAKVP  1454
              KRQ LE    SP A  P R+  LSRESSFK++++ K+K      P++    G       
Sbjct  355   AKRQALESSTGSPKASSPKRIVPLSRESSFKSMDKEKMKSGQQKIPMHNHLGGDDTELAR  414

Query  1455  S-STGPQPQPPRGIFSKSNSFSSLIAKPKVKLVDEVFPAKQKLSRETAFIESKEVAVRSM  1631
             S S GP+ Q  R    KSNSF++  +KP+VKLVDEV P KQK   E    ++ E     +
Sbjct  415   SLSAGPRSQNARSTLLKSNSFNN-NSKPRVKLVDEVVPQKQKGVVE-HISKNMETPAGMI  472

Query  1632  GKSMSFKPTTASRSNCTESKVKMFSPKFSHDQDVKWLRHKKDRSSFDRKNSLRSDR----  1799
              KSMSFK +   RSN  ESKVKM S K    QD+K  RH KD +SFDRK   + DR    
Sbjct  473   SKSMSFKLSNLGRSNAVESKVKMISSKPGTTQDLKASRHAKDSASFDRKFLSKIDRPVIC  532

Query  1800  --LAGGAISSPKSDNKPTPRGEPSSLSSLNTNRDYRALTSDNKPVTISNSTSGVAREVLK  1973
               +    +S+ K D K TP GE +  S++N NR+++ +  D K  ++S S +        
Sbjct  533   STMVSSVVSTSKGDPKLTPHGETAKPSTVNNNREFK-VNQDGKLYSLSKSMN--------  583

Query  1974  QASVDGVSSANRVSSSEENPSQAIPKEDSSSSSCVAERPSWSSNEVLPDGLSQSKESKAF  2153
                               N S   P+   SS     +R S S +E   D L +S+++   
Sbjct  584   ------------------NTSSKSPEPQVSS-----DRTSTSVDETQQDKLPRSQDTANQ  620

Query  2154  GDKTRESSASRSKQNSTASGKIVSCQKCKGNGHLAQVCTADG-----PESSALGSPFKSS  2318
              DK ++SS        T + K   C+KCK  GH  + CT  G      ESS + +   SS
Sbjct  621   VDKAKDSSIDHVMSGVTNASKSSFCRKCKDFGHATECCTVSGTQEFGAESSVIAT--SSS  678

Query  2319  REATNGPSDLKAAIEAARLRKPGICRKNRVADQSEDL--SASNMKSEIASQDQML-SSTV  2489
             +E  +  + LKAAI+AA LR+P I ++    DQ+ +   S++ +K E+ SQ Q+L SST+
Sbjct  679   KEEMHEGNRLKAAIQAALLRRPEIHKRKEAPDQTNEFPTSSTGLKREVTSQKQVLVSSTL  738

Query  2490  RRNVNGAEEAQKQE-------------TANNAKQLGII-AEASARTRNAGHVVFSDVKHS  2627
             + +++  E   KQE             +AN+ KQ+     +  ++ R +  V  +  K  
Sbjct  739   KNSISAEESNMKQEIIVNSTVETSKCPSANDLKQVKFCRTDFCSQLRKSDSVGPTSGKPV  798

Query  2628  VIDMERQTLVSMPVILK-TAIPEYQYIWQGGFEVQKSGKAFNLYDGIQAHLSSCASPKVL  2804
             V D+    +    ++ K + IPEY+YIWQG F+V ++G   +LY GIQAHLS+CASPKV 
Sbjct  799   VRDLPNNAMEISSILSKMSVIPEYEYIWQGVFKVHRNGMPPDLYTGIQAHLSACASPKVH  858

Query  2805  DAVNKFPRKVILNEVPRLSSWPMQFKECGVSEDNVALFFFAKDIGSYEKSYKVLLGDMVK  2984
             + V KF  +V LNEV RLS WP QF + G  EDN+AL+FFAKDI SYE+ YK LL  M++
Sbjct  859   EVVKKFLPEVSLNEVSRLSIWPSQFHQGGAKEDNIALYFFAKDIESYERYYKGLLDHMIR  918

Query  2985  HDLALQGNIGDIELLIFPSNQLPEKFQRWNLMFFLWGVFRGKRANSLQNFPGAEKPLI--  3158
             +DLAL+G    +ELLIF SNQLPE  QRWN++FFLWG+FRG+R N L +      P +  
Sbjct  919   NDLALRGTSDGVELLIFASNQLPEDSQRWNMLFFLWGIFRGRRINHLDSTKKICIPSLNV  978

Query  3159  ----QDIPTPATSLPENMFTP  3209
                 +D PT   +L E   +P
Sbjct  979   MPNEKDFPTAVMTLSETRCSP  999


 Score = 55.5 bits (132),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 66/184 (36%), Positives = 86/184 (47%), Gaps = 22/184 (12%)
 Frame = +3

Query  3912  YGCNDQTSCSKDGF-------LSEMGGTAS-QLSRQKNERDEALSKTAILETPGNAEMFF  4067
             +GC D  S +++ F       ++++G  +S +  R K   DE +    I E  G  E  F
Sbjct  1232  HGCYD--SGARESFNGSFASLVNDLGSCSSGENKRCKKPCDEKI----IHEDLGAMERTF  1285

Query  4068  FPVDPHPVGNIGSNNSSMPWKVHPLEEDQLHDKAPNLELALGAKTKPLMSGIPSFLSGKV  4247
             FPVD          +S M         DQ     PNLEL LG +TKP   G+  F  G V
Sbjct  1286  FPVDTRK-----KKDSGMVLNEPRAYVDQFQVGIPNLELGLGGETKPSHKGMLPFFVGAV  1340

Query  4248  EKKIIEENTSDNAATSANKEDVsaslslslsFPFPEKEHGTSSKPEQEDPRRRQANTSLL  4427
             +KK  +E T D        E+V+ASLSLSLSFP   KEH    KP  +       N+  L
Sbjct  1341  DKKNSQEKTPDILTDEREDENVAASLSLSLSFPSSNKEH---VKPVTKAEDGHNVNSPYL  1397

Query  4428  LFGR  4439
             LFGR
Sbjct  1398  LFGR  1401



>gb|KHN39855.1| Bromodomain adjacent to zinc finger domain protein 1A [Glycine 
soja]
Length=1411

 Score =   482 bits (1240),  Expect = 8e-141, Method: Compositional matrix adjust.
 Identities = 316/801 (39%), Positives = 435/801 (54%), Gaps = 113/801 (14%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNEHVNSG  1118
             CDICG  GRE LLAICSRC+DGAEHTYCM++MLEK+PEGDWLCEECK  +E  N  ++  
Sbjct  274   CDICGDAGREDLLAICSRCSDGAEHTYCMREMLEKVPEGDWLCEECKCAEETANRKLD--  331

Query  1119  RVNEKEKTSPSRRTTIAKSDHPLKMEQKTSDCWGDKAVEERSYLKTSGKRCTDDSEVSSP  1298
              + EK+    S  + I                              SGKR +   E+++ 
Sbjct  332   -IEEKKNHKVSSTSQI------------------------------SGKRPSQSMEIATA  360

Query  1299  TKRQRLE--LRSPTAQIPNRVTSLSRESSFKNLERGKVK------PLNPFSSGSFAAKVP  1454
              KRQ LE    SP A  P R+  LSRESSFK++++ K+K      P++    G       
Sbjct  361   AKRQALESSTGSPKASSPKRIVPLSRESSFKSMDKEKMKSGQQKIPMHNHLGGDDTELAR  420

Query  1455  S-STGPQPQPPRGIFSKSNSFSSLIAKPKVKLVDEVFPAKQKLSRETAFIESKEVAVRSM  1631
             S S GP+ Q  R    KSNSF++  +KP+VKLVDEV P KQK   E    ++ E     +
Sbjct  421   SLSAGPRSQNARSTLLKSNSFNN-NSKPRVKLVDEVVPQKQKGVVE-HISKNMETPAGMI  478

Query  1632  GKSMSFKPTTASRSNCTESKVKMFSPKFSHDQDVKWLRHKKDRSSFDRKNSLRSDR----  1799
              KSMSFK +   RSN  ESKVKM S K    QD+K  RH KD +SFDRK   + DR    
Sbjct  479   SKSMSFKLSNLGRSNAVESKVKMISSKPGTTQDLKASRHAKDSASFDRKFLSKIDRPVIC  538

Query  1800  --LAGGAISSPKSDNKPTPRGEPSSLSSLNTNRDYRALTSDNKPVTISNSTSGVAREVLK  1973
               +    +S+ K D K TP GE +  S++N NR+++ +  D K  ++S S +        
Sbjct  539   STMVSSVVSTSKGDPKLTPHGETAKPSTVNNNREFK-VNQDGKLYSLSKSMN--------  589

Query  1974  QASVDGVSSANRVSSSEENPSQAIPKEDSSSSSCVAERPSWSSNEVLPDGLSQSKESKAF  2153
                               N S   P+   SS     +R S S +E   D L +S+++   
Sbjct  590   ------------------NTSSKSPEPQVSS-----DRTSTSVDETQQDKLPRSQDTANQ  626

Query  2154  GDKTRESSASRSKQNSTASGKIVSCQKCKGNGHLAQVCTADG-----PESSALGSPFKSS  2318
              DK ++SS        T + K   C+KCK  GH  + CT  G      ESS + +   SS
Sbjct  627   VDKAKDSSIDHVMSGVTNASKSSFCRKCKDFGHATECCTVSGTQEFGAESSVIAT--SSS  684

Query  2319  REATNGPSDLKAAIEAARLRKPGICRKNRVADQSEDL--SASNMKSEIASQDQML-SSTV  2489
             +E  +  + LKAAI+AA LR+P I ++    DQ+ +   S++ +K E+ SQ Q+L SST+
Sbjct  685   KEEMHEGNRLKAAIQAALLRRPEIHKRKEAPDQTNEFPTSSTGLKREVTSQKQVLVSSTL  744

Query  2490  RRNVNGAEEAQKQE-------------TANNAKQLGII-AEASARTRNAGHVVFSDVKHS  2627
             + +++  E   KQE             +AN+ KQ+     +  ++ R +  V  +  K  
Sbjct  745   KNSISAEESNMKQEIIVNSTVETSKCPSANDLKQVKFCRTDFCSQLRKSDSVGPTSGKPV  804

Query  2628  VIDMERQTLVSMPVILK-TAIPEYQYIWQGGFEVQKSGKAFNLYDGIQAHLSSCASPKVL  2804
             V D+    +    ++ K + IPEY+YIWQG F+V ++G   +LY GIQAHLS+CASPKV 
Sbjct  805   VRDLPNNAMEISSILSKMSVIPEYEYIWQGVFKVHRNGMPPDLYTGIQAHLSACASPKVH  864

Query  2805  DAVNKFPRKVILNEVPRLSSWPMQFKECGVSEDNVALFFFAKDIGSYEKSYKVLLGDMVK  2984
             + V KF  +V LNEV RLS WP QF + G  EDN+AL+FFAKDI SYE+ YK LL  M++
Sbjct  865   EVVKKFLPEVSLNEVSRLSIWPSQFHQGGAKEDNIALYFFAKDIESYERYYKGLLDHMIR  924

Query  2985  HDLALQGNIGDIELLIFPSNQLPEKFQRWNLMFFLWGVFRGKRANSLQNFPGAEKPLI--  3158
             +DLAL+G    +ELLIF SNQLPE  QRWN++FFLWG+FRG+R N L +      P +  
Sbjct  925   NDLALRGTSDGVELLIFASNQLPEDSQRWNMLFFLWGIFRGRRINHLDSTKKICIPSLNV  984

Query  3159  ----QDIPTPATSLPENMFTP  3209
                 +D PT   +L E   +P
Sbjct  985   MPNEKDFPTAVMTLSETRCSP  1005


 Score = 55.5 bits (132),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 66/184 (36%), Positives = 86/184 (47%), Gaps = 22/184 (12%)
 Frame = +3

Query  3912  YGCNDQTSCSKDGF-------LSEMGGTAS-QLSRQKNERDEALSKTAILETPGNAEMFF  4067
             +GC D  S +++ F       ++++G  +S +  R K   DE +    I E  G  E  F
Sbjct  1238  HGCYD--SGARESFNGSFASLVNDLGSCSSGENKRCKKPCDEKI----IHEDLGAMERTF  1291

Query  4068  FPVDPHPVGNIGSNNSSMPWKVHPLEEDQLHDKAPNLELALGAKTKPLMSGIPSFLSGKV  4247
             FPVD          +S M         DQ     PNLEL LG +TKP   G+  F  G V
Sbjct  1292  FPVDTRK-----KKDSGMVLNEPRAYVDQFQVGIPNLELGLGGETKPSHKGMLPFFVGAV  1346

Query  4248  EKKIIEENTSDNAATSANKEDVsaslslslsFPFPEKEHGTSSKPEQEDPRRRQANTSLL  4427
             +KK  +E T D        E+V+ASLSLSLSFP   KEH    KP  +       N+  L
Sbjct  1347  DKKNSQEKTPDILTDEREDENVAASLSLSLSFPSSNKEH---VKPVTKAEDGHNVNSPYL  1403

Query  4428  LFGR  4439
             LFGR
Sbjct  1404  LFGR  1407



>ref|XP_006590859.1| PREDICTED: uncharacterized protein LOC100784908 isoform X1 [Glycine 
max]
 ref|XP_006590860.1| PREDICTED: uncharacterized protein LOC100784908 isoform X2 [Glycine 
max]
 ref|XP_006590861.1| PREDICTED: uncharacterized protein LOC100784908 isoform X3 [Glycine 
max]
Length=1411

 Score =   482 bits (1240),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 316/801 (39%), Positives = 435/801 (54%), Gaps = 113/801 (14%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNEHVNSG  1118
             CDICG  GRE LLAICSRC+DGAEHTYCM++MLEK+PEGDWLCEECK  +E  N  ++  
Sbjct  274   CDICGDAGREDLLAICSRCSDGAEHTYCMREMLEKVPEGDWLCEECKCAEETANRKLD--  331

Query  1119  RVNEKEKTSPSRRTTIAKSDHPLKMEQKTSDCWGDKAVEERSYLKTSGKRCTDDSEVSSP  1298
              + EK+    S  + I                              SGKR +   E+++ 
Sbjct  332   -IEEKKNHKVSSTSQI------------------------------SGKRPSQSMEIATA  360

Query  1299  TKRQRLE--LRSPTAQIPNRVTSLSRESSFKNLERGKVK------PLNPFSSGSFAAKVP  1454
              KRQ LE    SP A  P R+  LSRESSFK++++ K+K      P++    G       
Sbjct  361   AKRQALESSTGSPKASSPKRIVPLSRESSFKSMDKEKMKSGQQKIPMHNHLGGDDTELAR  420

Query  1455  S-STGPQPQPPRGIFSKSNSFSSLIAKPKVKLVDEVFPAKQKLSRETAFIESKEVAVRSM  1631
             S S GP+ Q  R    KSNSF++  +KP+VKLVDEV P KQK   E    ++ E     +
Sbjct  421   SLSAGPRSQNARSTLLKSNSFNN-NSKPRVKLVDEVVPQKQKGVVE-HISKNMETPAGMI  478

Query  1632  GKSMSFKPTTASRSNCTESKVKMFSPKFSHDQDVKWLRHKKDRSSFDRKNSLRSDR----  1799
              KSMSFK +   RSN  ESKVKM S K    QD+K  RH KD +SFDRK   + DR    
Sbjct  479   SKSMSFKLSNLGRSNAVESKVKMISSKPGTTQDLKASRHAKDSASFDRKFLSKIDRPVIC  538

Query  1800  --LAGGAISSPKSDNKPTPRGEPSSLSSLNTNRDYRALTSDNKPVTISNSTSGVAREVLK  1973
               +    +S+ K D K TP GE +  S++N NR+++ +  D K  ++S S +        
Sbjct  539   STMVSSVVSTSKGDPKLTPHGETAKPSTVNNNREFK-VNQDGKLYSLSKSMN--------  589

Query  1974  QASVDGVSSANRVSSSEENPSQAIPKEDSSSSSCVAERPSWSSNEVLPDGLSQSKESKAF  2153
                               N S   P+   SS     +R S S +E   D L +S+++   
Sbjct  590   ------------------NTSSKSPEPQVSS-----DRTSTSVDETQQDKLPRSQDTANQ  626

Query  2154  GDKTRESSASRSKQNSTASGKIVSCQKCKGNGHLAQVCTADG-----PESSALGSPFKSS  2318
              DK ++SS        T + K   C+KCK  GH  + CT  G      ESS + +   SS
Sbjct  627   VDKAKDSSIDHVMSGVTNASKSSFCRKCKDFGHATECCTVSGTQEFGAESSVIAT--SSS  684

Query  2319  REATNGPSDLKAAIEAARLRKPGICRKNRVADQSEDL--SASNMKSEIASQDQML-SSTV  2489
             +E  +  + LKAAI+AA LR+P I ++    DQ+ +   S++ +K E+ SQ Q+L SST+
Sbjct  685   KEEMHEGNRLKAAIQAALLRRPEIHKRKEAPDQTNEFPTSSTGLKREVTSQKQVLVSSTL  744

Query  2490  RRNVNGAEEAQKQE-------------TANNAKQLGII-AEASARTRNAGHVVFSDVKHS  2627
             + +++  E   KQE             +AN+ KQ+     +  ++ R +  V  +  K  
Sbjct  745   KNSISAEESNMKQEIIVNSTVETSKCPSANDLKQVKFCRTDFCSQLRKSDSVGPTSGKPV  804

Query  2628  VIDMERQTLVSMPVILK-TAIPEYQYIWQGGFEVQKSGKAFNLYDGIQAHLSSCASPKVL  2804
             V D+    +    ++ K + IPEY+YIWQG F+V ++G   +LY GIQAHLS+CASPKV 
Sbjct  805   VRDLPNNAMEISSILSKMSVIPEYEYIWQGVFKVHRNGMPPDLYTGIQAHLSACASPKVH  864

Query  2805  DAVNKFPRKVILNEVPRLSSWPMQFKECGVSEDNVALFFFAKDIGSYEKSYKVLLGDMVK  2984
             + V KF  +V LNEV RLS WP QF + G  EDN+AL+FFAKDI SYE+ YK LL  M++
Sbjct  865   EVVKKFLPEVSLNEVSRLSIWPSQFHQGGAKEDNIALYFFAKDIESYERYYKGLLDHMIR  924

Query  2985  HDLALQGNIGDIELLIFPSNQLPEKFQRWNLMFFLWGVFRGKRANSLQNFPGAEKPLI--  3158
             +DLAL+G    +ELLIF SNQLPE  QRWN++FFLWG+FRG+R N L +      P +  
Sbjct  925   NDLALRGTSDGVELLIFASNQLPEDSQRWNMLFFLWGIFRGRRINHLDSTKKICIPSLNV  984

Query  3159  ----QDIPTPATSLPENMFTP  3209
                 +D PT   +L E   +P
Sbjct  985   MPNEKDFPTAVMTLSETRCSP  1005


 Score = 55.5 bits (132),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 66/184 (36%), Positives = 86/184 (47%), Gaps = 22/184 (12%)
 Frame = +3

Query  3912  YGCNDQTSCSKDGF-------LSEMGGTAS-QLSRQKNERDEALSKTAILETPGNAEMFF  4067
             +GC D  S +++ F       ++++G  +S +  R K   DE +    I E  G  E  F
Sbjct  1238  HGCYD--SGARESFNGSFASLVNDLGSCSSGENKRCKKPCDEKI----IHEDLGAMERTF  1291

Query  4068  FPVDPHPVGNIGSNNSSMPWKVHPLEEDQLHDKAPNLELALGAKTKPLMSGIPSFLSGKV  4247
             FPVD          +S M         DQ     PNLEL LG +TKP   G+  F  G V
Sbjct  1292  FPVDTRK-----KKDSGMVLNEPRAYVDQFQVGIPNLELGLGGETKPSHKGMLPFFVGAV  1346

Query  4248  EKKIIEENTSDNAATSANKEDVsaslslslsFPFPEKEHGTSSKPEQEDPRRRQANTSLL  4427
             +KK  +E T D        E+V+ASLSLSLSFP   KEH    KP  +       N+  L
Sbjct  1347  DKKNSQEKTPDILTDEREDENVAASLSLSLSFPSSNKEH---VKPVTKAEDGHNVNSPYL  1403

Query  4428  LFGR  4439
             LFGR
Sbjct  1404  LFGR  1407



>ref|XP_010087452.1| DnAJ-like protein [Morus notabilis]
 gb|EXB29133.1| DnAJ-like protein [Morus notabilis]
Length=1795

 Score =   485 bits (1248),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 322/762 (42%), Positives = 446/762 (59%), Gaps = 71/762 (9%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNEHVNSG  1118
             CDICG  GRE +LA CSRC+DGAEHTYCM+KML K+P  +W+CEECKF +E+  +     
Sbjct  454   CDICGDAGREDMLATCSRCSDGAEHTYCMRKMLRKVPGRNWMCEECKFAEEINTQK----  509

Query  1119  RVNEKEKTSPSRRTTIAKSDHPLKMEQKTSDCWGDKAVEERSYLKTSGKRCTDDSEVSSP  1298
                EKE  S S+ +                              + S KR  ++ E +  
Sbjct  510   --QEKEGKSTSKASLST---------------------------QLSSKRLAENIEAAPV  540

Query  1299  TKRQRLE--LRSPTAQIPNRVTSLSRESSFKNLERGKVKPLNPFSSGSFAAKVPSSTGPQ  1472
              KRQ LE  + SP +  P R+ +LSRES FKNL++ + +P  P S G+ +      T   
Sbjct  541   AKRQSLETSIGSPKSSSPIRMAALSRESPFKNLDKERSRPAQPISVGNQSTNEMMETARS  600

Query  1473  P-QPPR----GIFSKSNSFSSLIAKPKVKLVDEVFPAKQKLSRETAFIESKEVAVRSMGK  1637
             P   PR    G   KSNSFS+  +KPKVKLVDEV P KQ   +E   ++ K+ + R +GK
Sbjct  601   PVAGPRLHNKGTLFKSNSFSATNSKPKVKLVDEVVPQKQNGGKEYTSLDRKDKSARIIGK  660

Query  1638  SMSFKPTTASRSNCTESKVKMFSPKFSHDQDVKWLRHKKDRSSFDRKNSLRSDR-----L  1802
             SMSFK   + RS+ ++SKVKM SP+ +   D K  +  K+R +F+RK+  R DR      
Sbjct  661   SMSFKSANSGRSSSSDSKVKMLSPRLALAIDTKGSKQAKERMAFERKSLSRLDRPPINST  720

Query  1803  AGGAISSPKSDNKPTPRGEPSSLSSLNTNRDYRALTSDNKPVTISNSTSGVAREVLK-QA  1979
                ++S+PK+D   T R E SS   ++ NR+ + + S+ K  T S ST  ++R+ ++   
Sbjct  721   TSSSVSTPKADQ--TSRVESSSF--VSNNRELK-VQSEGKSST-SKSTVNLSRKPVEIPI  774

Query  1980  SVDGVSSANRVSSS--EENPSQAIPKEDS-SSSSCVAERPSWSSNEVLPDGLSQSKESKA  2150
             +  GVSSA+ + ++  E   + A+ K+++ S+ S   E+PS + +  + DG ++ +E   
Sbjct  775   TAAGVSSASGMCNTAIEHKSNPAVFKDEALSTDSFTTEKPSNNIDGTMQDG-TRWQEIMH  833

Query  2151  FGDKTRESSASRSKQNSTASGKIVSCQKCKGNGHLAQVCTADGPESSAL-GSPFKSSREA  2327
               +K +E S SRS+   T S +   CQKCK  GH A  CT    E+S +  S  + SRE 
Sbjct  834   QTEKMKECS-SRSRPTVTTSSRSTFCQKCKEIGHSADFCTISSSETSGIDASAARGSREE  892

Query  2328  TNGPSDLKAAIEAARLRKPGICRKNRVADQSEDLSAS--NMKSEIASQDQM--LSSTVRR  2495
             T+  S LK AI AA LRKP I RK R  DQS++ S S  ++ SEI   DQ    S  +  
Sbjct  893   THRGSKLKDAIHAALLRKPEIQRKKRALDQSDEFSTSSRDLSSEITCLDQASNKSKIISP  952

Query  2496  NVNGAEEAQK-----QETANNAKQ---LGIIAEASARTRNAGHVVFSDVKHSVIDMERQT  2651
             +    EE Q        T NN  Q       A+ S++T +   +V S VK  V D+    
Sbjct  953   SEVTHEEPQSTLDSMHTTINNTMQHTAFTTNAKFSSKTGDLDALVSSTVKPVVKDLINHA  1012

Query  2652  LVSMPVILK-TAIPEYQYIWQGGFEVQKSGKAFNLYDGIQAHLSSCASPKVLDAVNKFPR  2828
             L + P +LK +AIPEY+YIW+G FEV +SG  F+L  GIQAHLS+CASP+V + V KFP 
Sbjct  1013  LATSPQLLKMSAIPEYEYIWRGTFEVHRSGSFFDLCAGIQAHLSTCASPRVPEVVCKFPH  1072

Query  2829  KVILNEVPRLSSWPMQFKECGVSEDNVALFFFAKDIGSYEKSYKVLLGDMVKHDLALQGN  3008
             K+ L EVPRLS+WP QF + G  EDN+AL+FFAKD+ SYE++YK LL  M+K+DLAL+GN
Sbjct  1073  KLSLIEVPRLSAWPTQFCDGGAKEDNIALYFFAKDLESYERNYKSLLDGMIKNDLALKGN  1132

Query  3009  IGDIELLIFPSNQLPEKFQRWNLMFFLWGVFRGKRANSLQNF  3134
             I  +ELLIFPSNQLPE  QRWN++FFLWGVFR +R +   +F
Sbjct  1133  IEGVELLIFPSNQLPENSQRWNMLFFLWGVFRARRTHCSDSF  1174


 Score = 59.3 bits (142),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 42/87 (48%), Positives = 53/87 (61%), Gaps = 9/87 (10%)
 Frame = +3

Query  4011  EALSKTAILETPGN-AEMFFFPVDPHPVGNIGSNNSSMPWKVHP---LEEDQLHDKAPNL  4178
             +A  +  ILE  G  AE  FFPVD    GNI   +S+ PWK  P   +++D+L D +PNL
Sbjct  1487  KACEEKVILEDLGTTAERRFFPVDSRQ-GNI---SSTPPWKTLPAGGVDDDRLLDGSPNL  1542

Query  4179  ELALGAKTKPLMS-GIPSFLSGKVEKK  4256
             ELALGA+TK   S GI  FL G  +KK
Sbjct  1543  ELALGAETKKQQSKGILPFLVGLADKK  1569



>ref|XP_006592006.1| PREDICTED: dentin sialophosphoprotein-like [Glycine max]
Length=1396

 Score =   473 bits (1218),  Expect = 7e-138, Method: Compositional matrix adjust.
 Identities = 314/801 (39%), Positives = 430/801 (54%), Gaps = 112/801 (14%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNEHVNSG  1118
             CDICG  GRE LLAICSRC+DGAEHTYCM++MLEK+PEGDWLCEECK  +E  N+     
Sbjct  250   CDICGDAGREDLLAICSRCSDGAEHTYCMREMLEKVPEGDWLCEECKCAEETANQK----  305

Query  1119  RVNEKEKTSPSRRTTIAKSDHPLKMEQKTSDCWGDKAVEERSYLKTSGKRCTDDSEVSSP  1298
                                   L +E+K       K  E RS  + SGKR +   E+++ 
Sbjct  306   ----------------------LDIEEK-------KNHEVRSTSRISGKRPSQSMEIATA  336

Query  1299  TKRQRL--ELRSPTAQIPNRVTSLSRESSFKNLERGKVK-----PLNPFSSGSFAAKVPS  1457
              KRQ L     SP A  P R+  L RESSFK++++GK+K     P+     G+      S
Sbjct  337   AKRQALGSSTGSPKASSPKRIVPLLRESSFKSMDKGKMKSGQQIPMCNHLGGNDTELARS  396

Query  1458  -STGPQPQPPRGIFSKSNSFSSLIAKPKVKLVDEVFPAKQKLSRETAFIESKEVAVRSMG  1634
              ST P+ Q  R    KSNSF++  +KP+VKLVDEV P KQK   E    ++ E     + 
Sbjct  397   LSTVPRGQNARSTLLKSNSFNNFNSKPRVKLVDEVIPQKQKGGVE-HISKNMETPAGMIS  455

Query  1635  KSMSFKPTTASRSNCTESKVKMFSPKFSHDQDVKWLRHKKDRSSFDRKNSLRSDR-----  1799
             KSMSFK +   RS   ESKVKM S K    +D+K  RH KD +SFDRK   + DR     
Sbjct  456   KSMSFKSSNLGRSIAVESKVKMMSSKPGTARDLKASRHTKDSASFDRKFLSKIDRPVICS  515

Query  1800  -LAGGAISSPKSDNKPTPRGEPSSLSSLNTNRDYRALTSDNKPVTISNSTSGVAREVLKQ  1976
              +    +S+ K D K TP GE +  S++N NR+++ +  D K  + S S +         
Sbjct  516   TMVSSVVSTSKGDQKLTPHGETAKPSTVNNNREFK-VNQDGKLYSSSKSIN---------  565

Query  1977  ASVDGVSSANRVSSSEENPSQAIPKEDSSSSSCVAERPSWSSNEVLPDGLSQSKESKAFG  2156
                              N S   P+   SS     +R S S +E   D L +S+++    
Sbjct  566   -----------------NTSSKSPEPQVSS-----DRTSTSVDETQQDRLPRSQDTANQV  603

Query  2157  DKTRESSASRSKQNSTASGKIVSCQKCKGNGHLAQVCTADG-----PESSALGSPFKSSR  2321
             DKT++SS+       T + K   C+KCK  GH  + CT  G      ESS + +   SS+
Sbjct  604   DKTKDSSSDHVTSGVTNASKSSFCRKCKDFGHATECCTVSGTQEFGAESSVIAT--SSSK  661

Query  2322  EATNGPSDLKAAIEAARLRKPGICRKNRVADQSEDL--SASNMKSEIASQDQML-SSTVR  2492
             +  +  + LKAAI+AA LR+P I ++    DQ+ +   S++ +K E+ SQ Q+L SST++
Sbjct  662   DEMHEGNRLKAAIQAALLRRPEIHKRKEAPDQTNEFPTSSTGLKREVTSQKQVLVSSTLK  721

Query  2493  RNVNGAEEAQKQE-------------TANNAKQLGII-AEASARTRNAGHVVFSDVKHSV  2630
               ++  E   KQE             +AN+ KQL     +  ++ R +     +  K  V
Sbjct  722   NGISAEESNMKQEIIENSTFETSKCPSANDLKQLEFCRTDVCSQLRKSDSAGPTSGKPVV  781

Query  2631  IDMERQTLVSMPVILK--TAIPEYQYIWQGGFEVQKSGKAFNLYDGIQAHLSSCASPKVL  2804
              D      + +  IL   + IPEY+ IWQG F V ++G   +LY GIQAHLS+CASPKV 
Sbjct  782   RDDFPNNAMEISSILSKMSVIPEYECIWQGVFVVHRNGMPPDLYTGIQAHLSACASPKVH  841

Query  2805  DAVNKFPRKVILNEVPRLSSWPMQFKECGVSEDNVALFFFAKDIGSYEKSYKVLLGDMVK  2984
             + V KF  +V LNEV RLS WP QF + G  EDN+AL+FFA+DI SYE+ YK LL  M++
Sbjct  842   EVVKKFLPEVSLNEVSRLSVWPSQFHQGGAKEDNIALYFFARDIESYERYYKGLLDHMIR  901

Query  2985  HDLALQGNIGDIELLIFPSNQLPEKFQRWNLMFFLWGVFRGKRANSLQNFPGAEKPLI--  3158
             +DLAL+G    +ELLIF SNQL E  QRWN++FFLWG+FRG+R N L +      P +  
Sbjct  902   NDLALRGTFDGVELLIFASNQLLEDSQRWNMLFFLWGIFRGRRINHLDSTKKICIPSLNV  961

Query  3159  ----QDIPTPATSLPENMFTP  3209
                 +D PT   +L E   +P
Sbjct  962   MPNEKDFPTAVMTLSETQCSP  982



>gb|KHN46480.1| Bromodomain adjacent to zinc finger domain protein 2B [Glycine 
soja]
Length=1420

 Score =   473 bits (1218),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 314/801 (39%), Positives = 430/801 (54%), Gaps = 112/801 (14%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNEHVNSG  1118
             CDICG  GRE LLAICSRC+DGAEHTYCM++MLEK+PEGDWLCEECK  +E  N+     
Sbjct  274   CDICGDAGREDLLAICSRCSDGAEHTYCMREMLEKVPEGDWLCEECKCAEETANQK----  329

Query  1119  RVNEKEKTSPSRRTTIAKSDHPLKMEQKTSDCWGDKAVEERSYLKTSGKRCTDDSEVSSP  1298
                                   L +E+K       K  E RS  + SGKR +   E+++ 
Sbjct  330   ----------------------LDIEEK-------KNHEVRSTSRISGKRPSQSMEIATA  360

Query  1299  TKRQRL--ELRSPTAQIPNRVTSLSRESSFKNLERGKVK-----PLNPFSSGSFAAKVPS  1457
              KRQ L     SP A  P R+  L RESSFK++++GK+K     P+     G+      S
Sbjct  361   AKRQALGSSTGSPKASSPKRIVPLLRESSFKSMDKGKMKSGQQIPMCNHLGGNDTELARS  420

Query  1458  -STGPQPQPPRGIFSKSNSFSSLIAKPKVKLVDEVFPAKQKLSRETAFIESKEVAVRSMG  1634
              ST P+ Q  R    KSNSF++  +KP+VKLVDEV P KQK   E    ++ E     + 
Sbjct  421   LSTVPRGQNARSTLLKSNSFNNFNSKPRVKLVDEVIPQKQKGGVE-HISKNMETPAGMIS  479

Query  1635  KSMSFKPTTASRSNCTESKVKMFSPKFSHDQDVKWLRHKKDRSSFDRKNSLRSDR-----  1799
             KSMSFK +   RS   ESKVKM S K    +D+K  RH KD +SFDRK   + DR     
Sbjct  480   KSMSFKSSNLGRSIAVESKVKMMSSKPGTARDLKASRHTKDSASFDRKFLSKIDRPVICS  539

Query  1800  -LAGGAISSPKSDNKPTPRGEPSSLSSLNTNRDYRALTSDNKPVTISNSTSGVAREVLKQ  1976
              +    +S+ K D K TP GE +  S++N NR+++ +  D K  + S S +         
Sbjct  540   TMVSSVVSTSKGDQKLTPHGETAKPSTVNNNREFK-VNQDGKLYSSSKSIN---------  589

Query  1977  ASVDGVSSANRVSSSEENPSQAIPKEDSSSSSCVAERPSWSSNEVLPDGLSQSKESKAFG  2156
                              N S   P+   SS     +R S S +E   D L +S+++    
Sbjct  590   -----------------NTSSKSPEPQVSS-----DRTSTSVDETQQDRLPRSQDTANQV  627

Query  2157  DKTRESSASRSKQNSTASGKIVSCQKCKGNGHLAQVCTADG-----PESSALGSPFKSSR  2321
             DKT++SS+       T + K   C+KCK  GH  + CT  G      ESS + +   SS+
Sbjct  628   DKTKDSSSDHVTSGVTNASKSSFCRKCKDFGHATECCTVSGTQEFGAESSVIAT--SSSK  685

Query  2322  EATNGPSDLKAAIEAARLRKPGICRKNRVADQSEDL--SASNMKSEIASQDQML-SSTVR  2492
             +  +  + LKAAI+AA LR+P I ++    DQ+ +   S++ +K E+ SQ Q+L SST++
Sbjct  686   DEMHEGNRLKAAIQAALLRRPEIHKRKEAPDQTNEFPTSSTGLKREVTSQKQVLVSSTLK  745

Query  2493  RNVNGAEEAQKQE-------------TANNAKQLGII-AEASARTRNAGHVVFSDVKHSV  2630
               ++  E   KQE             +AN+ KQL     +  ++ R +     +  K  V
Sbjct  746   NGISAEESNMKQEIIENSTFETSKCPSANDLKQLEFCRTDVCSQLRKSDSAGPTSGKPVV  805

Query  2631  IDMERQTLVSMPVILK--TAIPEYQYIWQGGFEVQKSGKAFNLYDGIQAHLSSCASPKVL  2804
              D      + +  IL   + IPEY+ IWQG F V ++G   +LY GIQAHLS+CASPKV 
Sbjct  806   RDDFPNNAMEISSILSKMSVIPEYECIWQGVFVVHRNGMPPDLYTGIQAHLSACASPKVH  865

Query  2805  DAVNKFPRKVILNEVPRLSSWPMQFKECGVSEDNVALFFFAKDIGSYEKSYKVLLGDMVK  2984
             + V KF  +V LNEV RLS WP QF + G  EDN+AL+FFA+DI SYE+ YK LL  M++
Sbjct  866   EVVKKFLPEVSLNEVSRLSVWPSQFHQGGAKEDNIALYFFARDIESYERYYKGLLDHMIR  925

Query  2985  HDLALQGNIGDIELLIFPSNQLPEKFQRWNLMFFLWGVFRGKRANSLQNFPGAEKPLI--  3158
             +DLAL+G    +ELLIF SNQL E  QRWN++FFLWG+FRG+R N L +      P +  
Sbjct  926   NDLALRGTFDGVELLIFASNQLLEDSQRWNMLFFLWGIFRGRRINHLDSTKKICIPSLNV  985

Query  3159  ----QDIPTPATSLPENMFTP  3209
                 +D PT   +L E   +P
Sbjct  986   MPNEKDFPTAVMTLSETQCSP  1006



>gb|KCW90977.1| hypothetical protein EUGRSUZ_A02991 [Eucalyptus grandis]
Length=1433

 Score =   470 bits (1210),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 424/1271 (33%), Positives = 598/1271 (47%), Gaps = 210/1271 (17%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNEHVNSG  1118
             CDICG  GRE LLAICSRC+DGAEHTYCM++ML+K+PEGDW+CEECK   E         
Sbjct  263   CDICGDAGREDLLAICSRCSDGAEHTYCMREMLQKVPEGDWVCEECKSADE---------  313

Query  1119  RVNEKEKTSPSRRTTIAKSDHPLKMEQKTSDCWGDKAVEERSYLKTSGKRCTDDSEVSSP  1298
               NE +K                 +E KT                    R T  S+V   
Sbjct  314   --NENQKPG---------------IEGKTL------------------SRVTSASQVPDK  338

Query  1299  TKRQRLELRSPTAQIPN---------RVTSLSRESSFKNLERGKVKPLNPFSSGSFAAKV  1451
             +  + +E+ SPT   P          RVTS SR+S FKN+++GK K     S  +     
Sbjct  339   SFVENIEV-SPTVIGPGSSKLCGSTRRVTS-SRDSCFKNIDKGKAKLARQMSCVNSVQDF  396

Query  1452  P-SSTGPQPQPPR--GIFSKSNSFSSLIAKPKVKLVDEVFPAKQKLSRETAFIESKEVAV  1622
             P  +  PQP   R  G   KSNSF++ IAKPKVK++DE    K K  RE +   SKE   
Sbjct  397   PEGARSPQPSNLRSKGTLLKSNSFNAFIAKPKVKVIDEGMIQKHKSIRENSSFISKEGPT  456

Query  1623  RSMGKSMSFKPTTASRSNCTESKVKMFSPKFSHDQDVKWLRHKKDRSSFDRKNSLRSDRL  1802
             + +GKSMSFK     R    ++KVKM   K +H Q  K  ++ K+ S  DR +  + DR 
Sbjct  457   KIIGKSMSFKHANPGRPLAVDAKVKMLPTKLTHVQTPKGSKNLKEGSVLDRMSLRKLDRT  516

Query  1803  AGGAI------SSPKSDNKPTPRGEPSSLSSLNTNRDYRALTSDNKPVTISNSTSGVARE  1964
                        S+P SD K T  GEP   S L+ NRD +   SD KP  +          
Sbjct  517   FSSLTRDNSTPSTPNSDQKLTSCGEPLQGSPLSNNRDSKLAQSDVKPAVL----------  566

Query  1965  VLKQASVDGVSSANRVSSSEENPSQAIPKEDS-SSSSCVAERPSWSSNEVLPDGLSQSKE  2141
                            V S+E   +Q   KE+  +SSS   E+     N +  DGLS+SK 
Sbjct  567   ---------------VKSAEYKSNQLDQKEEPLTSSSRTVEKHCIEGNGLRHDGLSRSKG  611

Query  2142  SKAFGDKTRESSASRSKQNSTASGKIVSCQKCKGNGHLAQVCTADGPESSALGSPFKSSR  2321
                  DK R+ S SRSK    +  + + CQKCK  GH A+ C     +     S  +S +
Sbjct  612   LANHTDKARDCSVSRSKPAVISGSRSIFCQKCKEVGHDAESCPVSSLQVGTDVSMTRSMK  671

Query  2322  EATNGPSDLKAAIEAARLRKPGICRKNRVADQSEDLSASNMKSEIASQDQMLSSTVRRNV  2501
             E T   S  K  I ++ L+KPG  R+N+  ++SEDLS S+        D +    V R V
Sbjct  672   EETYNSSKTKTPITSSMLKKPG--RRNKGPEKSEDLSVSSP----THMDPLSFPDVSRKV  725

Query  2502  ---NGAEEAQK-----------QETANNAKQLGIIAEASARTRNAGHVVFSDVKHSVIDM  2639
                +G  E Q            Q   NNA QL    +  A +    ++ F+         
Sbjct  726   MSADGPYEGQAVRQSCTSDSRLQMIGNNATQL-TGPQKGATSLKGANIDFTRHPEGSSSS  784

Query  2640  ERQTLVSMP--VILKTAIPEYQYIWQGGFEVQKSGKAFNLYDGIQAHLSSCASPKVLDAV  2813
                 +  +P  +   +AIPE++ IW+G  EV +  +  +   G+QAHLS+ AS +VLD V
Sbjct  785   HLPCVSVLPSAICRISAIPEHECIWRGSLEVCRGSQQLDFCGGLQAHLSTLASTRVLDMV  844

Query  2814  NKFPRKVILNEVPRLSSWPMQFKECGVSEDNVALFFFAKDIGSYEKSYKVLLGDMVKHDL  2993
              KF  K+ L+EVPR  +WP QF + G  +DN+AL+FFA+D  SYE+SYK LL  M+K DL
Sbjct  845   KKFSDKLSLSEVPRSCTWPTQFYDSGAQDDNIALYFFAEDPESYERSYKGLLEKMIKSDL  904

Query  2994  ALQGNIGDIELLIFPSNQLPEKFQRWNLMFFLWGVFRGKRANSLQNFPGAEKP-------  3152
             AL+GN   +ELLIFPSNQLPEK QRWN +F+LWGVFRG      +N  G+E+        
Sbjct  905   ALKGNFDGVELLIFPSNQLPEKSQRWNTLFYLWGVFRG------RNVIGSEQQSGSSLKS  958

Query  3153  -------LIQDIPTPATSLPENMFTPVPKLNSA----------RGSAATNTEMSAVKESE  3281
                     + +   P + +P +    +PK N            + S + N  + + + + 
Sbjct  959   SISTSNVTLPEKDIPPSVVPSSNKLSLPKCNGENLPPCGKYCEQSSPSGNPSLGSSQITP  1018

Query  3282  SASLHKIVNGNCSIQSSSQVSRDKC-SRINAEQNDKLDSSSMQNSEPKLGPDRRYFGVPL  3458
             S+     +NGNC  + SS      C + ++ E++   DS  +  S       ++    P 
Sbjct  1019  SS---MAMNGNCHAKDSSIDKMRICLNEVSIEEDSGHDSIDLHGSFTSSDWSKQQKKCP-  1074

Query  3459  GEAVHSSVQTAE-RVSSPNTSRPMSVHWAAPLDGEKLSMLSDETPTMQEATSVG---STT  3626
                     QT++  VS  +   PM +           S   D+   MQ ATS     S +
Sbjct  1075  --------QTSQNEVSGSDAIVPMELQPYVTTGAH--SSAEDDKMLMQCATSPDRKVSLS  1124

Query  3627  KNLCGK-------------DDVKIGRICLDN---------VSTEEAT-PLARHTSMEQ--  3731
              +L G              ++VK+ RI  +          V  E  T  + +H   EQ  
Sbjct  1125  HSLLGGIRNSREQELHGMGNEVKLDRILKEEDRLMDRGAAVDVESTTFDVLKHLQHEQKQ  1184

Query  3732  ---------TLNVISSFGVNPKKRSHS--AETVLQsasssgtsqafssysNDDILVEEFC  3878
                      TL+V+     + KKR HS   ET LQ++  +    A+++ S++++ +E   
Sbjct  1185  GAALEVESTTLDVLKHLQ-HEKKRRHSDLVETALQTSFGTNEKVAWNNVSSENVKIEHV-  1242

Query  3879  HKRVKLNSDRSYGCNDQTSCS-KDGFLSEMGGTASQLSRQKNERDEALSKTAILETPGNA  4055
              K+ K +    Y  +     +  DGF S+     S L+  +   ++   +   LE  G A
Sbjct  1243  DKKQKTDCREIYEASRPIDANLVDGFASQKSAQDSTLAVVEKLHNKVCDEPINLENTGTA  1302

Query  4056  EMFFFPVDPHPVGNIGSNNSSMPWKVHPLE-EDQLHDKAPNLELALGAKTKPLMSGIPSF  4232
             E FFFPV  +   ++ S  SSMPWK  P     + HD  PNL+LALGAKTK    G+   
Sbjct  1303  ERFFFPVLSNHAKDLTSAESSMPWKTLPSSVPARSHDGVPNLDLALGAKTKSSNKGLLPL  1362

Query  4233  LSGKVEKKIIEENTSDNAATSANKED-VsaslslslsFPFPEKEHGTSSKPEQED--PRR  4403
               G     + +++ S   A +A +ED VS SLSLSLSFPFP+ + G    P+ E   P  
Sbjct  1363  WIG-----VADKSDSHPEAVAAQEEDPVSGSLSLSLSFPFPDSDKGFKPVPDAEQLLPES  1417

Query  4404  RQANTSLLLFG  4436
             R+ NTSLLLFG
Sbjct  1418  RRVNTSLLLFG  1428



>ref|XP_004307841.1| PREDICTED: uncharacterized protein LOC101314703 [Fragaria vesca 
subsp. vesca]
Length=1361

 Score =   466 bits (1200),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 313/787 (40%), Positives = 447/787 (57%), Gaps = 82/787 (10%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNEHVNSG  1118
             CDICG  GRE  LA CSRC+DGAEH YCM+K L ++P+GDW CEECKF ++ +N+     
Sbjct  254   CDICGDAGREEQLATCSRCSDGAEHIYCMRKKLWRVPKGDWFCEECKFAEQTENQK----  309

Query  1119  RVNEKEKTSPSRRTTIAKSDHPLKMEQKTSDCWGDKAVEERSYLKTSGKRCTDDSEVSSP  1298
                                           D +G++  +     + S KR  D+++ +  
Sbjct  310   -----------------------------QDIYGNRTKKAILSTQLSNKRRADNTDAAPS  340

Query  1299  TKRQRLELR--SPTAQIPNRVTSLSRESSFKNLERGKVKP-LNPFSSGSFAAKVPSS---  1460
             +KRQ LE R  SP    P R  +LSRESSFK++++ K+K   + + + +    V  +   
Sbjct  341   SKRQTLETRVGSPKPSSPKRTVALSRESSFKSMDKDKLKSDKSAYQTSTTTNDVSETVRS  400

Query  1461  --TGPQPQPPRGIFSKSNSFSSLIAKPKVKLVDEVFPAKQKLSRETAFIESKEVAVRSMG  1634
               TGP+ Q  +G   KSNSF+ + +KPKVK VD + P KQK S+E   ++ KE   R MG
Sbjct  401   PTTGPRLQTAKGALLKSNSFN-MYSKPKVKPVDNIVPQKQKGSKEHISVDMKERTARMMG  459

Query  1635  KSMSFKPTTASRSNCTESKVKMFSPKFSHDQDVKWLRHKKDRSSFDRKNSLRSDRLAGGA  1814
             KS+SF+   + RS+  +SKVKM   KF+  QD+K ++  K+RS+ +RKN  + +R   G 
Sbjct  460   KSVSFRSPDSGRSSVPDSKVKMLPSKFNPLQDLKGVKQVKERSTVERKNLSKLERPLVGL  519

Query  1815  ISSPKSDNKPTPRGEPSSLSSLNTNRDYRALTSDNKPVTISNSTSGVA-REVLKQASVDG  1991
              +S  + + P        LSS+++ R+++AL SD K  T S + SG+  + V  Q+S  G
Sbjct  520   TTSSATVSTPKVDQASHLLSSVSSLREHKALPSDGKLSTSSKAISGLTLKGVEAQSSPGG  579

Query  1992  VSSANRVSS--SEENPSQAIPKEDSSSSSCVAERPSWSSNEVLPDGLSQSKESKAFGDKT  2165
              S  + + S  SE+  +Q I   + S +   +E       +VL     +S E     DKT
Sbjct  580   SSPTSGMCSAASEQKSNQIISNNEPSDAEGKSE-------DVL-----RSWEMTNQTDKT  627

Query  2166  RESSASRSKQNSTASGKIVSCQKCKGNGHLAQVCTADGPESSALG---SPFKSSREATNG  2336
             RE S   S+    AS K + C  CK  GH A  C +    S  +G   SP  S RE    
Sbjct  628   REGSVC-SRPIVAASPKGLFCSICKEIGHTADSCKSGI--SQDIGTDVSPPTSYREEVPR  684

Query  2337  PSDLKAAIEAARLRKPGICRKNRVADQSEDLSASNMKS--EIASQD---QMLSSTVRRNV  2501
              S LK AI+AA LRKP I RK  V +Q ++LS SNM+S  E+A  +    ML++ +    
Sbjct  685   SSRLKDAIQAALLRKPEIYRKKTVLEQCDELSVSNMESSNEVAPPECVSNMLNNYM--CT  742

Query  2502  NGAEEAQ-----KQETANNAKQLGIIAEA--SARTRNAGHVVFSDVKHSVIDMERQTLVS  2660
              G+ + Q        T++  K     A +   +R  ++G VV    K ++ +++R   + 
Sbjct  743   EGSHDGQAIPGISTSTSDFYKNTLHPANSVVPSRVVDSGSVVPFLGKSTMRNLQRHASMG  802

Query  2661  MPVILKT-AIPEYQYIWQGGFEVQKSGKAFNLYDGIQAHLSSCASPKVLDAVNKFPRKVI  2837
             M  + KT AIPEY++IWQG FE+Q+ G   ++  GIQAHLS+CASPKVL+ VNKFP KV 
Sbjct  803   MSFLTKTTAIPEYEHIWQGSFELQRGGNILDICGGIQAHLSTCASPKVLEVVNKFPHKVP  862

Query  2838  LNEVPRLSSWPMQFKECGVSEDNVALFFFAKDIGSYEKSYKVLLGDMVKHDLALQGNIGD  3017
             L EVPRLS WP QF + GV EDN+AL+FFAKD+ SYE++YK+L+  M+K+DLAL+G  G 
Sbjct  863   LKEVPRLSVWPTQFHQSGVKEDNIALYFFAKDLESYERNYKILIDAMIKNDLALKGKFGG  922

Query  3018  IELLIFPSNQLPEKFQRWNLMFFLWGVFRGKRANSLQNFPGAEKP---LIQDIPTPATSL  3188
             +ELLI PSNQLPEK QRWN+++FLWGVFR  R + + +    + P   L  DIPT  T +
Sbjct  923   VELLILPSNQLPEKSQRWNMLYFLWGVFRETRVHYIDSTRKVDLPDVSLDNDIPTVMT-V  981

Query  3189  PENMFTP  3209
              +N+  P
Sbjct  982   AKNLHVP  988


 Score = 65.1 bits (157),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 57/145 (39%), Positives = 77/145 (53%), Gaps = 6/145 (4%)
 Frame = +3

Query  4011  EALSKTAILETPGNAEMFFFPVDPHPVGNIGSNNSSMPWKVHPLEEDQLHDKAPNLELAL  4190
             E   +  I E  G  E  FFPV+   +     +NS +PWK     ++   D  P+LELAL
Sbjct  1215  EECDEKVIPEDLGTTERHFFPVESRNIQEFRMDNS-LPWKNFSSGKEDKSDGFPSLELAL  1273

Query  4191  GAKTK-PLMSGIPSFLSGKVEKKIIEENTSDNAATSANKEDVsaslslslsFPFPEKEHG  4367
              A+TK P    +P F+    E+   + +    A     ++D+SASLSLSLSFPFP++E  
Sbjct  1274  RAETKSPSKGNLPFFVGLGDERDNQDRHLEKTAG--EKEDDISASLSLSLSFPFPDEEQP  1331

Query  4368  TS--SKPEQEDPRRRQANTSLLLFG  4436
                 +K EQ  P R   NTSLLLFG
Sbjct  1332  VKPVTKSEQLVPERHHVNTSLLLFG  1356



>ref|XP_007131494.1| hypothetical protein PHAVU_011G017900g [Phaseolus vulgaris]
 ref|XP_007131495.1| hypothetical protein PHAVU_011G017900g [Phaseolus vulgaris]
 gb|ESW03488.1| hypothetical protein PHAVU_011G017900g [Phaseolus vulgaris]
 gb|ESW03489.1| hypothetical protein PHAVU_011G017900g [Phaseolus vulgaris]
Length=1419

 Score =   466 bits (1199),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 313/798 (39%), Positives = 430/798 (54%), Gaps = 107/798 (13%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNEHVNSG  1118
             CDICG  GRE LLAICSRC+DGAEHTYCM++ML K+PEGDWLCEECK  +E  N      
Sbjct  277   CDICGDAGREDLLAICSRCSDGAEHTYCMREMLVKLPEGDWLCEECKCVEETAN------  330

Query  1119  RVNEKEKTSPSRRTTIAKSDHPLKMEQKTSDCWGDKAVEERSYLKTSGKRCTDDSEVSSP  1298
                        RR         L +E+K       K  +  S  + SGKR +   E+++ 
Sbjct  331   -----------RR---------LVIEEK-------KLHKVISASQISGKRPSQSMEIATA  363

Query  1299  TKRQRLE--LRSPTAQIPNRVTSLSRESSFKNLERGKVK-----PLNPFSSGSFAAKVPS  1457
              KRQ LE    SP A  P R+ SLSRESS K++++GK+K     P+     G       S
Sbjct  364   AKRQALESSTGSPKASSPKRIVSLSRESSLKSMDKGKMKSGQQVPVRNHHGGDDVDLARS  423

Query  1458  -STGPQPQPPRGIFSKSNSFSSLIAKPKVKLVDEVFPAKQKLSRETAFIESKEVAVRSMG  1634
              STGP+ Q PR    KSNSF++  +KP++KLVDEV P KQK   E    ++ E     + 
Sbjct  424   LSTGPRSQNPRSTLLKSNSFNNFNSKPRIKLVDEVVPQKQKGGVE-HISKNLEKPTGMIS  482

Query  1635  KSMSFKPTTASRSNCTESKVKMFSPKFSHDQDVKWLRHKKDRSSFDRKNSLRSDR-----  1799
             KSMSFK +   RSN  ESKVK    K    QD K LRH K+  S D+K   + DR     
Sbjct  483   KSMSFKSSHLGRSNTNESKVKSSFSKHGIVQDSKALRHTKELGSLDKKFQPKIDRPVIHS  542

Query  1800  LAGGAISSPKSDNKPTPRGEPSSLSSLNTNRDYRALTSDNKPVTISNSTSGVAREVLKQA  1979
                 ++S+ K D+K  P GE +   ++N NR+++ +  D K  ++S S S          
Sbjct  543   TMVSSVSTSKGDHKLAPLGETAKPYTVNNNREFK-VNQDGKVYSLSKSMS----------  591

Query  1980  SVDGVSSANRVSSSEENPSQAIPKEDSSSSSCVAERPSWSSNEVLPDGLSQSKESKAFGD  2159
                             N     P+   SS     ++ S S NE   D L +S E+    D
Sbjct  592   ----------------NTGSRSPEPQVSS-----DKTSTSVNETQQDRLPRSHETVNHVD  630

Query  2160  KTRESSASRSKQNSTASGKIVSCQKCKGNGHLAQVCTADGPE---SSALGSPFKSSREAT  2330
             +T++SS+   +   T + K   C+KCK  GH  + C+  G +   + A  +   SS+E  
Sbjct  631   RTKDSSSDHVRSGVTNASKSSFCRKCKDFGHATECCSISGTQEFVAEASVTATSSSKEEM  690

Query  2331  NGPSDLKAAIEAARLRKPGICRKNRVADQSEDLSAS--NMKSEIASQDQML-SSTVRRNV  2501
             +  + LKAAI+AA LR+P I +K    D++ +   S    K E+ SQ+Q+L SST++ ++
Sbjct  691   HKGNRLKAAIQAALLRRPEIHKKKEGPDETNEFPTSIIGFKREVTSQNQVLVSSTLKNSI  750

Query  2502  NGAEEAQKQE-------------TANNAKQLGII-AEASARTRNAGHVVFSDVKHSVIDM  2639
                E   KQE             +AN+ KQL     +  ++ R +  V  +  +  V D+
Sbjct  751   YAEETNVKQEIVESSSFETTKCPSANDPKQLKFFQTDICSQLRKSDFVGLTSGEPVVRDL  810

Query  2640  ERQTLVSMPVILK-TAIPEYQYIWQGGFEVQKSGK-AFNLYDGIQAHLSSCASPKVLDAV  2813
                 +V   V+ K + IPEY+YIWQG FEV ++GK   +LY GIQAHLS+CASPKV++ V
Sbjct  811   ANNGMVLSSVLSKMSVIPEYEYIWQGVFEVHRNGKPPPDLYAGIQAHLSACASPKVIETV  870

Query  2814  NKFPRKVILNEVPRLSSWPMQFKECGVSEDNVALFFFAKDIGSYEKSYKVLLGDMVKHDL  2993
               F  +V LNEV RLS WP QF + G  EDN+AL+FFAKD  SYE+ YK LL  M+++DL
Sbjct  871   RNFSPEVSLNEVSRLSIWPSQFHQSGAKEDNIALYFFAKDTESYERHYKGLLDHMIRNDL  930

Query  2994  ALQGNIGDIELLIFPSNQLPEKFQRWNLMFFLWGVFRGKRANSLQNFPGAEKPLI-----  3158
             AL+G  G +ELLIF SNQLPE  QRWN++FFLWG FRG+R N   +      P +     
Sbjct  931   ALRGMFGGVELLIFASNQLPEDSQRWNMLFFLWGTFRGRRINHSNSTKSKCIPSLNVMPN  990

Query  3159  -QDIPTPATSLPENMFTP  3209
              +D P+   +L E   +P
Sbjct  991   EKDFPSAVMTLSETWCSP  1008


 Score = 55.5 bits (132),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 63/151 (42%), Positives = 73/151 (48%), Gaps = 18/151 (12%)
 Frame = +3

Query  4011  EALSKTAILETPGNAEMFFFPVDPHPVGNIGSNNSSMPWKVHPLEE-----DQLHDKAPN  4175
             EA  +  I E  G  E  FFPVD     N    NS M      L       DQ     PN
Sbjct  1275  EACDEKIIHEDLGTMERTFFPVD-----NRNKLNSGMVVNRESLNGAGEYVDQFEVGIPN  1329

Query  4176  LELALGAKTKPLMSGIPSFLSGKVEKKIIEENTSDNAATSANKEDVsaslslslsFPFPE  4355
             LELALG +TKP    +  F  G V+KKI  E T D      + E+V+ASLSLSLSFP   
Sbjct  1330  LELALGGETKPSHKSMLPFFVGAVDKKINPEKTPD---IERDDENVAASLSLSLSFPSSS  1386

Query  4356  KEHG---TSSKPEQEDPRRRQANTSLLLFGR  4439
             KEH    T ++P   D     A +S LLFGR
Sbjct  1387  KEHMKPVTKNEPLPTDG--HNAKSSFLLFGR  1415



>ref|XP_007131491.1| hypothetical protein PHAVU_011G017900g [Phaseolus vulgaris]
 gb|ESW03485.1| hypothetical protein PHAVU_011G017900g [Phaseolus vulgaris]
Length=1433

 Score =   466 bits (1200),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 313/798 (39%), Positives = 430/798 (54%), Gaps = 107/798 (13%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNEHVNSG  1118
             CDICG  GRE LLAICSRC+DGAEHTYCM++ML K+PEGDWLCEECK  +E  N      
Sbjct  291   CDICGDAGREDLLAICSRCSDGAEHTYCMREMLVKLPEGDWLCEECKCVEETAN------  344

Query  1119  RVNEKEKTSPSRRTTIAKSDHPLKMEQKTSDCWGDKAVEERSYLKTSGKRCTDDSEVSSP  1298
                        RR         L +E+K       K  +  S  + SGKR +   E+++ 
Sbjct  345   -----------RR---------LVIEEK-------KLHKVISASQISGKRPSQSMEIATA  377

Query  1299  TKRQRLE--LRSPTAQIPNRVTSLSRESSFKNLERGKVK-----PLNPFSSGSFAAKVPS  1457
              KRQ LE    SP A  P R+ SLSRESS K++++GK+K     P+     G       S
Sbjct  378   AKRQALESSTGSPKASSPKRIVSLSRESSLKSMDKGKMKSGQQVPVRNHHGGDDVDLARS  437

Query  1458  -STGPQPQPPRGIFSKSNSFSSLIAKPKVKLVDEVFPAKQKLSRETAFIESKEVAVRSMG  1634
              STGP+ Q PR    KSNSF++  +KP++KLVDEV P KQK   E    ++ E     + 
Sbjct  438   LSTGPRSQNPRSTLLKSNSFNNFNSKPRIKLVDEVVPQKQKGGVE-HISKNLEKPTGMIS  496

Query  1635  KSMSFKPTTASRSNCTESKVKMFSPKFSHDQDVKWLRHKKDRSSFDRKNSLRSDR-----  1799
             KSMSFK +   RSN  ESKVK    K    QD K LRH K+  S D+K   + DR     
Sbjct  497   KSMSFKSSHLGRSNTNESKVKSSFSKHGIVQDSKALRHTKELGSLDKKFQPKIDRPVIHS  556

Query  1800  LAGGAISSPKSDNKPTPRGEPSSLSSLNTNRDYRALTSDNKPVTISNSTSGVAREVLKQA  1979
                 ++S+ K D+K  P GE +   ++N NR+++ +  D K  ++S S S          
Sbjct  557   TMVSSVSTSKGDHKLAPLGETAKPYTVNNNREFK-VNQDGKVYSLSKSMS----------  605

Query  1980  SVDGVSSANRVSSSEENPSQAIPKEDSSSSSCVAERPSWSSNEVLPDGLSQSKESKAFGD  2159
                             N     P+   SS     ++ S S NE   D L +S E+    D
Sbjct  606   ----------------NTGSRSPEPQVSS-----DKTSTSVNETQQDRLPRSHETVNHVD  644

Query  2160  KTRESSASRSKQNSTASGKIVSCQKCKGNGHLAQVCTADGPE---SSALGSPFKSSREAT  2330
             +T++SS+   +   T + K   C+KCK  GH  + C+  G +   + A  +   SS+E  
Sbjct  645   RTKDSSSDHVRSGVTNASKSSFCRKCKDFGHATECCSISGTQEFVAEASVTATSSSKEEM  704

Query  2331  NGPSDLKAAIEAARLRKPGICRKNRVADQSEDLSAS--NMKSEIASQDQML-SSTVRRNV  2501
             +  + LKAAI+AA LR+P I +K    D++ +   S    K E+ SQ+Q+L SST++ ++
Sbjct  705   HKGNRLKAAIQAALLRRPEIHKKKEGPDETNEFPTSIIGFKREVTSQNQVLVSSTLKNSI  764

Query  2502  NGAEEAQKQE-------------TANNAKQLGII-AEASARTRNAGHVVFSDVKHSVIDM  2639
                E   KQE             +AN+ KQL     +  ++ R +  V  +  +  V D+
Sbjct  765   YAEETNVKQEIVESSSFETTKCPSANDPKQLKFFQTDICSQLRKSDFVGLTSGEPVVRDL  824

Query  2640  ERQTLVSMPVILK-TAIPEYQYIWQGGFEVQKSGK-AFNLYDGIQAHLSSCASPKVLDAV  2813
                 +V   V+ K + IPEY+YIWQG FEV ++GK   +LY GIQAHLS+CASPKV++ V
Sbjct  825   ANNGMVLSSVLSKMSVIPEYEYIWQGVFEVHRNGKPPPDLYAGIQAHLSACASPKVIETV  884

Query  2814  NKFPRKVILNEVPRLSSWPMQFKECGVSEDNVALFFFAKDIGSYEKSYKVLLGDMVKHDL  2993
               F  +V LNEV RLS WP QF + G  EDN+AL+FFAKD  SYE+ YK LL  M+++DL
Sbjct  885   RNFSPEVSLNEVSRLSIWPSQFHQSGAKEDNIALYFFAKDTESYERHYKGLLDHMIRNDL  944

Query  2994  ALQGNIGDIELLIFPSNQLPEKFQRWNLMFFLWGVFRGKRANSLQNFPGAEKPLI-----  3158
             AL+G  G +ELLIF SNQLPE  QRWN++FFLWG FRG+R N   +      P +     
Sbjct  945   ALRGMFGGVELLIFASNQLPEDSQRWNMLFFLWGTFRGRRINHSNSTKSKCIPSLNVMPN  1004

Query  3159  -QDIPTPATSLPENMFTP  3209
              +D P+   +L E   +P
Sbjct  1005  EKDFPSAVMTLSETWCSP  1022


 Score = 55.5 bits (132),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 63/151 (42%), Positives = 73/151 (48%), Gaps = 18/151 (12%)
 Frame = +3

Query  4011  EALSKTAILETPGNAEMFFFPVDPHPVGNIGSNNSSMPWKVHPLEE-----DQLHDKAPN  4175
             EA  +  I E  G  E  FFPVD     N    NS M      L       DQ     PN
Sbjct  1289  EACDEKIIHEDLGTMERTFFPVD-----NRNKLNSGMVVNRESLNGAGEYVDQFEVGIPN  1343

Query  4176  LELALGAKTKPLMSGIPSFLSGKVEKKIIEENTSDNAATSANKEDVsaslslslsFPFPE  4355
             LELALG +TKP    +  F  G V+KKI  E T D      + E+V+ASLSLSLSFP   
Sbjct  1344  LELALGGETKPSHKSMLPFFVGAVDKKINPEKTPD---IERDDENVAASLSLSLSFPSSS  1400

Query  4356  KEHG---TSSKPEQEDPRRRQANTSLLLFGR  4439
             KEH    T ++P   D     A +S LLFGR
Sbjct  1401  KEHMKPVTKNEPLPTDG--HNAKSSFLLFGR  1429



>ref|XP_007131489.1| hypothetical protein PHAVU_011G017900g [Phaseolus vulgaris]
 gb|ESW03483.1| hypothetical protein PHAVU_011G017900g [Phaseolus vulgaris]
Length=1421

 Score =   463 bits (1191),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 307/798 (38%), Positives = 422/798 (53%), Gaps = 119/798 (15%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNEHVNSG  1118
             CDICG  GRE LLAICSRC+DGAEHTYCM++ML K+PEGDWLCEECK  +E  N  + S 
Sbjct  291   CDICGDAGREDLLAICSRCSDGAEHTYCMREMLVKLPEGDWLCEECKCVEETANRRLAS-  349

Query  1119  RVNEKEKTSPSRRTTIAKSDHPLKMEQKTSDCWGDKAVEERSYLKTSGKRCTDDSEVSSP  1298
                                                         + SGKR +   E+++ 
Sbjct  350   --------------------------------------------QISGKRPSQSMEIATA  365

Query  1299  TKRQRLE--LRSPTAQIPNRVTSLSRESSFKNLERGKVK-----PLNPFSSGSFAAKVPS  1457
              KRQ LE    SP A  P R+ SLSRESS K++++GK+K     P+     G       S
Sbjct  366   AKRQALESSTGSPKASSPKRIVSLSRESSLKSMDKGKMKSGQQVPVRNHHGGDDVDLARS  425

Query  1458  -STGPQPQPPRGIFSKSNSFSSLIAKPKVKLVDEVFPAKQKLSRETAFIESKEVAVRSMG  1634
              STGP+ Q PR    KSNSF++  +KP++KLVDEV P KQK   E    ++ E     + 
Sbjct  426   LSTGPRSQNPRSTLLKSNSFNNFNSKPRIKLVDEVVPQKQKGGVE-HISKNLEKPTGMIS  484

Query  1635  KSMSFKPTTASRSNCTESKVKMFSPKFSHDQDVKWLRHKKDRSSFDRKNSLRSDR-----  1799
             KSMSFK +   RSN  ESKVK    K    QD K LRH K+  S D+K   + DR     
Sbjct  485   KSMSFKSSHLGRSNTNESKVKSSFSKHGIVQDSKALRHTKELGSLDKKFQPKIDRPVIHS  544

Query  1800  LAGGAISSPKSDNKPTPRGEPSSLSSLNTNRDYRALTSDNKPVTISNSTSGVAREVLKQA  1979
                 ++S+ K D+K  P GE +   ++N NR+++ +  D K  ++S S S          
Sbjct  545   TMVSSVSTSKGDHKLAPLGETAKPYTVNNNREFK-VNQDGKVYSLSKSMS----------  593

Query  1980  SVDGVSSANRVSSSEENPSQAIPKEDSSSSSCVAERPSWSSNEVLPDGLSQSKESKAFGD  2159
                             N     P+   SS     ++ S S NE   D L +S E+    D
Sbjct  594   ----------------NTGSRSPEPQVSS-----DKTSTSVNETQQDRLPRSHETVNHVD  632

Query  2160  KTRESSASRSKQNSTASGKIVSCQKCKGNGHLAQVCTADGPE---SSALGSPFKSSREAT  2330
             +T++SS+   +   T + K   C+KCK  GH  + C+  G +   + A  +   SS+E  
Sbjct  633   RTKDSSSDHVRSGVTNASKSSFCRKCKDFGHATECCSISGTQEFVAEASVTATSSSKEEM  692

Query  2331  NGPSDLKAAIEAARLRKPGICRKNRVADQSEDLSAS--NMKSEIASQDQML-SSTVRRNV  2501
             +  + LKAAI+AA LR+P I +K    D++ +   S    K E+ SQ+Q+L SST++ ++
Sbjct  693   HKGNRLKAAIQAALLRRPEIHKKKEGPDETNEFPTSIIGFKREVTSQNQVLVSSTLKNSI  752

Query  2502  NGAEEAQKQE-------------TANNAKQLGII-AEASARTRNAGHVVFSDVKHSVIDM  2639
                E   KQE             +AN+ KQL     +  ++ R +  V  +  +  V D+
Sbjct  753   YAEETNVKQEIVESSSFETTKCPSANDPKQLKFFQTDICSQLRKSDFVGLTSGEPVVRDL  812

Query  2640  ERQTLVSMPVILK-TAIPEYQYIWQGGFEVQKSGK-AFNLYDGIQAHLSSCASPKVLDAV  2813
                 +V   V+ K + IPEY+YIWQG FEV ++GK   +LY GIQAHLS+CASPKV++ V
Sbjct  813   ANNGMVLSSVLSKMSVIPEYEYIWQGVFEVHRNGKPPPDLYAGIQAHLSACASPKVIETV  872

Query  2814  NKFPRKVILNEVPRLSSWPMQFKECGVSEDNVALFFFAKDIGSYEKSYKVLLGDMVKHDL  2993
               F  +V LNEV RLS WP QF + G  EDN+AL+FFAKD  SYE+ YK LL  M+++DL
Sbjct  873   RNFSPEVSLNEVSRLSIWPSQFHQSGAKEDNIALYFFAKDTESYERHYKGLLDHMIRNDL  932

Query  2994  ALQGNIGDIELLIFPSNQLPEKFQRWNLMFFLWGVFRGKRANSLQNFPGAEKPLI-----  3158
             AL+G  G +ELLIF SNQLPE  QRWN++FFLWG FRG+R N   +      P +     
Sbjct  933   ALRGMFGGVELLIFASNQLPEDSQRWNMLFFLWGTFRGRRINHSNSTKSKCIPSLNVMPN  992

Query  3159  -QDIPTPATSLPENMFTP  3209
              +D P+   +L E   +P
Sbjct  993   EKDFPSAVMTLSETWCSP  1010


 Score = 55.5 bits (132),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 63/151 (42%), Positives = 73/151 (48%), Gaps = 18/151 (12%)
 Frame = +3

Query  4011  EALSKTAILETPGNAEMFFFPVDPHPVGNIGSNNSSMPWKVHPLEE-----DQLHDKAPN  4175
             EA  +  I E  G  E  FFPVD     N    NS M      L       DQ     PN
Sbjct  1277  EACDEKIIHEDLGTMERTFFPVD-----NRNKLNSGMVVNRESLNGAGEYVDQFEVGIPN  1331

Query  4176  LELALGAKTKPLMSGIPSFLSGKVEKKIIEENTSDNAATSANKEDVsaslslslsFPFPE  4355
             LELALG +TKP    +  F  G V+KKI  E T D      + E+V+ASLSLSLSFP   
Sbjct  1332  LELALGGETKPSHKSMLPFFVGAVDKKINPEKTPD---IERDDENVAASLSLSLSFPSSS  1388

Query  4356  KEHG---TSSKPEQEDPRRRQANTSLLLFGR  4439
             KEH    T ++P   D     A +S LLFGR
Sbjct  1389  KEHMKPVTKNEPLPTDG--HNAKSSFLLFGR  1417



>ref|XP_007131492.1| hypothetical protein PHAVU_011G017900g [Phaseolus vulgaris]
 ref|XP_007131497.1| hypothetical protein PHAVU_011G017900g [Phaseolus vulgaris]
 gb|ESW03486.1| hypothetical protein PHAVU_011G017900g [Phaseolus vulgaris]
 gb|ESW03491.1| hypothetical protein PHAVU_011G017900g [Phaseolus vulgaris]
Length=1407

 Score =   462 bits (1190),  Expect = 7e-134, Method: Compositional matrix adjust.
 Identities = 307/798 (38%), Positives = 422/798 (53%), Gaps = 119/798 (15%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNEHVNSG  1118
             CDICG  GRE LLAICSRC+DGAEHTYCM++ML K+PEGDWLCEECK  +E  N  + S 
Sbjct  277   CDICGDAGREDLLAICSRCSDGAEHTYCMREMLVKLPEGDWLCEECKCVEETANRRLAS-  335

Query  1119  RVNEKEKTSPSRRTTIAKSDHPLKMEQKTSDCWGDKAVEERSYLKTSGKRCTDDSEVSSP  1298
                                                         + SGKR +   E+++ 
Sbjct  336   --------------------------------------------QISGKRPSQSMEIATA  351

Query  1299  TKRQRLE--LRSPTAQIPNRVTSLSRESSFKNLERGKVK-----PLNPFSSGSFAAKVPS  1457
              KRQ LE    SP A  P R+ SLSRESS K++++GK+K     P+     G       S
Sbjct  352   AKRQALESSTGSPKASSPKRIVSLSRESSLKSMDKGKMKSGQQVPVRNHHGGDDVDLARS  411

Query  1458  -STGPQPQPPRGIFSKSNSFSSLIAKPKVKLVDEVFPAKQKLSRETAFIESKEVAVRSMG  1634
              STGP+ Q PR    KSNSF++  +KP++KLVDEV P KQK   E    ++ E     + 
Sbjct  412   LSTGPRSQNPRSTLLKSNSFNNFNSKPRIKLVDEVVPQKQKGGVE-HISKNLEKPTGMIS  470

Query  1635  KSMSFKPTTASRSNCTESKVKMFSPKFSHDQDVKWLRHKKDRSSFDRKNSLRSDR-----  1799
             KSMSFK +   RSN  ESKVK    K    QD K LRH K+  S D+K   + DR     
Sbjct  471   KSMSFKSSHLGRSNTNESKVKSSFSKHGIVQDSKALRHTKELGSLDKKFQPKIDRPVIHS  530

Query  1800  LAGGAISSPKSDNKPTPRGEPSSLSSLNTNRDYRALTSDNKPVTISNSTSGVAREVLKQA  1979
                 ++S+ K D+K  P GE +   ++N NR+++ +  D K  ++S S S          
Sbjct  531   TMVSSVSTSKGDHKLAPLGETAKPYTVNNNREFK-VNQDGKVYSLSKSMS----------  579

Query  1980  SVDGVSSANRVSSSEENPSQAIPKEDSSSSSCVAERPSWSSNEVLPDGLSQSKESKAFGD  2159
                             N     P+   SS     ++ S S NE   D L +S E+    D
Sbjct  580   ----------------NTGSRSPEPQVSS-----DKTSTSVNETQQDRLPRSHETVNHVD  618

Query  2160  KTRESSASRSKQNSTASGKIVSCQKCKGNGHLAQVCTADGPE---SSALGSPFKSSREAT  2330
             +T++SS+   +   T + K   C+KCK  GH  + C+  G +   + A  +   SS+E  
Sbjct  619   RTKDSSSDHVRSGVTNASKSSFCRKCKDFGHATECCSISGTQEFVAEASVTATSSSKEEM  678

Query  2331  NGPSDLKAAIEAARLRKPGICRKNRVADQSEDLSAS--NMKSEIASQDQML-SSTVRRNV  2501
             +  + LKAAI+AA LR+P I +K    D++ +   S    K E+ SQ+Q+L SST++ ++
Sbjct  679   HKGNRLKAAIQAALLRRPEIHKKKEGPDETNEFPTSIIGFKREVTSQNQVLVSSTLKNSI  738

Query  2502  NGAEEAQKQE-------------TANNAKQLGII-AEASARTRNAGHVVFSDVKHSVIDM  2639
                E   KQE             +AN+ KQL     +  ++ R +  V  +  +  V D+
Sbjct  739   YAEETNVKQEIVESSSFETTKCPSANDPKQLKFFQTDICSQLRKSDFVGLTSGEPVVRDL  798

Query  2640  ERQTLVSMPVILK-TAIPEYQYIWQGGFEVQKSGK-AFNLYDGIQAHLSSCASPKVLDAV  2813
                 +V   V+ K + IPEY+YIWQG FEV ++GK   +LY GIQAHLS+CASPKV++ V
Sbjct  799   ANNGMVLSSVLSKMSVIPEYEYIWQGVFEVHRNGKPPPDLYAGIQAHLSACASPKVIETV  858

Query  2814  NKFPRKVILNEVPRLSSWPMQFKECGVSEDNVALFFFAKDIGSYEKSYKVLLGDMVKHDL  2993
               F  +V LNEV RLS WP QF + G  EDN+AL+FFAKD  SYE+ YK LL  M+++DL
Sbjct  859   RNFSPEVSLNEVSRLSIWPSQFHQSGAKEDNIALYFFAKDTESYERHYKGLLDHMIRNDL  918

Query  2994  ALQGNIGDIELLIFPSNQLPEKFQRWNLMFFLWGVFRGKRANSLQNFPGAEKPLI-----  3158
             AL+G  G +ELLIF SNQLPE  QRWN++FFLWG FRG+R N   +      P +     
Sbjct  919   ALRGMFGGVELLIFASNQLPEDSQRWNMLFFLWGTFRGRRINHSNSTKSKCIPSLNVMPN  978

Query  3159  -QDIPTPATSLPENMFTP  3209
              +D P+   +L E   +P
Sbjct  979   EKDFPSAVMTLSETWCSP  996


 Score = 55.5 bits (132),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 63/151 (42%), Positives = 73/151 (48%), Gaps = 18/151 (12%)
 Frame = +3

Query  4011  EALSKTAILETPGNAEMFFFPVDPHPVGNIGSNNSSMPWKVHPLEE-----DQLHDKAPN  4175
             EA  +  I E  G  E  FFPVD     N    NS M      L       DQ     PN
Sbjct  1263  EACDEKIIHEDLGTMERTFFPVD-----NRNKLNSGMVVNRESLNGAGEYVDQFEVGIPN  1317

Query  4176  LELALGAKTKPLMSGIPSFLSGKVEKKIIEENTSDNAATSANKEDVsaslslslsFPFPE  4355
             LELALG +TKP    +  F  G V+KKI  E T D      + E+V+ASLSLSLSFP   
Sbjct  1318  LELALGGETKPSHKSMLPFFVGAVDKKINPEKTPD---IERDDENVAASLSLSLSFPSSS  1374

Query  4356  KEHG---TSSKPEQEDPRRRQANTSLLLFGR  4439
             KEH    T ++P   D     A +S LLFGR
Sbjct  1375  KEHMKPVTKNEPLPTDG--HNAKSSFLLFGR  1403



>gb|KEH17766.1| RING/FYVE/PHD zinc finger protein, putative [Medicago truncatula]
Length=1231

 Score =   456 bits (1174),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 298/794 (38%), Positives = 428/794 (54%), Gaps = 130/794 (16%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNEHVNSG  1118
             CDICG  GRE+LLAICSRC+DGAEHTYCM++MLEK+PEGDW CEEC++ +E  N+ +   
Sbjct  103   CDICGDSGRENLLAICSRCSDGAEHTYCMREMLEKVPEGDWFCEECQYAEETANQRLE--  160

Query  1119  RVNEKEKTSPSRRTTIAKSDHPLKMEQKTSDCWGDKAVEERSYLKTSGKRCTDDSEVSSP  1298
                              KS H +                  S  + +GKR ++  E+ + 
Sbjct  161   ----------------GKSGHKVS-----------------STSQITGKRSSEIMELVAA  187

Query  1299  TKRQRLELR--SPTAQIPNRVTSLSRESSFKNLERGKVKPLNPFSSGSFAAKVPSSTGPQ  1472
              KR+ LE R  SP A  P R+  LSRESSFK+L+ GK KP+                  Q
Sbjct  188   AKRRALESRTGSPKASSPRRLVPLSRESSFKSLDNGKEKPV------------------Q  229

Query  1473  PQPPRGIFSKSNSFSSLIAKPKVKLVDEVFPAKQKLSRETAFIESKEVAVRSMGKSMSFK  1652
                  G   KS SF++  +K +VKL D+V P KQK   E    ++ E  +R++GK MSFK
Sbjct  230   TSRRMGTLLKSCSFNNFSSKSRVKLDDDV-PQKQKGGGEHVS-KNTETPIRTIGKPMSFK  287

Query  1653  PTTASRSNCTESKVKMFSPKFSHDQDVKWLRHKKDRSSFDRKNSLRSDR------LAGGA  1814
              +   R+  TESKVKM SPK    QD+K     K+   FDRK+  R DR      +A   
Sbjct  288   SSNLGRA--TESKVKMLSPKSGTAQDLKGSSLAKESGVFDRKSLSRIDRPVVCSTMASSV  345

Query  1815  ISSPKSDNKPTPRGEPSSLSSLNTNRDYRALTSDNKPVTISNSTSGVAREVLKQASVDGV  1994
             IS+   + K TPRGE     ++N NRD++ +  D K  ++S S + ++ +          
Sbjct  346   IST--HNQKLTPRGETVKPLAINCNRDFK-VNHDGKSSSLSKSVNNISNK----------  392

Query  1995  SSANRVSSSEENPSQAIPKEDSSSSSCVAERPSWSSNEVLPDGLSQSKESKAFGDKTRES  2174
                                  SS    ++E+ S S ++   DGL + +E++   DKT++S
Sbjct  393   ---------------------SSEPQVISEKMSTSVDDTQLDGLPRLQETENQVDKTKDS  431

Query  2175  SASRSKQNSTASGKIVSCQKCKGNGHLAQVCTADGPESSALGSPFK--SSREATNGPSDL  2348
                R + ++ AS K   C KCK  GH  + CT    +           SS + ++  + L
Sbjct  432   YTHRVRSDTDAS-KSPFCHKCKDFGHATECCTVSVAQEFGTDGSLNAVSSPKESHTSNRL  490

Query  2349  KAAIEAARLRKPGICRKNRVADQSEDL--SASNMKSEIASQDQM---LSSTVRRNVNGAE  2513
             KAAI+ A L++P I +K  + DQ++    S + +K +++SQDQ+    S+T++ +++  E
Sbjct  491   KAAIQEALLKRPEIHKKKNLNDQTDQFPPSGTILKCKVSSQDQVEVSASNTLKNSISVVE  550

Query  2514  EAQKQE-------------TANNAKQLGIIAEASARTRNAGHVVFSDVKHSVIDMERQTL  2654
                +QE             + N+ KQL     +  +  ++G  + +  K  + D+     
Sbjct  551   INARQEMLGNSTSETSKCLSGNDLKQLKTDFCSQLKKSDSG--IPASEKPVLRDLPYHAS  608

Query  2655  VSMPVIL-KTAIPEYQYIWQGGFEVQKSGKAFNLYDGIQAHLSSCASPKVLDAVNKFPRK  2831
              +  V   K+AIPEY+YIWQG FEV  SG + +LY+GIQAHLSSCASPKVLD V+KF  +
Sbjct  609   ANSSVTSEKSAIPEYKYIWQGVFEVNGSGMSPDLYNGIQAHLSSCASPKVLDVVDKFLPE  668

Query  2832  VILNEVPRLSSWPMQFKECGVSEDNVALFFFAKDIGSYEKSYKVLLGDMVKHDLALQGNI  3011
             + L+EV RLS+WP  F +CG  EDN+AL+FFAKDI SYE+ YK LL  M++HDLAL+G  
Sbjct  669   ISLHEVSRLSTWPSHFHQCGAKEDNIALYFFAKDIESYERHYKGLLDHMIRHDLALKGFF  728

Query  3012  GDIELLIFPSNQLPEKFQRWNLMFFLWGVFRGKRANSLQNFPGAEKPLI-------QDIP  3170
               +ELLIF SNQLPE  QRWN++FFLWG+FRG+R N   +      P +       +D P
Sbjct  729   DGVELLIFASNQLPENSQRWNMLFFLWGIFRGRRINHSDSAKDIALPSLNVAVSNEKDFP  788

Query  3171  TPATSLPENMFTPV  3212
             T   +L +   +PV
Sbjct  789   TAVMTLSDTRCSPV  802



>gb|KEH17765.1| RING/FYVE/PHD zinc finger protein, putative [Medicago truncatula]
Length=1394

 Score =   457 bits (1177),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 298/794 (38%), Positives = 428/794 (54%), Gaps = 130/794 (16%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNEHVNSG  1118
             CDICG  GRE+LLAICSRC+DGAEHTYCM++MLEK+PEGDW CEEC++ +E  N+ +   
Sbjct  266   CDICGDSGRENLLAICSRCSDGAEHTYCMREMLEKVPEGDWFCEECQYAEETANQRLE--  323

Query  1119  RVNEKEKTSPSRRTTIAKSDHPLKMEQKTSDCWGDKAVEERSYLKTSGKRCTDDSEVSSP  1298
                              KS H +                  S  + +GKR ++  E+ + 
Sbjct  324   ----------------GKSGHKVS-----------------STSQITGKRSSEIMELVAA  350

Query  1299  TKRQRLELR--SPTAQIPNRVTSLSRESSFKNLERGKVKPLNPFSSGSFAAKVPSSTGPQ  1472
              KR+ LE R  SP A  P R+  LSRESSFK+L+ GK KP+                  Q
Sbjct  351   AKRRALESRTGSPKASSPRRLVPLSRESSFKSLDNGKEKPV------------------Q  392

Query  1473  PQPPRGIFSKSNSFSSLIAKPKVKLVDEVFPAKQKLSRETAFIESKEVAVRSMGKSMSFK  1652
                  G   KS SF++  +K +VKL D+V P KQK   E    ++ E  +R++GK MSFK
Sbjct  393   TSRRMGTLLKSCSFNNFSSKSRVKLDDDV-PQKQKGGGEHVS-KNTETPIRTIGKPMSFK  450

Query  1653  PTTASRSNCTESKVKMFSPKFSHDQDVKWLRHKKDRSSFDRKNSLRSDR------LAGGA  1814
              +   R+  TESKVKM SPK    QD+K     K+   FDRK+  R DR      +A   
Sbjct  451   SSNLGRA--TESKVKMLSPKSGTAQDLKGSSLAKESGVFDRKSLSRIDRPVVCSTMASSV  508

Query  1815  ISSPKSDNKPTPRGEPSSLSSLNTNRDYRALTSDNKPVTISNSTSGVAREVLKQASVDGV  1994
             IS+   + K TPRGE     ++N NRD++ +  D K  ++S S + ++ +          
Sbjct  509   IST--HNQKLTPRGETVKPLAINCNRDFK-VNHDGKSSSLSKSVNNISNK----------  555

Query  1995  SSANRVSSSEENPSQAIPKEDSSSSSCVAERPSWSSNEVLPDGLSQSKESKAFGDKTRES  2174
                                  SS    ++E+ S S ++   DGL + +E++   DKT++S
Sbjct  556   ---------------------SSEPQVISEKMSTSVDDTQLDGLPRLQETENQVDKTKDS  594

Query  2175  SASRSKQNSTASGKIVSCQKCKGNGHLAQVCTADGPESSALGSPFK--SSREATNGPSDL  2348
                R + ++ AS K   C KCK  GH  + CT    +           SS + ++  + L
Sbjct  595   YTHRVRSDTDAS-KSPFCHKCKDFGHATECCTVSVAQEFGTDGSLNAVSSPKESHTSNRL  653

Query  2349  KAAIEAARLRKPGICRKNRVADQSEDL--SASNMKSEIASQDQM---LSSTVRRNVNGAE  2513
             KAAI+ A L++P I +K  + DQ++    S + +K +++SQDQ+    S+T++ +++  E
Sbjct  654   KAAIQEALLKRPEIHKKKNLNDQTDQFPPSGTILKCKVSSQDQVEVSASNTLKNSISVVE  713

Query  2514  EAQKQE-------------TANNAKQLGIIAEASARTRNAGHVVFSDVKHSVIDMERQTL  2654
                +QE             + N+ KQL     +  +  ++G  + +  K  + D+     
Sbjct  714   INARQEMLGNSTSETSKCLSGNDLKQLKTDFCSQLKKSDSG--IPASEKPVLRDLPYHAS  771

Query  2655  VSMPVIL-KTAIPEYQYIWQGGFEVQKSGKAFNLYDGIQAHLSSCASPKVLDAVNKFPRK  2831
              +  V   K+AIPEY+YIWQG FEV  SG + +LY+GIQAHLSSCASPKVLD V+KF  +
Sbjct  772   ANSSVTSEKSAIPEYKYIWQGVFEVNGSGMSPDLYNGIQAHLSSCASPKVLDVVDKFLPE  831

Query  2832  VILNEVPRLSSWPMQFKECGVSEDNVALFFFAKDIGSYEKSYKVLLGDMVKHDLALQGNI  3011
             + L+EV RLS+WP  F +CG  EDN+AL+FFAKDI SYE+ YK LL  M++HDLAL+G  
Sbjct  832   ISLHEVSRLSTWPSHFHQCGAKEDNIALYFFAKDIESYERHYKGLLDHMIRHDLALKGFF  891

Query  3012  GDIELLIFPSNQLPEKFQRWNLMFFLWGVFRGKRANSLQNFPGAEKPLI-------QDIP  3170
               +ELLIF SNQLPE  QRWN++FFLWG+FRG+R N   +      P +       +D P
Sbjct  892   DGVELLIFASNQLPENSQRWNMLFFLWGIFRGRRINHSDSAKDIALPSLNVAVSNEKDFP  951

Query  3171  TPATSLPENMFTPV  3212
             T   +L +   +PV
Sbjct  952   TAVMTLSDTRCSPV  965



>gb|KEH17764.1| RING/FYVE/PHD zinc finger protein, putative [Medicago truncatula]
Length=1418

 Score =   457 bits (1175),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 298/794 (38%), Positives = 428/794 (54%), Gaps = 130/794 (16%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNEHVNSG  1118
             CDICG  GRE+LLAICSRC+DGAEHTYCM++MLEK+PEGDW CEEC++ +E  N+ +   
Sbjct  290   CDICGDSGRENLLAICSRCSDGAEHTYCMREMLEKVPEGDWFCEECQYAEETANQRLE--  347

Query  1119  RVNEKEKTSPSRRTTIAKSDHPLKMEQKTSDCWGDKAVEERSYLKTSGKRCTDDSEVSSP  1298
                              KS H +                  S  + +GKR ++  E+ + 
Sbjct  348   ----------------GKSGHKVS-----------------STSQITGKRSSEIMELVAA  374

Query  1299  TKRQRLELR--SPTAQIPNRVTSLSRESSFKNLERGKVKPLNPFSSGSFAAKVPSSTGPQ  1472
              KR+ LE R  SP A  P R+  LSRESSFK+L+ GK KP+                  Q
Sbjct  375   AKRRALESRTGSPKASSPRRLVPLSRESSFKSLDNGKEKPV------------------Q  416

Query  1473  PQPPRGIFSKSNSFSSLIAKPKVKLVDEVFPAKQKLSRETAFIESKEVAVRSMGKSMSFK  1652
                  G   KS SF++  +K +VKL D+V P KQK   E    ++ E  +R++GK MSFK
Sbjct  417   TSRRMGTLLKSCSFNNFSSKSRVKLDDDV-PQKQKGGGEHVS-KNTETPIRTIGKPMSFK  474

Query  1653  PTTASRSNCTESKVKMFSPKFSHDQDVKWLRHKKDRSSFDRKNSLRSDR------LAGGA  1814
              +   R+  TESKVKM SPK    QD+K     K+   FDRK+  R DR      +A   
Sbjct  475   SSNLGRA--TESKVKMLSPKSGTAQDLKGSSLAKESGVFDRKSLSRIDRPVVCSTMASSV  532

Query  1815  ISSPKSDNKPTPRGEPSSLSSLNTNRDYRALTSDNKPVTISNSTSGVAREVLKQASVDGV  1994
             IS+   + K TPRGE     ++N NRD++ +  D K  ++S S + ++ +          
Sbjct  533   IST--HNQKLTPRGETVKPLAINCNRDFK-VNHDGKSSSLSKSVNNISNK----------  579

Query  1995  SSANRVSSSEENPSQAIPKEDSSSSSCVAERPSWSSNEVLPDGLSQSKESKAFGDKTRES  2174
                                  SS    ++E+ S S ++   DGL + +E++   DKT++S
Sbjct  580   ---------------------SSEPQVISEKMSTSVDDTQLDGLPRLQETENQVDKTKDS  618

Query  2175  SASRSKQNSTASGKIVSCQKCKGNGHLAQVCTADGPESSALGSPFK--SSREATNGPSDL  2348
                R + ++ AS K   C KCK  GH  + CT    +           SS + ++  + L
Sbjct  619   YTHRVRSDTDAS-KSPFCHKCKDFGHATECCTVSVAQEFGTDGSLNAVSSPKESHTSNRL  677

Query  2349  KAAIEAARLRKPGICRKNRVADQSEDL--SASNMKSEIASQDQM---LSSTVRRNVNGAE  2513
             KAAI+ A L++P I +K  + DQ++    S + +K +++SQDQ+    S+T++ +++  E
Sbjct  678   KAAIQEALLKRPEIHKKKNLNDQTDQFPPSGTILKCKVSSQDQVEVSASNTLKNSISVVE  737

Query  2514  EAQKQE-------------TANNAKQLGIIAEASARTRNAGHVVFSDVKHSVIDMERQTL  2654
                +QE             + N+ KQL     +  +  ++G  + +  K  + D+     
Sbjct  738   INARQEMLGNSTSETSKCLSGNDLKQLKTDFCSQLKKSDSG--IPASEKPVLRDLPYHAS  795

Query  2655  VSMPVIL-KTAIPEYQYIWQGGFEVQKSGKAFNLYDGIQAHLSSCASPKVLDAVNKFPRK  2831
              +  V   K+AIPEY+YIWQG FEV  SG + +LY+GIQAHLSSCASPKVLD V+KF  +
Sbjct  796   ANSSVTSEKSAIPEYKYIWQGVFEVNGSGMSPDLYNGIQAHLSSCASPKVLDVVDKFLPE  855

Query  2832  VILNEVPRLSSWPMQFKECGVSEDNVALFFFAKDIGSYEKSYKVLLGDMVKHDLALQGNI  3011
             + L+EV RLS+WP  F +CG  EDN+AL+FFAKDI SYE+ YK LL  M++HDLAL+G  
Sbjct  856   ISLHEVSRLSTWPSHFHQCGAKEDNIALYFFAKDIESYERHYKGLLDHMIRHDLALKGFF  915

Query  3012  GDIELLIFPSNQLPEKFQRWNLMFFLWGVFRGKRANSLQNFPGAEKPLI-------QDIP  3170
               +ELLIF SNQLPE  QRWN++FFLWG+FRG+R N   +      P +       +D P
Sbjct  916   DGVELLIFASNQLPENSQRWNMLFFLWGIFRGRRINHSDSAKDIALPSLNVAVSNEKDFP  975

Query  3171  TPATSLPENMFTPV  3212
             T   +L +   +PV
Sbjct  976   TAVMTLSDTRCSPV  989



>ref|XP_004511404.1| PREDICTED: serine-rich adhesin for platelets-like isoform X1 
[Cicer arietinum]
 ref|XP_004511405.1| PREDICTED: serine-rich adhesin for platelets-like isoform X2 
[Cicer arietinum]
 ref|XP_004511406.1| PREDICTED: serine-rich adhesin for platelets-like isoform X3 
[Cicer arietinum]
Length=1536

 Score =   456 bits (1174),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 313/772 (41%), Positives = 431/772 (56%), Gaps = 117/772 (15%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNEHVNSG  1118
             CDICG  GRE LLAICSRCTDGAEHTYCM++MLEK+PE DW CEEC+   E +N+ +   
Sbjct  315   CDICGDAGREDLLAICSRCTDGAEHTYCMREMLEKVPEEDWFCEECQDALETENKRL---  371

Query  1119  RVNEKEKTSPSRRTTIAKSDHPLKMEQKTSDCWGDKAVEERSYLKT------SGKRCTDD  1280
                                           +C G   VEE+  +KT      SGKR +D+
Sbjct  372   ----------------------------VLNCLGSD-VEEKKIIKTASTSQASGKRPSDN  402

Query  1281  SEVSSP-TKRQRLELR--SPTAQIPNRVTSLSRESSFKNLER------GKVKPLNPFSSG  1433
              EV+ P  KRQ LEL   SP A  P R+  LSRESSFKN ++      G + PL   S G
Sbjct  403   IEVAPPAAKRQALELSKGSPKASSPKRLVPLSRESSFKNPDKLKGKAGGLLMPLRNHSGG  462

Query  1434  --SFAAKVPSSTGPQPQPPRGIFSKSNSFSSLIAKPKVKLVDEVFPAKQKLSRETAFIES  1607
               S  A+ P S GP+ Q  + I SKSNS ++L +KP+VKLVDEVFP + K   E    ++
Sbjct  463   DDSETARSP-SIGPRSQISKSILSKSNSSNNLNSKPRVKLVDEVFPPRSKGGNEQTS-KN  520

Query  1608  KEVAVRSMGKSMSFKPTTASRSNCTESKVKMFSPKFSHDQDVKWLRHKKDRSSFDRKNSL  1787
              E   R   KS  FK ++  RS+  ESKVKM SPK +  QD+K  RH K+  +FDRK   
Sbjct  521   MESTARMTSKSTLFKSSSLGRSSAIESKVKMLSPKSATTQDLKVSRHSKESGAFDRKYLS  580

Query  1788  RSDR-LAGGAISSPKSDNKPTPRGEPSSLSSLNTNRDYRALTSDNKPVTISNSTSGVARE  1964
             R+DR  A   +S+PK D K TPRG+     S   NR+ + +  D K    S S + ++R+
Sbjct  581   RNDRPSASSVVSTPKGDLKVTPRGDTIIKPSAVNNRELK-INQDGKLSASSKSLNNISRK  639

Query  1965  VLK-QASVDGVSSANRVSSSEENPSQAIPKEDSSSSSCVAERPSWSSNEVLPDGLSQSKE  2141
              L+ Q S                                +ER S S++E + D L +S+E
Sbjct  640   SLEPQGS--------------------------------SERTSASNDEAIQDALPRSRE  667

Query  2142  SKAFGDKTRESSASRSKQNSTASGKIVSCQKCKGNGHLAQVCTA-----DGPESSALGSP  2306
             +    +K+RES + R +     + K   CQKC+  GH  + CTA      G E S   S 
Sbjct  668   TANQVEKSRESFSDRVRPVVPITLKSPFCQKCEEFGHSLECCTASTVQDSGAEISVTASS  727

Query  2307  FKSSREATNGPSDLKAAIEAARLRKPGICRKNRVADQSEDLSASN--MKSEIASQDQMLS  2480
                S+E  +  + LKAAI+AA  ++P I RK  V+ Q++++S S   +  E+ S+DQ+L+
Sbjct  728   I--SKEEMHKGNRLKAAIQAALRKRPEIYRKKEVSSQTDEISTSGTELNCEVTSRDQVLA  785

Query  2481  S-TVRRNVNGAEEAQKQETANNA-------------KQLGI----IAEASARTRNAGHVV  2606
             S T++ +++  E  ++QE   N+             KQL      +     ++  AG   
Sbjct  786   SNTLKNSISTEETHEQQEVLENSTSDSSKCSSASDLKQLNSCPTDLCSQPGKSDLAG---  842

Query  2607  FSDVKHSVIDMERQTL-VSMPVILKTAIPEYQYIWQGGFEVQKSGKAFNLYDGIQAHLSS  2783
             F+  +  V D+ ++ + +S  +    A PEY+YIWQG FEV ++GK   L +G+QAHLSS
Sbjct  843   FNAQRPLVRDLSKKAVAISSALSKMLAFPEYEYIWQGVFEVHRNGKPPELCNGVQAHLSS  902

Query  2784  CASPKVLDAVNKFPRKVILNEVPRLSSWPMQFKECGVSEDNVALFFFAKDIGSYEKSYKV  2963
              ASPKVL+ V KF  +V L EV RLS+WP QF   G  EDN+AL+FFA+D+ SYE+ Y+ 
Sbjct  903   SASPKVLEVVTKFSPEVSLEEVSRLSTWPSQFHHDGAREDNIALYFFARDVESYERHYRG  962

Query  2964  LLGDMVKHDLALQGNIGDIELLIFPSNQLPEKFQRWNLMFFLWGVFRGKRAN  3119
             LL  M+++DLAL+G    +ELLIFPS+QLPE  QRWN++FFLWGVFRG+R N
Sbjct  963   LLDHMIRNDLALKGIFDGVELLIFPSSQLPENSQRWNMLFFLWGVFRGRRMN  1014



>ref|XP_004511407.1| PREDICTED: serine-rich adhesin for platelets-like isoform X4 
[Cicer arietinum]
Length=1529

 Score =   455 bits (1170),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 311/766 (41%), Positives = 430/766 (56%), Gaps = 112/766 (15%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNEHVNSG  1118
             CDICG  GRE LLAICSRCTDGAEHTYCM++MLEK+PE DW CEEC+   E +N+     
Sbjct  315   CDICGDAGREDLLAICSRCTDGAEHTYCMREMLEKVPEEDWFCEECQDALETENKR----  370

Query  1119  RVNEKEKTSPSRRTTIAKSDHPLKMEQKTSDCWGDKAVEERSYLKTSGKRCTDDSEVSSP  1298
                                   L +E+K       K ++  S  + SGKR +D+ EV+ P
Sbjct  371   ----------------------LDVEEK-------KIIKTASTSQASGKRPSDNIEVAPP  401

Query  1299  -TKRQRLELR--SPTAQIPNRVTSLSRESSFKNLER------GKVKPLNPFSSG--SFAA  1445
               KRQ LEL   SP A  P R+  LSRESSFKN ++      G + PL   S G  S  A
Sbjct  402   AAKRQALELSKGSPKASSPKRLVPLSRESSFKNPDKLKGKAGGLLMPLRNHSGGDDSETA  461

Query  1446  KVPSSTGPQPQPPRGIFSKSNSFSSLIAKPKVKLVDEVFPAKQKLSRETAFIESKEVAVR  1625
             + P S GP+ Q  + I SKSNS ++L +KP+VKLVDEVFP + K   E    ++ E   R
Sbjct  462   RSP-SIGPRSQISKSILSKSNSSNNLNSKPRVKLVDEVFPPRSKGGNEQTS-KNMESTAR  519

Query  1626  SMGKSMSFKPTTASRSNCTESKVKMFSPKFSHDQDVKWLRHKKDRSSFDRKNSLRSDR-L  1802
                KS  FK ++  RS+  ESKVKM SPK +  QD+K  RH K+  +FDRK   R+DR  
Sbjct  520   MTSKSTLFKSSSLGRSSAIESKVKMLSPKSATTQDLKVSRHSKESGAFDRKYLSRNDRPS  579

Query  1803  AGGAISSPKSDNKPTPRGEPSSLSSLNTNRDYRALTSDNKPVTISNSTSGVAREVLK-QA  1979
             A   +S+PK D K TPRG+     S   NR+ + +  D K    S S + ++R+ L+ Q 
Sbjct  580   ASSVVSTPKGDLKVTPRGDTIIKPSAVNNRELK-INQDGKLSASSKSLNNISRKSLEPQG  638

Query  1980  SVDGVSSANRVSSSEENPSQAIPKEDSSSSSCVAERPSWSSNEVLPDGLSQSKESKAFGD  2159
             S                                +ER S S++E + D L +S+E+    +
Sbjct  639   S--------------------------------SERTSASNDEAIQDALPRSRETANQVE  666

Query  2160  KTRESSASRSKQNSTASGKIVSCQKCKGNGHLAQVCTA-----DGPESSALGSPFKSSRE  2324
             K+RES + R +     + K   CQKC+  GH  + CTA      G E S   S    S+E
Sbjct  667   KSRESFSDRVRPVVPITLKSPFCQKCEEFGHSLECCTASTVQDSGAEISVTASSI--SKE  724

Query  2325  ATNGPSDLKAAIEAARLRKPGICRKNRVADQSEDLSASN--MKSEIASQDQMLSS-TVRR  2495
               +  + LKAAI+AA  ++P I RK  V+ Q++++S S   +  E+ S+DQ+L+S T++ 
Sbjct  725   EMHKGNRLKAAIQAALRKRPEIYRKKEVSSQTDEISTSGTELNCEVTSRDQVLASNTLKN  784

Query  2496  NVNGAEEAQKQETANNA-------------KQLGI----IAEASARTRNAGHVVFSDVKH  2624
             +++  E  ++QE   N+             KQL      +     ++  AG   F+  + 
Sbjct  785   SISTEETHEQQEVLENSTSDSSKCSSASDLKQLNSCPTDLCSQPGKSDLAG---FNAQRP  841

Query  2625  SVIDMERQTL-VSMPVILKTAIPEYQYIWQGGFEVQKSGKAFNLYDGIQAHLSSCASPKV  2801
              V D+ ++ + +S  +    A PEY+YIWQG FEV ++GK   L +G+QAHLSS ASPKV
Sbjct  842   LVRDLSKKAVAISSALSKMLAFPEYEYIWQGVFEVHRNGKPPELCNGVQAHLSSSASPKV  901

Query  2802  LDAVNKFPRKVILNEVPRLSSWPMQFKECGVSEDNVALFFFAKDIGSYEKSYKVLLGDMV  2981
             L+ V KF  +V L EV RLS+WP QF   G  EDN+AL+FFA+D+ SYE+ Y+ LL  M+
Sbjct  902   LEVVTKFSPEVSLEEVSRLSTWPSQFHHDGAREDNIALYFFARDVESYERHYRGLLDHMI  961

Query  2982  KHDLALQGNIGDIELLIFPSNQLPEKFQRWNLMFFLWGVFRGKRAN  3119
             ++DLAL+G    +ELLIFPS+QLPE  QRWN++FFLWGVFRG+R N
Sbjct  962   RNDLALKGIFDGVELLIFPSSQLPENSQRWNMLFFLWGVFRGRRMN  1007



>ref|XP_004516586.1| PREDICTED: serine-rich adhesin for platelets-like [Cicer arietinum]
Length=1402

 Score =   452 bits (1163),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 308/803 (38%), Positives = 429/803 (53%), Gaps = 120/803 (15%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNEHVNSG  1118
             CDICG  GR+HLLAICSRC+DGAEHTYCM++MLEK+PEGDW CEEC+  +E  N+ +   
Sbjct  284   CDICGDSGRDHLLAICSRCSDGAEHTYCMREMLEKVPEGDWFCEECQNAEETANQRL---  340

Query  1119  RVNEKEKTSPSRRTTIAKSDHPLKMEQKTSDCWGDKAVEERSYLKTSGKRCTDDSEVSSP  1298
                                           D  G K+ +  S  + +GKR ++  E +  
Sbjct  341   ------------------------------DVKGSKSNKVGSTSQIAGKRPSEGMEAAPA  370

Query  1299  TKRQRL--ELRSPTAQIPNRVTSLSRESSFKNLERGKVKP------LNPFSSGSFAAKVP  1454
              KR+ L     SP A  P  +  LSRESSFK+L+ GK KP       N   S        
Sbjct  371   AKRRVLGSSKGSPKASSPRILVPLSRESSFKSLDNGKAKPGQSIPIRNHLRSDDIEQTCS  430

Query  1455  SSTGPQPQPPR--GIFSKSNSFSSLIAKPKVKLVDEVFPAKQKLSRETAFIESKEVAVRS  1628
              S  P+    R  G   KS+SF+S  +K +VK  D+V P KQK   E    ++ E    +
Sbjct  431   LSAAPRSYTSRTMGTLLKSSSFNSNNSKSRVKHDDDV-PQKQKGGGEHTS-KNMETPSAT  488

Query  1629  MGKSMSFKPTTASRSNCTESKVKMFSPKFSHDQDVKWLRHKKDRSSFDRKNSLRSDR---  1799
             +GKS SFK +   R+   ESKVKM S K    QD+K  RH K+   FDR++  R DR   
Sbjct  489   IGKSTSFKSSNLGRA--AESKVKMLSSKSVTTQDLKGSRHAKESGVFDRRSLSRIDRPAI  546

Query  1800  ---LAGGAISSPKSDNKPTPRGEPSSLSSLNTNRDYRALTSDNKPVTISNSTSGVAREVL  1970
                +A   +SS K D K TPRGE +  S++N NR+++    D K  ++S   + ++ +  
Sbjct  547   CSTMASSIVSSSKGDQKLTPRGEIAKPSAINCNREFKG-NQDGKSSSLSKPVTNISNK--  603

Query  1971  KQASVDGVSSANRVSSSEENPSQAIPKEDSSSSSCVAERPSWSSNEVLPDGLSQSKESKA  2150
                                          +S    ++ER S S +E   D L + +E+  
Sbjct  604   -----------------------------NSEPKVISERTSTSLHETQQDWLPRPRETAN  634

Query  2151  FGDKTRESSASRSKQNSTASGKIVSCQKCKGNGHLAQVCTAD-----GPESSALGSPFKS  2315
               DKT++S   R + ++ AS K   C KCK  GH  + CT       G E S   +   S
Sbjct  635   QVDKTKDSFTHRVRSSTNAS-KCPICHKCKDFGHATECCTIGSTQEFGAEGSVTAA--SS  691

Query  2316  SREATNGPSDLKAAIEAARLRKPGICRKNRVADQSEDLSA--SNMKSEIASQDQMLSSTV  2489
             S+E   G + LK+AI+ A LR+P I +K  V DQ++      + +K +++SQDQML S  
Sbjct  692   SKEMHKG-NKLKSAIQVALLRRPEIHKKKDVHDQTDQFPTLPTVLKCKLSSQDQMLVSNT  750

Query  2490  RRNVNGAEEAQKQE---------------TANNAKQLGIIAEASARTRNAGHVVFSDVKH  2624
              +N    EE   ++               +AN++KQL I  +  ++ +N+        K 
Sbjct  751   LKNCIYDEETNARQEILENSTTSETSKCLSANDSKQLKI--DFCSQLKNSDSFSPGSEKP  808

Query  2625  SVIDMERQTL-VSMPVILKTAIPEYQYIWQGGFEVQKSGKAFNLYDGIQAHLSSCASPKV  2801
             +  D+    L +S    + +A+PEY+YIWQG FEV +SGK  NLY+GIQAHLSSCASPKV
Sbjct  809   AARDLPNHALEISRVASIMSAVPEYKYIWQGVFEVHRSGKPHNLYNGIQAHLSSCASPKV  868

Query  2802  LDAVNKFPRKVILNEVPRLSSWPMQFKECGVSEDNVALFFFAKDIGSYEKSYKVLLGDMV  2981
             LD VNKF  ++ L+EV RLS+WP  F + G  EDN+ L+FFAKDI SYE+ YK LL  M+
Sbjct  869   LDVVNKFLPEISLHEVSRLSTWPSHFHQAGAKEDNIGLYFFAKDIESYERHYKGLLDHMI  928

Query  2982  KHDLALQGNIGDIELLIFPSNQLPEKFQRWNLMFFLWGVFRGKR---ANSLQN--FPGAE  3146
             ++DLAL+G    +ELLIF SNQLPE  QRWN++FFLWG+FRG+R   ++S +N  FP   
Sbjct  929   RNDLALKGFFDGVELLIFASNQLPENSQRWNMLFFLWGIFRGRRGSHSDSAKNIVFPSLN  988

Query  3147  -KPLIQDIPTPATSLPENMFTPV  3212
               P  +D PT   +L +   +PV
Sbjct  989   VMPNEKDFPTAVMTLSDTRCSPV  1011



>gb|KEH27368.1| RING/FYVE/PHD zinc finger protein, putative [Medicago truncatula]
Length=1464

 Score =   448 bits (1153),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 307/762 (40%), Positives = 421/762 (55%), Gaps = 99/762 (13%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNEHVNSG  1118
             CDICG  GRE LLAIC RCTDGAEHTYCM++MLEK+PEGDWLCEEC+   E +N+     
Sbjct  232   CDICGDAGREDLLAICCRCTDGAEHTYCMREMLEKLPEGDWLCEECQDAVEAENKR----  287

Query  1119  RVNEKEKTSPSRRTTIAKSDHPLKMEQKTSDCWGDKAVEERSYLKTSGKRCTDDSEVSSP  1298
                                   L +    SD  G K ++  S  + SGKR  D+ EV+ P
Sbjct  288   ----------------------LVLNICCSDIEGKKNIKTTSTSQVSGKRRPDNIEVAPP  325

Query  1299  -TKRQRLELR--SPTAQIPNRVTSLSRESSFKNLER-----GKVKPLNPFSSGSFA--AK  1448
               KRQ LEL   SP    P ++  LSRESSFK+ ++     G + P    S G  A  A+
Sbjct  326   AAKRQALELSKGSPKVSSPKKLVPLSRESSFKSSDKLKGKSGLLMPPRNHSGGDDAQTAR  385

Query  1449  VPSSTGPQPQPPRGIFSKSNSFSSLIAKPKVKLVDEVFPAKQKLSRETAFIESKEVAVRS  1628
              P S G + Q  + +  KSNS ++L +KPKVK+ DEVFP + K   E    ++ E   R 
Sbjct  386   SP-SVGLRGQISKSMLLKSNSSNNLNSKPKVKIGDEVFPPRPKGGHEQTS-KNMETTARM  443

Query  1629  MGKSMSFKPTTASRSNCTESKVKMFSPKFSHDQDVKWLRHKKDRSSFDRKNSLRSDR-LA  1805
               +S  FK ++  RS+  ESKVKM  PK +  QD+K  RH K+  S DRK   R+DR +A
Sbjct  444   TSRSTLFKSSSLGRSSAIESKVKML-PKPATIQDLKGSRHSKESGSLDRKYLSRNDRPVA  502

Query  1806  GGAISSPKSDNKPTPRGEPSSLSSLNTNRDYRALTSDNKPVTISNSTSGVARE-VLKQAS  1982
                +S+PK D K TPRGE     S   NR+ + +  D K    S ST+ ++R+ V  Q S
Sbjct  503   SSVVSTPKGDQKLTPRGETVIKPSAVNNRESK-INQDGKLSASSKSTNNISRKSVEPQGS  561

Query  1983  VDGVSSANRVSSSEENPSQAIPKEDSSSSSCVAERPSWSSNEVLPDGLSQSKESKAFGDK  2162
                                             +ER   S++E L D L +S+E+    +K
Sbjct  562   --------------------------------SERTIASNDEALQDVLPRSRETANQVEK  589

Query  2163  TRESSASRSKQNSTASGKIVSCQKCKGNGHLAQVCTA-----DGPESSALGSPFKSSREA  2327
             +RES + R +     + K   CQKC+  GH  + CTA      G E S   S    S+E 
Sbjct  590   SRESLSDRLRPVVPTASKSSYCQKCEEFGHSLEGCTAGNLQESGAEISVTASSI--SKEE  647

Query  2328  TNGPSDLKAAIEAARLRKPGICRKNRVADQSEDL--SASNMKSEIASQDQML-SSTVRRN  2498
              +  + LKAAI+AA L++P I RK  V+ Q++++  S + +  E  S+DQ+L S+T++ +
Sbjct  648   MHKGNKLKAAIQAALLKRPEIYRKKEVSSQTDEIPTSGTELNCEATSRDQVLVSNTLKNS  707

Query  2499  VNGAEEAQKQETANNA-------------KQLGII-AEASARTRNAGHVVFSDVKHSVID  2636
             ++  E  ++QE   N+             KQL     +  ++   +  V  +  K  V D
Sbjct  708   ISTEETREQQEVLENSTSESSKCSSASDLKQLNSCPTDLCSQLGKSDLVGLNAQKPLVRD  767

Query  2637  MERQTLVSMPVILKT-AIPEYQYIWQGGFEVQKSGKAFNLYDGIQAHLSSCASPKVLDAV  2813
             + R+ +    V+ K  A PEY+YIWQG FEV ++GK   L  G+QAHLSS ASPKVL+ V
Sbjct  768   LSRKAVAISSVVSKMLAFPEYEYIWQGVFEVHRNGKPPELCTGVQAHLSSSASPKVLEVV  827

Query  2814  NKFPRKVILNEVPRLSSWPMQFKECGVSEDNVALFFFAKDIGSYEKSYKVLLGDMVKHDL  2993
              KF  +V LNEV RLS+WP QF   G  EDN+AL+FFA+D+ SYE+ YK LL  M+++DL
Sbjct  828   TKFSPEVSLNEVSRLSTWPSQFHHGGAREDNIALYFFARDVESYERHYKGLLDHMIRNDL  887

Query  2994  ALQGNIGDIELLIFPSNQLPEKFQRWNLMFFLWGVFRGKRAN  3119
             AL+G    +ELLIFPSNQLPE  QRWN++ FLWGVFRG+R +
Sbjct  888   ALKGIFDGVELLIFPSNQLPENSQRWNMLLFLWGVFRGRRVD  929



>ref|XP_003610802.1| Bromodomain adjacent to zinc finger domain protein 2B [Medicago 
truncatula]
 gb|AES93760.1| RING/FYVE/PHD zinc finger protein, putative [Medicago truncatula]
Length=1457

 Score =   446 bits (1148),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 305/762 (40%), Positives = 419/762 (55%), Gaps = 106/762 (14%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNEHVNSG  1118
             CDICG  GRE LLAIC RCTDGAEHTYCM++MLEK+PEGDWLCEEC+   E +N+ +   
Sbjct  232   CDICGDAGREDLLAICCRCTDGAEHTYCMREMLEKLPEGDWLCEECQDAVEAENKRL---  288

Query  1119  RVNEKEKTSPSRRTTIAKSDHPLKMEQKTSDCWGDKAVEERSYLKTSGKRCTDDSEVSSP  1298
                                           D  G K ++  S  + SGKR  D+ EV+ P
Sbjct  289   ------------------------------DIEGKKNIKTTSTSQVSGKRRPDNIEVAPP  318

Query  1299  -TKRQRLELR--SPTAQIPNRVTSLSRESSFKNLER-----GKVKPLNPFSSGSFA--AK  1448
               KRQ LEL   SP    P ++  LSRESSFK+ ++     G + P    S G  A  A+
Sbjct  319   AAKRQALELSKGSPKVSSPKKLVPLSRESSFKSSDKLKGKSGLLMPPRNHSGGDDAQTAR  378

Query  1449  VPSSTGPQPQPPRGIFSKSNSFSSLIAKPKVKLVDEVFPAKQKLSRETAFIESKEVAVRS  1628
              P S G + Q  + +  KSNS ++L +KPKVK+ DEVFP + K   E    ++ E   R 
Sbjct  379   SP-SVGLRGQISKSMLLKSNSSNNLNSKPKVKIGDEVFPPRPKGGHEQTS-KNMETTARM  436

Query  1629  MGKSMSFKPTTASRSNCTESKVKMFSPKFSHDQDVKWLRHKKDRSSFDRKNSLRSDR-LA  1805
               +S  FK ++  RS+  ESKVKM  PK +  QD+K  RH K+  S DRK   R+DR +A
Sbjct  437   TSRSTLFKSSSLGRSSAIESKVKML-PKPATIQDLKGSRHSKESGSLDRKYLSRNDRPVA  495

Query  1806  GGAISSPKSDNKPTPRGEPSSLSSLNTNRDYRALTSDNKPVTISNSTSGVARE-VLKQAS  1982
                +S+PK D K TPRGE     S   NR+ + +  D K    S ST+ ++R+ V  Q S
Sbjct  496   SSVVSTPKGDQKLTPRGETVIKPSAVNNRESK-INQDGKLSASSKSTNNISRKSVEPQGS  554

Query  1983  VDGVSSANRVSSSEENPSQAIPKEDSSSSSCVAERPSWSSNEVLPDGLSQSKESKAFGDK  2162
                                             +ER   S++E L D L +S+E+    +K
Sbjct  555   --------------------------------SERTIASNDEALQDVLPRSRETANQVEK  582

Query  2163  TRESSASRSKQNSTASGKIVSCQKCKGNGHLAQVCTA-----DGPESSALGSPFKSSREA  2327
             +RES + R +     + K   CQKC+  GH  + CTA      G E S   S    S+E 
Sbjct  583   SRESLSDRLRPVVPTASKSSYCQKCEEFGHSLEGCTAGNLQESGAEISVTASSI--SKEE  640

Query  2328  TNGPSDLKAAIEAARLRKPGICRKNRVADQSEDL--SASNMKSEIASQDQML-SSTVRRN  2498
              +  + LKAAI+AA L++P I RK  V+ Q++++  S + +  E  S+DQ+L S+T++ +
Sbjct  641   MHKGNKLKAAIQAALLKRPEIYRKKEVSSQTDEIPTSGTELNCEATSRDQVLVSNTLKNS  700

Query  2499  VNGAEEAQKQETANNA-------------KQLGII-AEASARTRNAGHVVFSDVKHSVID  2636
             ++  E  ++QE   N+             KQL     +  ++   +  V  +  K  V D
Sbjct  701   ISTEETREQQEVLENSTSESSKCSSASDLKQLNSCPTDLCSQLGKSDLVGLNAQKPLVRD  760

Query  2637  MERQTLVSMPVILKT-AIPEYQYIWQGGFEVQKSGKAFNLYDGIQAHLSSCASPKVLDAV  2813
             + R+ +    V+ K  A PEY+YIWQG FEV ++GK   L  G+QAHLSS ASPKVL+ V
Sbjct  761   LSRKAVAISSVVSKMLAFPEYEYIWQGVFEVHRNGKPPELCTGVQAHLSSSASPKVLEVV  820

Query  2814  NKFPRKVILNEVPRLSSWPMQFKECGVSEDNVALFFFAKDIGSYEKSYKVLLGDMVKHDL  2993
              KF  +V LNEV RLS+WP QF   G  EDN+AL+FFA+D+ SYE+ YK LL  M+++DL
Sbjct  821   TKFSPEVSLNEVSRLSTWPSQFHHGGAREDNIALYFFARDVESYERHYKGLLDHMIRNDL  880

Query  2994  ALQGNIGDIELLIFPSNQLPEKFQRWNLMFFLWGVFRGKRAN  3119
             AL+G    +ELLIFPSNQLPE  QRWN++ FLWGVFRG+R +
Sbjct  881   ALKGIFDGVELLIFPSNQLPENSQRWNMLLFLWGVFRGRRVD  922



>ref|XP_004154159.1| PREDICTED: uncharacterized protein LOC101211560, partial [Cucumis 
sativus]
Length=1116

 Score =   437 bits (1124),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 295/752 (39%), Positives = 409/752 (54%), Gaps = 104/752 (14%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNEHVNSG  1118
             CDICG  GRE LLAICSRCTDGAEHTYCM++ L+++PEGDWLCEECK  +E         
Sbjct  426   CDICGDAGREDLLAICSRCTDGAEHTYCMRERLDEVPEGDWLCEECKSAEE---------  476

Query  1119  RVNEKEKTSPSRRTTIAKSDHPLKMEQKTSDCWGDKAVEERSYLKTSGKRCTDDSEVSSP  1298
               NE +K                       D  G +   + S ++  GK+  D+ +VS  
Sbjct  477   --NENQK----------------------QDTEGKRVSRDGSSMRNFGKKNVDNVDVSVA  512

Query  1299  TKRQRLELR--SPTAQIPNRVTSLSRESSFKNLERGKVKPLNPFSSG-------SFAAKV  1451
              KRQ LE    S  A  P R   LSR+SS K+L++GK         G       S  A+ 
Sbjct  513   AKRQVLETNKGSTKASSPGRSIGLSRDSSSKSLDKGKSMLSQSKCLGDQCNNDVSEMARS  572

Query  1452  PSSTGPQPQPPRGIFSKSNSFSSLIAKPKVKLVDEVFPAKQKLSRETAFIESKEVAVRSM  1631
             PS  G +    +G   KSNSF++L +KPKV+LVD+  P K +  RE   +E KE   R++
Sbjct  573   PS-VGSRLHSLKGTLLKSNSFNTLNSKPKVRLVDDFIPQKPRGPREHTSLEVKEGPSRAL  631

Query  1632  GKSMSFKPTTASRSNCTESKVKMFSPKFSHDQDVKWLRHKKDRSSFDRKNSLRSDR----  1799
             GKS SFK  +  R++ +E+KVKM   KF H QD K ++  KDR+  DRKN  + DR    
Sbjct  632   GKSQSFKTPSFGRASMSEAKVKMIPSKFPHVQDPKGIKQGKDRNVLDRKNPSKVDRSWIS  691

Query  1800  --LAGGAISSPKSDNKPTPRGEPSSLSSLNTNRDYRALTSDNKPVTISNSTSGVAREVLK  1973
                   A+S+ K ++K + RGE    ++   NRD + + SD     IS ST   +R  L 
Sbjct  692   SVTTSSAVSTSKIESKLSSRGE----TNFGNNRDQKIIQSDG----IS-STHPKSRSSLV  742

Query  1974  QASVDGVSSANRV--------SSSEENPSQAIPKEDSSSSSCVAERPSWSSNEVLPDGLS  2129
                VD   S  R         SS ++  +  IPKE+  SSS   ER S++ N        
Sbjct  743   HKGVDSPLSPARALSTNGTCSSSVDQKINHVIPKEEPLSSSLTVERVSYNDN-------G  795

Query  2130  QSKESKAFGDKTRESSASRSKQNSTASGKIVSCQKCKGNGHLAQVCTADGPESSALGSPF  2309
             +S+E     +K RESSA+ SK     S K   C KCKG  H  + C +  P  S   +  
Sbjct  796   RSREMTGLDEKNRESSANPSKPTVATSPKSGHCLKCKGTEHATESCISGSPYVS--DNNI  853

Query  2310  KSSREATNGPSDLKAAIEAARLRKPGICRKNRVADQSE-------------------DLS  2432
              SSRE T   + LKAAI+AA L++P IC+K + +D S+                     S
Sbjct  854   ISSREDTCEENKLKAAIQAALLKRPEICKKRKFSDPSDEVSSSSTVSNSDIVHQDQFSFS  913

Query  2433  ASN-MKSEIASQDQMLSSTVRRNVNGAEEAQKQETANNAKQLGIIAEASARTRNAGHVVF  2609
              SN +K+E++S+      T+   VN +     ++  ++  +L ++    A   +      
Sbjct  914   FSNKLKTELSSERAHEGKTI---VNSSATNFHRQPVSSIPKLPVLPNLDAPVPSQSE---  967

Query  2610  SDVKHSVIDMERQTLVSMPVILKTAIPEYQYIWQGGFEVQKSGKAFNLYDGIQAHLSSCA  2789
              D   + I +E+  + S+  +LK  IPEY+YIWQGGFE+ + GK  +  DGIQAHLS+CA
Sbjct  968   -DTDSTSIPVEKVWMSSL--LLKIVIPEYEYIWQGGFELHRCGKLPDFCDGIQAHLSTCA  1024

Query  2790  SPKVLDAVNKFPRKVILNEVPRLSSWPMQFKECGVSEDNVALFFFAKDIGSYEKSYKVLL  2969
             SP+V++  +K P+ + L EVPRLS+WP QF +CGV EDN+AL+FFA+DI SYE++Y+ LL
Sbjct  1025  SPRVIEVASKLPQNISLKEVPRLSTWPSQFHDCGVKEDNIALYFFARDIHSYERNYRGLL  1084

Query  2970  GDMVKHDLALQGNIGDIELLIFPSNQLPEKFQ  3065
               M K+DLAL+GN+  +ELLIF SNQLPEK Q
Sbjct  1085  DHMTKNDLALKGNLDGVELLIFSSNQLPEKSQ  1116



>ref|XP_010549856.1| PREDICTED: uncharacterized protein LOC104820905 isoform X1 [Tarenaya 
hassleriana]
Length=1408

 Score =   415 bits (1066),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 300/753 (40%), Positives = 415/753 (55%), Gaps = 101/753 (13%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNEHVNSG  1118
             CDICG  GRE LLAICSRC+DGAEHTYCM++M++++PEGDWLCEECKF +E + + + + 
Sbjct  297   CDICGDAGREDLLAICSRCSDGAEHTYCMREMIDEVPEGDWLCEECKFAEEAEQQKLEAK  356

Query  1119  RVNEKEKTSPSRRTTIAKSDHPLKMEQKTSDCWGDKAVEERSYLKTSGKRCTDDSEVSSP  1298
             +  E   T P+             +  +TSD                 KRC + +E +  
Sbjct  357   KNRE---TGPN-------------LNAQTSD-----------------KRCAEKAEAALD  383

Query  1299  TKRQRLE--LRSPTAQIPNRVTSLSRESSFKNLERGKVKPLNPFSSGSFA---AKVPSST  1463
              KRQ +E    SP   I  R+ +LSRE SFK L++ K   ++  S  S +   A+   ST
Sbjct  384   VKRQAVEGPTGSPKKSILPRIAALSREPSFKALDKPKRTLVHQTSFTSLSSDDAESTHST  443

Query  1464  GPQPQPPRGIFSKSNSFSSLIAKPKVKLVDEVFPAKQKLSRETAFIESKEVAVRSMGKSM  1643
               Q Q  +G F +S+SF++  +KPKVKLVD+V   +Q+ ++E   I+ KE   R++GKSM
Sbjct  444   DSQFQSTKGTFFRSSSFNA-NSKPKVKLVDDVILPRQRTTKEHVSIDVKEGVSRTVGKSM  502

Query  1644  SFKPTTASRSNCTESKVKMFSPKFSHDQDVKWLRHKKDRSSFDRKNSLRSDRLAGGAISS  1823
             S + T    S+  + K K    KF H QDVK  +  KD+S+    NS           S 
Sbjct  503   SIRSTEVGCSSGNDLKGKTVLSKFYHLQDVKSSKQLKDQST--EANS-----------SV  549

Query  1824  PKSDNKPTPRGEPSSLSSLNTNRDYRALTSDNKPVTISNSTSGVAREVLKQ--ASVDGVS  1997
             P  D K   RG  S +S     RD +      K  +++  TS + R  L+   ASV G S
Sbjct  550   PTDDQKLISRGN-SFVSRAKNTRDLKG-----KLGSLTRQTSNLTRNRLENPIASV-GES  602

Query  1998  SANRVSSSEENPSQAIPKEDSSSSSCVAERPSWSSNEVLPDGLSQSKESKAFGDKTRESS  2177
             S N     +E  S + P E  +S + V            PD   +S+E +  G+K++E  
Sbjct  603   SINE---KDEPSSVSRPTEGLTSHATVN----------TPDATPRSREFREMGEKSKEVF  649

Query  2178  ASRSKQNSTASGKIVSCQKCKGNGHLAQ-VCTADGPESSALGSPFKSSREATNGPSDLKA  2354
              +RS+ +  +  K ++ QK    G  A+ + T+   ES    S  K  RE  N  + L+A
Sbjct  650   INRSRASLPSGSKGLASQK---EGQTAEPIDTSCASESDP--STTKKFREDINKGNRLRA  704

Query  2355  AIEAARLRKPGICRKNRVADQSEDLSASNMKS--EIASQDQMLSSTVRRNVN-----GAE  2513
             A++AA  +KP    KNR +   +    SNM S  +  SQ Q+   T + +++     G E
Sbjct  705   AVDAALRKKPNFG-KNRGSQLPDGSLVSNMDSSCDKTSQSQLPLKTTKNSMSSEGPQGGE  763

Query  2514  -------EAQKQETANNAKQLGI-IAEASARTRNAG-HVVFSDVKHSVIDMERQTLVSMP  2666
                    +  KQ  A N KQL    A+A    R+A   V F  VK  + D     LV   
Sbjct  764   LNLKIISDPYKQAIATNGKQLPFSAADAMYSPRSADLEVNFPSVKPVMRDW---PLVPTI  820

Query  2667  VILKT-AIPEYQYIWQGGFEVQKSGKAFNLYDGIQAHLSSCASPKVLDAVNKFPRKVILN  2843
             V+ KT AIPE++YIWQG  EVQ S     ++ GIQAHLS+ ASPKV + VNKF  KV LN
Sbjct  821   VLPKTSAIPEHEYIWQGDLEVQSSRNLLEMHSGIQAHLSTLASPKVREMVNKFLGKVPLN  880

Query  2844  EVPRLSSWPMQFKECGVSEDNVALFFFAKDIGSYEKSYKVLLGDMVKHDLALQGNIGDIE  3023
             EVPRLS+WP QF++ G  ED++ALFFFAKDI SYEK+YK L+ +M+K DLAL+GN+G +E
Sbjct  881   EVPRLSTWPAQFRDTGAKEDHIALFFFAKDIESYEKNYKPLVVNMIKKDLALKGNLGSVE  940

Query  3024  LLIFPSNQLPEKFQRWNLMFFLWGVFRGKRANS  3122
             LLIF SNQLP   QRWN++FFLWGVFRG++ +S
Sbjct  941   LLIFASNQLPRHCQRWNMLFFLWGVFRGRKESS  973



>gb|KCW90978.1| hypothetical protein EUGRSUZ_A02991 [Eucalyptus grandis]
Length=1112

 Score =   408 bits (1049),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 287/759 (38%), Positives = 383/759 (50%), Gaps = 113/759 (15%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNEHVNSG  1118
             CDICG  GRE LLAICSRC+DGAEHTYCM++ML+K+PEGDW+CEECK   E         
Sbjct  296   CDICGDAGREDLLAICSRCSDGAEHTYCMREMLQKVPEGDWVCEECKSADE---------  346

Query  1119  RVNEKEKTSPSRRTTIAKSDHPLKMEQKTSDCWGDKAVEERSYLKTSGKRCTDDSEVSSP  1298
               NE +K                 +E KT                    R T  S+V   
Sbjct  347   --NENQKPG---------------IEGKTL------------------SRVTSASQVPDK  371

Query  1299  TKRQRLELRSPTAQIPN---------RVTSLSRESSFKNLERGKVKPLNPFSSGSFAAKV  1451
             +  + +E+ SPT   P          RVTS SR+S FKN+++GK K     S  +     
Sbjct  372   SFVENIEV-SPTVIGPGSSKLCGSTRRVTS-SRDSCFKNIDKGKAKLARQMSCVNSVQDF  429

Query  1452  P-SSTGPQPQPPR--GIFSKSNSFSSLIAKPKVKLVDEVFPAKQKLSRETAFIESKEVAV  1622
             P  +  PQP   R  G   KSNSF++ IAKPKVK++DE    K K  RE +   SKE   
Sbjct  430   PEGARSPQPSNLRSKGTLLKSNSFNAFIAKPKVKVIDEGMIQKHKSIRENSSFISKEGPT  489

Query  1623  RSMGKSMSFKPTTASRSNCTESKVKMFSPKFSHDQDVKWLRHKKDRSSFDRKNSLRSDRL  1802
             + +GKSMSFK     R    ++KVKM   K +H Q  K  ++ K+ S  DR +  + DR 
Sbjct  490   KIIGKSMSFKHANPGRPLAVDAKVKMLPTKLTHVQTPKGSKNLKEGSVLDRMSLRKLDRT  549

Query  1803  AGGAI------SSPKSDNKPTPRGEPSSLSSLNTNRDYRALTSDNKPVTISNSTSGVARE  1964
                        S+P SD K T  GEP   S L+ NRD +   SD KP  +          
Sbjct  550   FSSLTRDNSTPSTPNSDQKLTSCGEPLQGSPLSNNRDSKLAQSDVKPAVL----------  599

Query  1965  VLKQASVDGVSSANRVSSSEENPSQAIPKEDS-SSSSCVAERPSWSSNEVLPDGLSQSKE  2141
                            V S+E   +Q   KE+  +SSS   E+     N +  DGLS+SK 
Sbjct  600   ---------------VKSAEYKSNQLDQKEEPLTSSSRTVEKHCIEGNGLRHDGLSRSKG  644

Query  2142  SKAFGDKTRESSASRSKQNSTASGKIVSCQKCKGNGHLAQVCTADGPESSALGSPFKSSR  2321
                  DK R+ S SRSK    +  + + CQKCK  GH A+ C     +     S  +S +
Sbjct  645   LANHTDKARDCSVSRSKPAVISGSRSIFCQKCKEVGHDAESCPVSSLQVGTDVSMTRSMK  704

Query  2322  EATNGPSDLKAAIEAARLRKPGICRKNRVADQSEDLSASNMKSEIASQDQMLSSTVRRNV  2501
             E T   S  K  I ++ L+KPG  R+N+  ++SEDLS S+        D +    V R V
Sbjct  705   EETYNSSKTKTPITSSMLKKPG--RRNKGPEKSEDLSVSSP----THMDPLSFPDVSRKV  758

Query  2502  ---NGAEEAQK-----------QETANNAKQLGIIAEASARTRNAGHVVFSDVKHSVIDM  2639
                +G  E Q            Q   NNA QL    +  A +    ++ F+         
Sbjct  759   MSADGPYEGQAVRQSCTSDSRLQMIGNNATQL-TGPQKGATSLKGANIDFTRHPEGSSSS  817

Query  2640  ERQTLVSMP--VILKTAIPEYQYIWQGGFEVQKSGKAFNLYDGIQAHLSSCASPKVLDAV  2813
                 +  +P  +   +AIPE++ IW+G  EV +  +  +   G+QAHLS+ AS +VLD V
Sbjct  818   HLPCVSVLPSAICRISAIPEHECIWRGSLEVCRGSQQLDFCGGLQAHLSTLASTRVLDMV  877

Query  2814  NKFPRKVILNEVPRLSSWPMQFKECGVSEDNVALFFFAKDIGSYEKSYKVLLGDMVKHDL  2993
              KF  K+ L+EVPR  +WP QF + G  +DN+AL+FFA+D  SYE+SYK LL  M+K DL
Sbjct  878   KKFSDKLSLSEVPRSCTWPTQFYDSGAQDDNIALYFFAEDPESYERSYKGLLEKMIKSDL  937

Query  2994  ALQGNIGDIELLIFPSNQLPEKFQRWNLMFFLWGVFRGK  3110
             AL+GN   +ELLIFPSNQLPEK QRWN +F+LWGVFRG+
Sbjct  938   ALKGNFDGVELLIFPSNQLPEKSQRWNTLFYLWGVFRGR  976



>ref|XP_010420369.1| PREDICTED: uncharacterized protein LOC104705960 [Camelina sativa]
 ref|XP_010420370.1| PREDICTED: uncharacterized protein LOC104705960 [Camelina sativa]
Length=1288

 Score =   409 bits (1050),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 298/783 (38%), Positives = 414/783 (53%), Gaps = 102/783 (13%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNEHVNSG  1118
             CDICG  GRE LLAICS C+DGAEHTYCM++ L ++P  DWLCEEC  + E         
Sbjct  276   CDICGDAGREDLLAICSGCSDGAEHTYCMRERLNEVPGDDWLCEECAEEAE---------  326

Query  1119  RVNEKEKTSPSRRTTIAKSDHPLKMEQKTSDCWGDKAVEERSYLKTSGKRCTDDSEVSSP  1298
                +K++    R T +  + H                        +SGKR  D  E +  
Sbjct  327   --KQKQEAKRKRETEVTLNAH------------------------SSGKRYADKIEAAPD  360

Query  1299  TKRQRLE--LRSPTAQIPNRVTSLSRESSFKNLER--GKVKPLNPFSSGSFAAKVPSSTG  1466
              KRQ +E    SP   I  R  +LSRE+SFK L+R  GK+     FS  + +A+   STG
Sbjct  361   AKRQAVEAPTGSPKKSILPRTGALSRETSFKGLDRLKGKLNHQTSFSDDTESAR---STG  417

Query  1467  PQPQPPRGIFSKSNSFSSLIAKPKVKLVDEVFPAKQKLSRETAFIESKEVAVRSMGKSMS  1646
              Q QPP+G F KS+SF+   +KPKV+L+D+    +QK  +E   +E KE   R++GKSMS
Sbjct  418   SQLQPPKGAFLKSSSFNCSSSKPKVQLMDDAIHPRQKTGKEYTALEIKEGGFRNVGKSMS  477

Query  1647  FKPTTASRSNCTESKVKMFSPKFSHDQDVKWLRHKKDRSSFDRKNSLRSDRLAGGAISSP  1826
              + T    S+  +S  K+   K  H Q+ K  +  KDRS+  +             +S+ 
Sbjct  478   SRTTDTGSSSGNDSHAKVLGSKVHHLQEGKSSKQVKDRSTEAK-------------VSAS  524

Query  1827  KSDNKPTPRGEPSSLSSLNTNRDYRALTSDNKPVTISNSTSGVAREVLKQ--ASVDGVSS  2000
               D K   RG  SS+S  N NRD + L SD K  +++   S + R  L+   AS   VS 
Sbjct  525   SIDQKLKSRGN-SSVSHANNNRDLKGLQSDGKRGSLTKQVSNLNRNRLENPVASGGDVSK  583

Query  2001  ANRVSSSEENPSQAIPKEDSSSSSCVAERPSWSSNEVLPDGLSQSKESKAFGDKTRESSA  2180
               + S SE++ SQA  K++  S SC  E         L DGL +S+ES+  G K++E+  
Sbjct  584   NEKCSGSEQSSSQADCKDELPSPSCTGEGTPSHGTVALHDGLPRSRESREVGKKSKEAVG  643

Query  2181  SRSKQNSTASGK-IVSCQKCKGNGHLAQVCTADGPESSALGSPFKSSREATNGPSDLKAA  2357
              R + +  +  K + S QK    G  A+     G   S L S  K  +E  N  + L+AA
Sbjct  644   KRQRSSLLSGAKGLPSHQK---GGQTAESSDTSGVPDSDL-STTKKVKEDINKGNRLRAA  699

Query  2358  IEAARLRKPGICRKNRVADQSEDLSASNMKSEIASQDQMLSSTV----RRNVNGAEEAQ-  2522
             ++AA  +KP    KNR  +QS+    SN+ S   S D+ L + +     +N    E  Q 
Sbjct  700   VDAALRKKPSFT-KNRGLEQSDASLVSNVDS---SSDKTLRNQLPPKLHKNYVSHEGLQG  755

Query  2523  ------------KQETANNAKQLGIIAEASARTRNAG-HVVFSDVKHSVIDMERQTLVSM  2663
                         KQ    N KQL      +   R+    V F  +K  + D+    LV  
Sbjct  756   GHPTLWPTSDPYKQTVVTNEKQLVFSGADTIPPRSMELEVNFPSIKPVMRDL---PLVPS  812

Query  2664  PVILKT-AIPEYQYIWQGGFEVQKSGKAFNLYDGIQAHLSSCASPKVLDAVNKFPRKVIL  2840
             P IL++ AIP+++ IWQG  EV+K      +  G+QAHLS+ ASP+V + VNKFP K  L
Sbjct  813   PFILRSSAIPDHESIWQGDLEVRKIRNQLAMCSGMQAHLSTLASPRVAEVVNKFPEKFSL  872

Query  2841  NEVPRLSSWPMQFKECGVSEDNVALFFFAKDIGSYEKSYKVLLGDMVKHDLALQGNIGDI  3020
             NEVPRLS+WP QF++ G  ED++ALFFFAKDI SYE++YK L+ +M+K+DLAL+GN+ ++
Sbjct  873   NEVPRLSTWPGQFQKLGTKEDHIALFFFAKDIESYERNYKPLVDNMIKNDLALKGNLENV  932

Query  3021  ELLIFPSNQLPEKFQRWNLMFFLWGVFRGKRANSLQNFPGAEKPLIQDIPTPATSLPENM  3200
             ELLIF SNQLP   QRWN+++FLWGVFRG R ++  N            P   TSLP + 
Sbjct  933   ELLIFASNQLPLSCQRWNMLYFLWGVFRG-RGDTCTN------------PQKNTSLPTSN  979

Query  3201  FTP  3209
               P
Sbjct  980   VVP  982



>ref|XP_010453830.1| PREDICTED: uncharacterized protein LOC104735701 [Camelina sativa]
Length=1274

 Score =   407 bits (1047),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 291/750 (39%), Positives = 407/750 (54%), Gaps = 89/750 (12%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNEHVNSG  1118
             CDICG  GRE LLAICS C+DGAEHTYCM++ L ++P  DWLCEEC  + E         
Sbjct  266   CDICGDAGREDLLAICSGCSDGAEHTYCMRERLNEVPGDDWLCEECAEEAE---------  316

Query  1119  RVNEKEKTSPSRRTTIAKSDHPLKMEQKTSDCWGDKAVEERSYLKTSGKRCTDDSEVSSP  1298
                +K++    R T +  + H                        +SGKR  D  E +  
Sbjct  317   --KQKQEAKRKRETEVTLNAH------------------------SSGKRYADKIEAAPD  350

Query  1299  TKRQRLE--LRSPTAQIPNRVTSLSRESSFKNLER--GKVKPLNPFSSGSFAAKVPSSTG  1466
              KRQ +E    SP   I  R+ +LSRE+SFK L+R  GK+     FS  + +A+   STG
Sbjct  351   AKRQAVEAPTGSPKKSILPRIGALSRETSFKGLDRLRGKLNHQTSFSDDTESAR---STG  407

Query  1467  PQPQPPRGIFSKSNSFSSLIAKPKVKLVDEVFPAKQKLSRETAFIESKEVAVRSMGKSMS  1646
              Q QPP+G F KS+SF+   +KPKV+L+D+    +QK  +E   +E KE   R++GKSMS
Sbjct  408   SQLQPPKGAFLKSSSFNCSSSKPKVQLMDDAIHPRQKTGKEYTALELKEGGFRNVGKSMS  467

Query  1647  FKPTTASRSNCTESKVKMFSPKFSHDQDVKWLRHKKDRSSFDRKNSLRSDRLAGGAISSP  1826
              + T +  S+  +S  K+   K  H Q+ K  +  KDRS+  +             +S+ 
Sbjct  468   SRTTDSGSSSGNDSHAKVLGSKVHHLQEGKSSKQVKDRSTEAK-------------VSAS  514

Query  1827  KSDNKPTPRGEPSSLSSLNTNRDYRALTSDNKPVTISNSTSGVAREVLKQ--ASVDGVSS  2000
               D K   RG  SS+S  N NRD + L SD K  +++   S + R  L    AS   VS 
Sbjct  515   SIDQKLKSRGN-SSVSHANNNRDLKGLQSDGKRGSLTKQVSNLNRNRLANPVASGGDVSK  573

Query  2001  ANRVSSSEENPSQAIPKEDSSSSSCVAERPSWSSNEVLPDGLSQSKESKAFGDKTRESSA  2180
               + S SE++ SQA  K++  S SC  E         L DGL +S+ES+  G K++E+  
Sbjct  574   NEKCSGSEQSSSQADCKDELPSPSCTGEGTPSHGTVALHDGLPRSRESREVGKKSKEAVG  633

Query  2181  SRSKQNSTASGK-IVSCQKCKGNGHLAQVCTADGPESSALGSPFKSSREATNGPSDLKAA  2357
              R + +  +  K + S QK    G  A+     G   S L S  K  +E  N  + L+AA
Sbjct  634   KRQRSSLLSGAKGLPSHQK---GGQTAESSDTSGVPDSDL-STTKKVKEDINKGNRLRAA  689

Query  2358  IEAARLRKPGICRKNRVADQSEDLSASNMKSEIASQDQMLSSTV----RRNVNGAEEAQ-  2522
             ++AA  +KP    KNR  +QS+    SN+ S   S D+ L + +     +N    E  Q 
Sbjct  690   VDAALRKKPSFT-KNRGLEQSDASLVSNVDS---SSDKTLRNQLPPKLHKNYVSHEGLQG  745

Query  2523  ------------KQETANNAKQLGIIAEASARTRNAG-HVVFSDVKHSVIDMERQTLVSM  2663
                         KQ    N KQL +    +   R+    V F  +K  + D+    LV  
Sbjct  746   GHPTLWPTSDPYKQTVVTNEKQLVLSGADTIPPRSMELEVNFPSIKPVMRDL---PLVPS  802

Query  2664  PVILKT-AIPEYQYIWQGGFEVQKSGKAFNLYDGIQAHLSSCASPKVLDAVNKFPRKVIL  2840
             PVIL++ AIP+++ IWQG  EV+K      +  G+QAHLS+ ASP+V + VNKFP K  L
Sbjct  803   PVILRSSAIPDHESIWQGDLEVRKIRNQLAMCSGMQAHLSTLASPRVAEVVNKFPEKFSL  862

Query  2841  NEVPRLSSWPMQFKECGVSEDNVALFFFAKDIGSYEKSYKVLLGDMVKHDLALQGNIGDI  3020
             NEVPRLS+WP QF++ G  ED++ALFFFAKDI SYE++YK L+ +M+K+DLAL+GN+ ++
Sbjct  863   NEVPRLSTWPGQFQKLGTKEDHIALFFFAKDIESYERNYKPLVDNMIKNDLALKGNLENV  922

Query  3021  ELLIFPSNQLPEKFQRWNLMFFLWGVFRGK  3110
             ELLIF SNQLP   QRWN+++FLWGVFRG+
Sbjct  923   ELLIFASNQLPLNCQRWNMLYFLWGVFRGR  952



>emb|CDX70705.1| BnaC03g07890D [Brassica napus]
Length=1192

 Score =   404 bits (1039),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 283/742 (38%), Positives = 406/742 (55%), Gaps = 86/742 (12%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNEHVNSG  1118
             CDICG  GRE LLAIC+ C+DGAEH YCM++ L  +PEGDWLCEEC+   E         
Sbjct  194   CDICGDAGREDLLAICTGCSDGAEHIYCMRERLNAVPEGDWLCEECQTVAE---------  244

Query  1119  RVNEKEKTSPSRRTTIAKSDHPLKMEQKTSDCWGDKAVEERSYLKTSGKRCTDDSEVSSP  1298
                +K++    R T +  S H                        +SGKR  D  E +  
Sbjct  245   --KQKQEAKRKRETEVILSPH------------------------SSGKRHADKIEAAPD  278

Query  1299  TKRQRLE--LRSPTAQIPNRVTSLSRESSFKNLE--RGKVKPLNPFSSGSFAAKVPSSTG  1466
              KRQ +E    SP   +  R+ +LSRE+SFK L+  RGK+   + F+     A+   STG
Sbjct  279   AKRQAVEDSTGSPKKPVLPRIGALSRETSFKGLDSPRGKLSHQSSFTDKMEGAR---STG  335

Query  1467  PQPQPPRGIFSKSNSFSSLIAKPKVKLVDE--VFPAKQKLSRETAFIESKEVAVRSMGKS  1640
              Q  PP+G F KS+SF+S  +KPKV+L+D+  + P K+           K+ ++ ++ KS
Sbjct  336   SQLHPPKGGFLKSSSFNSSSSKPKVQLMDDDVILPRKKI---------RKDSSLGNLSKS  386

Query  1641  MSFKPTTASRSNCTESKVKMFSPKFSHDQDVKWLRHKKDRSSFDRKNSLRSDRLAGGAIS  1820
             MS K T    SN  +S+ KM + K  H Q+ K  +  KDRS+            A    +
Sbjct  387   MSSKTTDTGSSNGNDSQAKMLASKVYHSQEGKSPKQLKDRSTE-----------ANAPAA  435

Query  1821  SPKSDNKPTPRGEPSSLSS--LNTNRDYRALTSDNKPVTISNSTSGVAREVLKQASVDG-  1991
             S  +D K TPR   SSL S   N+ RD + L SD K  +++   S + R  L+     G 
Sbjct  436   S--TDQKLTPR---SSLGSSYANSTRDSKGLQSDGKRGSLTKQVSNLNRNRLESPVTSGS  490

Query  1992  -VSSANRVSSSEENPSQAIPKEDSSSSSCVAERPSWSSNEVLPDGLSQSKESKAFGDKTR  2168
              + +  + ++ E++ SQA  + +  S+SC  E    + N    D L +S+E +  G K+R
Sbjct  491   DIPTNGKCNAREQSSSQADCENELLSTSCAGEVVPSNGNVASQDRLPRSREFREVGKKSR  550

Query  2169  ESSASRSKQNSTASGK-IVSCQKCKGNGHLAQVCTADGPESSALGSPFKSSREATNGPSD  2345
             E+S  R + +  +  K + S QK    G  A+     G   S L +P K++RE  N  + 
Sbjct  551   EASGKRQRSSLLSDAKGLPSSQK---GGQTAESNETSGVSDSDLPTP-KNAREDINKGNR  606

Query  2346  LKAAIEAARLRKPGICRKNRVADQSEDLSASNMK--SEIASQDQMLSSTVRRNVNGAEEA  2519
             L+AA++AA  +KP    KNRV +Q +  SASN+   S+ A Q+Q L   +      A + 
Sbjct  607   LRAAVDAALRKKPSFG-KNRVLEQCDTSSASNVHPSSDKALQNQ-LPPKMHTTSWPAPDP  664

Query  2520  QKQETANNAKQL---GIIAEASARTRNAGHVVFSDVKHSVIDMERQTLVSMPVILKT-AI  2687
              KQ    N KQL   G+ A    R+         ++      M    LV  P +L++ AI
Sbjct  665   YKQTIVTNEKQLVPSGVDAMMPPRSVELDMKPEVNIPSLKSVMRDWPLVPPPALLRSSAI  724

Query  2688  PEYQYIWQGGFEVQKSGKAFNLYDGIQAHLSSCASPKVLDAVNKFPRKVILNEVPRLSSW  2867
             P+++ IWQG  EV+K+     ++ G+QAHLS+ ASPKV + VNKFP K  LNEVPRLS+W
Sbjct  725   PDHESIWQGNLEVRKARNQSAMHSGMQAHLSTLASPKVAEVVNKFPEKFSLNEVPRLSTW  784

Query  2868  PMQFKECGVSEDNVALFFFAKDIGSYEKSYKVLLGDMVKHDLALQGNIGDIELLIFPSNQ  3047
             P QF++ G  ED++ALFFFAKD+ SYE++YK L+ +M+K DLAL+GN+  +ELLIF SNQ
Sbjct  785   PAQFQDSGTKEDHIALFFFAKDVESYERNYKPLVDNMMKKDLALKGNLDSVELLIFASNQ  844

Query  3048  LPEKFQRWNLMFFLWGVFRGKR  3113
             LP   QRWN+++FLWGVFRG++
Sbjct  845   LPPNCQRWNMLYFLWGVFRGRK  866



>ref|XP_010492581.1| PREDICTED: uncharacterized protein LOC104769950 [Camelina sativa]
 ref|XP_010492582.1| PREDICTED: uncharacterized protein LOC104769950 [Camelina sativa]
 ref|XP_010492583.1| PREDICTED: uncharacterized protein LOC104769950 [Camelina sativa]
Length=1303

 Score =   406 bits (1044),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 297/787 (38%), Positives = 422/787 (54%), Gaps = 110/787 (14%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNEHVNSG  1118
             CDICG  GRE LLAICS C+DGAEHTYCM++ L ++P  DWLCEEC  + E         
Sbjct  276   CDICGDAGREDLLAICSGCSDGAEHTYCMRERLNEVPGDDWLCEECAEEAE---------  326

Query  1119  RVNEKEKTSPSRRTTIAKSDHPLKMEQKTSDCWGDKAVEERSYLKTSGKRCTDDSEVSSP  1298
                +K+++   R T +  + H                        +SGKR  D  E +  
Sbjct  327   --KQKQESKRKRETEVTLNAH------------------------SSGKRHADKIEAAPD  360

Query  1299  TKRQRLE--LRSPTAQIPNRVTSLSRESSFKNLER--GKVKPLNPFSSGSFAAKVPSSTG  1466
              KRQ +E    SP   I  R+ +LSRE+SFK L+R  GK+     FS  + +A+   STG
Sbjct  361   AKRQAVEAPTGSPKKSILPRIGALSRETSFKGLDRLRGKLNHQTSFSDDTESAR---STG  417

Query  1467  PQPQPPRGIFSKSNSFSSLIAKPKVKLVDEVFPAKQKLSRETAFIESKEVAVRSMGKSMS  1646
              Q QPP+G + KS+SF+   +KPKV+L+D+    +QK  +E   +E KE   R++GKSMS
Sbjct  418   SQLQPPKGAYLKSSSFNCSSSKPKVQLMDDAIHPRQKTGKEYTALELKEGGNRNVGKSMS  477

Query  1647  FKPTTASRSNCTESKVKMFSPKFSHDQDVKWLRHKKDRSSFDRKNSLRSDRLAGGAISSP  1826
              + T    S+  +S  KM   K  H Q+ K  +  KDR++  +             +S+ 
Sbjct  478   SRTTDVGSSSGNDSHAKMLGSKVHHLQEGKSSKQVKDRNTEAK-------------VSAS  524

Query  1827  KSDNKPTPRGEPSSLSSLNTNRDYRALTSDNKPVTISNSTSGVAREVLKQ--ASVDGVSS  2000
               D K   RG  SS+S  N NRD + L SD K  +++   S + R  L+   AS   VS 
Sbjct  525   SIDQKLKSRGN-SSVSHANNNRDLKGLQSDGKRGSLTKQVSNLNRNRLENPVASGGDVSK  583

Query  2001  ANRVSSSEENPSQAIPKEDSSSSSCVAERPSWSSNEVLPDGLSQSKESKAFGDKTRESSA  2180
               + S SE++ SQA  +++  S SC  E         + DGL +S+ES+  G K++E+  
Sbjct  584   NEKCSGSEQSSSQADCRDELPSPSCTGEGTPSHGTVAIHDGLPRSRESREVGKKSKEAVG  643

Query  2181  SRSKQNSTASGKIVSCQKCKGNGHLAQVC-TADGPESSALG----SPFKSSREATNGPSD  2345
              R +++S  SG        KG     +VC TA+  ++S +     S  K+ +E  N  + 
Sbjct  644   KR-QRSSLLSG-------AKGLPSHQKVCQTAESSDTSGVPDSDLSTTKNVKEDINKGNR  695

Query  2346  LKAAIEAARLRKPGICRKNRVADQSEDLSASNMKSEIASQDQMLSSTV----RRNVNGAE  2513
             L+AA++AA  +KP    KNR  +QS+    SN+ S   S D+ L + +     +N    E
Sbjct  696   LRAAVDAALRKKPSFT-KNRGLEQSDASLVSNVDS---SSDKTLRNQLPPKLHKNYVSHE  751

Query  2514  EAQ-------------KQETANNAKQLGIIAEASARTRNAG-HVVFSDVKHSVIDMERQT  2651
               Q             KQ    N KQL +    +   R+    V F  +K  + D     
Sbjct  752   GWQGGHPTLWPASDPYKQTIVTNEKQLVLSGADTIPPRSMELEVNFPSIKPVMRDF---P  808

Query  2652  LVSMPVILKT-AIPEYQYIWQGGFEVQKSGKAFNLYDGIQAHLSSCASPKVLDAVNKFPR  2828
             LV  PVIL++ AIP+++ IWQG  EV+K      +  G+QAHLS+ ASP+V + VNKFP 
Sbjct  809   LVPSPVILRSSAIPDHESIWQGDLEVRKIRNQLAMCSGMQAHLSTLASPRVAEVVNKFPE  868

Query  2829  KVILNEVPRLSSWPMQFKECGVSEDNVALFFFAKDIGSYEKSYKVLLGDMVKHDLALQGN  3008
             K  LNEVPRLS+WP QF++ G  ED++ALFFFAKDI SYE++YK L+ +M+K+DLAL+GN
Sbjct  869   KFSLNEVPRLSTWPGQFQKLGTKEDHIALFFFAKDIESYERNYKPLVDNMIKNDLALKGN  928

Query  3009  IGDIELLIFPSNQLPEKFQRWNLMFFLWGVFRGKRANSLQNFPGAEKPLIQDIPTPATSL  3188
             + ++ELLIF SNQLP   QRWN+++FLWGVFRG R  +  N            P  +TSL
Sbjct  929   LDNVELLIFASNQLPLNCQRWNMLYFLWGVFRG-RGETCTN------------PQKSTSL  975

Query  3189  PENMFTP  3209
             P +   P
Sbjct  976   PTSNVMP  982



>ref|XP_010525303.1| PREDICTED: uncharacterized protein LOC104803125 [Tarenaya hassleriana]
Length=1388

 Score =   407 bits (1047),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 288/763 (38%), Positives = 413/763 (54%), Gaps = 99/763 (13%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNEHVNSG  1118
             CDICG  GRE LLAICSRC+DGAEHTYCM++ML+++P+GDWLCEECKF +E + +     
Sbjct  291   CDICGDAGREDLLAICSRCSDGAEHTYCMREMLDEVPKGDWLCEECKFAEEAEKQ-----  345

Query  1119  RVNEKEKTSPSRRTTIAKSDHPLKMEQKTSDCWGDKAVEERSYLKTSGKRCTDDSEVSSP  1298
                                    K+E K     G +  E    ++  GKR  + +E +  
Sbjct  346   -----------------------KLEAK-----GKRETEVNLNVQIPGKRRAEKAEAAPD  377

Query  1299  TKRQRLELR--SPTAQIPNRVTSLSRESSFKNLERGKVKPLNPFSSGSFA---AKVPSST  1463
              KRQ +E    SP   +  R+ SLSRESSFK L++ K K ++  S  S     A+   ST
Sbjct  378   AKRQAIEASTVSPKKSVLPRIASLSRESSFKGLDKTKRKLVHQASFTSLLSGDAENTRST  437

Query  1464  GPQPQPPRGIFSKSNSFSSLIAKPKVKLVDEVFPAKQKLSRETAFIESKEVAVRSMGKSM  1643
             G Q Q P+G F KSNSF++  +KPKVK +DEV   +Q+  +E   ++ KE   R++ KSM
Sbjct  438   GSQLQSPKGTFFKSNSFNA-SSKPKVKPIDEVVLPRQRSVKEHVSLDMKEGVSRTVAKSM  496

Query  1644  SFKPTTAS--RSNCTESKVKMFSPKFSHDQDVKWLRHKKDRSSFDRKNSLRSDRLAGGAI  1817
             S + +      SN  + KVK               R  KD+S+    NS           
Sbjct  497   SIRSSEVGCLISNDLKGKVKG--------------RQLKDQSA--EVNS-----------  529

Query  1818  SSPKSDNKPTPRGEPSSLSSLNTNRDYRALTSDNKPVTISNSTSGVAREVLKQ--ASVDG  1991
              +P  D K   RG  S   + NT RD + L +D K  +++   S ++R   +   ASV  
Sbjct  530   PAPMGDQKLISRGNSSLFHAKNT-RDLKGLQADVKLGSLTRQASNLSRSRAENPVASVGE  588

Query  1992  VSSANRVSSSEENPSQAIPKEDSSSSSCVAE---RPSWSSNEVLPDGLSQSKESKAFGDK  2162
              S   + +SSE+  SQ   K++  S S +AE   R +  +N    D + +S+ES   G+K
Sbjct  589   SSINEKGNSSEQISSQTNRKDEPQSISGLAEGLSRLTSHANVSTQDVVPRSRESGEMGEK  648

Query  2163  TRESSASRSKQNSTASGKIVSCQK-CKGNGHLAQVCTADGPESSALGSPFKSSREATNGP  2339
             +++   +R + +  +  K ++ QK  +    +   C +D    +      +S RE  N  
Sbjct  649   SKDVLINRPRSSLLSGPKDLASQKESQAAEPIDTSCASDTDLCTT-----RSYREDINKG  703

Query  2340  SDLKAAIEAARLRKPGICRKNRVADQSEDLSASNMK--SEIASQDQMLSSTVRR------  2495
             + L+AA++AA  +KP    KNR ++Q +  S SNM+   +  S  Q+   T +       
Sbjct  704   NRLRAAVDAALRKKPSFG-KNRGSEQPDGSSVSNMEPSCDKTSHSQLPLKTTKNSTSFEG  762

Query  2496  ------NVNGAEEAQKQETANNAKQLGIIAEASARTRNAGHVVFSDVKHSVIDMERQTLV  2657
                   N+  A +  KQ    N KQ    A  +  +  +  +  +      I  +   + 
Sbjct  763   PQGGQPNLRTASDPYKQTITTNGKQFAFSAADTVYSPRSEDLEVNYPSIKPIPRDWPFVP  822

Query  2658  SMPVILKTAIPEYQYIWQGGFEVQKSGKAFNLYDGIQAHLSSCASPKVLDAVNKFPRKVI  2837
             S  +   +AIPE++YIWQG FEVQ+S      + GIQAHLS+ ASPKVL+AVNKFP KV 
Sbjct  823   SNDMSKTSAIPEHEYIWQGDFEVQRSRNLLETHSGIQAHLSTLASPKVLEAVNKFPLKVS  882

Query  2838  LNEVPRLSSWPMQFKECGVSEDNVALFFFAKDIGSYEKSYKVLLGDMVKHDLALQGNIGD  3017
             LNEVPRLS+WP QF++ G  ED++ALFFFAKDI SYEK+YK L+ +M+K DLAL+GN G 
Sbjct  883   LNEVPRLSTWPAQFRD-GTKEDHIALFFFAKDIESYEKNYKPLVDNMIKKDLALKGNFGG  941

Query  3018  IELLIFPSNQLPEKFQRWNLMFFLWGVFRGKRANS---LQNFP  3137
             +ELLIF SNQLP+  QRWN++FFLWGVFRG++ +S   L+N P
Sbjct  942   VELLIFASNQLPQLCQRWNMLFFLWGVFRGRKESSSDQLKNNP  984



>ref|XP_010063523.1| PREDICTED: uncharacterized protein LOC104450589 isoform X3 [Eucalyptus 
grandis]
Length=1543

 Score =   409 bits (1052),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 287/759 (38%), Positives = 383/759 (50%), Gaps = 113/759 (15%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNEHVNSG  1118
             CDICG  GRE LLAICSRC+DGAEHTYCM++ML+K+PEGDW+CEECK   E         
Sbjct  263   CDICGDAGREDLLAICSRCSDGAEHTYCMREMLQKVPEGDWVCEECKSADE---------  313

Query  1119  RVNEKEKTSPSRRTTIAKSDHPLKMEQKTSDCWGDKAVEERSYLKTSGKRCTDDSEVSSP  1298
               NE +K                 +E KT                    R T  S+V   
Sbjct  314   --NENQKPG---------------IEGKTL------------------SRVTSASQVPDK  338

Query  1299  TKRQRLELRSPTAQIPN---------RVTSLSRESSFKNLERGKVKPLNPFSSGSFAAKV  1451
             +  + +E+ SPT   P          RVTS SR+S FKN+++GK K     S  +     
Sbjct  339   SFVENIEV-SPTVIGPGSSKLCGSTRRVTS-SRDSCFKNIDKGKAKLARQMSCVNSVQDF  396

Query  1452  P-SSTGPQPQPPR--GIFSKSNSFSSLIAKPKVKLVDEVFPAKQKLSRETAFIESKEVAV  1622
             P  +  PQP   R  G   KSNSF++ IAKPKVK++DE    K K  RE +   SKE   
Sbjct  397   PEGARSPQPSNLRSKGTLLKSNSFNAFIAKPKVKVIDEGMIQKHKSIRENSSFISKEGPT  456

Query  1623  RSMGKSMSFKPTTASRSNCTESKVKMFSPKFSHDQDVKWLRHKKDRSSFDRKNSLRSDRL  1802
             + +GKSMSFK     R    ++KVKM   K +H Q  K  ++ K+ S  DR +  + DR 
Sbjct  457   KIIGKSMSFKHANPGRPLAVDAKVKMLPTKLTHVQTPKGSKNLKEGSVLDRMSLRKLDRT  516

Query  1803  AGGAI------SSPKSDNKPTPRGEPSSLSSLNTNRDYRALTSDNKPVTISNSTSGVARE  1964
                        S+P SD K T  GEP   S L+ NRD +   SD KP  +          
Sbjct  517   FSSLTRDNSTPSTPNSDQKLTSCGEPLQGSPLSNNRDSKLAQSDVKPAVL----------  566

Query  1965  VLKQASVDGVSSANRVSSSEENPSQAIPKEDS-SSSSCVAERPSWSSNEVLPDGLSQSKE  2141
                            V S+E   +Q   KE+  +SSS   E+     N +  DGLS+SK 
Sbjct  567   ---------------VKSAEYKSNQLDQKEEPLTSSSRTVEKHCIEGNGLRHDGLSRSKG  611

Query  2142  SKAFGDKTRESSASRSKQNSTASGKIVSCQKCKGNGHLAQVCTADGPESSALGSPFKSSR  2321
                  DK R+ S SRSK    +  + + CQKCK  GH A+ C     +     S  +S +
Sbjct  612   LANHTDKARDCSVSRSKPAVISGSRSIFCQKCKEVGHDAESCPVSSLQVGTDVSMTRSMK  671

Query  2322  EATNGPSDLKAAIEAARLRKPGICRKNRVADQSEDLSASNMKSEIASQDQMLSSTVRRNV  2501
             E T   S  K  I ++ L+KPG  R+N+  ++SEDLS S+        D +    V R V
Sbjct  672   EETYNSSKTKTPITSSMLKKPG--RRNKGPEKSEDLSVSSP----THMDPLSFPDVSRKV  725

Query  2502  ---NGAEEAQK-----------QETANNAKQLGIIAEASARTRNAGHVVFSDVKHSVIDM  2639
                +G  E Q            Q   NNA QL    +  A +    ++ F+         
Sbjct  726   MSADGPYEGQAVRQSCTSDSRLQMIGNNATQL-TGPQKGATSLKGANIDFTRHPEGSSSS  784

Query  2640  ERQTLVSMP--VILKTAIPEYQYIWQGGFEVQKSGKAFNLYDGIQAHLSSCASPKVLDAV  2813
                 +  +P  +   +AIPE++ IW+G  EV +  +  +   G+QAHLS+ AS +VLD V
Sbjct  785   HLPCVSVLPSAICRISAIPEHECIWRGSLEVCRGSQQLDFCGGLQAHLSTLASTRVLDMV  844

Query  2814  NKFPRKVILNEVPRLSSWPMQFKECGVSEDNVALFFFAKDIGSYEKSYKVLLGDMVKHDL  2993
              KF  K+ L+EVPR  +WP QF + G  +DN+AL+FFA+D  SYE+SYK LL  M+K DL
Sbjct  845   KKFSDKLSLSEVPRSCTWPTQFYDSGAQDDNIALYFFAEDPESYERSYKGLLEKMIKSDL  904

Query  2994  ALQGNIGDIELLIFPSNQLPEKFQRWNLMFFLWGVFRGK  3110
             AL+GN   +ELLIFPSNQLPEK QRWN +F+LWGVFRG+
Sbjct  905   ALKGNFDGVELLIFPSNQLPEKSQRWNTLFYLWGVFRGR  943


 Score = 90.9 bits (224),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 88/242 (36%), Positives = 128/242 (53%), Gaps = 14/242 (6%)
 Frame = +3

Query  3732  TLNVISSFGVNPKKRSHS--AETVLQsasssgtsqafssysNDDILVEEFCHKRVKLNSD  3905
             TL+V+     + KKR HS   ET LQ++  +    A+++ S++++ +E    K+ K +  
Sbjct  1304  TLDVLKHLQ-HEKKRRHSDLVETALQTSFGTNEKVAWNNVSSENVKIEHV-DKKQKTDCR  1361

Query  3906  RSYGCNDQTSCS-KDGFLSEMGGTASQLSRQKNERDEALSKTAILETPGNAEMFFFPVDP  4082
               Y  +     +  DGF S+     S L+  +   ++   +   LE  G AE FFFPV  
Sbjct  1362  EIYEASRPIDANLVDGFASQKSAQDSTLAVVEKLHNKVCDEPINLENTGTAERFFFPVLS  1421

Query  4083  HPVGNIGSNNSSMPWKVHPLE-EDQLHDKAPNLELALGAKTKPLMSGIPSFLSGKVEKKI  4259
             +   ++ S  SSMPWK  P     + HD  PNL+LALGAKTK    G+     G     +
Sbjct  1422  NHAKDLTSAESSMPWKTLPSSVPARSHDGVPNLDLALGAKTKSSNKGLLPLWIG-----V  1476

Query  4260  IEENTSDNAATSANKED-VsaslslslsFPFPEKEHGTSSKPEQED--PRRRQANTSLLL  4430
              +++ S   A +A +ED VS SLSLSLSFPFP+ + G    P+ E   P  R+ NTSLLL
Sbjct  1477  ADKSDSHPEAVAAQEEDPVSGSLSLSLSFPFPDSDKGFKPVPDAEQLLPESRRVNTSLLL  1536

Query  4431  FG  4436
             FG
Sbjct  1537  FG  1538



>ref|XP_010063504.1| PREDICTED: uncharacterized protein LOC104450589 isoform X1 [Eucalyptus 
grandis]
Length=1609

 Score =   410 bits (1054),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 287/759 (38%), Positives = 383/759 (50%), Gaps = 113/759 (15%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNEHVNSG  1118
             CDICG  GRE LLAICSRC+DGAEHTYCM++ML+K+PEGDW+CEECK   E         
Sbjct  329   CDICGDAGREDLLAICSRCSDGAEHTYCMREMLQKVPEGDWVCEECKSADE---------  379

Query  1119  RVNEKEKTSPSRRTTIAKSDHPLKMEQKTSDCWGDKAVEERSYLKTSGKRCTDDSEVSSP  1298
               NE +K                 +E KT                    R T  S+V   
Sbjct  380   --NENQKPG---------------IEGKTL------------------SRVTSASQVPDK  404

Query  1299  TKRQRLELRSPTAQIPN---------RVTSLSRESSFKNLERGKVKPLNPFSSGSFAAKV  1451
             +  + +E+ SPT   P          RVTS SR+S FKN+++GK K     S  +     
Sbjct  405   SFVENIEV-SPTVIGPGSSKLCGSTRRVTS-SRDSCFKNIDKGKAKLARQMSCVNSVQDF  462

Query  1452  P-SSTGPQPQPPR--GIFSKSNSFSSLIAKPKVKLVDEVFPAKQKLSRETAFIESKEVAV  1622
             P  +  PQP   R  G   KSNSF++ IAKPKVK++DE    K K  RE +   SKE   
Sbjct  463   PEGARSPQPSNLRSKGTLLKSNSFNAFIAKPKVKVIDEGMIQKHKSIRENSSFISKEGPT  522

Query  1623  RSMGKSMSFKPTTASRSNCTESKVKMFSPKFSHDQDVKWLRHKKDRSSFDRKNSLRSDRL  1802
             + +GKSMSFK     R    ++KVKM   K +H Q  K  ++ K+ S  DR +  + DR 
Sbjct  523   KIIGKSMSFKHANPGRPLAVDAKVKMLPTKLTHVQTPKGSKNLKEGSVLDRMSLRKLDRT  582

Query  1803  AGGAI------SSPKSDNKPTPRGEPSSLSSLNTNRDYRALTSDNKPVTISNSTSGVARE  1964
                        S+P SD K T  GEP   S L+ NRD +   SD KP  +          
Sbjct  583   FSSLTRDNSTPSTPNSDQKLTSCGEPLQGSPLSNNRDSKLAQSDVKPAVL----------  632

Query  1965  VLKQASVDGVSSANRVSSSEENPSQAIPKEDS-SSSSCVAERPSWSSNEVLPDGLSQSKE  2141
                            V S+E   +Q   KE+  +SSS   E+     N +  DGLS+SK 
Sbjct  633   ---------------VKSAEYKSNQLDQKEEPLTSSSRTVEKHCIEGNGLRHDGLSRSKG  677

Query  2142  SKAFGDKTRESSASRSKQNSTASGKIVSCQKCKGNGHLAQVCTADGPESSALGSPFKSSR  2321
                  DK R+ S SRSK    +  + + CQKCK  GH A+ C     +     S  +S +
Sbjct  678   LANHTDKARDCSVSRSKPAVISGSRSIFCQKCKEVGHDAESCPVSSLQVGTDVSMTRSMK  737

Query  2322  EATNGPSDLKAAIEAARLRKPGICRKNRVADQSEDLSASNMKSEIASQDQMLSSTVRRNV  2501
             E T   S  K  I ++ L+KPG  R+N+  ++SEDLS S+        D +    V R V
Sbjct  738   EETYNSSKTKTPITSSMLKKPG--RRNKGPEKSEDLSVSSP----THMDPLSFPDVSRKV  791

Query  2502  ---NGAEEAQK-----------QETANNAKQLGIIAEASARTRNAGHVVFSDVKHSVIDM  2639
                +G  E Q            Q   NNA QL    +  A +    ++ F+         
Sbjct  792   MSADGPYEGQAVRQSCTSDSRLQMIGNNATQL-TGPQKGATSLKGANIDFTRHPEGSSSS  850

Query  2640  ERQTLVSMP--VILKTAIPEYQYIWQGGFEVQKSGKAFNLYDGIQAHLSSCASPKVLDAV  2813
                 +  +P  +   +AIPE++ IW+G  EV +  +  +   G+QAHLS+ AS +VLD V
Sbjct  851   HLPCVSVLPSAICRISAIPEHECIWRGSLEVCRGSQQLDFCGGLQAHLSTLASTRVLDMV  910

Query  2814  NKFPRKVILNEVPRLSSWPMQFKECGVSEDNVALFFFAKDIGSYEKSYKVLLGDMVKHDL  2993
              KF  K+ L+EVPR  +WP QF + G  +DN+AL+FFA+D  SYE+SYK LL  M+K DL
Sbjct  911   KKFSDKLSLSEVPRSCTWPTQFYDSGAQDDNIALYFFAEDPESYERSYKGLLEKMIKSDL  970

Query  2994  ALQGNIGDIELLIFPSNQLPEKFQRWNLMFFLWGVFRGK  3110
             AL+GN   +ELLIFPSNQLPEK QRWN +F+LWGVFRG+
Sbjct  971   ALKGNFDGVELLIFPSNQLPEKSQRWNTLFYLWGVFRGR  1009


 Score = 90.9 bits (224),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 88/242 (36%), Positives = 128/242 (53%), Gaps = 14/242 (6%)
 Frame = +3

Query  3732  TLNVISSFGVNPKKRSHS--AETVLQsasssgtsqafssysNDDILVEEFCHKRVKLNSD  3905
             TL+V+     + KKR HS   ET LQ++  +    A+++ S++++ +E    K+ K +  
Sbjct  1370  TLDVLKHLQ-HEKKRRHSDLVETALQTSFGTNEKVAWNNVSSENVKIEHV-DKKQKTDCR  1427

Query  3906  RSYGCNDQTSCS-KDGFLSEMGGTASQLSRQKNERDEALSKTAILETPGNAEMFFFPVDP  4082
               Y  +     +  DGF S+     S L+  +   ++   +   LE  G AE FFFPV  
Sbjct  1428  EIYEASRPIDANLVDGFASQKSAQDSTLAVVEKLHNKVCDEPINLENTGTAERFFFPVLS  1487

Query  4083  HPVGNIGSNNSSMPWKVHPLE-EDQLHDKAPNLELALGAKTKPLMSGIPSFLSGKVEKKI  4259
             +   ++ S  SSMPWK  P     + HD  PNL+LALGAKTK    G+     G     +
Sbjct  1488  NHAKDLTSAESSMPWKTLPSSVPARSHDGVPNLDLALGAKTKSSNKGLLPLWIG-----V  1542

Query  4260  IEENTSDNAATSANKED-VsaslslslsFPFPEKEHGTSSKPEQED--PRRRQANTSLLL  4430
              +++ S   A +A +ED VS SLSLSLSFPFP+ + G    P+ E   P  R+ NTSLLL
Sbjct  1543  ADKSDSHPEAVAAQEEDPVSGSLSLSLSFPFPDSDKGFKPVPDAEQLLPESRRVNTSLLL  1602

Query  4431  FG  4436
             FG
Sbjct  1603  FG  1604



>gb|KCW90976.1| hypothetical protein EUGRSUZ_A02991 [Eucalyptus grandis]
Length=1576

 Score =   410 bits (1053),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 287/759 (38%), Positives = 383/759 (50%), Gaps = 113/759 (15%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNEHVNSG  1118
             CDICG  GRE LLAICSRC+DGAEHTYCM++ML+K+PEGDW+CEECK   E         
Sbjct  296   CDICGDAGREDLLAICSRCSDGAEHTYCMREMLQKVPEGDWVCEECKSADE---------  346

Query  1119  RVNEKEKTSPSRRTTIAKSDHPLKMEQKTSDCWGDKAVEERSYLKTSGKRCTDDSEVSSP  1298
               NE +K                 +E KT                    R T  S+V   
Sbjct  347   --NENQKPG---------------IEGKTL------------------SRVTSASQVPDK  371

Query  1299  TKRQRLELRSPTAQIPN---------RVTSLSRESSFKNLERGKVKPLNPFSSGSFAAKV  1451
             +  + +E+ SPT   P          RVTS SR+S FKN+++GK K     S  +     
Sbjct  372   SFVENIEV-SPTVIGPGSSKLCGSTRRVTS-SRDSCFKNIDKGKAKLARQMSCVNSVQDF  429

Query  1452  P-SSTGPQPQPPR--GIFSKSNSFSSLIAKPKVKLVDEVFPAKQKLSRETAFIESKEVAV  1622
             P  +  PQP   R  G   KSNSF++ IAKPKVK++DE    K K  RE +   SKE   
Sbjct  430   PEGARSPQPSNLRSKGTLLKSNSFNAFIAKPKVKVIDEGMIQKHKSIRENSSFISKEGPT  489

Query  1623  RSMGKSMSFKPTTASRSNCTESKVKMFSPKFSHDQDVKWLRHKKDRSSFDRKNSLRSDRL  1802
             + +GKSMSFK     R    ++KVKM   K +H Q  K  ++ K+ S  DR +  + DR 
Sbjct  490   KIIGKSMSFKHANPGRPLAVDAKVKMLPTKLTHVQTPKGSKNLKEGSVLDRMSLRKLDRT  549

Query  1803  AGGAI------SSPKSDNKPTPRGEPSSLSSLNTNRDYRALTSDNKPVTISNSTSGVARE  1964
                        S+P SD K T  GEP   S L+ NRD +   SD KP  +          
Sbjct  550   FSSLTRDNSTPSTPNSDQKLTSCGEPLQGSPLSNNRDSKLAQSDVKPAVL----------  599

Query  1965  VLKQASVDGVSSANRVSSSEENPSQAIPKEDS-SSSSCVAERPSWSSNEVLPDGLSQSKE  2141
                            V S+E   +Q   KE+  +SSS   E+     N +  DGLS+SK 
Sbjct  600   ---------------VKSAEYKSNQLDQKEEPLTSSSRTVEKHCIEGNGLRHDGLSRSKG  644

Query  2142  SKAFGDKTRESSASRSKQNSTASGKIVSCQKCKGNGHLAQVCTADGPESSALGSPFKSSR  2321
                  DK R+ S SRSK    +  + + CQKCK  GH A+ C     +     S  +S +
Sbjct  645   LANHTDKARDCSVSRSKPAVISGSRSIFCQKCKEVGHDAESCPVSSLQVGTDVSMTRSMK  704

Query  2322  EATNGPSDLKAAIEAARLRKPGICRKNRVADQSEDLSASNMKSEIASQDQMLSSTVRRNV  2501
             E T   S  K  I ++ L+KPG  R+N+  ++SEDLS S+        D +    V R V
Sbjct  705   EETYNSSKTKTPITSSMLKKPG--RRNKGPEKSEDLSVSSP----THMDPLSFPDVSRKV  758

Query  2502  ---NGAEEAQK-----------QETANNAKQLGIIAEASARTRNAGHVVFSDVKHSVIDM  2639
                +G  E Q            Q   NNA QL    +  A +    ++ F+         
Sbjct  759   MSADGPYEGQAVRQSCTSDSRLQMIGNNATQL-TGPQKGATSLKGANIDFTRHPEGSSSS  817

Query  2640  ERQTLVSMP--VILKTAIPEYQYIWQGGFEVQKSGKAFNLYDGIQAHLSSCASPKVLDAV  2813
                 +  +P  +   +AIPE++ IW+G  EV +  +  +   G+QAHLS+ AS +VLD V
Sbjct  818   HLPCVSVLPSAICRISAIPEHECIWRGSLEVCRGSQQLDFCGGLQAHLSTLASTRVLDMV  877

Query  2814  NKFPRKVILNEVPRLSSWPMQFKECGVSEDNVALFFFAKDIGSYEKSYKVLLGDMVKHDL  2993
              KF  K+ L+EVPR  +WP QF + G  +DN+AL+FFA+D  SYE+SYK LL  M+K DL
Sbjct  878   KKFSDKLSLSEVPRSCTWPTQFYDSGAQDDNIALYFFAEDPESYERSYKGLLEKMIKSDL  937

Query  2994  ALQGNIGDIELLIFPSNQLPEKFQRWNLMFFLWGVFRGK  3110
             AL+GN   +ELLIFPSNQLPEK QRWN +F+LWGVFRG+
Sbjct  938   ALKGNFDGVELLIFPSNQLPEKSQRWNTLFYLWGVFRGR  976


 Score = 90.9 bits (224),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 88/242 (36%), Positives = 128/242 (53%), Gaps = 14/242 (6%)
 Frame = +3

Query  3732  TLNVISSFGVNPKKRSHS--AETVLQsasssgtsqafssysNDDILVEEFCHKRVKLNSD  3905
             TL+V+     + KKR HS   ET LQ++  +    A+++ S++++ +E    K+ K +  
Sbjct  1337  TLDVLKHLQ-HEKKRRHSDLVETALQTSFGTNEKVAWNNVSSENVKIEHV-DKKQKTDCR  1394

Query  3906  RSYGCNDQTSCS-KDGFLSEMGGTASQLSRQKNERDEALSKTAILETPGNAEMFFFPVDP  4082
               Y  +     +  DGF S+     S L+  +   ++   +   LE  G AE FFFPV  
Sbjct  1395  EIYEASRPIDANLVDGFASQKSAQDSTLAVVEKLHNKVCDEPINLENTGTAERFFFPVLS  1454

Query  4083  HPVGNIGSNNSSMPWKVHPLE-EDQLHDKAPNLELALGAKTKPLMSGIPSFLSGKVEKKI  4259
             +   ++ S  SSMPWK  P     + HD  PNL+LALGAKTK    G+     G     +
Sbjct  1455  NHAKDLTSAESSMPWKTLPSSVPARSHDGVPNLDLALGAKTKSSNKGLLPLWIG-----V  1509

Query  4260  IEENTSDNAATSANKED-VsaslslslsFPFPEKEHGTSSKPEQED--PRRRQANTSLLL  4430
              +++ S   A +A +ED VS SLSLSLSFPFP+ + G    P+ E   P  R+ NTSLLL
Sbjct  1510  ADKSDSHPEAVAAQEEDPVSGSLSLSLSFPFPDSDKGFKPVPDAEQLLPESRRVNTSLLL  1569

Query  4431  FG  4436
             FG
Sbjct  1570  FG  1571



>emb|CDY49643.1| BnaC09g41210D [Brassica napus]
Length=1214

 Score =   400 bits (1027),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 274/735 (37%), Positives = 396/735 (54%), Gaps = 90/735 (12%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNEHVNSG  1118
             CDICG  GRE LLAIC+ C+DGAEHTYCM+ ML ++PEGDWLCEEC+             
Sbjct  213   CDICGDAGREDLLAICTGCSDGAEHTYCMRVMLNEVPEGDWLCEECE-------------  259

Query  1119  RVNEKEKTSPSRRTTIAKSDHPLKMEQKTSDCWGDKAVEERSYLKTSGKRCTDDSEVSSP  1298
                EK+K    R+        P                      ++SGKR  D  E +  
Sbjct  260   -EAEKQKQEAKRKIETEIIHSP----------------------QSSGKRHADKIEAAPD  296

Query  1299  TKRQRLE--LRSPTAQIPNRVTSLSRESSFKNLER--GKVKPLNPFSSGSFAAKVPSSTG  1466
              KRQ +E    SP   I  R+  LSRE+S K L+R  GK+     FS  +  A+   STG
Sbjct  297   AKRQAVEGSTGSPKKSILPRIGPLSRETSLKGLDRPRGKLSHQASFSDTTEGAR---STG  353

Query  1467  PQPQPPRGIFSKSNSFSSLIAKPKVKLVDEVFPAKQKLSRETAFIESKEVAVRSMGKSMS  1646
              Q QPP+G F KS+SF+S  +KPKV+L+D+V   K+K  +E   ++ KE  +  + KSMS
Sbjct  354   LQLQPPKGAFLKSSSFNSSSSKPKVQLMDDVILPKKKTGKEYTPVDIKEGGLGIVSKSMS  413

Query  1647  FKPTTASRSNCTESKVKMFSPKFSHDQDVKWLRHKKDRSSFDRKNSLRSDRLAGGAISSP  1826
              + T    S+  +S+ K+ + K  H Q+ K  +  KDRS+    ++  +D+         
Sbjct  414   SRTTDTGSSSGNDSEAKILASKV-HSQEGKSSKQLKDRSAEANASAASTDQ---------  463

Query  1827  KSDNKPTPRGEPSSLSSLNTNRDYRALTSDNKPVTISNSTSGVAREVLKQASVDGVSSAN  2006
                 K TPR         ++ RD + L SD K  +++   S + R  L+     G  S  
Sbjct  464   ----KLTPR---------SSTRDLKGLQSDGKRCSLTKQVSNLNRNRLENPIASGGDS--  508

Query  2007  RVSSSEENPSQAIPKEDSSSSSCVAERPSWSSNEVLPDGLSQSKESKAFGDKTRESSASR  2186
                  E++ SQA  K++ +S+SC  E    + N    DGL +S+E K    K++E+   R
Sbjct  509   ----REQSVSQADCKDELTSTSCAGEGVPSNGNVASQDGLPRSREFKEVVKKSKEALGKR  564

Query  2187  SKQNSTASGKIVSCQKCKGNGHLAQVCTADGPESSALG----SPFKSSREATNGPSDLKA  2354
              + +  + GK +S  +  G        TA+  ++S +     S  K  RE  N  + L+A
Sbjct  565   QRSSLLSGGKGLSSSQKGGQ-------TAESSDTSGVSDSDPSTTKIVREDINKGNRLRA  617

Query  2355  AIEAARLRKPGICRKNRVADQSEDLSASNMKSEIASQDQMLSSTVRRNVNGAEEAQKQET  2534
             A++AA  +KP    KNRV +Q +   ASN+  +   +DQ L S +      A +  KQ  
Sbjct  618   AVDAALRKKPSFS-KNRVLEQCDAALASNVHPDKTLRDQ-LPSKMHTTSWPAPDPYKQTI  675

Query  2535  ANNAKQLGIIAEASARTRNAGHVVFSDVKHSVIDMERQTLVSMPV--ILKTAIPEYQYIW  2708
               N KQL     + A       V       SV  + R   +  P+  +  +AIP+ + IW
Sbjct  676   VTNGKQL---VPSGADAMPPRSVELEVNTPSVKPVMRDWPIVSPLAPLRNSAIPDRESIW  732

Query  2709  QGGFEVQKSGKAFNLYDGIQAHLSSCASPKVLDAVNKFPRKVILNEVPRLSSWPMQFKEC  2888
             QG  EV+K+ +   ++ G+QAHLS+ ASPKV + VNKFP K  LNEVPRLS+WP QF++ 
Sbjct  733   QGNLEVRKAREQSAMHSGMQAHLSTLASPKVAEVVNKFPEKFSLNEVPRLSTWPAQFQDI  792

Query  2889  GVSEDNVALFFFAKDIGSYEKSYKVLLGDMVKHDLALQGNIGDIELLIFPSNQLPEKFQR  3068
             G  ED++ALFFFAKD+ SYE++YK L+ +M+K DLAL+GN+ ++ELL+F SNQLP  FQR
Sbjct  793   GTKEDHIALFFFAKDVESYERTYKPLVDNMMKKDLALKGNLDNVELLVFASNQLPPNFQR  852

Query  3069  WNLMFFLWGVFRGKR  3113
             WN+++FLWGVFRG++
Sbjct  853   WNMLYFLWGVFRGRK  867



>ref|XP_010671078.1| PREDICTED: uncharacterized protein LOC104887980 isoform X3 [Beta 
vulgaris subsp. vulgaris]
Length=981

 Score =   394 bits (1011),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 314/861 (36%), Positives = 439/861 (51%), Gaps = 152/861 (18%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNEHVNSG  1118
             CDICG  GRE LLA+C RC+DGAEHTYCM+ MLEK+PEGDW CEEC+F++E++    +  
Sbjct  165   CDICGDAGREDLLAVCCRCSDGAEHTYCMRVMLEKVPEGDWFCEECEFNEELERRQEHLK  224

Query  1119  RVNEKEKTSPSRRTTIAKSDHPLKMEQKTSDCWGDKAVEERSYLKT-------SGKRCTD  1277
              +   E++    RTT   S+   K+E K S C       ERS LKT         KR  D
Sbjct  225   LLGTIERSRSLGRTTSVNSEFSPKLENKDSFC-------ERSKLKTFSVKKQLPSKRTED  277

Query  1278  DSEVSSPTKRQRLE--LRSPTAQIPNRVTSLSRESSFKNLERGKVKPLNPFSSGSFAAKV  1451
               E     K+Q LE    SPTA  P+RV  LS++SSF+NL++ K K +N  S G   A V
Sbjct  278   SFEAGPTAKKQALESSTGSPTALSPSRV--LSKDSSFRNLDKTKGKSINQLSMG-IEAAV  334

Query  1452  PSSTGPQ------PQPPRGIFSKSNSFSSLIAKPKVKLVDEVFPAKQKLSRETAFIESKE  1613
              +S  P+      PQ  +G   KSNSF+S  +K  VK V EV      L ++   +++K+
Sbjct  335   DASENPRSPTRNSPQSLKGNLLKSNSFNS-NSKANVK-VSEV------LQKQKQGVDAKD  386

Query  1614  VAVRSMGKSMSFKPTTASRSNCTESKVKMFSPKFSHDQDVKWLRHKKDRSSFDRKNSLRS  1793
                + + KSMSFK     RS+ +E KVKM SPK +  Q++K  +  +DR+SF+RKNS++ 
Sbjct  387   GQGKLIAKSMSFK--GLGRSSASEPKVKMLSPKCAPVQELKGQKQVRDRTSFERKNSIKL  444

Query  1794  DRLAGGAISSPKSDNKPTPRGEPSSLSSLNTNRDYRALTSDNKPVTISNSTSGVAREVLK  1973
             D      + +  +  K   R + +S  +++ +RD++   SD K  ++S     VA +   
Sbjct  445   DSFP---VQTAANSTKRHSRVDNTSTLTVSNSRDHKNAQSDGKLNSLSKPACHVAHK--S  499

Query  1974  QASVDGVSSANRVSSSEENPSQAIPKEDSSSSSCVAERPSWSSNEVLPDGLSQSKESKAF  2153
             Q S+  +    R SS+            S  SS V  +PS  S                 
Sbjct  500   QESMATLGEVKRSSSTNS--------RGSGISSSVESKPSHVS----------------L  535

Query  2154  GDKTRESSASRSKQNSTASGKIVSCQKCKGNGHLAQVCTADGPESSALGSPFKSSREATN  2333
              D T  SSA          G IV     K + H  Q     GPE++     F  SR+  N
Sbjct  536   KDVTTLSSAR------AVDGSIVGANGAKADMHDNQ--NEKGPENT-----FGRSRQGVN  582

Query  2334  GPS-------------------------DLKAAIEAARLRKPGICRKNRVADQSEDLSAS  2438
             G S                          LKAAIEAA  +K  I +KN++ ++  +LS  
Sbjct  583   GASVSGNRRGISADASLLRAKDGLREDNKLKAAIEAAMQKKQDIFKKNKLPEKLNELSVL  642

Query  2439  NMKSEIASQDQMLSSTVRRNVNGAEEAQKQETANNAKQLGIIAEASARTRNAGHVVFSD-  2615
             N      +Q   +   V               +N A  + +I+E +   R AG   +S  
Sbjct  643   N------TQGNHVGDGV---------------SNQA--MDVISEETVYAREAGLSNYSSN  679

Query  2616  -VKHSVIDMERQT------LVSMPVILKTAIPEYQYIWQGGFEVQKSGKAFNLYDGIQAH  2774
               KH+ I   +Q        V  P++ K+AIPE   +WQGGFE+ ++GK  ++  G QAH
Sbjct  680   SCKHTSIGSAKQLKVYPADFVEDPILTKSAIPELDAVWQGGFEIHRNGKLADVCGGFQAH  739

Query  2775  LSSCASPKVLDAVNKFPRKVILNEVPRLSSWPMQFKECGVSEDNVALFFFAKDIGSYEKS  2954
             LSS AS KVL+ V K P K++LNEV R  +WP QFKE G  +DN+AL+FFAKD  SY +S
Sbjct  740   LSSFASGKVLEVVRKLPPKMVLNEVSRPGAWPFQFKEAGAQDDNIALYFFAKDPESYSRS  799

Query  2955  YKVLLGDMVKHDLALQGNIGDIELLIFPSNQLPEKFQRWNLMFFLWGVFRGKRANSLQN-  3131
             YK+LL  M+KHDLAL+GNI   ELLIFPSN L  + QRWN +FF+WGVFRG+RA+   + 
Sbjct  800   YKILLEYMMKHDLALRGNINGAELLIFPSNHLAHRSQRWNTLFFMWGVFRGRRAHGPDDR  859

Query  3132  FPGAEK-----------PLIQDIPTPATSLPENMFTPVPKLN--SARGSAATNTEMSAVK  3272
             +   E+           P ++++ + A SLP N     P ++  SA GS A     S   
Sbjct  860   YASLERAEISVSVPNTIPRVRNVAS-AASLPVNTCLQKPAIDDLSALGSDAI-VSRSEAP  917

Query  3273  ESESASLHK---IVNGNCSIQ  3326
               + +SL K   + NG+C  Q
Sbjct  918   VLDGSSLQKSGCMSNGDCYDQ  938



>ref|XP_009131554.1| PREDICTED: uncharacterized protein LOC103856209 isoform X2 [Brassica 
rapa]
Length=1174

 Score =   398 bits (1022),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 277/744 (37%), Positives = 407/744 (55%), Gaps = 90/744 (12%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNEHVNSG  1118
             CDICG  GRE LLAIC+ C+DGAEH YCM++ L  +PEGDW CEEC+   E         
Sbjct  176   CDICGDAGREDLLAICTGCSDGAEHIYCMRERLNAVPEGDWFCEECQTVAE---------  226

Query  1119  RVNEKEKTSPSRRTTIAKSDHPLKMEQKTSDCWGDKAVEERSYLKTSGKRCTDDSEVSSP  1298
                +K++    R T +  S H                        +SGKR  D  E +  
Sbjct  227   --KQKQEAKRKRETEVILSPH------------------------SSGKRHADKIEAAPD  260

Query  1299  TKRQRLE--LRSPTAQIPNRVTSLSRESSFKNLE--RGKVKPLNPFSSGSFAAKVPSSTG  1466
              KRQ +E    SP   +  R+ +LSRE+SFK L+  RGK+   + F+     A+   STG
Sbjct  261   AKRQAVEDSTGSPKKPVLPRIGALSRETSFKGLDSPRGKLSHQSSFTDKMEGAR---STG  317

Query  1467  PQPQPPRGIFSKSNSFSSLIAKPKVKLVDE--VFPAKQKLSRETAFIESKEVAVRSMGKS  1640
              Q  PP+G F KS+SF+S  +KPKV+L+D+  + P K+           K+ ++ ++ KS
Sbjct  318   SQLHPPKGGFLKSSSFNSSSSKPKVQLMDDDVILPRKKI---------RKDSSLGNLSKS  368

Query  1641  MSFKPTTASRSNCTESKVKMFSPKFSHDQDVKWLRHKKDRSSFDRKNSLRSDRLAGGAIS  1820
             MS K T +  SN  +S+ KM + K  H Q+ K  +  KDRS+            A    +
Sbjct  369   MSSKTTDSGSSNGNDSQAKMLASKVYHSQEGKSPKQLKDRSTE-----------ANAPAA  417

Query  1821  SPKSDNKPTPRGEPSSL--SSLNTNRDYRALTSDNKPVTISNSTSGVAREVLKQASVDG-  1991
             S  +D K T R   SSL  S  N+ RD + L SD K  +++   S + R  L+     G 
Sbjct  418   S--TDQKLTSR---SSLVSSYANSTRDSKGLQSDGKRGSLTKQVSNLNRNRLESPVTSGG  472

Query  1992  -VSSANRVSSSEENPSQAIPKEDSSSSSCVAERPSWSSNEVLPDGLSQSKESKAFGDKTR  2168
              + +  + ++ E++ SQA  K++ +S+SC  E    + N    D L +S+E +  G K++
Sbjct  473   DIPTNGKCNAREQSSSQADSKDELTSTSCAGEGVPSNGNVASQDRLPRSREFREVGKKSK  532

Query  2169  ESSASRSKQNSTASGK-IVSCQKCKGNGHLAQVCTADGPESSALGSPFKSSREATNGPSD  2345
             +    R + +  +  K + S QK    G  A+     G   S L +P K++RE  N  + 
Sbjct  533   DGFGKRQRSSLLSHAKGLPSSQK---GGETAESNETSGVSDSDLPTP-KNAREDINKGNR  588

Query  2346  LKAAIEAARLRKPGICRKNRVADQSEDLSASNMKSEIASQDQMLSSTVRRNVNG----AE  2513
             L+AA++AA  +KP    KNRV +Q +   ASN+     S D+ L + +   ++     A 
Sbjct  589   LRAAVDAALRKKPSFG-KNRVLEQCDTSLASNVH---PSSDKSLQTQLPPKMHTTSWPAP  644

Query  2514  EAQKQETANNAKQL---GIIAEASARTRNAGHVVFSDVKHSVIDMERQTLVSMPVILKT-  2681
             +  KQ    N KQL   G+ A   +R+         ++      M    LVS P +L++ 
Sbjct  645   DPYKQTIVTNEKQLVPSGVDAVMPSRSVELDMKPEVNIPSLKSVMRDWPLVSPPALLRSS  704

Query  2682  AIPEYQYIWQGGFEVQKSGKAFNLYDGIQAHLSSCASPKVLDAVNKFPRKVILNEVPRLS  2861
             AIP+++ IWQG  EV+K+     ++ G+QAHLS+ ASPKV + VNKFP K  LNEVPRLS
Sbjct  705   AIPDHESIWQGNLEVRKARNQSAMHSGMQAHLSTLASPKVAEVVNKFPEKFSLNEVPRLS  764

Query  2862  SWPMQFKECGVSEDNVALFFFAKDIGSYEKSYKVLLGDMVKHDLALQGNIGDIELLIFPS  3041
             +WP QF++ G  ED++ALFFFAKD+ SYE++YK L+ +M+K DLAL+GN+ ++ELLIF S
Sbjct  765   TWPAQFQDSGTKEDHIALFFFAKDVESYERNYKPLVDNMIKKDLALKGNLDNVELLIFAS  824

Query  3042  NQLPEKFQRWNLMFFLWGVFRGKR  3113
             NQLP   QRWN+++FLWGVFRG++
Sbjct  825   NQLPPNCQRWNMLYFLWGVFRGRK  848



>emb|CDX78703.1| BnaA03g06150D [Brassica napus]
Length=1192

 Score =   398 bits (1023),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 277/744 (37%), Positives = 407/744 (55%), Gaps = 90/744 (12%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNEHVNSG  1118
             CDICG  GRE LLAIC+ C+DGAEH YCM++ L  +PEGDW CEEC+   E         
Sbjct  194   CDICGDAGREDLLAICTGCSDGAEHIYCMRERLNAVPEGDWFCEECQTVAE---------  244

Query  1119  RVNEKEKTSPSRRTTIAKSDHPLKMEQKTSDCWGDKAVEERSYLKTSGKRCTDDSEVSSP  1298
                +K++    R T +  S H                        +SGKR  D  E +  
Sbjct  245   --KQKQEAKRKRETEVILSPH------------------------SSGKRHADKIEAAPD  278

Query  1299  TKRQRLE--LRSPTAQIPNRVTSLSRESSFKNLE--RGKVKPLNPFSSGSFAAKVPSSTG  1466
              KRQ +E    SP   +  R+ +LSRE+SFK L+  RGK+   + F+     A+   STG
Sbjct  279   AKRQAVEDSTGSPKKPVLPRIGALSRETSFKGLDSPRGKLSHQSSFTDKMEGAR---STG  335

Query  1467  PQPQPPRGIFSKSNSFSSLIAKPKVKLVDE--VFPAKQKLSRETAFIESKEVAVRSMGKS  1640
              Q  PP+G F KS+SF+S  +KPKV+L+D+  + P K+           K+ ++ ++ KS
Sbjct  336   SQLHPPKGGFLKSSSFNSSSSKPKVQLMDDDVILPRKKI---------RKDSSLGNLSKS  386

Query  1641  MSFKPTTASRSNCTESKVKMFSPKFSHDQDVKWLRHKKDRSSFDRKNSLRSDRLAGGAIS  1820
             MS K T +  SN  +S+ KM + K  H Q+ K  +  KDRS+            A    +
Sbjct  387   MSSKTTDSGSSNGNDSQAKMLASKVYHSQEGKSPKQLKDRSTE-----------ANAPAA  435

Query  1821  SPKSDNKPTPRGEPSSLSS--LNTNRDYRALTSDNKPVTISNSTSGVAREVLKQASVDG-  1991
             S  +D K T R   SSL S   N+ RD + L SD K  +++   S + R  L+     G 
Sbjct  436   S--TDQKLTSR---SSLGSSYANSTRDSKGLQSDGKRGSLTKQVSNLNRNRLESPVTSGG  490

Query  1992  -VSSANRVSSSEENPSQAIPKEDSSSSSCVAERPSWSSNEVLPDGLSQSKESKAFGDKTR  2168
              + +  + ++ E++ SQA  K++ +S+SC  E    + N    D L +S+E +  G K++
Sbjct  491   DIPTNGKCNAREQSSSQADSKDELTSTSCAGEGVPSNGNVASQDRLPRSREFREVGKKSK  550

Query  2169  ESSASRSKQNSTASGK-IVSCQKCKGNGHLAQVCTADGPESSALGSPFKSSREATNGPSD  2345
             +    R + +  +  K + S QK    G  A+     G   S L +P K++RE  N  + 
Sbjct  551   DGFGKRQRSSLLSHAKGLPSSQK---GGETAESNETSGVSDSDLPTP-KNAREDINKGNR  606

Query  2346  LKAAIEAARLRKPGICRKNRVADQSEDLSASNMKSEIASQDQMLSSTVRRNVNG----AE  2513
             L+AA++AA  +KP    KNRV +Q +   ASN+     S D+ L + +   ++     A 
Sbjct  607   LRAAVDAALRKKPSFG-KNRVLEQCDTSLASNVH---PSSDKSLQTQLPPKMHTTSWPAP  662

Query  2514  EAQKQETANNAKQL---GIIAEASARTRNAGHVVFSDVKHSVIDMERQTLVSMPVILKT-  2681
             +  KQ    N KQL   G+ A   +R+         ++      M    LVS P +L++ 
Sbjct  663   DPYKQTIVTNEKQLVPSGVDAVMPSRSVELDMKPEVNIPSLKSVMRDWPLVSPPALLRSS  722

Query  2682  AIPEYQYIWQGGFEVQKSGKAFNLYDGIQAHLSSCASPKVLDAVNKFPRKVILNEVPRLS  2861
             AIP+++ IWQG  EV+K+     ++ G+QAHLS+ ASPKV + VNKFP K  LNEVPRLS
Sbjct  723   AIPDHESIWQGNLEVRKARNQSAMHSGMQAHLSTLASPKVAEVVNKFPEKFSLNEVPRLS  782

Query  2862  SWPMQFKECGVSEDNVALFFFAKDIGSYEKSYKVLLGDMVKHDLALQGNIGDIELLIFPS  3041
             +WP QF++ G  ED++ALFFFAKD+ SYE++YK L+ +M+K DLAL+GN+ ++ELLIF S
Sbjct  783   TWPAQFQDSGTKEDHIALFFFAKDVESYERNYKPLVDNMIKKDLALKGNLDNVELLIFAS  842

Query  3042  NQLPEKFQRWNLMFFLWGVFRGKR  3113
             NQLP   QRWN+++FLWGVFRG++
Sbjct  843   NQLPPNCQRWNMLYFLWGVFRGRK  866



>ref|NP_197170.3| RING/FYVE/PHD zinc finger-containing protein [Arabidopsis thaliana]
 gb|AED92325.1| RING/FYVE/PHD zinc finger-containing protein [Arabidopsis thaliana]
Length=1311

 Score =   400 bits (1028),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 285/753 (38%), Positives = 414/753 (55%), Gaps = 83/753 (11%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNEHVNSG  1118
             CDICG  GRE LLAICS C+DGAEHTYCM++ML+++PEGDWLCEE               
Sbjct  286   CDICGDAGREDLLAICSGCSDGAEHTYCMREMLDEVPEGDWLCEE-----------CAEE  334

Query  1119  RVNEKEKTSPSRRTTIAKSDHPLKMEQKTSDCWGDKAVEERSYLKTSGKRCTDDSEVSSP  1298
                +K++    R T +  + +                        +SGKR  D  E +  
Sbjct  335   AEKQKQEAKRKRETEVTFNTY------------------------SSGKRHADKIEAAPD  370

Query  1299  TKRQRLELR--SPTAQIPNRVTSLSRESSFKNLER--GKVKPLNPFSSGSFAAKVPSSTG  1466
              KRQ +E    SP   I  RV +LSRE+SFK L+R  GK+     FS  + +A+   S G
Sbjct  371   AKRQVVEASTGSPKKSILPRVGALSRETSFKGLDRLRGKLNHQTSFSDDTESAR---SAG  427

Query  1467  PQPQPPRGIFSKSNSFSSLIAKPKVKLVDEVFPAKQKLSRETAFIESKEVAVRSMGKSMS  1646
              Q QPP+G F KS+SF+   +KPKV+L+D+    +QK  +E   ++ K    R++GKSM 
Sbjct  428   SQLQPPKGAFLKSSSFNCSSSKPKVQLMDDAIHPRQKTGKEDTALDLKVGGFRNVGKSMP  487

Query  1647  FKPTTASRSNCTESKVKMFSPKFSHDQDVKWLRHKKDRSSFDRKNSLRSDRLAGGAISSP  1826
              + T A  S  ++S+ KM   K  H Q+ K L+  KDR           +R A  + SS 
Sbjct  488   SRTTDAGNSGGSDSQAKMLGSKVYHSQEGKSLKQVKDR-----------NREANASASS-  535

Query  1827  KSDNKPTPRGEPSSLSSLNTNRDYRALTSDNKPVTISNSTSGVAREVLKQASVDG--VSS  2000
               D K   RG  SS+S  N NRD + L SD K   ++   S ++R  L+ + V G  +S+
Sbjct  536   -IDQKLKSRGN-SSVSHANNNRDLKGLQSDGKRGNLTKQVSNLSRNRLENSVVSGGDIST  593

Query  2001  ANRVSSSEENPSQAIPKEDSSSSSCVAERPSWSSNEVLPDGLSQSKESKAFGDKTRESSA  2180
               + S+SE++ SQA  K++  S+SC  E         L DGL +S+  +  G K++E+ +
Sbjct  594   NEKCSASEQSSSQADCKDELPSTSCTGEGMPNHGTVALQDGLPRSRVPREVGKKSKEAFS  653

Query  2181  SRSKQNSTASGK-IVSCQKCKGNGHLAQVCTADGPESSALGSPFKSSREATNGPSDLKAA  2357
              R + +  A  K + S QK    G  A+     G   S L S  K+ +E  N  + L+AA
Sbjct  654   KRQRSSLLAGAKGLPSSQK---GGQTAESSDTSGVSDSDL-STTKNVKEDLNKGNRLRAA  709

Query  2358  IEAARLRKPGICRKNRVADQSEDLSASNMKS--EIASQDQMLSSTVRRNVNG--------  2507
             ++AA  +KP    KNRV +QS+    +N+ S  E   ++Q+ S   + +V+         
Sbjct  710   VDAALRKKPSFG-KNRVLEQSDASLVANVDSSSEKTLRNQLPSKMHKNHVSHEGLQGGHP  768

Query  2508  ----AEEAQKQETANNAKQLGIIAEASARTRNAG-HVVFSDVKHSVIDMERQTLVSMPVI  2672
                   +  KQ    N KQL      +  +R     V F  VK  + D+    LV  PV+
Sbjct  769   ILWPTSDPYKQTIVTNEKQLIFPGADTIPSRLVEPEVSFPAVKPVMRDL---PLVPSPVM  825

Query  2673  LKT-AIPEYQYIWQGGFEVQKSGKAFNLYDGIQAHLSSCASPKVLDAVNKFPRKVILNEV  2849
             L++ AIP++++IWQG  EV+K      ++ GIQAHLS+ ASP+V + VNKFP    LNEV
Sbjct  826   LRSSAIPDHEFIWQGDLEVRKIINQSAMHSGIQAHLSTLASPRVAEVVNKFPETFSLNEV  885

Query  2850  PRLSSWPMQFKECGVSEDNVALFFFAKDIGSYEKSYKVLLGDMVKHDLALQGNIGDIELL  3029
             PR S+WP QF++ G  E ++ALFFFAKD  SYE++YK L+ +M+K+DLAL+GN+ +++LL
Sbjct  886   PRKSTWPTQFEKLGTKEAHIALFFFAKDTESYERNYKPLVDNMIKNDLALKGNLDNVDLL  945

Query  3030  IFPSNQLPEKFQRWNLMFFLWGVFRGKRANSLQ  3128
             IF SNQLP   QRWN+++FLWGVF+G++  + Q
Sbjct  946   IFASNQLPSNCQRWNMLYFLWGVFQGRKETNPQ  978



>ref|XP_009131553.1| PREDICTED: uncharacterized protein LOC103856209 isoform X1 [Brassica 
rapa]
Length=1210

 Score =   398 bits (1022),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 277/744 (37%), Positives = 407/744 (55%), Gaps = 90/744 (12%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNEHVNSG  1118
             CDICG  GRE LLAIC+ C+DGAEH YCM++ L  +PEGDW CEEC+   E         
Sbjct  212   CDICGDAGREDLLAICTGCSDGAEHIYCMRERLNAVPEGDWFCEECQTVAE---------  262

Query  1119  RVNEKEKTSPSRRTTIAKSDHPLKMEQKTSDCWGDKAVEERSYLKTSGKRCTDDSEVSSP  1298
                +K++    R T +  S H                        +SGKR  D  E +  
Sbjct  263   --KQKQEAKRKRETEVILSPH------------------------SSGKRHADKIEAAPD  296

Query  1299  TKRQRLE--LRSPTAQIPNRVTSLSRESSFKNLE--RGKVKPLNPFSSGSFAAKVPSSTG  1466
              KRQ +E    SP   +  R+ +LSRE+SFK L+  RGK+   + F+     A+   STG
Sbjct  297   AKRQAVEDSTGSPKKPVLPRIGALSRETSFKGLDSPRGKLSHQSSFTDKMEGAR---STG  353

Query  1467  PQPQPPRGIFSKSNSFSSLIAKPKVKLVDE--VFPAKQKLSRETAFIESKEVAVRSMGKS  1640
              Q  PP+G F KS+SF+S  +KPKV+L+D+  + P K+           K+ ++ ++ KS
Sbjct  354   SQLHPPKGGFLKSSSFNSSSSKPKVQLMDDDVILPRKKI---------RKDSSLGNLSKS  404

Query  1641  MSFKPTTASRSNCTESKVKMFSPKFSHDQDVKWLRHKKDRSSFDRKNSLRSDRLAGGAIS  1820
             MS K T +  SN  +S+ KM + K  H Q+ K  +  KDRS+            A    +
Sbjct  405   MSSKTTDSGSSNGNDSQAKMLASKVYHSQEGKSPKQLKDRSTE-----------ANAPAA  453

Query  1821  SPKSDNKPTPRGEPSSL--SSLNTNRDYRALTSDNKPVTISNSTSGVAREVLKQASVDG-  1991
             S  +D K T R   SSL  S  N+ RD + L SD K  +++   S + R  L+     G 
Sbjct  454   S--TDQKLTSR---SSLVSSYANSTRDSKGLQSDGKRGSLTKQVSNLNRNRLESPVTSGG  508

Query  1992  -VSSANRVSSSEENPSQAIPKEDSSSSSCVAERPSWSSNEVLPDGLSQSKESKAFGDKTR  2168
              + +  + ++ E++ SQA  K++ +S+SC  E    + N    D L +S+E +  G K++
Sbjct  509   DIPTNGKCNAREQSSSQADSKDELTSTSCAGEGVPSNGNVASQDRLPRSREFREVGKKSK  568

Query  2169  ESSASRSKQNSTASGK-IVSCQKCKGNGHLAQVCTADGPESSALGSPFKSSREATNGPSD  2345
             +    R + +  +  K + S QK    G  A+     G   S L +P K++RE  N  + 
Sbjct  569   DGFGKRQRSSLLSHAKGLPSSQK---GGETAESNETSGVSDSDLPTP-KNAREDINKGNR  624

Query  2346  LKAAIEAARLRKPGICRKNRVADQSEDLSASNMKSEIASQDQMLSSTVRRNVNG----AE  2513
             L+AA++AA  +KP    KNRV +Q +   ASN+     S D+ L + +   ++     A 
Sbjct  625   LRAAVDAALRKKPSFG-KNRVLEQCDTSLASNVH---PSSDKSLQTQLPPKMHTTSWPAP  680

Query  2514  EAQKQETANNAKQL---GIIAEASARTRNAGHVVFSDVKHSVIDMERQTLVSMPVILKT-  2681
             +  KQ    N KQL   G+ A   +R+         ++      M    LVS P +L++ 
Sbjct  681   DPYKQTIVTNEKQLVPSGVDAVMPSRSVELDMKPEVNIPSLKSVMRDWPLVSPPALLRSS  740

Query  2682  AIPEYQYIWQGGFEVQKSGKAFNLYDGIQAHLSSCASPKVLDAVNKFPRKVILNEVPRLS  2861
             AIP+++ IWQG  EV+K+     ++ G+QAHLS+ ASPKV + VNKFP K  LNEVPRLS
Sbjct  741   AIPDHESIWQGNLEVRKARNQSAMHSGMQAHLSTLASPKVAEVVNKFPEKFSLNEVPRLS  800

Query  2862  SWPMQFKECGVSEDNVALFFFAKDIGSYEKSYKVLLGDMVKHDLALQGNIGDIELLIFPS  3041
             +WP QF++ G  ED++ALFFFAKD+ SYE++YK L+ +M+K DLAL+GN+ ++ELLIF S
Sbjct  801   TWPAQFQDSGTKEDHIALFFFAKDVESYERNYKPLVDNMIKKDLALKGNLDNVELLIFAS  860

Query  3042  NQLPEKFQRWNLMFFLWGVFRGKR  3113
             NQLP   QRWN+++FLWGVFRG++
Sbjct  861   NQLPPNCQRWNMLYFLWGVFRGRK  884



>ref|XP_010671077.1| PREDICTED: uncharacterized protein LOC104887980 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=1033

 Score =   394 bits (1011),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 314/861 (36%), Positives = 439/861 (51%), Gaps = 152/861 (18%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNEHVNSG  1118
             CDICG  GRE LLA+C RC+DGAEHTYCM+ MLEK+PEGDW CEEC+F++E++    +  
Sbjct  165   CDICGDAGREDLLAVCCRCSDGAEHTYCMRVMLEKVPEGDWFCEECEFNEELERRQEHLK  224

Query  1119  RVNEKEKTSPSRRTTIAKSDHPLKMEQKTSDCWGDKAVEERSYLKT-------SGKRCTD  1277
              +   E++    RTT   S+   K+E K S C       ERS LKT         KR  D
Sbjct  225   LLGTIERSRSLGRTTSVNSEFSPKLENKDSFC-------ERSKLKTFSVKKQLPSKRTED  277

Query  1278  DSEVSSPTKRQRLE--LRSPTAQIPNRVTSLSRESSFKNLERGKVKPLNPFSSGSFAAKV  1451
               E     K+Q LE    SPTA  P+RV  LS++SSF+NL++ K K +N  S G   A V
Sbjct  278   SFEAGPTAKKQALESSTGSPTALSPSRV--LSKDSSFRNLDKTKGKSINQLSMG-IEAAV  334

Query  1452  PSSTGPQ------PQPPRGIFSKSNSFSSLIAKPKVKLVDEVFPAKQKLSRETAFIESKE  1613
              +S  P+      PQ  +G   KSNSF+S  +K  VK V EV      L ++   +++K+
Sbjct  335   DASENPRSPTRNSPQSLKGNLLKSNSFNS-NSKANVK-VSEV------LQKQKQGVDAKD  386

Query  1614  VAVRSMGKSMSFKPTTASRSNCTESKVKMFSPKFSHDQDVKWLRHKKDRSSFDRKNSLRS  1793
                + + KSMSFK     RS+ +E KVKM SPK +  Q++K  +  +DR+SF+RKNS++ 
Sbjct  387   GQGKLIAKSMSFKGL--GRSSASEPKVKMLSPKCAPVQELKGQKQVRDRTSFERKNSIKL  444

Query  1794  DRLAGGAISSPKSDNKPTPRGEPSSLSSLNTNRDYRALTSDNKPVTISNSTSGVAREVLK  1973
             D      + +  +  K   R + +S  +++ +RD++   SD K  ++S     VA +   
Sbjct  445   DSFP---VQTAANSTKRHSRVDNTSTLTVSNSRDHKNAQSDGKLNSLSKPACHVAHK--S  499

Query  1974  QASVDGVSSANRVSSSEENPSQAIPKEDSSSSSCVAERPSWSSNEVLPDGLSQSKESKAF  2153
             Q S+  +    R SS+            S  SS V  +PS  S                 
Sbjct  500   QESMATLGEVKRSSSTNS--------RGSGISSSVESKPSHVS----------------L  535

Query  2154  GDKTRESSASRSKQNSTASGKIVSCQKCKGNGHLAQVCTADGPESSALGSPFKSSREATN  2333
              D T  SSA          G IV     K + H  Q     GPE++     F  SR+  N
Sbjct  536   KDVTTLSSAR------AVDGSIVGANGAKADMHDNQ--NEKGPENT-----FGRSRQGVN  582

Query  2334  GPS-------------------------DLKAAIEAARLRKPGICRKNRVADQSEDLSAS  2438
             G S                          LKAAIEAA  +K  I +KN++ ++  +LS  
Sbjct  583   GASVSGNRRGISADASLLRAKDGLREDNKLKAAIEAAMQKKQDIFKKNKLPEKLNELSVL  642

Query  2439  NMKSEIASQDQMLSSTVRRNVNGAEEAQKQETANNAKQLGIIAEASARTRNAGHVVFSD-  2615
             N      +Q   +   V               +N A  + +I+E +   R AG   +S  
Sbjct  643   N------TQGNHVGDGV---------------SNQA--MDVISEETVYAREAGLSNYSSN  679

Query  2616  -VKHSVIDMERQT------LVSMPVILKTAIPEYQYIWQGGFEVQKSGKAFNLYDGIQAH  2774
               KH+ I   +Q        V  P++ K+AIPE   +WQGGFE+ ++GK  ++  G QAH
Sbjct  680   SCKHTSIGSAKQLKVYPADFVEDPILTKSAIPELDAVWQGGFEIHRNGKLADVCGGFQAH  739

Query  2775  LSSCASPKVLDAVNKFPRKVILNEVPRLSSWPMQFKECGVSEDNVALFFFAKDIGSYEKS  2954
             LSS AS KVL+ V K P K++LNEV R  +WP QFKE G  +DN+AL+FFAKD  SY +S
Sbjct  740   LSSFASGKVLEVVRKLPPKMVLNEVSRPGAWPFQFKEAGAQDDNIALYFFAKDPESYSRS  799

Query  2955  YKVLLGDMVKHDLALQGNIGDIELLIFPSNQLPEKFQRWNLMFFLWGVFRGKRANSLQN-  3131
             YK+LL  M+KHDLAL+GNI   ELLIFPSN L  + QRWN +FF+WGVFRG+RA+   + 
Sbjct  800   YKILLEYMMKHDLALRGNINGAELLIFPSNHLAHRSQRWNTLFFMWGVFRGRRAHGPDDR  859

Query  3132  FPGAEK-----------PLIQDIPTPATSLPENMFTPVPKLN--SARGSAATNTEMSAVK  3272
             +   E+           P ++++ + A SLP N     P ++  SA GS A     S   
Sbjct  860   YASLERAEISVSVPNTIPRVRNVAS-AASLPVNTCLQKPAIDDLSALGSDAI-VSRSEAP  917

Query  3273  ESESASLHK---IVNGNCSIQ  3326
               + +SL K   + NG+C  Q
Sbjct  918   VLDGSSLQKSGCMSNGDCYDQ  938



>ref|XP_010671076.1| PREDICTED: uncharacterized protein LOC104887980 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=1372

 Score =   394 bits (1011),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 314/861 (36%), Positives = 439/861 (51%), Gaps = 152/861 (18%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNEHVNSG  1118
             CDICG  GRE LLA+C RC+DGAEHTYCM+ MLEK+PEGDW CEEC+F++E++    +  
Sbjct  165   CDICGDAGREDLLAVCCRCSDGAEHTYCMRVMLEKVPEGDWFCEECEFNEELERRQEHLK  224

Query  1119  RVNEKEKTSPSRRTTIAKSDHPLKMEQKTSDCWGDKAVEERSYLKT-------SGKRCTD  1277
              +   E++    RTT   S+   K+E K S C       ERS LKT         KR  D
Sbjct  225   LLGTIERSRSLGRTTSVNSEFSPKLENKDSFC-------ERSKLKTFSVKKQLPSKRTED  277

Query  1278  DSEVSSPTKRQRLE--LRSPTAQIPNRVTSLSRESSFKNLERGKVKPLNPFSSGSFAAKV  1451
               E     K+Q LE    SPTA  P+RV  LS++SSF+NL++ K K +N  S G   A V
Sbjct  278   SFEAGPTAKKQALESSTGSPTALSPSRV--LSKDSSFRNLDKTKGKSINQLSMG-IEAAV  334

Query  1452  PSSTGPQ------PQPPRGIFSKSNSFSSLIAKPKVKLVDEVFPAKQKLSRETAFIESKE  1613
              +S  P+      PQ  +G   KSNSF+S  +K  VK V EV      L ++   +++K+
Sbjct  335   DASENPRSPTRNSPQSLKGNLLKSNSFNS-NSKANVK-VSEV------LQKQKQGVDAKD  386

Query  1614  VAVRSMGKSMSFKPTTASRSNCTESKVKMFSPKFSHDQDVKWLRHKKDRSSFDRKNSLRS  1793
                + + KSMSFK     RS+ +E KVKM SPK +  Q++K  +  +DR+SF+RKNS++ 
Sbjct  387   GQGKLIAKSMSFK--GLGRSSASEPKVKMLSPKCAPVQELKGQKQVRDRTSFERKNSIKL  444

Query  1794  DRLAGGAISSPKSDNKPTPRGEPSSLSSLNTNRDYRALTSDNKPVTISNSTSGVAREVLK  1973
             D      + +  +  K   R + +S  +++ +RD++   SD K  ++S     VA +   
Sbjct  445   DSFP---VQTAANSTKRHSRVDNTSTLTVSNSRDHKNAQSDGKLNSLSKPACHVAHK--S  499

Query  1974  QASVDGVSSANRVSSSEENPSQAIPKEDSSSSSCVAERPSWSSNEVLPDGLSQSKESKAF  2153
             Q S+  +    R SS+            S  SS V  +PS  S                 
Sbjct  500   QESMATLGEVKRSSSTNS--------RGSGISSSVESKPSHVS----------------L  535

Query  2154  GDKTRESSASRSKQNSTASGKIVSCQKCKGNGHLAQVCTADGPESSALGSPFKSSREATN  2333
              D T  SSA          G IV     K + H  Q     GPE++     F  SR+  N
Sbjct  536   KDVTTLSSAR------AVDGSIVGANGAKADMHDNQ--NEKGPENT-----FGRSRQGVN  582

Query  2334  GPS-------------------------DLKAAIEAARLRKPGICRKNRVADQSEDLSAS  2438
             G S                          LKAAIEAA  +K  I +KN++ ++  +LS  
Sbjct  583   GASVSGNRRGISADASLLRAKDGLREDNKLKAAIEAAMQKKQDIFKKNKLPEKLNELSVL  642

Query  2439  NMKSEIASQDQMLSSTVRRNVNGAEEAQKQETANNAKQLGIIAEASARTRNAGHVVFSD-  2615
             N      +Q   +   V               +N A  + +I+E +   R AG   +S  
Sbjct  643   N------TQGNHVGDGV---------------SNQA--MDVISEETVYAREAGLSNYSSN  679

Query  2616  -VKHSVIDMERQT------LVSMPVILKTAIPEYQYIWQGGFEVQKSGKAFNLYDGIQAH  2774
               KH+ I   +Q        V  P++ K+AIPE   +WQGGFE+ ++GK  ++  G QAH
Sbjct  680   SCKHTSIGSAKQLKVYPADFVEDPILTKSAIPELDAVWQGGFEIHRNGKLADVCGGFQAH  739

Query  2775  LSSCASPKVLDAVNKFPRKVILNEVPRLSSWPMQFKECGVSEDNVALFFFAKDIGSYEKS  2954
             LSS AS KVL+ V K P K++LNEV R  +WP QFKE G  +DN+AL+FFAKD  SY +S
Sbjct  740   LSSFASGKVLEVVRKLPPKMVLNEVSRPGAWPFQFKEAGAQDDNIALYFFAKDPESYSRS  799

Query  2955  YKVLLGDMVKHDLALQGNIGDIELLIFPSNQLPEKFQRWNLMFFLWGVFRGKRANSLQN-  3131
             YK+LL  M+KHDLAL+GNI   ELLIFPSN L  + QRWN +FF+WGVFRG+RA+   + 
Sbjct  800   YKILLEYMMKHDLALRGNINGAELLIFPSNHLAHRSQRWNTLFFMWGVFRGRRAHGPDDR  859

Query  3132  FPGAEK-----------PLIQDIPTPATSLPENMFTPVPKLN--SARGSAATNTEMSAVK  3272
             +   E+           P ++++ + A SLP N     P ++  SA GS A     S   
Sbjct  860   YASLERAEISVSVPNTIPRVRNVAS-AASLPVNTCLQKPAIDDLSALGSDAI-VSRSEAP  917

Query  3273  ESESASLHK---IVNGNCSIQ  3326
               + +SL K   + NG+C  Q
Sbjct  918   VLDGSSLQKSGCMSNGDCYDQ  938


 Score = 88.2 bits (217),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 79/196 (40%), Positives = 107/196 (55%), Gaps = 9/196 (5%)
 Frame = +3

Query  3882  KRVKLNSDRSYGCNDQTSCSKDG-FLSEMGGTASQLSRQKNERDEALSKTAILETPGNAE  4058
             KR+K   D  YGC+ +   +  G  ++      S  SR ++  +EA+ + A     G+AE
Sbjct  1178  KRIK-GDDGFYGCDLRRFPNSLGDRITAQIHDVSTSSRIEDTSNEAMDEKATSVNSGSAE  1236

Query  4059  MFFFPVDPHPVGNIGSNNSSMPWKVHPL-EEDQLHDKAPNLELALGAKTKPLMSGIPSFL  4235
               FF VD H    + SN+ S PWKV  L  ED+L D +PNLELALG + K   +G+  F 
Sbjct  1237  RCFFLVDSHAAQGVPSNDRSSPWKVSLLGNEDRLPDGSPNLELALGVEKKQSRNGLLPFF  1296

Query  4236  SGKVEKKIIEENTSDNAATSANKEDVsaslslslsFPFPEKEH-GTSSKP----EQEDPR  4400
             +G V++K   +   D A+     ED SASLSLSL+FPF + E  G S +P    EQ  P 
Sbjct  1297  AGIVDRK-GPDRPPDIASPKEEDEDASASLSLSLAFPFSDMESPGKSVRPLTTLEQALPA  1355

Query  4401  RRQANTSLLLFGRPEG  4448
             R + NTSLLLF    G
Sbjct  1356  RHEGNTSLLLFRNSSG  1371



>ref|XP_006400205.1| hypothetical protein EUTSA_v10012458mg [Eutrema salsugineum]
 gb|ESQ41658.1| hypothetical protein EUTSA_v10012458mg [Eutrema salsugineum]
Length=1249

 Score =   390 bits (1002),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 274/732 (37%), Positives = 398/732 (54%), Gaps = 101/732 (14%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNEHVNSG  1118
             CDICG  GRE LLAICS C+DGAEH YCM++ L ++PEGDWLCEEC+  ++ K E     
Sbjct  269   CDICGDAGREDLLAICSECSDGAEHIYCMRERLSEVPEGDWLCEECEEAEKQKQE-----  323

Query  1119  RVNEKEKTSPSRRTTIAKSDHPLKMEQKTSDCWGDKAVEERSYLKTSGKRCTDDSEVSSP  1298
                 K K    R T +  + H                        +SGKR  D SE +  
Sbjct  324   ---AKRK----RETEVTLNPH------------------------SSGKRLADKSEAAPD  352

Query  1299  TKRQRLELRS--PTAQIPNRVTSLSRESSFKNLERGKVKPLNPFSSGSFAAKVPSSTGPQ  1472
              KRQ +E  S  P   I  R+ +LSRE+SFK L+R + + LN  SS S   +   STG Q
Sbjct  353   AKRQAVEGSSGSPKKSILPRIGALSRETSFKGLDRSRGR-LNHQSSLSDDTESARSTGSQ  411

Query  1473  PQPPRGIFSKSNSFSSLIAKPKVKLVDEVFPAKQKLSRETAFIESKEVAVRSMGKSMSFK  1652
              QPP+G F KS+SF+   ++ KV+ +D++   ++K  +E   ++ KE +  +  + MS +
Sbjct  412   LQPPKGAFLKSSSFNCSSSRGKVQHMDDIIIPRKKTGKEYTSLDIKEGSSGNASR-MSSR  470

Query  1653  PTTASRSNCTESKVKMFSPKFSHDQDVKWLRHKKDRSSFDRKNSLRSDRLAGGAISSPKS  1832
              T A  S+  +S+ K+F+ K     + K  +  KDRS+                +S+  +
Sbjct  471   TTDAGISSGNDSQAKLFASK-----EGKSSKQLKDRSTE-------------ANLSTSST  512

Query  1833  DNKPTPRGEPSSLSSLNTNRDYRALTSDNKPVTISNSTSGVAREVLKQASVDGVSSAN--  2006
             D K T R   SS S  N  RD + L SD K  +++   S + R  L+     G  +    
Sbjct  513   DQKLTSRSN-SSASYANNTRDLKGLQSDGKRGSLTKQVSNLNRNRLENPVASGGDNLKNE  571

Query  2007  RVSSSEENPSQAIPKEDSSSSSCVAERPSWSSNEVLPDGLSQSKESKAFGDKTRESSASR  2186
             + ++SE++ SQA  K++  S+SC  E    + N    DGL +S+E +  G K++++   R
Sbjct  572   KSNASEQSSSQADCKDELPSTSCAVEGVPSNGNVASQDGLPRSREFREAGKKSKDAFGKR  631

Query  2187  SKQNSTASGK-IVSCQKCKGNGHLAQVCTADGPESSALGSPFKSSREATNGPSDLKAAIE  2363
              + +  +  K + S QK    G  A+     G   S L S  K+ RE  N  + L+AA++
Sbjct  632   QRSSLLSGAKGLPSSQK---GGQTAESSDTSGVSDSDL-STTKNVREDINKGNRLRAAVD  687

Query  2364  AARLRKPGICRKNRVADQSEDLSASNMKSEIASQDQMLSSTVRRNVNGAEEAQKQETANN  2543
             AA  +KP    KNRV +Q  D+S             + S T+               A+N
Sbjct  688   AALRKKPSFG-KNRVLEQC-DVS-------------LASKTI---------------ASN  717

Query  2544  AKQLGIIAEASARTRNAG-HVVFSDVKHSVIDMERQTLVSMPVILKT-AIPEYQYIWQGG  2717
              KQLG+    +   R+    V    VK  + D     LVS P +L++ AIP+++ IWQG 
Sbjct  718   EKQLGLSGADAIPPRSVELEVNIPSVKPVIRDW---PLVSPPALLRSSAIPDHESIWQGD  774

Query  2718  FEVQKSGKAFNLYDGIQAHLSSCASPKVLDAVNKFPRKVILNEVPRLSSWPMQFKECGVS  2897
              EV+K+     ++ G+QAHLS+ ASPKV + VNKFP K  LNEVPRLS+WP QF++ G  
Sbjct  775   LEVRKARNQSAMHSGMQAHLSTLASPKVAEVVNKFPVKFSLNEVPRLSTWPAQFQDIGTK  834

Query  2898  EDNVALFFFAKDIGSYEKSYKVLLGDMVKHDLALQGNIGDIELLIFPSNQLPEKFQRWNL  3077
             ED++ALFFFAKD+ SYE++YK L+  M+K DLAL+GN+ ++ELLIF SNQLP   QRWN+
Sbjct  835   EDHIALFFFAKDVESYERNYKPLVDYMIKKDLALKGNLDNVELLIFASNQLPPNCQRWNM  894

Query  3078  MFFLWGVFRGKR  3113
             ++FLWGVFRG++
Sbjct  895   LYFLWGVFRGRK  906



>ref|XP_009121463.1| PREDICTED: uncharacterized protein LOC103846310 [Brassica rapa]
Length=1271

 Score =   390 bits (1002),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 273/735 (37%), Positives = 399/735 (54%), Gaps = 88/735 (12%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNEHVNSG  1118
             CDICG  GRE LLAIC  C+DGAEHTYCM+ ML ++PEGDWLCEEC+             
Sbjct  274   CDICGDAGREDLLAICFGCSDGAEHTYCMRVMLNEVPEGDWLCEECE-------------  320

Query  1119  RVNEKEKTSPSRRTTIAKSDHPLKMEQKTSDCWGDKAVEERSYLKTSGKRCTDDSEVSSP  1298
                EK+K    R+      + P                      ++SGKR  D  E +  
Sbjct  321   -EAEKQKQEAKRKIETEIINSP----------------------QSSGKRHADKIEAAPD  357

Query  1299  TKRQRLE--LRSPTAQIPNRVTSLSRESSFKNLERGKVKPLNPFSSGSFAAKVPSSTGPQ  1472
              KRQ +E    SP   I  R+  LSRE+S K L+R + K L+  +S S+  +   STG Q
Sbjct  358   AKRQAVEGSTGSPKKSILPRIGPLSRETSLKGLDRPRGK-LSHQASFSYTTEGARSTGLQ  416

Query  1473  PQPPRGIFSKSNSFSSLIAKPKVKLVDEVFPAKQKLSRETAFIESKEVAVRSMGKSMSFK  1652
              QPP+G F KS+SF+S  +KPKV+L+D+V   ++K  +E   ++ KE  +  + KSMS +
Sbjct  417   LQPPKGAFLKSSSFNSSSSKPKVQLMDDVILPRKKTGKEYTPVDIKEGGLGIVSKSMSSR  476

Query  1653  PTTASRSNCTESKVKMFSPKFSHDQDVKWLRHKKDRSSFDRKNSLRSDRLAGGAISSPKS  1832
              T    SN  +S+ K+ + K  H Q+ K  +  KDRS+    ++  +D+           
Sbjct  477   TTDTGSSNGNDSEAKILASKV-HSQEGKSSKQLKDRSAEANASAASTDQ-----------  524

Query  1833  DNKPTPRGEPSSLSSLNTNRDYRALTSDNKPVTISNSTSGVAREVLKQASVDGVSSANRV  2012
               K TPR         ++ RD + L SD K  +++   S + R  L+     G +S    
Sbjct  525   --KLTPR---------SSTRDLKGLQSDGKRGSLTKQVSNLNRNRLENPIASGGNS----  569

Query  2013  SSSEENPSQAIPKEDSSSSSCVAERPSWSSNEVLPDGLSQSKESKAFGDKTRESSASRSK  2192
                E++  QA  K++ +S+SC  E    + N    DGL +S+E K    K++E+   R +
Sbjct  570   --REQSVGQADCKDELTSTSCAGEGVPSNGNVTSQDGLPRSREFKEVVKKSKEALGKRQR  627

Query  2193  QNSTASGKIVSCQKCKGNGHLAQVCTADGPESSALG----SPFKSSREATNGPSDLKAAI  2360
              +  A GK +   + KG+       TA+  ++S +     S  K  RE  N  + L+AA+
Sbjct  628   SSLLAGGKGLPSSQ-KGDK------TAESSDTSGVSDSDPSTTKIVREDINKGNRLRAAV  680

Query  2361  EAARLRKPGICRKNRVADQSEDLSASNM--KSEIASQDQMLSSTVRRNVNGAEEAQKQET  2534
             +AA  +KP    KNRV +Q +   ASN+   S+   +DQ L S +      A +  KQ  
Sbjct  681   DAALRKKPSFS-KNRVLEQCDAALASNVPSNSDKTLRDQ-LPSKMHTTAWPAPDPYKQTI  738

Query  2535  ANNAKQLGIIAEASARTRNAGHVVFSDVKHSVIDMERQTLVSMPVIL--KTAIPEYQYIW  2708
               N KQL     + A       V       SV  + R   ++ P+ L   +AIP+++ IW
Sbjct  739   VTNGKQL---VPSGADAMPPRSVELEVNPPSVKPVMRDWPLASPLSLLRSSAIPDHESIW  795

Query  2709  QGGFEVQKSGKAFNLYDGIQAHLSSCASPKVLDAVNKFPRKVILNEVPRLSSWPMQFKEC  2888
             QG  EV+K+ +   ++ G+QAHLS+ ASPKV + VNKFP K  LNEVPRLS+WP QF++ 
Sbjct  796   QGNLEVRKAREQSAMHSGMQAHLSTLASPKVAEVVNKFPEKFSLNEVPRLSTWPAQFQDI  855

Query  2889  GVSEDNVALFFFAKDIGSYEKSYKVLLGDMVKHDLALQGNIGDIELLIFPSNQLPEKFQR  3068
             G  ED++A+FFFAKD+ SYE++YK L+ +M+K DLAL+GN+  +ELL+F SNQLP   QR
Sbjct  856   GTKEDHIAVFFFAKDVESYERNYKPLVDNMMKKDLALKGNLDYVELLVFASNQLPPNCQR  915

Query  3069  WNLMFFLWGVFRGKR  3113
             WN+++FLWGVFRG++
Sbjct  916   WNMLYFLWGVFRGRK  930



>ref|XP_006400206.1| hypothetical protein EUTSA_v10012458mg [Eutrema salsugineum]
 gb|ESQ41659.1| hypothetical protein EUTSA_v10012458mg [Eutrema salsugineum]
Length=1282

 Score =   390 bits (1002),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 274/732 (37%), Positives = 398/732 (54%), Gaps = 101/732 (14%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNEHVNSG  1118
             CDICG  GRE LLAICS C+DGAEH YCM++ L ++PEGDWLCEEC+  ++ K E     
Sbjct  302   CDICGDAGREDLLAICSECSDGAEHIYCMRERLSEVPEGDWLCEECEEAEKQKQE-----  356

Query  1119  RVNEKEKTSPSRRTTIAKSDHPLKMEQKTSDCWGDKAVEERSYLKTSGKRCTDDSEVSSP  1298
                 K K    R T +  + H                        +SGKR  D SE +  
Sbjct  357   ---AKRK----RETEVTLNPH------------------------SSGKRLADKSEAAPD  385

Query  1299  TKRQRLELRS--PTAQIPNRVTSLSRESSFKNLERGKVKPLNPFSSGSFAAKVPSSTGPQ  1472
              KRQ +E  S  P   I  R+ +LSRE+SFK L+R + + LN  SS S   +   STG Q
Sbjct  386   AKRQAVEGSSGSPKKSILPRIGALSRETSFKGLDRSRGR-LNHQSSLSDDTESARSTGSQ  444

Query  1473  PQPPRGIFSKSNSFSSLIAKPKVKLVDEVFPAKQKLSRETAFIESKEVAVRSMGKSMSFK  1652
              QPP+G F KS+SF+   ++ KV+ +D++   ++K  +E   ++ KE +  +  + MS +
Sbjct  445   LQPPKGAFLKSSSFNCSSSRGKVQHMDDIIIPRKKTGKEYTSLDIKEGSSGNASR-MSSR  503

Query  1653  PTTASRSNCTESKVKMFSPKFSHDQDVKWLRHKKDRSSFDRKNSLRSDRLAGGAISSPKS  1832
              T A  S+  +S+ K+F+ K     + K  +  KDRS+                +S+  +
Sbjct  504   TTDAGISSGNDSQAKLFASK-----EGKSSKQLKDRSTE-------------ANLSTSST  545

Query  1833  DNKPTPRGEPSSLSSLNTNRDYRALTSDNKPVTISNSTSGVAREVLKQASVDGVSSAN--  2006
             D K T R   SS S  N  RD + L SD K  +++   S + R  L+     G  +    
Sbjct  546   DQKLTSRSN-SSASYANNTRDLKGLQSDGKRGSLTKQVSNLNRNRLENPVASGGDNLKNE  604

Query  2007  RVSSSEENPSQAIPKEDSSSSSCVAERPSWSSNEVLPDGLSQSKESKAFGDKTRESSASR  2186
             + ++SE++ SQA  K++  S+SC  E    + N    DGL +S+E +  G K++++   R
Sbjct  605   KSNASEQSSSQADCKDELPSTSCAVEGVPSNGNVASQDGLPRSREFREAGKKSKDAFGKR  664

Query  2187  SKQNSTASGK-IVSCQKCKGNGHLAQVCTADGPESSALGSPFKSSREATNGPSDLKAAIE  2363
              + +  +  K + S QK    G  A+     G   S L S  K+ RE  N  + L+AA++
Sbjct  665   QRSSLLSGAKGLPSSQK---GGQTAESSDTSGVSDSDL-STTKNVREDINKGNRLRAAVD  720

Query  2364  AARLRKPGICRKNRVADQSEDLSASNMKSEIASQDQMLSSTVRRNVNGAEEAQKQETANN  2543
             AA  +KP    KNRV +Q  D+S             + S T+               A+N
Sbjct  721   AALRKKPSFG-KNRVLEQC-DVS-------------LASKTI---------------ASN  750

Query  2544  AKQLGIIAEASARTRNAG-HVVFSDVKHSVIDMERQTLVSMPVILKT-AIPEYQYIWQGG  2717
              KQLG+    +   R+    V    VK  + D     LVS P +L++ AIP+++ IWQG 
Sbjct  751   EKQLGLSGADAIPPRSVELEVNIPSVKPVIRDW---PLVSPPALLRSSAIPDHESIWQGD  807

Query  2718  FEVQKSGKAFNLYDGIQAHLSSCASPKVLDAVNKFPRKVILNEVPRLSSWPMQFKECGVS  2897
              EV+K+     ++ G+QAHLS+ ASPKV + VNKFP K  LNEVPRLS+WP QF++ G  
Sbjct  808   LEVRKARNQSAMHSGMQAHLSTLASPKVAEVVNKFPVKFSLNEVPRLSTWPAQFQDIGTK  867

Query  2898  EDNVALFFFAKDIGSYEKSYKVLLGDMVKHDLALQGNIGDIELLIFPSNQLPEKFQRWNL  3077
             ED++ALFFFAKD+ SYE++YK L+  M+K DLAL+GN+ ++ELLIF SNQLP   QRWN+
Sbjct  868   EDHIALFFFAKDVESYERNYKPLVDYMIKKDLALKGNLDNVELLIFASNQLPPNCQRWNM  927

Query  3078  MFFLWGVFRGKR  3113
             ++FLWGVFRG++
Sbjct  928   LYFLWGVFRGRK  939



>ref|XP_008796292.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103711790 
[Phoenix dactylifera]
Length=1752

 Score =   394 bits (1011),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 292/804 (36%), Positives = 435/804 (54%), Gaps = 77/804 (10%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNEHVN--  1112
             CDICG  G E LLA CSRC+DGAEHTYCM+  L+KIPEG+WLCEEC+  ++ +N+ V+  
Sbjct  525   CDICGDAGVEELLATCSRCSDGAEHTYCMRIKLDKIPEGEWLCEECQLKEDAENKKVDKS  584

Query  1113  -----SGRVN-EKEKTSPSRRTTIAKSDHPLKMEQKTSDCWGDKAVEERSYLKTSGKRCT  1274
                  + +V+  KE +       I K    L +E   ++  G  + +     + SGK   
Sbjct  585   DSFSGTSKVDILKENSQNFVSNLIPKILPKLDIEAIDTEVRG--STKGMQSPQKSGKSHA  642

Query  1275  DDSEVSSPTKRQRLELRSPTAQI--PNRVTSLSRESSFKNLERGKVKPLN--PFSSGSFA  1442
             D  EV+S   +   E+   +  I  P +   +SRESSFK+L+ GKVKP N  P S G  A
Sbjct  643   DSPEVTSMNSKMIPEIGGGSIGIASPRKNAVISRESSFKSLDMGKVKPTNLVPSSKGQSA  702

Query  1443  AKV------------PSSTGPQPQPPRGIFSKSNSFSSLIAKPKVKLVDEVFPAKQKLSR  1586
                            PS   PQ    RG  SK  SF +   KPKVK +    P KQK++R
Sbjct  703   NSSQAISRSHTSNSKPSKVQPQLHSTRGPLSKQLSFDNSYMKPKVKQLINNLPQKQKITR  762

Query  1587  ETAFIES-KEVAVRSMGKSMSFKPTTASRSNCTESKVKMFSPKFSHDQDVKWLRHKKDRS  1763
             E       K+  V++M KS SFK  ++  SN  ES  +  S K     + +  +  K+R+
Sbjct  763   EAVSSNGRKDEVVKTMMKSASFKSVSSGLSN-IESLNRTQSFKSPQADEPRGWKLVKERN  821

Query  1764  SFDRKNSLRSDRLAGGAISSPKSDNKPTPRGEPSSLSSLNTNRDYRALTSDNKPVTISNS  1943
               +RKNS   DR AG   S+ K D K       S  S   +N+  + + S  K   + N 
Sbjct  822   MRERKNSFVLDRPAG--TSAAKMDLKI------SQHSGNLSNKSEQDILSIKK--GLENP  871

Query  1944  TSGVAREVLKQASVDGVSSANRVSSSE-ENPSQAIPKEDSSSSSCVAERPSWSSNEVLPD  2120
                   EV KQ S    S    + +SE   P Q +P+E S ++    +R    ++ VL  
Sbjct  872   KDLGRTEVKKQTS--STSKRYELCNSEGRRPCQVVPREGSCANPTAVDRSRGDADLVLQR  929

Query  2121  GLSQSKESKAFGDKTRESS-ASRSKQNSTASGKIVSCQKCKGNGHLAQVCTADGPESSAL  2297
              +SQ +ES    D+ ++S+ +S S+Q +++ G+++ C KC   GH  Q C  D    SAL
Sbjct  930   SMSQVQESSPQEDQIKDSTHSSSSRQAASSDGRVLRCHKCNETGHATQFCPIDKLRISAL  989

Query  2298  G-SPFKSSREATNGPSDLKAAIEAARLRKPGICRKNRVADQSE-DLSASNMKSEIASQDQ  2471
               S  +S RE+++  +  K AIEAA+ R     ++N+++DQS     ++ +  E+AS+D 
Sbjct  990   KPSADRSLRESSHKSNKWKDAIEAAKTRTQ---KRNKLSDQSVCSTPSTEVSCEVASKDI  1046

Query  2472  MLSSTVRRNV--NGAEEAQK-----------QETANNAKQLGIIAEASARTRNA-GHVVF  2609
               +S+  +++   G  + Q            +E   + +Q     EAS   + +  + + 
Sbjct  1047  QSNSSGLKSLPLEGTSDGQADLRSFDADFGIREPVIDMQQAKHPVEASCLPKASDSNAIL  1106

Query  2610  SDVKHS------VIDMERQTLVSMPVILKTAIPEYQYIWQGGFEVQKSGKAFNLYDGIQA  2771
             ++   S       I +++ +L++ P    + IPE++YIWQGGFEV ++G     +DGIQA
Sbjct  1107  TNSDGSNANPSTRILLDQSSLLAYP-FRASGIPEHEYIWQGGFEVLRTGGLHEFFDGIQA  1165

Query  2772  HLSSCASPKVLDAVNKFPRKVILNEVPRLSSWPMQFKECGVSEDNVALFFFAKDIGSYEK  2951
             HLS+CASP +L+ V++FP K+ L+E P L  WP+QF+     EDN+A+FFFAKDI SYE+
Sbjct  1166  HLSTCASPNMLEVVSQFPCKLQLDEAPYLRLWPLQFQGISPKEDNIAIFFFAKDIESYER  1225

Query  2952  SYKVLLGDMVKHDLALQGNIGDIELLIFPSNQLPEKFQRWNLMFFLWGVFRGKRANS---  3122
             +Y  LL +M+K+DLAL+GNI ++E+LIFPSN+LPE  QRWN++FFLWGVFRG+   S   
Sbjct  1226  TYGKLLENMLKNDLALRGNINEVEILIFPSNKLPENCQRWNMLFFLWGVFRGRTECSKIL  1285

Query  3123  --LQ----NFPGAEKPLIQDIPTP  3176
               LQ     F  +  PL+Q I +P
Sbjct  1286  PDLQKQTCQFKLSTDPLVQKISSP  1309


 Score = 65.5 bits (158),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 62/147 (42%), Positives = 78/147 (53%), Gaps = 16/147 (11%)
 Frame = +3

Query  4020  SKTAILETPGNAEMFFFPVDPHPVGNIGSNNSSMPWKVHPL---EEDQLHDKAPNLELAL  4190
             S T + E P  AE FFFP D  PV N+ S N      +H L   +ED     +P+LELAL
Sbjct  1611  SGTGMTENPRCAEKFFFPADSGPVRNVVSENF-----IHVLSSDDEDVPESSSPDLELAL  1665

Query  4191  GAKTKPLMSGIPSFLSGKVEKKIIEENTSDNAATSANKEDVsaslslslsFPFPEKEHGT  4370
             G K K     + S L    ++K  +E     A     ++D+SASLSLSL+FP  EK+   
Sbjct  1666  GGKKKSSEKEVLSLLFPLADRKSSQEKLPGPAMD--GEDDMSASLSLSLAFPGTEKKQ--  1721

Query  4371  SSKP----EQEDPRRRQANTSLLLFGR  4439
               KP    EQ  P R + NTSLLLFGR
Sbjct  1722  KDKPILRTEQLLPERPRVNTSLLLFGR  1748



>emb|CAC01832.1| putative protein [Arabidopsis thaliana]
Length=1280

 Score =   384 bits (986),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 280/751 (37%), Positives = 403/751 (54%), Gaps = 100/751 (13%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNEHVNSG  1118
             CDICG  GRE LLAICS C+DGAEHTYCM++ML+++PEGDWLCEE               
Sbjct  276   CDICGDAGREDLLAICSGCSDGAEHTYCMREMLDEVPEGDWLCEE-----------CAEE  324

Query  1119  RVNEKEKTSPSRRTTIAKSDHPLKMEQKTSDCWGDKAVEERSYLKTSGKRCTDDSEVSSP  1298
                +K++    R T +  + +                        +SGKR  D  E +  
Sbjct  325   AEKQKQEAKRKRETEVTFNTY------------------------SSGKRHADKIEAAPD  360

Query  1299  TKRQRLELR--SPTAQIPNRVTSLSRESSFKNLER--GKVKPLNPFSSGSFAAKVPSSTG  1466
              KRQ +E    SP   I  RV +LSRE+SFK L+R  GK+     FS  + +A+   S G
Sbjct  361   AKRQVVEASTGSPKKSILPRVGALSRETSFKGLDRLRGKLNHQTSFSDDTESAR---SAG  417

Query  1467  PQPQPPRGIFSKSNSFSSLIAKPKVKLVDEVFPAKQKLSRETAFIESKEVAVRSMGKSMS  1646
              Q QPP+G F KS+SF+   +KPKV+L+D+    +QK  +E   ++ K    R++GKSM 
Sbjct  418   SQLQPPKGAFLKSSSFNCSSSKPKVQLMDDAIHPRQKTGKEDTALDLKVGGFRNVGKSMP  477

Query  1647  FKPTTASRSNCTESKVKMFSPKFSHDQDVKWLRHKKDRSSFDRKNSLRSDRLAGGAISSP  1826
              + T A  S  ++S+ KM   K  H Q+ K L+  KDR           +R A  + SS 
Sbjct  478   SRTTDAGNSGGSDSQAKMLGSKVYHSQEGKSLKQVKDR-----------NREANASASS-  525

Query  1827  KSDNKPTPRGEPSSLSSLNTNRDYRALTSDNKPVTISNSTSGVAREVLKQASVDGVSSAN  2006
               D K   RG  SS+S  N NRD + L SD K                       +S+  
Sbjct  526   -IDQKLKSRGN-SSVSHANNNRDLKGLQSDGK-------------------RGGDISTNE  564

Query  2007  RVSSSEENPSQAIPKEDSSSSSCVAERPSWSSNEVLPDGLSQSKESKAFGDKTRESSASR  2186
             + S+SE++ SQA  K++  S+SC  E         L DGL +S+  +  G K++E+ + R
Sbjct  565   KCSASEQSSSQADCKDELPSTSCTGEGMPNHGTVALQDGLPRSRVPREVGKKSKEAFSKR  624

Query  2187  SKQNSTASGK-IVSCQKCKGNGHLAQVCTADGPESSALGSPFKSSREATNGPSDLKAAIE  2363
              + +  A  K + S QK    G  A+     G   S L S  K+ +E  N  + L+AA++
Sbjct  625   QRSSLLAGAKGLPSSQK---GGQTAESSDTSGVSDSDL-STTKNVKEDLNKGNRLRAAVD  680

Query  2364  AARLRKPGICRKNRVADQSEDLSASNMKS--EIASQDQMLSSTVRRNVNG----------  2507
             AA  +KP    KNRV +QS+    +N+ S  E   ++Q+ S   + +V+           
Sbjct  681   AALRKKPSFG-KNRVLEQSDASLVANVDSSSEKTLRNQLPSKMHKNHVSHEGLQGGHPIL  739

Query  2508  --AEEAQKQETANNAKQLGIIAEASARTRNAG-HVVFSDVKHSVIDMERQTLVSMPVILK  2678
                 +  KQ    N KQL      +  +R     V F  VK  + D+    LV  PV+L+
Sbjct  740   WPTSDPYKQTIVTNEKQLIFPGADTIPSRLVEPEVSFPAVKPVMRDL---PLVPSPVMLR  796

Query  2679  T-AIPEYQYIWQGGFEVQKSGKAFNLYDGIQAHLSSCASPKVLDAVNKFPRKVILNEVPR  2855
             + AIP++++IWQG  EV+K      ++ GIQAHLS+ ASP+V + VNKFP    LNEVPR
Sbjct  797   SSAIPDHEFIWQGDLEVRKIINQSAMHSGIQAHLSTLASPRVAEVVNKFPETFSLNEVPR  856

Query  2856  LSSWPMQFKECGVSEDNVALFFFAKDIGSYEKSYKVLLGDMVKHDLALQGNIGDIELLIF  3035
              S+WP QF++ G  E ++ALFFFAKD  SYE++YK L+ +M+K+DLAL+GN+ +++LLIF
Sbjct  857   KSTWPTQFEKLGTKEAHIALFFFAKDTESYERNYKPLVDNMIKNDLALKGNLDNVDLLIF  916

Query  3036  PSNQLPEKFQRWNLMFFLWGVFRGKRANSLQ  3128
              SNQLP   QRWN+++FLWGVF+G++  + Q
Sbjct  917   ASNQLPSNCQRWNMLYFLWGVFQGRKETNPQ  947



>ref|XP_010933485.1| PREDICTED: uncharacterized protein LOC105053867 [Elaeis guineensis]
Length=1636

 Score =   388 bits (996),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 297/813 (37%), Positives = 417/813 (51%), Gaps = 104/813 (13%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNEHVN--  1112
             CDICG  G E LLAICSRC+DGAEHTYCM   L+KIPEG+WLCEEC   ++ +N+ V+  
Sbjct  435   CDICGDAGVEELLAICSRCSDGAEHTYCMHIKLDKIPEGEWLCEECHLKEDAENKKVDKS  494

Query  1113  ------SGRVNEKEKT----SPSRRTTIAKSDHPLKMEQKTSDCWGDKAVEERSYLK---  1253
                   S   N KEK+    S    T IAK D             G    E R   K   
Sbjct  495   DSISGTSKADNLKEKSQDFGSNYNPTNIAKLD------------IGATGTEVRGPTKGIR  542

Query  1254  ---TSGKRCTDDSEVSSPTKRQRLELR--SPTAQIPNRVTSLSRESSFKNLERGKVKPLN  1418
                 SG    D  EV+S   ++  E+   S     P +   LSRESSFK L+ GKVKP N
Sbjct  543   SPQKSGNMHADSQEVNSMNSKKISEMDGGSIGTTSPRKNAVLSRESSFKGLDMGKVKPTN  602

Query  1419  PFSS--------------GSFAAKVPSSTGPQPQPPRGIFSKSNSFSSLIAKPKVKLVDE  1556
               SS                 ++  PS    Q   PRG  SK  SF++   KPKV+ + +
Sbjct  603   LASSPRCPLANTFPAISRSHMSSSNPSRVEAQLHSPRGPLSKQLSFNNSNMKPKVRQLID  662

Query  1557  VFPAKQKLSRETAFIES-KEVAVRSMGKSMSFKPTTASRSNCTESKVKMFSPKFSHDQDV  1733
               P KQK++RE     S K+  V++M KS SFK  ++ RSN  ES  KM S       + 
Sbjct  663   NLPQKQKMTREYVSSNSRKDGVVKTMMKSASFKSVSSGRSN-VESVNKMQSLNSPRAAEP  721

Query  1734  KWLRHKKDRSSFDRKNSLRSDRLAGGAISSPKSDNKPTPRGEPSSLSSLNTNRDYRALTS  1913
             K  +  K+R+  +RKNS   DR              P     PS+ +S+        L S
Sbjct  722   KGWKPVKERNMMERKNSFVLDR--------------PVVSPSPSAGTSV----PKMDLKS  763

Query  1914  DNKPVTISNSTSGVAREVLKQASVDGVSSANRVSSSEENPSQAIPKEDSSSSSCVAERPS  2093
                   +SN +   +  V  + SV       + S++ +       +EDS ++    +R  
Sbjct  764   SQHNGNLSNKSEKGSENV--KDSVGHNEVKKQTSNTFKRYELCNAEEDSHANPSAIDRSC  821

Query  2094  WSSNEVLPDGLSQSKESKAFGDKTRESSASRSKQNSTASG-KIVSCQKCKGNGHLAQVCT  2270
               ++ VL   ++Q  ES     K ++SS S + +  ++SG +++ C KC   GH  Q C 
Sbjct  822   CDADSVLQRSVTQVPESSPREHKIKDSSHSSTSRQVSSSGSRVLRCHKCNETGHTTQFCP  881

Query  2271  ADGPESSALG-SPFKSSREATNGPSDLKAAIEAARLRKPGICRKNRVADQSE-DLSASNM  2444
              D    SAL  S  ++ RE +N  +  + A+EAA++R     + N++ DQS   + ++ +
Sbjct  882   IDKLSISALKPSTDRNLREGSNNSNKCRDAMEAAKMRTK---KSNKLPDQSACSMPSTEV  938

Query  2445  KSEIASQDQMLSSTVRRNV--NGAEEAQ-----------KQETANNAKQLGIIAEASART  2585
               E+AS+D   SS+  +++   G  + Q           ++E A +A+Q     EAS   
Sbjct  939   SYEVASKDFQSSSSGLKSLPQEGTSDGQVILRCSDADLGRREPAIDAQQAKHAVEASFLP  998

Query  2586  RNAGHVVFSDVKHSV-------IDMERQTLVSMPVILKTAIPEYQYIWQGGFEVQKSGKA  2744
             +            S+       I  ++ +L++ P    + IPE +YIWQGGFEV ++GK 
Sbjct  999   KECDSNAIPTNSDSLNANSSTQILPDQSSLLANP-FRPSIIPEIEYIWQGGFEVLRTGKL  1057

Query  2745  FNLYDGIQAHLSSCASPKVLDAVNKFPRKVILNEVPRLSSWPMQFKECGVSEDNVALFFF  2924
                +DGIQAHLS+CASPKVL+ V+ FP K+ L+EVP L  WP+QF+     EDN+AL FF
Sbjct  1058  PEFFDGIQAHLSTCASPKVLEVVSHFPGKLQLDEVPCLRLWPVQFQGMSPKEDNIALLFF  1117

Query  2925  AKDIGSYEKSYKVLLGDMVKHDLALQGNIGDIELLIFPSNQLPEKFQRWNLMFFLWGVFR  3104
             AKDI SYE +Y  LL +M+K+DLAL+GNI ++ELLIFPSN+LPE  QRWN++FFLWGVFR
Sbjct  1118  AKDIESYESAYGKLLENMLKNDLALRGNINELELLIFPSNKLPENCQRWNMLFFLWGVFR  1177

Query  3105  GKRANS-----LQNFPGAEK----PLIQDIPTP  3176
             G+   S     LQ  P   K    PL Q+I  P
Sbjct  1178  GRTECSKVLPDLQKQPCRPKLSTDPLAQEISFP  1210



>ref|XP_010935007.1| PREDICTED: uncharacterized protein LOC105055018 [Elaeis guineensis]
 ref|XP_010935008.1| PREDICTED: uncharacterized protein LOC105055018 [Elaeis guineensis]
 ref|XP_010935009.1| PREDICTED: uncharacterized protein LOC105055018 [Elaeis guineensis]
Length=1201

 Score =   380 bits (975),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 288/815 (35%), Positives = 427/815 (52%), Gaps = 100/815 (12%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNEHVNSG  1118
             CDICG  G+E LLAICSRC+DGA+HTYCM+ ML+K+PE DWLCEEC+  +E +N+ V+  
Sbjct  372   CDICGDAGQEELLAICSRCSDGAKHTYCMRVMLDKLPEDDWLCEECQLMEENENQKVDRS  431

Query  1119  R----------VNEKEKTSPSRRTTIAKSDHP-LKMEQKTSDCWGDKAVEERSYLKTSGK  1265
                        +NEK+++S +   T      P L+ ++  SD  G K +E     + S  
Sbjct  432   EAASEMLELPCLNEKDQSSGN---TFNPEVLPNLETKEINSDAKGAKGLES---TQDSTM  485

Query  1266  RCTDDSEVSSPTKRQRLEL--RSPTAQIPNRVTSLSRESSFKNLERGKVKPLNPFSSGSF  1439
             R   + EV+S T  +  E   RS     P + T L RESSF +L+ GKVKP+NP  S   
Sbjct  486   RHGKNVEVTSVTSNKVSETSGRSTGITSPRKNTMLLRESSFNSLDVGKVKPVNPSPSCGG  545

Query  1440  AAKVPSSTGPQPQPPRGIFSKSNSFSSLIAKPKVKLVDEVFPAKQKLSRETAFIESKEVA  1619
              ++  S +    Q   G+ SKS SF+S    PKVK + E  P +QK++  +     KE  
Sbjct  546   QSRSSSHSIAHSQASSGLLSKSASFNS-SKMPKVKQLIESVPFRQKITSSSD--SRKEGL  602

Query  1620  VRSMGKSMSFKPTTASRSNCTESKVKMFSPKFSHDQDVKWLRHKKDRSSFDRKNSLRSDR  1799
             ++++ KS SFK T +  S  +  K++   P ++  +D +  +  K+R+  ++KNS  SDR
Sbjct  603   LKTITKSASFKSTNSGCSIKSADKIQSLEPLWA--EDPRGGKQVKERNVINKKNSSMSDR  660

Query  1800  ----LAGGAISSP--------------KSDNKPTPRGEPSSLSSLNTNRDYRALTSDNKP  1925
                 L+  A + P              KSD  P P       S++ T+R           
Sbjct  661   PSISLSLSASTCPPFPKLDIKFSQQIGKSDKIPDP-------SNVGTDRGS---------  704

Query  1926  VTISNSTSGVAREVLKQAS----VDGVSSANRVSSSEENPS-QAIPKEDSSSSSCVAERP  2090
                +N+ +   +EV KQ+S      G + +N +  SE+  + Q + KE+  +SS   +R 
Sbjct  705   ---NNANNLGCKEVKKQSSFSMRTSGSTPSNGIRKSEDQKTYQPVSKENVRASSAAVDRA  761

Query  2091  SWSSNEVLPDGLSQSKESKAFGDKTRESS-ASRSKQNSTASGKIVSCQKCKGNGHLAQVC  2267
                 + +      Q  ES    DKT++ + +S S+Q ++ S +I+ CQ+C   GH  Q+C
Sbjct  762   CCKPDSIQQCSTHQVVESAHRDDKTKDRTFSSSSRQAASESSRILRCQRCNETGHTTQLC  821

Query  2268  TADGPESSAL-GSPFKSSREATNGPSDLKAAIEAARLRKPGICRKNRVADQSEDLSAS--  2438
               D    SA+  S  ++ RE +N  +  K  +EA   +   + +KN+  DQ E++S S  
Sbjct  822   AVDKLRMSAVRPSAERNLREGSNKNNKWKDTVEAISSKTRPL-KKNKSPDQYEEISTSSA  880

Query  2439  NMKSEIASQD-QMLSSTVRRNVNGAEE-AQKQETAN-----------NAKQLGIIAEASA  2579
             +  SE+ S+D Q  S +  RN+   EE A  QE              + KQ     E + 
Sbjct  881   DHNSEVTSKDLQSGSLSCARNLPSMEETADGQEILRRSADFSKAAVFHVKQKISYQEETV  940

Query  2580  RTRNAGHVV----FSD---VKHSVIDMERQTLVSMPVILKTAIPEYQYIWQGGFEVQKSG  2738
                  G++      SD   +K  +  +  Q  V  P +  + IP+ ++IWQGGF+V ++G
Sbjct  941   CDPKDGNINTIPNISDELNLKPQMQILPAQASVLAPPLRASTIPKLEFIWQGGFKVLRTG  1000

Query  2739  KAFNLYDGIQAHLSSCASPKVLDAVNKFPRKVILNEVPRLSSWPMQFKECGVSEDNVALF  2918
                 L DG+QAH S+C SPK L+   KFP  + L EVPR SSWP+QF+E    E+N+ALF
Sbjct  1001  GLSELCDGLQAHPSTCVSPKALEVAFKFPCIIHLEEVPRCSSWPLQFQENSPEEENIALF  1060

Query  2919  FFAKDIGSYEKSYKVLLGDMVKHDLALQGNIGDIELLIFPSNQLPEKFQRWNLMFFLWGV  3098
             FFAKDI SY+ +Y  LL  M+K+DLAL+GN+   EL IFPSN LPE  Q+WN + FLWGV
Sbjct  1061  FFAKDIDSYKNNYSKLLETMLKNDLALKGNMDGAELFIFPSNLLPENSQQWNNLTFLWGV  1120

Query  3099  FRGKRANSLQNFPGAEK---------PLIQDIPTP  3176
             FR ++  S  + P   K         PL QD+P P
Sbjct  1121  FRERKKKSSDDMPVFRKLDRPNLNMEPLDQDLPAP  1155



>ref|XP_010663576.1| PREDICTED: uncharacterized protein LOC100243800 isoform X2 [Vitis 
vinifera]
Length=1481

 Score =   382 bits (982),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 290/805 (36%), Positives = 421/805 (52%), Gaps = 94/805 (12%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNE-----  1103
             CDICG  G E LLA C++C+DGAEH YCM+  LEK+P   W+CEEC   +E + E     
Sbjct  415   CDICGDAGLEELLATCTKCSDGAEHIYCMRIKLEKVPGRGWMCEECMAKEETQKEMKCTI  474

Query  1104  -HVNSGRVNEKEKTSPSRRTTIAKSDHPLKMEQKTSDCWGDKAVEERSYLKTSGKRCTDD  1280
               +    +N+  K S +  T+  K ++ L+ E   S     +     S  + S KR  D 
Sbjct  475   GFLKGSSLNQTRKNSGNSSTS--KFENFLEFESMDSTVSRSRTKSLDSAPQFSAKRPADS  532

Query  1281  SEVSSPTKRQRLELRSPTAQIP--NRVTSLSRESSFKNLERGKVKPLNPFSSGSFAA---  1445
              E    TK++ LE  +   ++P  ++   LS +SSF+NL +GKVK  +  S G  ++   
Sbjct  533   LETVPVTKKRTLETITRPTKVPSPHKKDILSWDSSFRNLCKGKVKQAHETSFGDNSSNNT  592

Query  1446  ---------------KVPSSTGPQPQPPRGIFSKSNSFSSLIAKPKVKLVDEVFPAKQKL  1580
                            K+P     Q Q  RG   KSNSF  L A  KVKL ++    KQK 
Sbjct  593   LQSACLPTVSDYKSQKIPQ----QLQMSRGSLLKSNSFHILDANLKVKLSEKAVLQKQKF  648

Query  1581  SRETAFIESKEVAVRSMGKSMSFKPTTASRSNCTESKVKMFSPKFSHDQDVKWLRHKKDR  1760
             +RET   + K+   R M KS+SF    +   N  +SKVKMFS  FSH +D+K LRH K  
Sbjct  649   TRETDTSDMKKGIGRMMSKSLSFNGVGSKHLNVAQSKVKMFSSNFSHVEDLKRLRHAK--  706

Query  1761  SSFDRKNSLRSDR------------LAGGAISSPKSDNKPTPRGEPS-SLSSLNTNRDYR  1901
                  +NSL+ D             +AG   S+P +D K   RGE   + SS  T  + R
Sbjct  707   -----QNSLQRDHKSKSYNPHMISPVAGSGDSAPTTDKKTASRGETVLAHSSGITCNELR  761

Query  1902  ALTSDNKPVTISNSTSGVAREVLKQASVDGVSSANR----VSSSEENPSQAI------PK  2051
             ++         S  TS +A + LK +   GVS A R    +S  +++PS  +      PK
Sbjct  762   SMQFHRNSNNSSEPTSRLAPKDLKCSHGQGVSGAKRSALCLSDVDKDPSPRMSDSSHEPK  821

Query  2052  ED--------SSSSSCVAERPSWSSNEVLPDGLSQSKESKAFGDKTRE-SSASRSKQNST  2204
              +        +SSSS    R + +   +L D  SQ+ +S    +++R   S S+ +   +
Sbjct  822   VNRGIPEVVLTSSSSLTINRHNCNPGAILQDQSSQTGKSSNQEEQSRVICSFSQPRLKIS  881

Query  2205  ASGKIVSCQKCKGNGHLAQVCTADGPESSALGSPFKSSREATNGPSDLKAAIEAARLRKP  2384
                +   C +CKG GH  + C     +   L +   +S+E  N  S +    +AA + K 
Sbjct  882   VGSRSAHCHRCKGIGHSRESCPTMSSQVPILDA--GNSKEV-NKSSKMGDVAKAAIVGKD  938

Query  2385  GICRKNRVADQSEDLS-ASNMKSEIASQDQMLS--STVRRNVNGAEEAQKQE--------  2531
              + +++R  +QS++LS +S+  +   S    LS  S+   N+  A+E  +Q+        
Sbjct  939   ELHKRSRCPNQSDELSMSSSNVNSKVSSSDYLSRHSSWLVNLLSADETNEQQIRVAKDVR  998

Query  2532  --TANNAKQLGIIAEASARTRNAGHVVFSDVKHSVIDMER-QTLVSMPVILKTAIPEYQY  2702
                 +N +   +I     +  N+  VV SD +  V D+ R  + VS P  + +A+PE  Y
Sbjct  999   WHVEHNTQAANMI-----KVENSNSVVPSDERLYVRDVPRLASTVSFPSRI-SAVPELDY  1052

Query  2703  IWQGGFEVQKSGKAFNLYDGIQAHLSSCASPKVLDAVNKFPRKVILNEVPRLSSWPMQFK  2882
             IWQGGFEV + G+  + Y GIQAHLS+CASPKVL+ V+  P K+IL EVPRLS+WP QF 
Sbjct  1053  IWQGGFEVHRIGRLSSHYTGIQAHLSTCASPKVLEVVHMLPPKIILEEVPRLSTWPAQFM  1112

Query  2883  ECGVSEDNVALFFFAKDIGSYEKSYKVLLGDMVKHDLALQGNIGDIELLIFPSNQLPEKF  3062
             E   +EDN+AL+FFA D+ SY ++YK LL  M+K+DLAL+GN+  IELLIF S  LPEK 
Sbjct  1113  ENYATEDNIALYFFAADLESYGRNYKSLLEWMIKNDLALKGNLKGIELLIFSSKLLPEKS  1172

Query  3063  QRWNLMFFLWGVFRGKRANSLQNFP  3137
             QRWN + FLWGVFR +R N+ ++ P
Sbjct  1173  QRWNALSFLWGVFRVRRVNNSEHVP  1197



>ref|XP_006289796.1| hypothetical protein CARUB_v10003399mg, partial [Capsella rubella]
 gb|EOA22694.1| hypothetical protein CARUB_v10003399mg, partial [Capsella rubella]
Length=1325

 Score =   380 bits (975),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 282/742 (38%), Positives = 395/742 (53%), Gaps = 95/742 (13%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNEHVNSG  1118
             CDICG  GRE LLAICS C+DGAEHTYCM++ L ++P GDWLCEE               
Sbjct  313   CDICGDAGREDLLAICSGCSDGAEHTYCMRERLNEVPGGDWLCEE-----------CAEE  361

Query  1119  RVNEKEKTSPSRRTTIAKSDHPLKMEQKTSDCWGDKAVEERSYLKTSGKRCTDDSEVSSP  1298
                +K++    R T +  + H                        +SGKR  D  E    
Sbjct  362   AEKQKQEAKRKRETEVTLNTH------------------------SSGKRHIDKIEACPD  397

Query  1299  TKRQRLELR--SPTAQIPNRVTSLSRESSFKNLER--GKVKPLNPFSSGSFAAKVPSSTG  1466
              KRQ +E    SP   I  RV +LSRE+SFK L+R  GK+     FS  + + +   STG
Sbjct  398   AKRQAVEASTGSPKKPILPRVGALSRETSFKGLDRLRGKLNHQTSFSDDTESVR---STG  454

Query  1467  PQPQPPRGIFSKSNSFSSLIAKPKVKLVDEVFPAKQKLSRETAFIESKEVAVRSMGKSMS  1646
              QPQPP+G F KS+SF+   +KPKV+L+D+    +QK    TA     E+  R++GKSMS
Sbjct  455   SQPQPPKGAFLKSSSFNCSSSKPKVQLMDDAIHPRQK----TAL----ELKERNIGKSMS  506

Query  1647  FKPTTASRSNCTESKVKMFSPKFSHDQDVKWLRHKKDRSSFDRKNSLRSDRLAGGAISSP  1826
              + T    S+  +S  KM   K  H Q+ K  +  KDR +                +S+ 
Sbjct  507   SRTTDQGSSSGNDSHTKMIGSKVYHLQEGKSSKQMKDRGTE-------------ANVSTS  553

Query  1827  KSDNKPTPRGEPSSLSSLNTNRDYRALTSDNKPVTISNSTSGVAREVLKQASVDGVSSAN  2006
               D K   RG  SS+S  N NRD++ L SD K  +++   S + R  L+      V++  
Sbjct  554   SIDQKLKSRGN-SSVSHANNNRDFKGLQSDGKRGSLTKQVSNLNRNRLENP----VAAGG  608

Query  2007  RVSSSEENPSQAIPKEDSSSSSCVAERPSWSSNEVLPDGLSQSKESKAFGDKTRE-SSAS  2183
              +S++E+  +     + SS + C  E PS  +     DGL +S+ES+  G K++E     
Sbjct  609   DISTNEKCSASE---QSSSQADCKDELPSHGT-VASHDGLPRSRESREVGKKSKEFGKRQ  664

Query  2184  RSKQNSTASGKIVSCQKCKGNGHLAQVCTADGPESSALGSPFKSSREATNGPSDLKAAIE  2363
             RS   S A G + S QK    G   +     G   S L S  K+ +E  N  + L+AA++
Sbjct  665   RSSLLSGAKG-LPSSQK---GGQTVESSDTPGVPDSDL-STTKNVKEDINKGNRLRAAVD  719

Query  2364  AARLRKPGICRKNRVADQSEDLSASNMKS--EIASQDQMLSSTVRRNVNG---------A  2510
             AA  +KP    KNR  +Q++     N+ S  +   ++Q+ S   +  V+          A
Sbjct  720   AALRKKPSFT-KNRGLEQADASLVPNVDSSSDKTPRNQLPSKMSKNYVSHEGGHPTLWPA  778

Query  2511  EEAQKQETANNAKQLGIIAEASARTRNAG-HVVFSDVKHSVIDMERQTLVSMPVILKT-A  2684
              +  KQ    N KQL      +   R+    V F   K  + D     LV  PVIL++ A
Sbjct  779   SDLHKQTIVTNEKQLVPSGADTIPPRSLELEVKFPSTKPVMRDF---PLVPSPVILRSSA  835

Query  2685  IPEYQYIWQGGFEVQKSGKAFNLYDGIQAHLSSCASPKVLDAVNKFPRKVILNEVPRLSS  2864
             IP+++ IWQG  EV+K      +  G+QAHLS+ ASP+V + VNKFP K  LNEVPRLS+
Sbjct  836   IPDHESIWQGDLEVRKIRNQSAMCSGMQAHLSTLASPRVAEVVNKFPEKFCLNEVPRLST  895

Query  2865  WPMQFKECGVSEDNVALFFFAKDIGSYEKSYKVLLGDMVKHDLALQGNIGDIELLIFPSN  3044
             WP QF++ G  ED++ALFFFAKDI SYE++YK L+ +M+K+DLAL+GN+ ++ELLIF SN
Sbjct  896   WPGQFQKLGTKEDHIALFFFAKDIESYERNYKPLVDNMIKNDLALKGNLDNVELLIFASN  955

Query  3045  QLPEKFQRWNLMFFLWGVFRGK  3110
             QLP   QRWN+++FLWGVFRGK
Sbjct  956   QLPSNCQRWNMLYFLWGVFRGK  977



>ref|XP_010663595.1| PREDICTED: uncharacterized protein LOC100243800 isoform X6 [Vitis 
vinifera]
Length=1434

 Score =   380 bits (975),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 291/806 (36%), Positives = 421/806 (52%), Gaps = 95/806 (12%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNE-----  1103
             CDICG  G E LLA C++C+DGAEH YCM+  LEK+P   W+CEEC   +E + E     
Sbjct  367   CDICGDAGLEELLATCTKCSDGAEHIYCMRIKLEKVPGRGWMCEECMAKEETQKEMKCTI  426

Query  1104  -HVNSGRVNEKEKTSPSRRTTIAKSDHPLKMEQKTSDCWGDKAVEERSYLKTSGKRCTDD  1280
               +    +N+  K S +  T+  K ++ L+ E   S     +     S  + S KR  D 
Sbjct  427   GFLKGSSLNQTRKNSGNSSTS--KFENFLEFESMDSTVSRSRTKSLDSAPQFSAKRPADS  484

Query  1281  SEVSSPTKRQRLELRSPTAQIP--NRVTSLSRESSFKNLERGKVKPLNPFSSGSFAA---  1445
              E    TK++ LE  +   ++P  ++   LS +SSF+NL +GKVK  +  S G  ++   
Sbjct  485   LETVPVTKKRTLETITRPTKVPSPHKKDILSWDSSFRNLCKGKVKQAHETSFGDNSSNNT  544

Query  1446  ---------------KVPSSTGPQPQPPRGIFSKSNSFSSLIAKPKVKLVDEVFPAKQKL  1580
                            K+P     Q Q  RG   KSNSF  L A  KVKL ++    KQK 
Sbjct  545   LQSACLPTVSDYKSQKIPQ----QLQMSRGSLLKSNSFHILDANLKVKLSEKAVLQKQKF  600

Query  1581  SRETAFIESKEVAVRSMGKSMSFKPTTASRSNCTESKVKMFSPKFSHDQDVKWLRHKKDR  1760
             +RET   + K+   R M KS+SF    +   N  +SKVKMFS  FSH +D+K LRH K  
Sbjct  601   TRETDTSDMKKGIGRMMSKSLSFNGVGSKHLNVAQSKVKMFSSNFSHVEDLKRLRHAK--  658

Query  1761  SSFDRKNSLRSDR------------LAGGAISSPKSDNKPTPRGEPS-SLSSLNTNRDYR  1901
                  +NSL+ D             +AG   S+P +D K   RGE   + SS  T  + R
Sbjct  659   -----QNSLQRDHKSKSYNPHMISPVAGSGDSAPTTDKKTASRGETVLAHSSGITCNELR  713

Query  1902  ALTSDNKPVTISNSTSGVAREVLK----QASVDGVS-SANRVSSSEENPSQAI------P  2048
             ++         S  TS +A + LK    QA V G   SA  +S  +++PS  +      P
Sbjct  714   SMQFHRNSNNSSEPTSRLAPKDLKCSHGQAGVSGAKRSALCLSDVDKDPSPRMSDSSHEP  773

Query  2049  KED--------SSSSSCVAERPSWSSNEVLPDGLSQSKESKAFGDKTRE-SSASRSKQNS  2201
             K +        +SSSS    R + +   +L D  SQ+ +S    +++R   S S+ +   
Sbjct  774   KVNRGIPEVVLTSSSSLTINRHNCNPGAILQDQSSQTGKSSNQEEQSRVICSFSQPRLKI  833

Query  2202  TASGKIVSCQKCKGNGHLAQVCTADGPESSALGSPFKSSREATNGPSDLKAAIEAARLRK  2381
             +   +   C +CKG GH  + C     +   L +   +S+E  N  S +    +AA + K
Sbjct  834   SVGSRSAHCHRCKGIGHSRESCPTMSSQVPILDA--GNSKE-VNKSSKMGDVAKAAIVGK  890

Query  2382  PGICRKNRVADQSEDLS-ASNMKSEIASQDQMLS--STVRRNVNGAEEAQKQE-------  2531
               + +++R  +QS++LS +S+  +   S    LS  S+   N+  A+E  +Q+       
Sbjct  891   DELHKRSRCPNQSDELSMSSSNVNSKVSSSDYLSRHSSWLVNLLSADETNEQQIRVAKDV  950

Query  2532  ---TANNAKQLGIIAEASARTRNAGHVVFSDVKHSVIDMER-QTLVSMPVILKTAIPEYQ  2699
                  +N +   +I     +  N+  VV SD +  V D+ R  + VS P  + +A+PE  
Sbjct  951   RWHVEHNTQAANMI-----KVENSNSVVPSDERLYVRDVPRLASTVSFPSRI-SAVPELD  1004

Query  2700  YIWQGGFEVQKSGKAFNLYDGIQAHLSSCASPKVLDAVNKFPRKVILNEVPRLSSWPMQF  2879
             YIWQGGFEV + G+  + Y GIQAHLS+CASPKVL+ V+  P K+IL EVPRLS+WP QF
Sbjct  1005  YIWQGGFEVHRIGRLSSHYTGIQAHLSTCASPKVLEVVHMLPPKIILEEVPRLSTWPAQF  1064

Query  2880  KECGVSEDNVALFFFAKDIGSYEKSYKVLLGDMVKHDLALQGNIGDIELLIFPSNQLPEK  3059
              E   +EDN+AL+FFA D+ SY ++YK LL  M+K+DLAL+GN+  IELLIF S  LPEK
Sbjct  1065  MENYATEDNIALYFFAADLESYGRNYKSLLEWMIKNDLALKGNLKGIELLIFSSKLLPEK  1124

Query  3060  FQRWNLMFFLWGVFRGKRANSLQNFP  3137
              QRWN + FLWGVFR +R N+ ++ P
Sbjct  1125  SQRWNALSFLWGVFRVRRVNNSEHVP  1150



>ref|XP_010663589.1| PREDICTED: uncharacterized protein LOC100243800 isoform X5 [Vitis 
vinifera]
Length=1447

 Score =   380 bits (975),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 294/823 (36%), Positives = 428/823 (52%), Gaps = 95/823 (12%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNE-----  1103
             CDICG  G E LLA C++C+DGAEH YCM+  LEK+P   W+CEEC   +E + E     
Sbjct  415   CDICGDAGLEELLATCTKCSDGAEHIYCMRIKLEKVPGRGWMCEECMAKEETQKEMKCTI  474

Query  1104  -HVNSGRVNEKEKTSPSRRTTIAKSDHPLKMEQKTSDCWGDKAVEERSYLKTSGKRCTDD  1280
               +    +N+  K S +  T+  K ++ L+ E   S     +     S  + S KR  D 
Sbjct  475   GFLKGSSLNQTRKNSGNSSTS--KFENFLEFESMDSTVSRSRTKSLDSAPQFSAKRPADS  532

Query  1281  SEVSSPTKRQRLELRSPTAQIP--NRVTSLSRESSFKNLERGKVKPLNPFSSGSFAA---  1445
              E    TK++ LE  +   ++P  ++   LS +SSF+NL +GKVK  +  S G  ++   
Sbjct  533   LETVPVTKKRTLETITRPTKVPSPHKKDILSWDSSFRNLCKGKVKQAHETSFGDNSSNNT  592

Query  1446  ---------------KVPSSTGPQPQPPRGIFSKSNSFSSLIAKPKVKLVDEVFPAKQKL  1580
                            K+P     Q Q  RG   KSNSF  L A  KVKL ++    KQK 
Sbjct  593   LQSACLPTVSDYKSQKIPQ----QLQMSRGSLLKSNSFHILDANLKVKLSEKAVLQKQKF  648

Query  1581  SRETAFIESKEVAVRSMGKSMSFKPTTASRSNCTESKVKMFSPKFSHDQDVKWLRHKKDR  1760
             +RET   + K+   R M KS+SF    +   N  +SKVKMFS  FSH +D+K LRH K  
Sbjct  649   TRETDTSDMKKGIGRMMSKSLSFNGVGSKHLNVAQSKVKMFSSNFSHVEDLKRLRHAK--  706

Query  1761  SSFDRKNSLRSDR------------LAGGAISSPKSDNKPTPRGEPS-SLSSLNTNRDYR  1901
                  +NSL+ D             +AG   S+P +D K   RGE   + SS  T  + R
Sbjct  707   -----QNSLQRDHKSKSYNPHMISPVAGSGDSAPTTDKKTASRGETVLAHSSGITCNELR  761

Query  1902  ALTSDNKPVTISNSTSGVAREVLK----QASVDGVS-SANRVSSSEENPS----------  2036
             ++         S  TS +A + LK    QA V G   SA  +S  +++PS          
Sbjct  762   SMQFHRNSNNSSEPTSRLAPKDLKCSHGQAGVSGAKRSALCLSDVDKDPSPRMSDSSHEP  821

Query  2037  ---QAIPKED-SSSSSCVAERPSWSSNEVLPDGLSQSKESKAFGDKTRE-SSASRSKQNS  2201
                + IP+   +SSSS    R + +   +L D  SQ+ +S    +++R   S S+ +   
Sbjct  822   KVNRGIPEVVLTSSSSLTINRHNCNPGAILQDQSSQTGKSSNQEEQSRVICSFSQPRLKI  881

Query  2202  TASGKIVSCQKCKGNGHLAQVCTADGPESSALGSPFKSSREATNGPSDLKAAIEAARLRK  2381
             +   +   C +CKG GH  + C     +   L +   +S+E  N  S +    +AA + K
Sbjct  882   SVGSRSAHCHRCKGIGHSRESCPTMSSQVPILDA--GNSKE-VNKSSKMGDVAKAAIVGK  938

Query  2382  PGICRKNRVADQSEDLS-ASNMKSEIASQDQMLS--STVRRNVNGAEEAQKQE-------  2531
               + +++R  +QS++LS +S+  +   S    LS  S+   N+  A+E  +Q+       
Sbjct  939   DELHKRSRCPNQSDELSMSSSNVNSKVSSSDYLSRHSSWLVNLLSADETNEQQIRVAKDV  998

Query  2532  ---TANNAKQLGIIAEASARTRNAGHVVFSDVKHSVIDMER-QTLVSMPVILKTAIPEYQ  2699
                  +N +   +I     +  N+  VV SD +  V D+ R  + VS P  + +A+PE  
Sbjct  999   RWHVEHNTQAANMI-----KVENSNSVVPSDERLYVRDVPRLASTVSFPSRI-SAVPELD  1052

Query  2700  YIWQGGFEVQKSGKAFNLYDGIQAHLSSCASPKVLDAVNKFPRKVILNEVPRLSSWPMQF  2879
             YIWQGGFEV + G+  + Y GIQAHLS+CASPKVL+ V+  P K+IL EVPRLS+WP QF
Sbjct  1053  YIWQGGFEVHRIGRLSSHYTGIQAHLSTCASPKVLEVVHMLPPKIILEEVPRLSTWPAQF  1112

Query  2880  KECGVSEDNVALFFFAKDIGSYEKSYKVLLGDMVKHDLALQGNIGDIELLIFPSNQLPEK  3059
              E   +EDN+AL+FFA D+ SY ++YK LL  M+K+DLAL+GN+  IELLIF S  LPEK
Sbjct  1113  MENYATEDNIALYFFAADLESYGRNYKSLLEWMIKNDLALKGNLKGIELLIFSSKLLPEK  1172

Query  3060  FQRWNLMFFLWGVFRGKRANSLQNFPGAEKPLIQDIPTPATSL  3188
              QRWN + FLWGVFR +R N+ ++ P +    ++ I +  TS 
Sbjct  1173  SQRWNALSFLWGVFRVRRVNNSEHVPTSHIQELRRINSGRTSF  1215



>ref|XP_010663585.1| PREDICTED: uncharacterized protein LOC100243800 isoform X4 [Vitis 
vinifera]
Length=1454

 Score =   379 bits (973),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 291/806 (36%), Positives = 421/806 (52%), Gaps = 95/806 (12%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNE-----  1103
             CDICG  G E LLA C++C+DGAEH YCM+  LEK+P   W+CEEC   +E + E     
Sbjct  387   CDICGDAGLEELLATCTKCSDGAEHIYCMRIKLEKVPGRGWMCEECMAKEETQKEMKCTI  446

Query  1104  -HVNSGRVNEKEKTSPSRRTTIAKSDHPLKMEQKTSDCWGDKAVEERSYLKTSGKRCTDD  1280
               +    +N+  K S +  T+  K ++ L+ E   S     +     S  + S KR  D 
Sbjct  447   GFLKGSSLNQTRKNSGNSSTS--KFENFLEFESMDSTVSRSRTKSLDSAPQFSAKRPADS  504

Query  1281  SEVSSPTKRQRLELRSPTAQIP--NRVTSLSRESSFKNLERGKVKPLNPFSSGSFAA---  1445
              E    TK++ LE  +   ++P  ++   LS +SSF+NL +GKVK  +  S G  ++   
Sbjct  505   LETVPVTKKRTLETITRPTKVPSPHKKDILSWDSSFRNLCKGKVKQAHETSFGDNSSNNT  564

Query  1446  ---------------KVPSSTGPQPQPPRGIFSKSNSFSSLIAKPKVKLVDEVFPAKQKL  1580
                            K+P     Q Q  RG   KSNSF  L A  KVKL ++    KQK 
Sbjct  565   LQSACLPTVSDYKSQKIPQ----QLQMSRGSLLKSNSFHILDANLKVKLSEKAVLQKQKF  620

Query  1581  SRETAFIESKEVAVRSMGKSMSFKPTTASRSNCTESKVKMFSPKFSHDQDVKWLRHKKDR  1760
             +RET   + K+   R M KS+SF    +   N  +SKVKMFS  FSH +D+K LRH K  
Sbjct  621   TRETDTSDMKKGIGRMMSKSLSFNGVGSKHLNVAQSKVKMFSSNFSHVEDLKRLRHAK--  678

Query  1761  SSFDRKNSLRSDR------------LAGGAISSPKSDNKPTPRGEPS-SLSSLNTNRDYR  1901
                  +NSL+ D             +AG   S+P +D K   RGE   + SS  T  + R
Sbjct  679   -----QNSLQRDHKSKSYNPHMISPVAGSGDSAPTTDKKTASRGETVLAHSSGITCNELR  733

Query  1902  ALTSDNKPVTISNSTSGVAREVLK----QASVDGVS-SANRVSSSEENPS----------  2036
             ++         S  TS +A + LK    QA V G   SA  +S  +++PS          
Sbjct  734   SMQFHRNSNNSSEPTSRLAPKDLKCSHGQAGVSGAKRSALCLSDVDKDPSPRMSDSSHEP  793

Query  2037  ---QAIPKED-SSSSSCVAERPSWSSNEVLPDGLSQSKESKAFGDKTRE-SSASRSKQNS  2201
                + IP+   +SSSS    R + +   +L D  SQ+ +S    +++R   S S+ +   
Sbjct  794   KVNRGIPEVVLTSSSSLTINRHNCNPGAILQDQSSQTGKSSNQEEQSRVICSFSQPRLKI  853

Query  2202  TASGKIVSCQKCKGNGHLAQVCTADGPESSALGSPFKSSREATNGPSDLKAAIEAARLRK  2381
             +   +   C +CKG GH  + C     +   L +   +S+E  N  S +    +AA + K
Sbjct  854   SVGSRSAHCHRCKGIGHSRESCPTMSSQVPILDA--GNSKEV-NKSSKMGDVAKAAIVGK  910

Query  2382  PGICRKNRVADQSEDLS-ASNMKSEIASQDQMLS--STVRRNVNGAEEAQKQE-------  2531
               + +++R  +QS++LS +S+  +   S    LS  S+   N+  A+E  +Q+       
Sbjct  911   DELHKRSRCPNQSDELSMSSSNVNSKVSSSDYLSRHSSWLVNLLSADETNEQQIRVAKDV  970

Query  2532  ---TANNAKQLGIIAEASARTRNAGHVVFSDVKHSVIDMER-QTLVSMPVILKTAIPEYQ  2699
                  +N +   +I     +  N+  VV SD +  V D+ R  + VS P  + +A+PE  
Sbjct  971   RWHVEHNTQAANMI-----KVENSNSVVPSDERLYVRDVPRLASTVSFPSRI-SAVPELD  1024

Query  2700  YIWQGGFEVQKSGKAFNLYDGIQAHLSSCASPKVLDAVNKFPRKVILNEVPRLSSWPMQF  2879
             YIWQGGFEV + G+  + Y GIQAHLS+CASPKVL+ V+  P K+IL EVPRLS+WP QF
Sbjct  1025  YIWQGGFEVHRIGRLSSHYTGIQAHLSTCASPKVLEVVHMLPPKIILEEVPRLSTWPAQF  1084

Query  2880  KECGVSEDNVALFFFAKDIGSYEKSYKVLLGDMVKHDLALQGNIGDIELLIFPSNQLPEK  3059
              E   +EDN+AL+FFA D+ SY ++YK LL  M+K+DLAL+GN+  IELLIF S  LPEK
Sbjct  1085  MENYATEDNIALYFFAADLESYGRNYKSLLEWMIKNDLALKGNLKGIELLIFSSKLLPEK  1144

Query  3060  FQRWNLMFFLWGVFRGKRANSLQNFP  3137
              QRWN + FLWGVFR +R N+ ++ P
Sbjct  1145  SQRWNALSFLWGVFRVRRVNNSEHVP  1170



>ref|XP_010663573.1| PREDICTED: uncharacterized protein LOC100243800 isoform X1 [Vitis 
vinifera]
Length=1482

 Score =   379 bits (972),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 291/806 (36%), Positives = 421/806 (52%), Gaps = 95/806 (12%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNE-----  1103
             CDICG  G E LLA C++C+DGAEH YCM+  LEK+P   W+CEEC   +E + E     
Sbjct  415   CDICGDAGLEELLATCTKCSDGAEHIYCMRIKLEKVPGRGWMCEECMAKEETQKEMKCTI  474

Query  1104  -HVNSGRVNEKEKTSPSRRTTIAKSDHPLKMEQKTSDCWGDKAVEERSYLKTSGKRCTDD  1280
               +    +N+  K S +  T+  K ++ L+ E   S     +     S  + S KR  D 
Sbjct  475   GFLKGSSLNQTRKNSGNSSTS--KFENFLEFESMDSTVSRSRTKSLDSAPQFSAKRPADS  532

Query  1281  SEVSSPTKRQRLELRSPTAQIP--NRVTSLSRESSFKNLERGKVKPLNPFSSGSFAA---  1445
              E    TK++ LE  +   ++P  ++   LS +SSF+NL +GKVK  +  S G  ++   
Sbjct  533   LETVPVTKKRTLETITRPTKVPSPHKKDILSWDSSFRNLCKGKVKQAHETSFGDNSSNNT  592

Query  1446  ---------------KVPSSTGPQPQPPRGIFSKSNSFSSLIAKPKVKLVDEVFPAKQKL  1580
                            K+P     Q Q  RG   KSNSF  L A  KVKL ++    KQK 
Sbjct  593   LQSACLPTVSDYKSQKIPQ----QLQMSRGSLLKSNSFHILDANLKVKLSEKAVLQKQKF  648

Query  1581  SRETAFIESKEVAVRSMGKSMSFKPTTASRSNCTESKVKMFSPKFSHDQDVKWLRHKKDR  1760
             +RET   + K+   R M KS+SF    +   N  +SKVKMFS  FSH +D+K LRH K  
Sbjct  649   TRETDTSDMKKGIGRMMSKSLSFNGVGSKHLNVAQSKVKMFSSNFSHVEDLKRLRHAK--  706

Query  1761  SSFDRKNSLRSDR------------LAGGAISSPKSDNKPTPRGEPS-SLSSLNTNRDYR  1901
                  +NSL+ D             +AG   S+P +D K   RGE   + SS  T  + R
Sbjct  707   -----QNSLQRDHKSKSYNPHMISPVAGSGDSAPTTDKKTASRGETVLAHSSGITCNELR  761

Query  1902  ALTSDNKPVTISNSTSGVAREVLK----QASVDGVS-SANRVSSSEENPS----------  2036
             ++         S  TS +A + LK    QA V G   SA  +S  +++PS          
Sbjct  762   SMQFHRNSNNSSEPTSRLAPKDLKCSHGQAGVSGAKRSALCLSDVDKDPSPRMSDSSHEP  821

Query  2037  ---QAIPKED-SSSSSCVAERPSWSSNEVLPDGLSQSKESKAFGDKTRE-SSASRSKQNS  2201
                + IP+   +SSSS    R + +   +L D  SQ+ +S    +++R   S S+ +   
Sbjct  822   KVNRGIPEVVLTSSSSLTINRHNCNPGAILQDQSSQTGKSSNQEEQSRVICSFSQPRLKI  881

Query  2202  TASGKIVSCQKCKGNGHLAQVCTADGPESSALGSPFKSSREATNGPSDLKAAIEAARLRK  2381
             +   +   C +CKG GH  + C     +   L +   +S+E  N  S +    +AA + K
Sbjct  882   SVGSRSAHCHRCKGIGHSRESCPTMSSQVPILDA--GNSKE-VNKSSKMGDVAKAAIVGK  938

Query  2382  PGICRKNRVADQSEDLS-ASNMKSEIASQDQMLS--STVRRNVNGAEEAQKQE-------  2531
               + +++R  +QS++LS +S+  +   S    LS  S+   N+  A+E  +Q+       
Sbjct  939   DELHKRSRCPNQSDELSMSSSNVNSKVSSSDYLSRHSSWLVNLLSADETNEQQIRVAKDV  998

Query  2532  ---TANNAKQLGIIAEASARTRNAGHVVFSDVKHSVIDMER-QTLVSMPVILKTAIPEYQ  2699
                  +N +   +I     +  N+  VV SD +  V D+ R  + VS P  + +A+PE  
Sbjct  999   RWHVEHNTQAANMI-----KVENSNSVVPSDERLYVRDVPRLASTVSFPSRI-SAVPELD  1052

Query  2700  YIWQGGFEVQKSGKAFNLYDGIQAHLSSCASPKVLDAVNKFPRKVILNEVPRLSSWPMQF  2879
             YIWQGGFEV + G+  + Y GIQAHLS+CASPKVL+ V+  P K+IL EVPRLS+WP QF
Sbjct  1053  YIWQGGFEVHRIGRLSSHYTGIQAHLSTCASPKVLEVVHMLPPKIILEEVPRLSTWPAQF  1112

Query  2880  KECGVSEDNVALFFFAKDIGSYEKSYKVLLGDMVKHDLALQGNIGDIELLIFPSNQLPEK  3059
              E   +EDN+AL+FFA D+ SY ++YK LL  M+K+DLAL+GN+  IELLIF S  LPEK
Sbjct  1113  MENYATEDNIALYFFAADLESYGRNYKSLLEWMIKNDLALKGNLKGIELLIFSSKLLPEK  1172

Query  3060  FQRWNLMFFLWGVFRGKRANSLQNFP  3137
              QRWN + FLWGVFR +R N+ ++ P
Sbjct  1173  SQRWNALSFLWGVFRVRRVNNSEHVP  1198



>ref|XP_006408368.1| hypothetical protein EUTSA_v10020044mg [Eutrema salsugineum]
 gb|ESQ49821.1| hypothetical protein EUTSA_v10020044mg [Eutrema salsugineum]
Length=865

 Score =   364 bits (935),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 276/741 (37%), Positives = 384/741 (52%), Gaps = 135/741 (18%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNEHVNSG  1118
             CDICG  GRE LLAICSRC+DGAEHTYCM+ +L+K+PEGDWLCEECK  +E + +   +G
Sbjct  232   CDICGDAGREDLLAICSRCSDGAEHTYCMRVVLKKVPEGDWLCEECKLAEEAETKKTETG  291

Query  1119  RVNEKEKTSPSRRTTIAKSDHPLKMEQKTSDCWGDKAVEERSYLKTSGKRCTDDSEVSSP  1298
              VN                                         ++SGKR  D  EV+  
Sbjct  292   -VNLN--------------------------------------TQSSGKRHIDKLEVAPN  312

Query  1299  TKRQRLE--LRSPTAQIPNRVTSLSRESSFKNLERGKVK-PLNPFSSGSFAAKVPS--ST  1463
              KRQ +E    SP   +P R+++LSRE+SFK LE+   K   +P  +  F+    S  ST
Sbjct  313   AKRQAVEAPTGSPKRPVPPRLSALSRETSFKGLEKTTRKLSHHPSFNSHFSDDTESTRST  372

Query  1464  GPQPQPPRGIFSKSNSFSSLIAKPKVKLVDEVFPAKQKLSRETAFIESKEVAVRSMGKSM  1643
               Q Q P+G F KSNSF+S  ++PKV+ VD+    +QK+ +E A +  KE   R +GKS 
Sbjct  373   DSQLQSPKGSFIKSNSFNSSSSRPKVRPVDDDMLLRQKIGKENASL-VKEGFSRIVGKST  431

Query  1644  SFKPTTASRSNCTESKVKMFSPKFSHDQDVKWLRHKKDRSSFDRKNSLRSDRLAGGAISS  1823
             S +      S+C +SKVK               +  KDRS+                 S+
Sbjct  432   SARCIGVGSSSCKDSKVK-------------GSKQLKDRST-------------EANPSA  465

Query  1824  PKSDNKPTPRGEPSSLSSLNTNRDYRALTSDNKPVTISNSTSGVAREVLKQASVDGVSSA  2003
                D +   RG  SS+S  N  RD + + SD K  ++       ++  L+     G  S 
Sbjct  466   STVDQQLISRGH-SSISYANNARDLQGMQSDGKQGSLKKQARHRSQNRLEDIVASGTIST  524

Query  2004  NRVSSSEENPSQAIPKEDSSSSSCVAERPSWSSNEVLPDGLSQSKESKAFGDKTRESSAS  2183
                SSS E  S    ++D  +                 DGLS+S+E +  G+K++++   
Sbjct  525   ISKSSSSEQISSEAKRKDELADV---------------DGLSRSREFREAGEKSKDA---  566

Query  2184  RSKQNSTASGKIVSCQKCKGNGHLAQVCTADGPESSALGSPFKSSREATNGPSDLKAAIE  2363
                        + +CQ                   S L S  ++ RE  N  + L+AA++
Sbjct  567   -----------VGNCQ-------------------SNL-STTRNIREDINKGNRLRAAVD  595

Query  2364  AARLRKPGICRKNRVADQSEDLSASNMKSEIASQDQMLSSTVRR------NVNGAE---E  2516
             AA  RKP    KNR  +QS+  S SN+ S      Q   S V         + G      
Sbjct  596   AALRRKPSFG-KNRGLEQSDLPSVSNVDSSCDKTIQNFPSKVPVVRDWPVGLQGGHPNIR  654

Query  2517  AQKQETANNAKQLGII-AEASARTRNAGHVV-FSDVKHSVIDMERQTLVSMPVILKTAIP  2690
               KQ  A N KQ  +  A+A A +++A  VV  + VK  + D+      ++P    +AIP
Sbjct  655   THKQTVAVNGKQFTLSDADAMAASQSAETVVHLTSVKPVMRDLPVVAPSALPTT--SAIP  712

Query  2691  EYQYIWQGGFEVQKSGKAFNLYDGIQAHLSSCASPKVLDAVNKFPRKVILNEVPRLSSWP  2870
             E++YIWQG  EVQK+     +Y G+QA+LS+ ASPKV++ VN+FP KVILNEVPRLS+WP
Sbjct  713   EHEYIWQGDMEVQKNRNLSAMYCGMQAYLSTLASPKVVELVNQFPVKVILNEVPRLSTWP  772

Query  2871  MQFKECGVSEDNVALFFFAKDIGSYEKSYKVLLGDMVKHDLALQGNIGDIELLIFPSNQL  3050
              QF++ GV ED+VALFFF KD  SYEK+YK L+ +M++ D+AL+GN+  +ELLIF SNQL
Sbjct  773   AQFQDIGVKEDHVALFFFPKDNESYEKNYKPLVDNMIQKDVALKGNLEGVELLIFASNQL  832

Query  3051  PEKFQRWNLMFFLWGVFRGKR  3113
             P+  QRWN+ FFLWGVFRGK+
Sbjct  833   PQNCQRWNMFFFLWGVFRGKK  853



>emb|CDX69433.1| BnaA10g17820D [Brassica napus]
Length=1152

 Score =   370 bits (950),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 263/733 (36%), Positives = 375/733 (51%), Gaps = 134/733 (18%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNEHVNSG  1118
             CDICG  GRE LLAIC+ C+DGAEHTYCM+ ML ++PEGDWLCEEC+             
Sbjct  215   CDICGDAGREDLLAICTGCSDGAEHTYCMRVMLNEVPEGDWLCEECE-------------  261

Query  1119  RVNEKEKTSPSRRTTIAKSDHPLKMEQKTSDCWGDKAVEERSYLKTSGKRCTDDSEVSSP  1298
                EK+K    R+        P                      ++SGKR  D  E +  
Sbjct  262   -EAEKQKQEAKRKIETEIIHSP----------------------QSSGKRHADKIEAAPD  298

Query  1299  TKRQRLE--LRSPTAQIPNRVTSLSRESSFKNLER--GKVKPLNPFSSGSFAAKVPSSTG  1466
              KRQ +E    SP   I  R+  LSRE+S K L+R  GK+     FS  +  A+   STG
Sbjct  299   AKRQAVEGSTGSPKKSILPRIGPLSRETSLKGLDRPRGKLSHQASFSDTTEGAR---STG  355

Query  1467  PQPQPPRGIFSKSNSFSSLIAKPKVKLVDEVFPAKQKLSRETAFIESKEVAVRSMGKSMS  1646
              Q QPP+G F KS+SF+S  +KPKV+L+D+V   ++K  +E   ++ KE  +  + KSMS
Sbjct  356   LQLQPPKGAFLKSSSFNSSSSKPKVQLMDDVILPRKKTGKEYTPVDIKEGGLGIVSKSMS  415

Query  1647  FKPTTASRSNCTESKVKMFSPKFSHDQDVKWLRHKKDRSSFDRKNSLRSDRLAGGAISSP  1826
              + T    S+  +S+ K  + K             KDRS+    N+L           + 
Sbjct  416   SRTTDTGSSSGNDSEAKTLASK-----------QLKDRSA--EANAL-----------AA  451

Query  1827  KSDNKPTPRGEPSSLSSLNTNRDYRALTSDNKPVTISNSTSGVAREVLKQASVDGVSSAN  2006
              +D K TPR         +  RD + L SD K  +++   S + R  L+     G++ + 
Sbjct  452   STDQKLTPR---------SNTRDLKGLQSDGKRGSLTKQVSNLNRNRLENPIASGITDS-  501

Query  2007  RVSSSEENPSQAIPKEDSSSSSCVAERPSWSSNEVLPDGLSQSKESKAFGDKTRESSASR  2186
                           K++ +S+SC  E    + N    DGL +S+E K    K++E+   R
Sbjct  502   --------------KDELTSTSCAGEGVPSNGNVTSQDGLPRSREFKEVVKKSKEALGKR  547

Query  2187  SKQNSTASGKIVSCQKCKGNGHLAQVCTADGPESSALGSPFKSSREATNGPSDLKAAIEA  2366
                 ST   KIV                                RE  N  + L+AA++A
Sbjct  548   QSDPSTT--KIV--------------------------------REDINKGNRLRAAVDA  573

Query  2367  ARLRKPGICRKNRVADQSEDLSASNM--KSEIASQDQMLSSTVRRNVNGAEEAQKQETAN  2540
             A  +KP    KNRV +Q +   ASN+   S+   +DQ L S +      A +  KQ    
Sbjct  574   ALRKKPSFS-KNRVLEQCDAALASNVPSNSDKTLRDQ-LPSKMHTTSWPAPDPYKQTIVT  631

Query  2541  NAKQLGIIAEASARTRNAGHVVFSDVKHSVIDMERQTLVSMPVIL--KTAIPEYQYIWQG  2714
             N KQL      +   R+    V       V+   R   ++ P+ L   +AIP+++ IWQG
Sbjct  632   NGKQLVPSGADAMPPRSVELEVNPPFVKPVM---RDWPLASPLALLRSSAIPDHESIWQG  688

Query  2715  GFEVQKSGKAFNLYDGIQAHLSSCASPKVLDAVNKFPRKVILNEVPRLSSWPMQFKECGV  2894
               EV+K+ +   ++ G+QAHLS+ ASPKV + VNKFP K  LNEVPRLS+WP QF++ G 
Sbjct  689   NLEVRKAREQSAMHSGMQAHLSTLASPKVAEVVNKFPEKFSLNEVPRLSTWPAQFQDIGT  748

Query  2895  SEDNVALFFFAKDIGSYEKSYKVLLGDMVKHDLALQGNIGDIELLIFPSNQLPEKFQRWN  3074
              ED++ALFFFAKD+ SYE++YK L+ +M+K DLAL+GN+ ++ELL+F SNQLP   QRWN
Sbjct  749   KEDHIALFFFAKDVESYERNYKPLVDNMMKKDLALKGNLDNVELLVFASNQLPPNCQRWN  808

Query  3075  LMFFLWGVFRGKR  3113
             +++FLWGVFRG++
Sbjct  809   MLYFLWGVFRGRK  821



>ref|NP_186939.2| RING/FYVE/PHD zinc finger-related protein [Arabidopsis thaliana]
 gb|AEE73875.1| RING/FYVE/PHD zinc finger-related protein [Arabidopsis thaliana]
Length=994

 Score =   366 bits (939),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 277/776 (36%), Positives = 385/776 (50%), Gaps = 151/776 (19%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNEHVNSG  1118
             CD CG  GRE LLAICSRC+DGAEHTYCM+ ML+K+P+G WLCEECKF ++ +   + + 
Sbjct  215   CDTCGDAGREDLLAICSRCSDGAEHTYCMRVMLKKVPKGYWLCEECKFAEKAEKHKLETK  274

Query  1119  RVNEKEKTSPSRRTTIAKSDHPLKMEQKTSDCWGDKAVEERSYLKTSGKRCTDDSEVSSP  1298
             R  E E       T I+   H  K E          AV +   L                
Sbjct  275   RKRESEVNV---NTQISSKRHIDKFE----------AVPDSKRLAVGA------------  309

Query  1299  TKRQRLELRSPTAQIPNRVTSLSRESSFKNLER--GKVKPLNPFSS-GSFAAKVPSSTGP  1469
                   ++ SP   +  R+++LSRE+SFK LE+   K+   + F+S  S   +   ST  
Sbjct  310   ------QIGSPKRSVLPRMSTLSRETSFKGLEKPTRKLAHYSSFNSHSSDDTESTRSTDS  363

Query  1470  QPQPPRGIFSKSNSFSSLIAKPKVKLVDEVFPAKQKLSRETAFIESKEVAVRSMGKSMSF  1649
             Q Q P+G F KSNSF+SL ++ KV+ VD+    +QK   E + +E KE   +++GKSMS 
Sbjct  364   QLQSPKGSFLKSNSFNSLSSRSKVRPVDDDMLPRQKTGNENSSLEVKEGFSKNVGKSMSS  423

Query  1650  KPTTASRSNCTESKVKMFSPKFSHDQDVKWLRHKKDRSSFDRKNSLRSDRLAGGAISSPK  1829
             +      SNC +SKVK         Q   W       +S  R NS               
Sbjct  424   RCIDVGSSNCNDSKVK------GSKQLKDWSTEANPSASISRGNS---------------  462

Query  1830  SDNKPTPRGEPSSLSSLNTNRDYRALTSDNKPVTISNSTSGVAREVLKQ--ASVDGVSSA  2003
                         S+    + RD + L SD K  ++S     ++R  L+   ASV   S  
Sbjct  463   ------------SIPYAKSPRDLKDLQSDGKQGSLSKQARHLSRNRLEDIVASVGDSSKN  510

Query  2004  NRVSSSEENPSQAIPKEDSSSSSCVAERPSWSSNEVLPDGLSQSKESKAFGDKTRESSAS  2183
              + SSSE+  S+A  K++ +                  DG+ +S+E +  G+KT+++  +
Sbjct  511   EKCSSSEQISSEAKCKDELAQV----------------DGVPRSREFREAGEKTKDAVGN  554

Query  2184  RSKQNSTASGKIVSCQKCKGNGHLAQVCTADGPESSALGSPFKSSREATNGPSDLKAAIE  2363
               K+N                                +G       E  N  + L+AA++
Sbjct  555   HQKRN--------------------------------IG-------EDNNKGNRLRAAVD  575

Query  2364  AARLRKPGICRKNRVADQSEDLSASNMKSEIASQDQMLSSTV---------RRNVNGAE-  2513
             AA  +KP    KNR  +QS+    SN+ S      + LSS V          + + G   
Sbjct  576   AALRKKPSF-SKNRGLEQSDLPPVSNVDSGCNKALKCLSSKVPVIRDWPVGFQGLPGGHP  634

Query  2514  --EAQKQETANNAKQLGIIAEASARTRNAGHVVFSDVKH-SVIDMERQTLVSMPVILKT-  2681
                  KQ    N KQ   +A   A T  A   V  +V   SV  + R   V+ P +L T 
Sbjct  635   NLRTDKQTNTVNEKQF-TLAGTDATT--ASQSVEPEVNDPSVQSVMRDLPVAAPNVLSTT  691

Query  2682  -AIPEYQYIWQGGFEVQKSGKAFNLYDGIQAHLSSCASPKVLDAVNKFPRKVILNEVPRL  2858
              AIP+ +YIWQG  EVQKS     ++ GIQA+LS+ ASPKV++ V +FP KV LNEVPRL
Sbjct  692   SAIPKPEYIWQGDLEVQKSRNLSAMHSGIQAYLSTLASPKVVEVVKQFPEKVTLNEVPRL  751

Query  2859  SSWPMQFKECGVSEDNVALFFFAKDIGSYEKSYKVLLGDMVKHDLALQGNIGDIELLIFP  3038
             SSWP QF++ G  E +VALFFFAKDI SYEK+YK L+ +M++ DLAL+GN+  +ELLIF 
Sbjct  752   SSWPAQFQDTGAKEQHVALFFFAKDIESYEKNYKPLVDNMIQKDLALKGNLEGVELLIFA  811

Query  3039  SNQLPEKFQRWNLMFFLWGVFRGKRANSLQNFPGAEKPLIQDIPTPATSLPENMFT  3206
             SNQLP+  QRWN++FFLWGVFRGK+  S  N P       ++ P PA+ +  N  T
Sbjct  812   SNQLPQDCQRWNMLFFLWGVFRGKK-ESCSNPP-------KNTPLPASCVSPNRDT  859



>ref|XP_010663582.1| PREDICTED: uncharacterized protein LOC100243800 isoform X3 [Vitis 
vinifera]
Length=1455

 Score =   373 bits (957),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 287/792 (36%), Positives = 412/792 (52%), Gaps = 94/792 (12%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNE-----  1103
             CDICG  G E LLA C++C+DGAEH YCM+  LEK+P   W+CEEC   +E + E     
Sbjct  415   CDICGDAGLEELLATCTKCSDGAEHIYCMRIKLEKVPGRGWMCEECMAKEETQKEMKCTI  474

Query  1104  -HVNSGRVNEKEKTSPSRRTTIAKSDHPLKMEQKTSDCWGDKAVEERSYLKTSGKRCTDD  1280
               +    +N+  K S +  T+  K ++ L+ E   S     +     S  + S KR  D 
Sbjct  475   GFLKGSSLNQTRKNSGNSSTS--KFENFLEFESMDSTVSRSRTKSLDSAPQFSAKRPADS  532

Query  1281  SEVSSPTKRQRLELRSPTAQIP--NRVTSLSRESSFKNLERGKVKPLNPFSSGSFAA---  1445
              E    TK++ LE  +   ++P  ++   LS +SSF+NL +GKVK  +  S G  ++   
Sbjct  533   LETVPVTKKRTLETITRPTKVPSPHKKDILSWDSSFRNLCKGKVKQAHETSFGDNSSNNT  592

Query  1446  ---------------KVPSSTGPQPQPPRGIFSKSNSFSSLIAKPKVKLVDEVFPAKQKL  1580
                            K+P     Q Q  RG   KSNSF  L A  KVKL ++    KQK 
Sbjct  593   LQSACLPTVSDYKSQKIPQ----QLQMSRGSLLKSNSFHILDANLKVKLSEKAVLQKQKF  648

Query  1581  SRETAFIESKEVAVRSMGKSMSFKPTTASRSNCTESKVKMFSPKFSHDQDVKWLRHKKDR  1760
             +RET   + K+   R M KS+SF    +   N  +SKVKMFS  FSH +D+K LRH K  
Sbjct  649   TRETDTSDMKKGIGRMMSKSLSFNGVGSKHLNVAQSKVKMFSSNFSHVEDLKRLRHAK--  706

Query  1761  SSFDRKNSLRSDR------------LAGGAISSPKSDNKPTPRGEPS-SLSSLNTNRDYR  1901
                  +NSL+ D             +AG   S+P +D K   RGE   + SS  T  + R
Sbjct  707   -----QNSLQRDHKSKSYNPHMISPVAGSGDSAPTTDKKTASRGETVLAHSSGITCNELR  761

Query  1902  ALTSDNKPVTISNSTSGVAREVLK----QASVDGVS-SANRVSSSEENPSQAIPKEDSSS  2066
             ++         S  TS +A + LK    QA V G   SA  +S  +++PS   P+   SS
Sbjct  762   SMQFHRNSNNSSEPTSRLAPKDLKCSHGQAGVSGAKRSALCLSDVDKDPS---PRMSDSS  818

Query  2067  SSCVAERPSWSSNEVLPDGLSQSKESKAFGDKTRE-SSASRSKQNSTASGKIVSCQKCKG  2243
                   R          D  SQ+ +S    +++R   S S+ +   +   +   C +CKG
Sbjct  819   HEPKVNR----------DQSSQTGKSSNQEEQSRVICSFSQPRLKISVGSRSAHCHRCKG  868

Query  2244  NGHLAQVCTADGPESSALGSPFKSSREATNGPSDLKAAIEAARLRKPGICRKNRVADQSE  2423
              GH  + C     +   L +   +S+E  N  S +    +AA + K  + +++R  +QS+
Sbjct  869   IGHSRESCPTMSSQVPILDA--GNSKE-VNKSSKMGDVAKAAIVGKDELHKRSRCPNQSD  925

Query  2424  DLS-ASNMKSEIASQDQMLS--STVRRNVNGAEEAQKQE----------TANNAKQLGII  2564
             +LS +S+  +   S    LS  S+   N+  A+E  +Q+            +N +   +I
Sbjct  926   ELSMSSSNVNSKVSSSDYLSRHSSWLVNLLSADETNEQQIRVAKDVRWHVEHNTQAANMI  985

Query  2565  AEASARTRNAGHVVFSDVKHSVIDMER-QTLVSMPVILKTAIPEYQYIWQGGFEVQKSGK  2741
                  +  N+  VV SD +  V D+ R  + VS P  + +A+PE  YIWQGGFEV + G+
Sbjct  986   -----KVENSNSVVPSDERLYVRDVPRLASTVSFPSRI-SAVPELDYIWQGGFEVHRIGR  1039

Query  2742  AFNLYDGIQAHLSSCASPKVLDAVNKFPRKVILNEVPRLSSWPMQFKECGVSEDNVALFF  2921
               + Y GIQAHLS+CASPKVL+ V+  P K+IL EVPRLS+WP QF E   +EDN+AL+F
Sbjct  1040  LSSHYTGIQAHLSTCASPKVLEVVHMLPPKIILEEVPRLSTWPAQFMENYATEDNIALYF  1099

Query  2922  FAKDIGSYEKSYKVLLGDMVKHDLALQGNIGDIELLIFPSNQLPEKFQRWNLMFFLWGVF  3101
             FA D+ SY ++YK LL  M+K+DLAL+GN+  IELLIF S  LPEK QRWN + FLWGVF
Sbjct  1100  FAADLESYGRNYKSLLEWMIKNDLALKGNLKGIELLIFSSKLLPEKSQRWNALSFLWGVF  1159

Query  3102  RGKRANSLQNFP  3137
             R +R N+ ++ P
Sbjct  1160  RVRRVNNSEHVP  1171



>emb|CAN64336.1| hypothetical protein VITISV_001809 [Vitis vinifera]
Length=1953

 Score =   369 bits (948),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 282/773 (36%), Positives = 401/773 (52%), Gaps = 84/773 (11%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNE-----  1103
             CDICG  G E LLA C++C+DGAEH YCM+  LEK+P   W+CEEC   +E + E     
Sbjct  940   CDICGDAGLEELLATCTKCSDGAEHIYCMRIKLEKVPGRGWMCEECMAKEETQKEMKCTI  999

Query  1104  -HVNSGRVNEKEKTSPSRRTTIAKSDHPLKMEQKTSDCWGDKAVEERSYLKTSGKRCTDD  1280
               +    +N+  K S +  T+  K ++ L+ E   S     +     S  + S KR  D 
Sbjct  1000  GFLKGSSLNQTRKNSGNSSTS--KFENFLEFESMDSTVSRSRTKSLDSAPQFSAKRPADS  1057

Query  1281  SEVSSPTKRQRLELRSPTAQIP--NRVTSLSRESSFKNLERGKVKPLNPFSSGSFAAK--  1448
              E    TK++ LE  +   ++P  ++   LSR+SSF+NL +GKVK  +  S G  ++   
Sbjct  1058  LETVPVTKKRTLETITRPTKVPSPHKKDILSRDSSFRNLCKGKVKQAHETSFGDNSSNNT  1117

Query  1449  VPSSTGP------------QPQPPRGIFSKSNSFSSLIAKPKVKLVDEVFPAKQKLSRET  1592
             + S+  P            Q Q  RG   KSNSF  L A  KVKL ++    KQK +RET
Sbjct  1118  LQSACLPTVSDYKSQKIPQQLQMSRGSLLKSNSFHILDANLKVKLPEKAVLQKQKFTRET  1177

Query  1593  AFIESKEVAVRSMGKSMSFKPTTASRSNCTESKVKMFSPKFSHDQDVKWLRHKKDRSSFD  1772
                  K+   R M KS+SF    +   N  +SKVKMFS  FSH +D+K LRH K      
Sbjct  1178  DTSNMKKGIGRMMSKSLSFNGVGSKHLNVAQSKVKMFSCNFSHVEDLKRLRHAK------  1231

Query  1773  RKNSLRSDR------------LAGGAISSPKSDNKPTPRGEPSSLSSLNTNRDYRALTSD  1916
              +NSL+ D             +AG   S+P +D K   RGE                   
Sbjct  1232  -QNSLQRDHKSKSYNPHMISPVAGSGDSAPTTDKKTASRGE-------------------  1271

Query  1917  NKPVTISNSTSGVAREVLKQASVDGVSSANRVSSSEENP--SQAIPKED-SSSSSCVAER  2087
                 T     SG  R  L  + VD   S  R+S S   P  ++ IP+   +SSSS    R
Sbjct  1272  ----TWLAGVSGAKRSALCLSDVDKDPSP-RMSDSSHEPKLNRGIPEVVLTSSSSLTINR  1326

Query  2088  PSWSSNEVLPDGLSQSKESKAFGDKTRE-SSASRSKQNSTASGKIVSCQKCKGNGHLAQV  2264
              + +   +L D  SQ+ +S    +++R   S S+ +   +   +   C +CKG GH  + 
Sbjct  1327  HNCNPGAILQDQSSQTGKSSNQEEQSRVICSFSQPRLKISVGSRSAHCHRCKGIGHSRES  1386

Query  2265  CTADGPESSALGSPFKSSREATNGPSDLKAAIEAARLRKPGICRKNRVADQSEDLS-ASN  2441
             C     +   L +   +S+E  N  S +    +A  + K  + +++R  +QS++LS +S+
Sbjct  1387  CPTMSSQVPILDA--GNSKE-VNKSSKMGDVAKAXIVGKDELHKRSRCPNQSDELSMSSS  1443

Query  2442  MKSEIASQDQMLS--STVRRNVNGAEEAQKQE--TANNAK---QLGIIAEASARTRNAGH  2600
               +   S    LS  S+   N+  A+E   Q+   A + +   +    A    +  N+  
Sbjct  1444  NVNSKVSSSDYLSRHSSWLVNLFSADETNXQQIRVAKDVRWHVEHNTQAANMIKVENSNS  1503

Query  2601  VVFSDVKHSVIDMER-QTLVSMPVILKTAIPEYQYIWQGGFEVQKSGKAFNLYDGIQAHL  2777
             VV SD +  V D+ R  + VS P  + +A+PE  YIWQGGFEV + G+  + Y GIQAHL
Sbjct  1504  VVPSDERLYVRDVPRLASTVSFPSRI-SAVPELDYIWQGGFEVHRIGRLSSHYTGIQAHL  1562

Query  2778  SSCASPKVLDAVNKFPRKVILNEVPRLSSWPMQFKECGVSEDNVALFFFAKDIGSYEKSY  2957
             S+CASPKVL+ V+  P K+IL EVPRLS+WP QF E   +EDN+AL+FFA D+ SY ++Y
Sbjct  1563  STCASPKVLEVVHMLPPKIILEEVPRLSTWPAQFXENYATEDNIALYFFAADLESYGRNY  1622

Query  2958  KVLLGDMVKHDLALQGNIGDIELLIFPSNQLPEKFQRWNLMFFLWGVFRGKRA  3116
             K LL  M+K+DLAL+GN+  IELLIF S  LPEK QRWN + FLWGVFR +R 
Sbjct  1623  KSLLEWMIKNDLALKGNLKGIELLIFSSKLLPEKSQRWNALSFLWGVFRVRRV  1675



>gb|AAF26970.1|AC018363_15 unknown protein [Arabidopsis thaliana]
Length=963

 Score =   356 bits (914),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 275/775 (35%), Positives = 378/775 (49%), Gaps = 170/775 (22%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNEHVNSG  1118
             CD CG  GRE LLAICSRC+DGAEHTYCM+ ML+K+P+G WLCEECKF ++ +   + + 
Sbjct  205   CDTCGDAGREDLLAICSRCSDGAEHTYCMRVMLKKVPKGYWLCEECKFAEKAEKHKLETK  264

Query  1119  RVNEKEKTSPSRRTTIAKSDHPLKMEQKTSDCWGDKAVEERSYLKTSGKRCTDDSEVSSP  1298
             R  E E       T I+   H  K E          AV +   L                
Sbjct  265   RKRESEVNV---NTQISSKRHIDKFE----------AVPDSKRLAVGA------------  299

Query  1299  TKRQRLELRSPTAQIPNRVTSLSRESSFKNLER--GKVKPLNPFSS-GSFAAKVPSSTGP  1469
                   ++ SP   +  R+++LSRE+SFK LE+   K+   + F+S  S   +   ST  
Sbjct  300   ------QIGSPKRSVLPRMSTLSRETSFKGLEKPTRKLAHYSSFNSHSSDDTESTRSTDS  353

Query  1470  QPQPPRGIFSKSNSFSSLIAKPKVKLVDEVFPAKQKLSRETAFIESKEVAVRSMGKSMSF  1649
             Q Q P+G F KSNSF+SL ++ KV+ VD+    +QK   E + +E KE   +++GKSMS 
Sbjct  354   QLQSPKGSFLKSNSFNSLSSRSKVRPVDDDMLPRQKTGNENSSLEVKEGFSKNVGKSMSS  413

Query  1650  KPTTASRSNCTESKVKMFSPKFSHDQDVKWLRHKKDRSSFDRKNSLRSDRLAGGAISSPK  1829
             +      SNC +SKVK         Q   W       +S  R NS               
Sbjct  414   RCIDVGSSNCNDSKVK------GSKQLKDWSTEANPSASISRGNS---------------  452

Query  1830  SDNKPTPRGEPSSLSSLNTNRDYRALTSDNKPVTISNSTSGVAREVLKQASVDGVSSAN-  2006
                         S+    + RD + L SD K V                    G SS N 
Sbjct  453   ------------SIPYAKSPRDLKDLQSDGKQV--------------------GDSSKNE  480

Query  2007  RVSSSEENPSQAIPKEDSSSSSCVAERPSWSSNEVLPDGLSQSKESKAFGDKTRESSASR  2186
             + SSSE+  S+A  K++ +                  DG+ +S+E +  G+KT+++  + 
Sbjct  481   KCSSSEQISSEAKCKDELAQV----------------DGVPRSREFREAGEKTKDAVGNH  524

Query  2187  SKQNSTASGKIVSCQKCKGNGHLAQVCTADGPESSALGSPFKSSREATNGPSDLKAAIEA  2366
              K+N                                +G       E  N  + L+AA++A
Sbjct  525   QKRN--------------------------------IG-------EDNNKGNRLRAAVDA  545

Query  2367  ARLRKPGICRKNRVADQSEDLSASNMKSEIASQDQMLSSTV---------RRNVNGAE--  2513
             A  +KP    KNR  +QS+    SN+ S      + LSS V          + + G    
Sbjct  546   ALRKKPSF-SKNRGLEQSDLPPVSNVDSGCNKALKCLSSKVPVIRDWPVGFQGLPGGHPN  604

Query  2514  -EAQKQETANNAKQLGIIAEASARTRNAGHVVFSDVKH-SVIDMERQTLVSMPVILKT--  2681
                 KQ    N KQ   +A   A T  A   V  +V   SV  + R   V+ P +L T  
Sbjct  605   LRTDKQTNTVNEKQF-TLAGTDATT--ASQSVEPEVNDPSVQSVMRDLPVAAPNVLSTTS  661

Query  2682  AIPEYQYIWQGGFEVQKSGKAFNLYDGIQAHLSSCASPKVLDAVNKFPRKVILNEVPRLS  2861
             AIP+ +YIWQG  EVQKS     ++ GIQA+LS+ ASPKV++ V +FP KV LNEVPRLS
Sbjct  662   AIPKPEYIWQGDLEVQKSRNLSAMHSGIQAYLSTLASPKVVEVVKQFPEKVTLNEVPRLS  721

Query  2862  SWPMQFKECGVSEDNVALFFFAKDIGSYEKSYKVLLGDMVKHDLALQGNIGDIELLIFPS  3041
             SWP QF++ G  E +VALFFFAKDI SYEK+YK L+ +M++ DLAL+GN+  +ELLIF S
Sbjct  722   SWPAQFQDTGAKEQHVALFFFAKDIESYEKNYKPLVDNMIQKDLALKGNLEGVELLIFAS  781

Query  3042  NQLPEKFQRWNLMFFLWGVFRGKRANSLQNFPGAEKPLIQDIPTPATSLPENMFT  3206
             NQLP+  QRWN++FFLWGVFRGK+  S  N P       ++ P PA+ +  N  T
Sbjct  782   NQLPQDCQRWNMLFFLWGVFRGKK-ESCSNPP-------KNTPLPASCVSPNRDT  828



>ref|XP_009392779.1| PREDICTED: uncharacterized protein LOC103978646 isoform X3 [Musa 
acuminata subsp. malaccensis]
Length=1583

 Score =   358 bits (919),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 283/803 (35%), Positives = 406/803 (51%), Gaps = 94/803 (12%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNEHVNSG  1118
             CDICG  G+E LLAICSRC+DGAEHTYCM+ ML+K+PEG+WLCEEC+  +E +N+     
Sbjct  364   CDICGDSGQEELLAICSRCSDGAEHTYCMRIMLDKVPEGEWLCEECQL-KEAENQMKGKS  422

Query  1119  RVNEKEKTSPSRRTTIAKSDHPLKMEQKTSDCWGDKAVEERSYLKT-------SGKRCTD  1277
                 +   +P   T        ++   K+  C  +KAV+    +         S K   +
Sbjct  423   EAQFEAVEAPCLDTDRQN----IESTSKSLPCVENKAVDPDIKIDNKELGSSISSKMKGE  478

Query  1278  DSEVSSPTKRQRLELRSPTA--QIPNRVTSLSRESSFKNLERGKVKPLNPFSSGSFAAKV  1451
             +SE +S TK +  E  SP+    IP++   LS E+SF   +  +VKP    +S S +  +
Sbjct  479   NSEATSVTKEKIFEACSPSTGTSIPSKPNLLSHENSFSKPDFVQVKPSALITSCSQSEGI  538

Query  1452  ------------PSSTGPQP--QPPRGIFSKSNSFSSLIAKPKVKLVDEVFPAKQKLSRE  1589
                         P ++ P    +PPRG  SKS SF++L   PKVK +    P  +K+ +E
Sbjct  539   SRPVAHSKTSSDPDASKPHAHIEPPRGPLSKSVSFNNLKV-PKVKQLLVSIPQNKKMIKE  597

Query  1590  TAFIESKEVAVRSMGKSMSFK-PTTASRSNCTESKVK-MFSPKFSHDQDVKWLRHKKDRS  1763
             +    S++   +++ KS SF+  ++   S  T SK + + SP+  + + V+ +   K+RS
Sbjct  598   SNSSSSRKGPSQTITKSASFRNESSIVPSVKTMSKSQSLNSPQPDNPRGVQQV---KERS  654

Query  1764  SFDRKNSLRSDRLAGGAISSPKSDNKPTPRGEPSSLSSLNTNRDYRALTSDNKPVTISNS  1943
               D+K S  + R    ++S+       T    P   S +    D     SD+       S
Sbjct  655   VVDKKTSTSNCRFVNPSVSA-------TSVFSPKINSKVQQYDDKLKRASDS-------S  700

Query  1944  TSGVAREVLKQASVDGVSSANRVSSSEENPSQAIPKEDSSSSSCVAERPSWSSNEVLPDG  2123
              +G  R      S+D  SSAN V   ++ PS  + +    +SS    R   + ++ L   
Sbjct  701   NTGNNR-----VSIDATSSANEV---KQQPSSCLSRASGRTSSM---RLCKNEDQKLFQL  749

Query  2124  LSQSKESKAFGDKTRE-SSASRSKQNSTASGKIVSCQKCKGNGHLAQVCTADGPESSALG  2300
             + +  E     DKT++ +S S S+Q ++   ++   Q+CK   H AQ C  D    SA+ 
Sbjct  750   VPKPAELTHRDDKTKDHTSLSNSRQGASVGDRLQHFQRCKETDHSAQFCAVDKLRMSAVK  809

Query  2301  -SPFKSSREATNGPSDLKAAIEAARLRKPGICRKNRVADQSED--LSASNMKSEIASQD-  2468
              S  +S R+  N     K A+E     K G  R  R  DQSE+  LS +++ SE  S D 
Sbjct  810   PSSEQSLRDMDNRSIKSKDAVEVLSW-KFGTKRSVRSPDQSEEVSLSGTDVNSESTSSDF  868

Query  2469  --QMLSSTVRRNVNGAEEAQKQETANNA----------KQLGIIAEASARTRNAGHVVFS  2612
                 LSS     V GA +      A N+          K+  I +   A    A  +   
Sbjct  869   TSNFLSSGNLPMVEGAADVHNFSKATNSIHMKQKMDDHKKTIICSREGASLDAADDLNMK  928

Query  2613  DVKHSVIDMERQTLVSMPV--ILKTAIPEYQYIWQGGFEVQKSGKAFNLYDGIQAHLSSC  2786
              +   ++D       S P   +  + IPE +YIWQG FEV ++ K   L+DGIQAHLS+ 
Sbjct  929   PIIQILLDQ-----ASFPTHPLKASVIPELEYIWQGAFEVLRTAKPPALFDGIQAHLSAY  983

Query  2787  ASPKVLDAVNKFPRKVILNEVPRLSSWPMQFKECGVSEDNVALFFFAKDIGSYEKSYKVL  2966
              SPK L+    FP KV L EVPRL SWP+QF E    E+N+ALFFFAKD  SY+K Y  L
Sbjct  984   VSPKALEVATHFPCKVQLEEVPRLISWPLQFYENSPKEENIALFFFAKDTESYDKYYWKL  1043

Query  2967  LGDMVKHDLALQGNIGDIELLIFPSNQLPEKFQRWNLMFFLWGVFRGKRANSLQNFPGAE  3146
             L +M+K+DLAL GNI  +ELLIFPSN LPE  QRWN +F+LWGVFRG+   S  N P  E
Sbjct  1044  LENMLKNDLALIGNIDAVELLIFPSNVLPENSQRWNKLFYLWGVFRGRNKRSFTNLPDLE  1103

Query  3147  K----------PLIQDIPTPATS  3185
             K          P ++D+PTPA S
Sbjct  1104  KKPSISNLKLEPTVRDLPTPAVS  1126



>ref|XP_010919892.1| PREDICTED: uncharacterized protein LOC105043860 isoform X2 [Elaeis 
guineensis]
Length=1737

 Score =   359 bits (921),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 286/832 (34%), Positives = 431/832 (52%), Gaps = 70/832 (8%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNEHVN--  1112
             CDICG  G E LLA CSRC+DGAEHTYCM+  L+KIPEG+WLCEEC+  ++ +N+  +  
Sbjct  499   CDICGDAGVEELLATCSRCSDGAEHTYCMRIKLDKIPEGEWLCEECQLKEDAENKKTDKS  558

Query  1113  -----SGRVN-EKEKTSPSRRTTIAKSDHPLKMEQKTSDCWGDKAVEERSYLKTSGKRCT  1274
                  + +V+  KEK+         KS   L +E   ++  G  + +     + S +R  
Sbjct  559   DSVSGTSKVDILKEKSQNFGSNLNPKSVPKLDIEAIDTEVRG--STKGMQSPQKSAQRHA  616

Query  1275  DDSEVSSPTKRQRLELRSPTAQI--PNRVTSLSRESSFKNLERGKVKPLN----------  1418
             D  EV+S   R   E+   +  I  P +   +SRESSFK+L+ GKVKP N          
Sbjct  617   DSPEVTSMNSRMIPEIGGGSIGISSPRKNAVMSRESSFKSLDFGKVKPTNLAPSFKGQTT  676

Query  1419  --------PFSSGSFAAKVPSSTGPQPQPPRGIFSKSNSFSSLIAKPKVKLVDEVFPAKQ  1574
                       +S S A+KV +    Q    RG  SK  SF +   +PKVK +    P KQ
Sbjct  677   NGSQAISRSHTSSSNASKVQA----QLNSTRGPLSKQLSFDNSYMRPKVKQLINNSPRKQ  732

Query  1575  KLSRETAFIES-KEVAVRSMGKSMSFKPTTASRSNCTESKVKMFSPKFSHDQDVKWLRHK  1751
             K+ RE       K+V V++M KS SFK  ++  SN TES  K  S K     +    +  
Sbjct  733   KIMREAVSSNGRKDVIVKTMTKSASFKCVSSGLSN-TESLNKTQSLKSPRSDEPGGWKPV  791

Query  1752  KDRSSFDRKNSLRSDRLAGGAISSPKSDNKPTPR-GEPSSLSSLNTNRDYRALTSDNKPV  1928
             K+R+  +RKNS   D  +G   S+ K D K +   G  S+ S  +     + L + N   
Sbjct  792   KERNMMERKNSFVLDHPSGA--STAKMDLKISQHSGNLSNTSEQDILSIKKGLENPNDLG  849

Query  1929  T-ISNSTSGVAREVLKQASVDGVSSANRVSSSEENPSQAIPKEDSSSSSCVAERPSWSSN  2105
             T +S       R  +K+ + +        +  ++ P Q +P+E S ++    +R    ++
Sbjct  850   TNMSLEDFVTGRTEVKKQTSNSFKRYELCNPEDQRPFQVVPREGSCTNPIAIDRSHGDAD  909

Query  2106  EVLPDGLSQSKESKAFGDKTRESSASRSKQNSTASG-KIVSCQKCKGNGHLAQVCTADGP  2282
              VL   +S  +ES    DK+R+S+ S S + + +SG +++ C KC   GH  Q C  +  
Sbjct  910   SVLQRSMSLVRESFPREDKSRDSTHSSSSRQAASSGSRVLRCHKCNETGHATQFCPINKL  969

Query  2283  ESSALG-SPFKSSREATNGPSDLKAAIEAARLRKPGICRKNRVADQSE-DLSASNMKSEI  2456
               SAL  +  +S R + N  +  K AIEAA+ +      +N+++DQSE    ++ +  E 
Sbjct  970   RISALKPAADRSLRVSINKSNKWKDAIEAAKTKTQN---RNKLSDQSECSTPSTEVSCEA  1026

Query  2457  ASQDQMLSST---------------VRR----NVNGAEEAQKQETANNAKQLGIIAEASA  2579
             AS+D   +S+               V R    N    E     + A +  +   +++AS 
Sbjct  1027  ASKDLQSNSSGLKALPLEGTSDGKAVLRSFDANFGRREPVIDMQQAKHPVEASYLSKASD  1086

Query  2580  RTRNAGHVVFSDVKHSVIDMERQTLVSMPVILKTAIPEYQYIWQGGFEVQKSGKAFNLYD  2759
                   +   S+ K S   +  Q+ +       + IPE + IWQGGFEV ++G     +D
Sbjct  1087  SNAILTNTDSSNAKPSTQILHDQSSLLANPFGASVIPEQENIWQGGFEVLRTGGLPEFFD  1146

Query  2760  GIQAHLSSCASPKVLDAVNKFPRKVILNEVPRLSSWPMQFKECGVSEDNVALFFFAKDIG  2939
             GIQAHLS+CASP VL+ V++FP K+ L+E P    WP+QF+     EDN+A++FFAKDI 
Sbjct  1147  GIQAHLSTCASPNVLEVVSQFPCKLQLDEAPCFRLWPLQFQGISPKEDNIAIYFFAKDIE  1206

Query  2940  SYEKSYKVLLGDMVKHDLALQGNIGDIELLIFPSNQLPEKFQRWNLMFFLWGVFRGKRAN  3119
             SYE++Y  LL DM+K+DLAL+GNI ++E+LIFPSN+LPE  QRWN++FFLWGVFRG R  
Sbjct  1207  SYERTYGKLLEDMLKNDLALRGNINEVEILIFPSNKLPENCQRWNMLFFLWGVFRG-RTE  1265

Query  3120  SLQNFPGAEKPLIQDIPTPATSLPENMFTPVPKLNSARGSAATNTEMSAVKE  3275
               +  P  +K   Q       +L +   +P+ + +++R     N+  S+VKE
Sbjct  1266  CSKILPDLQKQACQ-FKLSTDTLVQEFSSPLFEASTSR---KINSHESSVKE  1313


 Score = 63.2 bits (152),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 56/142 (39%), Positives = 78/142 (55%), Gaps = 6/142 (4%)
 Frame = +3

Query  4020  SKTAILETPGNAEMFFFPVDPHPVGNIGSNNSSMPWKVHPLEEDQLHDKAPNLELALGAK  4199
             S T + E P +AE FFFP D  PV N+ S N  +   ++  +E      +P+LELALG K
Sbjct  1596  SGTGMTENPRSAEKFFFPADSGPVRNVVSEN--LTHVLYSEDEGMPESSSPDLELALGGK  1653

Query  4200  TKPLMSGIPSFLSGKVEKKIIEENTSDNAATSANKEDVsaslslslsFPFPEKEH--GTS  4373
              K     + S L    +++  +E     A    +++D+SA+LSLSL+FP  EK+    T 
Sbjct  1654  KKSSEKEVLSLLFPLGDRQGSQEELPGPAVD--DEDDMSAALSLSLAFPGTEKKQKDKTI  1711

Query  4374  SKPEQEDPRRRQANTSLLLFGR  4439
              + EQ  P R   NTSLLLFGR
Sbjct  1712  LRTEQLLPERPCVNTSLLLFGR  1733



>emb|CBI33889.3| unnamed protein product [Vitis vinifera]
Length=1457

 Score =   357 bits (915),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 280/785 (36%), Positives = 404/785 (51%), Gaps = 118/785 (15%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNEHVNSG  1118
             CDICG  G E LLA C++C+DGAEH YCM+  LEK+P   W+    KF+  ++ E ++S 
Sbjct  455   CDICGDAGLEELLATCTKCSDGAEHIYCMRIKLEKVPGRGWITS--KFENFLEFESMDS-  511

Query  1119  RVNEKEKTSPSRRTTIAKSDHPLKMEQKTSDCWGDKAVEERSYLKTSGKRCTDDSEVSSP  1298
                           T+++S        K+ D          S  + S KR  D  E    
Sbjct  512   --------------TVSRS------RTKSLD----------SAPQFSAKRPADSLETVPV  541

Query  1299  TKRQRLELRSPTAQI--PNRVTSLSRESSFKNLERGKVKPLNPFSSGSFAA---------  1445
             TK++ LE  +   ++  P++   LS +SSF+NL +GKVK  +  S G  ++         
Sbjct  542   TKKRTLETITRPTKVPSPHKKDILSWDSSFRNLCKGKVKQAHETSFGDNSSNNTLQSACL  601

Query  1446  ---------KVPSSTGPQPQPPRGIFSKSNSFSSLIAKPKVKLVDEVFPAKQKLSRETAF  1598
                      K+P     Q Q  RG   KSNSF  L A  KVKL ++    KQK +RET  
Sbjct  602   PTVSDYKSQKIPQ----QLQMSRGSLLKSNSFHILDANLKVKLSEKAVLQKQKFTRETDT  657

Query  1599  IESKEVAVRSMGKSMSFKPTTASRSNCTESKVKMFSPKFSHDQDVKWLRHKKDRSSFDRK  1778
              + K+   R M KS+SF    +   N  +SKVKMFS  FSH +D+K LRH K       +
Sbjct  658   SDMKKGIGRMMSKSLSFNGVGSKHLNVAQSKVKMFSSNFSHVEDLKRLRHAK-------Q  710

Query  1779  NSLRSDR------------LAGGAISSPKSDNKPTPRGEPS-SLSSLNTNRDYRALTSDN  1919
             NSL+ D             +AG   S+P +D K   RGE   + SS  T  + R++    
Sbjct  711   NSLQRDHKSKSYNPHMISPVAGSGDSAPTTDKKTASRGETVLAHSSGITCNELRSMQFHR  770

Query  1920  KPVTISNSTSGVAREVLKQASVDGVSSANR----VSSSEENPSQAIPKEDSSSSSCVAER  2087
                  S  TS +A + LK +   GVS A R    +S  +++PS   P+   SS      R
Sbjct  771   NSNNSSEPTSRLAPKDLKCSHGQGVSGAKRSALCLSDVDKDPS---PRMSDSSHEPKVNR  827

Query  2088  PSWSSNEVLPDGLSQSKESKAFGDKTRE-SSASRSKQNSTASGKIVSCQKCKGNGHLAQV  2264
                       D  SQ+ +S    +++R   S S+ +   +   +   C +CKG GH  + 
Sbjct  828   ----------DQSSQTGKSSNQEEQSRVICSFSQPRLKISVGSRSAHCHRCKGIGHSRES  877

Query  2265  CTADGPESSALGSPFKSSREATNGPSDLKAAIEAARLRKPGICRKNRVADQSEDLS-ASN  2441
             C     +   L +   +S+E  N  S +    +AA + K  + +++R  +QS++LS +S+
Sbjct  878   CPTMSSQVPILDA--GNSKE-VNKSSKMGDVAKAAIVGKDELHKRSRCPNQSDELSMSSS  934

Query  2442  MKSEIASQDQMLS--STVRRNVNGAEEAQKQE----------TANNAKQLGIIAEASART  2585
               +   S    LS  S+   N+  A+E  +Q+            +N +   +I     + 
Sbjct  935   NVNSKVSSSDYLSRHSSWLVNLLSADETNEQQIRVAKDVRWHVEHNTQAANMI-----KV  989

Query  2586  RNAGHVVFSDVKHSVIDMER-QTLVSMPVILKTAIPEYQYIWQGGFEVQKSGKAFNLYDG  2762
              N+  VV SD +  V D+ R  + VS P  + +A+PE  YIWQGGFEV + G+  + Y G
Sbjct  990   ENSNSVVPSDERLYVRDVPRLASTVSFPSRI-SAVPELDYIWQGGFEVHRIGRLSSHYTG  1048

Query  2763  IQAHLSSCASPKVLDAVNKFPRKVILNEVPRLSSWPMQFKECGVSEDNVALFFFAKDIGS  2942
             IQAHLS+CASPKVL+ V+  P K+IL EVPRLS+WP QF E   +EDN+AL+FFA D+ S
Sbjct  1049  IQAHLSTCASPKVLEVVHMLPPKIILEEVPRLSTWPAQFMENYATEDNIALYFFAADLES  1108

Query  2943  YEKSYKVLLGDMVKHDLALQGNIGDIELLIFPSNQLPEKFQRWNLMFFLWGVFRGKRANS  3122
             Y ++YK LL  M+K+DLAL+GN+  IELLIF S  LPEK QRWN + FLWGVFR +R N+
Sbjct  1109  YGRNYKSLLEWMIKNDLALKGNLKGIELLIFSSKLLPEKSQRWNALSFLWGVFRVRRVNN  1168

Query  3123  LQNFP  3137
              ++ P
Sbjct  1169  SEHVP  1173



>ref|XP_009392773.1| PREDICTED: uncharacterized protein LOC103978646 isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009392774.1| PREDICTED: uncharacterized protein LOC103978646 isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009392775.1| PREDICTED: uncharacterized protein LOC103978646 isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009392776.1| PREDICTED: uncharacterized protein LOC103978646 isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009392777.1| PREDICTED: uncharacterized protein LOC103978646 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=1683

 Score =   358 bits (919),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 283/803 (35%), Positives = 406/803 (51%), Gaps = 94/803 (12%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNEHVNSG  1118
             CDICG  G+E LLAICSRC+DGAEHTYCM+ ML+K+PEG+WLCEEC+  +E +N+     
Sbjct  464   CDICGDSGQEELLAICSRCSDGAEHTYCMRIMLDKVPEGEWLCEECQL-KEAENQMKGKS  522

Query  1119  RVNEKEKTSPSRRTTIAKSDHPLKMEQKTSDCWGDKAVEERSYLKT-------SGKRCTD  1277
                 +   +P   T        ++   K+  C  +KAV+    +         S K   +
Sbjct  523   EAQFEAVEAPCLDTDRQN----IESTSKSLPCVENKAVDPDIKIDNKELGSSISSKMKGE  578

Query  1278  DSEVSSPTKRQRLELRSPTA--QIPNRVTSLSRESSFKNLERGKVKPLNPFSSGSFAAKV  1451
             +SE +S TK +  E  SP+    IP++   LS E+SF   +  +VKP    +S S +  +
Sbjct  579   NSEATSVTKEKIFEACSPSTGTSIPSKPNLLSHENSFSKPDFVQVKPSALITSCSQSEGI  638

Query  1452  ------------PSSTGPQP--QPPRGIFSKSNSFSSLIAKPKVKLVDEVFPAKQKLSRE  1589
                         P ++ P    +PPRG  SKS SF++L   PKVK +    P  +K+ +E
Sbjct  639   SRPVAHSKTSSDPDASKPHAHIEPPRGPLSKSVSFNNLKV-PKVKQLLVSIPQNKKMIKE  697

Query  1590  TAFIESKEVAVRSMGKSMSFK-PTTASRSNCTESKVK-MFSPKFSHDQDVKWLRHKKDRS  1763
             +    S++   +++ KS SF+  ++   S  T SK + + SP+  + + V+ +   K+RS
Sbjct  698   SNSSSSRKGPSQTITKSASFRNESSIVPSVKTMSKSQSLNSPQPDNPRGVQQV---KERS  754

Query  1764  SFDRKNSLRSDRLAGGAISSPKSDNKPTPRGEPSSLSSLNTNRDYRALTSDNKPVTISNS  1943
               D+K S  + R    ++S+       T    P   S +    D     SD+       S
Sbjct  755   VVDKKTSTSNCRFVNPSVSA-------TSVFSPKINSKVQQYDDKLKRASDS-------S  800

Query  1944  TSGVAREVLKQASVDGVSSANRVSSSEENPSQAIPKEDSSSSSCVAERPSWSSNEVLPDG  2123
              +G  R      S+D  SSAN V   ++ PS  + +    +SS    R   + ++ L   
Sbjct  801   NTGNNR-----VSIDATSSANEV---KQQPSSCLSRASGRTSSM---RLCKNEDQKLFQL  849

Query  2124  LSQSKESKAFGDKTRE-SSASRSKQNSTASGKIVSCQKCKGNGHLAQVCTADGPESSALG  2300
             + +  E     DKT++ +S S S+Q ++   ++   Q+CK   H AQ C  D    SA+ 
Sbjct  850   VPKPAELTHRDDKTKDHTSLSNSRQGASVGDRLQHFQRCKETDHSAQFCAVDKLRMSAVK  909

Query  2301  -SPFKSSREATNGPSDLKAAIEAARLRKPGICRKNRVADQSED--LSASNMKSEIASQD-  2468
              S  +S R+  N     K A+E     K G  R  R  DQSE+  LS +++ SE  S D 
Sbjct  910   PSSEQSLRDMDNRSIKSKDAVEVLSW-KFGTKRSVRSPDQSEEVSLSGTDVNSESTSSDF  968

Query  2469  --QMLSSTVRRNVNGAEEAQKQETANNA----------KQLGIIAEASARTRNAGHVVFS  2612
                 LSS     V GA +      A N+          K+  I +   A    A  +   
Sbjct  969   TSNFLSSGNLPMVEGAADVHNFSKATNSIHMKQKMDDHKKTIICSREGASLDAADDLNMK  1028

Query  2613  DVKHSVIDMERQTLVSMPV--ILKTAIPEYQYIWQGGFEVQKSGKAFNLYDGIQAHLSSC  2786
              +   ++D       S P   +  + IPE +YIWQG FEV ++ K   L+DGIQAHLS+ 
Sbjct  1029  PIIQILLDQ-----ASFPTHPLKASVIPELEYIWQGAFEVLRTAKPPALFDGIQAHLSAY  1083

Query  2787  ASPKVLDAVNKFPRKVILNEVPRLSSWPMQFKECGVSEDNVALFFFAKDIGSYEKSYKVL  2966
              SPK L+    FP KV L EVPRL SWP+QF E    E+N+ALFFFAKD  SY+K Y  L
Sbjct  1084  VSPKALEVATHFPCKVQLEEVPRLISWPLQFYENSPKEENIALFFFAKDTESYDKYYWKL  1143

Query  2967  LGDMVKHDLALQGNIGDIELLIFPSNQLPEKFQRWNLMFFLWGVFRGKRANSLQNFPGAE  3146
             L +M+K+DLAL GNI  +ELLIFPSN LPE  QRWN +F+LWGVFRG+   S  N P  E
Sbjct  1144  LENMLKNDLALIGNIDAVELLIFPSNVLPENSQRWNKLFYLWGVFRGRNKRSFTNLPDLE  1203

Query  3147  K----------PLIQDIPTPATS  3185
             K          P ++D+PTPA S
Sbjct  1204  KKPSISNLKLEPTVRDLPTPAVS  1226



>ref|XP_010919895.1| PREDICTED: uncharacterized protein LOC105043860 isoform X5 [Elaeis 
guineensis]
Length=1726

 Score =   358 bits (920),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 284/831 (34%), Positives = 429/831 (52%), Gaps = 79/831 (10%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNEHVN--  1112
             CDICG  G E LLA CSRC+DGAEHTYCM+  L+KIPEG+WLCEEC+  ++ +N+  +  
Sbjct  499   CDICGDAGVEELLATCSRCSDGAEHTYCMRIKLDKIPEGEWLCEECQLKEDAENKKTDKS  558

Query  1113  -----SGRVN-EKEKTSPSRRTTIAKSDHPLKMEQKTSDCWGDKAVEERSYLKTSGKRCT  1274
                  + +V+  KEK+         KS   L +E   ++  G  + +     + S +R  
Sbjct  559   DSVSGTSKVDILKEKSQNFGSNLNPKSVPKLDIEAIDTEVRG--STKGMQSPQKSAQRHA  616

Query  1275  DDSEVSSPTKRQRLELRSPTAQI--PNRVTSLSRESSFKNLERGKVKPLN----------  1418
             D  EV+S   R   E+   +  I  P +   +SRESSFK+L+ GKVKP N          
Sbjct  617   DSPEVTSMNSRMIPEIGGGSIGISSPRKNAVMSRESSFKSLDFGKVKPTNLAPSFKGQTT  676

Query  1419  --------PFSSGSFAAKVPSSTGPQPQPPRGIFSKSNSFSSLIAKPKVKLVDEVFPAKQ  1574
                       +S S A+KV +    Q    RG  SK  SF +   +PKVK +    P KQ
Sbjct  677   NGSQAISRSHTSSSNASKVQA----QLNSTRGPLSKQLSFDNSYMRPKVKQLINNSPRKQ  732

Query  1575  KLSRETAFIES-KEVAVRSMGKSMSFKPTTASRSNCTESKVKMFSPKFSHDQDVKWLRHK  1751
             K+ RE       K+V V++M KS SFK  ++  SN TES  K  S K     +    +  
Sbjct  733   KIMREAVSSNGRKDVIVKTMTKSASFKCVSSGLSN-TESLNKTQSLKSPRSDEPGGWKPV  791

Query  1752  KDRSSFDRKNSLRSDRLAGGAISSPKSDNKPTPR-GEPSSLSSLNTNRDYRALTSDNKPV  1928
             K+R+  +RKNS   D  +G   S+ K D K +   G  S+ S  +     + L + N   
Sbjct  792   KERNMMERKNSFVLDHPSGA--STAKMDLKISQHSGNLSNTSEQDILSIKKGLENPND--  847

Query  1929  TISNSTSGVAREVLKQASVDGVSSANRVSSSEENPSQAIPKEDSSSSSCVAERPSWSSNE  2108
                     + R  +K+ + +        +  ++ P Q +P+E S ++    +R    ++ 
Sbjct  848   --------LGRTEVKKQTSNSFKRYELCNPEDQRPFQVVPREGSCTNPIAIDRSHGDADS  899

Query  2109  VLPDGLSQSKESKAFGDKTRESSASRSKQNSTASG-KIVSCQKCKGNGHLAQVCTADGPE  2285
             VL   +S  +ES    DK+R+S+ S S + + +SG +++ C KC   GH  Q C  +   
Sbjct  900   VLQRSMSLVRESFPREDKSRDSTHSSSSRQAASSGSRVLRCHKCNETGHATQFCPINKLR  959

Query  2286  SSALG-SPFKSSREATNGPSDLKAAIEAARLRKPGICRKNRVADQSE-DLSASNMKSEIA  2459
              SAL  +  +S R + N  +  K AIEAA+ +      +N+++DQSE    ++ +  E A
Sbjct  960   ISALKPAADRSLRVSINKSNKWKDAIEAAKTKTQN---RNKLSDQSECSTPSTEVSCEAA  1016

Query  2460  SQDQMLSST---------------VRR----NVNGAEEAQKQETANNAKQLGIIAEASAR  2582
             S+D   +S+               V R    N    E     + A +  +   +++AS  
Sbjct  1017  SKDLQSNSSGLKALPLEGTSDGKAVLRSFDANFGRREPVIDMQQAKHPVEASYLSKASDS  1076

Query  2583  TRNAGHVVFSDVKHSVIDMERQTLVSMPVILKTAIPEYQYIWQGGFEVQKSGKAFNLYDG  2762
                  +   S+ K S   +  Q+ +       + IPE + IWQGGFEV ++G     +DG
Sbjct  1077  NAILTNTDSSNAKPSTQILHDQSSLLANPFGASVIPEQENIWQGGFEVLRTGGLPEFFDG  1136

Query  2763  IQAHLSSCASPKVLDAVNKFPRKVILNEVPRLSSWPMQFKECGVSEDNVALFFFAKDIGS  2942
             IQAHLS+CASP VL+ V++FP K+ L+E P    WP+QF+     EDN+A++FFAKDI S
Sbjct  1137  IQAHLSTCASPNVLEVVSQFPCKLQLDEAPCFRLWPLQFQGISPKEDNIAIYFFAKDIES  1196

Query  2943  YEKSYKVLLGDMVKHDLALQGNIGDIELLIFPSNQLPEKFQRWNLMFFLWGVFRGKRANS  3122
             YE++Y  LL DM+K+DLAL+GNI ++E+LIFPSN+LPE  QRWN++FFLWGVFRG R   
Sbjct  1197  YERTYGKLLEDMLKNDLALRGNINEVEILIFPSNKLPENCQRWNMLFFLWGVFRG-RTEC  1255

Query  3123  LQNFPGAEKPLIQDIPTPATSLPENMFTPVPKLNSARGSAATNTEMSAVKE  3275
              +  P  +K   Q       +L +   +P+ + +++R     N+  S+VKE
Sbjct  1256  SKILPDLQKQACQ-FKLSTDTLVQEFSSPLFEASTSR---KINSHESSVKE  1302


 Score = 63.2 bits (152),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 56/142 (39%), Positives = 78/142 (55%), Gaps = 6/142 (4%)
 Frame = +3

Query  4020  SKTAILETPGNAEMFFFPVDPHPVGNIGSNNSSMPWKVHPLEEDQLHDKAPNLELALGAK  4199
             S T + E P +AE FFFP D  PV N+ S N  +   ++  +E      +P+LELALG K
Sbjct  1585  SGTGMTENPRSAEKFFFPADSGPVRNVVSEN--LTHVLYSEDEGMPESSSPDLELALGGK  1642

Query  4200  TKPLMSGIPSFLSGKVEKKIIEENTSDNAATSANKEDVsaslslslsFPFPEKEH--GTS  4373
              K     + S L    +++  +E     A    +++D+SA+LSLSL+FP  EK+    T 
Sbjct  1643  KKSSEKEVLSLLFPLGDRQGSQEELPGPAVD--DEDDMSAALSLSLAFPGTEKKQKDKTI  1700

Query  4374  SKPEQEDPRRRQANTSLLLFGR  4439
              + EQ  P R   NTSLLLFGR
Sbjct  1701  LRTEQLLPERPCVNTSLLLFGR  1722



>ref|XP_009392778.1| PREDICTED: uncharacterized protein LOC103978646 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=1677

 Score =   357 bits (917),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 283/803 (35%), Positives = 406/803 (51%), Gaps = 94/803 (12%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNEHVNSG  1118
             CDICG  G+E LLAICSRC+DGAEHTYCM+ ML+K+PEG+WLCEEC+  +E +N+     
Sbjct  458   CDICGDSGQEELLAICSRCSDGAEHTYCMRIMLDKVPEGEWLCEECQL-KEAENQMKGKS  516

Query  1119  RVNEKEKTSPSRRTTIAKSDHPLKMEQKTSDCWGDKAVEERSYLKT-------SGKRCTD  1277
                 +   +P   T        ++   K+  C  +KAV+    +         S K   +
Sbjct  517   EAQFEAVEAPCLDTDRQN----IESTSKSLPCVENKAVDPDIKIDNKELGSSISSKMKGE  572

Query  1278  DSEVSSPTKRQRLELRSPTA--QIPNRVTSLSRESSFKNLERGKVKPLNPFSSGSFAAKV  1451
             +SE +S TK +  E  SP+    IP++   LS E+SF   +  +VKP    +S S +  +
Sbjct  573   NSEATSVTKEKIFEACSPSTGTSIPSKPNLLSHENSFSKPDFVQVKPSALITSCSQSEGI  632

Query  1452  ------------PSSTGPQP--QPPRGIFSKSNSFSSLIAKPKVKLVDEVFPAKQKLSRE  1589
                         P ++ P    +PPRG  SKS SF++L   PKVK +    P  +K+ +E
Sbjct  633   SRPVAHSKTSSDPDASKPHAHIEPPRGPLSKSVSFNNLKV-PKVKQLLVSIPQNKKMIKE  691

Query  1590  TAFIESKEVAVRSMGKSMSFK-PTTASRSNCTESKVK-MFSPKFSHDQDVKWLRHKKDRS  1763
             +    S++   +++ KS SF+  ++   S  T SK + + SP+  + + V+ +   K+RS
Sbjct  692   SNSSSSRKGPSQTITKSASFRNESSIVPSVKTMSKSQSLNSPQPDNPRGVQQV---KERS  748

Query  1764  SFDRKNSLRSDRLAGGAISSPKSDNKPTPRGEPSSLSSLNTNRDYRALTSDNKPVTISNS  1943
               D+K S  + R    ++S+       T    P   S +    D     SD+       S
Sbjct  749   VVDKKTSTSNCRFVNPSVSA-------TSVFSPKINSKVQQYDDKLKRASDS-------S  794

Query  1944  TSGVAREVLKQASVDGVSSANRVSSSEENPSQAIPKEDSSSSSCVAERPSWSSNEVLPDG  2123
              +G  R      S+D  SSAN V   ++ PS  + +    +SS    R   + ++ L   
Sbjct  795   NTGNNR-----VSIDATSSANEV---KQQPSSCLSRASGRTSSM---RLCKNEDQKLFQL  843

Query  2124  LSQSKESKAFGDKTRE-SSASRSKQNSTASGKIVSCQKCKGNGHLAQVCTADGPESSALG  2300
             + +  E     DKT++ +S S S+Q ++   ++   Q+CK   H AQ C  D    SA+ 
Sbjct  844   VPKPAELTHRDDKTKDHTSLSNSRQGASVGDRLQHFQRCKETDHSAQFCAVDKLRMSAVK  903

Query  2301  -SPFKSSREATNGPSDLKAAIEAARLRKPGICRKNRVADQSED--LSASNMKSEIASQD-  2468
              S  +S R+  N     K A+E     K G  R  R  DQSE+  LS +++ SE  S D 
Sbjct  904   PSSEQSLRDMDNRSIKSKDAVEVLSW-KFGTKRSVRSPDQSEEVSLSGTDVNSESTSSDF  962

Query  2469  --QMLSSTVRRNVNGAEEAQKQETANNA----------KQLGIIAEASARTRNAGHVVFS  2612
                 LSS     V GA +      A N+          K+  I +   A    A  +   
Sbjct  963   TSNFLSSGNLPMVEGAADVHNFSKATNSIHMKQKMDDHKKTIICSREGASLDAADDLNMK  1022

Query  2613  DVKHSVIDMERQTLVSMPV--ILKTAIPEYQYIWQGGFEVQKSGKAFNLYDGIQAHLSSC  2786
              +   ++D       S P   +  + IPE +YIWQG FEV ++ K   L+DGIQAHLS+ 
Sbjct  1023  PIIQILLDQ-----ASFPTHPLKASVIPELEYIWQGAFEVLRTAKPPALFDGIQAHLSAY  1077

Query  2787  ASPKVLDAVNKFPRKVILNEVPRLSSWPMQFKECGVSEDNVALFFFAKDIGSYEKSYKVL  2966
              SPK L+    FP KV L EVPRL SWP+QF E    E+N+ALFFFAKD  SY+K Y  L
Sbjct  1078  VSPKALEVATHFPCKVQLEEVPRLISWPLQFYENSPKEENIALFFFAKDTESYDKYYWKL  1137

Query  2967  LGDMVKHDLALQGNIGDIELLIFPSNQLPEKFQRWNLMFFLWGVFRGKRANSLQNFPGAE  3146
             L +M+K+DLAL GNI  +ELLIFPSN LPE  QRWN +F+LWGVFRG+   S  N P  E
Sbjct  1138  LENMLKNDLALIGNIDAVELLIFPSNVLPENSQRWNKLFYLWGVFRGRNKRSFTNLPDLE  1197

Query  3147  K----------PLIQDIPTPATS  3185
             K          P ++D+PTPA S
Sbjct  1198  KKPSISNLKLEPTVRDLPTPAVS  1220



>ref|XP_010270011.1| PREDICTED: uncharacterized protein LOC104606480 isoform X5 [Nelumbo 
nucifera]
Length=1667

 Score =   357 bits (917),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 314/921 (34%), Positives = 456/921 (50%), Gaps = 113/921 (12%)
 Frame = +3

Query  1944  TSGVAREVLKQASVDGVSSANRVSSSEENPSQAIPKEDSSSSSCV-AERPSWSSNEVLPD  2120
             T   + EV +Q+ V  +SS  R SS+E+ PSQ  PK++ +SSS V A+R     + +L D
Sbjct  765   TLAASNEVKRQSVVGALSSNGRCSSTEQKPSQVSPKDEPTSSSSVSADRACGKHDTLLQD  824

Query  2121  GLSQSKESKAFGDKTRES-SASRSKQNSTASGKIVSCQKCKGNGHLAQVCTADGPESSAL  2297
             GL QS+ES   G K+RE      S+Q+ +  G+   CQKCKG GH+AQ C       S L
Sbjct  825   GLPQSRESLNQGAKSREPPHLGHSRQSISVGGQSARCQKCKGMGHVAQSCPVSNSRVSVL  884

Query  2298  -GSPFKSSREATNGPSDLKAAIEAARLRKPGICRKNRVADQSEDLSAS--NMKSEIASQD  2468
               S  K S+E  +    LK A+E   L++PGICRKNR  +Q ++LS S  ++ +E+ S+D
Sbjct  885   EASAEKISKEMMDKSCKLKEAVEPKILKRPGICRKNRSPEQLDELSMSSTDLSTEV-SKD  943

Query  2469  QML--SSTVRRNV------------NGAEEAQKQETANNAKQLGIIAEASARTRNAGHVV  2606
             Q+   SS +R N             N A +  +  T +N KQ  I       +  AG   
Sbjct  944   QLSASSSCLRNNSSQGTSDGQEIVRNSAADISRITTVDNVKQYAIHLREEIISPQAGE--  1001

Query  2607  FSDVKHSV-IDMERQTLVSMPVILKTA--------IPEYQYIWQGGFEVQKSGKAFNLYD  2759
              SD   SV  +    ++ ++P +  +         IPE+ ++WQG FEVQ++G   +L D
Sbjct  1002  -SDPSFSVDANKTSSSIRNLPFLESSVAAPSGISVIPEHDFLWQGCFEVQRNGILPDLCD  1060

Query  2760  GIQAHLSSCASPKVLDAVNKFPRKVILNEVPRLSSWPMQFKECGVSEDNVALFFFAKDIG  2939
             GIQAHLS+CASPKV + V KFP KV+L EVP LS+WP QF +   +EDNVAL+FFAKDI 
Sbjct  1061  GIQAHLSTCASPKVPEVVKKFPSKVLLEEVPCLSTWPRQFDDNHATEDNVALYFFAKDIE  1120

Query  2940  SYEKSYKVLLGDMVKHDLALQGNIGDIELLIFPSNQLPEKFQRWNLMFFLWGVFRGKRAN  3119
             SYE+ YK L+  M+++DLAL+GN    ELLIFPSN+LP+K QRWN++FFLWGVFRG+R N
Sbjct  1121  SYERYYKCLVDKMIRNDLALKGNFDGTELLIFPSNKLPDKSQRWNMLFFLWGVFRGRRPN  1180

Query  3120  SL---------------------QNFPGAEKPLIQDIPTPA----TSLPENMF-------  3203
              L                     QN P + +P+ + +  P      S     F       
Sbjct  1181  CLEQTPGPQKKVSQANLDTVFAHQNLPASVQPVHKQLHLPGQMEDLSASNKSFCGPEADK  1240

Query  3204  ----TPVPKLNSARGSAATNTEMSAVKESESASLHKIVNGNCSIQSSSQVSRDKCSRINA  3371
                   +P L+S R        +S++    ++S HK  +     Q  S +  +  SRI+ 
Sbjct  1241  STASVELPFLSSGRLDGDCEPNISSLDHKYTSS-HKNFD-----QQGSGLDNNSMSRIHT  1294

Query  3372  EQNDKLDSSSMQNSEPKLGPDRRYFGVPLGEAVHSSVQTAERVSSPNTSRPMSVHWAAPL  3551
               +++L + S  N+   L       G+  G+ + +  Q   +  +    + + V     L
Sbjct  1295  -GDEQLSTKSNSNT---LKEQTNKEGMQEGK-IQTCTQATTQNGNLYKGKSVPVELNNSL  1349

Query  3552  DGEKLSMLSDETPTMQEATSVGSTTKNLCGKDDVKIGRICLDNVSTEE------------  3695
             D +  S  S +TP    + S G     + G D  KI     D +  E             
Sbjct  1350  DRQDDSSCSLKTPPFSTSLSQGFGV--VGGTDKQKIPERMQDEIRDEMKIQKEMMSPDGL  1407

Query  3696  ---ATPLARHTSMEQTLNVISSFGVNPKKRSH--SAETVLQsasssgtsqafss--ysND  3854
                 T L R    E       ++  N +KR H  SA  + Q +  + +S++ ++     D
Sbjct  1408  MDIGTALKRTLKSESLDKGNCNWESNSRKRLHMDSALMIQQVSGETSSSRSRATLWMGED  1467

Query  3855  DILVE-EFCHKRVKLNSDRSYGCND--QTSCSKDGFLSEMGGTASQLSRQKNERDEALSK  4025
              +LV  E   K++K  S   YGCN   + +   + F  ++   AS      NE+ +    
Sbjct  1468  HLLVGGESEMKKIKRCSSVVYGCNSSSEQNSFNERFPPQVHDVASGFP--INEQQQYGEP  1525

Query  4026  TAILETPGNAEMFFFPVDPHPVGNIGSNNSSMPWKV-HPLEEDQLHDKAPNLELALGAKT  4202
                +E     E  FFP+D   V +    ++S+  ++     ED L  +APNLELALGA+ 
Sbjct  1526  YERMENLRTTERHFFPLDLGSVKDCKPRDTSVSSQILSSNNEDLLGSEAPNLELALGAER  1585

Query  4203  KPLMSGIPSFLSGKVEKKIIEENTSDNAATSANKED-VsaslslslsFPFPEKEHGTS--  4373
             +P   G+  +L G  +K+    NT D  A     +D VSASLSLSL+FPF  KEH     
Sbjct  1586  RPPKQGMLPWLVGTADKR----NTRDPVANKKVDDDGVSASLSLSLAFPFSSKEHTVKPV  1641

Query  4374  SKPEQEDPRRRQANTSLLLFG  4436
             S  EQ  P   + NTSL LFG
Sbjct  1642  SITEQLLPEAHRVNTSLFLFG  1662


 Score =   171 bits (432),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 119/291 (41%), Positives = 160/291 (55%), Gaps = 33/291 (11%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNE-----  1103
             CDICG  GRE LLA CSRC+DGAEHTYCM+ ML+K+PEGDW+CEECK  ++ + +     
Sbjct  510   CDICGDAGREDLLAFCSRCSDGAEHTYCMRLMLDKVPEGDWMCEECKLKEDTEKQKQDEV  569

Query  1104  HVNSGRVNE---KEKTSPSRRTTIAKSDHPLKMEQKTSDCWGDKAVEERSYLKTSGKRCT  1274
                SG   E    E++  S   +   S   +K+E K  D  G+++ +  S    S KR  
Sbjct  570   ETTSGFSKEPYLSERSQNSGGASTVSSKMMMKVELKAPDSEGNRSAKVISSSLLSVKRHL  629

Query  1275  DDSEVSSPTKRQRLE--LRSPTAQIPNRVTSLSRESSFKNLERGKVKPLNPFSS-GS-FA  1442
             D+SEV+S  KRQ  +  + SP A  P++   LSRESSFK+L++GKVK ++  +S GS FA
Sbjct  630   DNSEVASAEKRQAFDTSVGSPKASSPSKKPLLSRESSFKSLDKGKVKTIHKVASFGSHFA  689

Query  1443  ------AKVPSSTGPQP-------QPPRGIFSKSNSFSSLIAKPKVKLVDEVFPAKQKLS  1583
                   A  P++TGP P       Q PRG   KS SF+ L  K KVKLV E    K+K++
Sbjct  690   NNSHEIAHSPTTTGPNPSRIQSRLQSPRGTLLKSKSFNMLNLKSKVKLVQEDVSQKKKVA  749

Query  1584  RETAFIE-SKEVAVRSMGKSMSFKPTTA-------SRSNCTESKVKMFSPK  1712
                   +  KE  VR++  S   K  +         R + TE K    SPK
Sbjct  750   GNCVIGDMKKEGLVRTLAASNEVKRQSVVGALSSNGRCSSTEQKPSQVSPK  800



>ref|XP_002882257.1| hypothetical protein ARALYDRAFT_477535 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58516.1| hypothetical protein ARALYDRAFT_477535 [Arabidopsis lyrata subsp. 
lyrata]
Length=969

 Score =   347 bits (889),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 268/747 (36%), Positives = 373/747 (50%), Gaps = 168/747 (22%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNEHVNSG  1118
             CD CG  GRE LLAICSRC+DGAEHTYCM+ ML+K+P+G WLCEECKF +E + +     
Sbjct  203   CDTCGDAGREDLLAICSRCSDGAEHTYCMRVMLKKVPKGYWLCEECKFAEEAEKQ-----  257

Query  1119  RVNEKEKTSPSRRTTIAKSDHPLKMEQKTSDCWGDKAVEERSYLKTSGKRCTDDSEVSSP  1298
                                    K+E K     G +  E     ++S KR  D  E +  
Sbjct  258   -----------------------KLETK-----GKRESEVNRNTQSSSKRHIDKFETAPD  289

Query  1299  TKRQRLE--LRSPTAQIPNRVTSLSRESSFKNLERGKVKPLNPFSSGSFAA---KVPSST  1463
             +KR  +E    SP   +  RV++LSRE+SFK LE+   K  +  S  S+++   +   ST
Sbjct  290   SKRLAVEAPTGSPKRSVLPRVSALSRETSFKGLEKPARKLAHHSSFNSYSSDDTESTRST  349

Query  1464  GPQPQPPRGIFSKSNSFSSLIAKPKVKLVDEVFPAKQKLSRETAFIESKEVAVRSMGKSM  1643
               Q + P+G F KSNSF+S  ++PKV+ VD+V   +QK  +  +  + KE   +++GKSM
Sbjct  350   DSQLRSPKGSFYKSNSFNSSSSRPKVRPVDDVMLPRQKTGKGNSSFDVKEGFSKNVGKSM  409

Query  1644  SFKPTTASRSNCTESKVKMFSPKFSHDQDVKWLRHKKDRSSFDRKNSLRSDRLAGGAISS  1823
             S +      S+C  S             +VK  +  KDRS+           +A  ++S 
Sbjct  410   SSRCIDVGSSSCNGS-------------EVKGSKQLKDRST-----------VANPSVS-  444

Query  1824  PKSDNKPTPRGEPSSLSSLNTNRDYRALTSDNKPVTISNSTSGVAREVLKQASVDGVSSA  2003
                      RG  SS+    + RD + L SD K V                    G SS 
Sbjct  445   -------ISRGN-SSIPYAKSPRDLKDLQSDGKQV--------------------GDSSK  476

Query  2004  NRVSSSEENPSQAIPKEDSSSSSCVAERPSWSSNEVLPDGLSQSKESKAFGDKTRESSAS  2183
             N   SS E        + SS + C  E           DGL +S+E +  G+K++++  +
Sbjct  477   NEKCSSSE--------QISSETKCKDELAHV-------DGLPRSREFREAGEKSKDAVGN  521

Query  2184  RSKQNSTASGKIVSCQKCKGNGHLAQVCTADGPESSALGSPFKSSREATNGPSDLKAAIE  2363
               KQN +                                       E  N  + L+AA++
Sbjct  522   HQKQNIS---------------------------------------EDINKGNRLRAAVD  542

Query  2364  AARLRKPGICRKNRVADQSEDLSASNMKSEIASQDQMLSSTV---------RRNVNGAE-  2513
             AA  +KP    KNR  +QS+  S SN+ S      + L S V          + + G   
Sbjct  543   AALRKKPSFS-KNRGLEQSDLPSVSNVDSGCNKALKSLPSKVPVIRDWPVGFQGLPGGHP  601

Query  2514  --EAQKQETANNAKQ---LGIIAEASARTRNAGHVVFSDVKHSVIDMERQTLVSMPVILK  2678
                  KQ  A N  Q    G  A A+ ++     V F  VK  + D+     V+ P +L 
Sbjct  602   NLRTDKQTNAVNGNQSTLAGTDAMAAFQSVEL-EVNFPSVKPVMRDLP----VAAPNVLS  656

Query  2679  T--AIPEYQYIWQGGFEVQKSGKAFNLYDGIQAHLSSCASPKVLDAVNKFPRKVILNEVP  2852
             T  AIPE++YIWQG  EVQKS     ++ GIQA+LS+ ASPKV++ V +FP KV LNEVP
Sbjct  657   TTSAIPEHEYIWQGDLEVQKSRNLSAMHSGIQAYLSTSASPKVVEVVKQFPEKVTLNEVP  716

Query  2853  RLSSWPMQFKECGVSEDNVALFFFAKDIGSYEKSYKVLLGDMVKHDLALQGNIGDIELLI  3032
             RLSSWP QF++ G  E +VALFFFAKDI SYEK+YK L+ +M++ DLAL+G++  +ELLI
Sbjct  717   RLSSWPAQFQDTGAKEQHVALFFFAKDIESYEKNYKPLVDNMIQKDLALKGSLEGVELLI  776

Query  3033  FPSNQLPEKFQRWNLMFFLWGVFRGKR  3113
             F SNQLP+  QRWN++FFLWGVFRGK+
Sbjct  777   FASNQLPQDCQRWNMLFFLWGVFRGKK  803



>ref|XP_008788672.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103706375 
[Phoenix dactylifera]
Length=1571

 Score =   352 bits (903),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 272/817 (33%), Positives = 415/817 (51%), Gaps = 104/817 (13%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNEHVNSG  1118
             CDICG  G+E LLAICSRC+DGAEH YCM+ ML+K+PEGDWLCEEC+  +E++N+ V+  
Sbjct  374   CDICGDAGQEELLAICSRCSDGAEHIYCMRVMLDKLPEGDWLCEECQLKEEIENQKVDKS  433

Query  1119  RVNEKEKTSPSRRTTIAKSDHPLKMEQKTSDCWGD---KAVEERSYLKTSGKRCTDDSEV  1289
                 +    P        S +    E      W +   K +   +     G + T DS  
Sbjct  434   EAASEMLEIPCLNEKAQSSGNTFNPE-----VWPNLETKEINSDAKGGVKGLQSTQDS--  486

Query  1290  SSPTKRQRLELRSPTAQIPNRVTSLSRESSFKNLERGKVKPLNPFSSGSFAAKVPSSTGP  1469
                TKR  +         P + T  SRESSF +L+ GKVKP+NP  S      V S +G 
Sbjct  487   ---TKRHGI-------TSPRKNTVWSRESSFNSLDVGKVKPVNPLPS----CGVQSRSGS  532

Query  1470  QP-------------------QPPRGIFSKSNSFSSLIAKPKVKLVDEVFPAKQKLSRET  1592
             QP                   +  RG+ SKS SF+S    PKVK + E  P +QK++  +
Sbjct  533   QPIAHSQASLGSNSSKIEAQFESTRGLLSKSASFNS-SKMPKVKQLIESVPLRQKITSSS  591

Query  1593  AFIESKEVAVRSMGKSMSFKPTTASRSNCTESKVKMFSPKFSHDQDVKWLRHKKDRSSFD  1772
                  KE  +++  KS SFK T +  +  + +K++   P  +  ++ +  +  K+R+  +
Sbjct  592   D--SRKEGLLKTFTKSASFKSTNSGCNTESANKIQSLDPLRA--EEPRGGKLVKERNVIN  647

Query  1773  RKNSLRSDRLAGGAISSPKSDNKPTPRGE-----PSSLSSLNTNRDYRALTSDNKPVTIS  1937
             +KNS  SDR    +IS   S +  +P  +     P  +   N   D   + +D      +
Sbjct  648   KKNSSVSDR---PSISPSLSASTSSPFTKVDIKFPQHVGKSNKIPDLSNVGTDRGS---N  701

Query  1938  NSTSGVAREVLKQASVDGV----SSANRVSSSEENPS-QAIPKEDSSSSSCVAERPSWSS  2102
             N+ +   +EV KQ+S        + +N +  SE+  + Q + KE++ +SS   +R   + 
Sbjct  702   NANNLGCKEVKKQSSFSSRTSGSTPSNGLRKSEDQKTYQPVSKENACASSAAVDRACCNP  761

Query  2103  NEVLPDGLSQSKESKAFGDKTRESS-ASRSKQNSTASGKIVSCQKCKGNGHLAQVCTADG  2279
             + +      Q  ES    D T++ + +S S+Q ++ S +++ CQ+C   GH  Q C  D 
Sbjct  762   DSIQQCSTPQVAESTHRDDTTKDHTLSSSSRQAASGSSRLLRCQRCNETGHTTQFCAVDK  821

Query  2280  PESSALG-SPFKSSREATNGPSDLKAAIEAARLRKPGICRKNRVADQSEDLSAS--NMKS  2450
                SA+  S  ++ RE +N  S  K  +EA   +   + +  +  DQS ++S S  +  S
Sbjct  822   LRMSAVRPSAERNLREGSNRNSKWKDVVEAMSSKTRPL-KNIKSPDQSVEISTSSADQNS  880

Query  2451  EIASQDQMLSSTVR--RNVNGAEEAQ--------------------KQETANNAKQLGII  2564
             ++ S+D   S ++R  RN+   EE                      KQ+T+   + + + 
Sbjct  881   QVTSKD-FQSGSLRCPRNLPSMEETADGQEVFRSSADFSKAAVFHVKQKTSYQEETVCVP  939

Query  2565  AEASART-RNAGHVVFSDVKHSVIDMERQTLVSMPVILKTAIPEYQYIWQGGFEVQKSGK  2741
              + +  T  N    +  ++K  +  +  Q  V  P +  + IP+ + IWQGGF+V ++G 
Sbjct  940   KDGNTNTILNISEKL--NLKPQMQILPGQASVLEPPLRASVIPKLELIWQGGFKVLRTGG  997

Query  2742  AFNLYDGIQAHLSSCASPKVLDAVNKFPRKVILNEVPRLSSWPMQFKECGVSEDNVALFF  2921
                + DG+QAH S+C SPK L+A  KFP  + L EVPR  SWP QF++    EDN+AL F
Sbjct  998   HSEICDGLQAHPSTCVSPKALEAAFKFPCIIHLEEVPRHGSWPSQFQKNSPKEDNIALXF  1057

Query  2922  FAKDIGSYEKSYKVLLGDMVKHDLALQGNIGDIELLIFPSNQLPEKFQRWNLMFFLWGVF  3101
             FAKDI SY+ +Y  LL  M+K+DLA++GN+   ELLIFPSN LPE  QRWN +FFLWGVF
Sbjct  1058  FAKDIESYKNNYSKLLETMLKNDLAMKGNVDGAELLIFPSNLLPENSQRWNNLFFLWGVF  1117

Query  3102  RGKRANSLQNFPGAEK---------PLIQDIPTPATS  3185
             R ++  SL + P  +K         PL QD+P P  S
Sbjct  1118  RERKEKSLDDMPVFQKLNRPNLNMEPLDQDLPAPIMS  1154



>ref|XP_009418603.1| PREDICTED: uncharacterized protein LOC103998755 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=1698

 Score =   350 bits (898),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 291/814 (36%), Positives = 413/814 (51%), Gaps = 122/814 (15%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNEHVNSG  1118
             CDICG  G+E LLAICSRC+DGAEHTYCM+ ML+K+PEG+WLCEEC+  +E +N+ +   
Sbjct  491   CDICGDAGQEELLAICSRCSDGAEHTYCMRIMLDKVPEGEWLCEECQL-KEAENQMIGKS  549

Query  1119  RVNEKEKTSPS----RRTTIAKSDHPLKMEQKTSDCWGDKAVEERSYLKTSG-----KRC  1271
                 +   +PS     + T + S+    +E K     GD A + R+  K  G     KR 
Sbjct  550   EAQTEAIEAPSVSEYNQITGSTSNSFPCVENK-----GDNA-DTRTDNKELGNSNSFKRK  603

Query  1272  TDDSEVSSPTKRQRLEL--RSPTAQIPNRVTSLSRESSFKNLERGKVKPLNPFSSG----  1433
              ++ EV+  TK +  E    S    IP + T  S E+S    +  KVKP    +S     
Sbjct  604   GENLEVTCVTKEKISEACGASTKTTIPMKPTLHSHENSSNKPDFVKVKPSALITSCGQPE  663

Query  1434  --------SFAAKVPSSTGPQP--QPPRGIFSKSNSFSSLIAKPKVKLVDEVFPAKQKLS  1583
                     S  + VP  + PQ   +P RG  SKS SF++    PKVK + E  P  +K++
Sbjct  664   VISQPVPRSQTSSVPDLSKPQAHLEPTRGPLSKSASFNNSKV-PKVKQLVENIPQNKKMT  722

Query  1584  RETAFIES---KEVAVRSMGKSMSFKPTTASRSNC-TESKVKMFSPKFSHDQDVKWLRHK  1751
             RE  F  S   KE  +R++ KS SF+  ++S S+  T SKV+  +P      D + ++ +
Sbjct  723   RE--FNSSSIRKEGPLRTITKSASFRSESSSFSSVKTMSKVQSLNPP--QPDDPRGVKQQ  778

Query  1752  KDRSSFDRKNSLRSDRLAG-----GAISSPKSDNKPT---PRGEPSSLSS-LNTNRDYRA  1904
             K+RS+ D K S+   R         +IS  K D+K     PR + +S SS L  NR    
Sbjct  779   KERSAVDLKGSIPGSRFVSPSASTTSISPLKVDSKVQQNDPRLKRTSDSSNLGNNR----  834

Query  1905  LTSDNKPVTISNSTSGVAREVLKQASVDGVSSANRVSSSEENPSQAIPKEDSSSSSCVAE  2084
                 N   T++N         L Q S    SS     + ++ P Q +PK           
Sbjct  835   --GSNDAATLANDVKKQPSSSLSQTSA-CTSSIRSCKNEDQKPFQLVPK-----------  880

Query  2085  RPSWSSNEVLPDGLSQSKESKAFGDKTRESS-ASRSKQNSTASGKIVSCQKCKGNGHLAQ  2261
                             + E     DKT++ + +S S+Q ++AS ++  C +C   GH  Q
Sbjct  881   ----------------AAELTHRDDKTKDHTFSSNSRQAASASNRLPRCHRCNETGHSTQ  924

Query  2262  VCTADGPESSALG-SPFKSSREATNGPSDLKAAIEAARLRKPGICRKNRVADQSEDLS--  2432
              C  D    SA+  S  +S R+  N     K   E     K G  R +R  DQSE++S  
Sbjct  925   FCAVDKLRISAMKPSSERSLRDMDNRNVKSKDGAEVLGW-KLGTKRTSRSPDQSEEVSLC  983

Query  2433  ASNMKSEIASQDQMLSSTVRRNV----------------NGAEEAQKQETANNAKQLGII  2564
             +++  SE+ ++D   SS   RN+                NG    QK E  N+ K + I 
Sbjct  984   SADANSELTAKDFSSSSLNFRNLPSLEGTSDVQNFSKATNGIHAHQKVE--NHKKAMLIA  1041

Query  2565  AEASARTRNAGHVVFSDVKHSVID-MERQTLVSMPVILKTAIPEYQYIWQGGFEVQKSGK  2741
              E  A   + G  +  ++K  +I  +  +  + M  +  + IPE  YIWQG FEV ++ +
Sbjct  1042  GEGIAL--DIGDDL--NLKKPIIQTLSNEASIPMHPLRASVIPELDYIWQGAFEVLRTAE  1097

Query  2742  AFNLYDGIQAHLSSCASPKVLDAVNKFPRKVILNEVPRLSSWPMQFKECGVSEDNVALFF  2921
             A  L+DG QAHLS+  SPK L+  ++FP K+ L E+PRL SWP+QF      +DN+ALFF
Sbjct  1098  APTLFDGFQAHLSTYVSPKALEVASQFPCKIQLEEIPRLRSWPLQFHINSPKDDNIALFF  1157

Query  2922  FAKDIGSYEKSYKVLLGDMVKHDLALQGNIGDIELLIFPSNQLPEKFQRWNLMFFLWGVF  3101
             FAKDI SY K Y  LL +M+K+DLAL GNI  +ELLIFPSN LPE  QRWN +F+LWGVF
Sbjct  1158  FAKDIESYGKYYWKLLENMLKNDLALIGNIDTVELLIFPSNMLPENSQRWNKLFYLWGVF  1217

Query  3102  RGKRANSLQNFPGAE----------KPLIQDIPT  3173
             RG++ NSL + P  E          K +IQD+PT
Sbjct  1218  RGRKINSLVDLPSLERKPSVCNLNSKTIIQDLPT  1251


 Score = 60.5 bits (145),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 62/194 (32%), Positives = 96/194 (49%), Gaps = 14/194 (7%)
 Frame = +3

Query  3861  LVEEFCHKRVKLNSDRSYGCNDQTSCSKDGFLSEMGGTASQLSRQKNERDEALSKTAILE  4040
             L +E  HK+++L+S     C            SEM    S L+      ++++    + E
Sbjct  1509  LTDEKVHKKMRLDSGGHLPCISTGENLSSSISSEMQPLLSCLT------NDSIYCENVSE  1562

Query  4041  TPGNAEMFFFPVDPHPVGNIGSNNSSMPWKVHPLEEDQLHDKAPNLELALGAKTKPLMSG  4220
             +  N+E  FFP+DP P  +  ++N  + + +   +ED     AP+LEL LG K +P+   
Sbjct  1563  SLKNSERHFFPIDPGPQTSTKADN--LVYVLSSDDEDSPESNAPDLELGLGRKKRPIEQD  1620

Query  4221  IPSFLSGKVEKKIIEENTSDNAATSANKEDVsaslslslsFPFPEKEHGTSSKPEQED--  4394
             I   LS KV +K   +      A++ + +D+ ASLSLSL+FP  EK       P+ E   
Sbjct  1621  IFPLLSPKVGEKSHRDKM---PASAVDCDDLRASLSLSLAFPASEKAQTVKPIPQAEQLL  1677

Query  4395  PRRRQANTSLLLFG  4436
             P +   NT LLLFG
Sbjct  1678  PDKPCINT-LLLFG  1690



>ref|XP_010919891.1| PREDICTED: uncharacterized protein LOC105043860 isoform X1 [Elaeis 
guineensis]
Length=1746

 Score =   349 bits (895),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 285/841 (34%), Positives = 430/841 (51%), Gaps = 79/841 (9%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNEHVN--  1112
             CDICG  G E LLA CSRC+DGAEHTYCM+  L+KIPEG+WLCEEC+  ++ +N+  +  
Sbjct  499   CDICGDAGVEELLATCSRCSDGAEHTYCMRIKLDKIPEGEWLCEECQLKEDAENKKTDKS  558

Query  1113  -----SGRVN-EKEKTSPSRRTTIAKSDHPLKMEQKTSDCWGDKAVEERSYLKTSGKRCT  1274
                  + +V+  KEK+         KS   L +E   ++  G  + +     + S +R  
Sbjct  559   DSVSGTSKVDILKEKSQNFGSNLNPKSVPKLDIEAIDTEVRG--STKGMQSPQKSAQRHA  616

Query  1275  DDSEVSSPTKRQRLELRSPTAQI--PNRVTSLSRESSFKNLERGKVKPLN----------  1418
             D  EV+S   R   E+   +  I  P +   +SRESSFK+L+ GKVKP N          
Sbjct  617   DSPEVTSMNSRMIPEIGGGSIGISSPRKNAVMSRESSFKSLDFGKVKPTNLAPSFKGQTT  676

Query  1419  --------PFSSGSFAAKVPSSTGPQPQPPRGIFSKSNSFSSLIAKPKVKLVDEVFPAKQ  1574
                       +S S A+KV +    Q    RG  SK  SF +   +PKVK +    P KQ
Sbjct  677   NGSQAISRSHTSSSNASKVQA----QLNSTRGPLSKQLSFDNSYMRPKVKQLINNSPRKQ  732

Query  1575  KLSRETAFIES-KEVAVRSMGKSMSFKPTTASRSNCTESKVKMFSPKFSHDQDVKWLRHK  1751
             K+ RE       K+V V++M KS SFK  ++  SN TES  K  S K     +    +  
Sbjct  733   KIMREAVSSNGRKDVIVKTMTKSASFKCVSSGLSN-TESLNKTQSLKSPRSDEPGGWKPV  791

Query  1752  KDRSSFDRKNSLRSDRLAGGAISSPKSDNKPTPR-GEPSSLSSLNTNRDYRALTSDNKPV  1928
             K+R+  +RKNS   D  +G   S+ K D K +   G  S+ S  +     + L + N   
Sbjct  792   KERNMMERKNSFVLDHPSGA--STAKMDLKISQHSGNLSNTSEQDILSIKKGLENPNDLG  849

Query  1929  T-ISNSTSGVAREVLKQASVDGVSSANRVSSSEENPSQAIPKEDSSSSSCVAERPSWSSN  2105
             T +S       R  +K+ + +        +  ++ P Q +P+E S ++    +R    ++
Sbjct  850   TNMSLEDFVTGRTEVKKQTSNSFKRYELCNPEDQRPFQVVPREGSCTNPIAIDRSHGDAD  909

Query  2106  EVLPDGLSQSKESKAFGDKTRESSASRSKQNSTASG-KIVSCQKCKGNGHLAQVCTADGP  2282
              VL   +S  +ES    DK+R+S+ S S + + +SG +++ C KC   GH  Q C  +  
Sbjct  910   SVLQRSMSLVRESFPREDKSRDSTHSSSSRQAASSGSRVLRCHKCNETGHATQFCPINKL  969

Query  2283  ESSALG-SPFKSSREATNGPSDLKAAIEAARLRKPGICRKNRVADQSE-DLSASNMKSEI  2456
               SAL  +  +S R + N  +  K AIEAA+ +      +N+++DQSE    ++ +  E 
Sbjct  970   RISALKPAADRSLRVSINKSNKWKDAIEAAKTKTQN---RNKLSDQSECSTPSTEVSCEA  1026

Query  2457  ASQDQMLSST---------------VRR----NVNGAEEAQKQETANNAKQLGIIAEASA  2579
             AS+D   +S+               V R    N    E     + A +  +   +++AS 
Sbjct  1027  ASKDLQSNSSGLKALPLEGTSDGKAVLRSFDANFGRREPVIDMQQAKHPVEASYLSKASD  1086

Query  2580  RTRNAGHVVFSDVKHSVIDMERQTLVSMPVILKTAIPEYQYIWQGGFEVQKSGKAFNLYD  2759
                   +   S+ K S   +  Q+ +       + IPE + IWQGGFEV ++G     +D
Sbjct  1087  SNAILTNTDSSNAKPSTQILHDQSSLLANPFGASVIPEQENIWQGGFEVLRTGGLPEFFD  1146

Query  2760  GIQAHLSSCASPKVLDAVNKFPRKVILNEVPRLSSWPMQFKECGVSEDNVALFFFAKDIG  2939
             GIQAHLS+CASP VL+ V++FP K+ L+E P    WP+QF+     EDN+A++FFAKDI 
Sbjct  1147  GIQAHLSTCASPNVLEVVSQFPCKLQLDEAPCFRLWPLQFQGISPKEDNIAIYFFAKDIE  1206

Query  2940  SYEKSYKVLLGDMVKHDLALQGNIGDIELLIFPSNQLPEK---------FQRWNLMFFLW  3092
             SYE++Y  LL DM+K+DLAL+GNI ++E+LIFPSN+LPE          F  WN++FFLW
Sbjct  1207  SYERTYGKLLEDMLKNDLALRGNINEVEILIFPSNKLPENCQLRRCFLFFSGWNMLFFLW  1266

Query  3093  GVFRGKRANSLQNFPGAEKPLIQDIPTPATSLPENMFTPVPKLNSARGSAATNTEMSAVK  3272
             GVFRG R    +  P  +K   Q       +L +   +P+ + +++R     N+  S+VK
Sbjct  1267  GVFRG-RTECSKILPDLQKQACQ-FKLSTDTLVQEFSSPLFEASTSR---KINSHESSVK  1321

Query  3273  E  3275
             E
Sbjct  1322  E  1322


 Score = 63.2 bits (152),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 56/142 (39%), Positives = 78/142 (55%), Gaps = 6/142 (4%)
 Frame = +3

Query  4020  SKTAILETPGNAEMFFFPVDPHPVGNIGSNNSSMPWKVHPLEEDQLHDKAPNLELALGAK  4199
             S T + E P +AE FFFP D  PV N+ S N  +   ++  +E      +P+LELALG K
Sbjct  1605  SGTGMTENPRSAEKFFFPADSGPVRNVVSEN--LTHVLYSEDEGMPESSSPDLELALGGK  1662

Query  4200  TKPLMSGIPSFLSGKVEKKIIEENTSDNAATSANKEDVsaslslslsFPFPEKEH--GTS  4373
              K     + S L    +++  +E     A    +++D+SA+LSLSL+FP  EK+    T 
Sbjct  1663  KKSSEKEVLSLLFPLGDRQGSQEELPGPAVD--DEDDMSAALSLSLAFPGTEKKQKDKTI  1720

Query  4374  SKPEQEDPRRRQANTSLLLFGR  4439
              + EQ  P R   NTSLLLFGR
Sbjct  1721  LRTEQLLPERPCVNTSLLLFGR  1742



>ref|XP_010919894.1| PREDICTED: uncharacterized protein LOC105043860 isoform X4 [Elaeis 
guineensis]
Length=1735

 Score =   348 bits (894),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 285/841 (34%), Positives = 430/841 (51%), Gaps = 79/841 (9%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNEHVN--  1112
             CDICG  G E LLA CSRC+DGAEHTYCM+  L+KIPEG+WLCEEC+  ++ +N+  +  
Sbjct  488   CDICGDAGVEELLATCSRCSDGAEHTYCMRIKLDKIPEGEWLCEECQLKEDAENKKTDKS  547

Query  1113  -----SGRVN-EKEKTSPSRRTTIAKSDHPLKMEQKTSDCWGDKAVEERSYLKTSGKRCT  1274
                  + +V+  KEK+         KS   L +E   ++  G  + +     + S +R  
Sbjct  548   DSVSGTSKVDILKEKSQNFGSNLNPKSVPKLDIEAIDTEVRG--STKGMQSPQKSAQRHA  605

Query  1275  DDSEVSSPTKRQRLELRSPTAQI--PNRVTSLSRESSFKNLERGKVKPLN----------  1418
             D  EV+S   R   E+   +  I  P +   +SRESSFK+L+ GKVKP N          
Sbjct  606   DSPEVTSMNSRMIPEIGGGSIGISSPRKNAVMSRESSFKSLDFGKVKPTNLAPSFKGQTT  665

Query  1419  --------PFSSGSFAAKVPSSTGPQPQPPRGIFSKSNSFSSLIAKPKVKLVDEVFPAKQ  1574
                       +S S A+KV +    Q    RG  SK  SF +   +PKVK +    P KQ
Sbjct  666   NGSQAISRSHTSSSNASKVQA----QLNSTRGPLSKQLSFDNSYMRPKVKQLINNSPRKQ  721

Query  1575  KLSRETAFIES-KEVAVRSMGKSMSFKPTTASRSNCTESKVKMFSPKFSHDQDVKWLRHK  1751
             K+ RE       K+V V++M KS SFK  ++  SN TES  K  S K     +    +  
Sbjct  722   KIMREAVSSNGRKDVIVKTMTKSASFKCVSSGLSN-TESLNKTQSLKSPRSDEPGGWKPV  780

Query  1752  KDRSSFDRKNSLRSDRLAGGAISSPKSDNKPTPR-GEPSSLSSLNTNRDYRALTSDNKPV  1928
             K+R+  +RKNS   D  +G   S+ K D K +   G  S+ S  +     + L + N   
Sbjct  781   KERNMMERKNSFVLDHPSGA--STAKMDLKISQHSGNLSNTSEQDILSIKKGLENPNDLG  838

Query  1929  T-ISNSTSGVAREVLKQASVDGVSSANRVSSSEENPSQAIPKEDSSSSSCVAERPSWSSN  2105
             T +S       R  +K+ + +        +  ++ P Q +P+E S ++    +R    ++
Sbjct  839   TNMSLEDFVTGRTEVKKQTSNSFKRYELCNPEDQRPFQVVPREGSCTNPIAIDRSHGDAD  898

Query  2106  EVLPDGLSQSKESKAFGDKTRESSASRSKQNSTASG-KIVSCQKCKGNGHLAQVCTADGP  2282
              VL   +S  +ES    DK+R+S+ S S + + +SG +++ C KC   GH  Q C  +  
Sbjct  899   SVLQRSMSLVRESFPREDKSRDSTHSSSSRQAASSGSRVLRCHKCNETGHATQFCPINKL  958

Query  2283  ESSALG-SPFKSSREATNGPSDLKAAIEAARLRKPGICRKNRVADQSE-DLSASNMKSEI  2456
               SAL  +  +S R + N  +  K AIEAA+ +      +N+++DQSE    ++ +  E 
Sbjct  959   RISALKPAADRSLRVSINKSNKWKDAIEAAKTKTQN---RNKLSDQSECSTPSTEVSCEA  1015

Query  2457  ASQDQMLSST---------------VRR----NVNGAEEAQKQETANNAKQLGIIAEASA  2579
             AS+D   +S+               V R    N    E     + A +  +   +++AS 
Sbjct  1016  ASKDLQSNSSGLKALPLEGTSDGKAVLRSFDANFGRREPVIDMQQAKHPVEASYLSKASD  1075

Query  2580  RTRNAGHVVFSDVKHSVIDMERQTLVSMPVILKTAIPEYQYIWQGGFEVQKSGKAFNLYD  2759
                   +   S+ K S   +  Q+ +       + IPE + IWQGGFEV ++G     +D
Sbjct  1076  SNAILTNTDSSNAKPSTQILHDQSSLLANPFGASVIPEQENIWQGGFEVLRTGGLPEFFD  1135

Query  2760  GIQAHLSSCASPKVLDAVNKFPRKVILNEVPRLSSWPMQFKECGVSEDNVALFFFAKDIG  2939
             GIQAHLS+CASP VL+ V++FP K+ L+E P    WP+QF+     EDN+A++FFAKDI 
Sbjct  1136  GIQAHLSTCASPNVLEVVSQFPCKLQLDEAPCFRLWPLQFQGISPKEDNIAIYFFAKDIE  1195

Query  2940  SYEKSYKVLLGDMVKHDLALQGNIGDIELLIFPSNQLPEK---------FQRWNLMFFLW  3092
             SYE++Y  LL DM+K+DLAL+GNI ++E+LIFPSN+LPE          F  WN++FFLW
Sbjct  1196  SYERTYGKLLEDMLKNDLALRGNINEVEILIFPSNKLPENCQLRRCFLFFSGWNMLFFLW  1255

Query  3093  GVFRGKRANSLQNFPGAEKPLIQDIPTPATSLPENMFTPVPKLNSARGSAATNTEMSAVK  3272
             GVFRG R    +  P  +K   Q       +L +   +P+ + +++R     N+  S+VK
Sbjct  1256  GVFRG-RTECSKILPDLQKQACQ-FKLSTDTLVQEFSSPLFEASTSR---KINSHESSVK  1310

Query  3273  E  3275
             E
Sbjct  1311  E  1311


 Score = 63.2 bits (152),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 56/142 (39%), Positives = 78/142 (55%), Gaps = 6/142 (4%)
 Frame = +3

Query  4020  SKTAILETPGNAEMFFFPVDPHPVGNIGSNNSSMPWKVHPLEEDQLHDKAPNLELALGAK  4199
             S T + E P +AE FFFP D  PV N+ S N  +   ++  +E      +P+LELALG K
Sbjct  1594  SGTGMTENPRSAEKFFFPADSGPVRNVVSEN--LTHVLYSEDEGMPESSSPDLELALGGK  1651

Query  4200  TKPLMSGIPSFLSGKVEKKIIEENTSDNAATSANKEDVsaslslslsFPFPEKEH--GTS  4373
              K     + S L    +++  +E     A    +++D+SA+LSLSL+FP  EK+    T 
Sbjct  1652  KKSSEKEVLSLLFPLGDRQGSQEELPGPAVD--DEDDMSAALSLSLAFPGTEKKQKDKTI  1709

Query  4374  SKPEQEDPRRRQANTSLLLFGR  4439
              + EQ  P R   NTSLLLFGR
Sbjct  1710  LRTEQLLPERPCVNTSLLLFGR  1731



>ref|XP_010919893.1| PREDICTED: uncharacterized protein LOC105043860 isoform X3 [Elaeis 
guineensis]
Length=1735

 Score =   348 bits (893),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 283/840 (34%), Positives = 428/840 (51%), Gaps = 88/840 (10%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNEHVN--  1112
             CDICG  G E LLA CSRC+DGAEHTYCM+  L+KIPEG+WLCEEC+  ++ +N+  +  
Sbjct  499   CDICGDAGVEELLATCSRCSDGAEHTYCMRIKLDKIPEGEWLCEECQLKEDAENKKTDKS  558

Query  1113  -----SGRVN-EKEKTSPSRRTTIAKSDHPLKMEQKTSDCWGDKAVEERSYLKTSGKRCT  1274
                  + +V+  KEK+         KS   L +E   ++  G  + +     + S +R  
Sbjct  559   DSVSGTSKVDILKEKSQNFGSNLNPKSVPKLDIEAIDTEVRG--STKGMQSPQKSAQRHA  616

Query  1275  DDSEVSSPTKRQRLELRSPTAQI--PNRVTSLSRESSFKNLERGKVKPLN----------  1418
             D  EV+S   R   E+   +  I  P +   +SRESSFK+L+ GKVKP N          
Sbjct  617   DSPEVTSMNSRMIPEIGGGSIGISSPRKNAVMSRESSFKSLDFGKVKPTNLAPSFKGQTT  676

Query  1419  --------PFSSGSFAAKVPSSTGPQPQPPRGIFSKSNSFSSLIAKPKVKLVDEVFPAKQ  1574
                       +S S A+KV +    Q    RG  SK  SF +   +PKVK +    P KQ
Sbjct  677   NGSQAISRSHTSSSNASKVQA----QLNSTRGPLSKQLSFDNSYMRPKVKQLINNSPRKQ  732

Query  1575  KLSRETAFIES-KEVAVRSMGKSMSFKPTTASRSNCTESKVKMFSPKFSHDQDVKWLRHK  1751
             K+ RE       K+V V++M KS SFK  ++  SN TES  K  S K     +    +  
Sbjct  733   KIMREAVSSNGRKDVIVKTMTKSASFKCVSSGLSN-TESLNKTQSLKSPRSDEPGGWKPV  791

Query  1752  KDRSSFDRKNSLRSDRLAGGAISSPKSDNKPTPR-GEPSSLSSLNTNRDYRALTSDNKPV  1928
             K+R+  +RKNS   D  +G   S+ K D K +   G  S+ S  +     + L + N   
Sbjct  792   KERNMMERKNSFVLDHPSGA--STAKMDLKISQHSGNLSNTSEQDILSIKKGLENPND--  847

Query  1929  TISNSTSGVAREVLKQASVDGVSSANRVSSSEENPSQAIPKEDSSSSSCVAERPSWSSNE  2108
                     + R  +K+ + +        +  ++ P Q +P+E S ++    +R    ++ 
Sbjct  848   --------LGRTEVKKQTSNSFKRYELCNPEDQRPFQVVPREGSCTNPIAIDRSHGDADS  899

Query  2109  VLPDGLSQSKESKAFGDKTRESSASRSKQNSTASG-KIVSCQKCKGNGHLAQVCTADGPE  2285
             VL   +S  +ES    DK+R+S+ S S + + +SG +++ C KC   GH  Q C  +   
Sbjct  900   VLQRSMSLVRESFPREDKSRDSTHSSSSRQAASSGSRVLRCHKCNETGHATQFCPINKLR  959

Query  2286  SSALG-SPFKSSREATNGPSDLKAAIEAARLRKPGICRKNRVADQSE-DLSASNMKSEIA  2459
              SAL  +  +S R + N  +  K AIEAA+ +      +N+++DQSE    ++ +  E A
Sbjct  960   ISALKPAADRSLRVSINKSNKWKDAIEAAKTKTQN---RNKLSDQSECSTPSTEVSCEAA  1016

Query  2460  SQDQMLSST---------------VRR----NVNGAEEAQKQETANNAKQLGIIAEASAR  2582
             S+D   +S+               V R    N    E     + A +  +   +++AS  
Sbjct  1017  SKDLQSNSSGLKALPLEGTSDGKAVLRSFDANFGRREPVIDMQQAKHPVEASYLSKASDS  1076

Query  2583  TRNAGHVVFSDVKHSVIDMERQTLVSMPVILKTAIPEYQYIWQGGFEVQKSGKAFNLYDG  2762
                  +   S+ K S   +  Q+ +       + IPE + IWQGGFEV ++G     +DG
Sbjct  1077  NAILTNTDSSNAKPSTQILHDQSSLLANPFGASVIPEQENIWQGGFEVLRTGGLPEFFDG  1136

Query  2763  IQAHLSSCASPKVLDAVNKFPRKVILNEVPRLSSWPMQFKECGVSEDNVALFFFAKDIGS  2942
             IQAHLS+CASP VL+ V++FP K+ L+E P    WP+QF+     EDN+A++FFAKDI S
Sbjct  1137  IQAHLSTCASPNVLEVVSQFPCKLQLDEAPCFRLWPLQFQGISPKEDNIAIYFFAKDIES  1196

Query  2943  YEKSYKVLLGDMVKHDLALQGNIGDIELLIFPSNQLPEK---------FQRWNLMFFLWG  3095
             YE++Y  LL DM+K+DLAL+GNI ++E+LIFPSN+LPE          F  WN++FFLWG
Sbjct  1197  YERTYGKLLEDMLKNDLALRGNINEVEILIFPSNKLPENCQLRRCFLFFSGWNMLFFLWG  1256

Query  3096  VFRGKRANSLQNFPGAEKPLIQDIPTPATSLPENMFTPVPKLNSARGSAATNTEMSAVKE  3275
             VFRG R    +  P  +K   Q       +L +   +P+ + +++R     N+  S+VKE
Sbjct  1257  VFRG-RTECSKILPDLQKQACQ-FKLSTDTLVQEFSSPLFEASTSR---KINSHESSVKE  1311


 Score = 63.2 bits (152),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 56/142 (39%), Positives = 78/142 (55%), Gaps = 6/142 (4%)
 Frame = +3

Query  4020  SKTAILETPGNAEMFFFPVDPHPVGNIGSNNSSMPWKVHPLEEDQLHDKAPNLELALGAK  4199
             S T + E P +AE FFFP D  PV N+ S N  +   ++  +E      +P+LELALG K
Sbjct  1594  SGTGMTENPRSAEKFFFPADSGPVRNVVSEN--LTHVLYSEDEGMPESSSPDLELALGGK  1651

Query  4200  TKPLMSGIPSFLSGKVEKKIIEENTSDNAATSANKEDVsaslslslsFPFPEKEH--GTS  4373
              K     + S L    +++  +E     A    +++D+SA+LSLSL+FP  EK+    T 
Sbjct  1652  KKSSEKEVLSLLFPLGDRQGSQEELPGPAVD--DEDDMSAALSLSLAFPGTEKKQKDKTI  1709

Query  4374  SKPEQEDPRRRQANTSLLLFGR  4439
              + EQ  P R   NTSLLLFGR
Sbjct  1710  LRTEQLLPERPCVNTSLLLFGR  1731



>ref|XP_009418602.1| PREDICTED: uncharacterized protein LOC103998755 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=1701

 Score =   348 bits (893),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 285/805 (35%), Positives = 416/805 (52%), Gaps = 101/805 (13%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNEHVNSG  1118
             CDICG  G+E LLAICSRC+DGAEHTYCM+ ML+K+PEG+WLCEEC+  +E +N+ +   
Sbjct  491   CDICGDAGQEELLAICSRCSDGAEHTYCMRIMLDKVPEGEWLCEECQL-KEAENQMIGKS  549

Query  1119  RVNEKEKTSPS----RRTTIAKSDHPLKMEQKTSDCWGDKAVEERSYLKTSG-----KRC  1271
                 +   +PS     + T + S+    +E K     GD A + R+  K  G     KR 
Sbjct  550   EAQTEAIEAPSVSEYNQITGSTSNSFPCVENK-----GDNA-DTRTDNKELGNSNSFKRK  603

Query  1272  TDDSEVSSPTKRQRLEL--RSPTAQIPNRVTSLSRESSFKNLERGKVKPLNPFSSG----  1433
              ++ EV+  TK +  E    S    IP + T  S E+S    +  KVKP    +S     
Sbjct  604   GENLEVTCVTKEKISEACGASTKTTIPMKPTLHSHENSSNKPDFVKVKPSALITSCGQPE  663

Query  1434  --------SFAAKVPSSTGPQP--QPPRGIFSKSNSFSSLIAKPKVKLVDEVFPAKQKLS  1583
                     S  + VP  + PQ   +P RG  SKS SF++    PKVK + E  P  +K++
Sbjct  664   VISQPVPRSQTSSVPDLSKPQAHLEPTRGPLSKSASFNNSKV-PKVKQLVENIPQNKKMT  722

Query  1584  RETAFIES---KEVAVRSMGKSMSFKPTTASRSNC-TESKVKMFSPKFSHDQDVKWLRHK  1751
             RE  F  S   KE  +R++ KS SF+  ++S S+  T SKV+  +P      D + ++ +
Sbjct  723   RE--FNSSSIRKEGPLRTITKSASFRSESSSFSSVKTMSKVQSLNPP--QPDDPRGVKQQ  778

Query  1752  KDRSSFDRKNSLRSDRLAGGAISSPKSDNKPTPRGEPSSLSSLNTNRDYRALTSDNKPVT  1931
             K+RS+ D K S+   R               +P    +S+S L    D +   +D +   
Sbjct  779   KERSAVDLKGSIPGSRFV-------------SPSASTTSISPLKV--DSKVQQNDPRLKR  823

Query  1932  ISNSTS-GVAREVLKQASVDGVSSANRVSSSEENPSQAIPKEDSSSSSCVAERPSWSSNE  2108
              S+S++ G  R      S D  +  +  +  ++ PS ++    S +S+C +   S  + +
Sbjct  824   TSDSSNLGNNR-----GSNDAATLGSLANDVKKQPSSSL----SQTSACTSSIRSCKNED  874

Query  2109  VLPDGL-SQSKESKAFGDKTRESS-ASRSKQNSTASGKIVSCQKCKGNGHLAQVCTADGP  2282
               P  L  ++ E     DKT++ + +S S+Q ++AS ++  C +C   GH  Q C  D  
Sbjct  875   QKPFQLVPKAAELTHRDDKTKDHTFSSNSRQAASASNRLPRCHRCNETGHSTQFCAVDKL  934

Query  2283  ESSALG-SPFKSSREATNGPSDLKAAIEAARLRKPGICRKNRVADQSEDLS--ASNMKSE  2453
               SA+  S  +S R+  N     K   E     K G  R +R  DQSE++S  +++  SE
Sbjct  935   RISAMKPSSERSLRDMDNRNVKSKDGAEVLGW-KLGTKRTSRSPDQSEEVSLCSADANSE  993

Query  2454  IASQDQMLSSTVRRNV---NGAEEAQKQETANNAKQLGIIAEASARTRN-----AGHVVF  2609
             + ++D   SS   RN+    G  + Q    A N    GI A             AG  + 
Sbjct  994   LTAKDFSSSSLNFRNLPSLEGTSDVQNFSKATN----GIHAHQKVENHKKAMLIAGEGIA  1049

Query  2610  SDV------KHSVID-MERQTLVSMPVILKTAIPEYQYIWQGGFEVQKSGKAFNLYDGIQ  2768
              D+      K  +I  +  +  + M  +  + IPE  YIWQG FEV ++ +A  L+DG Q
Sbjct  1050  LDIGDDLNLKKPIIQTLSNEASIPMHPLRASVIPELDYIWQGAFEVLRTAEAPTLFDGFQ  1109

Query  2769  AHLSSCASPKVLDAVNKFPRKVILNEVPRLSSWPMQFKECGVSEDNVALFFFAKDIGSYE  2948
             AHLS+  SPK L+  ++FP K+ L E+PRL SWP+QF      +DN+ALFFFAKDI SY 
Sbjct  1110  AHLSTYVSPKALEVASQFPCKIQLEEIPRLRSWPLQFHINSPKDDNIALFFFAKDIESYG  1169

Query  2949  KSYKVLLGDMVKHDLALQGNIGDIELLIFPSNQLPEKFQRWNLMFFLWGVFRGKRANSLQ  3128
             K Y  LL +M+K+DLAL GNI  +ELLIFPSN LPE  QRWN +F+LWGVFRG++ NSL 
Sbjct  1170  KYYWKLLENMLKNDLALIGNIDTVELLIFPSNMLPENSQRWNKLFYLWGVFRGRKINSLV  1229

Query  3129  NFPGAE----------KPLIQDIPT  3173
             + P  E          K +IQD+PT
Sbjct  1230  DLPSLERKPSVCNLNSKTIIQDLPT  1254


 Score = 60.5 bits (145),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 62/194 (32%), Positives = 96/194 (49%), Gaps = 14/194 (7%)
 Frame = +3

Query  3861  LVEEFCHKRVKLNSDRSYGCNDQTSCSKDGFLSEMGGTASQLSRQKNERDEALSKTAILE  4040
             L +E  HK+++L+S     C            SEM    S L+      ++++    + E
Sbjct  1512  LTDEKVHKKMRLDSGGHLPCISTGENLSSSISSEMQPLLSCLT------NDSIYCENVSE  1565

Query  4041  TPGNAEMFFFPVDPHPVGNIGSNNSSMPWKVHPLEEDQLHDKAPNLELALGAKTKPLMSG  4220
             +  N+E  FFP+DP P  +  ++N  + + +   +ED     AP+LEL LG K +P+   
Sbjct  1566  SLKNSERHFFPIDPGPQTSTKADN--LVYVLSSDDEDSPESNAPDLELGLGRKKRPIEQD  1623

Query  4221  IPSFLSGKVEKKIIEENTSDNAATSANKEDVsaslslslsFPFPEKEHGTSSKPEQED--  4394
             I   LS KV +K   +      A++ + +D+ ASLSLSL+FP  EK       P+ E   
Sbjct  1624  IFPLLSPKVGEKSHRDKM---PASAVDCDDLRASLSLSLAFPASEKAQTVKPIPQAEQLL  1680

Query  4395  PRRRQANTSLLLFG  4436
             P +   NT LLLFG
Sbjct  1681  PDKPCINT-LLLFG  1693



>ref|XP_010941238.1| PREDICTED: uncharacterized protein LOC105059588 isoform X5 [Elaeis 
guineensis]
Length=1399

 Score =   345 bits (885),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 284/832 (34%), Positives = 418/832 (50%), Gaps = 111/832 (13%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNEHVNSG  1118
             CDICG  G+E LLAICSRC+DGAEH YCMQ ML+K+PEGDWLCEEC+  ++ +N+  +  
Sbjct  455   CDICGDAGQEELLAICSRCSDGAEHIYCMQMMLDKLPEGDWLCEECQLKEDTENQRADKS  514

Query  1119  R----------VNEKEKTSPSRRTTIAKSDHPLKMEQKTSDCWGDKAVEERSYLKTSGKR  1268
             +          +NEK+++S S        +  L+ ++  SD  G K ++     + S KR
Sbjct  515   QAASEMLEVPFLNEKDQSSGSMFNPKVLPN--LETKEINSDVKGAKGLQSS---QISSKR  569

Query  1269  CTDDSEVSSPTKRQRLELRSPTAQI--PNRVTSLSRESSFKNLERGKVKPLNPF-----S  1427
             CT++  V+S T  +  E    +  I  P + T LSRESSF N++ GKVKP N        
Sbjct  570   CTENIVVTSVTSNKVSEAGGGSIGITSPRKNTLLSRESSFNNMDVGKVKPANLLPSCGGQ  629

Query  1428  SGSFAAKVPSSTG----------PQPQPPRGIFSKSNSFSSLIAKPKVKLVDEVFPAKQK  1577
             SGS +  +  S             Q +  RGI SKS S S  +  PKVK + E  P +QK
Sbjct  630   SGSVSQPMAYSQASSGSNSSKIQAQFESTRGILSKSVS-SKSLKMPKVKQLIESVPIRQK  688

Query  1578  LSRETAFIES-KEVAVRSMGKSMSFKPTTASRSNCTESKVKMFSPKFSHDQDVKWLRHKK  1754
             +   T+  +S KE  V+++ KS SF+ T++  S  + +K +   P  +  +D + ++  K
Sbjct  689   V---TSLRDSRKEGLVKTIRKSASFRNTSSGCSAESANKTQSLDPLRA--EDPRGVKQLK  743

Query  1755  DRSSFDRKNSLRSDRLAGGAISSPKSDNKPTPRGEPSSLSSLNT---NRDYRALTSDNKP  1925
             + +  +RKNS  SD                 P   PS  +S +T     D +    D K 
Sbjct  744   EINVVNRKNSSISD----------------CPSISPSLSASTSTPFPKVDMKCKQHDRKS  787

Query  1926  VTISNSTS-GVAR-----------EVLKQASVDGV----SSANRVSSSEE-NPSQAIPKE  2054
               I +S++ G  R           EV KQ+S        + AN +  SE+  P Q + KE
Sbjct  788   NKIPDSSNVGTDRGSNNANNLGCKEVKKQSSFSSRTSGSTPANGLQKSEDPKPCQPVSKE  847

Query  2055  DSSSSSCVAERPSWSSNEVLPDGLSQSKESKAFGDKTRESS-ASRSKQNSTASGKIVSCQ  2231
             +  +S   A R   + +        Q+ ES    DKT++ + +S S+Q ++   +I+ CQ
Sbjct  848   NGCASFAAAARSCCNPDSTQRCSTPQAAESTHQDDKTKDHTFSSSSRQAASGGSRILHCQ  907

Query  2232  KCKGNGHLAQVCTADGPESSALG-SPFKSSREATNGPSDLKAAIEAARLRKPGICRKNRV  2408
              C   GH+ Q C  D P  SA+  S  ++ RE +N  S     +E     KP   +  R 
Sbjct  908   TCNETGHMTQFCAVDKPRISAVKPSAEQNLREGSNKNSKWNDVVEVTN-SKPRPLKSIRS  966

Query  2409  ADQSEDLSAS--NMKSEIASQDQMLSS-TVRRNV-------NGAE------EAQKQETAN  2540
               +SE++S S  +  S++ S+D    S +  RN+       NG E      +  K   A 
Sbjct  967   PHRSEEISTSGADQNSDVTSKDLPSGSLSCPRNLPSMEGTANGKEILRSCADFGKAAVAI  1026

Query  2541  NAKQLGIIAEASARTRNAGHV-------VFSDVKHSVIDMERQTLVSMPVILKTAIPEYQ  2699
             N K      E +      G++       V  +VK  +  +  Q  V    +  + IP+ +
Sbjct  1027  NVKHKTSYQEETVCVSKDGNINTVLNTSVKLNVKPHMQILPGQAFVLAHPLKASIIPKLE  1086

Query  2700  YIWQGGFEVQKSGKAFNLYDGIQAHLSSCASPKVLDAVNKFPRKVILNEVPRLSSWPMQF  2879
             +IWQGGF V ++     L +G+QAH S+  SPK L+A  +FP  + L EV R S+WP QF
Sbjct  1087  FIWQGGFNVLRTTGCSELCEGLQAHPSTSVSPKALEAAIQFPCIIQLEEVVRHSTWPAQF  1146

Query  2880  KECGVSEDNVALFFFAKDIGSYEKSYKVLLGDMVKHDLALQGNIGDIELLIFPSNQLPEK  3059
             +E    EDN+ALFFFAKDI SY+ +Y  LL +M+K+DLAL+GN+   ELLIFPSN LP+ 
Sbjct  1147  QENSPKEDNIALFFFAKDIESYKNNYSKLLENMLKNDLALRGNMDGAELLIFPSNLLPQN  1206

Query  3060  FQRWNLMFFLWGVFRGKRANSLQNFPGAE----------KPLIQDIPTPATS  3185
              QRWN   FLW VFR ++   L + P  +          +PL QD+P P  S
Sbjct  1207  SQRWNNFLFLWSVFRERKEKCLDDMPALQGKFNRPNLNMEPLDQDLPAPIIS  1258



>ref|XP_010941237.1| PREDICTED: uncharacterized protein LOC105059588 isoform X4 [Elaeis 
guineensis]
Length=1427

 Score =   345 bits (884),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 284/832 (34%), Positives = 418/832 (50%), Gaps = 111/832 (13%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNEHVNSG  1118
             CDICG  G+E LLAICSRC+DGAEH YCMQ ML+K+PEGDWLCEEC+  ++ +N+  +  
Sbjct  455   CDICGDAGQEELLAICSRCSDGAEHIYCMQMMLDKLPEGDWLCEECQLKEDTENQRADKS  514

Query  1119  R----------VNEKEKTSPSRRTTIAKSDHPLKMEQKTSDCWGDKAVEERSYLKTSGKR  1268
             +          +NEK+++S S        +  L+ ++  SD  G K ++     + S KR
Sbjct  515   QAASEMLEVPFLNEKDQSSGSMFNPKVLPN--LETKEINSDVKGAKGLQSS---QISSKR  569

Query  1269  CTDDSEVSSPTKRQRLELRSPTAQI--PNRVTSLSRESSFKNLERGKVKPLNPF-----S  1427
             CT++  V+S T  +  E    +  I  P + T LSRESSF N++ GKVKP N        
Sbjct  570   CTENIVVTSVTSNKVSEAGGGSIGITSPRKNTLLSRESSFNNMDVGKVKPANLLPSCGGQ  629

Query  1428  SGSFAAKVPSSTG----------PQPQPPRGIFSKSNSFSSLIAKPKVKLVDEVFPAKQK  1577
             SGS +  +  S             Q +  RGI SKS S S  +  PKVK + E  P +QK
Sbjct  630   SGSVSQPMAYSQASSGSNSSKIQAQFESTRGILSKSVS-SKSLKMPKVKQLIESVPIRQK  688

Query  1578  LSRETAFIES-KEVAVRSMGKSMSFKPTTASRSNCTESKVKMFSPKFSHDQDVKWLRHKK  1754
             +   T+  +S KE  V+++ KS SF+ T++  S  + +K +   P  +  +D + ++  K
Sbjct  689   V---TSLRDSRKEGLVKTIRKSASFRNTSSGCSAESANKTQSLDPLRA--EDPRGVKQLK  743

Query  1755  DRSSFDRKNSLRSDRLAGGAISSPKSDNKPTPRGEPSSLSSLNT---NRDYRALTSDNKP  1925
             + +  +RKNS  SD                 P   PS  +S +T     D +    D K 
Sbjct  744   EINVVNRKNSSISD----------------CPSISPSLSASTSTPFPKVDMKCKQHDRKS  787

Query  1926  VTISNSTS-GVAR-----------EVLKQASVDGV----SSANRVSSSEE-NPSQAIPKE  2054
               I +S++ G  R           EV KQ+S        + AN +  SE+  P Q + KE
Sbjct  788   NKIPDSSNVGTDRGSNNANNLGCKEVKKQSSFSSRTSGSTPANGLQKSEDPKPCQPVSKE  847

Query  2055  DSSSSSCVAERPSWSSNEVLPDGLSQSKESKAFGDKTRESS-ASRSKQNSTASGKIVSCQ  2231
             +  +S   A R   + +        Q+ ES    DKT++ + +S S+Q ++   +I+ CQ
Sbjct  848   NGCASFAAAARSCCNPDSTQRCSTPQAAESTHQDDKTKDHTFSSSSRQAASGGSRILHCQ  907

Query  2232  KCKGNGHLAQVCTADGPESSALG-SPFKSSREATNGPSDLKAAIEAARLRKPGICRKNRV  2408
              C   GH+ Q C  D P  SA+  S  ++ RE +N  S     +E     KP   +  R 
Sbjct  908   TCNETGHMTQFCAVDKPRISAVKPSAEQNLREGSNKNSKWNDVVEVTN-SKPRPLKSIRS  966

Query  2409  ADQSEDLSAS--NMKSEIASQDQMLSS-TVRRNV-------NGAE------EAQKQETAN  2540
               +SE++S S  +  S++ S+D    S +  RN+       NG E      +  K   A 
Sbjct  967   PHRSEEISTSGADQNSDVTSKDLPSGSLSCPRNLPSMEGTANGKEILRSCADFGKAAVAI  1026

Query  2541  NAKQLGIIAEASARTRNAGHV-------VFSDVKHSVIDMERQTLVSMPVILKTAIPEYQ  2699
             N K      E +      G++       V  +VK  +  +  Q  V    +  + IP+ +
Sbjct  1027  NVKHKTSYQEETVCVSKDGNINTVLNTSVKLNVKPHMQILPGQAFVLAHPLKASIIPKLE  1086

Query  2700  YIWQGGFEVQKSGKAFNLYDGIQAHLSSCASPKVLDAVNKFPRKVILNEVPRLSSWPMQF  2879
             +IWQGGF V ++     L +G+QAH S+  SPK L+A  +FP  + L EV R S+WP QF
Sbjct  1087  FIWQGGFNVLRTTGCSELCEGLQAHPSTSVSPKALEAAIQFPCIIQLEEVVRHSTWPAQF  1146

Query  2880  KECGVSEDNVALFFFAKDIGSYEKSYKVLLGDMVKHDLALQGNIGDIELLIFPSNQLPEK  3059
             +E    EDN+ALFFFAKDI SY+ +Y  LL +M+K+DLAL+GN+   ELLIFPSN LP+ 
Sbjct  1147  QENSPKEDNIALFFFAKDIESYKNNYSKLLENMLKNDLALRGNMDGAELLIFPSNLLPQN  1206

Query  3060  FQRWNLMFFLWGVFRGKRANSLQNFPGAE----------KPLIQDIPTPATS  3185
              QRWN   FLW VFR ++   L + P  +          +PL QD+P P  S
Sbjct  1207  SQRWNNFLFLWSVFRERKEKCLDDMPALQGKFNRPNLNMEPLDQDLPAPIIS  1258



>ref|XP_010941235.1| PREDICTED: uncharacterized protein LOC105059588 isoform X2 [Elaeis 
guineensis]
Length=1647

 Score =   345 bits (885),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 284/832 (34%), Positives = 418/832 (50%), Gaps = 111/832 (13%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNEHVNSG  1118
             CDICG  G+E LLAICSRC+DGAEH YCMQ ML+K+PEGDWLCEEC+  ++ +N+  +  
Sbjct  454   CDICGDAGQEELLAICSRCSDGAEHIYCMQMMLDKLPEGDWLCEECQLKEDTENQRADKS  513

Query  1119  R----------VNEKEKTSPSRRTTIAKSDHPLKMEQKTSDCWGDKAVEERSYLKTSGKR  1268
             +          +NEK+++S S        +  L+ ++  SD  G K ++     + S KR
Sbjct  514   QAASEMLEVPFLNEKDQSSGSMFNPKVLPN--LETKEINSDVKGAKGLQSS---QISSKR  568

Query  1269  CTDDSEVSSPTKRQRLELRSPTAQI--PNRVTSLSRESSFKNLERGKVKPLNPF-----S  1427
             CT++  V+S T  +  E    +  I  P + T LSRESSF N++ GKVKP N        
Sbjct  569   CTENIVVTSVTSNKVSEAGGGSIGITSPRKNTLLSRESSFNNMDVGKVKPANLLPSCGGQ  628

Query  1428  SGSFAAKVPSSTG----------PQPQPPRGIFSKSNSFSSLIAKPKVKLVDEVFPAKQK  1577
             SGS +  +  S             Q +  RGI SKS S S  +  PKVK + E  P +QK
Sbjct  629   SGSVSQPMAYSQASSGSNSSKIQAQFESTRGILSKSVS-SKSLKMPKVKQLIESVPIRQK  687

Query  1578  LSRETAFIES-KEVAVRSMGKSMSFKPTTASRSNCTESKVKMFSPKFSHDQDVKWLRHKK  1754
             +   T+  +S KE  V+++ KS SF+ T++  S  + +K +   P  +  +D + ++  K
Sbjct  688   V---TSLRDSRKEGLVKTIRKSASFRNTSSGCSAESANKTQSLDPLRA--EDPRGVKQLK  742

Query  1755  DRSSFDRKNSLRSDRLAGGAISSPKSDNKPTPRGEPSSLSSLNT---NRDYRALTSDNKP  1925
             + +  +RKNS  SD                 P   PS  +S +T     D +    D K 
Sbjct  743   EINVVNRKNSSISD----------------CPSISPSLSASTSTPFPKVDMKCKQHDRKS  786

Query  1926  VTISNSTS-GVAR-----------EVLKQASVDGV----SSANRVSSSEE-NPSQAIPKE  2054
               I +S++ G  R           EV KQ+S        + AN +  SE+  P Q + KE
Sbjct  787   NKIPDSSNVGTDRGSNNANNLGCKEVKKQSSFSSRTSGSTPANGLQKSEDPKPCQPVSKE  846

Query  2055  DSSSSSCVAERPSWSSNEVLPDGLSQSKESKAFGDKTRESS-ASRSKQNSTASGKIVSCQ  2231
             +  +S   A R   + +        Q+ ES    DKT++ + +S S+Q ++   +I+ CQ
Sbjct  847   NGCASFAAAARSCCNPDSTQRCSTPQAAESTHQDDKTKDHTFSSSSRQAASGGSRILHCQ  906

Query  2232  KCKGNGHLAQVCTADGPESSALG-SPFKSSREATNGPSDLKAAIEAARLRKPGICRKNRV  2408
              C   GH+ Q C  D P  SA+  S  ++ RE +N  S     +E     KP   +  R 
Sbjct  907   TCNETGHMTQFCAVDKPRISAVKPSAEQNLREGSNKNSKWNDVVEVTN-SKPRPLKSIRS  965

Query  2409  ADQSEDLSAS--NMKSEIASQDQMLSS-TVRRNV-------NGAE------EAQKQETAN  2540
               +SE++S S  +  S++ S+D    S +  RN+       NG E      +  K   A 
Sbjct  966   PHRSEEISTSGADQNSDVTSKDLPSGSLSCPRNLPSMEGTANGKEILRSCADFGKAAVAI  1025

Query  2541  NAKQLGIIAEASARTRNAGHV-------VFSDVKHSVIDMERQTLVSMPVILKTAIPEYQ  2699
             N K      E +      G++       V  +VK  +  +  Q  V    +  + IP+ +
Sbjct  1026  NVKHKTSYQEETVCVSKDGNINTVLNTSVKLNVKPHMQILPGQAFVLAHPLKASIIPKLE  1085

Query  2700  YIWQGGFEVQKSGKAFNLYDGIQAHLSSCASPKVLDAVNKFPRKVILNEVPRLSSWPMQF  2879
             +IWQGGF V ++     L +G+QAH S+  SPK L+A  +FP  + L EV R S+WP QF
Sbjct  1086  FIWQGGFNVLRTTGCSELCEGLQAHPSTSVSPKALEAAIQFPCIIQLEEVVRHSTWPAQF  1145

Query  2880  KECGVSEDNVALFFFAKDIGSYEKSYKVLLGDMVKHDLALQGNIGDIELLIFPSNQLPEK  3059
             +E    EDN+ALFFFAKDI SY+ +Y  LL +M+K+DLAL+GN+   ELLIFPSN LP+ 
Sbjct  1146  QENSPKEDNIALFFFAKDIESYKNNYSKLLENMLKNDLALRGNMDGAELLIFPSNLLPQN  1205

Query  3060  FQRWNLMFFLWGVFRGKRANSLQNFPGAE----------KPLIQDIPTPATS  3185
              QRWN   FLW VFR ++   L + P  +          +PL QD+P P  S
Sbjct  1206  SQRWNNFLFLWSVFRERKEKCLDDMPALQGKFNRPNLNMEPLDQDLPAPIIS  1257



>ref|XP_010941234.1| PREDICTED: uncharacterized protein LOC105059588 isoform X1 [Elaeis 
guineensis]
Length=1648

 Score =   345 bits (884),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 284/832 (34%), Positives = 418/832 (50%), Gaps = 111/832 (13%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNEHVNSG  1118
             CDICG  G+E LLAICSRC+DGAEH YCMQ ML+K+PEGDWLCEEC+  ++ +N+  +  
Sbjct  455   CDICGDAGQEELLAICSRCSDGAEHIYCMQMMLDKLPEGDWLCEECQLKEDTENQRADKS  514

Query  1119  R----------VNEKEKTSPSRRTTIAKSDHPLKMEQKTSDCWGDKAVEERSYLKTSGKR  1268
             +          +NEK+++S S        +  L+ ++  SD  G K ++     + S KR
Sbjct  515   QAASEMLEVPFLNEKDQSSGSMFNPKVLPN--LETKEINSDVKGAKGLQSS---QISSKR  569

Query  1269  CTDDSEVSSPTKRQRLELRSPTAQI--PNRVTSLSRESSFKNLERGKVKPLNPF-----S  1427
             CT++  V+S T  +  E    +  I  P + T LSRESSF N++ GKVKP N        
Sbjct  570   CTENIVVTSVTSNKVSEAGGGSIGITSPRKNTLLSRESSFNNMDVGKVKPANLLPSCGGQ  629

Query  1428  SGSFAAKVPSSTG----------PQPQPPRGIFSKSNSFSSLIAKPKVKLVDEVFPAKQK  1577
             SGS +  +  S             Q +  RGI SKS S S  +  PKVK + E  P +QK
Sbjct  630   SGSVSQPMAYSQASSGSNSSKIQAQFESTRGILSKSVS-SKSLKMPKVKQLIESVPIRQK  688

Query  1578  LSRETAFIES-KEVAVRSMGKSMSFKPTTASRSNCTESKVKMFSPKFSHDQDVKWLRHKK  1754
             +   T+  +S KE  V+++ KS SF+ T++  S  + +K +   P  +  +D + ++  K
Sbjct  689   V---TSLRDSRKEGLVKTIRKSASFRNTSSGCSAESANKTQSLDPLRA--EDPRGVKQLK  743

Query  1755  DRSSFDRKNSLRSDRLAGGAISSPKSDNKPTPRGEPSSLSSLNT---NRDYRALTSDNKP  1925
             + +  +RKNS  SD                 P   PS  +S +T     D +    D K 
Sbjct  744   EINVVNRKNSSISD----------------CPSISPSLSASTSTPFPKVDMKCKQHDRKS  787

Query  1926  VTISNSTS-GVAR-----------EVLKQASVDGV----SSANRVSSSEE-NPSQAIPKE  2054
               I +S++ G  R           EV KQ+S        + AN +  SE+  P Q + KE
Sbjct  788   NKIPDSSNVGTDRGSNNANNLGCKEVKKQSSFSSRTSGSTPANGLQKSEDPKPCQPVSKE  847

Query  2055  DSSSSSCVAERPSWSSNEVLPDGLSQSKESKAFGDKTRESS-ASRSKQNSTASGKIVSCQ  2231
             +  +S   A R   + +        Q+ ES    DKT++ + +S S+Q ++   +I+ CQ
Sbjct  848   NGCASFAAAARSCCNPDSTQRCSTPQAAESTHQDDKTKDHTFSSSSRQAASGGSRILHCQ  907

Query  2232  KCKGNGHLAQVCTADGPESSALG-SPFKSSREATNGPSDLKAAIEAARLRKPGICRKNRV  2408
              C   GH+ Q C  D P  SA+  S  ++ RE +N  S     +E     KP   +  R 
Sbjct  908   TCNETGHMTQFCAVDKPRISAVKPSAEQNLREGSNKNSKWNDVVEVTN-SKPRPLKSIRS  966

Query  2409  ADQSEDLSAS--NMKSEIASQDQMLSS-TVRRNV-------NGAE------EAQKQETAN  2540
               +SE++S S  +  S++ S+D    S +  RN+       NG E      +  K   A 
Sbjct  967   PHRSEEISTSGADQNSDVTSKDLPSGSLSCPRNLPSMEGTANGKEILRSCADFGKAAVAI  1026

Query  2541  NAKQLGIIAEASARTRNAGHV-------VFSDVKHSVIDMERQTLVSMPVILKTAIPEYQ  2699
             N K      E +      G++       V  +VK  +  +  Q  V    +  + IP+ +
Sbjct  1027  NVKHKTSYQEETVCVSKDGNINTVLNTSVKLNVKPHMQILPGQAFVLAHPLKASIIPKLE  1086

Query  2700  YIWQGGFEVQKSGKAFNLYDGIQAHLSSCASPKVLDAVNKFPRKVILNEVPRLSSWPMQF  2879
             +IWQGGF V ++     L +G+QAH S+  SPK L+A  +FP  + L EV R S+WP QF
Sbjct  1087  FIWQGGFNVLRTTGCSELCEGLQAHPSTSVSPKALEAAIQFPCIIQLEEVVRHSTWPAQF  1146

Query  2880  KECGVSEDNVALFFFAKDIGSYEKSYKVLLGDMVKHDLALQGNIGDIELLIFPSNQLPEK  3059
             +E    EDN+ALFFFAKDI SY+ +Y  LL +M+K+DLAL+GN+   ELLIFPSN LP+ 
Sbjct  1147  QENSPKEDNIALFFFAKDIESYKNNYSKLLENMLKNDLALRGNMDGAELLIFPSNLLPQN  1206

Query  3060  FQRWNLMFFLWGVFRGKRANSLQNFPGAE----------KPLIQDIPTPATS  3185
              QRWN   FLW VFR ++   L + P  +          +PL QD+P P  S
Sbjct  1207  SQRWNNFLFLWSVFRERKEKCLDDMPALQGKFNRPNLNMEPLDQDLPAPIIS  1258



>ref|XP_010941236.1| PREDICTED: uncharacterized protein LOC105059588 isoform X3 [Elaeis 
guineensis]
Length=1646

 Score =   345 bits (884),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 284/832 (34%), Positives = 418/832 (50%), Gaps = 111/832 (13%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNEHVNSG  1118
             CDICG  G+E LLAICSRC+DGAEH YCMQ ML+K+PEGDWLCEEC+  ++ +N+  +  
Sbjct  455   CDICGDAGQEELLAICSRCSDGAEHIYCMQMMLDKLPEGDWLCEECQLKEDTENQRADKS  514

Query  1119  R----------VNEKEKTSPSRRTTIAKSDHPLKMEQKTSDCWGDKAVEERSYLKTSGKR  1268
             +          +NEK+++S S        +  L+ ++  SD  G K ++     + S KR
Sbjct  515   QAASEMLEVPFLNEKDQSSGSMFNPKVLPN--LETKEINSDVKGAKGLQSS---QISSKR  569

Query  1269  CTDDSEVSSPTKRQRLELRSPTAQI--PNRVTSLSRESSFKNLERGKVKPLNPF-----S  1427
             CT++  V+S T  +  E    +  I  P + T LSRESSF N++ GKVKP N        
Sbjct  570   CTENIVVTSVTSNKVSEAGGGSIGITSPRKNTLLSRESSFNNMDVGKVKPANLLPSCGGQ  629

Query  1428  SGSFAAKVPSSTG----------PQPQPPRGIFSKSNSFSSLIAKPKVKLVDEVFPAKQK  1577
             SGS +  +  S             Q +  RGI SKS S S  +  PKVK + E  P +QK
Sbjct  630   SGSVSQPMAYSQASSGSNSSKIQAQFESTRGILSKSVS-SKSLKMPKVKQLIESVPIRQK  688

Query  1578  LSRETAFIES-KEVAVRSMGKSMSFKPTTASRSNCTESKVKMFSPKFSHDQDVKWLRHKK  1754
             +   T+  +S KE  V+++ KS SF+ T++  S  + +K +   P  +  +D + ++  K
Sbjct  689   V---TSLRDSRKEGLVKTIRKSASFRNTSSGCSAESANKTQSLDPLRA--EDPRGVKQLK  743

Query  1755  DRSSFDRKNSLRSDRLAGGAISSPKSDNKPTPRGEPSSLSSLNT---NRDYRALTSDNKP  1925
             + +  +RKNS  SD                 P   PS  +S +T     D +    D K 
Sbjct  744   EINVVNRKNSSISD----------------CPSISPSLSASTSTPFPKVDMKCKQHDRKS  787

Query  1926  VTISNSTS-GVAR-----------EVLKQASVDGV----SSANRVSSSEE-NPSQAIPKE  2054
               I +S++ G  R           EV KQ+S        + AN +  SE+  P Q + KE
Sbjct  788   NKIPDSSNVGTDRGSNNANNLGCKEVKKQSSFSSRTSGSTPANGLQKSEDPKPCQPVSKE  847

Query  2055  DSSSSSCVAERPSWSSNEVLPDGLSQSKESKAFGDKTRESS-ASRSKQNSTASGKIVSCQ  2231
             +  +S   A R   + +        Q+ ES    DKT++ + +S S+Q ++   +I+ CQ
Sbjct  848   NGCASFAAAARSCCNPDSTQRCSTPQAAESTHQDDKTKDHTFSSSSRQAASGGSRILHCQ  907

Query  2232  KCKGNGHLAQVCTADGPESSALG-SPFKSSREATNGPSDLKAAIEAARLRKPGICRKNRV  2408
              C   GH+ Q C  D P  SA+  S  ++ RE +N  S     +E     KP   +  R 
Sbjct  908   TCNETGHMTQFCAVDKPRISAVKPSAEQNLREGSNKNSKWNDVVEVTN-SKPRPLKSIRS  966

Query  2409  ADQSEDLSAS--NMKSEIASQDQMLSS-TVRRNV-------NGAE------EAQKQETAN  2540
               +SE++S S  +  S++ S+D    S +  RN+       NG E      +  K   A 
Sbjct  967   PHRSEEISTSGADQNSDVTSKDLPSGSLSCPRNLPSMEGTANGKEILRSCADFGKAAVAI  1026

Query  2541  NAKQLGIIAEASARTRNAGHV-------VFSDVKHSVIDMERQTLVSMPVILKTAIPEYQ  2699
             N K      E +      G++       V  +VK  +  +  Q  V    +  + IP+ +
Sbjct  1027  NVKHKTSYQEETVCVSKDGNINTVLNTSVKLNVKPHMQILPGQAFVLAHPLKASIIPKLE  1086

Query  2700  YIWQGGFEVQKSGKAFNLYDGIQAHLSSCASPKVLDAVNKFPRKVILNEVPRLSSWPMQF  2879
             +IWQGGF V ++     L +G+QAH S+  SPK L+A  +FP  + L EV R S+WP QF
Sbjct  1087  FIWQGGFNVLRTTGCSELCEGLQAHPSTSVSPKALEAAIQFPCIIQLEEVVRHSTWPAQF  1146

Query  2880  KECGVSEDNVALFFFAKDIGSYEKSYKVLLGDMVKHDLALQGNIGDIELLIFPSNQLPEK  3059
             +E    EDN+ALFFFAKDI SY+ +Y  LL +M+K+DLAL+GN+   ELLIFPSN LP+ 
Sbjct  1147  QENSPKEDNIALFFFAKDIESYKNNYSKLLENMLKNDLALRGNMDGAELLIFPSNLLPQN  1206

Query  3060  FQRWNLMFFLWGVFRGKRANSLQNFPGAE----------KPLIQDIPTPATS  3185
              QRWN   FLW VFR ++   L + P  +          +PL QD+P P  S
Sbjct  1207  SQRWNNFLFLWSVFRERKEKCLDDMPALQGKFNRPNLNMEPLDQDLPAPIIS  1258



>ref|XP_010463720.1| PREDICTED: uncharacterized protein LOC104744372 isoform X1 [Camelina 
sativa]
Length=1139

 Score =   335 bits (859),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 273/776 (35%), Positives = 389/776 (50%), Gaps = 155/776 (20%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNEHVNSG  1118
             CD CG  GRE LLAICSRC+DGAEHTYCM+ ML+K+P+GDWLCEECKF +E         
Sbjct  212   CDTCGDAGREDLLAICSRCSDGAEHTYCMRVMLKKVPKGDWLCEECKFAEEA--------  263

Query  1119  RVNEKEKTSPSRRTTIAKSDHPLKMEQKTSDCWGDKAVEERSYLKTSGKRCTDDSEVSSP  1298
                EK+K       T AK +  + +  ++S                  KR  D  E +  
Sbjct  264   ---EKKKLE-----TKAKRESAVNLNTQSS-----------------SKRHMDKFEAAPD  298

Query  1299  TKRQRLE--LRSPTAQIPNRVTSLSRESSFKNLERGKVKPLNPFSSGSFAAKVPSST---  1463
             +KR  +E    SP   +  R ++LSRE+SFK LE+   K  +  S  S ++    ST   
Sbjct  299   SKRLAVEAPTGSPKRSVLPRSSALSRETSFKGLEKPTRKLAHHSSFNSHSSDDSESTRSP  358

Query  1464  GPQPQPPRGIFSKSNSFSSLIAKPKVKLVDEVFPAKQKLSRETAFIESKEVAVRSMGKSM  1643
               Q + P+G F KSNSF+S  ++PKV+ VD+V   +QK  ++ + ++ KE   R++GKSM
Sbjct  359   DSQLRSPKGSFFKSNSFNSSSSRPKVRTVDDVMLPRQKTGKDNSSLDLKEGFSRNVGKSM  418

Query  1644  SFKPTTASRSNCTESKVKMFSPKFSHDQDVKWLRHKKDRSSFDRKNSLRSDRLAGGAISS  1823
             S +      S+C +SKV             K L+                DR      S+
Sbjct  419   SSRCIDVGSSSCYDSKV----------NGTKQLK----------------DRSIEANPSA  452

Query  1824  PKSDNKPTPRGEPSSLSSLNTNRDYRALTSDNKPVTISNSTSGVAREVLKQ--ASVDGVS  1997
                D K   RG  SS S   + RD + L SD +  +++     ++R  L+   ASV   S
Sbjct  453   STIDQKLISRGRSSS-SYAKSPRDLKDLESDGQQGSLTKQARHLSRNRLEDIVASVGDSS  511

Query  1998  SANRVSSSEENPSQAIPKEDSSSSSCVAERPSWSSNEVLPDGLSQSKESKAFGDKTRESS  2177
             +  + SSSE              + C  E  +        DGL + +E +  G+K+++++
Sbjct  512   TNEKCSSSE--------------AKCKNELANV-------DGLLRPREVREAGEKSKDAA  550

Query  2178  ASRSKQNSTASGKIVSCQKCKGNGHLAQVCTADGPESSALGSPFKSSREATNGPSDLKAA  2357
                                  GN     +                  RE  N  + L+AA
Sbjct  551   ---------------------GNHQTLNI------------------REDINKGNRLRAA  571

Query  2358  IEAARLRKPGICRKNRVADQSEDLSASNMKSEIASQDQMLSSTVR---------RNVNGA  2510
             ++AA  +KP    K+R  +QS+  S SN+ S      + +SS V          + + G 
Sbjct  572   VDAALRKKPNFG-KSRGLEQSDLPSVSNVDSGCDKALRNMSSKVPVIRDWPVGFKGLPGG  630

Query  2511  EE---AQKQETANNAKQLGIIAEASARTRNAGHVVFSDVK-HSVIDMERQTLVSMPVILK  2678
                    KQ  A N  Q    A+A A    A   V  +V   S+  + R   V+ P +L 
Sbjct  631   HPNLGTDKQTIAVNGTQSLPGADAMA----ASLSVVPEVHVPSIKPVMRDFPVAAPAVLS  686

Query  2679  T--AIPEYQYIWQGGFEVQKSGKAFNLYDGIQAHLSSCASPKVLDAVNKFPRKVILNEVP  2852
             T  AIPE +YIWQG  EV+KS     +++G+QA+LS+ ASPKV++ VN+FP  + LNEVP
Sbjct  687   TTSAIPEPEYIWQGDLEVEKSRNLSRMHNGMQAYLSTLASPKVVEVVNQFPVILTLNEVP  746

Query  2853  RLSSWPMQFKECGVSEDNVALFFFAKDIGSYEKSYKVLLGDMVKHDLALQGNIGDIELLI  3032
             RLS+WP QF++ G  E +VALFFFAKDI SYEK+YK L+ +M++ DLAL+GN+  +ELL+
Sbjct  747   RLSAWPAQFQDLGAKEQHVALFFFAKDIESYEKNYKPLVDNMIQKDLALKGNLEGVELLV  806

Query  3033  FPSNQLPEKFQRWNLMFFLWGVFRGKRANSLQNFPGAEKPLIQDIPTPATSLPENM  3200
             F SNQLP   QRWN+++FLWGVFRG R  S  N      PL +  P PA+ +  NM
Sbjct  807   FASNQLPRDCQRWNMLYFLWGVFRG-RNQSCSN------PL-KSTPLPASCVLPNM  854



>ref|XP_010463721.1| PREDICTED: uncharacterized protein LOC104744372 isoform X2 [Camelina 
sativa]
Length=1099

 Score =   334 bits (857),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 273/776 (35%), Positives = 389/776 (50%), Gaps = 155/776 (20%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNEHVNSG  1118
             CD CG  GRE LLAICSRC+DGAEHTYCM+ ML+K+P+GDWLCEECKF +E         
Sbjct  172   CDTCGDAGREDLLAICSRCSDGAEHTYCMRVMLKKVPKGDWLCEECKFAEEA--------  223

Query  1119  RVNEKEKTSPSRRTTIAKSDHPLKMEQKTSDCWGDKAVEERSYLKTSGKRCTDDSEVSSP  1298
                EK+K       T AK +  + +  ++S                  KR  D  E +  
Sbjct  224   ---EKKKLE-----TKAKRESAVNLNTQSS-----------------SKRHMDKFEAAPD  258

Query  1299  TKRQRLE--LRSPTAQIPNRVTSLSRESSFKNLERGKVKPLNPFSSGSFAAKVPSST---  1463
             +KR  +E    SP   +  R ++LSRE+SFK LE+   K  +  S  S ++    ST   
Sbjct  259   SKRLAVEAPTGSPKRSVLPRSSALSRETSFKGLEKPTRKLAHHSSFNSHSSDDSESTRSP  318

Query  1464  GPQPQPPRGIFSKSNSFSSLIAKPKVKLVDEVFPAKQKLSRETAFIESKEVAVRSMGKSM  1643
               Q + P+G F KSNSF+S  ++PKV+ VD+V   +QK  ++ + ++ KE   R++GKSM
Sbjct  319   DSQLRSPKGSFFKSNSFNSSSSRPKVRTVDDVMLPRQKTGKDNSSLDLKEGFSRNVGKSM  378

Query  1644  SFKPTTASRSNCTESKVKMFSPKFSHDQDVKWLRHKKDRSSFDRKNSLRSDRLAGGAISS  1823
             S +      S+C +SKV             K L+                DR      S+
Sbjct  379   SSRCIDVGSSSCYDSKV----------NGTKQLK----------------DRSIEANPSA  412

Query  1824  PKSDNKPTPRGEPSSLSSLNTNRDYRALTSDNKPVTISNSTSGVAREVLKQ--ASVDGVS  1997
                D K   RG  SS S   + RD + L SD +  +++     ++R  L+   ASV   S
Sbjct  413   STIDQKLISRGRSSS-SYAKSPRDLKDLESDGQQGSLTKQARHLSRNRLEDIVASVGDSS  471

Query  1998  SANRVSSSEENPSQAIPKEDSSSSSCVAERPSWSSNEVLPDGLSQSKESKAFGDKTRESS  2177
             +  + SSSE              + C  E  +        DGL + +E +  G+K+++++
Sbjct  472   TNEKCSSSE--------------AKCKNELANV-------DGLLRPREVREAGEKSKDAA  510

Query  2178  ASRSKQNSTASGKIVSCQKCKGNGHLAQVCTADGPESSALGSPFKSSREATNGPSDLKAA  2357
                                  GN     +                  RE  N  + L+AA
Sbjct  511   ---------------------GNHQTLNI------------------REDINKGNRLRAA  531

Query  2358  IEAARLRKPGICRKNRVADQSEDLSASNMKSEIASQDQMLSSTVR---------RNVNGA  2510
             ++AA  +KP    K+R  +QS+  S SN+ S      + +SS V          + + G 
Sbjct  532   VDAALRKKPNFG-KSRGLEQSDLPSVSNVDSGCDKALRNMSSKVPVIRDWPVGFKGLPGG  590

Query  2511  EE---AQKQETANNAKQLGIIAEASARTRNAGHVVFSDVK-HSVIDMERQTLVSMPVILK  2678
                    KQ  A N  Q    A+A A    A   V  +V   S+  + R   V+ P +L 
Sbjct  591   HPNLGTDKQTIAVNGTQSLPGADAMA----ASLSVVPEVHVPSIKPVMRDFPVAAPAVLS  646

Query  2679  T--AIPEYQYIWQGGFEVQKSGKAFNLYDGIQAHLSSCASPKVLDAVNKFPRKVILNEVP  2852
             T  AIPE +YIWQG  EV+KS     +++G+QA+LS+ ASPKV++ VN+FP  + LNEVP
Sbjct  647   TTSAIPEPEYIWQGDLEVEKSRNLSRMHNGMQAYLSTLASPKVVEVVNQFPVILTLNEVP  706

Query  2853  RLSSWPMQFKECGVSEDNVALFFFAKDIGSYEKSYKVLLGDMVKHDLALQGNIGDIELLI  3032
             RLS+WP QF++ G  E +VALFFFAKDI SYEK+YK L+ +M++ DLAL+GN+  +ELL+
Sbjct  707   RLSAWPAQFQDLGAKEQHVALFFFAKDIESYEKNYKPLVDNMIQKDLALKGNLEGVELLV  766

Query  3033  FPSNQLPEKFQRWNLMFFLWGVFRGKRANSLQNFPGAEKPLIQDIPTPATSLPENM  3200
             F SNQLP   QRWN+++FLWGVFRG R  S  N      PL +  P PA+ +  NM
Sbjct  767   FASNQLPRDCQRWNMLYFLWGVFRG-RNQSCSN------PL-KSTPLPASCVLPNM  814



>ref|XP_010485621.1| PREDICTED: uncharacterized protein LOC104763913 [Camelina sativa]
Length=1146

 Score =   333 bits (854),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 265/756 (35%), Positives = 381/756 (50%), Gaps = 144/756 (19%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNEHVNSG  1118
             CDICG  GRE LLAICSRC+DGAEHTYCM+ ML+K+P+GDWLCEECKF ++ K E     
Sbjct  211   CDICGDAGREDLLAICSRCSDGAEHTYCMRVMLKKVPKGDWLCEECKFAEKKKLE-----  265

Query  1119  RVNEKEKTSPSRRTTIAKSDHPLKMEQKTSDCWGDKAVEERSYLKTSGKRCTDDSEVSSP  1298
                           T  K +  + +                   ++S KR  D  E +  
Sbjct  266   --------------TKGKRESAVNLN-----------------TQSSSKRHIDKFEAAPD  294

Query  1299  TKRQRLE--LRSPTAQIPNRVTSLSRESSFKNLERGKVKPLNPFSSGSFAAKVPSST---  1463
             +KR  +E    SP   +  R ++LSRE+SFK LE+   K  +  S  S ++    ST   
Sbjct  295   SKRLAVEAPTGSPKRSVLPRSSTLSRETSFKGLEKPTRKLAHHSSFNSHSSDDSESTRSP  354

Query  1464  GPQPQPPRGIFSKSNSFSSLIAKPKVKLVDEVFPAKQKLSRETAFIESKEVAVRSMGKSM  1643
               Q + P+G F KSNSF+S  ++PKV+ VD+V   +QK+ ++ + ++ KE   R+ GKSM
Sbjct  355   DSQLRSPKGSFFKSNSFNSSSSRPKVRPVDDVMLPRQKIGKDNSSLDVKEGFSRNAGKSM  414

Query  1644  SFKPTTASRSNCTESKVKMFSPKFSHDQDVKWLRHKKDRSSFDRKNSLRSDRLAGGAISS  1823
             S +      S+C +SKV             K L+                DR      S+
Sbjct  415   SSRCIDVGSSSCYDSKV----------NGTKQLK----------------DRSIEANPSA  448

Query  1824  PKSDNKPTPRGEPSSLSSLNTNRDYRALTSDNKPVTISNSTSGVAREVLKQASVDGVSSA  2003
                D K   RG  SS S   + RD + L SD +  +++     ++R  L+    D V+S 
Sbjct  449   STIDQKLISRGRSSS-SYAKSPRDLKDLDSDGQQGSLTKQARHLSRNRLE----DIVAS-  502

Query  2004  NRVSSSEENPSQAIPKEDSSSSSCVAERPSWSSNEVLPDGLSQSKESKAFGDKTRESSAS  2183
               V  S  N   +  +  SS + C  E  +        DGL + +E +  G+K++++   
Sbjct  503   --VGDSSTNEKCSSSECSSSEAKCKNELANV-------DGLLRPREVREAGEKSKDAV--  551

Query  2184  RSKQNSTASGKIVSCQKCKGNGHLAQVCTADGPESSALGSPFKSSREATNGPSDLKAAIE  2363
                                GN     +                   E  N  + L+AA++
Sbjct  552   -------------------GNHQTLSIM------------------EDNNKGNRLRAAVD  574

Query  2364  AARLRKPGICRKNRVADQSEDLSASNMKSEIASQDQMLSSTVR---------RNVNGAE-  2513
             AA  +KP    K+R  +QS+  S SN+ S      + +SS V          + + G   
Sbjct  575   AALRKKPSFG-KSRGLEQSDLPSVSNVDSGCDKALRNMSSKVPVIRDWPVGFKGLPGGHP  633

Query  2514  --EAQKQETANNAKQLGIIAEASARTRNAGHVVFSDVK-HSVIDMERQTLVSMPVILKT-  2681
                  KQ  A N  Q    ++A A    A   V  +V   S+  + R   V  P +L T 
Sbjct  634   DLRTDKQTIAVNGTQSLAGSDAMA----ASQSVVPEVHVPSIKPVMRDLPVVAPAVLSTT  689

Query  2682  -AIPEYQYIWQGGFEVQKSGKAFNLYDGIQAHLSSCASPKVLDAVNKFPRKVILNEVPRL  2858
              AIPE +YIWQG  EVQKS     +++G+QA+LS+ ASPKV++ VN+FP K+ LNEVPRL
Sbjct  690   SAIPEPEYIWQGDLEVQKSRNLSTMHNGMQAYLSTLASPKVVEVVNQFPVKLTLNEVPRL  749

Query  2859  SSWPMQFKECGVSEDNVALFFFAKDIGSYEKSYKVLLGDMVKHDLALQGNIGDIELLIFP  3038
             S+WP QF++ G  E +VALFFFAKDI SYEK+YK L+ +M++ DLAL+GN+  +ELLIF 
Sbjct  750   SAWPAQFQDIGAKEQHVALFFFAKDIESYEKNYKPLVDNMIQKDLALKGNLEGVELLIFA  809

Query  3039  SNQLPEKFQRWNLMFFLWGVFRGKR---ANSLQNFP  3137
             SNQLP   QRWN+++FLWGVFRG++   +N L++ P
Sbjct  810   SNQLPRDCQRWNMLYFLWGVFRGRKQSCSNPLKSTP  845



>ref|XP_006300137.1| hypothetical protein CARUB_v10016366mg [Capsella rubella]
 gb|EOA33035.1| hypothetical protein CARUB_v10016366mg [Capsella rubella]
Length=1135

 Score =   331 bits (848),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 270/757 (36%), Positives = 381/757 (50%), Gaps = 151/757 (20%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNEHVNSG  1118
             CD CG  GRE LLAICSRC+DGAEHTYCM+ ML+K+P+GDWLCEECKF            
Sbjct  215   CDTCGDAGREDLLAICSRCSDGAEHTYCMRVMLKKVPKGDWLCEECKF-----------A  263

Query  1119  RVNEKEKTSPSRRTTIAKSDHPLKMEQKTSDCWGDKAVEERSYLKTSGKRCTDDSEVSSP  1298
              V EK+K       T  K +  + M  + S                  KR  D  E +  
Sbjct  264   EVAEKKKLE-----TKGKRESAVNMNTQNS-----------------SKRHIDRFEAALD  301

Query  1299  TKRQRLE--LRSPTAQIPNRVTSLSRESSFKNLERGKVKPLNPFSSGSFAAKVPSST---  1463
             +KR  +E    SP   +  R+++LSRE+SFK LE+   K  +  S  S ++    ST   
Sbjct  302   SKRLAVEAPTGSPKRAVLPRLSALSRETSFKGLEKPTRKLAHHSSFNSHSSDDSESTRSP  361

Query  1464  GPQPQPPRGIFSKSNSFSSLIAKPKVKLVDEVFPAKQKLSRETAFIESKEVAVRSMGKSM  1643
               Q Q P+G   KSNSF+S  ++PKV+ VD+V   +QK  ++ +  + KE   R++GKSM
Sbjct  362   DSQLQSPKGSIFKSNSFNSSSSRPKVRPVDDV--PRQKTGKDNSSRDIKEGFSRNVGKSM  419

Query  1644  SFKPTTASRSNCTESKVKMFSPKFSHDQDVKWLRHKKDRSSFDRKNSLRSDRLAGGAISS  1823
             S +      S+C +SKV             K L+                DR      S+
Sbjct  420   SSRCVDLGSSSCIDSKV----------NSTKQLK----------------DRNTEANPSA  453

Query  1824  PKSDNKPTPRGEPSSLSSLNTNRDYRALTSDNKPVTISNSTSGVAREVLKQ--ASVDGVS  1997
                D K   RG  SS S   + RD + L SD +  +++     ++R  L+   ASV G S
Sbjct  454   STIDQKLISRGSWSS-SYAKSPRDLKDLQSDGQQGSLTKQARHLSRNRLEDIVASV-GDS  511

Query  1998  SANRVSSSEENPSQAIPKEDSSSSSCVAERPSWSSNEVLPDGLSQSKESKAFGDKTRESS  2177
             S N   SS E              +C         NE+  DGL +S+E +  G+K+++  
Sbjct  512   STNEKCSSGE-------------VTC--------KNELNVDGLPRSREVREAGEKSKD--  548

Query  2178  ASRSKQNSTASGKIVSCQKCKGNGHLAQVCTADGPESSALGSPFKSSREATNGPSDLKAA  2357
                          +V      GN  +  +                  RE  N  + L+AA
Sbjct  549   -------------VV------GNHQMLNI------------------REDINKGNRLRAA  571

Query  2358  IEAARLRKPGICRKNRVADQSEDLSASNMKSEIASQDQMLSSTV---------RRNVNGA  2510
             ++AA  +KP    K+R  +QS+  S SN+ S      + LSS V          + + G 
Sbjct  572   VDAALRKKPSF-SKSRGLEQSDLPSVSNVDSVCNKAVRSLSSKVPVIRDWPVGFKGLPGG  630

Query  2511  E---EAQKQETANNAKQLGIIAEASARTRNAGHVVFSDVKHSVIDMERQTLVSMPVILKT  2681
                    KQ  A +  Q    A+A   +++A   V      S+  + R   V+ P +  T
Sbjct  631   HPNLRTDKQTIAVDGTQSLAGADAMPASQSAVPEVHVP---SIKPVMRDFPVATPAVPST  687

Query  2682  A--IPEYQYIWQGGFEVQKSGKAFNLYDGIQAHLSSCASPKVLDAVNKFPRKVILNEVPR  2855
                IPE++YIWQG  EVQKS     ++ G+QA+LS+ ASPKV++ VN+FP K+ LNEVPR
Sbjct  688   TSTIPEHEYIWQGDLEVQKSRNLSVMHSGMQAYLSTLASPKVVEVVNQFPVKLSLNEVPR  747

Query  2856  LSSWPMQFKECGVSEDNVALFFFAKDIGSYEKSYKVLLGDMVKHDLALQGNIGDIELLIF  3035
             LS+WP QF++ G +E +VALFFFAKDI SYEK+YK L+ +M++ DLAL+GN+  +EL+IF
Sbjct  748   LSTWPAQFQDIGATEHHVALFFFAKDIESYEKNYKPLVDNMIQKDLALKGNLEGVELMIF  807

Query  3036  PSNQLPEKFQRWNLMFFLWGVFRGKR---ANSLQNFP  3137
              SNQLP   QRWN+ +FLWGVFRGK+   +N L+  P
Sbjct  808   ASNQLPWDCQRWNMFYFLWGVFRGKKKSCSNPLKTTP  844



>ref|XP_010063514.1| PREDICTED: uncharacterized protein LOC104450589 isoform X2 [Eucalyptus 
grandis]
Length=1583

 Score =   334 bits (857),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 233/613 (38%), Positives = 316/613 (52%), Gaps = 59/613 (10%)
 Frame = +3

Query  1350  RVTSLSRESSFKNLERGKVKPLNPFSSGSFAAKVP-SSTGPQPQPPR--GIFSKSNSFSS  1520
             RVTS SR+S FKN+++GK K     S  +     P  +  PQP   R  G   KSNSF++
Sbjct  404   RVTS-SRDSCFKNIDKGKAKLARQMSCVNSVQDFPEGARSPQPSNLRSKGTLLKSNSFNA  462

Query  1521  LIAKPKVKLVDEVFPAKQKLSRETAFIESKEVAVRSMGKSMSFKPTTASRSNCTESKVKM  1700
              IAKPKVK++DE    K K  RE +   SKE   + +GKSMSFK     R    ++KVKM
Sbjct  463   FIAKPKVKVIDEGMIQKHKSIRENSSFISKEGPTKIIGKSMSFKHANPGRPLAVDAKVKM  522

Query  1701  FSPKFSHDQDVKWLRHKKDRSSFDRKNSLRSDRLAGGAI------SSPKSDNKPTPRGEP  1862
                K +H Q  K  ++ K+ S  DR +  + DR            S+P SD K T  GEP
Sbjct  523   LPTKLTHVQTPKGSKNLKEGSVLDRMSLRKLDRTFSSLTRDNSTPSTPNSDQKLTSCGEP  582

Query  1863  SSLSSLNTNRDYRALTSDNKPVTISNSTSGVAREVLKQASVDGVSSANRVSSSEENPSQA  2042
                S L+ NRD +   SD KP  +                         V S+E   +Q 
Sbjct  583   LQGSPLSNNRDSKLAQSDVKPAVL-------------------------VKSAEYKSNQL  617

Query  2043  IPKEDS-SSSSCVAERPSWSSNEVLPDGLSQSKESKAFGDKTRESSASRSKQNSTASGKI  2219
               KE+  +SSS   E+     N +  DGLS+SK      DK R+ S SRSK    +  + 
Sbjct  618   DQKEEPLTSSSRTVEKHCIEGNGLRHDGLSRSKGLANHTDKARDCSVSRSKPAVISGSRS  677

Query  2220  VSCQKCKGNGHLAQVCTADGPESSALGSPFKSSREATNGPSDLKAAIEAARLRKPGICRK  2399
             + CQKCK  GH A+ C     +     S  +S +E T   S  K  I ++ L+KPG  R+
Sbjct  678   IFCQKCKEVGHDAESCPVSSLQVGTDVSMTRSMKEETYNSSKTKTPITSSMLKKPG--RR  735

Query  2400  NRVADQSEDLSASNMKSEIASQDQMLSSTVRRNV---NGAEEAQK-----------QETA  2537
             N+  ++SEDLS S+        D +    V R V   +G  E Q            Q   
Sbjct  736   NKGPEKSEDLSVSSP----THMDPLSFPDVSRKVMSADGPYEGQAVRQSCTSDSRLQMIG  791

Query  2538  NNAKQLGIIAEASARTRNAGHVVFSDVKHSVIDMERQTLVSMP--VILKTAIPEYQYIWQ  2711
             NNA QL    +  A +    ++ F+             +  +P  +   +AIPE++ IW+
Sbjct  792   NNATQL-TGPQKGATSLKGANIDFTRHPEGSSSSHLPCVSVLPSAICRISAIPEHECIWR  850

Query  2712  GGFEVQKSGKAFNLYDGIQAHLSSCASPKVLDAVNKFPRKVILNEVPRLSSWPMQFKECG  2891
             G  EV +  +  +   G+QAHLS+ AS +VLD V KF  K+ L+EVPR  +WP QF + G
Sbjct  851   GSLEVCRGSQQLDFCGGLQAHLSTLASTRVLDMVKKFSDKLSLSEVPRSCTWPTQFYDSG  910

Query  2892  VSEDNVALFFFAKDIGSYEKSYKVLLGDMVKHDLALQGNIGDIELLIFPSNQLPEKFQRW  3071
               +DN+AL+FFA+D  SYE+SYK LL  M+K DLAL+GN   +ELLIFPSNQLPEK QRW
Sbjct  911   AQDDNIALYFFAEDPESYERSYKGLLEKMIKSDLALKGNFDGVELLIFPSNQLPEKSQRW  970

Query  3072  NLMFFLWGVFRGK  3110
             N +F+LWGVFRG+
Sbjct  971   NTLFYLWGVFRGR  983


 Score =   102 bits (255),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 40/55 (73%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNE  1103
             CDICG  GRE LLAICSRC+DGAEHTYCM++ML+K+PEGDW+CEECK   E +N+
Sbjct  329   CDICGDAGREDLLAICSRCSDGAEHTYCMREMLQKVPEGDWVCEECKSADENENQ  383


 Score = 91.3 bits (225),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 88/242 (36%), Positives = 128/242 (53%), Gaps = 14/242 (6%)
 Frame = +3

Query  3732  TLNVISSFGVNPKKRSHS--AETVLQsasssgtsqafssysNDDILVEEFCHKRVKLNSD  3905
             TL+V+     + KKR HS   ET LQ++  +    A+++ S++++ +E    K+ K +  
Sbjct  1344  TLDVLKHLQ-HEKKRRHSDLVETALQTSFGTNEKVAWNNVSSENVKIEHV-DKKQKTDCR  1401

Query  3906  RSYGCNDQTSCS-KDGFLSEMGGTASQLSRQKNERDEALSKTAILETPGNAEMFFFPVDP  4082
               Y  +     +  DGF S+     S L+  +   ++   +   LE  G AE FFFPV  
Sbjct  1402  EIYEASRPIDANLVDGFASQKSAQDSTLAVVEKLHNKVCDEPINLENTGTAERFFFPVLS  1461

Query  4083  HPVGNIGSNNSSMPWKVHPLE-EDQLHDKAPNLELALGAKTKPLMSGIPSFLSGKVEKKI  4259
             +   ++ S  SSMPWK  P     + HD  PNL+LALGAKTK    G+     G     +
Sbjct  1462  NHAKDLTSAESSMPWKTLPSSVPARSHDGVPNLDLALGAKTKSSNKGLLPLWIG-----V  1516

Query  4260  IEENTSDNAATSANKED-VsaslslslsFPFPEKEHGTSSKPEQED--PRRRQANTSLLL  4430
              +++ S   A +A +ED VS SLSLSLSFPFP+ + G    P+ E   P  R+ NTSLLL
Sbjct  1517  ADKSDSHPEAVAAQEEDPVSGSLSLSLSFPFPDSDKGFKPVPDAEQLLPESRRVNTSLLL  1576

Query  4431  FG  4436
             FG
Sbjct  1577  FG  1578



>ref|XP_010502842.1| PREDICTED: uncharacterized protein LOC104779880 isoform X4 [Camelina 
sativa]
Length=980

 Score =   320 bits (819),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 255/749 (34%), Positives = 366/749 (49%), Gaps = 155/749 (21%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNEHVNSG  1118
             CDICG  GRE LLAICSRC+DGAEHTYCM+ ML+K+P+GDWLCEECKF +E K + + + 
Sbjct  197   CDICGDAGREDLLAICSRCSDGAEHTYCMRVMLKKVPKGDWLCEECKFAEEAKKKKLETK  256

Query  1119  RVNEKEKTSPSRRTTIAKSDHPLKMEQKTSDCWGDKAVEERSYLKTSGKRCTDDSEVSSP  1298
               +E                                AV   +  ++S KR  D  E +  
Sbjct  257   GKSES-------------------------------AVNLST--QSSSKRHIDKFEAAPD  283

Query  1299  TKRQRLE--LRSPTAQIPNRVTSLSRESSFKNLERGKVKPLNPFSSGSFAAK-----VPS  1457
             +KR  +E    +P   +  R ++LSRE+SFK LE    KP    +  S         + S
Sbjct  284   SKRLAVEAPTGAPKRSVLPRSSTLSRETSFKGLE----KPTRKLAHHSSFNSHSSDDLES  339

Query  1458  STGPQPQ--PPRGIFSKSNSFSSLIAKPKVKLVDEVFPAKQKLSRETAFIESKEVAVRSM  1631
             +  P  Q   P+G F KSNSF+S  ++PKV+ VD+V   +QK  ++   ++      R++
Sbjct  340   TRSPDSQLRSPKGSFLKSNSFNSSSSRPKVRPVDDVMLPRQKTGKDNCSLD----VSRNV  395

Query  1632  GKSMSFKPTTASRSNCTESKVKMFSPKFSHDQDVKWLRHKKDRSSFDRKNSLRSDRLAGG  1811
             GKSMS +      S+C +SKV    P                            DR    
Sbjct  396   GKSMSNRCIDVGSSSCYDSKVNGTKP--------------------------LKDRSIEA  429

Query  1812  AISSPKSDNKPTPRGEPSSLSSLNTNRDYRALTSDNKPVTISNSTSGVAREVLKQASVDG  1991
               S+   D K   RG  SS S   + RD + L SD +   ++     ++R  L+    D 
Sbjct  430   NPSASTIDQKLISRGRSSS-SYAKSPRDLKDLESDGQQGRLTKQARHLSRNRLE----DI  484

Query  1992  VSSANRVSSSEENPSQAIPKEDSSSSSCVAERPSWSSNEVLPDGLSQSKESKAFGDKTRE  2171
             V+S    S++E+               C +    + +     DG  + +E +  G+K+++
Sbjct  485   VASVGDSSTNEK---------------CSSSEAKYKNELANVDGFPRPREVREAGEKSKD  529

Query  2172  SSASRSKQNSTASGKIVSCQKCKGNGHLAQVCTADGPESSALGSPFKSSREATNGPSDLK  2351
             +                      GN     +                  RE  N  + L+
Sbjct  530   AV---------------------GNHQTLNI------------------REDNNKGNRLR  550

Query  2352  AAIEAARLRKPGICRKNRVADQSEDLSASNMKSEIASQDQMLSSTV---------RRNVN  2504
             AA++AA  +KP    K R  +QS+  S SN+ S      + +SS V          + + 
Sbjct  551   AAVDAALRKKPSF-SKGRGLEQSDLPSVSNVDSGCDKALRNMSSKVPVIRDWPVGFKGLP  609

Query  2505  GAE---EAQKQETANNAKQLGIIAEASARTRNAGHVVFSDVK-HSVIDMERQTLVSMPVI  2672
             G        KQ  A N  Q    A+A A    A   V  +V   S+  + R   V+ P +
Sbjct  610   GGHPNLRTDKQTIAVNGTQSLAGADAMA----ASQSVVPEVHVPSIKPVMRDLPVAAPAV  665

Query  2673  LKT--AIPEYQYIWQGGFEVQKSGKAFNLYDGIQAHLSSCASPKVLDAVNKFPRKVILNE  2846
             L T  AIPE +YIWQG  EVQKS     +++G+QA+LS+ ASPKV++ VN+FP K+ LNE
Sbjct  666   LSTTSAIPEPEYIWQGDLEVQKSRNLSTMHNGMQAYLSTLASPKVVEVVNQFPVKLTLNE  725

Query  2847  VPRLSSWPMQFKECGVSEDNVALFFFAKDIGSYEKSYKVLLGDMVKHDLALQGNIGDIEL  3026
             VPRLS+WP QF++ G  E +VALFFFAKDI SYEK+YK L+ +M++ DLAL+GN+  +EL
Sbjct  726   VPRLSAWPAQFQDIGAKEQHVALFFFAKDIKSYEKNYKPLVDNMIQKDLALKGNLEGVEL  785

Query  3027  LIFPSNQLPEKFQRWNLMFFLWGVFRGKR  3113
             LIF SN LP   QRWN+++FLWGVFRG++
Sbjct  786   LIFASNHLPRDCQRWNMLYFLWGVFRGRK  814



>ref|XP_008799388.1| PREDICTED: uncharacterized protein LOC103714039 isoform X4 [Phoenix 
dactylifera]
Length=1625

 Score =   327 bits (838),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 275/810 (34%), Positives = 412/810 (51%), Gaps = 94/810 (12%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNEHVNSG  1118
             CDICG  GRE LLAICSRC+DGAEHTYCM+ ML+K+PE DWLCEECK  +E +N+  +  
Sbjct  473   CDICGDAGREELLAICSRCSDGAEHTYCMRMMLDKLPEDDWLCEECKLKEETENQRTDKF  532

Query  1119  R----------VNEKEKTSPSRRTTIAKSDHPLKMEQKTSDCWGDKAVEERSYLKTSGKR  1268
             +          +NEK+++S S        +  L+ ++  SD  G K ++     + S KR
Sbjct  533   QATSKMLEVPFLNEKDQSSGSVFNPKVLPN--LETKEINSDIKGAKGLQSS---QISTKR  587

Query  1269  CTDDSEVSSPTKRQRLELRSPTAQIPNRVTSLSRESSFKNLERGKVKPLN----------  1418
               ++  V+S T        S     P + T LS ESSF NL+ G  KP N          
Sbjct  588   HIENIVVTSVTGSLEAGGGSIGITSPRKNTVLSHESSFNNLDVGNAKPANLSPSCGGQSG  647

Query  1419  ----PFS-SGSFAAKVPSSTGPQPQPPRGIFSKSNSFSSLIAKPKVKLVDEVFPAKQKLS  1583
                 P + S +F+    S   P+ +  RG+ SKS S       PKVK + E  P +QK++
Sbjct  648   SVSQPIAYSQAFSGPNSSKIQPEFESTRGLLSKSVS-FKSSKMPKVKQLIESVPLRQKVT  706

Query  1584  RETAFIESKEVAVRSMGKSMSFKPTTASRSNCTESKVKMFSPKFSHDQDVKWLRHKKDRS  1763
               +    +KE  V++  KS SFK T++  S  + +K + F       +D + ++  K+ +
Sbjct  707   SSSD--STKEGMVKTSRKSASFKSTSSGCSAESANKTQPFD--LLRAEDPRGVKQLKEIN  762

Query  1764  SFDRKNSLRSDRLAGGAISSPKSDNKPTPRGEPSSLSSLNTNRDYRALTSDNKPVTISNS  1943
               +RKNS  SD  +   + S  S + P P+             D +    D K   I +S
Sbjct  763   VINRKNSSISDCPSISPLVS-ASTSTPFPKA------------DIKFKQHDGKSNKIPDS  809

Query  1944  TS-GVAR-----------EVLKQASVDGVSSANRVS-----SSEENPSQAIPKEDSSSS-  2069
             ++ G  R           EV KQ+S    +  +  S     S ++ P Q + KE+  +S 
Sbjct  810   SNVGTDRGSNNANNLGCKEVKKQSSFSSRTCGSTPSIGLRKSEDQKPCQPVSKENGCASF  869

Query  2070  SCVAERPSWSSNEVLPDGLSQSKESKAFGDKTRESS-ASRSKQNSTASGKIVSCQKCKGN  2246
             +  A R   + + +      Q+ ES    +KT++ + +S S+Q+++ S +I+ CQ+C   
Sbjct  870   AAAAARSCCNPDSIQRCNTPQAAESTHRDEKTKDRTFSSSSRQSASGSSRILRCQRCNET  929

Query  2247  GHLAQVCTADGPESSALG-SPFKSSREATNGPSDLKAAIEAARLRKPGICRKN-RVADQS  2420
             GH AQ C  D    SA+  S  ++ RE +   S     +E    +   I  KN R  D+S
Sbjct  930   GHTAQFCAVDKLRMSAVKPSAERNLREGSYKNSKWNDVVEVTNSKT--IPLKNIRSPDRS  987

Query  2421  EDLSAS--NMKSEIASQDQMLSS-TVRRNVNGAE-EAQKQETANNAKQLGIIAEASARTR  2588
             E++S S  +  SE+ S+D +  S +  RN+   E  A  QE   ++      + A    +
Sbjct  988   EEISTSSADQNSEVTSKDFLSGSLSCPRNLPSMEGTADGQEILRSSADFSKASVAINVRQ  1047

Query  2589  NAGHVVFSDVKHSVIDMERQTLVSMPVILKTAI-PEYQYIWQGGFEVQKSGKAFNLYDGI  2765
             N  +      +   I   + ++++ P  LK +I P+ ++IWQGGF V ++G    L DG+
Sbjct  1048  NTSY------QEETILPGQASVLAYP--LKASIFPKLEFIWQGGFNVLRTGGCSELCDGL  1099

Query  2766  QAHLSSCASPKVLDAVNKFPRKVILNEVPRLSSWPMQFKECGVSEDNVALFFFAKDIGSY  2945
             QAH S+  SPK L+A  +FP  + L EV R S+WP QF+E    EDN+ALFFFAKD  SY
Sbjct  1100  QAHPSTSVSPKALEAAIQFPCMIQLEEVVRHSAWPSQFQENSPKEDNIALFFFAKDFESY  1159

Query  2946  EKSYKVLLGDMVKHDLALQGNIGDIELLIFPSNQLPEKFQRWNLMFFLWGVFRGKRANSL  3125
             + +Y  LL +M+K+DLAL+GN+   ELLIFPSN LPE  QRWN + FLW VFR ++   L
Sbjct  1160  KNNYSKLLENMIKNDLALRGNMDGAELLIFPSNLLPENSQRWNNLLFLWSVFRERKKKCL  1219

Query  3126  QNFPGAE----------KPLIQDIPTPATS  3185
                P  +          +PL QD+P P  S
Sbjct  1220  GYMPALQEKLNRPNLNMEPLDQDLPAPIIS  1249



>ref|XP_010502787.1| PREDICTED: uncharacterized protein LOC104779880 isoform X3 [Camelina 
sativa]
Length=981

 Score =   319 bits (817),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 257/749 (34%), Positives = 369/749 (49%), Gaps = 155/749 (21%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNEHVNSG  1118
             CDICG  GRE LLAICSRC+DGAEHTYCM+ ML+K+P+GDWLCEECKF +E K + + + 
Sbjct  198   CDICGDAGREDLLAICSRCSDGAEHTYCMRVMLKKVPKGDWLCEECKFAEEAKKKKLETK  257

Query  1119  RVNEKEKTSPSRRTTIAKSDHPLKMEQKTSDCWGDKAVEERSYLKTSGKRCTDDSEVSSP  1298
               +E                                AV   +  ++S KR  D  E +  
Sbjct  258   GKSES-------------------------------AVNLST--QSSSKRHIDKFEAAPD  284

Query  1299  TKRQRLE--LRSPTAQIPNRVTSLSRESSFKNLERGKVKPLNPFSSGSFAAK-----VPS  1457
             +KR  +E    +P   +  R ++LSRE+SFK LE    KP    +  S         + S
Sbjct  285   SKRLAVEAPTGAPKRSVLPRSSTLSRETSFKGLE----KPTRKLAHHSSFNSHSSDDLES  340

Query  1458  STGP--QPQPPRGIFSKSNSFSSLIAKPKVKLVDEVFPAKQKLSRETAFIESKEVAVRSM  1631
             +  P  Q + P+G F KSNSF+S  ++PKV+ VD+V   +QK  ++   ++      R++
Sbjct  341   TRSPDSQLRSPKGSFLKSNSFNSSSSRPKVRPVDDVMLPRQKTGKDNCSLD----VSRNV  396

Query  1632  GKSMSFKPTTASRSNCTESKVKMFSPKFSHDQDVKWLRHKKDRSSFDRKNSLRSDRLAGG  1811
             GKSMS +      S+C +SKV    P              KDRS                
Sbjct  397   GKSMSNRCIDVGSSSCYDSKVNGTKPL-------------KDRS-------------IEA  430

Query  1812  AISSPKSDNKPTPRGEPSSLSSLNTNRDYRALTSDNKPVTISNSTSGVAREVLKQASVDG  1991
               S+   D K   RG  SS S   + RD + L SD +   ++     ++R  L+    D 
Sbjct  431   NPSASTIDQKLISRGRSSS-SYAKSPRDLKDLESDGQQGRLTKQARHLSRNRLE----DI  485

Query  1992  VSSANRVSSSEENPSQAIPKEDSSSSSCVAERPSWSSNEVLPDGLSQSKESKAFGDKTRE  2171
             V+S    S++E+               C +    + +     DG  + +E +  G+K+++
Sbjct  486   VASVGDSSTNEK---------------CSSSEAKYKNELANVDGFPRPREVREAGEKSKD  530

Query  2172  SSASRSKQNSTASGKIVSCQKCKGNGHLAQVCTADGPESSALGSPFKSSREATNGPSDLK  2351
             +                      GN     +                  RE  N  + L+
Sbjct  531   AV---------------------GNHQTLNI------------------REDNNKGNRLR  551

Query  2352  AAIEAARLRKPGICRKNRVADQSEDLSASNMKSEIASQDQMLSSTV---------RRNVN  2504
             AA++AA  +KP    K R  +QS+  S SN+ S      + +SS V          + + 
Sbjct  552   AAVDAALRKKPSF-SKGRGLEQSDLPSVSNVDSGCDKALRNMSSKVPVIRDWPVGFKGLP  610

Query  2505  GAE---EAQKQETANNAKQLGIIAEASARTRNAGHVVFSDVK-HSVIDMERQTLVSMPVI  2672
             G        KQ  A N  Q    A+A A    A   V  +V   S+  + R   V+ P +
Sbjct  611   GGHPNLRTDKQTIAVNGTQSLAGADAMA----ASQSVVPEVHVPSIKPVMRDLPVAAPAV  666

Query  2673  LKT--AIPEYQYIWQGGFEVQKSGKAFNLYDGIQAHLSSCASPKVLDAVNKFPRKVILNE  2846
             L T  AIPE +YIWQG  EVQKS     +++G+QA+LS+ ASPKV++ VN+FP K+ LNE
Sbjct  667   LSTTSAIPEPEYIWQGDLEVQKSRNLSTMHNGMQAYLSTLASPKVVEVVNQFPVKLTLNE  726

Query  2847  VPRLSSWPMQFKECGVSEDNVALFFFAKDIGSYEKSYKVLLGDMVKHDLALQGNIGDIEL  3026
             VPRLS+WP QF++ G  E +VALFFFAKDI SYEK+YK L+ +M++ DLAL+GN+  +EL
Sbjct  727   VPRLSAWPAQFQDIGAKEQHVALFFFAKDIKSYEKNYKPLVDNMIQKDLALKGNLEGVEL  786

Query  3027  LIFPSNQLPEKFQRWNLMFFLWGVFRGKR  3113
             LIF SN LP   QRWN+++FLWGVFRG++
Sbjct  787   LIFASNHLPRDCQRWNMLYFLWGVFRGRK  815



>ref|XP_010502637.1| PREDICTED: uncharacterized protein LOC104779880 isoform X1 [Camelina 
sativa]
Length=1016

 Score =   319 bits (818),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 257/749 (34%), Positives = 369/749 (49%), Gaps = 155/749 (21%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNEHVNSG  1118
             CDICG  GRE LLAICSRC+DGAEHTYCM+ ML+K+P+GDWLCEECKF +E K + + + 
Sbjct  233   CDICGDAGREDLLAICSRCSDGAEHTYCMRVMLKKVPKGDWLCEECKFAEEAKKKKLETK  292

Query  1119  RVNEKEKTSPSRRTTIAKSDHPLKMEQKTSDCWGDKAVEERSYLKTSGKRCTDDSEVSSP  1298
               +E                                AV   +  ++S KR  D  E +  
Sbjct  293   GKSES-------------------------------AVNLST--QSSSKRHIDKFEAAPD  319

Query  1299  TKRQRLE--LRSPTAQIPNRVTSLSRESSFKNLERGKVKPLNPFSSGSFAAK-----VPS  1457
             +KR  +E    +P   +  R ++LSRE+SFK LE    KP    +  S         + S
Sbjct  320   SKRLAVEAPTGAPKRSVLPRSSTLSRETSFKGLE----KPTRKLAHHSSFNSHSSDDLES  375

Query  1458  STGP--QPQPPRGIFSKSNSFSSLIAKPKVKLVDEVFPAKQKLSRETAFIESKEVAVRSM  1631
             +  P  Q + P+G F KSNSF+S  ++PKV+ VD+V   +QK  ++   ++      R++
Sbjct  376   TRSPDSQLRSPKGSFLKSNSFNSSSSRPKVRPVDDVMLPRQKTGKDNCSLD----VSRNV  431

Query  1632  GKSMSFKPTTASRSNCTESKVKMFSPKFSHDQDVKWLRHKKDRSSFDRKNSLRSDRLAGG  1811
             GKSMS +      S+C +SKV    P              KDRS                
Sbjct  432   GKSMSNRCIDVGSSSCYDSKVNGTKPL-------------KDRS-------------IEA  465

Query  1812  AISSPKSDNKPTPRGEPSSLSSLNTNRDYRALTSDNKPVTISNSTSGVAREVLKQASVDG  1991
               S+   D K   RG  SS S   + RD + L SD +   ++     ++R  L+    D 
Sbjct  466   NPSASTIDQKLISRGRSSS-SYAKSPRDLKDLESDGQQGRLTKQARHLSRNRLE----DI  520

Query  1992  VSSANRVSSSEENPSQAIPKEDSSSSSCVAERPSWSSNEVLPDGLSQSKESKAFGDKTRE  2171
             V+S    S++E+               C +    + +     DG  + +E +  G+K+++
Sbjct  521   VASVGDSSTNEK---------------CSSSEAKYKNELANVDGFPRPREVREAGEKSKD  565

Query  2172  SSASRSKQNSTASGKIVSCQKCKGNGHLAQVCTADGPESSALGSPFKSSREATNGPSDLK  2351
             +                      GN     +                  RE  N  + L+
Sbjct  566   AV---------------------GNHQTLNI------------------REDNNKGNRLR  586

Query  2352  AAIEAARLRKPGICRKNRVADQSEDLSASNMKSEIASQDQMLSSTV---------RRNVN  2504
             AA++AA  +KP    K R  +QS+  S SN+ S      + +SS V          + + 
Sbjct  587   AAVDAALRKKPSF-SKGRGLEQSDLPSVSNVDSGCDKALRNMSSKVPVIRDWPVGFKGLP  645

Query  2505  GAE---EAQKQETANNAKQLGIIAEASARTRNAGHVVFSDVK-HSVIDMERQTLVSMPVI  2672
             G        KQ  A N  Q    A+A A    A   V  +V   S+  + R   V+ P +
Sbjct  646   GGHPNLRTDKQTIAVNGTQSLAGADAMA----ASQSVVPEVHVPSIKPVMRDLPVAAPAV  701

Query  2673  LKT--AIPEYQYIWQGGFEVQKSGKAFNLYDGIQAHLSSCASPKVLDAVNKFPRKVILNE  2846
             L T  AIPE +YIWQG  EVQKS     +++G+QA+LS+ ASPKV++ VN+FP K+ LNE
Sbjct  702   LSTTSAIPEPEYIWQGDLEVQKSRNLSTMHNGMQAYLSTLASPKVVEVVNQFPVKLTLNE  761

Query  2847  VPRLSSWPMQFKECGVSEDNVALFFFAKDIGSYEKSYKVLLGDMVKHDLALQGNIGDIEL  3026
             VPRLS+WP QF++ G  E +VALFFFAKDI SYEK+YK L+ +M++ DLAL+GN+  +EL
Sbjct  762   VPRLSAWPAQFQDIGAKEQHVALFFFAKDIKSYEKNYKPLVDNMIQKDLALKGNLEGVEL  821

Query  3027  LIFPSNQLPEKFQRWNLMFFLWGVFRGKR  3113
             LIF SN LP   QRWN+++FLWGVFRG++
Sbjct  822   LIFASNHLPRDCQRWNMLYFLWGVFRGRK  850



>ref|XP_010502712.1| PREDICTED: uncharacterized protein LOC104779880 isoform X2 [Camelina 
sativa]
Length=1012

 Score =   319 bits (817),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 257/749 (34%), Positives = 369/749 (49%), Gaps = 155/749 (21%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNEHVNSG  1118
             CDICG  GRE LLAICSRC+DGAEHTYCM+ ML+K+P+GDWLCEECKF +E K + + + 
Sbjct  229   CDICGDAGREDLLAICSRCSDGAEHTYCMRVMLKKVPKGDWLCEECKFAEEAKKKKLETK  288

Query  1119  RVNEKEKTSPSRRTTIAKSDHPLKMEQKTSDCWGDKAVEERSYLKTSGKRCTDDSEVSSP  1298
               +E                                AV   +  ++S KR  D  E +  
Sbjct  289   GKSES-------------------------------AVNLST--QSSSKRHIDKFEAAPD  315

Query  1299  TKRQRLE--LRSPTAQIPNRVTSLSRESSFKNLERGKVKPLNPFSSGSFAAK-----VPS  1457
             +KR  +E    +P   +  R ++LSRE+SFK LE    KP    +  S         + S
Sbjct  316   SKRLAVEAPTGAPKRSVLPRSSTLSRETSFKGLE----KPTRKLAHHSSFNSHSSDDLES  371

Query  1458  STGP--QPQPPRGIFSKSNSFSSLIAKPKVKLVDEVFPAKQKLSRETAFIESKEVAVRSM  1631
             +  P  Q + P+G F KSNSF+S  ++PKV+ VD+V   +QK  ++   ++      R++
Sbjct  372   TRSPDSQLRSPKGSFLKSNSFNSSSSRPKVRPVDDVMLPRQKTGKDNCSLD----VSRNV  427

Query  1632  GKSMSFKPTTASRSNCTESKVKMFSPKFSHDQDVKWLRHKKDRSSFDRKNSLRSDRLAGG  1811
             GKSMS +      S+C +SKV    P              KDRS                
Sbjct  428   GKSMSNRCIDVGSSSCYDSKVNGTKPL-------------KDRS-------------IEA  461

Query  1812  AISSPKSDNKPTPRGEPSSLSSLNTNRDYRALTSDNKPVTISNSTSGVAREVLKQASVDG  1991
               S+   D K   RG  SS S   + RD + L SD +   ++     ++R  L+    D 
Sbjct  462   NPSASTIDQKLISRGRSSS-SYAKSPRDLKDLESDGQQGRLTKQARHLSRNRLE----DI  516

Query  1992  VSSANRVSSSEENPSQAIPKEDSSSSSCVAERPSWSSNEVLPDGLSQSKESKAFGDKTRE  2171
             V+S    S++E+               C +    + +     DG  + +E +  G+K+++
Sbjct  517   VASVGDSSTNEK---------------CSSSEAKYKNELANVDGFPRPREVREAGEKSKD  561

Query  2172  SSASRSKQNSTASGKIVSCQKCKGNGHLAQVCTADGPESSALGSPFKSSREATNGPSDLK  2351
             +                      GN     +                  RE  N  + L+
Sbjct  562   AV---------------------GNHQTLNI------------------REDNNKGNRLR  582

Query  2352  AAIEAARLRKPGICRKNRVADQSEDLSASNMKSEIASQDQMLSSTV---------RRNVN  2504
             AA++AA  +KP    K R  +QS+  S SN+ S      + +SS V          + + 
Sbjct  583   AAVDAALRKKPSF-SKGRGLEQSDLPSVSNVDSGCDKALRNMSSKVPVIRDWPVGFKGLP  641

Query  2505  GAE---EAQKQETANNAKQLGIIAEASARTRNAGHVVFSDVK-HSVIDMERQTLVSMPVI  2672
             G        KQ  A N  Q    A+A A    A   V  +V   S+  + R   V+ P +
Sbjct  642   GGHPNLRTDKQTIAVNGTQSLAGADAMA----ASQSVVPEVHVPSIKPVMRDLPVAAPAV  697

Query  2673  LKT--AIPEYQYIWQGGFEVQKSGKAFNLYDGIQAHLSSCASPKVLDAVNKFPRKVILNE  2846
             L T  AIPE +YIWQG  EVQKS     +++G+QA+LS+ ASPKV++ VN+FP K+ LNE
Sbjct  698   LSTTSAIPEPEYIWQGDLEVQKSRNLSTMHNGMQAYLSTLASPKVVEVVNQFPVKLTLNE  757

Query  2847  VPRLSSWPMQFKECGVSEDNVALFFFAKDIGSYEKSYKVLLGDMVKHDLALQGNIGDIEL  3026
             VPRLS+WP QF++ G  E +VALFFFAKDI SYEK+YK L+ +M++ DLAL+GN+  +EL
Sbjct  758   VPRLSAWPAQFQDIGAKEQHVALFFFAKDIKSYEKNYKPLVDNMIQKDLALKGNLEGVEL  817

Query  3027  LIFPSNQLPEKFQRWNLMFFLWGVFRGKR  3113
             LIF SN LP   QRWN+++FLWGVFRG++
Sbjct  818   LIFASNHLPRDCQRWNMLYFLWGVFRGRK  846



>ref|XP_008799387.1| PREDICTED: uncharacterized protein LOC103714039 isoform X3 [Phoenix 
dactylifera]
Length=1632

 Score =   325 bits (834),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 279/830 (34%), Positives = 419/830 (50%), Gaps = 108/830 (13%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNEHVNSG  1118
             CDICG  GRE LLAICSRC+DGAEHTYCM+ ML+K+PE DWLCEECK  +E +N+  +  
Sbjct  473   CDICGDAGREELLAICSRCSDGAEHTYCMRMMLDKLPEDDWLCEECKLKEETENQRTDKF  532

Query  1119  R----------VNEKEKTSPSRRTTIAKSDHPLKMEQKTSDCWGDKAVEERSYLKTSGKR  1268
             +          +NEK+++S S        +  L+ ++  SD  G K ++     + S KR
Sbjct  533   QATSKMLEVPFLNEKDQSSGSVFNPKVLPN--LETKEINSDIKGAKGLQSS---QISTKR  587

Query  1269  CTDDSEVSSPTKRQRLELRSPTAQIPNRVTSLSRESSFKNLERGKVKPLN----------  1418
               ++  V+S T        S     P + T LS ESSF NL+ G  KP N          
Sbjct  588   HIENIVVTSVTGSLEAGGGSIGITSPRKNTVLSHESSFNNLDVGNAKPANLSPSCGGQSG  647

Query  1419  ----PFS-SGSFAAKVPSSTGPQPQPPRGIFSKSNSFSSLIAKPKVKLVDEVFPAKQKLS  1583
                 P + S +F+    S   P+ +  RG+ SKS S       PKVK + E  P +QK++
Sbjct  648   SVSQPIAYSQAFSGPNSSKIQPEFESTRGLLSKSVS-FKSSKMPKVKQLIESVPLRQKVT  706

Query  1584  RETAFIESKEVAVRSMGKSMSFKPTTASRSNCTESKVKMFSPKFSHDQDVKWLRHKKDRS  1763
               +    +KE  V++  KS SFK T++  S  + +K + F       +D + ++  K+ +
Sbjct  707   SSSD--STKEGMVKTSRKSASFKSTSSGCSAESANKTQPFD--LLRAEDPRGVKQLKEIN  762

Query  1764  SFDRKNSLRSDRLAGGAISSPKSDNKPTPRGEPSSLSSLNTNRDYRALTSDNKPVTISNS  1943
               +RKNS  SD  +   + S  S + P P+             D +    D K   I +S
Sbjct  763   VINRKNSSISDCPSISPLVS-ASTSTPFPKA------------DIKFKQHDGKSNKIPDS  809

Query  1944  TS-GVAR-----------EVLKQASVDGVSSANRVS-----SSEENPSQAIPKEDSSSS-  2069
             ++ G  R           EV KQ+S    +  +  S     S ++ P Q + KE+  +S 
Sbjct  810   SNVGTDRGSNNANNLGCKEVKKQSSFSSRTCGSTPSIGLRKSEDQKPCQPVSKENGCASF  869

Query  2070  SCVAERPSWSSNEVLPDGLSQSKESKAFGDKTRESS-ASRSKQNSTASGKIVSCQKCKGN  2246
             +  A R   + + +      Q+ ES    +KT++ + +S S+Q+++ S +I+ CQ+C   
Sbjct  870   AAAAARSCCNPDSIQRCNTPQAAESTHRDEKTKDRTFSSSSRQSASGSSRILRCQRCNET  929

Query  2247  GHLAQVCTADGPESSALG-SPFKSSREATNGPSDLKAAIEAARLRKPGICRKN-RVADQS  2420
             GH AQ C  D    SA+  S  ++ RE +   S     +E    +   I  KN R  D+S
Sbjct  930   GHTAQFCAVDKLRMSAVKPSAERNLREGSYKNSKWNDVVEVTNSKT--IPLKNIRSPDRS  987

Query  2421  EDLSAS--NMKSEIASQDQMLSS-TVRRNV---NGAEEAQ----------KQETANNAKQ  2552
             E++S S  +  SE+ S+D +  S +  RN+    G  + Q          K   A N +Q
Sbjct  988   EEISTSSADQNSEVTSKDFLSGSLSCPRNLPSMEGTADGQEILRSSADFSKASVAINVRQ  1047

Query  2553  LGIIAEAS---ARTRNAGHVVFSDVK-----HSVIDMERQTLVSMPVILKTAI-PEYQYI  2705
                  E +   ++  N   ++ + +K     H  I   + ++++ P  LK +I P+ ++I
Sbjct  1048  NTSYQEETVCVSKDGNINTILNTSIKLNVKPHMQILPGQASVLAYP--LKASIFPKLEFI  1105

Query  2706  WQGGFEVQKSGKAFNLYDGIQAHLSSCASPKVLDAVNKFPRKVILNEVPRLSSWPMQFKE  2885
             WQGGF V ++G    L DG+QAH S+  SPK L+A  +FP  + L EV R S+WP QF+E
Sbjct  1106  WQGGFNVLRTGGCSELCDGLQAHPSTSVSPKALEAAIQFPCMIQLEEVVRHSAWPSQFQE  1165

Query  2886  CGVSEDNVALFFFAKDIGSYEKSYKVLLGDMVKHDLALQGNIGDIELLIFPSNQLPEKFQ  3065
                 EDN+ALFFFAKD  SY+ +Y  LL +M+K+DLAL+GN+   ELLIFPSN LPE  Q
Sbjct  1166  NSPKEDNIALFFFAKDFESYKNNYSKLLENMIKNDLALRGNMDGAELLIFPSNLLPENSQ  1225

Query  3066  RWNLMFFLWGVFRGKRANSLQNFPGAE----------KPLIQDIPTPATS  3185
             RWN + FLW VFR ++   L   P  +          +PL QD+P P  S
Sbjct  1226  RWNNLLFLWSVFRERKKKCLGYMPALQEKLNRPNLNMEPLDQDLPAPIIS  1275



>ref|XP_008799389.1| PREDICTED: uncharacterized protein LOC103714039 isoform X5 [Phoenix 
dactylifera]
Length=1561

 Score =   325 bits (833),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 279/830 (34%), Positives = 419/830 (50%), Gaps = 108/830 (13%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNEHVNSG  1118
             CDICG  GRE LLAICSRC+DGAEHTYCM+ ML+K+PE DWLCEECK  +E +N+  +  
Sbjct  383   CDICGDAGREELLAICSRCSDGAEHTYCMRMMLDKLPEDDWLCEECKLKEETENQRTDKF  442

Query  1119  R----------VNEKEKTSPSRRTTIAKSDHPLKMEQKTSDCWGDKAVEERSYLKTSGKR  1268
             +          +NEK+++S S        +  L+ ++  SD  G K ++     + S KR
Sbjct  443   QATSKMLEVPFLNEKDQSSGSVFNPKVLPN--LETKEINSDIKGAKGLQSS---QISTKR  497

Query  1269  CTDDSEVSSPTKRQRLELRSPTAQIPNRVTSLSRESSFKNLERGKVKPLN----------  1418
               ++  V+S T        S     P + T LS ESSF NL+ G  KP N          
Sbjct  498   HIENIVVTSVTGSLEAGGGSIGITSPRKNTVLSHESSFNNLDVGNAKPANLSPSCGGQSG  557

Query  1419  ----PFS-SGSFAAKVPSSTGPQPQPPRGIFSKSNSFSSLIAKPKVKLVDEVFPAKQKLS  1583
                 P + S +F+    S   P+ +  RG+ SKS S       PKVK + E  P +QK++
Sbjct  558   SVSQPIAYSQAFSGPNSSKIQPEFESTRGLLSKSVS-FKSSKMPKVKQLIESVPLRQKVT  616

Query  1584  RETAFIESKEVAVRSMGKSMSFKPTTASRSNCTESKVKMFSPKFSHDQDVKWLRHKKDRS  1763
               +    +KE  V++  KS SFK T++  S  + +K + F       +D + ++  K+ +
Sbjct  617   SSSD--STKEGMVKTSRKSASFKSTSSGCSAESANKTQPFD--LLRAEDPRGVKQLKEIN  672

Query  1764  SFDRKNSLRSDRLAGGAISSPKSDNKPTPRGEPSSLSSLNTNRDYRALTSDNKPVTISNS  1943
               +RKNS  SD  +   + S  S + P P+             D +    D K   I +S
Sbjct  673   VINRKNSSISDCPSISPLVS-ASTSTPFPKA------------DIKFKQHDGKSNKIPDS  719

Query  1944  TS-GVAR-----------EVLKQASVDGVSSANRVS-----SSEENPSQAIPKEDSSSS-  2069
             ++ G  R           EV KQ+S    +  +  S     S ++ P Q + KE+  +S 
Sbjct  720   SNVGTDRGSNNANNLGCKEVKKQSSFSSRTCGSTPSIGLRKSEDQKPCQPVSKENGCASF  779

Query  2070  SCVAERPSWSSNEVLPDGLSQSKESKAFGDKTRESS-ASRSKQNSTASGKIVSCQKCKGN  2246
             +  A R   + + +      Q+ ES    +KT++ + +S S+Q+++ S +I+ CQ+C   
Sbjct  780   AAAAARSCCNPDSIQRCNTPQAAESTHRDEKTKDRTFSSSSRQSASGSSRILRCQRCNET  839

Query  2247  GHLAQVCTADGPESSALG-SPFKSSREATNGPSDLKAAIEAARLRKPGICRKN-RVADQS  2420
             GH AQ C  D    SA+  S  ++ RE +   S     +E    +   I  KN R  D+S
Sbjct  840   GHTAQFCAVDKLRMSAVKPSAERNLREGSYKNSKWNDVVEVTNSKT--IPLKNIRSPDRS  897

Query  2421  EDLSAS--NMKSEIASQDQMLSS-TVRRNV---NGAEEAQ----------KQETANNAKQ  2552
             E++S S  +  SE+ S+D +  S +  RN+    G  + Q          K   A N +Q
Sbjct  898   EEISTSSADQNSEVTSKDFLSGSLSCPRNLPSMEGTADGQEILRSSADFSKASVAINVRQ  957

Query  2553  LGIIAEAS---ARTRNAGHVVFSDVK-----HSVIDMERQTLVSMPVILKTAI-PEYQYI  2705
                  E +   ++  N   ++ + +K     H  I   + ++++ P  LK +I P+ ++I
Sbjct  958   NTSYQEETVCVSKDGNINTILNTSIKLNVKPHMQILPGQASVLAYP--LKASIFPKLEFI  1015

Query  2706  WQGGFEVQKSGKAFNLYDGIQAHLSSCASPKVLDAVNKFPRKVILNEVPRLSSWPMQFKE  2885
             WQGGF V ++G    L DG+QAH S+  SPK L+A  +FP  + L EV R S+WP QF+E
Sbjct  1016  WQGGFNVLRTGGCSELCDGLQAHPSTSVSPKALEAAIQFPCMIQLEEVVRHSAWPSQFQE  1075

Query  2886  CGVSEDNVALFFFAKDIGSYEKSYKVLLGDMVKHDLALQGNIGDIELLIFPSNQLPEKFQ  3065
                 EDN+ALFFFAKD  SY+ +Y  LL +M+K+DLAL+GN+   ELLIFPSN LPE  Q
Sbjct  1076  NSPKEDNIALFFFAKDFESYKNNYSKLLENMIKNDLALRGNMDGAELLIFPSNLLPENSQ  1135

Query  3066  RWNLMFFLWGVFRGKRANSLQNFPGAE----------KPLIQDIPTPATS  3185
             RWN + FLW VFR ++   L   P  +          +PL QD+P P  S
Sbjct  1136  RWNNLLFLWSVFRERKKKCLGYMPALQEKLNRPNLNMEPLDQDLPAPIIS  1185



>ref|XP_008799384.1| PREDICTED: uncharacterized protein LOC103714039 isoform X1 [Phoenix 
dactylifera]
Length=1651

 Score =   325 bits (834),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 279/830 (34%), Positives = 419/830 (50%), Gaps = 108/830 (13%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNEHVNSG  1118
             CDICG  GRE LLAICSRC+DGAEHTYCM+ ML+K+PE DWLCEECK  +E +N+  +  
Sbjct  473   CDICGDAGREELLAICSRCSDGAEHTYCMRMMLDKLPEDDWLCEECKLKEETENQRTDKF  532

Query  1119  R----------VNEKEKTSPSRRTTIAKSDHPLKMEQKTSDCWGDKAVEERSYLKTSGKR  1268
             +          +NEK+++S S        +  L+ ++  SD  G K ++     + S KR
Sbjct  533   QATSKMLEVPFLNEKDQSSGSVFNPKVLPN--LETKEINSDIKGAKGLQSS---QISTKR  587

Query  1269  CTDDSEVSSPTKRQRLELRSPTAQIPNRVTSLSRESSFKNLERGKVKPLN----------  1418
               ++  V+S T        S     P + T LS ESSF NL+ G  KP N          
Sbjct  588   HIENIVVTSVTGSLEAGGGSIGITSPRKNTVLSHESSFNNLDVGNAKPANLSPSCGGQSG  647

Query  1419  ----PFS-SGSFAAKVPSSTGPQPQPPRGIFSKSNSFSSLIAKPKVKLVDEVFPAKQKLS  1583
                 P + S +F+    S   P+ +  RG+ SKS S       PKVK + E  P +QK++
Sbjct  648   SVSQPIAYSQAFSGPNSSKIQPEFESTRGLLSKSVS-FKSSKMPKVKQLIESVPLRQKVT  706

Query  1584  RETAFIESKEVAVRSMGKSMSFKPTTASRSNCTESKVKMFSPKFSHDQDVKWLRHKKDRS  1763
               +    +KE  V++  KS SFK T++  S  + +K + F       +D + ++  K+ +
Sbjct  707   SSSD--STKEGMVKTSRKSASFKSTSSGCSAESANKTQPFD--LLRAEDPRGVKQLKEIN  762

Query  1764  SFDRKNSLRSDRLAGGAISSPKSDNKPTPRGEPSSLSSLNTNRDYRALTSDNKPVTISNS  1943
               +RKNS  SD  +   + S  S + P P+             D +    D K   I +S
Sbjct  763   VINRKNSSISDCPSISPLVS-ASTSTPFPKA------------DIKFKQHDGKSNKIPDS  809

Query  1944  TS-GVAR-----------EVLKQASVDGVSSANRVS-----SSEENPSQAIPKEDSSSS-  2069
             ++ G  R           EV KQ+S    +  +  S     S ++ P Q + KE+  +S 
Sbjct  810   SNVGTDRGSNNANNLGCKEVKKQSSFSSRTCGSTPSIGLRKSEDQKPCQPVSKENGCASF  869

Query  2070  SCVAERPSWSSNEVLPDGLSQSKESKAFGDKTRESS-ASRSKQNSTASGKIVSCQKCKGN  2246
             +  A R   + + +      Q+ ES    +KT++ + +S S+Q+++ S +I+ CQ+C   
Sbjct  870   AAAAARSCCNPDSIQRCNTPQAAESTHRDEKTKDRTFSSSSRQSASGSSRILRCQRCNET  929

Query  2247  GHLAQVCTADGPESSALG-SPFKSSREATNGPSDLKAAIEAARLRKPGICRKN-RVADQS  2420
             GH AQ C  D    SA+  S  ++ RE +   S     +E    +   I  KN R  D+S
Sbjct  930   GHTAQFCAVDKLRMSAVKPSAERNLREGSYKNSKWNDVVEVTNSKT--IPLKNIRSPDRS  987

Query  2421  EDLSAS--NMKSEIASQDQMLSS-TVRRNV---NGAEEAQ----------KQETANNAKQ  2552
             E++S S  +  SE+ S+D +  S +  RN+    G  + Q          K   A N +Q
Sbjct  988   EEISTSSADQNSEVTSKDFLSGSLSCPRNLPSMEGTADGQEILRSSADFSKASVAINVRQ  1047

Query  2553  LGIIAEAS---ARTRNAGHVVFSDVK-----HSVIDMERQTLVSMPVILKTAI-PEYQYI  2705
                  E +   ++  N   ++ + +K     H  I   + ++++ P  LK +I P+ ++I
Sbjct  1048  NTSYQEETVCVSKDGNINTILNTSIKLNVKPHMQILPGQASVLAYP--LKASIFPKLEFI  1105

Query  2706  WQGGFEVQKSGKAFNLYDGIQAHLSSCASPKVLDAVNKFPRKVILNEVPRLSSWPMQFKE  2885
             WQGGF V ++G    L DG+QAH S+  SPK L+A  +FP  + L EV R S+WP QF+E
Sbjct  1106  WQGGFNVLRTGGCSELCDGLQAHPSTSVSPKALEAAIQFPCMIQLEEVVRHSAWPSQFQE  1165

Query  2886  CGVSEDNVALFFFAKDIGSYEKSYKVLLGDMVKHDLALQGNIGDIELLIFPSNQLPEKFQ  3065
                 EDN+ALFFFAKD  SY+ +Y  LL +M+K+DLAL+GN+   ELLIFPSN LPE  Q
Sbjct  1166  NSPKEDNIALFFFAKDFESYKNNYSKLLENMIKNDLALRGNMDGAELLIFPSNLLPENSQ  1225

Query  3066  RWNLMFFLWGVFRGKRANSLQNFPGAE----------KPLIQDIPTPATS  3185
             RWN + FLW VFR ++   L   P  +          +PL QD+P P  S
Sbjct  1226  RWNNLLFLWSVFRERKKKCLGYMPALQEKLNRPNLNMEPLDQDLPAPIIS  1275



>ref|XP_008799386.1| PREDICTED: uncharacterized protein LOC103714039 isoform X2 [Phoenix 
dactylifera]
Length=1640

 Score =   325 bits (834),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 279/830 (34%), Positives = 419/830 (50%), Gaps = 108/830 (13%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNEHVNSG  1118
             CDICG  GRE LLAICSRC+DGAEHTYCM+ ML+K+PE DWLCEECK  +E +N+  +  
Sbjct  462   CDICGDAGREELLAICSRCSDGAEHTYCMRMMLDKLPEDDWLCEECKLKEETENQRTDKF  521

Query  1119  R----------VNEKEKTSPSRRTTIAKSDHPLKMEQKTSDCWGDKAVEERSYLKTSGKR  1268
             +          +NEK+++S S        +  L+ ++  SD  G K ++     + S KR
Sbjct  522   QATSKMLEVPFLNEKDQSSGSVFNPKVLPN--LETKEINSDIKGAKGLQSS---QISTKR  576

Query  1269  CTDDSEVSSPTKRQRLELRSPTAQIPNRVTSLSRESSFKNLERGKVKPLN----------  1418
               ++  V+S T        S     P + T LS ESSF NL+ G  KP N          
Sbjct  577   HIENIVVTSVTGSLEAGGGSIGITSPRKNTVLSHESSFNNLDVGNAKPANLSPSCGGQSG  636

Query  1419  ----PFS-SGSFAAKVPSSTGPQPQPPRGIFSKSNSFSSLIAKPKVKLVDEVFPAKQKLS  1583
                 P + S +F+    S   P+ +  RG+ SKS S       PKVK + E  P +QK++
Sbjct  637   SVSQPIAYSQAFSGPNSSKIQPEFESTRGLLSKSVS-FKSSKMPKVKQLIESVPLRQKVT  695

Query  1584  RETAFIESKEVAVRSMGKSMSFKPTTASRSNCTESKVKMFSPKFSHDQDVKWLRHKKDRS  1763
               +    +KE  V++  KS SFK T++  S  + +K + F       +D + ++  K+ +
Sbjct  696   SSSD--STKEGMVKTSRKSASFKSTSSGCSAESANKTQPFD--LLRAEDPRGVKQLKEIN  751

Query  1764  SFDRKNSLRSDRLAGGAISSPKSDNKPTPRGEPSSLSSLNTNRDYRALTSDNKPVTISNS  1943
               +RKNS  SD  +   + S  S + P P+             D +    D K   I +S
Sbjct  752   VINRKNSSISDCPSISPLVS-ASTSTPFPKA------------DIKFKQHDGKSNKIPDS  798

Query  1944  TS-GVAR-----------EVLKQASVDGVSSANRVS-----SSEENPSQAIPKEDSSSS-  2069
             ++ G  R           EV KQ+S    +  +  S     S ++ P Q + KE+  +S 
Sbjct  799   SNVGTDRGSNNANNLGCKEVKKQSSFSSRTCGSTPSIGLRKSEDQKPCQPVSKENGCASF  858

Query  2070  SCVAERPSWSSNEVLPDGLSQSKESKAFGDKTRESS-ASRSKQNSTASGKIVSCQKCKGN  2246
             +  A R   + + +      Q+ ES    +KT++ + +S S+Q+++ S +I+ CQ+C   
Sbjct  859   AAAAARSCCNPDSIQRCNTPQAAESTHRDEKTKDRTFSSSSRQSASGSSRILRCQRCNET  918

Query  2247  GHLAQVCTADGPESSALG-SPFKSSREATNGPSDLKAAIEAARLRKPGICRKN-RVADQS  2420
             GH AQ C  D    SA+  S  ++ RE +   S     +E    +   I  KN R  D+S
Sbjct  919   GHTAQFCAVDKLRMSAVKPSAERNLREGSYKNSKWNDVVEVTNSKT--IPLKNIRSPDRS  976

Query  2421  EDLSAS--NMKSEIASQDQMLSS-TVRRNV---NGAEEAQ----------KQETANNAKQ  2552
             E++S S  +  SE+ S+D +  S +  RN+    G  + Q          K   A N +Q
Sbjct  977   EEISTSSADQNSEVTSKDFLSGSLSCPRNLPSMEGTADGQEILRSSADFSKASVAINVRQ  1036

Query  2553  LGIIAEAS---ARTRNAGHVVFSDVK-----HSVIDMERQTLVSMPVILKTAI-PEYQYI  2705
                  E +   ++  N   ++ + +K     H  I   + ++++ P  LK +I P+ ++I
Sbjct  1037  NTSYQEETVCVSKDGNINTILNTSIKLNVKPHMQILPGQASVLAYP--LKASIFPKLEFI  1094

Query  2706  WQGGFEVQKSGKAFNLYDGIQAHLSSCASPKVLDAVNKFPRKVILNEVPRLSSWPMQFKE  2885
             WQGGF V ++G    L DG+QAH S+  SPK L+A  +FP  + L EV R S+WP QF+E
Sbjct  1095  WQGGFNVLRTGGCSELCDGLQAHPSTSVSPKALEAAIQFPCMIQLEEVVRHSAWPSQFQE  1154

Query  2886  CGVSEDNVALFFFAKDIGSYEKSYKVLLGDMVKHDLALQGNIGDIELLIFPSNQLPEKFQ  3065
                 EDN+ALFFFAKD  SY+ +Y  LL +M+K+DLAL+GN+   ELLIFPSN LPE  Q
Sbjct  1155  NSPKEDNIALFFFAKDFESYKNNYSKLLENMIKNDLALRGNMDGAELLIFPSNLLPENSQ  1214

Query  3066  RWNLMFFLWGVFRGKRANSLQNFPGAE----------KPLIQDIPTPATS  3185
             RWN + FLW VFR ++   L   P  +          +PL QD+P P  S
Sbjct  1215  RWNNLLFLWSVFRERKKKCLGYMPALQEKLNRPNLNMEPLDQDLPAPIIS  1264



>ref|XP_010275228.1| PREDICTED: uncharacterized protein LOC104610357 isoform X5 [Nelumbo 
nucifera]
 ref|XP_010275229.1| PREDICTED: uncharacterized protein LOC104610357 isoform X5 [Nelumbo 
nucifera]
 ref|XP_010275230.1| PREDICTED: uncharacterized protein LOC104610357 isoform X5 [Nelumbo 
nucifera]
Length=1788

 Score =   323 bits (827),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 237/577 (41%), Positives = 333/577 (58%), Gaps = 57/577 (10%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNEHVNSG  1118
             CDICG  GRE LLA CSRC+DGAEHTYCMQ ML+K+PEGDWLCEECK  +E +N+  +  
Sbjct  413   CDICGDAGREELLAFCSRCSDGAEHTYCMQVMLDKVPEGDWLCEECKIKEETENQKQDKV  472

Query  1119  RV----------NEKEKTSPSRRTTIAKSDHPLKMEQKTSDCWGDKAVEERSYLKTSGKR  1268
              +          NEK + +P    T++ S   LK++ K +D  G++  +  S    S KR
Sbjct  473   EIVLGSSKAPYLNEKTQ-NPGGIDTVS-SKVSLKLDVKETDTEGNRITKVSSSSFGSVKR  530

Query  1269  CTDDSEVSSPTKRQRLE--LRSPTAQIPNRV-TSLSRESSFKNLERGKVKPLNPF-----  1424
              +D+ E +SP KRQ LE  + SP    P++    LSRESSFK+L++GKVK  +       
Sbjct  531   HSDNLEAASPAKRQMLETSVASPKTSSPDKKPVLLSRESSFKSLDKGKVKTPHQLGLPSS  590

Query  1425  -SSGSFAAKVPS-STGP-------QPQPPRGIFSKSNSFSSLIAKPKVKLVDEVFPAKQK  1577
              S+ S    V S +TGP       Q Q PRG   KSNSF++L +KPKVKLV E    K+K
Sbjct  591   HSANSSHENVHSPTTGPSSSKNQSQLQSPRGNLLKSNSFNTLNSKPKVKLVQEDVSQKKK  650

Query  1578  LSRETAFIES-KEVAVRSMGKSMSFKPTTASRSNCTESKVKMFSPKFSHDQDVKWLRHKK  1754
             ++R+T   ++ KE  VR +GKS+SFK  ++ R N TESKVKM S   S  +++K L+  K
Sbjct  651   VARDTVINDAKKEGPVRMIGKSISFKTPSSGRFNVTESKVKMLSHNLSCVEELKGLKQAK  710

Query  1755  DRSSFDRKNSLRSDR------LAGGAISSPKSDNKPTPRGE-PSSLSSLNTNRDYRALTS  1913
             +    +RKNS +SDR       A  ++S+PK+D K T RGE  SSL+S    RD +++ +
Sbjct  711   EWGLIERKNSFKSDRPLISSPTAVSSVSTPKTDQKVTSRGETTSSLTSATNCRDMKSVQA  770

Query  1914  DN------KPVTISNSTS------GVAREVLKQASVDGVSSANRVSSSEENPSQAIPKED  2057
             D       KP +++N  S        + EV +Q+ V   SS  R SS+E+ P Q   ++ 
Sbjct  771   DGKLNTSAKPTSLANKGSENRNVLAGSSEVKRQSVVGTPSSNGRCSSTEQKPIQVSTQDG  830

Query  2058  SSSSSCVAERPSWSSNEVLP-DGLSQSKESKAFGDKTRE-SSASRSKQNSTASGKIVSCQ  2231
             ++SSS  A++ SWS ++ +P DGL QS ES     K RE     R KQ  +  G+ + C 
Sbjct  831   TTSSSWTADK-SWSKHDAVPHDGLPQSPESLNQDAKARELFPTGRPKQGVSVGGQSIRCH  889

Query  2232  KCKGNGHLAQVCTADGPESSALGSPFKSSREATNGPSDLKAAIEAARLRKPGICRKNRVA  2411
             KCK  GH AQ C      S    S  KSS+E T     LK A++A  L+ PG+ RKNR++
Sbjct  890   KCKELGHTAQSCPVTKV-SVFEASAEKSSKEVTGKSFKLKEAVKAIMLKPPGMSRKNRLS  948

Query  2412  DQSEDLSAS--NMKSEIASQDQM-LSSTVRRNVNGAE  2513
             +Q ++LS S  ++  E+ S+DQ+  +S   RN+N  E
Sbjct  949   EQLDELSMSSADLSCEV-SKDQLPTTSNCSRNLNSGE  984


 Score =   274 bits (700),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 166/400 (42%), Positives = 234/400 (59%), Gaps = 53/400 (13%)
 Frame = +3

Query  2349  KAAIEAARLRKPGICRKNRVADQSEDLSAS--NMKSEIASQDQM-LSSTVRRNVNGAE--  2513
             K A++A  L+ PG+ R+NR+++Q ++LS S  ++  E+ S+DQ+  +    RN+N  E  
Sbjct  1002  KTAVKAVTLKSPGMSRRNRLSEQLDELSMSSADLSCEV-SKDQLPTTXNCSRNLNSGEVT  1060

Query  2514  -------------EAQKQETANNAKQ-LGIIAEASARTRNAGHVVFSDVK-------HSV  2630
                          +  K  T NN KQ +    EA+   R A  V  S +         S+
Sbjct  1061  NDDGQEIVRSSAADISKTTTVNNLKQDILKSTEATCSPRGASDVTISPISLDENKPSSSI  1120

Query  2631  IDMER-QTLVSMPVILKTAIPEYQYIWQGGFEVQKSGKAFNLYDGIQAHLSSCASPKVLD  2807
              D+ R ++ V++P  + +AIPE+ YIWQGGFEVQ+SG   +L DGIQA+LS+CASPK+ +
Sbjct  1121  TDLPRVESSVAIPSRI-SAIPEHDYIWQGGFEVQRSGILADLCDGIQAYLSTCASPKIPE  1179

Query  2808  AVNKFPRKVILNEVPRLSSWPMQFKECGVSEDNVALFFFAKDIGSYEKSYKVLLGDMVKH  2987
              V K PRKV+L EVPRLS+WP QF E   +EDNVAL+FFAKD+ SYE+ YK LL  M+K+
Sbjct  1180  VVKKLPRKVLLEEVPRLSTWPRQFDENRATEDNVALYFFAKDLESYERYYKGLLDKMIKN  1239

Query  2988  DLALQGNIGDIELLIFPSNQLPEKFQRWNLMFFLWGVFRGKRANSLQNFPGAEKPL----  3155
             DLAL+GN   IELLIFPSNQLPEK QRWN++FFLWGVFRG+R+N  +   GA+K +    
Sbjct  1240  DLALKGNFNGIELLIFPSNQLPEKSQRWNMLFFLWGVFRGRRSNCSEQILGAQKKVSRSN  1299

Query  3156  ------IQDIPTPATSLPENMF--------TPVPKLNSARGSAATNTEMSAVKESE----  3281
                    Q      TS+ + ++         P+P +  A   +++  E+S    S     
Sbjct  1300  PDVTIAYQGFAAGVTSVSQKVYLPGHKEDPNPLPSVMPAFTGSSSGMEVSKSMASMELPF  1359

Query  3282  -SASLHKIVNGNCSIQSSSQVSRDKCSRINAEQN-DKLDS  3395
              S+S     NGNC    SS   ++  S+ N  Q+ + LDS
Sbjct  1360  ISSSGKLNGNGNCDSNMSSIDYKNLSSQTNFNQHGNGLDS  1399


 Score = 70.5 bits (171),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 56/130 (43%), Positives = 71/130 (55%), Gaps = 4/130 (3%)
 Frame = +3

Query  4056  EMFFFPVDPHPVGNIGSNNSSMPWKV-HPLEEDQLHDKAPNLELALGAKTKPLMSGIPSF  4232
             E  FFP+D  P  +  S  +  P +V     ED +  + PNLELALGA+ +P    I  +
Sbjct  1655  ERHFFPIDLGPAKDCKSRGTLEPLQVLSSTNEDIMGSEVPNLELALGAEKRPRKQAIFPW  1714

Query  4233  LSGKVEKKIIEENTSDNAATSANKEDVsaslslslsFPFPEKEHGTS--SKPEQEDPRRR  4406
             L G  +K+   +   D   T+ N +DVSASLSLSL+FPF  KE      SK EQ  P  R
Sbjct  1715  LVGIADKRNNRDKFPD-PVTNNNDDDVSASLSLSLAFPFSNKEQTVKPVSKTEQLLPDAR  1773

Query  4407  QANTSLLLFG  4436
               NTSL LFG
Sbjct  1774  HVNTSLFLFG  1783



>ref|XP_010275227.1| PREDICTED: uncharacterized protein LOC104610357 isoform X4 [Nelumbo 
nucifera]
Length=1807

 Score =   323 bits (827),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 237/577 (41%), Positives = 333/577 (58%), Gaps = 57/577 (10%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNEHVNSG  1118
             CDICG  GRE LLA CSRC+DGAEHTYCMQ ML+K+PEGDWLCEECK  +E +N+  +  
Sbjct  432   CDICGDAGREELLAFCSRCSDGAEHTYCMQVMLDKVPEGDWLCEECKIKEETENQKQDKV  491

Query  1119  RV----------NEKEKTSPSRRTTIAKSDHPLKMEQKTSDCWGDKAVEERSYLKTSGKR  1268
              +          NEK + +P    T++ S   LK++ K +D  G++  +  S    S KR
Sbjct  492   EIVLGSSKAPYLNEKTQ-NPGGIDTVS-SKVSLKLDVKETDTEGNRITKVSSSSFGSVKR  549

Query  1269  CTDDSEVSSPTKRQRLE--LRSPTAQIPNRV-TSLSRESSFKNLERGKVKPLNPF-----  1424
              +D+ E +SP KRQ LE  + SP    P++    LSRESSFK+L++GKVK  +       
Sbjct  550   HSDNLEAASPAKRQMLETSVASPKTSSPDKKPVLLSRESSFKSLDKGKVKTPHQLGLPSS  609

Query  1425  -SSGSFAAKVPS-STGP-------QPQPPRGIFSKSNSFSSLIAKPKVKLVDEVFPAKQK  1577
              S+ S    V S +TGP       Q Q PRG   KSNSF++L +KPKVKLV E    K+K
Sbjct  610   HSANSSHENVHSPTTGPSSSKNQSQLQSPRGNLLKSNSFNTLNSKPKVKLVQEDVSQKKK  669

Query  1578  LSRETAFIES-KEVAVRSMGKSMSFKPTTASRSNCTESKVKMFSPKFSHDQDVKWLRHKK  1754
             ++R+T   ++ KE  VR +GKS+SFK  ++ R N TESKVKM S   S  +++K L+  K
Sbjct  670   VARDTVINDAKKEGPVRMIGKSISFKTPSSGRFNVTESKVKMLSHNLSCVEELKGLKQAK  729

Query  1755  DRSSFDRKNSLRSDR------LAGGAISSPKSDNKPTPRGE-PSSLSSLNTNRDYRALTS  1913
             +    +RKNS +SDR       A  ++S+PK+D K T RGE  SSL+S    RD +++ +
Sbjct  730   EWGLIERKNSFKSDRPLISSPTAVSSVSTPKTDQKVTSRGETTSSLTSATNCRDMKSVQA  789

Query  1914  DN------KPVTISNSTS------GVAREVLKQASVDGVSSANRVSSSEENPSQAIPKED  2057
             D       KP +++N  S        + EV +Q+ V   SS  R SS+E+ P Q   ++ 
Sbjct  790   DGKLNTSAKPTSLANKGSENRNVLAGSSEVKRQSVVGTPSSNGRCSSTEQKPIQVSTQDG  849

Query  2058  SSSSSCVAERPSWSSNEVLP-DGLSQSKESKAFGDKTRE-SSASRSKQNSTASGKIVSCQ  2231
             ++SSS  A++ SWS ++ +P DGL QS ES     K RE     R KQ  +  G+ + C 
Sbjct  850   TTSSSWTADK-SWSKHDAVPHDGLPQSPESLNQDAKARELFPTGRPKQGVSVGGQSIRCH  908

Query  2232  KCKGNGHLAQVCTADGPESSALGSPFKSSREATNGPSDLKAAIEAARLRKPGICRKNRVA  2411
             KCK  GH AQ C      S    S  KSS+E T     LK A++A  L+ PG+ RKNR++
Sbjct  909   KCKELGHTAQSCPVTKV-SVFEASAEKSSKEVTGKSFKLKEAVKAIMLKPPGMSRKNRLS  967

Query  2412  DQSEDLSAS--NMKSEIASQDQM-LSSTVRRNVNGAE  2513
             +Q ++LS S  ++  E+ S+DQ+  +S   RN+N  E
Sbjct  968   EQLDELSMSSADLSCEV-SKDQLPTTSNCSRNLNSGE  1003


 Score =   274 bits (700),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 166/400 (42%), Positives = 234/400 (59%), Gaps = 53/400 (13%)
 Frame = +3

Query  2349  KAAIEAARLRKPGICRKNRVADQSEDLSAS--NMKSEIASQDQM-LSSTVRRNVNGAE--  2513
             K A++A  L+ PG+ R+NR+++Q ++LS S  ++  E+ S+DQ+  +    RN+N  E  
Sbjct  1021  KTAVKAVTLKSPGMSRRNRLSEQLDELSMSSADLSCEV-SKDQLPTTXNCSRNLNSGEVT  1079

Query  2514  -------------EAQKQETANNAKQ-LGIIAEASARTRNAGHVVFSDVK-------HSV  2630
                          +  K  T NN KQ +    EA+   R A  V  S +         S+
Sbjct  1080  NDDGQEIVRSSAADISKTTTVNNLKQDILKSTEATCSPRGASDVTISPISLDENKPSSSI  1139

Query  2631  IDMER-QTLVSMPVILKTAIPEYQYIWQGGFEVQKSGKAFNLYDGIQAHLSSCASPKVLD  2807
              D+ R ++ V++P  + +AIPE+ YIWQGGFEVQ+SG   +L DGIQA+LS+CASPK+ +
Sbjct  1140  TDLPRVESSVAIPSRI-SAIPEHDYIWQGGFEVQRSGILADLCDGIQAYLSTCASPKIPE  1198

Query  2808  AVNKFPRKVILNEVPRLSSWPMQFKECGVSEDNVALFFFAKDIGSYEKSYKVLLGDMVKH  2987
              V K PRKV+L EVPRLS+WP QF E   +EDNVAL+FFAKD+ SYE+ YK LL  M+K+
Sbjct  1199  VVKKLPRKVLLEEVPRLSTWPRQFDENRATEDNVALYFFAKDLESYERYYKGLLDKMIKN  1258

Query  2988  DLALQGNIGDIELLIFPSNQLPEKFQRWNLMFFLWGVFRGKRANSLQNFPGAEKPL----  3155
             DLAL+GN   IELLIFPSNQLPEK QRWN++FFLWGVFRG+R+N  +   GA+K +    
Sbjct  1259  DLALKGNFNGIELLIFPSNQLPEKSQRWNMLFFLWGVFRGRRSNCSEQILGAQKKVSRSN  1318

Query  3156  ------IQDIPTPATSLPENMF--------TPVPKLNSARGSAATNTEMSAVKESE----  3281
                    Q      TS+ + ++         P+P +  A   +++  E+S    S     
Sbjct  1319  PDVTIAYQGFAAGVTSVSQKVYLPGHKEDPNPLPSVMPAFTGSSSGMEVSKSMASMELPF  1378

Query  3282  -SASLHKIVNGNCSIQSSSQVSRDKCSRINAEQN-DKLDS  3395
              S+S     NGNC    SS   ++  S+ N  Q+ + LDS
Sbjct  1379  ISSSGKLNGNGNCDSNMSSIDYKNLSSQTNFNQHGNGLDS  1418


 Score = 70.5 bits (171),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 56/130 (43%), Positives = 71/130 (55%), Gaps = 4/130 (3%)
 Frame = +3

Query  4056  EMFFFPVDPHPVGNIGSNNSSMPWKV-HPLEEDQLHDKAPNLELALGAKTKPLMSGIPSF  4232
             E  FFP+D  P  +  S  +  P +V     ED +  + PNLELALGA+ +P    I  +
Sbjct  1674  ERHFFPIDLGPAKDCKSRGTLEPLQVLSSTNEDIMGSEVPNLELALGAEKRPRKQAIFPW  1733

Query  4233  LSGKVEKKIIEENTSDNAATSANKEDVsaslslslsFPFPEKEHGTS--SKPEQEDPRRR  4406
             L G  +K+   +   D   T+ N +DVSASLSLSL+FPF  KE      SK EQ  P  R
Sbjct  1734  LVGIADKRNNRDKFPD-PVTNNNDDDVSASLSLSLAFPFSNKEQTVKPVSKTEQLLPDAR  1792

Query  4407  QANTSLLLFG  4436
               NTSL LFG
Sbjct  1793  HVNTSLFLFG  1802



>ref|XP_010275224.1| PREDICTED: uncharacterized protein LOC104610357 isoform X1 [Nelumbo 
nucifera]
Length=1856

 Score =   322 bits (826),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 237/577 (41%), Positives = 333/577 (58%), Gaps = 57/577 (10%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNEHVNSG  1118
             CDICG  GRE LLA CSRC+DGAEHTYCMQ ML+K+PEGDWLCEECK  +E +N+  +  
Sbjct  481   CDICGDAGREELLAFCSRCSDGAEHTYCMQVMLDKVPEGDWLCEECKIKEETENQKQDKV  540

Query  1119  RV----------NEKEKTSPSRRTTIAKSDHPLKMEQKTSDCWGDKAVEERSYLKTSGKR  1268
              +          NEK + +P    T++ S   LK++ K +D  G++  +  S    S KR
Sbjct  541   EIVLGSSKAPYLNEKTQ-NPGGIDTVS-SKVSLKLDVKETDTEGNRITKVSSSSFGSVKR  598

Query  1269  CTDDSEVSSPTKRQRLE--LRSPTAQIPNRV-TSLSRESSFKNLERGKVKPLNPF-----  1424
              +D+ E +SP KRQ LE  + SP    P++    LSRESSFK+L++GKVK  +       
Sbjct  599   HSDNLEAASPAKRQMLETSVASPKTSSPDKKPVLLSRESSFKSLDKGKVKTPHQLGLPSS  658

Query  1425  -SSGSFAAKVPS-STGP-------QPQPPRGIFSKSNSFSSLIAKPKVKLVDEVFPAKQK  1577
              S+ S    V S +TGP       Q Q PRG   KSNSF++L +KPKVKLV E    K+K
Sbjct  659   HSANSSHENVHSPTTGPSSSKNQSQLQSPRGNLLKSNSFNTLNSKPKVKLVQEDVSQKKK  718

Query  1578  LSRETAFIES-KEVAVRSMGKSMSFKPTTASRSNCTESKVKMFSPKFSHDQDVKWLRHKK  1754
             ++R+T   ++ KE  VR +GKS+SFK  ++ R N TESKVKM S   S  +++K L+  K
Sbjct  719   VARDTVINDAKKEGPVRMIGKSISFKTPSSGRFNVTESKVKMLSHNLSCVEELKGLKQAK  778

Query  1755  DRSSFDRKNSLRSDR------LAGGAISSPKSDNKPTPRGE-PSSLSSLNTNRDYRALTS  1913
             +    +RKNS +SDR       A  ++S+PK+D K T RGE  SSL+S    RD +++ +
Sbjct  779   EWGLIERKNSFKSDRPLISSPTAVSSVSTPKTDQKVTSRGETTSSLTSATNCRDMKSVQA  838

Query  1914  DN------KPVTISNSTS------GVAREVLKQASVDGVSSANRVSSSEENPSQAIPKED  2057
             D       KP +++N  S        + EV +Q+ V   SS  R SS+E+ P Q   ++ 
Sbjct  839   DGKLNTSAKPTSLANKGSENRNVLAGSSEVKRQSVVGTPSSNGRCSSTEQKPIQVSTQDG  898

Query  2058  SSSSSCVAERPSWSSNEVLP-DGLSQSKESKAFGDKTRE-SSASRSKQNSTASGKIVSCQ  2231
             ++SSS  A++ SWS ++ +P DGL QS ES     K RE     R KQ  +  G+ + C 
Sbjct  899   TTSSSWTADK-SWSKHDAVPHDGLPQSPESLNQDAKARELFPTGRPKQGVSVGGQSIRCH  957

Query  2232  KCKGNGHLAQVCTADGPESSALGSPFKSSREATNGPSDLKAAIEAARLRKPGICRKNRVA  2411
             KCK  GH AQ C      S    S  KSS+E T     LK A++A  L+ PG+ RKNR++
Sbjct  958   KCKELGHTAQSCPVTKV-SVFEASAEKSSKEVTGKSFKLKEAVKAIMLKPPGMSRKNRLS  1016

Query  2412  DQSEDLSAS--NMKSEIASQDQM-LSSTVRRNVNGAE  2513
             +Q ++LS S  ++  E+ S+DQ+  +S   RN+N  E
Sbjct  1017  EQLDELSMSSADLSCEV-SKDQLPTTSNCSRNLNSGE  1052


 Score =   273 bits (699),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 166/400 (42%), Positives = 234/400 (59%), Gaps = 53/400 (13%)
 Frame = +3

Query  2349  KAAIEAARLRKPGICRKNRVADQSEDLSAS--NMKSEIASQDQM-LSSTVRRNVNGAE--  2513
             K A++A  L+ PG+ R+NR+++Q ++LS S  ++  E+ S+DQ+  +    RN+N  E  
Sbjct  1070  KTAVKAVTLKSPGMSRRNRLSEQLDELSMSSADLSCEV-SKDQLPTTXNCSRNLNSGEVT  1128

Query  2514  -------------EAQKQETANNAKQ-LGIIAEASARTRNAGHVVFSDVK-------HSV  2630
                          +  K  T NN KQ +    EA+   R A  V  S +         S+
Sbjct  1129  NDDGQEIVRSSAADISKTTTVNNLKQDILKSTEATCSPRGASDVTISPISLDENKPSSSI  1188

Query  2631  IDMER-QTLVSMPVILKTAIPEYQYIWQGGFEVQKSGKAFNLYDGIQAHLSSCASPKVLD  2807
              D+ R ++ V++P  + +AIPE+ YIWQGGFEVQ+SG   +L DGIQA+LS+CASPK+ +
Sbjct  1189  TDLPRVESSVAIPSRI-SAIPEHDYIWQGGFEVQRSGILADLCDGIQAYLSTCASPKIPE  1247

Query  2808  AVNKFPRKVILNEVPRLSSWPMQFKECGVSEDNVALFFFAKDIGSYEKSYKVLLGDMVKH  2987
              V K PRKV+L EVPRLS+WP QF E   +EDNVAL+FFAKD+ SYE+ YK LL  M+K+
Sbjct  1248  VVKKLPRKVLLEEVPRLSTWPRQFDENRATEDNVALYFFAKDLESYERYYKGLLDKMIKN  1307

Query  2988  DLALQGNIGDIELLIFPSNQLPEKFQRWNLMFFLWGVFRGKRANSLQNFPGAEKPL----  3155
             DLAL+GN   IELLIFPSNQLPEK QRWN++FFLWGVFRG+R+N  +   GA+K +    
Sbjct  1308  DLALKGNFNGIELLIFPSNQLPEKSQRWNMLFFLWGVFRGRRSNCSEQILGAQKKVSRSN  1367

Query  3156  ------IQDIPTPATSLPENMF--------TPVPKLNSARGSAATNTEMSAVKESE----  3281
                    Q      TS+ + ++         P+P +  A   +++  E+S    S     
Sbjct  1368  PDVTIAYQGFAAGVTSVSQKVYLPGHKEDPNPLPSVMPAFTGSSSGMEVSKSMASMELPF  1427

Query  3282  -SASLHKIVNGNCSIQSSSQVSRDKCSRINAEQN-DKLDS  3395
              S+S     NGNC    SS   ++  S+ N  Q+ + LDS
Sbjct  1428  ISSSGKLNGNGNCDSNMSSIDYKNLSSQTNFNQHGNGLDS  1467


 Score = 70.5 bits (171),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 56/130 (43%), Positives = 71/130 (55%), Gaps = 4/130 (3%)
 Frame = +3

Query  4056  EMFFFPVDPHPVGNIGSNNSSMPWKV-HPLEEDQLHDKAPNLELALGAKTKPLMSGIPSF  4232
             E  FFP+D  P  +  S  +  P +V     ED +  + PNLELALGA+ +P    I  +
Sbjct  1723  ERHFFPIDLGPAKDCKSRGTLEPLQVLSSTNEDIMGSEVPNLELALGAEKRPRKQAIFPW  1782

Query  4233  LSGKVEKKIIEENTSDNAATSANKEDVsaslslslsFPFPEKEHGTS--SKPEQEDPRRR  4406
             L G  +K+   +   D   T+ N +DVSASLSLSL+FPF  KE      SK EQ  P  R
Sbjct  1783  LVGIADKRNNRDKFPD-PVTNNNDDDVSASLSLSLAFPFSNKEQTVKPVSKTEQLLPDAR  1841

Query  4407  QANTSLLLFG  4436
               NTSL LFG
Sbjct  1842  HVNTSLFLFG  1851



>ref|XP_010275226.1| PREDICTED: uncharacterized protein LOC104610357 isoform X3 [Nelumbo 
nucifera]
Length=1844

 Score =   322 bits (826),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 237/577 (41%), Positives = 333/577 (58%), Gaps = 57/577 (10%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNEHVNSG  1118
             CDICG  GRE LLA CSRC+DGAEHTYCMQ ML+K+PEGDWLCEECK  +E +N+  +  
Sbjct  469   CDICGDAGREELLAFCSRCSDGAEHTYCMQVMLDKVPEGDWLCEECKIKEETENQKQDKV  528

Query  1119  RV----------NEKEKTSPSRRTTIAKSDHPLKMEQKTSDCWGDKAVEERSYLKTSGKR  1268
              +          NEK + +P    T++ S   LK++ K +D  G++  +  S    S KR
Sbjct  529   EIVLGSSKAPYLNEKTQ-NPGGIDTVS-SKVSLKLDVKETDTEGNRITKVSSSSFGSVKR  586

Query  1269  CTDDSEVSSPTKRQRLE--LRSPTAQIPNRV-TSLSRESSFKNLERGKVKPLNPF-----  1424
              +D+ E +SP KRQ LE  + SP    P++    LSRESSFK+L++GKVK  +       
Sbjct  587   HSDNLEAASPAKRQMLETSVASPKTSSPDKKPVLLSRESSFKSLDKGKVKTPHQLGLPSS  646

Query  1425  -SSGSFAAKVPS-STGP-------QPQPPRGIFSKSNSFSSLIAKPKVKLVDEVFPAKQK  1577
              S+ S    V S +TGP       Q Q PRG   KSNSF++L +KPKVKLV E    K+K
Sbjct  647   HSANSSHENVHSPTTGPSSSKNQSQLQSPRGNLLKSNSFNTLNSKPKVKLVQEDVSQKKK  706

Query  1578  LSRETAFIES-KEVAVRSMGKSMSFKPTTASRSNCTESKVKMFSPKFSHDQDVKWLRHKK  1754
             ++R+T   ++ KE  VR +GKS+SFK  ++ R N TESKVKM S   S  +++K L+  K
Sbjct  707   VARDTVINDAKKEGPVRMIGKSISFKTPSSGRFNVTESKVKMLSHNLSCVEELKGLKQAK  766

Query  1755  DRSSFDRKNSLRSDR------LAGGAISSPKSDNKPTPRGE-PSSLSSLNTNRDYRALTS  1913
             +    +RKNS +SDR       A  ++S+PK+D K T RGE  SSL+S    RD +++ +
Sbjct  767   EWGLIERKNSFKSDRPLISSPTAVSSVSTPKTDQKVTSRGETTSSLTSATNCRDMKSVQA  826

Query  1914  DN------KPVTISNSTS------GVAREVLKQASVDGVSSANRVSSSEENPSQAIPKED  2057
             D       KP +++N  S        + EV +Q+ V   SS  R SS+E+ P Q   ++ 
Sbjct  827   DGKLNTSAKPTSLANKGSENRNVLAGSSEVKRQSVVGTPSSNGRCSSTEQKPIQVSTQDG  886

Query  2058  SSSSSCVAERPSWSSNEVLP-DGLSQSKESKAFGDKTRE-SSASRSKQNSTASGKIVSCQ  2231
             ++SSS  A++ SWS ++ +P DGL QS ES     K RE     R KQ  +  G+ + C 
Sbjct  887   TTSSSWTADK-SWSKHDAVPHDGLPQSPESLNQDAKARELFPTGRPKQGVSVGGQSIRCH  945

Query  2232  KCKGNGHLAQVCTADGPESSALGSPFKSSREATNGPSDLKAAIEAARLRKPGICRKNRVA  2411
             KCK  GH AQ C      S    S  KSS+E T     LK A++A  L+ PG+ RKNR++
Sbjct  946   KCKELGHTAQSCPVTKV-SVFEASAEKSSKEVTGKSFKLKEAVKAIMLKPPGMSRKNRLS  1004

Query  2412  DQSEDLSAS--NMKSEIASQDQM-LSSTVRRNVNGAE  2513
             +Q ++LS S  ++  E+ S+DQ+  +S   RN+N  E
Sbjct  1005  EQLDELSMSSADLSCEV-SKDQLPTTSNCSRNLNSGE  1040


 Score =   273 bits (699),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 166/400 (42%), Positives = 234/400 (59%), Gaps = 53/400 (13%)
 Frame = +3

Query  2349  KAAIEAARLRKPGICRKNRVADQSEDLSAS--NMKSEIASQDQM-LSSTVRRNVNGAE--  2513
             K A++A  L+ PG+ R+NR+++Q ++LS S  ++  E+ S+DQ+  +    RN+N  E  
Sbjct  1058  KTAVKAVTLKSPGMSRRNRLSEQLDELSMSSADLSCEV-SKDQLPTTXNCSRNLNSGEVT  1116

Query  2514  -------------EAQKQETANNAKQ-LGIIAEASARTRNAGHVVFSDVK-------HSV  2630
                          +  K  T NN KQ +    EA+   R A  V  S +         S+
Sbjct  1117  NDDGQEIVRSSAADISKTTTVNNLKQDILKSTEATCSPRGASDVTISPISLDENKPSSSI  1176

Query  2631  IDMER-QTLVSMPVILKTAIPEYQYIWQGGFEVQKSGKAFNLYDGIQAHLSSCASPKVLD  2807
              D+ R ++ V++P  + +AIPE+ YIWQGGFEVQ+SG   +L DGIQA+LS+CASPK+ +
Sbjct  1177  TDLPRVESSVAIPSRI-SAIPEHDYIWQGGFEVQRSGILADLCDGIQAYLSTCASPKIPE  1235

Query  2808  AVNKFPRKVILNEVPRLSSWPMQFKECGVSEDNVALFFFAKDIGSYEKSYKVLLGDMVKH  2987
              V K PRKV+L EVPRLS+WP QF E   +EDNVAL+FFAKD+ SYE+ YK LL  M+K+
Sbjct  1236  VVKKLPRKVLLEEVPRLSTWPRQFDENRATEDNVALYFFAKDLESYERYYKGLLDKMIKN  1295

Query  2988  DLALQGNIGDIELLIFPSNQLPEKFQRWNLMFFLWGVFRGKRANSLQNFPGAEKPL----  3155
             DLAL+GN   IELLIFPSNQLPEK QRWN++FFLWGVFRG+R+N  +   GA+K +    
Sbjct  1296  DLALKGNFNGIELLIFPSNQLPEKSQRWNMLFFLWGVFRGRRSNCSEQILGAQKKVSRSN  1355

Query  3156  ------IQDIPTPATSLPENMF--------TPVPKLNSARGSAATNTEMSAVKESE----  3281
                    Q      TS+ + ++         P+P +  A   +++  E+S    S     
Sbjct  1356  PDVTIAYQGFAAGVTSVSQKVYLPGHKEDPNPLPSVMPAFTGSSSGMEVSKSMASMELPF  1415

Query  3282  -SASLHKIVNGNCSIQSSSQVSRDKCSRINAEQN-DKLDS  3395
              S+S     NGNC    SS   ++  S+ N  Q+ + LDS
Sbjct  1416  ISSSGKLNGNGNCDSNMSSIDYKNLSSQTNFNQHGNGLDS  1455


 Score = 70.5 bits (171),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 56/130 (43%), Positives = 71/130 (55%), Gaps = 4/130 (3%)
 Frame = +3

Query  4056  EMFFFPVDPHPVGNIGSNNSSMPWKV-HPLEEDQLHDKAPNLELALGAKTKPLMSGIPSF  4232
             E  FFP+D  P  +  S  +  P +V     ED +  + PNLELALGA+ +P    I  +
Sbjct  1711  ERHFFPIDLGPAKDCKSRGTLEPLQVLSSTNEDIMGSEVPNLELALGAEKRPRKQAIFPW  1770

Query  4233  LSGKVEKKIIEENTSDNAATSANKEDVsaslslslsFPFPEKEHGTS--SKPEQEDPRRR  4406
             L G  +K+   +   D   T+ N +DVSASLSLSL+FPF  KE      SK EQ  P  R
Sbjct  1771  LVGIADKRNNRDKFPD-PVTNNNDDDVSASLSLSLAFPFSNKEQTVKPVSKTEQLLPDAR  1829

Query  4407  QANTSLLLFG  4436
               NTSL LFG
Sbjct  1830  HVNTSLFLFG  1839



>ref|XP_010275225.1| PREDICTED: uncharacterized protein LOC104610357 isoform X2 [Nelumbo 
nucifera]
Length=1856

 Score =   318 bits (816),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 236/577 (41%), Positives = 331/577 (57%), Gaps = 57/577 (10%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNEHVNSG  1118
             CDICG  GRE LLA CSRC+DGAEHTYCMQ ML+K+PEGDWLCEECK  +E +N+  +  
Sbjct  481   CDICGDAGREELLAFCSRCSDGAEHTYCMQVMLDKVPEGDWLCEECKIKEETENQKQDKV  540

Query  1119  RV----------NEKEKTSPSRRTTIAKSDHPLKMEQKTSDCWGDKAVEERSYLKTSGKR  1268
              +          NEK + +P    T++ S   LK++ K +D  G++  +  S    S KR
Sbjct  541   EIVLGSSKAPYLNEKTQ-NPGGIDTVS-SKVSLKLDVKETDTEGNRITKVSSSSFGSVKR  598

Query  1269  CTDDSEVSSPTKRQRLE--LRSPTAQIPNRV-TSLSRESSFKNLERGKVKPLNPF-----  1424
              +D+ E +SP KRQ LE  + SP    P++    LSRESSFK+L++GKVK  +       
Sbjct  599   HSDNLEAASPAKRQMLETSVASPKTSSPDKKPVLLSRESSFKSLDKGKVKTPHQLGLPSS  658

Query  1425  -SSGSFAAKVPS-STGP-------QPQPPRGIFSKSNSFSSLIAKPKVKLVDEVFPAKQK  1577
              S+ S    V S +TGP       Q Q PRG   KSNSF++L +KPKVKLV E    K+K
Sbjct  659   HSANSSHENVHSPTTGPSSSKNQSQLQSPRGNLLKSNSFNTLNSKPKVKLVQEDVSQKKK  718

Query  1578  LSRETAFIES-KEVAVRSMGKSMSFKPTTASRSNCTESKVKMFSPKFSHDQDVKWLRHKK  1754
             ++R+T   ++ KE  VR +GKS+SFK  ++ R N TESKVKM S   S  +++K L+  K
Sbjct  719   VARDTVINDAKKEGPVRMIGKSISFKTPSSGRFNVTESKVKMLSHNLSCVEELKGLKQAK  778

Query  1755  DRSSFDRKNSLRSDR------LAGGAISSPKSDNKPTPRGE-PSSLSSLNTNRDYRALTS  1913
             +    +RKNS +SDR       A  ++S+PK+D K T RGE  SSL+S    RD +++ +
Sbjct  779   EWGLIERKNSFKSDRPLISSPTAVSSVSTPKTDQKVTSRGETTSSLTSATNCRDMKSVQA  838

Query  1914  DN------KPVTISNSTS------GVAREVLKQASVDGVSSANRVSSSEENPSQAIPKED  2057
             D       KP +++N  S        + EV +Q+ V   SS  R SS+E+ P Q   ++ 
Sbjct  839   DGKLNTSAKPTSLANKGSENRNVLAGSSEVKRQSVVGTPSSNGRCSSTEQKPIQVSTQDG  898

Query  2058  SSSSSCVAERPSWSSNEVLP-DGLSQSKESKAFGDKTRE-SSASRSKQNSTASGKIVSCQ  2231
             ++SSS  A++ SWS ++ +P DGL QS ES     K RE     R KQ  +  G+ + C 
Sbjct  899   TTSSSWTADK-SWSKHDAVPHDGLPQSPESLNQDAKARELFPTGRPKQGVSVGGQSIRCH  957

Query  2232  KCKGNGHLAQVCTADGPESSALGSPFKSSREATNGPSDLKAAIEAARLRKPGICRKNRVA  2411
             KCK  GH AQ C      S    S  KSS+E T     LK A++A  L+ PG+ RKNR+ 
Sbjct  958   KCKELGHTAQSCPVTKV-SVFEASAEKSSKEVTGKSFKLKEAVKAIMLKPPGMSRKNRLP  1016

Query  2412  DQSEDLSAS--NMKSEIASQDQM-LSSTVRRNVNGAE  2513
             +  ++LS S  ++  E+ S+DQ+  +S   RN+N  E
Sbjct  1017  EWLDELSMSSADLSCEV-SKDQLPTTSNCSRNLNSGE  1052


 Score =   273 bits (699),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 166/400 (42%), Positives = 234/400 (59%), Gaps = 53/400 (13%)
 Frame = +3

Query  2349  KAAIEAARLRKPGICRKNRVADQSEDLSAS--NMKSEIASQDQM-LSSTVRRNVNGAE--  2513
             K A++A  L+ PG+ R+NR+++Q ++LS S  ++  E+ S+DQ+  +    RN+N  E  
Sbjct  1070  KTAVKAVTLKSPGMSRRNRLSEQLDELSMSSADLSCEV-SKDQLPTTXNCSRNLNSGEVT  1128

Query  2514  -------------EAQKQETANNAKQ-LGIIAEASARTRNAGHVVFSDVK-------HSV  2630
                          +  K  T NN KQ +    EA+   R A  V  S +         S+
Sbjct  1129  NDDGQEIVRSSAADISKTTTVNNLKQDILKSTEATCSPRGASDVTISPISLDENKPSSSI  1188

Query  2631  IDMER-QTLVSMPVILKTAIPEYQYIWQGGFEVQKSGKAFNLYDGIQAHLSSCASPKVLD  2807
              D+ R ++ V++P  + +AIPE+ YIWQGGFEVQ+SG   +L DGIQA+LS+CASPK+ +
Sbjct  1189  TDLPRVESSVAIPSRI-SAIPEHDYIWQGGFEVQRSGILADLCDGIQAYLSTCASPKIPE  1247

Query  2808  AVNKFPRKVILNEVPRLSSWPMQFKECGVSEDNVALFFFAKDIGSYEKSYKVLLGDMVKH  2987
              V K PRKV+L EVPRLS+WP QF E   +EDNVAL+FFAKD+ SYE+ YK LL  M+K+
Sbjct  1248  VVKKLPRKVLLEEVPRLSTWPRQFDENRATEDNVALYFFAKDLESYERYYKGLLDKMIKN  1307

Query  2988  DLALQGNIGDIELLIFPSNQLPEKFQRWNLMFFLWGVFRGKRANSLQNFPGAEKPL----  3155
             DLAL+GN   IELLIFPSNQLPEK QRWN++FFLWGVFRG+R+N  +   GA+K +    
Sbjct  1308  DLALKGNFNGIELLIFPSNQLPEKSQRWNMLFFLWGVFRGRRSNCSEQILGAQKKVSRSN  1367

Query  3156  ------IQDIPTPATSLPENMF--------TPVPKLNSARGSAATNTEMSAVKESE----  3281
                    Q      TS+ + ++         P+P +  A   +++  E+S    S     
Sbjct  1368  PDVTIAYQGFAAGVTSVSQKVYLPGHKEDPNPLPSVMPAFTGSSSGMEVSKSMASMELPF  1427

Query  3282  -SASLHKIVNGNCSIQSSSQVSRDKCSRINAEQN-DKLDS  3395
              S+S     NGNC    SS   ++  S+ N  Q+ + LDS
Sbjct  1428  ISSSGKLNGNGNCDSNMSSIDYKNLSSQTNFNQHGNGLDS  1467


 Score = 70.5 bits (171),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 56/130 (43%), Positives = 71/130 (55%), Gaps = 4/130 (3%)
 Frame = +3

Query  4056  EMFFFPVDPHPVGNIGSNNSSMPWKV-HPLEEDQLHDKAPNLELALGAKTKPLMSGIPSF  4232
             E  FFP+D  P  +  S  +  P +V     ED +  + PNLELALGA+ +P    I  +
Sbjct  1723  ERHFFPIDLGPAKDCKSRGTLEPLQVLSSTNEDIMGSEVPNLELALGAEKRPRKQAIFPW  1782

Query  4233  LSGKVEKKIIEENTSDNAATSANKEDVsaslslslsFPFPEKEHGTS--SKPEQEDPRRR  4406
             L G  +K+   +   D   T+ N +DVSASLSLSL+FPF  KE      SK EQ  P  R
Sbjct  1783  LVGIADKRNNRDKFPD-PVTNNNDDDVSASLSLSLAFPFSNKEQTVKPVSKTEQLLPDAR  1841

Query  4407  QANTSLLLFG  4436
               NTSL LFG
Sbjct  1842  HVNTSLFLFG  1851



>gb|EYU19754.1| hypothetical protein MIMGU_mgv1a000792mg [Erythranthe guttata]
Length=985

 Score =   309 bits (792),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 183/440 (42%), Positives = 254/440 (58%), Gaps = 68/440 (15%)
 Frame = +3

Query  2061  SSSSCVAERPSWSSNEVLPDGLSQSKESKAFGDKTRESSASRSKQNSTASGKIVSCQKCK  2240
             + +S + E+P   +NE LPDG  + ++    G++ RE S SR                  
Sbjct  527   TGNSVIPEKPPIDANEGLPDGSPRPRDVSNAGERMREGSGSRF-----------------  569

Query  2241  GNGHLAQVCTADGPESSALGSPFKSSREATNGPSDLKAAIEAARLRKPGICRKNRVADQS  2420
                         GP S+      KSSR+ ++   +LKA IEAA L+KPG+ R++R   QS
Sbjct  570   ------------GPPSA------KSSRDESH---NLKAIIEAAVLKKPGVYRRHRAFGQS  608

Query  2421  EDLSASNMKSEIASQDQMLSSTVRRNV---------------NGAEEAQKQETANNAKQL  2555
             ED S +++  E+AS    +SS+ R+N                N A +   Q T NN K  
Sbjct  609   EDRSVASVGGEVASHQGPMSSSARKNKFSSDADLHERPTVSRNLATDPLNQITPNNMKPS  668

Query  2556  GIIAEASARTRNAGHVVFSDVKHSVIDMERQTLVSMPVILKT-AIPEYQYIWQGGFEVQK  2732
              ++        ++G    S +  S  DM      + P++LK+ AIPE++YIWQG F++ +
Sbjct  669   SLVP---LEGLSSGGQDVSHIGSSSRDMFSNVPAATPILLKSLAIPEHEYIWQGSFDICR  725

Query  2733  SGKAFNLYDGIQAHLSSCASPKVLDAVNKFPRKVILNEVPRLSSWPMQFKECGVSEDNVA  2912
             SGK  +L+DGIQAH+S+CASPKV+D V KF  +++L EVPRLS+WP QF+E GV EDNVA
Sbjct  726   SGKTSDLWDGIQAHVSTCASPKVIDTVYKFKSRIVLYEVPRLSTWPAQFQEHGVKEDNVA  785

Query  2913  LFFFAKDIGSYEKSYKVLLGDMVKHDLALQGNIGDIELLIFPSNQLPEKFQRWNLMFFLW  3092
             LFFFAKD+ SY+  YK LL +M+K+DLAL+GN   +ELLIFPSNQLP+  QRWN+++FLW
Sbjct  786   LFFFAKDLESYDNIYKSLLDNMMKNDLALKGNFNGVELLIFPSNQLPDNSQRWNMLYFLW  845

Query  3093  GVFRGKRANSLQNFPGAEKPLIQ-----DIPTPATSLPENMFTPVP---KLNSARGSAAT  3248
             GVFRGK+ + LQ  P   +PL Q     DIP P  SLPEN  +  P    L+++  +AA 
Sbjct  846   GVFRGKKESCLQQMP---EPLDQFFASRDIPAPIMSLPENRCSIRPVAEDLHTSEDAAAP  902

Query  3249  NTEMSAVKESESASLHKIVN  3308
               E+ A  E     L K VN
Sbjct  903   VLEVPASDELHRLLLSKAVN  922


 Score =   194 bits (492),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 146/353 (41%), Positives = 208/353 (59%), Gaps = 46/353 (13%)
 Frame = +3

Query  768   EAKMEVSDSLEDHVVSLADKEGIDKVV----------NTTGLDLIASQIHQMeesddsei  917
             + K E+ + L +H+ SL+ K     VV          +    D +  +IH ++E++DS++
Sbjct  162   DTKGELLEGLTEHLDSLSPKGAASNVVCGDIPATPLISIVKNDDMEVEIHSVDETEDSDM  221

Query  918   vevdvkvCDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMK  1097
             VE DVKVCDICG  GRE LLAIC RC+DGAEHTYCM++ML ++PEGDWLCEECK  + ++
Sbjct  222   VEQDVKVCDICGDAGREDLLAICCRCSDGAEHTYCMREMLTEVPEGDWLCEECKSVERVR  281

Query  1098  N-EHVNSGRVNEKEKTSPSRRTTIAKSDHPLKMEQKTSDCWGDKAVEERSYLKTSGKRCT  1274
             N      G+ +EKEK + S     A S++       +SD  G +    +  ++T  KR  
Sbjct  282   NGRQEKMGKADEKEKNNSSGE---ASSEY-----ANSSDAEGRR---NKGSVRTPCKRHR  330

Query  1275  DDS--EVSSPTKRQRLE--LRSPTAQIPNRVTSLSRESSFKNLERGKVK----------P  1412
             DD   EVSS  K+  LE  + SP    P++  +LSRE+S KNL++G+++          P
Sbjct  331   DDDGIEVSSVGKKPALETIVGSPKTSNPSKTAALSRETSLKNLDKGRLQSSHHSVPDTVP  390

Query  1413  LNPFSSGSFAAKVPSSTGPQPQPPRGIFSKSNSFSSLIAKPKVKLVDEVFPAKQKLSRET  1592
             +N  +     A  PS    +    RGIFSKSNSF+SL +KPKVKLVD+V   +QK S+E 
Sbjct  391   VNEITE---TAGTPSDR--RGHNFRGIFSKSNSFNSLSSKPKVKLVDQVVIQRQKSSKEH  445

Query  1593  AFIESKEVAVRSMGKSMSFKPTTASRSNCTESKVKMFSP--KFSHDQDVKWLR  1745
                  K+  VRS+GKSMSFK T +SRS   ESK+K+ +   K    +D K+++
Sbjct  446   GSFRLKDGGVRSIGKSMSFKSTNSSRS---ESKIKIITETVKACRSKDCKYIQ  495



>ref|XP_006847740.1| hypothetical protein AMTR_s00149p00102010 [Amborella trichopoda]
 gb|ERN09321.1| hypothetical protein AMTR_s00149p00102010 [Amborella trichopoda]
Length=1575

 Score =   315 bits (806),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 270/799 (34%), Positives = 394/799 (49%), Gaps = 98/799 (12%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNEHVNS-  1115
             CDICG  GRE LLAICSRC+DGAEHTYCMQ ML+K+PEG+WLCEECK  ++ +N+  N  
Sbjct  427   CDICGDTGREDLLAICSRCSDGAEHTYCMQIMLDKLPEGEWLCEECKLKEQAENKKPNKI  486

Query  1116  -------GRVNEKEKTSPSRRTTIAKSDHPLKMEQKTSDCWGDKAVEERSYLKTSGKRCT  1274
                      V   EK+  SR  T +K    L ++    D      +     L  S KR +
Sbjct  487   GTLLPTPKPVYSNEKSQNSRDPTSSKPSSKLNIKVPDQDTSKSSKLVPSPSL--SSKRPS  544

Query  1275  DDSEVSSPTKRQRLELRSPTAQIP--NRVTSLSRESSFKNLERGKVKPLNPF-SSGSFAA  1445
             ++S+ SS +KRQ LE  S   ++   ++   LSR+ S KNLE GK KP +   SSGS   
Sbjct  545   ENSDTSSLSKRQALEGPSSGQRVSGLSKKPMLSRDGSSKNLEMGKTKPTHLLNSSGSQLG  604

Query  1446  -------KVPSSTGPQPQPPR---GIFSKSNSFSSLIAKPKVKLVDE----VFPAKQK--  1577
                    K  S +G  P  P+    + S  + F+SL   P+  L       V P      
Sbjct  605   RSSQDNGKSHSPSGLNPSSPKVQSRLHSSRSKFTSLSRLPRDALRSNIGGIVSPGVHSSL  664

Query  1578  LSRETAFIESKEVAVRSMGKSMSFKPTTASRSNCTESKVKMFSPKFSHDQDVKWLRHKKD  1757
             +S+     +S +V   S+ +S+  KP     S  T  K  M        +DV     KK+
Sbjct  665   VSKSPILSKSPDVKSSSL-QSLKPKPKVKPVSVETPGKQVMT-------RDVSGNHSKKE  716

Query  1758  RS--------SFDRKNSLRSDRLAGGAISSPKSD-NKPTPRGEPSSLSSLNTNRDYRALT  1910
              +        SF    +  S ++   A SS ++D ++ T  G+  S   +N+   +++  
Sbjct  717   EANKTLSKSASFKSGTNPNSSKIHAQAQSSSRADESRGTKLGKEGSFKRINS---FKSNG  773

Query  1911  SDNKPVTISNSTSGVAREVLKQASVDGVSS--ANRVSSSEENPSQAIPKEDSSSSSCVAE  2084
             S N  ++  +  S   R  LK  S   V S   N ++ S+   +++  K  +S+   V  
Sbjct  774   SSNASISAGDKLS-RPRVDLKNTSNSAVISLPPNSLNGSDLRSAESDEKSTTSTDVTVP-  831

Query  2085  RPSWSSNEVLPDGLSQSKESKAFGDKTRESSASRSKQNSTASGKIVSCQKCKGNGHLAQV  2264
                     V   GL  +  S   G+     S S +          + C KCK  GH A  
Sbjct  832   --------VAGKGLEIATGSAGKGENGPTPSPSSNN---------IRCYKCKEMGHRALF  874

Query  2265  C---TADG------PESSALGSPFKSSREATN-GPSDLKAAIEAARLRKPGICRKNRVAD  2414
             C     DG      P  S L    K S+E    G S  K  +E A  ++P     +R+  
Sbjct  875   CPENNRDGVNHSPNPPLSTLAE--KKSKEIDGKGTSKWKHVVETAMSKQPKASENSRLPS  932

Query  2415  QSEDLSASNMKSEIASQDQMLSSTVRRNVNGAEEAQKQETANNAKQLGIIAEASARTR-N  2591
             +S++LS  N  +E  ++D   S++   N++G              Q GI++     T+ N
Sbjct  933   RSQELS--NPSNEGNNKDAR-SNSKPVNISGRTNFISPSEGTRDTQ-GILSSVPDHTKQN  988

Query  2592  AGHVV--------FSDVKHSVIDMERQTLVSMPVILKT-AIPEYQYIWQGGFEVQKSGKA  2744
               H +         + + H   D  +  L  + ++ K  AIPE+ YIWQG FEV++ G+ 
Sbjct  989   VPHYMDIPGTVPRVTAIPHGKSDGGQ--LSGLTILGKILAIPEHDYIWQGRFEVERGGRF  1046

Query  2745  FNLYDGIQAHLSSCASPKVLDAVNKFPRKVILNEVPRLSSWPMQFKECGVSEDNVALFFF  2924
                YDGIQAH+SSCASPKVL+ V++ P +  L EVPR+SSWP QF+E   ++D +AL+FF
Sbjct  1047  STSYDGIQAHVSSCASPKVLETVDQLPLRFKLEEVPRMSSWPAQFEEIHPTDDTIALYFF  1106

Query  2925  AKDIGSYEKSYKVLLGDMVKHDLALQGNIGDIELLIFPSNQLPEKFQRWNLMFFLWGVFR  3104
             AKD+ SYEK Y  LL  M+K+D AL+GNI  +ELLIF SN L EK QRWN ++FLWGVFR
Sbjct  1107  AKDVESYEKHYLKLLETMIKNDFALRGNIKGVELLIFTSNHLIEKSQRWNRLYFLWGVFR  1166

Query  3105  GKRANSLQNFPGAEKPLIQ  3161
              ++A   ++   +++ L +
Sbjct  1167  ERKATCSESLDSSQRILAE  1185


 Score = 56.2 bits (134),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 56/131 (43%), Positives = 70/131 (53%), Gaps = 9/131 (7%)
 Frame = +3

Query  4056  EMFFFPVDPHPVGNIGSNNSSMPWKVHPLEEDQL--HDKAPNLELALGAKTKPLMSGIPS  4229
             E FFFPVDP  V    ++ S+  W +   E++ L     AP+LELALGA+ KP   G+  
Sbjct  1445  ERFFFPVDPGQVRECSTSGSNS-WPLSMREDEGLPPDSDAPDLELALGAEKKPSNEGLWP  1503

Query  4230  FLSGKVEKKIIEENTSDNAATSANKEDVsaslslslsFPFPEKEHGT--SSKPEQEDPRR  4403
              +S   EKKI            A  E+  ASLSLSLS P   +E  T  SS+  Q  P R
Sbjct  1504  LISRSPEKKI----APGKGPLMAEGEEDIASLSLSLSCPCSGEEKTTKPSSQTHQLLPER  1559

Query  4404  RQANTSLLLFG  4436
              + NTSLLLFG
Sbjct  1560  PRVNTSLLLFG  1570



>ref|XP_011012541.1| PREDICTED: uncharacterized protein LOC105116774 isoform X2 [Populus 
euphratica]
Length=1690

 Score =   306 bits (783),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 232/577 (40%), Positives = 320/577 (55%), Gaps = 87/577 (15%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNEHVNSG  1118
             CDICG  GRE  LAICSRC DGAEH YCM++ML+K+PEGDWLCEECK  +E +N+     
Sbjct  391   CDICGDAGREDFLAICSRCADGAEHIYCMREMLQKLPEGDWLCEECKLAEEAENQ-----  445

Query  1119  RVNEKEKTSPSRRTTIAKSDHPLKMEQKTSDCWGDKAVEERSYLKTSGKRCTDDSEVSSP  1298
                  ++ +  +R  +A +                         ++SGKR  +  E++  
Sbjct  446   -----KQDAEEKRMNVAST-------------------------QSSGKRHAEHMELALA  475

Query  1299  TKRQRLE--LRSPTAQIPNRVTSLSRESSFKNLERGKVKPLNPFSSGSFA------AKVP  1454
              KRQ  E  L SP +  P+R+ ++SR++SFK+L++GKVK  +  S G+ +         P
Sbjct  476   PKRQATETSLASPKSCSPSRIAAVSRDTSFKSLDKGKVKIAHQTSFGNRSNIDLPEIARP  535

Query  1455  SSTGPQPQPPRGIFSKSNSFSSLIAKPKVKLVDEVFPAKQKLSRETAFIESKEVAVRSMG  1634
             S  GP  Q P+G   KSNSF++L +K KVKLVDEV P K K +RE++ ++ KE   R M 
Sbjct  536   SVNGPHVQTPKGALLKSNSFNTLNSKMKVKLVDEV-PQKHKGARESS-LDMKEGTARMMR  593

Query  1635  KSMSFKPTTASRSNCTESKVKMFSPKFSHDQDVKWLRHKKDRSSFDRKNSLRSDRLAG--  1808
             KSMSFK  ++ RS+  E KVKM S KFSH QD + L+  KDR + DRK  LR  R  G  
Sbjct  594   KSMSFKSASSGRSSTNELKVKMLSSKFSHIQDSRGLKQVKDRDAVDRKKLLRLGRPPGSS  653

Query  1809  ----GAISSPKSDNKPTPRGEPSSLSSLNTNRDYRALTSDNKPVTISNSTS-----GVAR  1961
                   +S+PK D   T RGE    SS   NR+ ++  S+ K  T+S STS     G   
Sbjct  654   MTSSAVVSTPKVDQGFT-RGESVIASSTGNNRELKSAQSNGKLGTLSRSTSSAGCKGADT  712

Query  1962  EV--LKQASVDGVSSANRVSSSEENPSQAIPKEDSSSSSCVAERPSWSSNEVLPDGLSQS  2135
              V  ++ +S +G+SS    +S+E+  +Q  PK++ SSS   +   + ++ E L DGL +S
Sbjct  713   PVTSVQASSKNGISS----NSAEQKLNQINPKDEPSSS---SWNAASNATENLQDGLPRS  765

Query  2136  KESKAFGDKTRESSASRSKQNSTASGKIVSCQKCKGNGHLAQVCTADGPESSALGSPFKS  2315
             +ES   G+K RE+S SR +       K V+CQKCK   H  + CT   P +S  G+   +
Sbjct  766   RESSNQGEKARENSLSRLRPAGITGLKNVTCQKCKEICHATENCTVVSPLAS--GTDVSA  823

Query  2316  SR---EATNGPSDLKAAIE-AARLRKPGICRKNRVADQSEDLSASNM--KSEIASQDQML  2477
             SR   E  +    LKAAIE AA L+KPGI RK +  DQS+ LS+SN+    EIASQDQ+ 
Sbjct  824   SRIPKEEMSKGRKLKAAIEAAAMLKKPGIYRKKKEIDQSDGLSSSNVDESGEIASQDQL-  882

Query  2478  SSTVRRNVNGAEEAQ-----------KQETANNAKQL  2555
              S + +   G +E Q           K    NN KQL
Sbjct  883   -SVLNKMSEGTDEGQANISASSSDFCKSTIINNVKQL  918


 Score =   300 bits (769),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 239/644 (37%), Positives = 334/644 (52%), Gaps = 93/644 (14%)
 Frame = +3

Query  2640  ERQTLVSMPVILKTAIPEYQYIWQGGFEVQKSGKAFNLYDGIQAHLSSCASPKVLDAVNK  2819
             E+  L  M     +AIPE++YIWQG FEV ++ K  +LYDGIQAHLS+CASPKVLD V+K
Sbjct  1088  EKSVLAKM-----SAIPEHEYIWQGVFEVHRAEKVIDLYDGIQAHLSTCASPKVLDVVSK  1142

Query  2820  FPRKVILNEVPRLSSWPMQFKECGVSEDNVALFFFAKDIGSYEKSYKVLLGDMVKHDLAL  2999
             FP+K+ L+EVP +S+WP QF   GV E+N+AL+FFAK+  SYE +YK LL +M+K DLAL
Sbjct  1143  FPQKIKLDEVPCISTWPRQFLVTGVKEENIALYFFAKNFESYE-NYKRLLDNMIKKDLAL  1201

Query  3000  QGNIGDIELLIFPSNQLPEKFQRWNLMFFLWGVFRGKRANSLQNFPGAEKPLI------Q  3161
             +G+   +E  IFPS QLPE  QRWN+++FLWGVFRG+R++   +F     P +      +
Sbjct  1202  KGSFEGVEFFIFPSTQLPENSQRWNMLYFLWGVFRGRRSDCSDSFKKLVMPSLNGVPRDK  1261

Query  3162  DIPTPATSLPENMFTP--VPKLNSARGSAATNTEMSAVKESESASLHKIVNGNCSIQSSS  3335
             DIP    +  EN+F P  + K  SA  S  ++    A    E  S+   +NGN       
Sbjct  1262  DIPAAVMTSSENIFVPECIVKNTSACDSPCSSDVHLAANAPEKPSVS--LNGN-------  1312

Query  3336  QVSRDKC--SRINAEQND-KLDSSSMQN----SEP-------------KLGPDRRYFGV-  3452
               S DK   S+ N E+ D K+DS S+ N    S P             ++GP R    V 
Sbjct  1313  --SDDKVFNSQTNLEKQDGKVDSRSLTNIRGSSNPWCPEARCSSPCLEEVGPPRCSLDVD  1370

Query  3453  --PLGEAVHSSVQTAERVSSPNTSRPMSVHWAAPLDGEKLSMLSDETPTMQ--EATSVGS  3620
               P  E          R +S +  + + +H       E  S L ++ P+ +     S  S
Sbjct  1371  PKPCTEVT--------RTNSVSDVKEIQIH-------EGGSCLGEDMPSFKIFGVGSQNS  1415

Query  3621  TTKNLCGKDDVKIGRICLDNVSTEEATPLARHTSMEQTLNV-ISSF-GVNPKKR-----S  3779
               + + G+D +      +D   +++   +      +  +N+ + +F G  P+KR     S
Sbjct  1416  GCRRIFGEDTI------VDRTFSDKDNIIVERDLNDDNVNMDVETFSGKGPRKRPFLYLS  1469

Query  3780  HSAETVLQsasssgtsqafssysNDDILVE-EFCHKRVKLNSDRSYG---CNDQTSCSKD  3947
              SA  +      S +   ++   N++ LV+ E   K++K      YG     D+ S S  
Sbjct  1470  DSAPLI------SSSMTPWNKADNNNTLVDGESISKKLKTGFSGRYGGSGSRDENSLS-G  1522

Query  3948  GFLSEMGGTASQLSRQKNERDEALSKTAILETPGNAEMFFFPVDPHPVGNIGSNNSSMPW  4127
              F S+     S  S ++   D+A ++  ILE  G +E +FFPVD H V +      SMPW
Sbjct  1523  SFTSQTCDLGSSSSVEERSYDKASAEKVILEGLGTSERYFFPVDSHHVKDSRFPAISMPW  1582

Query  4128  KVHPLEEDQLHDKAPNLELALGAKTKPLMSGIPSFLSGKVEKKIIEENTSDNAATSANKE  4307
                  +ED + D  PNLELALGA+TK    GI  F  G  EK  I+    D        +
Sbjct  1583  NSSN-DEDPVIDGIPNLELALGAETKSPNKGILPFF-GMAEKNRIQNKPPDKVMNKEEDD  1640

Query  4308  DVsaslslslsFPFPEKEHGTS--SKPEQEDPRRRQANTSLLLF  4433
              VSASLSLSLSFPFP+KE      SK EQ  P R   NTSLLLF
Sbjct  1641  GVSASLSLSLSFPFPDKEQTVKPVSKTEQLVPERCHVNTSLLLF  1684



>ref|XP_011012542.1| PREDICTED: uncharacterized protein LOC105116774 isoform X3 [Populus 
euphratica]
Length=1682

 Score =   306 bits (783),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 232/577 (40%), Positives = 320/577 (55%), Gaps = 87/577 (15%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNEHVNSG  1118
             CDICG  GRE  LAICSRC DGAEH YCM++ML+K+PEGDWLCEECK  +E +N+     
Sbjct  383   CDICGDAGREDFLAICSRCADGAEHIYCMREMLQKLPEGDWLCEECKLAEEAENQ-----  437

Query  1119  RVNEKEKTSPSRRTTIAKSDHPLKMEQKTSDCWGDKAVEERSYLKTSGKRCTDDSEVSSP  1298
                  ++ +  +R  +A +                         ++SGKR  +  E++  
Sbjct  438   -----KQDAEEKRMNVAST-------------------------QSSGKRHAEHMELALA  467

Query  1299  TKRQRLE--LRSPTAQIPNRVTSLSRESSFKNLERGKVKPLNPFSSGSFA------AKVP  1454
              KRQ  E  L SP +  P+R+ ++SR++SFK+L++GKVK  +  S G+ +         P
Sbjct  468   PKRQATETSLASPKSCSPSRIAAVSRDTSFKSLDKGKVKIAHQTSFGNRSNIDLPEIARP  527

Query  1455  SSTGPQPQPPRGIFSKSNSFSSLIAKPKVKLVDEVFPAKQKLSRETAFIESKEVAVRSMG  1634
             S  GP  Q P+G   KSNSF++L +K KVKLVDEV P K K +RE++ ++ KE   R M 
Sbjct  528   SVNGPHVQTPKGALLKSNSFNTLNSKMKVKLVDEV-PQKHKGARESS-LDMKEGTARMMR  585

Query  1635  KSMSFKPTTASRSNCTESKVKMFSPKFSHDQDVKWLRHKKDRSSFDRKNSLRSDRLAG--  1808
             KSMSFK  ++ RS+  E KVKM S KFSH QD + L+  KDR + DRK  LR  R  G  
Sbjct  586   KSMSFKSASSGRSSTNELKVKMLSSKFSHIQDSRGLKQVKDRDAVDRKKLLRLGRPPGSS  645

Query  1809  ----GAISSPKSDNKPTPRGEPSSLSSLNTNRDYRALTSDNKPVTISNSTS-----GVAR  1961
                   +S+PK D   T RGE    SS   NR+ ++  S+ K  T+S STS     G   
Sbjct  646   MTSSAVVSTPKVDQGFT-RGESVIASSTGNNRELKSAQSNGKLGTLSRSTSSAGCKGADT  704

Query  1962  EV--LKQASVDGVSSANRVSSSEENPSQAIPKEDSSSSSCVAERPSWSSNEVLPDGLSQS  2135
              V  ++ +S +G+SS    +S+E+  +Q  PK++ SSS   +   + ++ E L DGL +S
Sbjct  705   PVTSVQASSKNGISS----NSAEQKLNQINPKDEPSSS---SWNAASNATENLQDGLPRS  757

Query  2136  KESKAFGDKTRESSASRSKQNSTASGKIVSCQKCKGNGHLAQVCTADGPESSALGSPFKS  2315
             +ES   G+K RE+S SR +       K V+CQKCK   H  + CT   P +S  G+   +
Sbjct  758   RESSNQGEKARENSLSRLRPAGITGLKNVTCQKCKEICHATENCTVVSPLAS--GTDVSA  815

Query  2316  SR---EATNGPSDLKAAIE-AARLRKPGICRKNRVADQSEDLSASNM--KSEIASQDQML  2477
             SR   E  +    LKAAIE AA L+KPGI RK +  DQS+ LS+SN+    EIASQDQ+ 
Sbjct  816   SRIPKEEMSKGRKLKAAIEAAAMLKKPGIYRKKKEIDQSDGLSSSNVDESGEIASQDQL-  874

Query  2478  SSTVRRNVNGAEEAQ-----------KQETANNAKQL  2555
              S + +   G +E Q           K    NN KQL
Sbjct  875   -SVLNKMSEGTDEGQANISASSSDFCKSTIINNVKQL  910


 Score =   300 bits (769),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 239/644 (37%), Positives = 334/644 (52%), Gaps = 93/644 (14%)
 Frame = +3

Query  2640  ERQTLVSMPVILKTAIPEYQYIWQGGFEVQKSGKAFNLYDGIQAHLSSCASPKVLDAVNK  2819
             E+  L  M     +AIPE++YIWQG FEV ++ K  +LYDGIQAHLS+CASPKVLD V+K
Sbjct  1080  EKSVLAKM-----SAIPEHEYIWQGVFEVHRAEKVIDLYDGIQAHLSTCASPKVLDVVSK  1134

Query  2820  FPRKVILNEVPRLSSWPMQFKECGVSEDNVALFFFAKDIGSYEKSYKVLLGDMVKHDLAL  2999
             FP+K+ L+EVP +S+WP QF   GV E+N+AL+FFAK+  SYE +YK LL +M+K DLAL
Sbjct  1135  FPQKIKLDEVPCISTWPRQFLVTGVKEENIALYFFAKNFESYE-NYKRLLDNMIKKDLAL  1193

Query  3000  QGNIGDIELLIFPSNQLPEKFQRWNLMFFLWGVFRGKRANSLQNFPGAEKPLI------Q  3161
             +G+   +E  IFPS QLPE  QRWN+++FLWGVFRG+R++   +F     P +      +
Sbjct  1194  KGSFEGVEFFIFPSTQLPENSQRWNMLYFLWGVFRGRRSDCSDSFKKLVMPSLNGVPRDK  1253

Query  3162  DIPTPATSLPENMFTP--VPKLNSARGSAATNTEMSAVKESESASLHKIVNGNCSIQSSS  3335
             DIP    +  EN+F P  + K  SA  S  ++    A    E  S+   +NGN       
Sbjct  1254  DIPAAVMTSSENIFVPECIVKNTSACDSPCSSDVHLAANAPEKPSVS--LNGN-------  1304

Query  3336  QVSRDKC--SRINAEQND-KLDSSSMQN----SEP-------------KLGPDRRYFGV-  3452
               S DK   S+ N E+ D K+DS S+ N    S P             ++GP R    V 
Sbjct  1305  --SDDKVFNSQTNLEKQDGKVDSRSLTNIRGSSNPWCPEARCSSPCLEEVGPPRCSLDVD  1362

Query  3453  --PLGEAVHSSVQTAERVSSPNTSRPMSVHWAAPLDGEKLSMLSDETPTMQ--EATSVGS  3620
               P  E          R +S +  + + +H       E  S L ++ P+ +     S  S
Sbjct  1363  PKPCTEVT--------RTNSVSDVKEIQIH-------EGGSCLGEDMPSFKIFGVGSQNS  1407

Query  3621  TTKNLCGKDDVKIGRICLDNVSTEEATPLARHTSMEQTLNV-ISSF-GVNPKKR-----S  3779
               + + G+D +      +D   +++   +      +  +N+ + +F G  P+KR     S
Sbjct  1408  GCRRIFGEDTI------VDRTFSDKDNIIVERDLNDDNVNMDVETFSGKGPRKRPFLYLS  1461

Query  3780  HSAETVLQsasssgtsqafssysNDDILVE-EFCHKRVKLNSDRSYG---CNDQTSCSKD  3947
              SA  +      S +   ++   N++ LV+ E   K++K      YG     D+ S S  
Sbjct  1462  DSAPLI------SSSMTPWNKADNNNTLVDGESISKKLKTGFSGRYGGSGSRDENSLS-G  1514

Query  3948  GFLSEMGGTASQLSRQKNERDEALSKTAILETPGNAEMFFFPVDPHPVGNIGSNNSSMPW  4127
              F S+     S  S ++   D+A ++  ILE  G +E +FFPVD H V +      SMPW
Sbjct  1515  SFTSQTCDLGSSSSVEERSYDKASAEKVILEGLGTSERYFFPVDSHHVKDSRFPAISMPW  1574

Query  4128  KVHPLEEDQLHDKAPNLELALGAKTKPLMSGIPSFLSGKVEKKIIEENTSDNAATSANKE  4307
                  +ED + D  PNLELALGA+TK    GI  F  G  EK  I+    D        +
Sbjct  1575  NSSN-DEDPVIDGIPNLELALGAETKSPNKGILPFF-GMAEKNRIQNKPPDKVMNKEEDD  1632

Query  4308  DVsaslslslsFPFPEKEHGTS--SKPEQEDPRRRQANTSLLLF  4433
              VSASLSLSLSFPFP+KE      SK EQ  P R   NTSLLLF
Sbjct  1633  GVSASLSLSLSFPFPDKEQTVKPVSKTEQLVPERCHVNTSLLLF  1676



>ref|XP_011012540.1| PREDICTED: uncharacterized protein LOC105116774 isoform X1 [Populus 
euphratica]
Length=1694

 Score =   306 bits (783),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 232/577 (40%), Positives = 320/577 (55%), Gaps = 87/577 (15%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNEHVNSG  1118
             CDICG  GRE  LAICSRC DGAEH YCM++ML+K+PEGDWLCEECK  +E +N+     
Sbjct  395   CDICGDAGREDFLAICSRCADGAEHIYCMREMLQKLPEGDWLCEECKLAEEAENQ-----  449

Query  1119  RVNEKEKTSPSRRTTIAKSDHPLKMEQKTSDCWGDKAVEERSYLKTSGKRCTDDSEVSSP  1298
                  ++ +  +R  +A +                         ++SGKR  +  E++  
Sbjct  450   -----KQDAEEKRMNVAST-------------------------QSSGKRHAEHMELALA  479

Query  1299  TKRQRLE--LRSPTAQIPNRVTSLSRESSFKNLERGKVKPLNPFSSGSFA------AKVP  1454
              KRQ  E  L SP +  P+R+ ++SR++SFK+L++GKVK  +  S G+ +         P
Sbjct  480   PKRQATETSLASPKSCSPSRIAAVSRDTSFKSLDKGKVKIAHQTSFGNRSNIDLPEIARP  539

Query  1455  SSTGPQPQPPRGIFSKSNSFSSLIAKPKVKLVDEVFPAKQKLSRETAFIESKEVAVRSMG  1634
             S  GP  Q P+G   KSNSF++L +K KVKLVDEV P K K +RE++ ++ KE   R M 
Sbjct  540   SVNGPHVQTPKGALLKSNSFNTLNSKMKVKLVDEV-PQKHKGARESS-LDMKEGTARMMR  597

Query  1635  KSMSFKPTTASRSNCTESKVKMFSPKFSHDQDVKWLRHKKDRSSFDRKNSLRSDRLAG--  1808
             KSMSFK  ++ RS+  E KVKM S KFSH QD + L+  KDR + DRK  LR  R  G  
Sbjct  598   KSMSFKSASSGRSSTNELKVKMLSSKFSHIQDSRGLKQVKDRDAVDRKKLLRLGRPPGSS  657

Query  1809  ----GAISSPKSDNKPTPRGEPSSLSSLNTNRDYRALTSDNKPVTISNSTS-----GVAR  1961
                   +S+PK D   T RGE    SS   NR+ ++  S+ K  T+S STS     G   
Sbjct  658   MTSSAVVSTPKVDQGFT-RGESVIASSTGNNRELKSAQSNGKLGTLSRSTSSAGCKGADT  716

Query  1962  EV--LKQASVDGVSSANRVSSSEENPSQAIPKEDSSSSSCVAERPSWSSNEVLPDGLSQS  2135
              V  ++ +S +G+SS    +S+E+  +Q  PK++ SSS   +   + ++ E L DGL +S
Sbjct  717   PVTSVQASSKNGISS----NSAEQKLNQINPKDEPSSS---SWNAASNATENLQDGLPRS  769

Query  2136  KESKAFGDKTRESSASRSKQNSTASGKIVSCQKCKGNGHLAQVCTADGPESSALGSPFKS  2315
             +ES   G+K RE+S SR +       K V+CQKCK   H  + CT   P +S  G+   +
Sbjct  770   RESSNQGEKARENSLSRLRPAGITGLKNVTCQKCKEICHATENCTVVSPLAS--GTDVSA  827

Query  2316  SR---EATNGPSDLKAAIE-AARLRKPGICRKNRVADQSEDLSASNM--KSEIASQDQML  2477
             SR   E  +    LKAAIE AA L+KPGI RK +  DQS+ LS+SN+    EIASQDQ+ 
Sbjct  828   SRIPKEEMSKGRKLKAAIEAAAMLKKPGIYRKKKEIDQSDGLSSSNVDESGEIASQDQL-  886

Query  2478  SSTVRRNVNGAEEAQ-----------KQETANNAKQL  2555
              S + +   G +E Q           K    NN KQL
Sbjct  887   -SVLNKMSEGTDEGQANISASSSDFCKSTIINNVKQL  922


 Score =   301 bits (770),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 239/644 (37%), Positives = 334/644 (52%), Gaps = 93/644 (14%)
 Frame = +3

Query  2640  ERQTLVSMPVILKTAIPEYQYIWQGGFEVQKSGKAFNLYDGIQAHLSSCASPKVLDAVNK  2819
             E+  L  M     +AIPE++YIWQG FEV ++ K  +LYDGIQAHLS+CASPKVLD V+K
Sbjct  1092  EKSVLAKM-----SAIPEHEYIWQGVFEVHRAEKVIDLYDGIQAHLSTCASPKVLDVVSK  1146

Query  2820  FPRKVILNEVPRLSSWPMQFKECGVSEDNVALFFFAKDIGSYEKSYKVLLGDMVKHDLAL  2999
             FP+K+ L+EVP +S+WP QF   GV E+N+AL+FFAK+  SYE +YK LL +M+K DLAL
Sbjct  1147  FPQKIKLDEVPCISTWPRQFLVTGVKEENIALYFFAKNFESYE-NYKRLLDNMIKKDLAL  1205

Query  3000  QGNIGDIELLIFPSNQLPEKFQRWNLMFFLWGVFRGKRANSLQNFPGAEKPLI------Q  3161
             +G+   +E  IFPS QLPE  QRWN+++FLWGVFRG+R++   +F     P +      +
Sbjct  1206  KGSFEGVEFFIFPSTQLPENSQRWNMLYFLWGVFRGRRSDCSDSFKKLVMPSLNGVPRDK  1265

Query  3162  DIPTPATSLPENMFTP--VPKLNSARGSAATNTEMSAVKESESASLHKIVNGNCSIQSSS  3335
             DIP    +  EN+F P  + K  SA  S  ++    A    E  S+   +NGN       
Sbjct  1266  DIPAAVMTSSENIFVPECIVKNTSACDSPCSSDVHLAANAPEKPSVS--LNGN-------  1316

Query  3336  QVSRDKC--SRINAEQND-KLDSSSMQN----SEP-------------KLGPDRRYFGV-  3452
               S DK   S+ N E+ D K+DS S+ N    S P             ++GP R    V 
Sbjct  1317  --SDDKVFNSQTNLEKQDGKVDSRSLTNIRGSSNPWCPEARCSSPCLEEVGPPRCSLDVD  1374

Query  3453  --PLGEAVHSSVQTAERVSSPNTSRPMSVHWAAPLDGEKLSMLSDETPTMQ--EATSVGS  3620
               P  E          R +S +  + + +H       E  S L ++ P+ +     S  S
Sbjct  1375  PKPCTEVT--------RTNSVSDVKEIQIH-------EGGSCLGEDMPSFKIFGVGSQNS  1419

Query  3621  TTKNLCGKDDVKIGRICLDNVSTEEATPLARHTSMEQTLNV-ISSF-GVNPKKR-----S  3779
               + + G+D +      +D   +++   +      +  +N+ + +F G  P+KR     S
Sbjct  1420  GCRRIFGEDTI------VDRTFSDKDNIIVERDLNDDNVNMDVETFSGKGPRKRPFLYLS  1473

Query  3780  HSAETVLQsasssgtsqafssysNDDILVE-EFCHKRVKLNSDRSYG---CNDQTSCSKD  3947
              SA  +      S +   ++   N++ LV+ E   K++K      YG     D+ S S  
Sbjct  1474  DSAPLI------SSSMTPWNKADNNNTLVDGESISKKLKTGFSGRYGGSGSRDENSLS-G  1526

Query  3948  GFLSEMGGTASQLSRQKNERDEALSKTAILETPGNAEMFFFPVDPHPVGNIGSNNSSMPW  4127
              F S+     S  S ++   D+A ++  ILE  G +E +FFPVD H V +      SMPW
Sbjct  1527  SFTSQTCDLGSSSSVEERSYDKASAEKVILEGLGTSERYFFPVDSHHVKDSRFPAISMPW  1586

Query  4128  KVHPLEEDQLHDKAPNLELALGAKTKPLMSGIPSFLSGKVEKKIIEENTSDNAATSANKE  4307
                  +ED + D  PNLELALGA+TK    GI  F  G  EK  I+    D        +
Sbjct  1587  NSSN-DEDPVIDGIPNLELALGAETKSPNKGILPFF-GMAEKNRIQNKPPDKVMNKEEDD  1644

Query  4308  DVsaslslslsFPFPEKEHGTS--SKPEQEDPRRRQANTSLLLF  4433
              VSASLSLSLSFPFP+KE      SK EQ  P R   NTSLLLF
Sbjct  1645  GVSASLSLSLSFPFPDKEQTVKPVSKTEQLVPERCHVNTSLLLF  1688



>ref|XP_011012543.1| PREDICTED: uncharacterized protein LOC105116774 isoform X4 [Populus 
euphratica]
Length=1678

 Score =   306 bits (783),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 232/577 (40%), Positives = 320/577 (55%), Gaps = 87/577 (15%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNEHVNSG  1118
             CDICG  GRE  LAICSRC DGAEH YCM++ML+K+PEGDWLCEECK  +E +N+     
Sbjct  379   CDICGDAGREDFLAICSRCADGAEHIYCMREMLQKLPEGDWLCEECKLAEEAENQ-----  433

Query  1119  RVNEKEKTSPSRRTTIAKSDHPLKMEQKTSDCWGDKAVEERSYLKTSGKRCTDDSEVSSP  1298
                  ++ +  +R  +A +                         ++SGKR  +  E++  
Sbjct  434   -----KQDAEEKRMNVAST-------------------------QSSGKRHAEHMELALA  463

Query  1299  TKRQRLE--LRSPTAQIPNRVTSLSRESSFKNLERGKVKPLNPFSSGSFA------AKVP  1454
              KRQ  E  L SP +  P+R+ ++SR++SFK+L++GKVK  +  S G+ +         P
Sbjct  464   PKRQATETSLASPKSCSPSRIAAVSRDTSFKSLDKGKVKIAHQTSFGNRSNIDLPEIARP  523

Query  1455  SSTGPQPQPPRGIFSKSNSFSSLIAKPKVKLVDEVFPAKQKLSRETAFIESKEVAVRSMG  1634
             S  GP  Q P+G   KSNSF++L +K KVKLVDEV P K K +RE++ ++ KE   R M 
Sbjct  524   SVNGPHVQTPKGALLKSNSFNTLNSKMKVKLVDEV-PQKHKGARESS-LDMKEGTARMMR  581

Query  1635  KSMSFKPTTASRSNCTESKVKMFSPKFSHDQDVKWLRHKKDRSSFDRKNSLRSDRLAG--  1808
             KSMSFK  ++ RS+  E KVKM S KFSH QD + L+  KDR + DRK  LR  R  G  
Sbjct  582   KSMSFKSASSGRSSTNELKVKMLSSKFSHIQDSRGLKQVKDRDAVDRKKLLRLGRPPGSS  641

Query  1809  ----GAISSPKSDNKPTPRGEPSSLSSLNTNRDYRALTSDNKPVTISNSTS-----GVAR  1961
                   +S+PK D   T RGE    SS   NR+ ++  S+ K  T+S STS     G   
Sbjct  642   MTSSAVVSTPKVDQGFT-RGESVIASSTGNNRELKSAQSNGKLGTLSRSTSSAGCKGADT  700

Query  1962  EV--LKQASVDGVSSANRVSSSEENPSQAIPKEDSSSSSCVAERPSWSSNEVLPDGLSQS  2135
              V  ++ +S +G+SS    +S+E+  +Q  PK++ SSS   +   + ++ E L DGL +S
Sbjct  701   PVTSVQASSKNGISS----NSAEQKLNQINPKDEPSSS---SWNAASNATENLQDGLPRS  753

Query  2136  KESKAFGDKTRESSASRSKQNSTASGKIVSCQKCKGNGHLAQVCTADGPESSALGSPFKS  2315
             +ES   G+K RE+S SR +       K V+CQKCK   H  + CT   P +S  G+   +
Sbjct  754   RESSNQGEKARENSLSRLRPAGITGLKNVTCQKCKEICHATENCTVVSPLAS--GTDVSA  811

Query  2316  SR---EATNGPSDLKAAIE-AARLRKPGICRKNRVADQSEDLSASNM--KSEIASQDQML  2477
             SR   E  +    LKAAIE AA L+KPGI RK +  DQS+ LS+SN+    EIASQDQ+ 
Sbjct  812   SRIPKEEMSKGRKLKAAIEAAAMLKKPGIYRKKKEIDQSDGLSSSNVDESGEIASQDQL-  870

Query  2478  SSTVRRNVNGAEEAQ-----------KQETANNAKQL  2555
              S + +   G +E Q           K    NN KQL
Sbjct  871   -SVLNKMSEGTDEGQANISASSSDFCKSTIINNVKQL  906


 Score =   300 bits (768),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 239/644 (37%), Positives = 334/644 (52%), Gaps = 93/644 (14%)
 Frame = +3

Query  2640  ERQTLVSMPVILKTAIPEYQYIWQGGFEVQKSGKAFNLYDGIQAHLSSCASPKVLDAVNK  2819
             E+  L  M     +AIPE++YIWQG FEV ++ K  +LYDGIQAHLS+CASPKVLD V+K
Sbjct  1076  EKSVLAKM-----SAIPEHEYIWQGVFEVHRAEKVIDLYDGIQAHLSTCASPKVLDVVSK  1130

Query  2820  FPRKVILNEVPRLSSWPMQFKECGVSEDNVALFFFAKDIGSYEKSYKVLLGDMVKHDLAL  2999
             FP+K+ L+EVP +S+WP QF   GV E+N+AL+FFAK+  SYE +YK LL +M+K DLAL
Sbjct  1131  FPQKIKLDEVPCISTWPRQFLVTGVKEENIALYFFAKNFESYE-NYKRLLDNMIKKDLAL  1189

Query  3000  QGNIGDIELLIFPSNQLPEKFQRWNLMFFLWGVFRGKRANSLQNFPGAEKPLI------Q  3161
             +G+   +E  IFPS QLPE  QRWN+++FLWGVFRG+R++   +F     P +      +
Sbjct  1190  KGSFEGVEFFIFPSTQLPENSQRWNMLYFLWGVFRGRRSDCSDSFKKLVMPSLNGVPRDK  1249

Query  3162  DIPTPATSLPENMFTP--VPKLNSARGSAATNTEMSAVKESESASLHKIVNGNCSIQSSS  3335
             DIP    +  EN+F P  + K  SA  S  ++    A    E  S+   +NGN       
Sbjct  1250  DIPAAVMTSSENIFVPECIVKNTSACDSPCSSDVHLAANAPEKPSVS--LNGN-------  1300

Query  3336  QVSRDKC--SRINAEQND-KLDSSSMQN----SEP-------------KLGPDRRYFGV-  3452
               S DK   S+ N E+ D K+DS S+ N    S P             ++GP R    V 
Sbjct  1301  --SDDKVFNSQTNLEKQDGKVDSRSLTNIRGSSNPWCPEARCSSPCLEEVGPPRCSLDVD  1358

Query  3453  --PLGEAVHSSVQTAERVSSPNTSRPMSVHWAAPLDGEKLSMLSDETPTMQ--EATSVGS  3620
               P  E          R +S +  + + +H       E  S L ++ P+ +     S  S
Sbjct  1359  PKPCTEVT--------RTNSVSDVKEIQIH-------EGGSCLGEDMPSFKIFGVGSQNS  1403

Query  3621  TTKNLCGKDDVKIGRICLDNVSTEEATPLARHTSMEQTLNV-ISSF-GVNPKKR-----S  3779
               + + G+D +      +D   +++   +      +  +N+ + +F G  P+KR     S
Sbjct  1404  GCRRIFGEDTI------VDRTFSDKDNIIVERDLNDDNVNMDVETFSGKGPRKRPFLYLS  1457

Query  3780  HSAETVLQsasssgtsqafssysNDDILVE-EFCHKRVKLNSDRSYG---CNDQTSCSKD  3947
              SA  +      S +   ++   N++ LV+ E   K++K      YG     D+ S S  
Sbjct  1458  DSAPLI------SSSMTPWNKADNNNTLVDGESISKKLKTGFSGRYGGSGSRDENSLS-G  1510

Query  3948  GFLSEMGGTASQLSRQKNERDEALSKTAILETPGNAEMFFFPVDPHPVGNIGSNNSSMPW  4127
              F S+     S  S ++   D+A ++  ILE  G +E +FFPVD H V +      SMPW
Sbjct  1511  SFTSQTCDLGSSSSVEERSYDKASAEKVILEGLGTSERYFFPVDSHHVKDSRFPAISMPW  1570

Query  4128  KVHPLEEDQLHDKAPNLELALGAKTKPLMSGIPSFLSGKVEKKIIEENTSDNAATSANKE  4307
                  +ED + D  PNLELALGA+TK    GI  F  G  EK  I+    D        +
Sbjct  1571  NSSN-DEDPVIDGIPNLELALGAETKSPNKGILPFF-GMAEKNRIQNKPPDKVMNKEEDD  1628

Query  4308  DVsaslslslsFPFPEKEHGTS--SKPEQEDPRRRQANTSLLLF  4433
              VSASLSLSLSFPFP+KE      SK EQ  P R   NTSLLLF
Sbjct  1629  GVSASLSLSLSFPFPDKEQTVKPVSKTEQLVPERCHVNTSLLLF  1672



>ref|XP_011012545.1| PREDICTED: uncharacterized protein LOC105116774 isoform X5 [Populus 
euphratica]
Length=1625

 Score =   300 bits (769),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 239/645 (37%), Positives = 335/645 (52%), Gaps = 93/645 (14%)
 Frame = +3

Query  2637  MERQTLVSMPVILKTAIPEYQYIWQGGFEVQKSGKAFNLYDGIQAHLSSCASPKVLDAVN  2816
             +E+  L  M     +AIPE++YIWQG FEV ++ K  +LYDGIQAHLS+CASPKVLD V+
Sbjct  1022  VEKSVLTKM-----SAIPEHEYIWQGVFEVHRAEKVIDLYDGIQAHLSTCASPKVLDVVS  1076

Query  2817  KFPRKVILNEVPRLSSWPMQFKECGVSEDNVALFFFAKDIGSYEKSYKVLLGDMVKHDLA  2996
             KFP+K+ L+EVP +S+WP QF   GV E+N+AL+FFAK+  SYE +YK LL +M+K DLA
Sbjct  1077  KFPQKIKLDEVPCISTWPRQFLVTGVKEENIALYFFAKNFESYE-NYKRLLDNMIKKDLA  1135

Query  2997  LQGNIGDIELLIFPSNQLPEKFQRWNLMFFLWGVFRGKRANSLQNFPGAEKPLI------  3158
             L+G+   +E  IFPS QLPE  QRWN+++FLWGVFRG+R++   +F     P +      
Sbjct  1136  LKGSFEGVEFFIFPSTQLPENSQRWNMLYFLWGVFRGRRSDCSDSFKKLVMPSLNGVPRD  1195

Query  3159  QDIPTPATSLPENMFTP--VPKLNSARGSAATNTEMSAVKESESASLHKIVNGNCSIQSS  3332
             +DIP    +  EN+F P  + K  SA  S  ++    A    E  S+   +NGN      
Sbjct  1196  KDIPAAVMTSSENIFVPECIVKNTSACDSPCSSDVHLAANAPEKPSVS--LNGN------  1247

Query  3333  SQVSRDKC--SRINAEQND-KLDSSSMQN----SEP-------------KLGPDRRYFGV  3452
                S DK   S+ N E+ D K+DS S+ N    S P             ++GP R    V
Sbjct  1248  ---SDDKVFNSQTNLEKQDGKVDSRSLTNIRGSSNPWCPEARCSSPCLEEVGPPRCSLDV  1304

Query  3453  ---PLGEAVHSSVQTAERVSSPNTSRPMSVHWAAPLDGEKLSMLSDETPTMQ--EATSVG  3617
                P  E          R +S +  + + +H       E  S L ++ P+ +     S  
Sbjct  1305  DPKPCTEVT--------RTNSVSDVKEIQIH-------EGGSCLGEDMPSFKIFGVGSQN  1349

Query  3618  STTKNLCGKDDVKIGRICLDNVSTEEATPLARHTSMEQTLNV-ISSF-GVNPKKR-----  3776
             S  + + G+D +      +D   +++   +      +  +N+ + +F G  P+KR     
Sbjct  1350  SGCRRIFGEDTI------VDRTFSDKDNIIVERDLNDDNVNMDVETFSGKGPRKRPFLYL  1403

Query  3777  SHSAETVLQsasssgtsqafssysNDDILVE-EFCHKRVKLNSDRSYG---CNDQTSCSK  3944
             S SA  +      S +   ++   N++ LV+ E   K++K      YG     D+ S S 
Sbjct  1404  SDSAPLI------SSSMTPWNKADNNNTLVDGESISKKLKTGFSGRYGGSGSRDENSLS-  1456

Query  3945  DGFLSEMGGTASQLSRQKNERDEALSKTAILETPGNAEMFFFPVDPHPVGNIGSNNSSMP  4124
               F S+     S  S ++   D+A ++  ILE  G +E +FFPVD H V +      SMP
Sbjct  1457  GSFTSQTCDLGSSSSVEERSYDKASAEKVILEGLGTSERYFFPVDSHHVKDSRFPAISMP  1516

Query  4125  WKVHPLEEDQLHDKAPNLELALGAKTKPLMSGIPSFLSGKVEKKIIEENTSDNAATSANK  4304
             W     +ED + D  PNLELALGA+TK    GI  F  G  EK  I+    D        
Sbjct  1517  WNSSN-DEDPVIDGIPNLELALGAETKSPNKGILPFF-GMAEKNRIQNKPPDKVMNKEED  1574

Query  4305  EDVsaslslslsFPFPEKEHGTS--SKPEQEDPRRRQANTSLLLF  4433
             + VSASLSLSLSFPFP+KE      SK EQ  P R   NTSLLLF
Sbjct  1575  DGVSASLSLSLSFPFPDKEQTVKPVSKTEQLVPERCHVNTSLLLF  1619



>ref|XP_010502985.1| PREDICTED: dentin sialophosphoprotein-like isoform X5 [Camelina 
sativa]
Length=841

 Score =   284 bits (726),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 246/733 (34%), Positives = 353/733 (48%), Gaps = 155/733 (21%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNEHVNSG  1118
             CDICG  GRE LLAICSRC+DGAEHTYCM+ ML+K+P+GDWLCEECKF +E K + + + 
Sbjct  233   CDICGDAGREDLLAICSRCSDGAEHTYCMRVMLKKVPKGDWLCEECKFAEEAKKKKLETK  292

Query  1119  RVNEKEKTSPSRRTTIAKSDHPLKMEQKTSDCWGDKAVEERSYLKTSGKRCTDDSEVSSP  1298
               +E                                AV   +  ++S KR  D  E +  
Sbjct  293   GKSES-------------------------------AVNLST--QSSSKRHIDKFEAAPD  319

Query  1299  TKRQRLE--LRSPTAQIPNRVTSLSRESSFKNLERGKVKPLNPFSSGSFAAK-----VPS  1457
             +KR  +E    +P   +  R ++LSRE+SFK LE    KP    +  S         + S
Sbjct  320   SKRLAVEAPTGAPKRSVLPRSSTLSRETSFKGLE----KPTRKLAHHSSFNSHSSDDLES  375

Query  1458  STGP--QPQPPRGIFSKSNSFSSLIAKPKVKLVDEVFPAKQKLSRETAFIESKEVAVRSM  1631
             +  P  Q + P+G F KSNSF+S  ++PKV+ VD+V   +QK  ++   ++      R++
Sbjct  376   TRSPDSQLRSPKGSFLKSNSFNSSSSRPKVRPVDDVMLPRQKTGKDNCSLD----VSRNV  431

Query  1632  GKSMSFKPTTASRSNCTESKVKMFSPKFSHDQDVKWLRHKKDRSSFDRKNSLRSDRLAGG  1811
             GKSMS +      S+C +SKV    P              KDRS                
Sbjct  432   GKSMSNRCIDVGSSSCYDSKVNGTKPL-------------KDRS-------------IEA  465

Query  1812  AISSPKSDNKPTPRGEPSSLSSLNTNRDYRALTSDNKPVTISNSTSGVAREVLKQASVDG  1991
               S+   D K   RG  SS S   + RD + L SD +   ++     ++R  L+    D 
Sbjct  466   NPSASTIDQKLISRGRSSS-SYAKSPRDLKDLESDGQQGRLTKQARHLSRNRLE----DI  520

Query  1992  VSSANRVSSSEENPSQAIPKEDSSSSSCVAERPSWSSNEVLPDGLSQSKESKAFGDKTRE  2171
             V+S    S++E+               C +    + +     DG  + +E +  G+K+++
Sbjct  521   VASVGDSSTNEK---------------CSSSEAKYKNELANVDGFPRPREVREAGEKSKD  565

Query  2172  SSASRSKQNSTASGKIVSCQKCKGNGHLAQVCTADGPESSALGSPFKSSREATNGPSDLK  2351
             +                      GN     +                  RE  N  + L+
Sbjct  566   AV---------------------GNHQTLNI------------------REDNNKGNRLR  586

Query  2352  AAIEAARLRKPGICRKNRVADQSEDLSASNMKSEIASQDQMLSSTV---------RRNVN  2504
             AA++AA  +KP    K R  +QS+  S SN+ S      + +SS V          + + 
Sbjct  587   AAVDAALRKKPSFS-KGRGLEQSDLPSVSNVDSGCDKALRNMSSKVPVIRDWPVGFKGLP  645

Query  2505  GAE---EAQKQETANNAKQLGIIAEASARTRNAGHVVFSDVK-HSVIDMERQTLVSMPVI  2672
             G        KQ  A N  Q    A+A A    A   V  +V   S+  + R   V+ P +
Sbjct  646   GGHPNLRTDKQTIAVNGTQSLAGADAMA----ASQSVVPEVHVPSIKPVMRDLPVAAPAV  701

Query  2673  LKT--AIPEYQYIWQGGFEVQKSGKAFNLYDGIQAHLSSCASPKVLDAVNKFPRKVILNE  2846
             L T  AIPE +YIWQG  EVQKS     +++G+QA+LS+ ASPKV++ VN+FP K+ LNE
Sbjct  702   LSTTSAIPEPEYIWQGDLEVQKSRNLSTMHNGMQAYLSTLASPKVVEVVNQFPVKLTLNE  761

Query  2847  VPRLSSWPMQFKECGVSEDNVALFFFAKDIGSYEKSYKVLLGDMVKHDLALQGNIGDIEL  3026
             VPRLS+WP QF++ G  E +VALFFFAKDI SYEK+YK L+ +M++ DLAL+GN+  +EL
Sbjct  762   VPRLSAWPAQFQDIGAKEQHVALFFFAKDIKSYEKNYKPLVDNMIQKDLALKGNLEGVEL  821

Query  3027  LIFPSNQLPEKFQ  3065
             LIF SN LP   Q
Sbjct  822   LIFASNHLPRDCQ  834



>ref|XP_009397135.1| PREDICTED: uncharacterized protein LOC103982059 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=1661

 Score =   282 bits (721),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 265/836 (32%), Positives = 399/836 (48%), Gaps = 151/836 (18%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNEHVNSG  1118
             CDICG  GRE LLA CSRC DGAEHTYCMQ ML+K+PE DWLCEEC+     K E V   
Sbjct  450   CDICGDAGREDLLASCSRCIDGAEHTYCMQIMLDKVPERDWLCEECQ-----KKEDVEIK  504

Query  1119  RVNEKEKTSPS--------RRTTIAKSDHPL---KMEQKTSD---CWGDKAVEERSYLKT  1256
             ++ + E  S +        +      S +P    K++ ++++   C   K ++     +T
Sbjct  505   KMKKAESVSGTSNICYLNKKIQNFGSSVNPESSPKLDTRSTNPEACGSSKQIQSP---RT  561

Query  1257  SGKRCTDDSEVSSPTKRQRLE-----LRSPTAQIPNRVTSLSRESSFKNLERGKVKPLNP  1421
             + K+  D  +V   TK++  E     LR+ + +I    T  SRESSFKNL   +VK  N 
Sbjct  562   TSKKQMDRVDVGPVTKKKASETSDEPLRTASPRI---ATKFSRESSFKNLHMAQVKQTNI  618

Query  1422  FSS-----------------------------GSFAAKVPSSTGPQ--------------  1472
              S+                             G+    + S TG Q              
Sbjct  619   ASTLGDHSTNSSQTSRLLTLDRENSFKNLHMAGTKGTIIASLTGDQCTKSSQTSHSLTLD  678

Query  1473  ---------PQPPRGIFSKSNSFSSLIAKPKVK-LVDEVFPAKQKLSRETAFIESKEVAV  1622
                         PRG  SK  SF    A+PKVK LV+ V    QKL++E+    +K++ +
Sbjct  679   SKSSNVRRELYSPRGFLSKQVSFKK-SAEPKVKQLVEGV---SQKLAKESTSSNTKQMLI  734

Query  1623  RSMGKSMSFKPTTASRSNCTESKVKMFSPKFSHDQDVKWLRHKKDRSSFDRKNSLRSDRL  1802
             R++ +S S K  ++   N  +S +K  S K +   D K     K+R   +RK+S   D  
Sbjct  735   RTVNRSASCKSVSSGHHN-VKSLIKAQSLK-TPRADPKSFNPNKERGVMERKSSFDLD--  790

Query  1803  AGGAISSPKSDNKPTPRGEPSSLSSLNTNRDYRALTSDNKPVTISNSTSGVARE------  1964
                 IS P    KP P+ +   ++  N+N       S+   ++I  S+ G  RE      
Sbjct  791   -CQLISPPPVGRKPLPKLD-VKIAPPNSN------ASNKSELSILCSSKGFDRENNFGFK  842

Query  1965  -VLKQASVDGVSSANRVSSSE-ENPSQAIPKEDSSSSSCVAERPSWSSNEVLPDGLSQSK  2138
              V KQ+S    S  N +  SE + P + + KE    +S           EV         
Sbjct  843   EVKKQSSFKWKS--NEICDSENKKPGEFVNKEAVLVNSAATYVSCSDDGEVRSSVSPSID  900

Query  2139  ESKA--FGDKTRESSASRSKQNSTASGKIVSCQKCKGNGHL----AQVCTADGPESSALG  2300
              S      D T++ S + S+   T    +V        GH+    A+    D P  SA  
Sbjct  901   SSHQGNLDDTTKDFSGT-SRSAVTGVNHVV--------GHVKLTEAKCGQIDRPNMSAAK  951

Query  2301  SPFKSSR-EATNGPSDLKAAIEAARLRKPGICRKNRVADQSE-DLSASNMKSEIASQDQM  2474
                     + TN  +  K A++AA  +     + +R  DQSE  L  +N+  E +S+  +
Sbjct  952   PSVDVGLVDGTNKRNKWKDALKAAISKN----KMSRTVDQSECKLLKNNIICEDSSRSSL  1007

Query  2475  LSSTVRRNV--NGAEEAQ-----------KQETANNAKQLGIIAEASARTRNAGHVVFSD  2615
              SS+  +++   GA   +           + ++A++A+Q   + E+S      G +  + 
Sbjct  1008  TSSSCLKDLPLEGAPYGKVILRVSDTDNGRTDSASDAEQTKHLTESSY-VPGVGDLNVNP  1066

Query  2616  VKHSVIDMER--QTLVSMPVILKT-----AIPEYQYIWQGGFEVQKSGKAFNLYDGIQAH  2774
             +    ++ +   Q L   P  L T      +PE+++IWQG FE+ + G+   + +GIQAH
Sbjct  1067  INPDALNEKSSAQILPDHPSPLTTDFRFLVVPEHKFIWQGAFEILRIGRFPKVVEGIQAH  1126

Query  2775  LSSCASPKVLDAVNKFPRKVILNEVPRLSSWPMQFKECGVSEDNVALFFFAKDIGSYEKS  2954
             LS+ ASPKV +   +FP  + L EVPR+S WP+QF+E G  EDN+ L+FFAKD  SYEKS
Sbjct  1127  LSNFASPKVHEVACRFPCNIQLEEVPRVSLWPLQFQETGPKEDNIGLYFFAKDAESYEKS  1186

Query  2955  YKVLLGDMVKHDLALQGNIGDIELLIFPSNQLPEKFQRWNLMFFLWGVFRGKRANS  3122
             Y+ LL    K+DLA +G+I ++ELLIFPSN LPE  QRWN++FFLWG+F+ ++ +S
Sbjct  1187  YQKLLDAAQKNDLAFKGSINEVELLIFPSNVLPESSQRWNMLFFLWGIFKVRKQDS  1242



>ref|XP_007131493.1| hypothetical protein PHAVU_011G017900g [Phaseolus vulgaris]
 ref|XP_007131496.1| hypothetical protein PHAVU_011G017900g [Phaseolus vulgaris]
 gb|ESW03487.1| hypothetical protein PHAVU_011G017900g [Phaseolus vulgaris]
 gb|ESW03490.1| hypothetical protein PHAVU_011G017900g [Phaseolus vulgaris]
Length=1249

 Score =   278 bits (712),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 164/403 (41%), Positives = 233/403 (58%), Gaps = 28/403 (7%)
 Frame = +3

Query  2085  RPSWSSNEVLPDGLSQSKESKAFGDKTRESSASRSKQNSTASGKIVSCQKCKGNGHLAQV  2264
             + S S NE   D L +S E+    D+T++SS+   +   T + K   C+KCK  GH  + 
Sbjct  436   KTSTSVNETQQDRLPRSHETVNHVDRTKDSSSDHVRSGVTNASKSSFCRKCKDFGHATEC  495

Query  2265  CTADGPE---SSALGSPFKSSREATNGPSDLKAAIEAARLRKPGICRKNRVADQSEDLSA  2435
             C+  G +   + A  +   SS+E  +  + LKAAI+AA LR+P I +K    D++ +   
Sbjct  496   CSISGTQEFVAEASVTATSSSKEEMHKGNRLKAAIQAALLRRPEIHKKKEGPDETNEFPT  555

Query  2436  S--NMKSEIASQDQML-SSTVRRNVNGAEEAQKQE-------------TANNAKQLGII-  2564
             S    K E+ SQ+Q+L SST++ ++   E   KQE             +AN+ KQL    
Sbjct  556   SIIGFKREVTSQNQVLVSSTLKNSIYAEETNVKQEIVESSSFETTKCPSANDPKQLKFFQ  615

Query  2565  AEASARTRNAGHVVFSDVKHSVIDMERQTLVSMPVILK-TAIPEYQYIWQGGFEVQKSGK  2741
              +  ++ R +  V  +  +  V D+    +V   V+ K + IPEY+YIWQG FEV ++GK
Sbjct  616   TDICSQLRKSDFVGLTSGEPVVRDLANNGMVLSSVLSKMSVIPEYEYIWQGVFEVHRNGK  675

Query  2742  AF-NLYDGIQAHLSSCASPKVLDAVNKFPRKVILNEVPRLSSWPMQFKECGVSEDNVALF  2918
                +LY GIQAHLS+CASPKV++ V  F  +V LNEV RLS WP QF + G  EDN+AL+
Sbjct  676   PPPDLYAGIQAHLSACASPKVIETVRNFSPEVSLNEVSRLSIWPSQFHQSGAKEDNIALY  735

Query  2919  FFAKDIGSYEKSYKVLLGDMVKHDLALQGNIGDIELLIFPSNQLPEKFQRWNLMFFLWGV  3098
             FFAKD  SYE+ YK LL  M+++DLAL+G  G +ELLIF SNQLPE  QRWN++FFLWG 
Sbjct  736   FFAKDTESYERHYKGLLDHMIRNDLALRGMFGGVELLIFASNQLPEDSQRWNMLFFLWGT  795

Query  3099  FRGKRANSLQNFPGAEKPLI------QDIPTPATSLPENMFTP  3209
             FRG+R N   +      P +      +D P+   +L E   +P
Sbjct  796   FRGRRINHSNSTKSKCIPSLNVMPNEKDFPSAVMTLSETWCSP  838


 Score =   132 bits (332),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 86/197 (44%), Positives = 107/197 (54%), Gaps = 41/197 (21%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNEHVNSG  1118
             CDICG  GRE LLAICSRC+DGAEHTYCM++ML K+PEGDWLCEECK  +E  N      
Sbjct  277   CDICGDAGREDLLAICSRCSDGAEHTYCMREMLVKLPEGDWLCEECKCVEETAN------  330

Query  1119  RVNEKEKTSPSRRTTIAKSDHPLKMEQKTSDCWGDKAVEERSYLKTSGKRCTDDSEVSSP  1298
                        RR         L +E+K       K  +  S  + SGKR +   E+++ 
Sbjct  331   -----------RR---------LVIEEK-------KLHKVISASQISGKRPSQSMEIATA  363

Query  1299  TKRQRLE--LRSPTAQIPNRVTSLSRESSFKNLERGKVK-----PLNPFSSGSFAAKVPS  1457
              KRQ LE    SP A  P R+ SLSRESS K++++GK+K     P+     G       S
Sbjct  364   AKRQALESSTGSPKASSPKRIVSLSRESSLKSMDKGKMKSGQQVPVRNHHGGDDVDLARS  423

Query  1458  -STGPQPQPPRGIFSKS  1505
              STGP+ Q PR   S S
Sbjct  424   LSTGPRSQNPRNKTSTS  440


 Score = 55.5 bits (132),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 63/151 (42%), Positives = 73/151 (48%), Gaps = 18/151 (12%)
 Frame = +3

Query  4011  EALSKTAILETPGNAEMFFFPVDPHPVGNIGSNNSSMPWKVHPLEE-----DQLHDKAPN  4175
             EA  +  I E  G  E  FFPVD     N    NS M      L       DQ     PN
Sbjct  1105  EACDEKIIHEDLGTMERTFFPVD-----NRNKLNSGMVVNRESLNGAGEYVDQFEVGIPN  1159

Query  4176  LELALGAKTKPLMSGIPSFLSGKVEKKIIEENTSDNAATSANKEDVsaslslslsFPFPE  4355
             LELALG +TKP    +  F  G V+KKI  E T D      + E+V+ASLSLSLSFP   
Sbjct  1160  LELALGGETKPSHKSMLPFFVGAVDKKINPEKTPD---IERDDENVAASLSLSLSFPSSS  1216

Query  4356  KEHG---TSSKPEQEDPRRRQANTSLLLFGR  4439
             KEH    T ++P   D     A +S LLFGR
Sbjct  1217  KEHMKPVTKNEPLPTDG--HNAKSSFLLFGR  1245



>ref|XP_007131490.1| hypothetical protein PHAVU_011G017900g [Phaseolus vulgaris]
 gb|ESW03484.1| hypothetical protein PHAVU_011G017900g [Phaseolus vulgaris]
Length=1263

 Score =   278 bits (712),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 164/403 (41%), Positives = 233/403 (58%), Gaps = 28/403 (7%)
 Frame = +3

Query  2085  RPSWSSNEVLPDGLSQSKESKAFGDKTRESSASRSKQNSTASGKIVSCQKCKGNGHLAQV  2264
             + S S NE   D L +S E+    D+T++SS+   +   T + K   C+KCK  GH  + 
Sbjct  450   KTSTSVNETQQDRLPRSHETVNHVDRTKDSSSDHVRSGVTNASKSSFCRKCKDFGHATEC  509

Query  2265  CTADGPE---SSALGSPFKSSREATNGPSDLKAAIEAARLRKPGICRKNRVADQSEDLSA  2435
             C+  G +   + A  +   SS+E  +  + LKAAI+AA LR+P I +K    D++ +   
Sbjct  510   CSISGTQEFVAEASVTATSSSKEEMHKGNRLKAAIQAALLRRPEIHKKKEGPDETNEFPT  569

Query  2436  S--NMKSEIASQDQML-SSTVRRNVNGAEEAQKQE-------------TANNAKQLGII-  2564
             S    K E+ SQ+Q+L SST++ ++   E   KQE             +AN+ KQL    
Sbjct  570   SIIGFKREVTSQNQVLVSSTLKNSIYAEETNVKQEIVESSSFETTKCPSANDPKQLKFFQ  629

Query  2565  AEASARTRNAGHVVFSDVKHSVIDMERQTLVSMPVILK-TAIPEYQYIWQGGFEVQKSGK  2741
              +  ++ R +  V  +  +  V D+    +V   V+ K + IPEY+YIWQG FEV ++GK
Sbjct  630   TDICSQLRKSDFVGLTSGEPVVRDLANNGMVLSSVLSKMSVIPEYEYIWQGVFEVHRNGK  689

Query  2742  AF-NLYDGIQAHLSSCASPKVLDAVNKFPRKVILNEVPRLSSWPMQFKECGVSEDNVALF  2918
                +LY GIQAHLS+CASPKV++ V  F  +V LNEV RLS WP QF + G  EDN+AL+
Sbjct  690   PPPDLYAGIQAHLSACASPKVIETVRNFSPEVSLNEVSRLSIWPSQFHQSGAKEDNIALY  749

Query  2919  FFAKDIGSYEKSYKVLLGDMVKHDLALQGNIGDIELLIFPSNQLPEKFQRWNLMFFLWGV  3098
             FFAKD  SYE+ YK LL  M+++DLAL+G  G +ELLIF SNQLPE  QRWN++FFLWG 
Sbjct  750   FFAKDTESYERHYKGLLDHMIRNDLALRGMFGGVELLIFASNQLPEDSQRWNMLFFLWGT  809

Query  3099  FRGKRANSLQNFPGAEKPLI------QDIPTPATSLPENMFTP  3209
             FRG+R N   +      P +      +D P+   +L E   +P
Sbjct  810   FRGRRINHSNSTKSKCIPSLNVMPNEKDFPSAVMTLSETWCSP  852


 Score =   132 bits (332),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 86/197 (44%), Positives = 107/197 (54%), Gaps = 41/197 (21%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNEHVNSG  1118
             CDICG  GRE LLAICSRC+DGAEHTYCM++ML K+PEGDWLCEECK  +E  N      
Sbjct  291   CDICGDAGREDLLAICSRCSDGAEHTYCMREMLVKLPEGDWLCEECKCVEETAN------  344

Query  1119  RVNEKEKTSPSRRTTIAKSDHPLKMEQKTSDCWGDKAVEERSYLKTSGKRCTDDSEVSSP  1298
                        RR         L +E+K       K  +  S  + SGKR +   E+++ 
Sbjct  345   -----------RR---------LVIEEK-------KLHKVISASQISGKRPSQSMEIATA  377

Query  1299  TKRQRLE--LRSPTAQIPNRVTSLSRESSFKNLERGKVK-----PLNPFSSGSFAAKVPS  1457
              KRQ LE    SP A  P R+ SLSRESS K++++GK+K     P+     G       S
Sbjct  378   AKRQALESSTGSPKASSPKRIVSLSRESSLKSMDKGKMKSGQQVPVRNHHGGDDVDLARS  437

Query  1458  -STGPQPQPPRGIFSKS  1505
              STGP+ Q PR   S S
Sbjct  438   LSTGPRSQNPRNKTSTS  454


 Score = 55.5 bits (132),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 63/151 (42%), Positives = 73/151 (48%), Gaps = 18/151 (12%)
 Frame = +3

Query  4011  EALSKTAILETPGNAEMFFFPVDPHPVGNIGSNNSSMPWKVHPLEE-----DQLHDKAPN  4175
             EA  +  I E  G  E  FFPVD     N    NS M      L       DQ     PN
Sbjct  1119  EACDEKIIHEDLGTMERTFFPVD-----NRNKLNSGMVVNRESLNGAGEYVDQFEVGIPN  1173

Query  4176  LELALGAKTKPLMSGIPSFLSGKVEKKIIEENTSDNAATSANKEDVsaslslslsFPFPE  4355
             LELALG +TKP    +  F  G V+KKI  E T D      + E+V+ASLSLSLSFP   
Sbjct  1174  LELALGGETKPSHKSMLPFFVGAVDKKINPEKTPD---IERDDENVAASLSLSLSFPSSS  1230

Query  4356  KEHG---TSSKPEQEDPRRRQANTSLLLFGR  4439
             KEH    T ++P   D     A +S LLFGR
Sbjct  1231  KEHMKPVTKNEPLPTDG--HNAKSSFLLFGR  1259



>gb|EPS73829.1| hypothetical protein M569_00926, partial [Genlisea aurea]
Length=298

 Score =   240 bits (613),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 130/275 (47%), Positives = 178/275 (65%), Gaps = 15/275 (5%)
 Frame = +3

Query  2343  DLKAAIEAARLRKPGICRKNRVADQSEDLSASNMKSEIA-SQDQMLSSTVRRN-VNGAEE  2516
             +++AAIEAA L++     KNR  +QS +   S+   ++A  QD+    T R N ++  E+
Sbjct  22    NIRAAIEAASLKR---YLKNRTVNQSVESPISSSACDLAPHQDRRPGFTGRTNTLSDTEQ  78

Query  2517  AQKQETANNAKQLGIIAEASARTRNAGHVVFSDVKHSVIDMERQTLVS-------MPVIL  2675
             A +   + N        ++    R +          SV+D +R + V        MP+ +
Sbjct  79    AGRSVASENLTADHTKLDSKNNRRQSSVAALGGC--SVVDADRSSGVHLNTYPSDMPLFM  136

Query  2676  K-TAIPEYQYIWQGGFEVQKSGKAFNLYDGIQAHLSSCASPKVLDAVNKFPRKVILNEVP  2852
             K   +PE+ YIWQG FEV +SGK+   ++GIQAHLSS +SPKV++AV  F  +++L+E+ 
Sbjct  137   KHVTVPEHDYIWQGSFEVFQSGKSVGSWEGIQAHLSSTSSPKVVEAVKSFKSRIVLHEMS  196

Query  2853  RLSSWPMQFKECGVSEDNVALFFFAKDIGSYEKSYKVLLGDMVKHDLALQGNIGDIELLI  3032
             RLSSWPMQF+E GVSEDN+ALFFFAKD+ SY K YKV L +M+K DLAL+GNI D+ELLI
Sbjct  197   RLSSWPMQFQEHGVSEDNIALFFFAKDLDSYNKIYKVSLDNMMKKDLALKGNINDVELLI  256

Query  3033  FPSNQLPEKFQRWNLMFFLWGVFRGKRANSLQNFP  3137
             +PSNQLPE  QRWN+MFFLWGVFR K+   LQ  P
Sbjct  257   YPSNQLPENSQRWNMMFFLWGVFRAKKETCLQANP  291



>ref|XP_010549857.1| PREDICTED: uncharacterized protein LOC104820905 isoform X2 [Tarenaya 
hassleriana]
Length=1261

 Score =   252 bits (644),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 158/354 (45%), Positives = 214/354 (60%), Gaps = 27/354 (8%)
 Frame = +3

Query  2115  PDGLSQSKESKAFGDKTRESSASRSKQNSTASGKIVSCQKCKGNGHLAQ-VCTADGPESS  2291
             PD   +S+E +  G+K++E   +RS+ +  +  K ++ QK    G  A+ + T+   ES 
Sbjct  482   PDATPRSREFREMGEKSKEVFINRSRASLPSGSKGLASQK---EGQTAEPIDTSCASESD  538

Query  2292  ALGSPFKSSREATNGPSDLKAAIEAARLRKPGICRKNRVADQSEDLSASNMKS--EIASQ  2465
                S  K  RE  N  + L+AA++AA  +KP    KNR +   +    SNM S  +  SQ
Sbjct  539   P--STTKKFREDINKGNRLRAAVDAALRKKPNFG-KNRGSQLPDGSLVSNMDSSCDKTSQ  595

Query  2466  DQMLSSTVRRNVN-----GAE-------EAQKQETANNAKQLGI-IAEASARTRNAG-HV  2603
              Q+   T + +++     G E       +  KQ  A N KQL    A+A    R+A   V
Sbjct  596   SQLPLKTTKNSMSSEGPQGGELNLKIISDPYKQAIATNGKQLPFSAADAMYSPRSADLEV  655

Query  2604  VFSDVKHSVIDMERQTLVSMPVILKT-AIPEYQYIWQGGFEVQKSGKAFNLYDGIQAHLS  2780
              F  VK  + D     LV   V+ KT AIPE++YIWQG  EVQ S     ++ GIQAHLS
Sbjct  656   NFPSVKPVMRDW---PLVPTIVLPKTSAIPEHEYIWQGDLEVQSSRNLLEMHSGIQAHLS  712

Query  2781  SCASPKVLDAVNKFPRKVILNEVPRLSSWPMQFKECGVSEDNVALFFFAKDIGSYEKSYK  2960
             + ASPKV + VNKF  KV LNEVPRLS+WP QF++ G  ED++ALFFFAKDI SYEK+YK
Sbjct  713   TLASPKVREMVNKFLGKVPLNEVPRLSTWPAQFRDTGAKEDHIALFFFAKDIESYEKNYK  772

Query  2961  VLLGDMVKHDLALQGNIGDIELLIFPSNQLPEKFQRWNLMFFLWGVFRGKRANS  3122
              L+ +M+K DLAL+GN+G +ELLIF SNQLP   QRWN++FFLWGVFRG++ +S
Sbjct  773   PLVVNMIKKDLALKGNLGSVELLIFASNQLPRHCQRWNMLFFLWGVFRGRKESS  826


 Score =   121 bits (304),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 65/157 (41%), Positives = 88/157 (56%), Gaps = 35/157 (22%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNEHVNSG  1118
             CDICG  GRE LLAICSRC+DGAEHTYCM++M++++PEGDWLCEECKF +E + + + + 
Sbjct  297   CDICGDAGREDLLAICSRCSDGAEHTYCMREMIDEVPEGDWLCEECKFAEEAEQQKLEAK  356

Query  1119  RVNEKEKTSPSRRTTIAKSDHPLKMEQKTSDCWGDKAVEERSYLKTSGKRCTDDSEVSSP  1298
             +  E   T P+                                 +TS KRC + +E +  
Sbjct  357   KNRE---TGPNLNA------------------------------QTSDKRCAEKAEAALD  383

Query  1299  TKRQRLE--LRSPTAQIPNRVTSLSRESSFKNLERGK  1403
              KRQ +E    SP   I  R+ +LSRE SFK L++ K
Sbjct  384   VKRQAVEGPTGSPKKSILPRIAALSREPSFKALDKPK  420



>ref|XP_009395441.1| PREDICTED: uncharacterized protein LOC103980699 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=1294

 Score =   237 bits (605),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 211/604 (35%), Positives = 292/604 (48%), Gaps = 86/604 (14%)
 Frame = +3

Query  1485  RGIFSKSNSFSSLIAKPKVKLVDEVFPAKQKLSRETAFIESKEVA-VRSMGKSMSFKPTT  1661
             +G  SKS SF+     PKVK + E  P KQK++RE +    ++    +++ KS SF+  +
Sbjct  315   KGSLSKSVSFNKSKV-PKVKQLLENIPHKQKMTREYSLSSMRKGGPSQAITKSASFRSES  373

Query  1662  ASRSNC-TESKVKMFSPKFSHD-QDVKWLRHKK--DRSSFDRKNSLRSDRLAGGAISSPK  1829
             +  SN  T   V + +P    D +DVK ++ K   D+  F       S  +A  ++SS K
Sbjct  374   SGFSNVSTVGDVLLPNPPPCEDLRDVKQVKEKSMTDKRLFMSDRPFTSLSVAATSVSSVK  433

Query  1830  SDNK-------PTPRGEPSSLSSLNTNRDYRALTSDNKPVTISNSTSGVAREVLKQASVD  1988
                K       P    +PS LS+   NR  +  T               A+E LKQ  + 
Sbjct  434   IAPKVLQYEATPEVMLDPSKLSN---NRGSKEATK-------------FAKE-LKQLPIS  476

Query  1989  GVSSANRVSSSEENPSQAIPKEDSSSSSCVAERPSWSSNEVLPDGLSQSKESKAFGDKTR  2168
              +S  +  +SS     ++   ED        ++P           L    E     DKT+
Sbjct  477   PISQTSGSTSS----VRSCKNED--------QKP-----------LHHGAELIHKDDKTK  513

Query  2169  ESS-ASRSKQNSTASGKIVSCQKCKGNGHLAQVCTADGPESSALGSPFK-SSREATNGPS  2342
             + +  S  +Q ++   ++  CQ+C  +GH  Q C  D    SA+    K +S++      
Sbjct  514   DHTFLSNIRQAASVDNRLARCQRCNESGHSTQFCAVDKLHMSAMKPSLKRNSKDVDYRSG  573

Query  2343  DLKAAIEAARLRKPGICRKNRVADQSEDLSAS--NMKSEIASQDQMLSSTVRRNVNGAEE  2516
               K A++   L   G  R  R  DQS ++S S  ++ SE  S+D   S    RN+   E 
Sbjct  574   KWKDAVDVFTLES-GTKRTARSPDQSMEVSMSSGDVHSEATSKDFPSSLISSRNLAFMEH  632

Query  2517  AQ-KQETANNAKQLGIIAEASART------RNAGHVVFSDVKHSVIDMER--QTL---VS  2660
             A   Q+ +N A  + +  +   R       R    + F+D     ++M+   QTL   VS
Sbjct  633   ASVAQDFSNTANAIHVKQKVEDRKKYTFLPRKVTPLDFADD----LNMQPVIQTLPDQVS  688

Query  2661  MPVILKTA--IPEYQYIWQGGFEVQKSGKAFNLYDGIQAHLSSCASPKVLDAVNKFPRKV  2834
             MP+ L  A  IPE   IW+G FEV K  K     DGIQAHLSS  SPK L+ V KFP KV
Sbjct  689   MPLHLLRASVIPELDCIWEGVFEVLKIAKPPAFLDGIQAHLSSYVSPKALELVKKFPCKV  748

Query  2835  ILNEVPRLSSWPMQFKECGVSEDNVALFFFAKDIGSYEKSYKVLLGDMVKHDLALQGNIG  3014
              L EVPRLS+WP Q  E    EDN+ALFFFAKD  SYEKSY  LL DM+K+DLAL GNI 
Sbjct  749   QLEEVPRLSAWPFQSHENSPKEDNIALFFFAKDTESYEKSYLNLLEDMLKNDLALIGNID  808

Query  3015  DIELLIFPSNQLPEKFQRWNLMFFLWGVFRGKRANSLQNFPGAEK----------PLIQD  3164
              +ELLI PSN LP   Q WN +F+LWGVFRG+  +   + P  EK          P +QD
Sbjct  809   AVELLILPSNLLPANSQCWNKLFYLWGVFRGRNISCFTDLPDLEKKPSVSSLNLEPTVQD  868

Query  3165  IPTP  3176
                P
Sbjct  869   QSIP  872


 Score = 89.4 bits (220),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 35/57 (61%), Positives = 44/57 (77%), Gaps = 1/57 (2%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNEHV  1109
             CDICG  G E LLA CSRC+DGAEHTYCMQ  L+ +PE +W+CEEC+  +E +NE +
Sbjct  118   CDICGDSGLEELLAFCSRCSDGAEHTYCMQVRLDTVPESEWICEECRL-KEAQNEMI  173



>ref|XP_009395440.1| PREDICTED: uncharacterized protein LOC103980699 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=1542

 Score =   237 bits (605),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 211/604 (35%), Positives = 292/604 (48%), Gaps = 86/604 (14%)
 Frame = +3

Query  1485  RGIFSKSNSFSSLIAKPKVKLVDEVFPAKQKLSRETAFIESKEVA-VRSMGKSMSFKPTT  1661
             +G  SKS SF+     PKVK + E  P KQK++RE +    ++    +++ KS SF+  +
Sbjct  563   KGSLSKSVSFNKSKV-PKVKQLLENIPHKQKMTREYSLSSMRKGGPSQAITKSASFRSES  621

Query  1662  ASRSNC-TESKVKMFSPKFSHD-QDVKWLRHKK--DRSSFDRKNSLRSDRLAGGAISSPK  1829
             +  SN  T   V + +P    D +DVK ++ K   D+  F       S  +A  ++SS K
Sbjct  622   SGFSNVSTVGDVLLPNPPPCEDLRDVKQVKEKSMTDKRLFMSDRPFTSLSVAATSVSSVK  681

Query  1830  SDNK-------PTPRGEPSSLSSLNTNRDYRALTSDNKPVTISNSTSGVAREVLKQASVD  1988
                K       P    +PS LS+   NR  +  T               A+E LKQ  + 
Sbjct  682   IAPKVLQYEATPEVMLDPSKLSN---NRGSKEATK-------------FAKE-LKQLPIS  724

Query  1989  GVSSANRVSSSEENPSQAIPKEDSSSSSCVAERPSWSSNEVLPDGLSQSKESKAFGDKTR  2168
              +S  +  +SS     ++   ED        ++P           L    E     DKT+
Sbjct  725   PISQTSGSTSS----VRSCKNED--------QKP-----------LHHGAELIHKDDKTK  761

Query  2169  ESS-ASRSKQNSTASGKIVSCQKCKGNGHLAQVCTADGPESSALGSPFK-SSREATNGPS  2342
             + +  S  +Q ++   ++  CQ+C  +GH  Q C  D    SA+    K +S++      
Sbjct  762   DHTFLSNIRQAASVDNRLARCQRCNESGHSTQFCAVDKLHMSAMKPSLKRNSKDVDYRSG  821

Query  2343  DLKAAIEAARLRKPGICRKNRVADQSEDLSAS--NMKSEIASQDQMLSSTVRRNVNGAEE  2516
               K A++   L   G  R  R  DQS ++S S  ++ SE  S+D   S    RN+   E 
Sbjct  822   KWKDAVDVFTLES-GTKRTARSPDQSMEVSMSSGDVHSEATSKDFPSSLISSRNLAFMEH  880

Query  2517  AQ-KQETANNAKQLGIIAEASART------RNAGHVVFSDVKHSVIDMER--QTL---VS  2660
             A   Q+ +N A  + +  +   R       R    + F+D     ++M+   QTL   VS
Sbjct  881   ASVAQDFSNTANAIHVKQKVEDRKKYTFLPRKVTPLDFADD----LNMQPVIQTLPDQVS  936

Query  2661  MPVILKTA--IPEYQYIWQGGFEVQKSGKAFNLYDGIQAHLSSCASPKVLDAVNKFPRKV  2834
             MP+ L  A  IPE   IW+G FEV K  K     DGIQAHLSS  SPK L+ V KFP KV
Sbjct  937   MPLHLLRASVIPELDCIWEGVFEVLKIAKPPAFLDGIQAHLSSYVSPKALELVKKFPCKV  996

Query  2835  ILNEVPRLSSWPMQFKECGVSEDNVALFFFAKDIGSYEKSYKVLLGDMVKHDLALQGNIG  3014
              L EVPRLS+WP Q  E    EDN+ALFFFAKD  SYEKSY  LL DM+K+DLAL GNI 
Sbjct  997   QLEEVPRLSAWPFQSHENSPKEDNIALFFFAKDTESYEKSYLNLLEDMLKNDLALIGNID  1056

Query  3015  DIELLIFPSNQLPEKFQRWNLMFFLWGVFRGKRANSLQNFPGAEK----------PLIQD  3164
              +ELLI PSN LP   Q WN +F+LWGVFRG+  +   + P  EK          P +QD
Sbjct  1057  AVELLILPSNLLPANSQCWNKLFYLWGVFRGRNISCFTDLPDLEKKPSVSSLNLEPTVQD  1116

Query  3165  IPTP  3176
                P
Sbjct  1117  QSIP  1120


 Score = 89.4 bits (220),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 35/57 (61%), Positives = 44/57 (77%), Gaps = 1/57 (2%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNEHV  1109
             CDICG  G E LLA CSRC+DGAEHTYCMQ  L+ +PE +W+CEEC+  +E +NE +
Sbjct  366   CDICGDSGLEELLAFCSRCSDGAEHTYCMQVRLDTVPESEWICEECRL-KEAQNEMI  421



>emb|CDY53750.1| BnaAnng12780D [Brassica napus]
Length=1150

 Score =   209 bits (533),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 116/233 (50%), Positives = 152/233 (65%), Gaps = 16/233 (7%)
 Frame = +3

Query  2514  EAQKQETANNAKQLGII-AEASARTRNAGHVV-FSDVKHSVIDMERQTLVSMPVILKT--  2681
             +  KQ  A N KQ  +  A+A A +++    V F  VK  + D+        P +L T  
Sbjct  674   QTDKQTIAVNRKQFPLASADAMAASQSVEPTVHFHSVKPVMSDLPGVD----PSVLSTTS  729

Query  2682  AIPEYQYIWQGGFEVQKSGKAFNLYDGIQAHLSSCASPKVLDAVNKFPRKVILNEVPRLS  2861
             AIPE +YIWQG  EV+KS     ++ G+QA+LS+ ASPKV + VN+FP KV LNEVPRLS
Sbjct  730   AIPEPEYIWQGEMEVRKSRNLSAMHCGMQAYLSTLASPKVAEVVNQFPVKVTLNEVPRLS  789

Query  2862  SWPMQFKECGVSEDNVALFFFAKDIGSYEKSYKVLLGDMVKHDLALQGNIGDIELLIFPS  3041
             +WP QF++ G  E +VALFFFAKDI SYE+SYK L+ +M++ DLAL+G++  +ELLIF S
Sbjct  790   TWPSQFQDIGAKEGHVALFFFAKDIVSYERSYKPLVDNMIQKDLALKGSLEGVELLIFAS  849

Query  3042  NQLPEKFQRWNLMFFLWGVFRGKRANSLQNFPGAEKPLIQDIPTPATSLPENM  3200
             NQLP   QRWN+ FFLWGVFRGK  N   + P   KPL      PA+++  NM
Sbjct  850   NQLPRNCQRWNMFFFLWGVFRGK--NKKCSDPLKNKPL------PASNVLPNM  894


 Score =   122 bits (307),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 95/261 (36%), Positives = 129/261 (49%), Gaps = 53/261 (20%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNEHVNSG  1118
             CD CG  GRE LLAICSRC+DGAEHTYCM+ ML+K+P GDWLCEECKF ++ + +     
Sbjct  152   CDTCGDAGREDLLAICSRCSDGAEHTYCMRVMLKKVPAGDWLCEECKFAEQAEKQ-----  206

Query  1119  RVNEKEKTSPSRRTTIAKSDHPLKMEQKTSDCWGDKAVEERSYLKTSGKRCTDDSEVSSP  1298
                              K D   K +Q++         E     ++S KR  D  E +  
Sbjct  207   -----------------KRDKESKRKQES---------EANLNTQSSSKRPIDRPEAAPD  240

Query  1299  TKRQRLE--LRSPTAQIPNRVTSLSRESSFKNLERGKVKPLNPFSSGSFA---AKVPSST  1463
              KRQ  E    SP   +  R+ + SRE+SFK LE+   K  +  S  S +    +   ST
Sbjct  241   AKRQAFEAPTGSPKKPVLPRLPTFSRETSFKRLEKTTRKLAHHSSFNSHSSDDTESTRST  300

Query  1464  GPQPQPPR---GIFSKSNSFSSLIAKPKVKLVDEVFPAKQKLSRETAFIESKEVAVRSMG  1634
               Q Q P+   G   KS SF+S  ++PKV+ VD+V P              KE   R +G
Sbjct  301   DSQVQSPKACAGSLFKSKSFNSSSSRPKVRPVDDVMP--------------KEGLSRKLG  346

Query  1635  KSMSFKPTTASRSNCTESKVK  1697
             +SMS +      S C +S+V+
Sbjct  347   RSMSTRCIDVGSSGCNDSRVQ  367



>ref|XP_009118644.1| PREDICTED: uncharacterized protein LOC103843647 [Brassica rapa]
Length=1204

 Score =   210 bits (534),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 116/233 (50%), Positives = 152/233 (65%), Gaps = 16/233 (7%)
 Frame = +3

Query  2514  EAQKQETANNAKQLGII-AEASARTRNAGHVV-FSDVKHSVIDMERQTLVSMPVILKT--  2681
             +  KQ  A N KQ  +  A+A A +++    V F  VK  + D+        P +L T  
Sbjct  713   QTDKQTIAVNRKQFPLASADAMAASQSVEPTVHFHSVKPVMSDLPGVD----PSVLSTTS  768

Query  2682  AIPEYQYIWQGGFEVQKSGKAFNLYDGIQAHLSSCASPKVLDAVNKFPRKVILNEVPRLS  2861
             AIPE +YIWQG  EV+KS     ++ G+QA+LS+ ASPKV + VN+FP KV LNEVPRLS
Sbjct  769   AIPEPEYIWQGEMEVRKSRNLSAMHCGMQAYLSTLASPKVAEVVNQFPVKVTLNEVPRLS  828

Query  2862  SWPMQFKECGVSEDNVALFFFAKDIGSYEKSYKVLLGDMVKHDLALQGNIGDIELLIFPS  3041
             +WP QF++ G  E +VALFFFAKDI SYE+SYK L+ +M++ DLAL+G++  +ELLIF S
Sbjct  829   TWPSQFQDIGAKEGHVALFFFAKDIVSYERSYKPLVDNMIQKDLALKGSLEGVELLIFAS  888

Query  3042  NQLPEKFQRWNLMFFLWGVFRGKRANSLQNFPGAEKPLIQDIPTPATSLPENM  3200
             NQLP   QRWN+ FFLWGVFRGK  N   + P   KPL      PA+++  NM
Sbjct  889   NQLPRNCQRWNMFFFLWGVFRGK--NKKCSDPLKNKPL------PASNVLPNM  933


 Score =   123 bits (308),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 95/261 (36%), Positives = 129/261 (49%), Gaps = 53/261 (20%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNEHVNSG  1118
             CD CG  GRE LLAICSRC+DGAEHTYCM+ ML+K+P GDWLCEECKF ++ + +     
Sbjct  151   CDTCGDAGREDLLAICSRCSDGAEHTYCMRVMLKKVPAGDWLCEECKFAEQAEKQ-----  205

Query  1119  RVNEKEKTSPSRRTTIAKSDHPLKMEQKTSDCWGDKAVEERSYLKTSGKRCTDDSEVSSP  1298
                              K D   K +Q++         E     ++S KR  D  E +  
Sbjct  206   -----------------KRDKESKRKQES---------EANLNTQSSSKRPIDRPEAAPD  239

Query  1299  TKRQRLE--LRSPTAQIPNRVTSLSRESSFKNLERGKVKPLNPFSSGSFA---AKVPSST  1463
              KRQ  E    SP   +  R+ + SRE+SFK LE+   K  +  S  S +    +   ST
Sbjct  240   AKRQAFEAPTGSPKKPVLPRLPTFSRETSFKRLEKTTRKLAHHSSFNSHSSDDTESTRST  299

Query  1464  GPQPQPPR---GIFSKSNSFSSLIAKPKVKLVDEVFPAKQKLSRETAFIESKEVAVRSMG  1634
               Q Q P+   G   KS SF+S  ++PKV+ VD+V P              KE   R +G
Sbjct  300   DSQVQSPKACAGSLFKSKSFNSSSSRPKVRPVDDVMP--------------KEGLSRKLG  345

Query  1635  KSMSFKPTTASRSNCTESKVK  1697
             +SMS +      S C +S+V+
Sbjct  346   RSMSTRCIDVGSSGCNDSRVQ  366



>ref|XP_006663990.1| PREDICTED: uncharacterized protein LOC102710931 isoform X1 [Oryza 
brachyantha]
Length=1347

 Score =   209 bits (531),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 122/332 (37%), Positives = 175/332 (53%), Gaps = 24/332 (7%)
 Frame = +3

Query  2199  STASGKIVSCQKCKGNGHLAQVCTADGPESSAL-----------GSPFKSSREATNGPSD  2345
             + +S   + CQ+C   GH  Q C+ D    SA+            +    + EATN  S 
Sbjct  638   AISSNLTMRCQRCNEAGHYTQFCSVDKISLSAVKPVGERNMKDSSAKRNKTSEATNMISA  697

Query  2346  LKAAI----EAARLRKPGICRKNRVADQSEDLSASNMKSEIASQDQMLSSTVRRNVNGAE  2513
              KAA     ++  + K G C  N      + LS S     +    Q+   T  +++    
Sbjct  698   DKAAFRSVDQSENILKWGPCH-NPTYRPKDPLSTS--FGHVKKPSQLYGRTGEQDIRNTS  754

Query  2514  EAQKQETANNAKQLGIIAEASARTRNAGHVVFSD--VKHSVIDMERQTLVSMPVILKTAI  2687
              ++     +  K      E    +  AG  V+    +  S++D   Q L+       + +
Sbjct  755   NSRGSTDCSKLKP----NECQPVSVMAGRFVYDSFTMPDSLVDKSNQVLIPGYGSKVSTV  810

Query  2688  PEYQYIWQGGFEVQKSGKAFNLYDGIQAHLSSCASPKVLDAVNKFPRKVILNEVPRLSSW  2867
             PE  +IWQGGFE++++G++  L DG QAHLS  ASPKVL+   KFP KV L E+PRL+SW
Sbjct  811   PELDFIWQGGFELRRTGRSPELCDGFQAHLSCSASPKVLEVAKKFPSKVQLEELPRLNSW  870

Query  2868  PMQFKECGVSEDNVALFFFAKDIGSYEKSYKVLLGDMVKHDLALQGNIGDIELLIFPSNQ  3047
             P QF+E G S +N+ LFFFA+D  SYE  Y  L+ +M+K+DLAL+G I   ELLIFPSN 
Sbjct  871   PRQFQENGPSYENIGLFFFARDTDSYENHYSKLVENMLKNDLALRGTIETAELLIFPSNI  930

Query  3048  LPEKFQRWNLMFFLWGVFRGKRANSLQNFPGA  3143
             L + FQRWN+ +FLWGVFR ++   +   PG 
Sbjct  931   LSKNFQRWNMFYFLWGVFRVRKKGQMNIPPGV  962


 Score =   116 bits (291),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 103/311 (33%), Positives = 150/311 (48%), Gaps = 63/311 (20%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECK----FDQEMKNEH  1106
             CDICG VG E  LA+C+RC DGAEH YCM+ M+E++PEG+WLCEECK    FD+E K   
Sbjct  224   CDICGDVGEEERLAVCTRCNDGAEHIYCMKVMMEEVPEGEWLCEECKNELEFDKEKKKLE  283

Query  1107  VNSGRVNEKEKTSPSRRTTIAKSDHPLKMEQKTSDCWGDKAVE----ERSYLKTSGKRCT  1274
              +  +V   +     R+        P K+   +S+ + D+A E    + S L T+ K  +
Sbjct  284   KSQLKVGASKGQFFERK--------PDKIANASSNSYDDEASESFQGKNSKLDTALKNKS  335

Query  1275  ----------DDSEVSSPTKRQRLELR----------SPTAQIPNRV-----------TS  1361
                       D+ E++S  +   + ++          S    IP R              
Sbjct  336   SENGVKDEDGDNKELNSTNQCNNITMKRKDEGAEIISSIRQSIPERCGLSMGVEPRKRLP  395

Query  1362  LSRESSFK-NLERGKVKPLNPFSSGSFAAKVPSSTGPQPQPPRGIFSKSNSFSSLIAKPK  1538
             LSRESSF+ ++ +GK       +S +F A    + GP   P RG FSKS SF++    PK
Sbjct  396   LSRESSFRLDVVKGKQSTTQVPTSLAFDAA--KNLGP---PLRGQFSKSTSFNNSKV-PK  449

Query  1539  VK-LVDEVFPAKQKLSRETAFIESKEVAVRSMGKSMSF-KPTTASRSNCTESKV------  1694
             VK LV+EV P    L    +++  KE  V  + KS  F KP +    N  +S +      
Sbjct  450   VKQLVNEVPPKPNNLKDHLSYLAKKEGPVGILAKSPFFKKPKSCESGNKAKSSLLPLNEE  509

Query  1695  -KMFSPKFSHD  1724
              K+ +P  SH+
Sbjct  510   SKVMNPPVSHN  520



>ref|XP_006663991.1| PREDICTED: uncharacterized protein LOC102710931 isoform X2 [Oryza 
brachyantha]
Length=1326

 Score =   208 bits (530),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 122/332 (37%), Positives = 175/332 (53%), Gaps = 24/332 (7%)
 Frame = +3

Query  2199  STASGKIVSCQKCKGNGHLAQVCTADGPESSAL-----------GSPFKSSREATNGPSD  2345
             + +S   + CQ+C   GH  Q C+ D    SA+            +    + EATN  S 
Sbjct  617   AISSNLTMRCQRCNEAGHYTQFCSVDKISLSAVKPVGERNMKDSSAKRNKTSEATNMISA  676

Query  2346  LKAAI----EAARLRKPGICRKNRVADQSEDLSASNMKSEIASQDQMLSSTVRRNVNGAE  2513
              KAA     ++  + K G C  N      + LS S     +    Q+   T  +++    
Sbjct  677   DKAAFRSVDQSENILKWGPCH-NPTYRPKDPLSTS--FGHVKKPSQLYGRTGEQDIRNTS  733

Query  2514  EAQKQETANNAKQLGIIAEASARTRNAGHVVFSD--VKHSVIDMERQTLVSMPVILKTAI  2687
              ++     +  K      E    +  AG  V+    +  S++D   Q L+       + +
Sbjct  734   NSRGSTDCSKLKP----NECQPVSVMAGRFVYDSFTMPDSLVDKSNQVLIPGYGSKVSTV  789

Query  2688  PEYQYIWQGGFEVQKSGKAFNLYDGIQAHLSSCASPKVLDAVNKFPRKVILNEVPRLSSW  2867
             PE  +IWQGGFE++++G++  L DG QAHLS  ASPKVL+   KFP KV L E+PRL+SW
Sbjct  790   PELDFIWQGGFELRRTGRSPELCDGFQAHLSCSASPKVLEVAKKFPSKVQLEELPRLNSW  849

Query  2868  PMQFKECGVSEDNVALFFFAKDIGSYEKSYKVLLGDMVKHDLALQGNIGDIELLIFPSNQ  3047
             P QF+E G S +N+ LFFFA+D  SYE  Y  L+ +M+K+DLAL+G I   ELLIFPSN 
Sbjct  850   PRQFQENGPSYENIGLFFFARDTDSYENHYSKLVENMLKNDLALRGTIETAELLIFPSNI  909

Query  3048  LPEKFQRWNLMFFLWGVFRGKRANSLQNFPGA  3143
             L + FQRWN+ +FLWGVFR ++   +   PG 
Sbjct  910   LSKNFQRWNMFYFLWGVFRVRKKGQMNIPPGV  941


 Score =   116 bits (291),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 103/311 (33%), Positives = 150/311 (48%), Gaps = 63/311 (20%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECK----FDQEMKNEH  1106
             CDICG VG E  LA+C+RC DGAEH YCM+ M+E++PEG+WLCEECK    FD+E K   
Sbjct  203   CDICGDVGEEERLAVCTRCNDGAEHIYCMKVMMEEVPEGEWLCEECKNELEFDKEKKKLE  262

Query  1107  VNSGRVNEKEKTSPSRRTTIAKSDHPLKMEQKTSDCWGDKAVE----ERSYLKTSGKRCT  1274
              +  +V   +     R+        P K+   +S+ + D+A E    + S L T+ K  +
Sbjct  263   KSQLKVGASKGQFFERK--------PDKIANASSNSYDDEASESFQGKNSKLDTALKNKS  314

Query  1275  ----------DDSEVSSPTKRQRLELR----------SPTAQIPNRV-----------TS  1361
                       D+ E++S  +   + ++          S    IP R              
Sbjct  315   SENGVKDEDGDNKELNSTNQCNNITMKRKDEGAEIISSIRQSIPERCGLSMGVEPRKRLP  374

Query  1362  LSRESSFK-NLERGKVKPLNPFSSGSFAAKVPSSTGPQPQPPRGIFSKSNSFSSLIAKPK  1538
             LSRESSF+ ++ +GK       +S +F A    + GP   P RG FSKS SF++    PK
Sbjct  375   LSRESSFRLDVVKGKQSTTQVPTSLAFDAA--KNLGP---PLRGQFSKSTSFNNSKV-PK  428

Query  1539  VK-LVDEVFPAKQKLSRETAFIESKEVAVRSMGKSMSF-KPTTASRSNCTESKV------  1694
             VK LV+EV P    L    +++  KE  V  + KS  F KP +    N  +S +      
Sbjct  429   VKQLVNEVPPKPNNLKDHLSYLAKKEGPVGILAKSPFFKKPKSCESGNKAKSSLLPLNEE  488

Query  1695  -KMFSPKFSHD  1724
              K+ +P  SH+
Sbjct  489   SKVMNPPVSHN  499



>ref|XP_006662092.1| PREDICTED: uncharacterized protein LOC102719988 [Oryza brachyantha]
Length=1487

 Score =   208 bits (530),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 122/342 (36%), Positives = 186/342 (54%), Gaps = 32/342 (9%)
 Frame = +3

Query  2511  EEAQKQETANNAKQLGIIAEASARTRNA---GHVVFS-----DVKHSVIDMERQTLVSMP  2666
             EE   Q   N + +  +  +AS         GH+V       D K + +++++++ V + 
Sbjct  926   EEHIIQSVGNGSSKSAVAVQASKDILPGSPQGHLVVHNPNNPDSKLNDLNLKQESFVDLY  985

Query  2667  VILKTA-----IPEYQYIWQGGFEVQKSGKAFNLYDGIQAHLSSCASPKVLDAVNKFPRK  2831
               ++ +     IPE  YIWQG FEV + G +  +YDG QAHLS+CASPKVL+ V + P++
Sbjct  986   SAVEGSFGALVIPEQTYIWQGTFEVSRPGNSPEMYDGFQAHLSACASPKVLEVVKQLPQR  1045

Query  2832  VILNEVPRLSSWPMQFKECGVSEDNVALFFFAKDIGSYEKSYKVLLGDMVKHDLALQGNI  3011
             + L EVPR SSWP+QFKE   +ED++AL+FFAKD+ SYE++Y  LL +M+  DL+L   I
Sbjct  1046  IQLAEVPRRSSWPLQFKEVKPNEDSIALYFFAKDVESYERAYGKLLKNMLAGDLSLAAKI  1105

Query  3012  GDIELLIFPSNQLPEKFQRWNLMFFLWGVFRGKRANSLQNF--PGAEKPLIQDIPTPATS  3185
              DIELLIF S++LPEK QRWN + F WGVF  ++ANS       G ++  ++ I  PA  
Sbjct  1106  SDIELLIFTSDKLPEKAQRWNGLLFFWGVFHARKANSSTELLVKGMDQSPLEQINEPA--  1163

Query  3186  LPENMFTPVPKLNSARGSAATNTEMSAVKESESASLHKIVNGNCSIQSSSQVSRDKCSRI  3365
                N     PK+  + G       +  + +   +   K+ NG  S+   + +S +     
Sbjct  1164  ---NQLVCSPKMPQSLGIDLNECPIDELYDPAVSVEVKMENGGASVDHETLLSPN-----  1215

Query  3366  NAEQNDKLDSSSMQNSEPKLGPDRRYFG----VPLGEAVHSS  3479
                +  +L+S  +   E  +   +  FG    VP G  VH+S
Sbjct  1216  --HETKRLNSCEIHCPETAVT-GKILFGTPTAVPFGVHVHAS  1254


 Score = 96.7 bits (239),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 46/60 (77%), Gaps = 0/60 (0%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNEHVNSG  1118
             CDICG VGRE+LLA C+RC +GAEHTYCM+  LEK+P+G+WLCEEC+  ++      N G
Sbjct  379   CDICGDVGREYLLATCTRCLEGAEHTYCMRVKLEKVPDGEWLCEECQLKEDQSQTKSNDG  438



>ref|XP_007039510.1| Uncharacterized protein isoform 6, partial [Theobroma cacao]
 ref|XP_007039511.1| Uncharacterized protein isoform 6, partial [Theobroma cacao]
 gb|EOY24011.1| Uncharacterized protein isoform 6, partial [Theobroma cacao]
 gb|EOY24012.1| Uncharacterized protein isoform 6, partial [Theobroma cacao]
Length=996

 Score =   204 bits (520),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 88/162 (54%), Positives = 119/162 (73%), Gaps = 1/162 (1%)
 Frame = +3

Query  2655  VSMPVILKTAIPEYQYIWQGGFEVQKSGKAFNLYDGIQAHLSSCASPKVLDAVNKFPRKV  2834
             + MP  + +A+P+  YIWQG FE+Q+SG      DGIQAHLS+C S KV++ V K P+K+
Sbjct  737   LHMPSWI-SAVPQLDYIWQGKFEIQRSGGLPFTCDGIQAHLSTCGSHKVVEVVQKLPQKL  795

Query  2835  ILNEVPRLSSWPMQFKECGVSEDNVALFFFAKDIGSYEKSYKVLLGDMVKHDLALQGNIG  3014
             +L EVPRLS WP QF +   +EDN+AL+FFAKD+ SYE+SY+ LL  M+K++++L+GN G
Sbjct  796   LLEEVPRLSMWPTQFMKSHATEDNIALYFFAKDLNSYERSYENLLDRMIKNEVSLKGNFG  855

Query  3015  DIELLIFPSNQLPEKFQRWNLMFFLWGVFRGKRANSLQNFPG  3140
              ++LLIF SN LPEK +RWN + FLWGVF GK  + L   PG
Sbjct  856   GVDLLIFTSNLLPEKSRRWNNLLFLWGVFGGKGVHCLGKIPG  897


 Score =   110 bits (274),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 91/285 (32%), Positives = 135/285 (47%), Gaps = 23/285 (8%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNEHVNSG  1118
             CDICG +GRE LLAICS+C DGAEH YCM+  ++ +P+ DW+CEEC             G
Sbjct  365   CDICGDIGREELLAICSKCNDGAEHIYCMRVKMDNVPKSDWMCEECML-----------G  413

Query  1119  RVNEKEKTSPSRR-TTIAKSDHPLKMEQKTSDCWGDKAVEERSYLKTSGKRCTDDSEVSS  1295
             +  EK+K         I K  + L+ E K  +    K    R +   S KR     +V  
Sbjct  414   KETEKQKQDKIEEGVGIFKKSNTLEPETKVEESEAYKVSSSRLF---SFKRPAGGLQV--  468

Query  1296  PTKRQRLELRSPTAQIPNRVTSLSRESSFKNLERGKVKPLNPFSSGSFAAKVPSSTGPQP  1475
               +++  E    +    +  +  S   S  N     +K +   +  S  +   SS   Q 
Sbjct  469   -VRKRPFETVLKSPSTSSSSSKTSMHQSGGNSSSTTLKTVCIPTESSIKSPKLSS---QS  524

Query  1476  QPPRGIFSKSNSFSSLIAKPKVKLVDEVFPAKQKLSRETAFIESKEVAVRSMGKSMSFKP  1655
             Q  RG   KS SFS++ +K  V+L+ E     Q  +++TA  +SK   V  M KSMS K 
Sbjct  525   QVLRGSLLKSKSFSAMSSKEDVQLLKEGGSRMQGFAKDTAASDSKR-GVLMMSKSMSLKN  583

Query  1656  TTASRSNCTESKVKMFSPKFSHDQDVKWLRHKKDRSSFDRKNSLR  1790
               +   N + +  ++  P FSH +D+K  RH K + S + +  LR
Sbjct  584   MRSYGVNNSNADSRL-CPNFSHGEDLKRSRHAKGQHSTNTEKKLR  627



>ref|XP_007039506.1| Uncharacterized protein isoform 2, partial [Theobroma cacao]
 gb|EOY24007.1| Uncharacterized protein isoform 2, partial [Theobroma cacao]
Length=1048

 Score =   204 bits (520),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 88/162 (54%), Positives = 119/162 (73%), Gaps = 1/162 (1%)
 Frame = +3

Query  2655  VSMPVILKTAIPEYQYIWQGGFEVQKSGKAFNLYDGIQAHLSSCASPKVLDAVNKFPRKV  2834
             + MP  + +A+P+  YIWQG FE+Q+SG      DGIQAHLS+C S KV++ V K P+K+
Sbjct  737   LHMPSWI-SAVPQLDYIWQGKFEIQRSGGLPFTCDGIQAHLSTCGSHKVVEVVQKLPQKL  795

Query  2835  ILNEVPRLSSWPMQFKECGVSEDNVALFFFAKDIGSYEKSYKVLLGDMVKHDLALQGNIG  3014
             +L EVPRLS WP QF +   +EDN+AL+FFAKD+ SYE+SY+ LL  M+K++++L+GN G
Sbjct  796   LLEEVPRLSMWPTQFMKSHATEDNIALYFFAKDLNSYERSYENLLDRMIKNEVSLKGNFG  855

Query  3015  DIELLIFPSNQLPEKFQRWNLMFFLWGVFRGKRANSLQNFPG  3140
              ++LLIF SN LPEK +RWN + FLWGVF GK  + L   PG
Sbjct  856   GVDLLIFTSNLLPEKSRRWNNLLFLWGVFGGKGVHCLGKIPG  897


 Score =   109 bits (273),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 91/285 (32%), Positives = 135/285 (47%), Gaps = 23/285 (8%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNEHVNSG  1118
             CDICG +GRE LLAICS+C DGAEH YCM+  ++ +P+ DW+CEEC             G
Sbjct  365   CDICGDIGREELLAICSKCNDGAEHIYCMRVKMDNVPKSDWMCEECML-----------G  413

Query  1119  RVNEKEKTSPSRR-TTIAKSDHPLKMEQKTSDCWGDKAVEERSYLKTSGKRCTDDSEVSS  1295
             +  EK+K         I K  + L+ E K  +    K    R +   S KR     +V  
Sbjct  414   KETEKQKQDKIEEGVGIFKKSNTLEPETKVEESEAYKVSSSRLF---SFKRPAGGLQV--  468

Query  1296  PTKRQRLELRSPTAQIPNRVTSLSRESSFKNLERGKVKPLNPFSSGSFAAKVPSSTGPQP  1475
               +++  E    +    +  +  S   S  N     +K +   +  S  +   SS   Q 
Sbjct  469   -VRKRPFETVLKSPSTSSSSSKTSMHQSGGNSSSTTLKTVCIPTESSIKSPKLSS---QS  524

Query  1476  QPPRGIFSKSNSFSSLIAKPKVKLVDEVFPAKQKLSRETAFIESKEVAVRSMGKSMSFKP  1655
             Q  RG   KS SFS++ +K  V+L+ E     Q  +++TA  +SK   V  M KSMS K 
Sbjct  525   QVLRGSLLKSKSFSAMSSKEDVQLLKEGGSRMQGFAKDTAASDSKR-GVLMMSKSMSLKN  583

Query  1656  TTASRSNCTESKVKMFSPKFSHDQDVKWLRHKKDRSSFDRKNSLR  1790
               +   N + +  ++  P FSH +D+K  RH K + S + +  LR
Sbjct  584   MRSYGVNNSNADSRL-CPNFSHGEDLKRSRHAKGQHSTNTEKKLR  627



>ref|XP_007039508.1| Uncharacterized protein isoform 4, partial [Theobroma cacao]
 gb|EOY24009.1| Uncharacterized protein isoform 4, partial [Theobroma cacao]
Length=1044

 Score =   204 bits (520),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 88/162 (54%), Positives = 119/162 (73%), Gaps = 1/162 (1%)
 Frame = +3

Query  2655  VSMPVILKTAIPEYQYIWQGGFEVQKSGKAFNLYDGIQAHLSSCASPKVLDAVNKFPRKV  2834
             + MP  + +A+P+  YIWQG FE+Q+SG      DGIQAHLS+C S KV++ V K P+K+
Sbjct  737   LHMPSWI-SAVPQLDYIWQGKFEIQRSGGLPFTCDGIQAHLSTCGSHKVVEVVQKLPQKL  795

Query  2835  ILNEVPRLSSWPMQFKECGVSEDNVALFFFAKDIGSYEKSYKVLLGDMVKHDLALQGNIG  3014
             +L EVPRLS WP QF +   +EDN+AL+FFAKD+ SYE+SY+ LL  M+K++++L+GN G
Sbjct  796   LLEEVPRLSMWPTQFMKSHATEDNIALYFFAKDLNSYERSYENLLDRMIKNEVSLKGNFG  855

Query  3015  DIELLIFPSNQLPEKFQRWNLMFFLWGVFRGKRANSLQNFPG  3140
              ++LLIF SN LPEK +RWN + FLWGVF GK  + L   PG
Sbjct  856   GVDLLIFTSNLLPEKSRRWNNLLFLWGVFGGKGVHCLGKIPG  897


 Score =   110 bits (274),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 91/285 (32%), Positives = 135/285 (47%), Gaps = 23/285 (8%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNEHVNSG  1118
             CDICG +GRE LLAICS+C DGAEH YCM+  ++ +P+ DW+CEEC             G
Sbjct  365   CDICGDIGREELLAICSKCNDGAEHIYCMRVKMDNVPKSDWMCEECML-----------G  413

Query  1119  RVNEKEKTSPSRR-TTIAKSDHPLKMEQKTSDCWGDKAVEERSYLKTSGKRCTDDSEVSS  1295
             +  EK+K         I K  + L+ E K  +    K    R +   S KR     +V  
Sbjct  414   KETEKQKQDKIEEGVGIFKKSNTLEPETKVEESEAYKVSSSRLF---SFKRPAGGLQV--  468

Query  1296  PTKRQRLELRSPTAQIPNRVTSLSRESSFKNLERGKVKPLNPFSSGSFAAKVPSSTGPQP  1475
               +++  E    +    +  +  S   S  N     +K +   +  S  +   SS   Q 
Sbjct  469   -VRKRPFETVLKSPSTSSSSSKTSMHQSGGNSSSTTLKTVCIPTESSIKSPKLSS---QS  524

Query  1476  QPPRGIFSKSNSFSSLIAKPKVKLVDEVFPAKQKLSRETAFIESKEVAVRSMGKSMSFKP  1655
             Q  RG   KS SFS++ +K  V+L+ E     Q  +++TA  +SK   V  M KSMS K 
Sbjct  525   QVLRGSLLKSKSFSAMSSKEDVQLLKEGGSRMQGFAKDTAASDSKR-GVLMMSKSMSLKN  583

Query  1656  TTASRSNCTESKVKMFSPKFSHDQDVKWLRHKKDRSSFDRKNSLR  1790
               +   N + +  ++  P FSH +D+K  RH K + S + +  LR
Sbjct  584   MRSYGVNNSNADSRL-CPNFSHGEDLKRSRHAKGQHSTNTEKKLR  627



>ref|XP_007039507.1| Uncharacterized protein isoform 3 [Theobroma cacao]
 gb|EOY24008.1| Uncharacterized protein isoform 3 [Theobroma cacao]
Length=1161

 Score =   204 bits (519),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 88/162 (54%), Positives = 119/162 (73%), Gaps = 1/162 (1%)
 Frame = +3

Query  2655  VSMPVILKTAIPEYQYIWQGGFEVQKSGKAFNLYDGIQAHLSSCASPKVLDAVNKFPRKV  2834
             + MP  + +A+P+  YIWQG FE+Q+SG      DGIQAHLS+C S KV++ V K P+K+
Sbjct  737   LHMPSWI-SAVPQLDYIWQGKFEIQRSGGLPFTCDGIQAHLSTCGSHKVVEVVQKLPQKL  795

Query  2835  ILNEVPRLSSWPMQFKECGVSEDNVALFFFAKDIGSYEKSYKVLLGDMVKHDLALQGNIG  3014
             +L EVPRLS WP QF +   +EDN+AL+FFAKD+ SYE+SY+ LL  M+K++++L+GN G
Sbjct  796   LLEEVPRLSMWPTQFMKSHATEDNIALYFFAKDLNSYERSYENLLDRMIKNEVSLKGNFG  855

Query  3015  DIELLIFPSNQLPEKFQRWNLMFFLWGVFRGKRANSLQNFPG  3140
              ++LLIF SN LPEK +RWN + FLWGVF GK  + L   PG
Sbjct  856   GVDLLIFTSNLLPEKSRRWNNLLFLWGVFGGKGVHCLGKIPG  897


 Score =   110 bits (275),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 91/285 (32%), Positives = 135/285 (47%), Gaps = 23/285 (8%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNEHVNSG  1118
             CDICG +GRE LLAICS+C DGAEH YCM+  ++ +P+ DW+CEEC             G
Sbjct  365   CDICGDIGREELLAICSKCNDGAEHIYCMRVKMDNVPKSDWMCEECML-----------G  413

Query  1119  RVNEKEKTSPSRR-TTIAKSDHPLKMEQKTSDCWGDKAVEERSYLKTSGKRCTDDSEVSS  1295
             +  EK+K         I K  + L+ E K  +    K    R +   S KR     +V  
Sbjct  414   KETEKQKQDKIEEGVGIFKKSNTLEPETKVEESEAYKVSSSRLF---SFKRPAGGLQV--  468

Query  1296  PTKRQRLELRSPTAQIPNRVTSLSRESSFKNLERGKVKPLNPFSSGSFAAKVPSSTGPQP  1475
               +++  E    +    +  +  S   S  N     +K +   +  S  +   SS   Q 
Sbjct  469   -VRKRPFETVLKSPSTSSSSSKTSMHQSGGNSSSTTLKTVCIPTESSIKSPKLSS---QS  524

Query  1476  QPPRGIFSKSNSFSSLIAKPKVKLVDEVFPAKQKLSRETAFIESKEVAVRSMGKSMSFKP  1655
             Q  RG   KS SFS++ +K  V+L+ E     Q  +++TA  +SK   V  M KSMS K 
Sbjct  525   QVLRGSLLKSKSFSAMSSKEDVQLLKEGGSRMQGFAKDTAASDSKR-GVLMMSKSMSLKN  583

Query  1656  TTASRSNCTESKVKMFSPKFSHDQDVKWLRHKKDRSSFDRKNSLR  1790
               +   N + +  ++  P FSH +D+K  RH K + S + +  LR
Sbjct  584   MRSYGVNNSNADSRL-CPNFSHGEDLKRSRHAKGQHSTNTEKKLR  627



>ref|XP_007208845.1| hypothetical protein PRUPE_ppa025567mg, partial [Prunus persica]
 gb|EMJ10044.1| hypothetical protein PRUPE_ppa025567mg, partial [Prunus persica]
Length=591

 Score =   198 bits (504),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 84/148 (57%), Positives = 112/148 (76%), Gaps = 0/148 (0%)
 Frame = +3

Query  2673  LKTAIPEYQYIWQGGFEVQKSGKAFNLYDGIQAHLSSCASPKVLDAVNKFPRKVILNEVP  2852
             L  A+P+  YIW+GGFE+ ++G+     DG+QAHLS+ ASPKVL+ V K P+K+++ EVP
Sbjct  381   LAFAVPQLDYIWKGGFEMWRNGRVLGSCDGMQAHLSTVASPKVLEVVPKLPQKMLVEEVP  440

Query  2853  RLSSWPMQFKECGVSEDNVALFFFAKDIGSYEKSYKVLLGDMVKHDLALQGNIGDIELLI  3032
             RLS+WP QF     +EDN+AL+FFA+D+ SY ++YKVL+  MV+ DLAL+ N+  +ELLI
Sbjct  441   RLSTWPTQFVRNHPTEDNIALYFFAEDLESYRRNYKVLVECMVRDDLALRANVDGVELLI  500

Query  3033  FPSNQLPEKFQRWNLMFFLWGVFRGKRA  3116
             FPSN LPE  Q WN M FLWGVFRG+R 
Sbjct  501   FPSNMLPEDLQCWNRMLFLWGVFRGRRV  528



>ref|XP_007039505.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOY24006.1| Uncharacterized protein isoform 1 [Theobroma cacao]
Length=1201

 Score =   203 bits (517),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 88/162 (54%), Positives = 119/162 (73%), Gaps = 1/162 (1%)
 Frame = +3

Query  2655  VSMPVILKTAIPEYQYIWQGGFEVQKSGKAFNLYDGIQAHLSSCASPKVLDAVNKFPRKV  2834
             + MP  + +A+P+  YIWQG FE+Q+SG      DGIQAHLS+C S KV++ V K P+K+
Sbjct  737   LHMPSWI-SAVPQLDYIWQGKFEIQRSGGLPFTCDGIQAHLSTCGSHKVVEVVQKLPQKL  795

Query  2835  ILNEVPRLSSWPMQFKECGVSEDNVALFFFAKDIGSYEKSYKVLLGDMVKHDLALQGNIG  3014
             +L EVPRLS WP QF +   +EDN+AL+FFAKD+ SYE+SY+ LL  M+K++++L+GN G
Sbjct  796   LLEEVPRLSMWPTQFMKSHATEDNIALYFFAKDLNSYERSYENLLDRMIKNEVSLKGNFG  855

Query  3015  DIELLIFPSNQLPEKFQRWNLMFFLWGVFRGKRANSLQNFPG  3140
              ++LLIF SN LPEK +RWN + FLWGVF GK  + L   PG
Sbjct  856   GVDLLIFTSNLLPEKSRRWNNLLFLWGVFGGKGVHCLGKIPG  897


 Score =   110 bits (274),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 91/285 (32%), Positives = 135/285 (47%), Gaps = 23/285 (8%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNEHVNSG  1118
             CDICG +GRE LLAICS+C DGAEH YCM+  ++ +P+ DW+CEEC             G
Sbjct  365   CDICGDIGREELLAICSKCNDGAEHIYCMRVKMDNVPKSDWMCEECML-----------G  413

Query  1119  RVNEKEKTSPSRR-TTIAKSDHPLKMEQKTSDCWGDKAVEERSYLKTSGKRCTDDSEVSS  1295
             +  EK+K         I K  + L+ E K  +    K    R +   S KR     +V  
Sbjct  414   KETEKQKQDKIEEGVGIFKKSNTLEPETKVEESEAYKVSSSRLF---SFKRPAGGLQV--  468

Query  1296  PTKRQRLELRSPTAQIPNRVTSLSRESSFKNLERGKVKPLNPFSSGSFAAKVPSSTGPQP  1475
               +++  E    +    +  +  S   S  N     +K +   +  S  +   SS   Q 
Sbjct  469   -VRKRPFETVLKSPSTSSSSSKTSMHQSGGNSSSTTLKTVCIPTESSIKSPKLSS---QS  524

Query  1476  QPPRGIFSKSNSFSSLIAKPKVKLVDEVFPAKQKLSRETAFIESKEVAVRSMGKSMSFKP  1655
             Q  RG   KS SFS++ +K  V+L+ E     Q  +++TA  +SK   V  M KSMS K 
Sbjct  525   QVLRGSLLKSKSFSAMSSKEDVQLLKEGGSRMQGFAKDTAASDSKR-GVLMMSKSMSLKN  583

Query  1656  TTASRSNCTESKVKMFSPKFSHDQDVKWLRHKKDRSSFDRKNSLR  1790
               +   N + +  ++  P FSH +D+K  RH K + S + +  LR
Sbjct  584   MRSYGVNNSNADSRL-CPNFSHGEDLKRSRHAKGQHSTNTEKKLR  627



>ref|XP_007039509.1| Uncharacterized protein isoform 5 [Theobroma cacao]
 gb|EOY24010.1| Uncharacterized protein isoform 5 [Theobroma cacao]
Length=1197

 Score =   203 bits (517),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 88/162 (54%), Positives = 119/162 (73%), Gaps = 1/162 (1%)
 Frame = +3

Query  2655  VSMPVILKTAIPEYQYIWQGGFEVQKSGKAFNLYDGIQAHLSSCASPKVLDAVNKFPRKV  2834
             + MP  + +A+P+  YIWQG FE+Q+SG      DGIQAHLS+C S KV++ V K P+K+
Sbjct  737   LHMPSWI-SAVPQLDYIWQGKFEIQRSGGLPFTCDGIQAHLSTCGSHKVVEVVQKLPQKL  795

Query  2835  ILNEVPRLSSWPMQFKECGVSEDNVALFFFAKDIGSYEKSYKVLLGDMVKHDLALQGNIG  3014
             +L EVPRLS WP QF +   +EDN+AL+FFAKD+ SYE+SY+ LL  M+K++++L+GN G
Sbjct  796   LLEEVPRLSMWPTQFMKSHATEDNIALYFFAKDLNSYERSYENLLDRMIKNEVSLKGNFG  855

Query  3015  DIELLIFPSNQLPEKFQRWNLMFFLWGVFRGKRANSLQNFPG  3140
              ++LLIF SN LPEK +RWN + FLWGVF GK  + L   PG
Sbjct  856   GVDLLIFTSNLLPEKSRRWNNLLFLWGVFGGKGVHCLGKIPG  897


 Score =   110 bits (275),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 91/285 (32%), Positives = 135/285 (47%), Gaps = 23/285 (8%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNEHVNSG  1118
             CDICG +GRE LLAICS+C DGAEH YCM+  ++ +P+ DW+CEEC             G
Sbjct  365   CDICGDIGREELLAICSKCNDGAEHIYCMRVKMDNVPKSDWMCEECML-----------G  413

Query  1119  RVNEKEKTSPSRR-TTIAKSDHPLKMEQKTSDCWGDKAVEERSYLKTSGKRCTDDSEVSS  1295
             +  EK+K         I K  + L+ E K  +    K    R +   S KR     +V  
Sbjct  414   KETEKQKQDKIEEGVGIFKKSNTLEPETKVEESEAYKVSSSRLF---SFKRPAGGLQV--  468

Query  1296  PTKRQRLELRSPTAQIPNRVTSLSRESSFKNLERGKVKPLNPFSSGSFAAKVPSSTGPQP  1475
               +++  E    +    +  +  S   S  N     +K +   +  S  +   SS   Q 
Sbjct  469   -VRKRPFETVLKSPSTSSSSSKTSMHQSGGNSSSTTLKTVCIPTESSIKSPKLSS---QS  524

Query  1476  QPPRGIFSKSNSFSSLIAKPKVKLVDEVFPAKQKLSRETAFIESKEVAVRSMGKSMSFKP  1655
             Q  RG   KS SFS++ +K  V+L+ E     Q  +++TA  +SK   V  M KSMS K 
Sbjct  525   QVLRGSLLKSKSFSAMSSKEDVQLLKEGGSRMQGFAKDTAASDSKR-GVLMMSKSMSLKN  583

Query  1656  TTASRSNCTESKVKMFSPKFSHDQDVKWLRHKKDRSSFDRKNSLR  1790
               +   N + +  ++  P FSH +D+K  RH K + S + +  LR
Sbjct  584   MRSYGVNNSNADSRL-CPNFSHGEDLKRSRHAKGQHSTNTEKKLR  627



>ref|XP_002464896.1| hypothetical protein SORBIDRAFT_01g028420 [Sorghum bicolor]
 gb|EER91894.1| hypothetical protein SORBIDRAFT_01g028420 [Sorghum bicolor]
Length=1534

 Score =   201 bits (512),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 99/224 (44%), Positives = 135/224 (60%), Gaps = 9/224 (4%)
 Frame = +3

Query  2556  GIIAEASARTRNAGHVVFS-DVKHSVIDMERQTLVSMPVILKT-----AIPEYQYIWQGG  2717
             G I   + R     H ++  D K   +D++++ L      L        IPE  YIWQG 
Sbjct  986   GDILSVTPRGLQMAHNLYPPDNKLDKLDLKKEALADQSSALGNPLKDFVIPEQSYIWQGS  1045

Query  2718  FEVQKSGKAFNLYDGIQAHLSSCASPKVLDAVNKFPRKVILNEVPRLSSWPMQFKECGVS  2897
             FEV   G +  ++DG QA+LS+CAS KV +   + P K+ L EVPR SSWP+QF E   +
Sbjct  1046  FEVSGHGNSPEMFDGFQAYLSTCASSKVREVGEQLPDKIQLAEVPRHSSWPLQFNEVNAT  1105

Query  2898  EDNVALFFFAKDIGSYEKSYKVLLGDMVKHDLALQGNIGDIELLIFPSNQLPEKFQRWNL  3077
             EDN+ALFFFAKD+ SYE++Y  LL +M+  DL+L+ NIG IELLIFPS++LPE+ QRWN 
Sbjct  1106  EDNIALFFFAKDVESYERAYGKLLDNMLLGDLSLKANIGGIELLIFPSDKLPERIQRWNG  1165

Query  3078  MFFLWGVFRGKRANSLQNFPGAEKPLIQDIPTPATSLPENMFTP  3209
             + F WG+F  ++ +S    P    PL Q I  P T    +M +P
Sbjct  1166  LLFFWGIFYARKESSPLELPTNSCPLEQ-INGPVTE--HDMVSP  1206


 Score = 96.7 bits (239),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 46/60 (77%), Gaps = 0/60 (0%)
 Frame = +3

Query  939   CDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWLCEECKFDQEMKNEHVNSG  1118
             CDICG VGRE+LLA C+RC +GAEHTYCM+  LEK+P G+WLCEEC+  ++  N   N G
Sbjct  419   CDICGDVGREYLLATCTRCLEGAEHTYCMRVKLEKVPVGEWLCEECQLKEDQNNTRSNYG  478



>gb|EEC69185.1| hypothetical protein OsI_38169 [Oryza sativa Indica Group]
Length=1305

 Score =   200 bits (509),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 88/164 (54%), Positives = 118/164 (72%), Gaps = 4/164 (2%)
 Frame = +3

Query  2655  VSMPVIL---KTAIPEYQYIWQGGFEVQKSGKAFNLYDGIQAHLSSCASPKVLDAVNKFP  2825
             ++MP  L    + +PE  +IWQGGFE++++G++  L DG QAHLS  ASPKVL+   KFP
Sbjct  769   LTMPDALMDKSSTVPELDFIWQGGFELRRTGRSPELCDGFQAHLSCSASPKVLEVAKKFP  828

Query  2826  RKVILNEVPRLSSWPMQFKECGVSEDNVALFFFAKDIGSYEKSYKVLLGDMVKHDLALQG  3005
              KV L E+PR +SWP QF+E G S +N+ LFFFA+D  SYE  Y  L+ +M+K+DLAL+G
Sbjct  829   SKVQLEELPRQNSWPTQFQENGPSYENIGLFFFARDTDSYENYYSKLVENMLKNDLALRG  888

Query  3006  NIGDIELLIFPSNQLPEKFQRWNLMFFLWGVFRGKRANSLQNFP  3137
             NI   ELLIFPSN L + FQRWN+ +FLWGVFR ++ + + N P
Sbjct  889   NIETAELLIFPSNILSKNFQRWNMFYFLWGVFRVRKKDQM-NIP  931


 Score = 99.0 bits (245),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 119/379 (31%), Positives = 179/379 (47%), Gaps = 54/379 (14%)
 Frame = +3

Query  726   DVLPASKSKKDFALEAKMEVSDSLEDHVVSLADKEGIDKVVNTTG-LDLIA-SQIHQMee  899
             D L    + KD +     E S +LED  V  A  + ++   N+   +D ++ + ++    
Sbjct  156   DGLDIETTGKDVSASEAYEKSSTLEDTSVGHAAAKSVNPEDNSLDPMDNVSDTHVNATSS  215

Query  900   sddseivevdvkvCDICGAVGREHLLAICSRCTDGAEHTYCMQKMLEKIPEGDWL-----  1064
              D S     DVKVCDICG VG E  LA+C+RC DGAEH YCM+ M+E++PEG+WL     
Sbjct  216   EDKSSEEVEDVKVCDICGDVGEEERLAVCTRCNDGAEHIYCMRVMMEEVPEGEWLCEECE  275

Query  1065  -------------------CEECKFDQEMKNEHVNSGRVNEKE-KTSPSRRTTIAKSDHP  1184
                                  + +F +   N+  N+ +    E +TS +    I+K D  
Sbjct  276   NELEYEKKKKLEKSQLKVGASKSQFFERKTNKIANASKSKSYEDETSKALEGKISKPDTA  335

Query  1185  LK----MEQKTSDCWGDKAVEERSYL--KTSGKRCTDDSEVSSPTKR---QRLELRSPTA  1337
             LK     E +  +  GDK     +     ++ KR  + + + S  K+   +R  L S  A
Sbjct  336   LKNRSSFENEVENENGDKKELNSTNQCNNSNSKRKEEGAGIISSIKQSITERCGL-SMGA  394

Query  1338  QIPNRVTSLSRESSFK-NLERGKVKPLNPFSSGSFAAKVPSSTGPQPQPPRGIFSKSNSF  1514
             +   R+  LSRESSF+ ++E+GK       +S +F A    + GP   P RG FSKS SF
Sbjct  395   ESRKRLP-LSRESSFRLDVEKGKQAATKVPTSLAFDAA--KNLGP---PLRGQFSKSTSF  448

Query  1515  SSLIAKPKVK-LVDEVFPAKQKLSRETAFIESKEVAVRSMGKSMSF-KPTTASRSNCTES  1688
             ++    PKVK LV+EV      L     F+  KE  V  + KS  F KP +   +N  +S
Sbjct  449   NNSKV-PKVKQLVNEVPQKPNNLKDHIPFLAKKEGPVGILAKSPFFKKPKSCESANKAKS  507

Query  1689  KV-------KMFSPKFSHD  1724
              +       K+ +P  SH+
Sbjct  508   SILPPTEESKVVNPPVSHN  526



>ref|XP_002437705.1| hypothetical protein SORBIDRAFT_10g001106 [Sorghum bicolor]
 gb|EER89072.1| hypothetical protein SORBIDRAFT_10g001106 [Sorghum bicolor]
Length=518

 Score =   193 bits (490),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 83/150 (55%), Positives = 112/150 (75%), Gaps = 0/150 (0%)
 Frame = +3

Query  2673  LKTAIPEYQYIWQGGFEVQKSGKAFNLYDGIQAHLSSCASPKVLDAVNKFPRKVILNEVP  2852
             + + +PE  +IWQGGFE+Q++G++  L DG QAHLS  AS  VLD V KFP KV L EVP
Sbjct  58    MASTVPELDWIWQGGFELQRTGRSPELCDGFQAHLSCSASQLVLDVVKKFPSKVQLEEVP  117

Query  2853  RLSSWPMQFKECGVSEDNVALFFFAKDIGSYEKSYKVLLGDMVKHDLALQGNIGDIELLI  3032
             R +SWP QF+E G + DN+ LFFFA+D+ SYE  Y  L+ +M+K+DL L+G++G +ELLI
Sbjct  118   RQNSWPTQFQENGPTYDNIGLFFFARDVQSYENHYSKLVENMLKNDLVLRGSVGTVELLI  177

Query  3033  FPSNQLPEKFQRWNLMFFLWGVFRGKRANS  3122