BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c24341_g1_i1 len=2005 path=[1983:0-13 1997:14-37 2021:38-179
2163:180-203 7591:204-213 2197:214-355 2339:356-360 2344:361-443
2427:444-450 2434:451-462 2446:463-487 2471:488-725 2709:726-906
2890:907-946 7810:947-968 2952:969-2004]

Length=2005
                                                                      Score     E

gb|ADR74212.1|  (3S)-linalool/(E)-nerolidol synthase                    534   5e-179   
gb|ADR74211.1|  (3S)-linalool/(E)-nerolidol synthase                    533   2e-178   
gb|AEY82696.1|  (3S)-linalool/(E)-nerolidol synthase                    532   3e-178   
emb|CAN76849.1|  hypothetical protein VITISV_005997                     530   2e-177   Vitis vinifera
ref|XP_002263717.2|  PREDICTED: (3S,6E)-nerolidol synthase 1-like       529   1e-176   Vitis vinifera
ref|NP_001267895.1|  (3S,6E)-nerolidol synthase 1, chloroplastic-...    521   1e-174   
gb|ADR74213.1|  (3S)-linalool/(E)-nerolidol /(E,E)-geranyl linalo...    520   5e-174   
ref|XP_003635168.1|  PREDICTED: (3S,6E)-nerolidol synthase 1-like       519   1e-173   
gb|ADD81295.1|  linalool synthase                                       520   1e-173   Actinidia polygama
ref|NP_001268060.1|  (3S,6E)-nerolidol synthase 1-like                  518   2e-173   
ref|XP_010646907.1|  PREDICTED: (3S,6E)-nerolidol synthase 1, chl...    518   3e-173   
ref|NP_001267990.1|  (3S)-linalool/(E)-nerolidol /(E,E)-geranyl l...    516   1e-172   
ref|XP_003635282.1|  PREDICTED: (3S,6E)-nerolidol synthase 1-like       516   2e-172   
ref|XP_010646906.1|  PREDICTED: (3S,6E)-nerolidol synthase 1, chl...    515   3e-172   
ref|XP_003635413.1|  PREDICTED: (3S,6E)-nerolidol synthase 1-like       515   4e-172   
ref|XP_010646919.1|  PREDICTED: (3S,6E)-nerolidol synthase 1, chl...    507   9e-170   
emb|CAN83267.1|  hypothetical protein VITISV_023827                     506   2e-169   Vitis vinifera
ref|XP_010646706.1|  PREDICTED: (3S,6E)-nerolidol synthase 1-like...    504   5e-168   
emb|CBI41004.3|  unnamed protein product                                503   2e-167   
gb|ADD81294.1|  linalool synthase                                       504   2e-167   Actinidia arguta
emb|CAN66667.1|  hypothetical protein VITISV_032494                     500   3e-167   Vitis vinifera
ref|NP_001267928.1|  (3S,6E)-nerolidol synthase 1, chloroplastic-...    504   4e-167   
ref|XP_003635177.1|  PREDICTED: (3S,6E)-nerolidol synthase 1-like...    502   1e-166   
gb|KDP20831.1|  hypothetical protein JCGZ_21302                         501   1e-166   
emb|CAN64072.1|  hypothetical protein VITISV_038269                     498   2e-166   Vitis vinifera
gb|KDP20833.1|  hypothetical protein JCGZ_21304                         501   2e-166   
gb|AER36088.1|  nerolidol synthase                                      497   9e-165   
gb|AGX26045.1|  bifunctional terpenoid synthase                         492   7e-163   
ref|XP_007213872.1|  hypothetical protein PRUPE_ppa003380mg             492   1e-162   
gb|AEI52903.1|  terpene synthase 3                                      489   7e-162   
ref|XP_004293480.1|  PREDICTED: (3S,6E)-nerolidol synthase 2, chl...    486   4e-161   
ref|XP_008224889.1|  PREDICTED: (3S,6E)-nerolidol synthase 1-like       484   9e-160   
ref|XP_009349841.1|  PREDICTED: (3S,6E)-nerolidol synthase 1-like...    482   6e-159   
ref|NP_001280833.1|  (3S,6E)-nerolidol synthase 1-like                  481   1e-158   
ref|XP_009349840.1|  PREDICTED: (3S,6E)-nerolidol synthase 1-like...    481   1e-158   
sp|P0CV95.1|NES2_FRAAN  RecName: Full=(3S,6E)-nerolidol synthase ...    480   4e-158   
ref|XP_010999558.1|  PREDICTED: (3S,6E)-nerolidol synthase 1-like       481   5e-158   
gb|AIC76501.1|  terpene synthase                                        480   7e-158   
sp|P0CV94.1|NES1_FRAAN  RecName: Full=(3S,6E)-nerolidol synthase ...    477   9e-158   
ref|XP_008245818.1|  PREDICTED: (3S,6E)-nerolidol synthase 1-like       478   2e-157   
ref|XP_009349839.1|  PREDICTED: (3S,6E)-nerolidol synthase 1-like       478   3e-157   
ref|XP_007025895.1|  3S-linalool/(E)-nerolidol /(E,E)-geranyl lin...    478   4e-157   
ref|XP_002518583.1|  1,8-cineole synthase, chloroplast precursor,...    474   1e-155   Ricinus communis
sp|P0CV96.1|NES1_FRAVE  RecName: Full=(3S,6E)-nerolidol synthase ...    471   2e-154   
ref|XP_007025896.1|  3S-linalool/(E)-nerolidol /(E,E)-geranyl lin...    467   9e-153   
ref|XP_004309665.1|  PREDICTED: (3S,6E)-nerolidol synthase 1, chl...    461   1e-150   
ref|XP_008383955.1|  PREDICTED: (3S,6E)-nerolidol synthase 1-like       460   1e-150   
ref|XP_003528417.2|  PREDICTED: (3S,6E)-nerolidol synthase 2, chl...    460   2e-150   
emb|CBI41007.3|  unnamed protein product                                459   4e-150   
ref|XP_008245819.1|  PREDICTED: (3S,6E)-nerolidol synthase 1-like       456   5e-149   
ref|XP_010248179.1|  PREDICTED: (3S,6E)-nerolidol synthase 1-like       457   1e-148   
ref|XP_008224887.1|  PREDICTED: (3S,6E)-nerolidol synthase 1-like...    453   3e-148   
ref|XP_010106430.1|  (3S,6E)-nerolidol synthase 1                       454   3e-148   
ref|XP_010646705.1|  PREDICTED: (3S,6E)-nerolidol synthase 1-like...    453   4e-148   
ref|XP_008224888.1|  PREDICTED: (3S,6E)-nerolidol synthase 1-like...    452   4e-148   
gb|AHY21667.1|  nerolidol synthase                                      452   5e-148   
ref|XP_011003385.1|  PREDICTED: (3S,6E)-nerolidol synthase 1-like       452   8e-148   
emb|CDO99690.1|  unnamed protein product                                454   1e-147   
ref|XP_007211378.1|  hypothetical protein PRUPE_ppa002670mg             455   2e-147   
ref|XP_006352599.1|  PREDICTED: (3S,6E)-nerolidol synthase 1-like       451   4e-147   
gb|AIC76496.1|  linalool/nerolidol synthase                             450   1e-146   
ref|XP_002513346.1|  1,8-cineole synthase, chloroplast precursor,...    449   3e-146   Ricinus communis
ref|XP_006449155.1|  hypothetical protein CICLE_v10014632mg             451   4e-146   
ref|XP_002305633.2|  hypothetical protein POPTR_0004s02970g             447   5e-146   Populus trichocarpa [western balsam poplar]
ref|XP_006493821.1|  PREDICTED: (3S,6E)-nerolidol synthase 1-like...    449   8e-146   
gb|AII32468.1|  terpene synthase                                        446   2e-145   
ref|XP_002305635.2|  hypothetical protein POPTR_0004s02990g             446   2e-145   Populus trichocarpa [western balsam poplar]
ref|XP_006493822.1|  PREDICTED: (3S,6E)-nerolidol synthase 1-like...    444   3e-145   
ref|XP_006493063.1|  PREDICTED: (3S,6E)-nerolidol synthase 1-like       447   4e-145   
ref|XP_009368862.1|  PREDICTED: (3S,6E)-nerolidol synthase 1-like       446   4e-145   
ref|XP_006467945.1|  PREDICTED: (3S,6E)-nerolidol synthase 2, chl...    444   1e-143   
ref|XP_006420934.1|  hypothetical protein CICLE_v10004558mg             442   6e-143   
ref|XP_008371218.1|  PREDICTED: (3S,6E)-nerolidol synthase 1-like       440   1e-142   
emb|CBI33221.3|  unnamed protein product                                438   1e-142   
ref|XP_006449154.1|  hypothetical protein CICLE_v10014707mg             439   8e-142   
ref|XP_010057691.1|  PREDICTED: (3S,6E)-nerolidol synthase 1-like       437   8e-142   
dbj|BAP75559.1|  linalool synthase                                      437   3e-141   
gb|ABR24417.1|  nerolidol/linalool synthase 1                           436   4e-141   Antirrhinum majus [garden snapdragon]
ref|XP_010098578.1|  (3S,6E)-nerolidol synthase 1                       436   7e-141   
ref|XP_006352644.1|  PREDICTED: (3S,6E)-nerolidol synthase 1, chl...    434   1e-140   
ref|XP_010327233.1|  PREDICTED: (3S,6E)-nerolidol synthase 1-like...    435   1e-140   
ref|XP_004248509.2|  PREDICTED: (3S,6E)-nerolidol synthase 1-like       434   2e-140   
gb|KCW74867.1|  hypothetical protein EUGRSUZ_E03605                     430   6e-140   
gb|AFQ20809.1|  S-(+)-linalool synthase                                 434   7e-140   
ref|XP_008383953.1|  PREDICTED: (3S,6E)-nerolidol synthase 1-like...    432   8e-140   
gb|AFK09263.1|  S-(+)-linalool synthase                                 433   9e-140   
gb|AFK09265.1|  S-(+)-linalool synthase                                 432   2e-139   
ref|XP_007159218.1|  hypothetical protein PHAVU_002G219100g             432   2e-139   
gb|AFK09264.1|  S-(+)-linalool synthase                                 432   3e-139   
ref|XP_006352642.1|  PREDICTED: (3S,6E)-nerolidol synthase 2, chl...    431   3e-139   
gb|AFK09266.1|  S-(+)-linalool synthase                                 431   6e-139   
gb|AFK09262.1|  S-(+)-linalool synthase                                 431   6e-139   
ref|XP_009626821.1|  PREDICTED: (3S,6E)-nerolidol synthase 1            430   7e-139   
ref|XP_006467943.1|  PREDICTED: (3S,6E)-nerolidol synthase 1, chl...    430   1e-138   
gb|AFQ20808.1|  S-(+)-linalool synthase                                 430   1e-138   
ref|XP_010059433.1|  PREDICTED: (3S,6E)-nerolidol synthase 1-like       428   2e-138   
gb|AFQ20810.1|  S-(+)-linalool synthase                                 428   7e-138   
gb|AFQ20812.1|  S-(+)-linalool synthase                                 428   1e-137   
gb|ABR24418.1|  nerolidol/linalool synthase 2                           428   1e-137   Antirrhinum majus [garden snapdragon]
gb|AFQ20811.1|  S-(+)-linalool synthase                                 427   2e-137   
ref|XP_010059435.1|  PREDICTED: (3S,6E)-nerolidol synthase 1-like       423   2e-137   
gb|AFK09261.1|  S-(+)-linalool synthase                                 426   4e-137   
gb|KCW74831.1|  hypothetical protein EUGRSUZ_E03566                     422   5e-137   
sp|Q84NC8.1|TPS1_ANTMA  RecName: Full=Tricyclene synthase 0e23, c...    424   3e-136   Antirrhinum majus [garden snapdragon]
ref|XP_009368652.1|  PREDICTED: (3S,6E)-nerolidol synthase 1-like       421   7e-136   
ref|XP_010059419.1|  PREDICTED: (3S,6E)-nerolidol synthase 1-like       422   2e-135   
ref|XP_008364116.1|  PREDICTED: (3S,6E)-nerolidol synthase 1-like       418   1e-134   
ref|XP_011096217.1|  PREDICTED: tricyclene synthase Oc15, chlorop...    419   2e-134   
emb|CAN81698.1|  hypothetical protein VITISV_037651                     416   4e-134   Vitis vinifera
gb|AGB14626.1|  (E)-nerolidol synthase                                  416   8e-134   
ref|XP_010059440.1|  PREDICTED: (3S,6E)-nerolidol synthase 1-like       418   1e-133   
ref|XP_004504948.1|  PREDICTED: (3S,6E)-nerolidol synthase 1-like       416   1e-133   
sp|Q84ND0.1|TPS2_ANTMA  RecName: Full=Tricyclene synthase Oc15, c...    417   2e-133   Antirrhinum majus [garden snapdragon]
ref|XP_004504950.1|  PREDICTED: (3S,6E)-nerolidol synthase 1-like       416   3e-133   
ref|XP_010098579.1|  (3S,6E)-nerolidol synthase 1                       415   3e-133   
sp|Q84NC9.1|TPS3_ANTMA  RecName: Full=Tricyclene synthase 1e20, c...    416   4e-133   Antirrhinum majus [garden snapdragon]
gb|KEH31175.1|  (3S)-linalool/(E)-nerolidol/(E,E)-geranyl linaloo...    414   1e-132   
ref|XP_008441674.1|  PREDICTED: (3S,6E)-nerolidol synthase 1-like       411   9e-132   
emb|CBI33220.3|  unnamed protein product                                409   2e-131   
dbj|BAP75560.1|  linalool synthase                                      410   1e-130   
gb|KCW74839.1|  hypothetical protein EUGRSUZ_E03574                     405   1e-130   
ref|XP_011096166.1|  PREDICTED: tricyclene synthase Oc15, chlorop...    409   2e-130   
gb|AEZ53170.1|  linalool synthase                                       402   6e-130   
emb|CBI23482.3|  unnamed protein product                                406   1e-129   
ref|XP_002263720.2|  PREDICTED: (3S,6E)-nerolidol synthase 1-like       397   2e-128   Vitis vinifera
ref|XP_010686920.1|  PREDICTED: (3S,6E)-nerolidol synthase 1-like       402   2e-128   
ref|XP_004504907.1|  PREDICTED: (3S,6E)-nerolidol synthase 2, chl...    401   1e-127   
ref|XP_007148287.1|  hypothetical protein PHAVU_006G195600g             399   3e-127   
gb|AAV36466.1|  wound-inducible putative chloroplast terpene synt...    399   8e-127   Medicago truncatula
ref|XP_004145158.1|  PREDICTED: (3S,6E)-nerolidol synthase 1-like       398   1e-126   
gb|EYU33926.1|  hypothetical protein MIMGU_mgv1a004820mg                395   3e-126   
gb|KCW74829.1|  hypothetical protein EUGRSUZ_E03562                     398   3e-126   
gb|KHN19069.1|  (3S,6E)-nerolidol synthase 1                            396   4e-126   
gb|KGN64586.1|  hypothetical protein Csa_1G066550                       397   9e-126   
ref|XP_008441685.1|  PREDICTED: (3S,6E)-nerolidol synthase 1-like       396   2e-125   
ref|NP_001276223.1|  uncharacterized protein LOC100789381               394   2e-125   
ref|XP_008441664.1|  PREDICTED: (3S,6E)-nerolidol synthase 1-like       395   7e-125   
ref|XP_004151014.1|  PREDICTED: (3S,6E)-nerolidol synthase 1-like       394   7e-125   
gb|KGN64589.1|  hypothetical protein Csa_1G068570                       394   1e-124   
ref|XP_010665800.1|  PREDICTED: (3S,6E)-nerolidol synthase 1-like       393   1e-124   
gb|AES70355.2|  (3S)-linalool/(E)-nerolidol/(E,E)-geranyl linaloo...    392   1e-124   
gb|KDP42342.1|  hypothetical protein JCGZ_02815                         392   3e-124   
gb|AGS83387.1|  terpene synthase                                        391   1e-123   
ref|XP_010547042.1|  PREDICTED: S-(+)-linalool synthase, chloropl...    391   2e-123   
ref|XP_003528418.1|  PREDICTED: (3S,6E)-nerolidol synthase 1-like       390   4e-123   
gb|KHN07696.1|  (3S,6E)-nerolidol synthase 1                            386   7e-123   
ref|XP_011096134.1|  PREDICTED: tricyclene synthase Oc15, chlorop...    387   9e-123   
gb|KEH34552.1|  (3S)-linalool/(E)-nerolidol/(E,E)-geranyl linaloo...    385   3e-122   
ref|XP_010533841.1|  PREDICTED: S-(+)-linalool synthase, chloropl...    387   7e-122   
ref|XP_004166431.1|  PREDICTED: (3S,6E)-nerolidol synthase 1-like       394   8e-122   
ref|XP_010533843.1|  PREDICTED: S-(+)-linalool synthase, chloropl...    385   8e-122   
ref|XP_004309674.1|  PREDICTED: (3S,6E)-nerolidol synthase 1-like       385   1e-121   
ref|XP_003600104.1|  Linalool synthase                                  384   1e-121   
gb|KDP42343.1|  hypothetical protein JCGZ_02816                         385   2e-121   
ref|XP_011096219.1|  PREDICTED: tricyclene synthase Oc15, chlorop...    383   1e-120   
ref|XP_007159220.1|  hypothetical protein PHAVU_002G219300g             382   3e-120   
ref|XP_010547053.1|  PREDICTED: S-(+)-linalool synthase, chloropl...    382   3e-120   
gb|AES63645.2|  (3S)-linalool/(E)-nerolidol/(E,E)-geranyl linaloo...    380   4e-120   
ref|XP_004486251.1|  PREDICTED: (3S,6E)-nerolidol synthase 1-like       380   7e-120   
ref|XP_008446523.1|  PREDICTED: (3S,6E)-nerolidol synthase 1-like       380   3e-119   
gb|KEH34358.1|  (3S)-linalool/(E)-nerolidol/(E,E)-geranyl linaloo...    378   3e-119   
ref|XP_003593394.1|  Linalool synthase                                  380   1e-118   
ref|XP_004485671.1|  PREDICTED: (3S,6E)-nerolidol synthase 1-like       375   4e-118   
ref|XP_007148288.1|  hypothetical protein PHAVU_006G195700g             376   7e-118   
gb|KEH34554.1|  (3S)-linalool/(E)-nerolidol/(E,E)-geranyl linaloo...    373   2e-117   
ref|XP_011071312.1|  PREDICTED: uncharacterized protein LOC105156792    387   7e-117   
gb|KEH34550.1|  (3S)-linalool/(E)-nerolidol/(E,E)-geranyl linaloo...    369   2e-116   
ref|XP_006301761.1|  hypothetical protein CARUB_v10022222mg             371   7e-116   
ref|XP_006851183.1|  hypothetical protein AMTR_s00043p00183580          369   3e-115   
ref|XP_006377269.1|  hypothetical protein POPTR_0011s03490g             363   1e-114   
ref|XP_003619707.1|  Linalool synthase                                  365   3e-114   
gb|KCW74835.1|  hypothetical protein EUGRSUZ_E03570                     360   5e-114   
ref|XP_010059416.1|  PREDICTED: (3S,6E)-nerolidol synthase 1-like       358   7e-113   
emb|CBI40952.3|  unnamed protein product                                355   4e-112   
ref|NP_176361.2|  terpene synthase 14                                   358   4e-111   Arabidopsis thaliana [mouse-ear cress]
gb|AAO85533.1|  linalool synthase                                       356   2e-110   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006841714.1|  hypothetical protein AMTR_s00003p00254990          355   3e-110   
ref|XP_003573593.1|  PREDICTED: (3S,6E)-nerolidol synthase 1            353   3e-109   
ref|NP_001267920.1|  geraniol synthase                                  354   3e-109   
ref|NP_001185286.1|  terpene synthase 14                                351   3e-108   
ref|XP_010657362.1|  PREDICTED: geraniol synthase isoform X1            348   7e-108   
gb|KDP32232.1|  hypothetical protein JCGZ_13839                         348   3e-107   
ref|XP_002451414.1|  hypothetical protein SORBIDRAFT_04g001760          345   5e-107   Sorghum bicolor [broomcorn]
ref|XP_002451418.1|  hypothetical protein SORBIDRAFT_04g001800          348   5e-107   Sorghum bicolor [broomcorn]
ref|XP_010908315.1|  PREDICTED: probable terpene synthase 11            347   1e-106   
gb|EMT19528.1|  Linalool synthase, chloroplastic                        345   2e-106   
ref|XP_002451416.1|  hypothetical protein SORBIDRAFT_04g001780          345   2e-106   Sorghum bicolor [broomcorn]
ref|XP_006648251.1|  PREDICTED: LOW QUALITY PROTEIN: probable ter...    346   3e-106   
dbj|BAJ85660.1|  predicted protein                                      345   3e-106   
gb|ADR74217.1|  geraniol synthase                                       345   6e-106   
gb|KCW74834.1|  hypothetical protein EUGRSUZ_E03569                     339   7e-106   
ref|XP_011096135.1|  PREDICTED: tricyclene synthase Oc15, chlorop...    342   1e-105   
gb|KCW74836.1|  hypothetical protein EUGRSUZ_E03571                     339   1e-105   
ref|XP_009385198.1|  PREDICTED: probable terpene synthase 11            345   1e-105   
ref|XP_010657363.1|  PREDICTED: R-linalool synthase, chloroplasti...    344   1e-105   
ref|XP_008383954.1|  PREDICTED: (3S,6E)-nerolidol synthase 1-like...    340   2e-105   
ref|XP_002886523.1|  linalool synthase                                  343   4e-105   
gb|KCW74869.1|  hypothetical protein EUGRSUZ_E03610                     337   4e-105   
ref|XP_010042378.1|  PREDICTED: (3S,6E)-nerolidol synthase 1-like       335   9e-105   
gb|EMT19527.1|  Linalool synthase, chloroplastic                        340   1e-104   
ref|XP_008679963.1|  PREDICTED: (3S,6E)-nerolidol synthase 1-like...    339   2e-103   
ref|XP_004954742.1|  PREDICTED: (3S,6E)-nerolidol synthase 1, chl...    338   2e-103   
ref|XP_008679962.1|  PREDICTED: (3S,6E)-nerolidol synthase 1-like...    338   3e-103   
gb|KGN64587.1|  hypothetical protein Csa_1G066560                       333   3e-103   
gb|EAY84259.1|  hypothetical protein OsI_05639                          336   4e-103   Oryza sativa Indica Group [Indian rice]
gb|AGB05613.1|  sesquiterpene synthase 4                                337   4e-103   
ref|NP_001268099.1|  R-linalool synthase, chloroplastic-like            338   4e-103   
gb|AGB05612.1|  sesquiterpene synthase 3                                337   8e-103   
emb|CBI40948.3|  unnamed protein product                                332   1e-102   
ref|XP_010686917.1|  PREDICTED: (3S,6E)-nerolidol synthase 1-like...    336   2e-102   
ref|NP_001045720.1|  Os02g0121700                                       336   3e-102   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006851178.1|  hypothetical protein AMTR_s00043p00177130          332   4e-102   
gb|AHE41084.1|  geraniol synthase                                       334   1e-101   
ref|XP_009386568.1|  PREDICTED: (3S,6E)-nerolidol synthase 1-like       328   2e-101   
gb|ADK62524.1|  geraniol synthase                                       332   5e-101   
ref|XP_010419443.1|  PREDICTED: S-(+)-linalool synthase, chloropl...    329   9e-101   
gb|EMS50987.1|  (3S,6E)-nerolidol synthase 1, chloroplastic             329   4e-100   
emb|CDP20228.1|  unnamed protein product                                327   5e-100   
ref|XP_006858763.1|  hypothetical protein AMTR_s00066p00144770          328   8e-100   
emb|CDP20227.1|  unnamed protein product                                328   2e-99    
ref|XP_010059420.1|  PREDICTED: (3S,6E)-nerolidol synthase 1-like       329   2e-98    
ref|XP_002513266.1|  1,8-cineole synthase, chloroplast precursor,...    325   3e-98    Ricinus communis
ref|XP_003619712.1|  Linalool synthase                                  319   4e-98    
ref|XP_004487383.1|  PREDICTED: geraniol synthase, chloroplastic-...    325   4e-98    
gb|EMT00022.1|  Linalool synthase, chloroplastic                        321   5e-98    
gb|AFD64744.1|  plastid geraniol synthase                               324   6e-98    
ref|NP_001105854.1|  terpene synthase 2                                 324   8e-98    Zea mays [maize]
ref|XP_010686918.1|  PREDICTED: (3S,6E)-nerolidol synthase 1-like...    323   8e-98    
ref|NP_001147300.1|  terpene synthase 2                                 323   2e-97    Zea mays [maize]
ref|XP_011080637.1|  PREDICTED: geraniol synthase, chloroplastic-...    322   6e-97    
ref|XP_004952082.1|  PREDICTED: probable terpene synthase 13-like...    320   9e-97    
gb|KCW74862.1|  hypothetical protein EUGRSUZ_E03598                     313   1e-96    
gb|AFW66581.1|  hypothetical protein ZEAMMB73_828091                    338   1e-96    
ref|XP_004952083.1|  PREDICTED: probable terpene synthase 13-like...    320   2e-96    
ref|XP_010109572.1|  R-linalool synthase                                320   2e-96    
ref|XP_006469778.1|  PREDICTED: probable terpene synthase 11-like       322   2e-96    
gb|EYU46035.1|  hypothetical protein MIMGU_mgv1a019488mg                317   2e-96    
sp|Q5SBP3.1|LLOS_OCIBA  RecName: Full=R-linalool synthase, chloro...    318   1e-95    Ocimum basilicum [basil]
ref|XP_002451415.1|  hypothetical protein SORBIDRAFT_04g001770          311   7e-95    Sorghum bicolor [broomcorn]
gb|KHN25759.1|  R-linalool synthase, chloroplastic                      315   9e-95    
ref|XP_007149937.1|  hypothetical protein PHAVU_005G111700g             315   1e-94    
emb|CCM43930.1|  putative monoterpene synthase                          315   2e-94    
ref|XP_003540326.1|  PREDICTED: probable terpene synthase 11            315   2e-94    
ref|NP_001064918.2|  Os10g0489500                                       311   2e-94    Oryza sativa Japonica Group [Japonica rice]
gb|AAR87368.1|  putative terpene synthase                               312   3e-94    Oryza sativa Japonica Group [Japonica rice]
ref|XP_003597053.1|  Myrcene synthase                                   313   4e-94    
gb|EAY79010.1|  hypothetical protein OsI_34119                          312   1e-93    Oryza sativa Indica Group [Indian rice]
gb|EMT16520.1|  Linalool synthase, chloroplastic                        310   6e-93    
ref|XP_003597054.1|  Myrcene synthase                                   307   1e-91    
gb|KHN25758.1|  R-linalool synthase, chloroplastic                      307   1e-91    
sp|Q6USK1.1|GERS_OCIBA  RecName: Full=Geraniol synthase, chloropl...    306   2e-91    Ocimum basilicum [basil]
gb|AFI47926.1|  geraniol synthase 1                                     306   3e-91    
ref|XP_007149935.1|  hypothetical protein PHAVU_005G111500g             306   5e-91    
gb|AHX97739.1|  geraniol synthase                                       306   6e-91    
gb|AEK70968.1|  isoprene synthase                                       304   6e-91    
gb|AEJ91554.1|  trans-ocimene synthase                                  305   8e-91    
gb|KHN08617.1|  Isoprene synthase, chloroplastic                        303   1e-90    
ref|XP_002266808.1|  PREDICTED: (-)-alpha-terpineol synthase            305   2e-90    Vitis vinifera
ref|XP_007149934.1|  hypothetical protein PHAVU_005G111400g             304   3e-90    
gb|AII32477.1|  terpene synthase                                        304   4e-90    
dbj|BAK07473.1|  predicted protein                                      300   1e-89    
ref|XP_004161807.1|  PREDICTED: LOW QUALITY PROTEIN: (-)-alpha-te...    303   1e-89    
ref|XP_006661888.1|  PREDICTED: (3S,6E)-nerolidol synthase 2, chl...    299   2e-89    
ref|XP_006843914.1|  hypothetical protein AMTR_s00007p00269050          300   2e-89    
gb|AEK70969.1|  isoprene synthase                                       300   2e-89    
ref|XP_006593284.1|  PREDICTED: probable terpene synthase 11-like       301   4e-89    
ref|XP_006370889.1|  hypothetical protein POPTR_0019s014601g            299   5e-89    
ref|XP_006476905.1|  PREDICTED: (-)-germacrene D synthase-like          299   8e-89    
gb|AII32471.1|  terpene synthase                                        299   9e-89    
gb|KHN36571.1|  R-linalool synthase, chloroplastic                      299   2e-88    
ref|XP_006594872.1|  PREDICTED: probable terpene synthase 11-like...    299   2e-88    
gb|KDO69460.1|  hypothetical protein CISIN_1g044370mg                   298   2e-88    
ref|XP_003541931.2|  PREDICTED: probable terpene synthase 11-like...    299   2e-88    
ref|XP_008461028.1|  PREDICTED: terpene synthase 10-like                299   3e-88    
ref|XP_011009233.1|  PREDICTED: terpene synthase 10-like                299   3e-88    
ref|NP_001268028.1|  valencene synthase-like                            298   4e-88    
ref|XP_011015484.1|  PREDICTED: valencene synthase-like                 298   4e-88    
gb|AEJ91556.1|  alpha-thujene synthase/sabinene synthase                298   4e-88    
gb|KHN24142.1|  Isoprene synthase, chloroplastic                        299   4e-88    
gb|ADR66821.1|  germacrene A synthase                                   297   5e-88    
ref|XP_010247894.1|  PREDICTED: terpene synthase 10-like                299   5e-88    
ref|XP_006370878.1|  terpene synthase/cyclase family protein            298   6e-88    
ref|XP_002275273.1|  PREDICTED: probable terpene synthase 9             298   6e-88    
ref|XP_004165181.1|  PREDICTED: myrcene synthase, chloroplastic-like    297   7e-88    
ref|XP_011005621.1|  PREDICTED: (-)-germacrene D synthase-like          296   8e-88    
gb|KDP27310.1|  hypothetical protein JCGZ_20298                         297   1e-87    
ref|XP_010645642.1|  PREDICTED: (-)-alpha-terpineol synthase-like       296   1e-87    
ref|XP_011005622.1|  PREDICTED: valencene synthase-like isoform X1      296   1e-87    
ref|XP_010088018.1|  Myrcene synthase                                   298   1e-87    
gb|AFP23130.1|  monoterpene synthases                                   295   2e-87    
ref|XP_004487361.1|  PREDICTED: geraniol synthase, chloroplastic-...    296   2e-87    
ref|XP_010059418.1|  PREDICTED: (3S,6E)-nerolidol synthase 1-like       290   2e-87    
ref|XP_002321642.1|  hypothetical protein POPTR_0015s09710g             295   2e-87    
ref|XP_006388684.1|  terpene synthase/cyclase family protein            295   3e-87    
ref|NP_001105855.1|  terpene synthase 3                                 296   3e-87    
ref|XP_006374233.1|  hypothetical protein POPTR_0015s05270g             295   3e-87    
gb|AEJ91555.1|  alpha-thujene synthase                                  295   6e-87    
gb|AAX16121.1|  germacrene-D synthase                                   295   7e-87    
emb|CDP15198.1|  unnamed protein product                                295   9e-87    
ref|XP_009418354.1|  PREDICTED: (3S,6E)-nerolidol synthase 1-like       286   1e-86    
emb|CBI31262.3|  unnamed protein product                                294   2e-86    
gb|AIU39887.1|  terpene synthase                                        294   3e-86    
ref|XP_010659051.1|  PREDICTED: (-)-alpha-terpineol synthase-like       292   3e-86    
gb|AAV36464.1|  wound-inducible putative cytosolic terpene syntha...    292   5e-86    
dbj|BAM24405.1|  sesquiterpene synthase                                 291   7e-86    
ref|XP_002275408.3|  PREDICTED: valencene synthase                      291   1e-85    
ref|XP_011100412.1|  PREDICTED: geraniol synthase, chloroplastic-...    291   2e-85    
ref|XP_002515689.1|  (R)-limonene synthase, putative                    291   2e-85    
ref|XP_010646921.1|  PREDICTED: (3S,6E)-nerolidol synthase 1, chl...    282   3e-85    
gb|KFK40674.1|  hypothetical protein AALP_AA2G026500                    286   3e-85    
ref|NP_001268216.1|  (-)-alpha-terpineol synthase                       291   3e-85    
sp|Q93X23.1|MYRS_QUEIL  RecName: Full=Myrcene synthase, chloropla...    291   4e-85    
ref|XP_009350435.1|  PREDICTED: (3S,6E)-nerolidol synthase 1-like       280   5e-85    
sp|Q6PWU2.1|ATESY_VITVI  RecName: Full=(-)-alpha-terpineol synthase     290   5e-85    
ref|XP_004161822.1|  PREDICTED: (-)-alpha-terpineol synthase-like       290   6e-85    
ref|XP_004150681.1|  PREDICTED: myrcene synthase, chloroplastic-like    290   6e-85    
ref|XP_008230161.1|  PREDICTED: probable terpene synthase 9             290   7e-85    
sp|Q6EJ97.1|ISPS_PUEML  RecName: Full=Isoprene synthase, chloropl...    290   9e-85    
ref|XP_011090121.1|  PREDICTED: (+)-epi-alpha-bisabolol synthase-...    288   1e-84    
ref|XP_011090122.1|  PREDICTED: (+)-epi-alpha-bisabolol synthase-...    288   1e-84    
gb|ADR74206.1|  (E)-beta-ocimene/myrcene synthase                       288   2e-84    
ref|XP_007048227.1|  Myrcene synthase, chloroplastic, putative is...    289   2e-84    
ref|XP_002275106.1|  PREDICTED: probable terpene synthase 9             289   2e-84    
ref|XP_011035527.1|  PREDICTED: (-)-germacrene D synthase-like          287   2e-84    
ref|XP_010258444.1|  PREDICTED: (-)-germacrene D synthase-like          287   3e-84    
emb|CAN62729.1|  hypothetical protein VITISV_003091                     288   3e-84    
ref|NP_001268215.1|  valencene synthase                                 287   3e-84    
emb|CBI20483.3|  unnamed protein product                                287   4e-84    
ref|XP_008460926.1|  PREDICTED: terpene synthase 10-like                288   5e-84    
ref|XP_010908676.1|  PREDICTED: alpha-humulene synthase-like            286   5e-84    
gb|AID55337.1|  terpene synthase                                        288   5e-84    
ref|XP_008226805.1|  PREDICTED: (-)-alpha-pinene synthase-like          286   5e-84    
gb|AFE56211.1|  terpene synthase                                        287   6e-84    
ref|XP_002283076.1|  PREDICTED: (-)-germacrene D synthase               286   6e-84    
ref|NP_001268204.1|  uncharacterized protein LOC100257265               286   7e-84    
ref|XP_009395678.1|  PREDICTED: (-)-alpha-terpineol synthase-like       285   9e-84    
ref|XP_010092292.1|  (-)-germacrene D synthase                          286   1e-83    
ref|XP_008230162.1|  PREDICTED: probable terpene synthase 9             286   1e-83    
ref|XP_002273624.2|  PREDICTED: valencene synthase                      285   2e-83    
ref|NP_001268213.1|  (-)-germacrene D synthase                          285   2e-83    
gb|KDO74408.1|  hypothetical protein CISIN_1g008427mg                   285   2e-83    
gb|EMT13131.1|  Linalool synthase, chloroplastic                        286   2e-83    
ref|XP_006475286.1|  PREDICTED: (-)-germacrene D synthase-like is...    285   2e-83    
emb|CBI20475.3|  unnamed protein product                                286   2e-83    
ref|XP_010092286.1|  (-)-germacrene D synthase                          285   2e-83    
dbj|BAJ46125.1|  sesquiterpene synthase                                 285   3e-83    
sp|Q6Q3H2.1|TPSVS_VITVI  RecName: Full=Valencene synthase; Short=...    285   3e-83    
emb|CAN82172.1|  hypothetical protein VITISV_040547                     285   3e-83    
emb|CAK55186.1|  pinene synthase                                        286   3e-83    
ref|XP_009779942.1|  PREDICTED: (-)-alpha-terpineol synthase-like       284   4e-83    
ref|NP_001268024.1|  valencene synthase-like                            285   5e-83    
emb|CAN68620.1|  hypothetical protein VITISV_013313                     284   5e-83    
ref|XP_002274445.2|  PREDICTED: valencene synthase-like                 284   5e-83    
ref|XP_011096132.1|  PREDICTED: trans-alpha-bergamotene synthase-...    283   6e-83    
ref|NP_001268009.1|  myrcene synthase, chloroplastic-like               285   7e-83    
gb|ADR74199.1|  gamma-cadinene synthase                                 285   7e-83    
ref|XP_006371106.1|  hypothetical protein POPTR_0019s03980g             284   7e-83    
ref|XP_002275058.1|  PREDICTED: valencene synthase                      284   7e-83    
ref|XP_008775412.1|  PREDICTED: terpene synthase 10-like                284   9e-83    
sp|Q5SBP4.1|AZIS_OCIBA  RecName: Full=Alpha-zingiberene synthase        283   1e-82    
gb|AIC76495.1|  terpene synthase                                        282   1e-82    
emb|CAN83470.1|  hypothetical protein VITISV_030783                     283   2e-82    
ref|NP_001267972.1|  valencene synthase-like                            283   2e-82    
emb|CBI31305.3|  unnamed protein product                                285   2e-82    
gb|AHD24667.1|  terpene synthase                                        283   2e-82    
gb|AGV54642.1|  nerol synthase                                          280   2e-82    
sp|F6M8H7.1|SMST_SANMU  RecName: Full=Probable sesquiterpene synt...    282   3e-82    
ref|XP_004295289.1|  PREDICTED: (-)-germacrene D synthase-like          282   3e-82    
gb|AII32476.1|  terpene synthase                                        283   3e-82    
ref|XP_002274781.1|  PREDICTED: valencene synthase                      282   3e-82    
ref|XP_002275351.1|  PREDICTED: valencene synthase                      282   3e-82    
ref|XP_010645413.1|  PREDICTED: (-)-alpha-terpineol synthase            281   3e-82    
gb|KDO83772.1|  hypothetical protein CISIN_1g035568mg                   280   4e-82    
ref|XP_006469777.1|  PREDICTED: probable terpene synthase 9-like        282   4e-82    
gb|AEQ27769.1|  sesquiterpene synthase                                  281   4e-82    
ref|XP_006475284.1|  PREDICTED: (-)-germacrene D synthase-like          281   4e-82    
ref|XP_007217528.1|  hypothetical protein PRUPE_ppa023532mg             281   5e-82    
emb|CBI31291.3|  unnamed protein product                                283   5e-82    
ref|XP_006473872.1|  PREDICTED: (-)-germacrene D synthase-like          281   5e-82    
dbj|BAP75561.1|  linalool synthase                                      281   5e-82    
dbj|BAP74389.1|  delta-elemene synthase                                 281   5e-82    
sp|B3TPQ6.1|BCUSY_MAGGA  RecName: Full=Beta-cubebene synthase; Sh...    281   5e-82    
ref|XP_009623875.1|  PREDICTED: (-)-germacrene D synthase-like          281   6e-82    
ref|XP_004289147.1|  PREDICTED: alpha-terpineol synthase, chlorop...    282   6e-82    
ref|XP_007010143.1|  3R-linalool synthase, putative isoform 1           281   6e-82    
emb|CBI31294.3|  unnamed protein product                                282   7e-82    
gb|KDP35323.1|  hypothetical protein JCGZ_09482                         282   7e-82    
gb|ABK95568.1|  unknown                                                 282   7e-82    
ref|XP_008461030.1|  PREDICTED: terpene synthase 10-like                282   8e-82    
ref|XP_011006402.1|  PREDICTED: isoprene synthase, chloroplastic        282   9e-82    
ref|XP_002533355.1|  (R)-limonene synthase, putative                    280   9e-82    
gb|KHG19407.1|  Myrcene synthase, chloroplastic                         280   9e-82    
gb|AEK70965.1|  isoprene synthase                                       281   1e-81    
sp|F6M8H4.1|SAST_SANAL  RecName: Full=Probable sesquiterpene synt...    280   1e-81    
gb|ACD70404.1|  putative chloroplast isoprene synthase                  280   1e-81    
ref|XP_007022410.1|  3R-linalool synthase, putative isoform 1           280   1e-81    
ref|XP_006475285.1|  PREDICTED: (-)-germacrene D synthase-like is...    280   1e-81    
sp|B3TPQ7.1|ATESY_MAGGA  RecName: Full=Alpha-terpineol synthase, ...    281   1e-81    
gb|AIC76493.1|  linalool/nerolidol synthase                             282   2e-81    
gb|AEK70967.1|  isoprene synthase                                       281   2e-81    
ref|XP_002515692.1|  (R)-limonene synthase, putative                    281   2e-81    
gb|AGB05614.1|  sesquiterpene synthase 5                                280   2e-81    
emb|CDP12281.1|  unnamed protein product                                280   2e-81    
sp|Q7XAS7.1|ISPS_POPTM  RecName: Full=Isoprene synthase, chloropl...    281   2e-81    
gb|AEK70964.1|  isoprene synthase                                       281   2e-81    
ref|XP_002325741.2|  hypothetical protein POPTR_0019s01270g             280   2e-81    
gb|AAC31570.2|  sesquiterpene synthase                                  280   2e-81    
ref|XP_008226801.1|  PREDICTED: (-)-alpha-pinene synthase-like          280   3e-81    
gb|ADG96473.1|  chloroplast isoprene synthase 2                         280   3e-81    
gb|KDP32240.1|  hypothetical protein JCGZ_13847                         279   4e-81    
ref|XP_006373002.1|  hypothetical protein POPTR_0017s06920g             280   4e-81    
gb|ADR74194.1|  (E)-beta-caryophyllene synthase                         279   4e-81    
sp|Q50L36.1|ISPS_POPAL  RecName: Full=Isoprene synthase, chloropl...    280   4e-81    
gb|AEP82768.1|  terpene synthase                                        278   4e-81    
ref|XP_002282488.1|  PREDICTED: (-)-germacrene D synthase               279   4e-81    
ref|XP_011011288.1|  PREDICTED: (-)-germacrene D synthase-like          275   4e-81    
ref|XP_004233802.1|  PREDICTED: (-)-alpha-terpineol synthase-like       278   4e-81    
ref|XP_007021115.1|  Delta-cadinene synthase isozyme A, putative        279   4e-81    
ref|XP_009586876.1|  PREDICTED: (-)-camphene/tricyclene synthase,...    280   5e-81    
ref|XP_006494713.1|  PREDICTED: (-)-germacrene D synthase-like is...    279   6e-81    
gb|AEP17005.1|  (E)-beta-caryophyllene synthase                         278   6e-81    
gb|AEK70966.1|  isoprene synthase                                       280   7e-81    
pdb|3N0F|A  Chain A, Crystal Structure Of Isoprene Synthase From ...    278   7e-81    
gb|ABV04402.1|  chloroplast isoprene synthase 1                         279   9e-81    
ref|XP_010645872.1|  PREDICTED: LOW QUALITY PROTEIN: valencene sy...    278   9e-81    
gb|KDO38269.1|  hypothetical protein CISIN_1g008206mg                   277   9e-81    
ref|XP_010109558.1|  Myrcene synthase                                   279   9e-81    
ref|XP_008644296.1|  PREDICTED: terpene synthase 3 isoform X1           277   1e-80    
sp|B5A435.1|STPS1_SANAL  RecName: Full=Sesquiterpene synthase; Sh...    278   1e-80    
ref|XP_009346480.1|  PREDICTED: (-)-alpha-pinene synthase-like          278   1e-80    
emb|CAL69918.1|  isoprene synthase                                      279   1e-80    
ref|NP_001268063.1|  uncharacterized protein LOC100267145               278   1e-80    
sp|F6M8H5.1|SAUST_SANAS  RecName: Full=Probable sesquiterpene syn...    278   1e-80    
ref|XP_002283070.1|  PREDICTED: (-)-germacrene D synthase               278   1e-80    
ref|XP_002277351.2|  PREDICTED: valencene synthase                      278   1e-80    
gb|ADG96474.1|  chloroplast isoprene synthase 3                         278   1e-80    
gb|ADR74200.1|  beta-curcumene synthase                                 278   1e-80    
ref|XP_008245781.1|  PREDICTED: (-)-alpha-pinene synthase-like          278   2e-80    
ref|XP_004287914.1|  PREDICTED: (-)-alpha-terpineol synthase-like       278   2e-80    
emb|CAN78342.1|  hypothetical protein VITISV_000109                     277   2e-80    
gb|KDO38264.1|  hypothetical protein CISIN_1g008206mg                   277   2e-80    
ref|XP_010905141.1|  PREDICTED: alpha-humulene synthase-like isof...    277   2e-80    
gb|AAR99061.1|  (-)-germacrene D synthase                               277   2e-80    
gb|AEI52904.1|  terpene synthase 4                                      276   3e-80    
ref|XP_008226738.1|  PREDICTED: (-)-alpha-pinene synthase-like is...    277   3e-80    
gb|AFI47928.1|  terpene synthase 3                                      278   3e-80    
ref|XP_002522812.1|  (+)-delta-cadinene synthase isozyme A, putative    276   3e-80    
ref|XP_009388168.1|  PREDICTED: terpene synthase 10-like                280   3e-80    
ref|XP_010055485.1|  PREDICTED: (-)-germacrene D synthase-like          277   3e-80    
ref|XP_010051775.1|  PREDICTED: monoterpene synthase-like               277   3e-80    
sp|E3W207.1|SAUSS_SANAS  RecName: Full=Sesquiterpene synthase; Sh...    276   4e-80    
sp|J7LJN5.1|TPS6_PHYDL  RecName: Full=Beta-caryophyllene synthase...    276   4e-80    
gb|KDP35321.1|  hypothetical protein JCGZ_09480                         277   4e-80    
ref|XP_004294324.1|  PREDICTED: (-)-alpha-pinene synthase-like          276   4e-80    
emb|CDP11842.1|  unnamed protein product                                278   4e-80    
ref|XP_009395679.1|  PREDICTED: (-)-alpha-terpineol synthase-like       275   4e-80    
emb|CAN81129.1|  hypothetical protein VITISV_002911                     276   5e-80    
ref|XP_010905142.1|  PREDICTED: alpha-humulene synthase-like isof...    276   6e-80    
ref|XP_009600964.1|  PREDICTED: (-)-alpha-terpineol synthase-like       275   6e-80    
ref|XP_009388290.1|  PREDICTED: terpene synthase 10-like                276   6e-80    
sp|J7LQ09.1|TPS7_PHYDL  RecName: Full=Trans-alpha-bergamotene syn...    275   7e-80    
gb|KCW71959.1|  hypothetical protein EUGRSUZ_E00414                     277   7e-80    
ref|XP_002468073.1|  hypothetical protein SORBIDRAFT_01g039090          277   7e-80    
ref|XP_004505471.1|  PREDICTED: (-)-germacrene D synthase-like          276   7e-80    
ref|XP_011006403.1|  PREDICTED: isoprene synthase, chloroplastic-...    276   8e-80    
emb|CBI20482.3|  unnamed protein product                                280   8e-80    
emb|CBI31313.3|  unnamed protein product                                276   9e-80    
ref|XP_008226737.1|  PREDICTED: (-)-alpha-pinene synthase-like is...    275   1e-79    
ref|XP_010109567.1|  Isoprene synthase                                  276   1e-79    
emb|CAN64328.1|  hypothetical protein VITISV_027228                     275   1e-79    
ref|NP_001268167.1|  (+)-alpha-phellandrene synthase                    276   1e-79    
gb|ADR74202.1|  terpene synthase                                        276   1e-79    
ref|XP_011003243.1|  PREDICTED: probable terpene synthase 12            276   1e-79    
ref|XP_010449725.1|  PREDICTED: (E)-beta-ocimene synthase, chloro...    276   1e-79    
gb|AHB60732.1|  isoprene synthase                                       276   1e-79    
ref|XP_002523635.1|  (+)-delta-cadinene synthase isozyme A, putative    275   1e-79    
emb|CAN64943.1|  hypothetical protein VITISV_001721                     275   2e-79    
ref|XP_010910563.1|  PREDICTED: alpha-humulene synthase-like            273   2e-79    
ref|XP_006475262.1|  PREDICTED: (-)-germacrene D synthase-like          275   2e-79    
ref|XP_010267843.1|  PREDICTED: alpha-terpineol synthase, chlorop...    276   2e-79    
emb|CAN62153.1|  hypothetical protein VITISV_032405                     276   2e-79    
ref|NP_001268188.1|  uncharacterized protein LOC100243167               275   2e-79    
ref|XP_010041348.1|  PREDICTED: (-)-germacrene D synthase-like          276   2e-79    
emb|CAN65805.1|  hypothetical protein VITISV_042691                     275   3e-79    
emb|CCM43927.1|  limonene synthase                                      274   3e-79    
ref|XP_009342276.1|  PREDICTED: probable terpene synthase 9             275   3e-79    
gb|KDP30235.1|  hypothetical protein JCGZ_17017                         275   3e-79    
gb|ADR74201.1|  (+)-alpha-phellandrene synthase                         275   3e-79    
ref|XP_002267453.1|  PREDICTED: (-)-alpha-terpineol synthase            275   3e-79    
ref|XP_010038257.1|  PREDICTED: (-)-germacrene D synthase-like          274   4e-79    
ref|XP_010090242.1|  Myrcene synthase                                   275   4e-79    
ref|XP_009396629.1|  PREDICTED: terpene synthase 10-like                274   4e-79    
ref|XP_009410179.1|  PREDICTED: alpha-humulene synthase-like            273   4e-79    
ref|XP_009355680.1|  PREDICTED: (-)-alpha-pinene synthase-like          275   5e-79    
ref|XP_006475310.1|  PREDICTED: (-)-germacrene D synthase-like          282   5e-79    
ref|XP_006853509.1|  hypothetical protein AMTR_s00032p00219920          272   5e-79    
ref|XP_002309850.2|  hypothetical protein POPTR_0007s02810g             273   5e-79    
emb|CDP12283.1|  unnamed protein product                                273   6e-79    
gb|AFP23421.1|  linalool synthase                                       274   6e-79    
sp|Q9AR86.1|ISPS_POPCN  RecName: Full=Isoprene synthase, chloropl...    274   6e-79    



>gb|ADR74212.1| (3S)-linalool/(E)-nerolidol synthase [Vitis vinifera]
Length=577

 Score =   534 bits (1375),  Expect = 5e-179, Method: Compositional matrix adjust.
 Identities = 247/506 (49%), Positives = 363/506 (72%), Gaps = 7/506 (1%)
 Frame = -2

Query  1719  DEFLLKSEGKREWQRGLLYQFQEDDLQVLNVIDAIQHLGIDHHFHDQIGAILQRQYQKVK  1540
             DEF +K   + +  R +  +  ED L+ L +IDAIQ LGID+HF ++I A+LQRQY K  
Sbjct  67    DEFYIKHAQRLDEIRNVFSEVGEDTLEGLMMIDAIQRLGIDYHFKEEIEAVLQRQYMKAS  126

Query  1539  IDDFQKINGLYDISLSFRLLRQEGYNVSSDVFTKFTSEKGEFKEELSKDIRGLMALHEAS  1360
                 + I  LY+++L FRLLRQEGY+V +DVF  F +++G+FK+ LSKDI+GL+ L+EAS
Sbjct  127   THG-ESIQDLYEVALRFRLLRQEGYHVPADVFNNFKNKEGKFKQNLSKDIKGLLGLYEAS  185

Query  1359  HLSIEGEDVLDEAAKFSRESLIANMVHLDECQASMVQNTLQYPYHKSLARFTAKTFIENM  1180
              LSIEGED+L+EA +FS   L A + HLD  +A++V +TL++P+HKSL RF AK+F+++ 
Sbjct  186   QLSIEGEDILEEAQRFSSTLLNAGLEHLDHHEATVVVHTLEHPHHKSLPRFMAKSFLKDF  245

Query  1179  RVENEWEATLVNLATMDYSITQSFYQEEFRQILRWWKSLGLKDEL--AKNQQLKWYIWTL  1006
             +  N W   L  LA  D+++ QS +Q+E  QI +WW+ LGL +EL  A++Q LKW++W +
Sbjct  246   QGPNGWLTVLQELAKADFNMVQSIHQQELLQISKWWQDLGLAEELKFARDQPLKWHMWPM  305

Query  1005  ALIPDPSMSRERIELTKPIALVYLIDDIIDVYATFDQTKQFIDAINRWDLSVGEGLPDYM  826
             A++PDPS+S +R+ELTKPI+++Y+IDDI DV+ T D+   F +A+NRWD++  E LP+YM
Sbjct  306   AVLPDPSLSEQRVELTKPISMIYIIDDIFDVHGTLDELTLFTEAVNRWDIAAFETLPNYM  365

Query  825   KRCLVVLFDTTNDINNLVFEKYGWNPIDHLKRAWKCLCSAYITEAKWFATGKSPSANEYL  646
             K C   L + TN+I+N V++++GWNP+D L++ W  LC+A++ EAKWFA+G  P A+EYL
Sbjct  366   KICFKTLDEITNEISNKVYKEHGWNPVDSLRKTWMSLCNAFLVEAKWFASGHVPKADEYL  425

Query  645   QTGIITTGIPMVLITCFFLLGHGAFAGTTDIED----MITSVGAILRLLDDLDATQGEKQ  478
             + G+I++G+ +VL+  FFLLGHG   G  D+ D    +I+S  AILRL DDL + + E Q
Sbjct  426   KNGVISSGVHVVLVHLFFLLGHGITRGNVDLVDDFPSIISSTAAILRLWDDLGSAKDENQ  485

Query  477   DGNDASYVEYYVKEHEGLSISDGKQRIMNMVSEQWKLINKQCLSPTRIPESFSKSCLNIA  298
             DG+D SY+E Y+KEH+G S+ + +Q +  M+S+ WK +NK+CLS      SF+K  LNIA
Sbjct  486   DGHDGSYIECYIKEHQGSSMENARQNVTYMISDLWKRLNKECLSQHLFSTSFTKGSLNIA  545

Query  297   RMVPMMYNYSDTHCLPILQKQIMSMF  220
             RMVP+MY+Y D   LP L++ + S+ 
Sbjct  546   RMVPLMYSYDDNQSLPHLEEHMKSLL  571



>gb|ADR74211.1| (3S)-linalool/(E)-nerolidol synthase [Vitis vinifera]
Length=612

 Score =   533 bits (1374),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 247/506 (49%), Positives = 364/506 (72%), Gaps = 7/506 (1%)
 Frame = -2

Query  1719  DEFLLKSEGKREWQRGLLYQFQEDDLQVLNVIDAIQHLGIDHHFHDQIGAILQRQYQKVK  1540
             DEF +K   + +  R +  +  ED L+ L +IDAIQ LGID+HF ++I A+LQRQY K  
Sbjct  102   DEFYIKHAQRLDEIRNVFSEVGEDTLEGLMMIDAIQRLGIDYHFKEEIEAVLQRQYMKAS  161

Query  1539  IDDFQKINGLYDISLSFRLLRQEGYNVSSDVFTKFTSEKGEFKEELSKDIRGLMALHEAS  1360
              +  + I  LY+++L FRLLRQEGY+V +DVF  F +++G+FK+ LSKDI+GL+AL+EAS
Sbjct  162   -NHGESIQDLYEVALRFRLLRQEGYHVPADVFNNFKNKEGKFKQNLSKDIKGLLALYEAS  220

Query  1359  HLSIEGEDVLDEAAKFSRESLIANMVHLDECQASMVQNTLQYPYHKSLARFTAKTFIENM  1180
              LSIEGED+L+EA +FS   L A + HLD  +A++V +TL++P+HKSL RF AK+F+++ 
Sbjct  221   QLSIEGEDILEEAQRFSSTLLNAGLEHLDHHEATVVGHTLEHPHHKSLPRFMAKSFLKDF  280

Query  1179  RVENEWEATLVNLATMDYSITQSFYQEEFRQILRWWKSLGLKDEL--AKNQQLKWYIWTL  1006
             +  N W   L  LA  D+++ QS +Q+E  QI +WW+  GL +EL  A++Q LKW++W +
Sbjct  281   QGPNGWLTVLQELAKADFNMVQSIHQQELLQISKWWQDRGLAEELKFARDQPLKWHMWPM  340

Query  1005  ALIPDPSMSRERIELTKPIALVYLIDDIIDVYATFDQTKQFIDAINRWDLSVGEGLPDYM  826
             A++PDPS+S +R+ELTKPI+++Y+IDDI DV+ T D+   F +A+NRWD++  E LP+YM
Sbjct  341   AVLPDPSLSEQRVELTKPISMIYIIDDIFDVHGTLDELTLFTEAVNRWDIAAFETLPNYM  400

Query  825   KRCLVVLFDTTNDINNLVFEKYGWNPIDHLKRAWKCLCSAYITEAKWFATGKSPSANEYL  646
             K C   L + TN+I+N V++++GWNP+D L++ W  LC+A++ EAKWFA+G  P A+EYL
Sbjct  401   KICFKTLDEITNEISNKVYKEHGWNPVDSLRKTWVSLCNAFLVEAKWFASGHVPKAHEYL  460

Query  645   QTGIITTGIPMVLITCFFLLGHGAFAGTTDIED----MITSVGAILRLLDDLDATQGEKQ  478
             + G+I++G+ +VL+  FFLLGHG   G  D+ D    +I+S  AILRL DDL + + E Q
Sbjct  461   KNGVISSGVHVVLVHLFFLLGHGITRGNVDLVDDFPSIISSTAAILRLWDDLGSAKDENQ  520

Query  477   DGNDASYVEYYVKEHEGLSISDGKQRIMNMVSEQWKLINKQCLSPTRIPESFSKSCLNIA  298
             DG+D SY+E Y+KEH+G S+ + +Q +  M+S+ WK +NK+CLS      SF+K  LNIA
Sbjct  521   DGHDGSYIECYIKEHQGSSMENARQNVTYMISDLWKRLNKECLSQHPFSTSFTKGSLNIA  580

Query  297   RMVPMMYNYSDTHCLPILQKQIMSMF  220
             RMVP+MY+Y D   LP L++ + S+ 
Sbjct  581   RMVPLMYSYDDNQSLPHLEEHMKSLL  606



>gb|AEY82696.1| (3S)-linalool/(E)-nerolidol synthase [Vitis vinifera]
Length=577

 Score =   532 bits (1370),  Expect = 3e-178, Method: Compositional matrix adjust.
 Identities = 246/506 (49%), Positives = 363/506 (72%), Gaps = 7/506 (1%)
 Frame = -2

Query  1719  DEFLLKSEGKREWQRGLLYQFQEDDLQVLNVIDAIQHLGIDHHFHDQIGAILQRQYQKVK  1540
             DEF +K   + +  R +  +  ED L+ L +IDAIQ LGID+HF ++I A+LQRQY K  
Sbjct  67    DEFYIKHAQRLDEIRNVFSEVGEDTLEGLMMIDAIQRLGIDYHFKEEIEAVLQRQYMKAS  126

Query  1539  IDDFQKINGLYDISLSFRLLRQEGYNVSSDVFTKFTSEKGEFKEELSKDIRGLMALHEAS  1360
                 + I  LY+++L FRLLRQEGY+V +DVF  F +++G+FK+ LSKDI+GL+AL+EAS
Sbjct  127   THG-ESIQDLYEVALRFRLLRQEGYHVPADVFNNFKNKEGKFKQNLSKDIKGLLALYEAS  185

Query  1359  HLSIEGEDVLDEAAKFSRESLIANMVHLDECQASMVQNTLQYPYHKSLARFTAKTFIENM  1180
              LSIEGED+L+EA +FS   L A + HL+  +A++V +TL++P+HKSL RF AK+F+++ 
Sbjct  186   QLSIEGEDILEEAQRFSSTLLNAGLEHLNHHEATVVGHTLEHPHHKSLPRFMAKSFLKDF  245

Query  1179  RVENEWEATLVNLATMDYSITQSFYQEEFRQILRWWKSLGLKDEL--AKNQQLKWYIWTL  1006
             +  N W   L  LA  D+++ QS +Q+E  QI +WW+  GL +EL  A++Q LKW++W +
Sbjct  246   QGPNGWLTVLQELAKADFNMVQSIHQQELLQISKWWQDRGLAEELKFARDQPLKWHMWPM  305

Query  1005  ALIPDPSMSRERIELTKPIALVYLIDDIIDVYATFDQTKQFIDAINRWDLSVGEGLPDYM  826
             A++PDPS+S +R+ELTKPI+++Y+IDDI DV+ T D+   F +A+NRWD++  E LP+YM
Sbjct  306   AVLPDPSLSEQRVELTKPISMIYIIDDIFDVHGTLDELTLFTEAVNRWDIAAFETLPNYM  365

Query  825   KRCLVVLFDTTNDINNLVFEKYGWNPIDHLKRAWKCLCSAYITEAKWFATGKSPSANEYL  646
             K C   L + TN+I+N V++++GWNP+D L++ W  LC+A++ EAKWFA+G  P A+EYL
Sbjct  366   KICFKTLDEITNEISNKVYKEHGWNPVDSLRKTWVSLCNAFLVEAKWFASGHVPKAHEYL  425

Query  645   QTGIITTGIPMVLITCFFLLGHGAFAGTTDIED----MITSVGAILRLLDDLDATQGEKQ  478
             + G+I++G+ +VL+  FFLLGHG   G  D+ D    +I+S  AILRL DDL + + E Q
Sbjct  426   KNGVISSGVHVVLVHLFFLLGHGITRGNVDLVDDFPSIISSTAAILRLWDDLGSAKDENQ  485

Query  477   DGNDASYVEYYVKEHEGLSISDGKQRIMNMVSEQWKLINKQCLSPTRIPESFSKSCLNIA  298
             DG+D SY+E Y+KEH+G S+ + +Q +  M+S+ WK +NK+CLS      SF+K  LNIA
Sbjct  486   DGHDGSYIECYIKEHQGSSMENARQNVTYMISDLWKRLNKECLSQHPFSTSFTKGSLNIA  545

Query  297   RMVPMMYNYSDTHCLPILQKQIMSMF  220
             RMVP+MY+Y D   LP L++ + S+ 
Sbjct  546   RMVPLMYSYDDNQSLPHLEEHMKSLL  571



>emb|CAN76849.1| hypothetical protein VITISV_005997 [Vitis vinifera]
Length=595

 Score =   530 bits (1366),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 246/506 (49%), Positives = 361/506 (71%), Gaps = 7/506 (1%)
 Frame = -2

Query  1719  DEFLLKSEGKREWQRGLLYQFQEDDLQVLNVIDAIQHLGIDHHFHDQIGAILQRQYQKVK  1540
             DEF  K   + +  R +  +  ED L+ L +IDAIQ LGID+HF ++I A+LQRQY K  
Sbjct  85    DEFYXKHAQRLDEIRNVFSEVGEDTLEGLMMIDAIQRLGIDYHFKEEIEAVLQRQYXKAS  144

Query  1539  IDDFQKINGLYDISLSFRLLRQEGYNVSSDVFTKFTSEKGEFKEELSKDIRGLMALHEAS  1360
                 + I  LY+++L FRLLRQEGY+V +DVF  F +++G+FK+ LSKDI+GL+ L+EAS
Sbjct  145   XHG-ESIQDLYEVALRFRLLRQEGYHVPADVFNNFKNKEGKFKQNLSKDIKGLLXLYEAS  203

Query  1359  HLSIEGEDVLDEAAKFSRESLIANMVHLDECQASMVQNTLQYPYHKSLARFTAKTFIENM  1180
              LSIEGED+L+EA +FS   L A + HLD  +A++V +TL++P+HKSL RF AK+F+++ 
Sbjct  204   QLSIEGEDILEEAQRFSSTLLNAGLEHLDHHEATVVGHTLEHPHHKSLPRFMAKSFLKDF  263

Query  1179  RVENEWEATLVNLATMDYSITQSFYQEEFRQILRWWKSLGLKDEL--AKNQQLKWYIWTL  1006
             +  N W   L  LA  D+++ QS +Q+E  QI +WW+  GL +EL  A++Q LKW++W +
Sbjct  264   QGPNGWLTVLQELAKADFNMVQSIHQQELLQISKWWQDRGLAEELKFARDQPLKWHMWPM  323

Query  1005  ALIPDPSMSRERIELTKPIALVYLIDDIIDVYATFDQTKQFIDAINRWDLSVGEGLPDYM  826
             A++PDPS+S +R+ELTKPI+++Y+IDDI DV+ T D+   F +A+NRWD++  E LP+YM
Sbjct  324   AVLPDPSLSEQRVELTKPISMIYIIDDIFDVHGTLDELTLFTEAVNRWDIAAFETLPNYM  383

Query  825   KRCLVVLFDTTNDINNLVFEKYGWNPIDHLKRAWKCLCSAYITEAKWFATGKSPSANEYL  646
             K C   L + TN+I+N V++++GWNP+D L++ W  LC+A++ EAKWFA+G  P A+EYL
Sbjct  384   KICFKTLDEITNEISNKVYKEHGWNPVDSLRKTWMSLCNAFLVEAKWFASGHVPKAHEYL  443

Query  645   QTGIITTGIPMVLITCFFLLGHGAFAGTTDIED----MITSVGAILRLLDDLDATQGEKQ  478
             + G+I++G+ +VL+  FFLLGHG   G  D+ D    +I+S  AILRL DDL + + E Q
Sbjct  444   KNGVISSGVHVVLVHLFFLLGHGITRGNVDLVDDFPSIISSTAAILRLWDDLGSAKDENQ  503

Query  477   DGNDASYVEYYVKEHEGLSISDGKQRIMNMVSEQWKLINKQCLSPTRIPESFSKSCLNIA  298
             DG+D SY+E Y+KEH+G S+ + +Q +  M+S+ WK +NK+CLS      SF+K  LNIA
Sbjct  504   DGHDGSYIECYIKEHQGSSMENARQNVTYMISDLWKRLNKECLSQHPFSTSFTKGSLNIA  563

Query  297   RMVPMMYNYSDTHCLPILQKQIMSMF  220
             RMVP+MY+Y D   LP L++ + S+ 
Sbjct  564   RMVPLMYSYDDNQSLPHLEEHMKSLL  589



>ref|XP_002263717.2| PREDICTED: (3S,6E)-nerolidol synthase 1-like [Vitis vinifera]
Length=612

 Score =   529 bits (1362),  Expect = 1e-176, Method: Compositional matrix adjust.
 Identities = 246/506 (49%), Positives = 362/506 (72%), Gaps = 7/506 (1%)
 Frame = -2

Query  1719  DEFLLKSEGKREWQRGLLYQFQEDDLQVLNVIDAIQHLGIDHHFHDQIGAILQRQYQKVK  1540
             DEF +K   + +  R +  +  ED L+ L +IDAIQ LGID+HF ++I A+LQRQY K  
Sbjct  102   DEFYVKHAQRLDEIRNVFSEVGEDTLEGLMMIDAIQRLGIDYHFKEEIEAVLQRQYTKAS  161

Query  1539  IDDFQKINGLYDISLSFRLLRQEGYNVSSDVFTKFTSEKGEFKEELSKDIRGLMALHEAS  1360
                 + I  LY+++L FRLLRQEGY+V +DVF  F +++G+FK+ LSKDI+GL+ L+EAS
Sbjct  162   THG-ESIQDLYEVALRFRLLRQEGYHVPADVFNNFKNKEGKFKQNLSKDIKGLLGLYEAS  220

Query  1359  HLSIEGEDVLDEAAKFSRESLIANMVHLDECQASMVQNTLQYPYHKSLARFTAKTFIENM  1180
              LSIEGED+L+EA +FS   L A + HLD  +A++V +TL++P+HKSL RF AK+F+++ 
Sbjct  221   QLSIEGEDILEEAQRFSSTLLNAGLEHLDHHEATVVGHTLEHPHHKSLPRFMAKSFLKDF  280

Query  1179  RVENEWEATLVNLATMDYSITQSFYQEEFRQILRWWKSLGLKDEL--AKNQQLKWYIWTL  1006
             +  N W   L  LA  D+++ QS +Q+E  QI +WW+ LGL +EL  A++Q LKW++W +
Sbjct  281   QGPNGWLTVLQELAKADFNMVQSIHQQELLQISKWWQDLGLAEELKFARDQPLKWHMWPM  340

Query  1005  ALIPDPSMSRERIELTKPIALVYLIDDIIDVYATFDQTKQFIDAINRWDLSVGEGLPDYM  826
             A++PDPS+S +R+ELTKPI+++Y+IDDI DV+ T D+   F +A+NRWD++  E LP+YM
Sbjct  341   AVLPDPSLSEQRVELTKPISMIYIIDDIFDVHGTLDELTLFTEAVNRWDIAAFETLPNYM  400

Query  825   KRCLVVLFDTTNDINNLVFEKYGWNPIDHLKRAWKCLCSAYITEAKWFATGKSPSANEYL  646
             K C   L + TN+I+N V++++GWNP+D L++ W  LC+A++ EAKWFA+G  P A+EYL
Sbjct  401   KICFKTLDEITNEISNKVYKEHGWNPVDSLRKTWMSLCNAFLVEAKWFASGHVPKAHEYL  460

Query  645   QTGIITTGIPMVLITCFFLLGHGAFAGTTDIED----MITSVGAILRLLDDLDATQGEKQ  478
             + G+I++G+ +VL+  FFLLGHG   G  D+ D    +I+S  AILRL DDL + + E Q
Sbjct  461   KNGVISSGVHVVLVHLFFLLGHGITRGNVDLVDDFPSIISSTAAILRLWDDLGSAKDENQ  520

Query  477   DGNDASYVEYYVKEHEGLSISDGKQRIMNMVSEQWKLINKQCLSPTRIPESFSKSCLNIA  298
             DG+D SY+E Y+KEH+G S+ + +Q +  M+S+  K +NK+CLS      SF+K  LNIA
Sbjct  521   DGHDGSYIECYIKEHQGSSMENARQNVTYMISDLRKRLNKECLSQHPFSTSFTKGSLNIA  580

Query  297   RMVPMMYNYSDTHCLPILQKQIMSMF  220
             RMVP+MY+Y D   LP L++ + S+ 
Sbjct  581   RMVPLMYSYDDNQSLPHLEEHMKSLL  606



>ref|NP_001267895.1| (3S,6E)-nerolidol synthase 1, chloroplastic-like [Vitis vinifera]
 gb|ADR74215.1| (3S)-linalool/(E)-nerolidol /(E,E)-geranyl linalool synthase 
[Vitis vinifera]
Length=545

 Score =   521 bits (1343),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 248/506 (49%), Positives = 350/506 (69%), Gaps = 9/506 (2%)
 Frame = -2

Query  1719  DEFLLKSEGKREWQRGLLYQFQEDDLQVLNVIDAIQHLGIDHHFHDQIGAILQRQYQKVK  1540
             +EF ++   K E  R +L +  ED L+ L +IDAIQ LGID+HFH +I  +LQR + K  
Sbjct  35    NEFYMEHAQKLEEVRSVLKEVGEDTLEALLMIDAIQRLGIDYHFHGEIEVVLQRLHTKFN  94

Query  1539  -IDDFQKINGLYDISLSFRLLRQEGYNVSSDVFTKFTSEKGEFKEELSKDIRGLMALHEA  1363
              + D    N LY+++L FRLLRQEGY+VS+DVF      +G+ +E+LS+DI+GLM L+EA
Sbjct  95    TLSDCH--NNLYELALGFRLLRQEGYHVSADVFNNLKDTEGKLQEKLSEDIKGLMGLYEA  152

Query  1362  SHLSIEGEDVLDEAAKFSRESLIANMVHLDECQASMVQNTLQYPYHKSLARFTAKTFIEN  1183
             S L I+GED+L+E   FS + L     H D  QA +V+NTL +P+HKSLARF AK+F+ +
Sbjct  153   SQLCIKGEDILEEIGNFSSQLLNTWNTHNDHSQARIVRNTLGHPHHKSLARFMAKSFLSD  212

Query  1182  MRVENEWEATLVNLATMDYSITQSFYQEEFRQILRWWKSLGLKDEL--AKNQQLKWYIWT  1009
              +  + W      LA MD++I +S +Q+E  Q+ +WWK LGL  EL  A+NQ LKWY+W 
Sbjct  213   FQGTDGWINVFRELAKMDFNIVKSIHQKEMLQVSKWWKDLGLAKELKFARNQPLKWYMWP  272

Query  1008  LALIPDPSMSRERIELTKPIALVYLIDDIIDVYATFDQTKQFIDAINRWDLSVGEGLPDY  829
             LA++PDPS+S +R+ELTKPI+LVY+IDDI DV+ T D    F +A+NRW+ +  E LPDY
Sbjct  273   LAVLPDPSLSEQRVELTKPISLVYIIDDIFDVHGTLDDLTLFTEAVNRWEYAAVEQLPDY  332

Query  828   MKRCLVVLFDTTNDINNLVFEKYGWNPIDHLKRAWKCLCSAYITEAKWFATGKSPSANEY  649
             MK C   L   TN+I++ V+  +GWNP++ L++AW CLC+A++ EAKWFA G  P A+EY
Sbjct  333   MKICFNALNGITNEISSKVYNDHGWNPMESLRKAWACLCNAFLVEAKWFADGHVPKADEY  392

Query  648   LQTGIITTGIPMVLITCFFLLGHGAFAGTTDIED----MITSVGAILRLLDDLDATQGEK  481
             L+ G+I++G+ +VL+  FFLLGHG      DI D    +I+SV  ILRL DDL + + E 
Sbjct  393   LKNGVISSGVHVVLVHMFFLLGHGITKRNVDIVDDFPEIISSVAKILRLWDDLGSAKDEN  452

Query  480   QDGNDASYVEYYVKEHEGLSISDGKQRIMNMVSEQWKLINKQCLSPTRIPESFSKSCLNI  301
             QDG+D SY+E Y+KE  G SI + +  +M+ +SE WK +N +CL+P     SF+K+CLN+
Sbjct  453   QDGHDGSYLECYMKEKPGTSIENARCHVMHTISETWKSLNNECLAPNPFSTSFTKACLNV  512

Query  300   ARMVPMMYNYSDTHCLPILQKQIMSM  223
             ARMVP+MY+Y D  CLP L++ + S+
Sbjct  513   ARMVPLMYSYDDNRCLPSLEEHMKSL  538



>gb|ADR74213.1| (3S)-linalool/(E)-nerolidol /(E,E)-geranyl linalool synthase 
[Vitis vinifera]
Length=545

 Score =   520 bits (1339),  Expect = 5e-174, Method: Compositional matrix adjust.
 Identities = 246/506 (49%), Positives = 351/506 (69%), Gaps = 9/506 (2%)
 Frame = -2

Query  1719  DEFLLKSEGKREWQRGLLYQFQEDDLQVLNVIDAIQHLGIDHHFHDQIGAILQRQYQKVK  1540
             +EF ++   K E  R +L +  ED L+ L +IDAIQ LGID+HFH +I  +LQR + K  
Sbjct  35    NEFYMEHAQKLEEVRSVLKEVGEDTLEALLMIDAIQRLGIDYHFHGEIEVVLQRLHTKFN  94

Query  1539  -IDDFQKINGLYDISLSFRLLRQEGYNVSSDVFTKFTSEKGEFKEELSKDIRGLMALHEA  1363
              + D    N LY+++L FRLLRQEGY VS+DVF      +G+ +E+LS+DI+GLM L+EA
Sbjct  95    TVSDCH--NNLYELALGFRLLRQEGYYVSADVFNNLKDTEGKIQEKLSEDIKGLMGLYEA  152

Query  1362  SHLSIEGEDVLDEAAKFSRESLIANMVHLDECQASMVQNTLQYPYHKSLARFTAKTFIEN  1183
             S L I+GED+L+E   FS + L A   H D  QA +V+NTL +P+HKSLA+F AK+F+ +
Sbjct  153   SQLCIKGEDILEEIGNFSSQLLNAWNTHNDHSQARIVRNTLGHPHHKSLAKFMAKSFLSD  212

Query  1182  MRVENEWEATLVNLATMDYSITQSFYQEEFRQILRWWKSLGLKDEL--AKNQQLKWYIWT  1009
              +  + W      LA MD+++ +S +Q+E  Q+ +WWK LGL  EL  A+NQ LKWY+W 
Sbjct  213   FQGTDGWVNVFRELAKMDFNVVKSIHQKEMLQLSKWWKDLGLAKELKFARNQPLKWYMWP  272

Query  1008  LALIPDPSMSRERIELTKPIALVYLIDDIIDVYATFDQTKQFIDAINRWDLSVGEGLPDY  829
             LA++PDPS+S +R+ELTKPI+LVY+IDDI DV+ T D+   F +A+NRW+ +  E LPDY
Sbjct  273   LAVLPDPSLSEQRVELTKPISLVYIIDDIFDVHGTLDELTLFTEAVNRWEYAAVEQLPDY  332

Query  828   MKRCLVVLFDTTNDINNLVFEKYGWNPIDHLKRAWKCLCSAYITEAKWFATGKSPSANEY  649
             MK C   L   TN+I++ V+  +GWNP++ L++AW CLC+A++ EAKWFA G  P A+EY
Sbjct  333   MKICFNALNGITNEISSKVYNDHGWNPMESLRKAWACLCNAFLVEAKWFADGHVPKADEY  392

Query  648   LQTGIITTGIPMVLITCFFLLGHGAFAGTTDIED----MITSVGAILRLLDDLDATQGEK  481
             L+ G+I++G+ +VL+  FFLLGHG      D+ D    +I+SV  ILRL DDL + + E 
Sbjct  393   LKNGVISSGVHVVLVHMFFLLGHGITKRNVDVVDDFPEIISSVAKILRLWDDLGSAKDEN  452

Query  480   QDGNDASYVEYYVKEHEGLSISDGKQRIMNMVSEQWKLINKQCLSPTRIPESFSKSCLNI  301
             QDG+D SY+E Y+KE  G SI + +  +M+ +SE WK +N +CL+P     SF+K+CLN+
Sbjct  453   QDGHDGSYLECYMKEKPGTSIENARCHVMHTISETWKSLNNECLAPNPFSTSFTKACLNV  512

Query  300   ARMVPMMYNYSDTHCLPILQKQIMSM  223
             ARMVP+MY+Y D  CLP L++ + S+
Sbjct  513   ARMVPLMYSYDDNRCLPSLEEHMKSL  538



>ref|XP_003635168.1| PREDICTED: (3S,6E)-nerolidol synthase 1-like [Vitis vinifera]
Length=545

 Score =   519 bits (1337),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 247/506 (49%), Positives = 349/506 (69%), Gaps = 9/506 (2%)
 Frame = -2

Query  1719  DEFLLKSEGKREWQRGLLYQFQEDDLQVLNVIDAIQHLGIDHHFHDQIGAILQRQYQKVK  1540
             +EF ++   K E  R  L +  ED L+ L +IDAIQ LGID+HFH +I  +LQR + K  
Sbjct  35    NEFYMEHAQKLEEVRRALKEVGEDTLEALLMIDAIQRLGIDYHFHGEIEVVLQRLHTKFN  94

Query  1539  -IDDFQKINGLYDISLSFRLLRQEGYNVSSDVFTKFTSEKGEFKEELSKDIRGLMALHEA  1363
              + D    N LY+++L FRLLRQEGY VS+DVF      +G+ +E+LS+DI+GLM L+EA
Sbjct  95    TVSDCH--NNLYELALGFRLLRQEGYYVSADVFNNLKDTEGKLQEKLSEDIKGLMGLYEA  152

Query  1362  SHLSIEGEDVLDEAAKFSRESLIANMVHLDECQASMVQNTLQYPYHKSLARFTAKTFIEN  1183
             S L I+GED+L+E   FS + L A   H D  QA +V+NTL +P+HKSLARF AK+F+ +
Sbjct  153   SQLCIKGEDILEEIGNFSSQLLNAWNTHNDHSQARIVRNTLGHPHHKSLARFMAKSFLSD  212

Query  1182  MRVENEWEATLVNLATMDYSITQSFYQEEFRQILRWWKSLGLKDEL--AKNQQLKWYIWT  1009
              +  + W      LA MD+++ +S +Q+E  Q+ +WWK LGL  EL  A+NQ LKWY+W 
Sbjct  213   FQGTDGWVNVFRELAKMDFNVVKSIHQKEMLQVSKWWKDLGLAKELKFARNQPLKWYMWP  272

Query  1008  LALIPDPSMSRERIELTKPIALVYLIDDIIDVYATFDQTKQFIDAINRWDLSVGEGLPDY  829
             LA++PDPS+S +R+ELTKPI+LVY+IDDI DV+ T D+   F +A+NRW+ +  E LPDY
Sbjct  273   LAVLPDPSLSEQRVELTKPISLVYIIDDIFDVHGTLDELTLFTEAVNRWEYAAVEQLPDY  332

Query  828   MKRCLVVLFDTTNDINNLVFEKYGWNPIDHLKRAWKCLCSAYITEAKWFATGKSPSANEY  649
             MK C   L   TN+I++ V+  +GWNP++ L++AW CLC+A++ EAKWFA G  P A+EY
Sbjct  333   MKICFNALNGITNEISSKVYNDHGWNPMESLRKAWACLCNAFLVEAKWFADGHVPKADEY  392

Query  648   LQTGIITTGIPMVLITCFFLLGHGAFAGTTDIED----MITSVGAILRLLDDLDATQGEK  481
             L+ G+I++G+ +VL+  FFLLGHG      DI D    +I+SV  ILRL DDL + + E 
Sbjct  393   LKNGVISSGVHVVLVHMFFLLGHGITKRNVDIVDDFPEIISSVAKILRLWDDLGSAKDEN  452

Query  480   QDGNDASYVEYYVKEHEGLSISDGKQRIMNMVSEQWKLINKQCLSPTRIPESFSKSCLNI  301
             QDG+D SY+E Y+KE  G SI + +  +M+ +SE WK +N +CL+P      F+K+CLN+
Sbjct  453   QDGHDGSYLECYMKEKPGTSIENARCHVMHTISETWKSLNNECLAPNPFSTCFTKACLNV  512

Query  300   ARMVPMMYNYSDTHCLPILQKQIMSM  223
             ARMVP+MY+Y D  CLP L++ + S+
Sbjct  513   ARMVPLMYSYDDNRCLPSLEEHMKSL  538



>gb|ADD81295.1| linalool synthase [Actinidia polygama]
Length=574

 Score =   520 bits (1339),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 248/507 (49%), Positives = 349/507 (69%), Gaps = 10/507 (2%)
 Frame = -2

Query  1719  DEFLLKSEGKREWQRGLLYQFQEDDLQVLNVIDAIQHLGIDHHFHDQIGAILQRQYQKVK  1540
             DEF +K E K +  R  L + +E  L+ L +ID +Q LGID+HF  +IGA+LQ+Q +K K
Sbjct  66    DEFYVKREKKLKDVRRALREVEETPLEGLVMIDTLQRLGIDYHFQGEIGALLQKQQRKSK  125

Query  1539  IDDFQKINGLYDISLSFRLLRQEGYNVSSDVFTKFTSEKGEFKEELSKDIRGLMALHEAS  1360
              D  +  + L+++S  FRLLRQEG+NV +DVF  F  +KG FK ELS+DIRGLM+L+EAS
Sbjct  126   CDYPE--HDLFEVSTRFRLLRQEGHNVPADVFNHFRDKKGRFKSELSRDIRGLMSLYEAS  183

Query  1359  HLSIEGEDVLDEAAKFSRESLIANMVHLDECQASMVQNTLQYPYHKSLARFTAKTFIENM  1180
              LSI+GED+LD+AA FS + L     + D  QA +V+N L +PYHKSLA FTA+ F  + 
Sbjct  184   QLSIQGEDILDQAADFSSQLLSGWATNPDHHQARLVRNALTHPYHKSLATFTARNFHYDC  243

Query  1179  RVENEWEATLVNLATMDYSITQSFYQEEFRQILRWWKSLGLKDEL--AKNQQLKWYIWTL  1006
             + +N W   L  LA MD ++ QS +Q+E  Q+ +WWK  GL +EL   +NQ LKWY+W +
Sbjct  244   KGQNGWVNNLQELAKMDLTVVQSMHQKEVLQVSQWWKDRGLANELKLVRNQPLKWYMWPM  303

Query  1005  ALIPDPSMSRERIELTKPIALVYLIDDIIDVYATFDQTKQFIDAINRWDLSVGEGLPDYM  826
             A + DP  S ER+ELTKPI+ +Y+IDDI DVY T ++   F DA+NRW+L+  E LPDYM
Sbjct  304   AALTDPRFSEERVELTKPISFIYIIDDIFDVYGTLEELTLFTDAVNRWELTAVEQLPDYM  363

Query  825   KRCLVVLFDTTNDINNLVFEKYGWNPIDHLKRAWKCLCSAYITEAKWFATGKSPSANEYL  646
             K C   L+D TN+I   +++K+GWNPID L+R W  LC+A++ EAKWFA+G  P A EYL
Sbjct  364   KVCFKALYDITNEIAYKIYKKHGWNPIDSLRRMWASLCNAFLVEAKWFASGHLPKAEEYL  423

Query  645   QTGIITTGIPMVLITCFFLLGHGAFAGTT-----DIEDMITSVGAILRLLDDLDATQGEK  481
             + GII++G+ +V +  FFLLG G F   +     +   + +S+  ILRL DDL + + E 
Sbjct  424   KNGIISSGMHVVTVHMFFLLG-GCFTDESVNLVDEHAGITSSIATILRLSDDLGSAKDED  482

Query  480   QDGNDASYVEYYVKEHEGLSISDGKQRIMNMVSEQWKLINKQCLSPTRIPESFSKSCLNI  301
             QDG D SYVEYY+K+H+G S+ + ++ ++ M+S+ WK +N++CLSP     +F K CLNI
Sbjct  483   QDGYDGSYVEYYLKDHKGSSVENAREEVIRMISDAWKRLNEECLSPNPFSATFRKGCLNI  542

Query  300   ARMVPMMYNYSDTHCLPILQKQIMSMF  220
             ARMVP+MY+Y D H LP+L++ + +M 
Sbjct  543   ARMVPLMYSYDDNHNLPLLEEHMKAML  569



>ref|NP_001268060.1| (3S,6E)-nerolidol synthase 1-like [Vitis vinifera]
 gb|ADR74216.1| (3S)-linalool/(E)-nerolidol /(E,E)-geranyl linalool synthase 
[Vitis vinifera]
Length=545

 Score =   518 bits (1335),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 246/503 (49%), Positives = 349/503 (69%), Gaps = 9/503 (2%)
 Frame = -2

Query  1719  DEFLLKSEGKREWQRGLLYQFQEDDLQVLNVIDAIQHLGIDHHFHDQIGAILQRQYQKVK  1540
             +EF ++   K E  R +L +  ED L+ L +IDAIQ LGID+HFH +I  +LQR + K  
Sbjct  35    NEFYMEHAQKLEEVRSVLKEVGEDTLEALLMIDAIQRLGIDYHFHGEIEVVLQRLHTKFN  94

Query  1539  -IDDFQKINGLYDISLSFRLLRQEGYNVSSDVFTKFTSEKGEFKEELSKDIRGLMALHEA  1363
              + D    N LY+++L FRLLRQEGY  S+DVF      +G+ +E+LS+D++GLM L+EA
Sbjct  95    TMSDCH--NNLYELALGFRLLRQEGYYASADVFNNLKDTEGKIQEKLSEDVKGLMGLYEA  152

Query  1362  SHLSIEGEDVLDEAAKFSRESLIANMVHLDECQASMVQNTLQYPYHKSLARFTAKTFIEN  1183
             S LSI+ ED+L+E   FS + L A   H D  QA +V+NTL +P+HKSLARF AK+F+ +
Sbjct  153   SQLSIKREDILEEIGNFSSQLLNAWNTHNDHSQARIVRNTLGHPHHKSLARFMAKSFLSD  212

Query  1182  MRVENEWEATLVNLATMDYSITQSFYQEEFRQILRWWKSLGLKDEL--AKNQQLKWYIWT  1009
              +  + W      LA MD+++ +S +Q+E  Q+ +WWK LGL  EL  A+NQ LKWY+W 
Sbjct  213   FQGTDGWINVFRELAKMDFNVVKSIHQKEMLQVSKWWKDLGLAKELKFARNQPLKWYMWP  272

Query  1008  LALIPDPSMSRERIELTKPIALVYLIDDIIDVYATFDQTKQFIDAINRWDLSVGEGLPDY  829
             LA++PDPS+S +R+ELTKPI+LVY+IDDI DV+ T D+   F +A+NRW+ +  E LPDY
Sbjct  273   LAVLPDPSLSEQRVELTKPISLVYIIDDIFDVHGTLDELTLFTEAVNRWEYAAVEQLPDY  332

Query  828   MKRCLVVLFDTTNDINNLVFEKYGWNPIDHLKRAWKCLCSAYITEAKWFATGKSPSANEY  649
             MK C   L   TN+I++ V+  +GWNP++ L++AW CLC+A++ EAKWFA G  P A+EY
Sbjct  333   MKICFNALNGITNEISSKVYNDHGWNPMESLRKAWACLCNAFLVEAKWFADGHVPKADEY  392

Query  648   LQTGIITTGIPMVLITCFFLLGHGAFAGTTDIED----MITSVGAILRLLDDLDATQGEK  481
             L+ G+I++G+ +VL+  FFLLGHG      DI D    +I+SV  ILRL DDL + + E 
Sbjct  393   LKNGVISSGVHVVLVHMFFLLGHGITKRNVDIVDDFPEIISSVAKILRLWDDLGSAKDEN  452

Query  480   QDGNDASYVEYYVKEHEGLSISDGKQRIMNMVSEQWKLINKQCLSPTRIPESFSKSCLNI  301
             QDG+D SY+E Y+KE  G SI + +  +M+ +SE WK +NK+CL+P     SF+K+CLN+
Sbjct  453   QDGHDGSYLECYMKEKPGTSIENARCHVMHTISETWKRLNKECLAPNPFSTSFTKACLNV  512

Query  300   ARMVPMMYNYSDTHCLPILQKQI  232
             ARMVP+MY+Y D  CLP L++ +
Sbjct  513   ARMVPLMYSYDDNQCLPSLEEHM  535



>ref|XP_010646907.1| PREDICTED: (3S,6E)-nerolidol synthase 1, chloroplastic-like isoform 
X2 [Vitis vinifera]
Length=544

 Score =   518 bits (1333),  Expect = 3e-173, Method: Compositional matrix adjust.
 Identities = 245/506 (48%), Positives = 349/506 (69%), Gaps = 9/506 (2%)
 Frame = -2

Query  1719  DEFLLKSEGKREWQRGLLYQFQEDDLQVLNVIDAIQHLGIDHHFHDQIGAILQRQYQKVK  1540
             +EF ++   K E  R +L +  ED L+ L +IDAIQ LGID+HFH +I  +LQR + K  
Sbjct  34    NEFYMEHAQKLEEVRSVLKEVGEDTLEALLMIDAIQRLGIDYHFHGEIEVVLQRLHTKFN  93

Query  1539  -IDDFQKINGLYDISLSFRLLRQEGYNVSSDVFTKFTSEKGEFKEELSKDIRGLMALHEA  1363
              + D    N LY+++L FRLLRQEGY+VS+DVF      +G+ +E+LS+DI+GLM L+EA
Sbjct  94    TVSDCH--NNLYELALGFRLLRQEGYHVSADVFNNLKDTEGKLQEKLSEDIKGLMGLYEA  151

Query  1362  SHLSIEGEDVLDEAAKFSRESLIANMVHLDECQASMVQNTLQYPYHKSLARFTAKTFIEN  1183
             S L I+GED+L+E   FS + L A   H D  QA +V+NTL +P+HKSLARF AK+F+ +
Sbjct  152   SQLCIKGEDILEEIGNFSSQLLNAWDTHNDHSQARIVRNTLGHPHHKSLARFMAKSFLSD  211

Query  1182  MRVENEWEATLVNLATMDYSITQSFYQEEFRQILRWWKSLGLKDEL--AKNQQLKWYIWT  1009
              +  + W+     LA MD+++ +S +Q+E  Q+ +WWK LGL  EL  A+NQ LKWY+W 
Sbjct  212   FQGTDGWKNVFRELAKMDFNVVKSIHQKEMLQVSKWWKDLGLAKELKFARNQPLKWYMWP  271

Query  1008  LALIPDPSMSRERIELTKPIALVYLIDDIIDVYATFDQTKQFIDAINRWDLSVGEGLPDY  829
             LA++PDPS+S +R+ELTKPI+LVY+IDDI DV+ T D    F +A+NRW+ +  E LPDY
Sbjct  272   LAVLPDPSLSEQRVELTKPISLVYIIDDIFDVHGTLDDLTLFTEAVNRWEYAAVEQLPDY  331

Query  828   MKRCLVVLFDTTNDINNLVFEKYGWNPIDHLKRAWKCLCSAYITEAKWFATGKSPSANEY  649
             M  C   L   TN+I++ V+  +GWNP++ L++AW CLC+A++ EAKWFA G  P A+EY
Sbjct  332   MTICFNALNGITNEISSKVYNDHGWNPMESLRKAWACLCNAFLVEAKWFADGHVPKADEY  391

Query  648   LQTGIITTGIPMVLITCFFLLGHGAFAGTTDIED----MITSVGAILRLLDDLDATQGEK  481
             L+ G+I++G+ +VL+  FFLLGHG      D  D    +I+SV  ILRL DDL + + E 
Sbjct  392   LKNGVISSGVHVVLVHMFFLLGHGITKRNVDTVDDFPEIISSVAKILRLWDDLGSAKDEN  451

Query  480   QDGNDASYVEYYVKEHEGLSISDGKQRIMNMVSEQWKLINKQCLSPTRIPESFSKSCLNI  301
             QDG+D SY+E Y+KE  G SI + +  +M+ +SE WK +N +CL+P      F+K+CLN+
Sbjct  452   QDGHDGSYLECYMKEKPGTSIENARCHVMHTISETWKSLNNECLAPNPFSTCFTKACLNV  511

Query  300   ARMVPMMYNYSDTHCLPILQKQIMSM  223
             ARMVP+MY+Y D  CLP L++ + S+
Sbjct  512   ARMVPLMYSYDDNRCLPSLEEHMKSL  537



>ref|NP_001267990.1| (3S)-linalool/(E)-nerolidol /(E,E)-geranyl linalool synthase 
[Vitis vinifera]
 gb|ADR74214.1| (3S)-linalool/(E)-nerolidol /(E,E)-geranyl linalool synthase 
[Vitis vinifera]
Length=545

 Score =   516 bits (1330),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 245/506 (48%), Positives = 349/506 (69%), Gaps = 9/506 (2%)
 Frame = -2

Query  1719  DEFLLKSEGKREWQRGLLYQFQEDDLQVLNVIDAIQHLGIDHHFHDQIGAILQRQYQKVK  1540
             +EF ++   K E  R +L +  ED L+ L +IDAIQ LGID+HFH +I  +LQR + K  
Sbjct  35    NEFYMEHAQKLEEVRSVLKEVGEDTLEALLMIDAIQRLGIDYHFHGEIEVVLQRLHTKFN  94

Query  1539  -IDDFQKINGLYDISLSFRLLRQEGYNVSSDVFTKFTSEKGEFKEELSKDIRGLMALHEA  1363
              + D    N LY+++L FRLLRQEGY VS+DVF      +G+ +E+LS+DI+GLM L+EA
Sbjct  95    TLSDCH--NNLYELALGFRLLRQEGYYVSADVFNNLKDTEGKIQEKLSEDIKGLMGLYEA  152

Query  1362  SHLSIEGEDVLDEAAKFSRESLIANMVHLDECQASMVQNTLQYPYHKSLARFTAKTFIEN  1183
             S L I+GED+L+E   FS + L A   H D  QA +V+NTL +P+HKSLARF AK+F+ +
Sbjct  153   SQLCIKGEDILEEIGNFSSQLLNAWNTHNDHSQARIVRNTLGHPHHKSLARFMAKSFLSD  212

Query  1182  MRVENEWEATLVNLATMDYSITQSFYQEEFRQILRWWKSLGLKDEL--AKNQQLKWYIWT  1009
              +  + W      LA MD+++ +S +Q+E  Q+ +WWK LGL  EL  A+NQ LKWY+W 
Sbjct  213   FQGTDGWVNVFRELAKMDFNVVKSIHQKEMLQVSKWWKDLGLAKELKFARNQPLKWYMWP  272

Query  1008  LALIPDPSMSRERIELTKPIALVYLIDDIIDVYATFDQTKQFIDAINRWDLSVGEGLPDY  829
             LA++PDPS+S +R+ELTKPI+LVY+IDDI DV+ T D+   F +A+NRW+ +  E LPDY
Sbjct  273   LAVLPDPSLSEQRVELTKPISLVYIIDDIFDVHGTLDELTLFTEAVNRWEYAAVEQLPDY  332

Query  828   MKRCLVVLFDTTNDINNLVFEKYGWNPIDHLKRAWKCLCSAYITEAKWFATGKSPSANEY  649
             MK C   L   TN+I++ V+  +GWNP++ L++AW CLC+A++ EAKWFA G  P A+EY
Sbjct  333   MKICFNALNGITNEISSKVYNDHGWNPMESLRKAWACLCNAFLVEAKWFADGHVPKADEY  392

Query  648   LQTGIITTGIPMVLITCFFLLGHGAFAGTTDIED----MITSVGAILRLLDDLDATQGEK  481
             L+ G+I++G+ +VL+  FFLLGHG      DI D    +I+SV  ILRL DDL + + E 
Sbjct  393   LKNGVISSGVHVVLVHMFFLLGHGITKRNVDIVDDFPEIISSVAKILRLWDDLGSAKDEN  452

Query  480   QDGNDASYVEYYVKEHEGLSISDGKQRIMNMVSEQWKLINKQCLSPTRIPESFSKSCLNI  301
             QDG+D SY+E Y+KE  G SI + +  +M+ +SE WK ++ +CL+P      F+ +CLN+
Sbjct  453   QDGHDGSYLECYMKEKPGTSIENARCHVMHTISETWKSLSNECLAPNPFSTCFTNACLNV  512

Query  300   ARMVPMMYNYSDTHCLPILQKQIMSM  223
             ARMVP+MY+Y D  CLP L++ + S+
Sbjct  513   ARMVPLMYSYDDNRCLPSLEEHMKSL  538



>ref|XP_003635282.1| PREDICTED: (3S,6E)-nerolidol synthase 1-like [Vitis vinifera]
Length=545

 Score =   516 bits (1328),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 246/506 (49%), Positives = 350/506 (69%), Gaps = 9/506 (2%)
 Frame = -2

Query  1719  DEFLLKSEGKREWQRGLLYQFQEDDLQVLNVIDAIQHLGIDHHFHDQIGAILQRQYQKVK  1540
             +EF ++   K E  R +L +  ED L+ L +IDAIQ LGID+HFH +I  +LQR + K  
Sbjct  35    NEFYMEHAQKLEEVRSVLKEVGEDTLEALLMIDAIQRLGIDYHFHGEIEVVLQRLHTKFN  94

Query  1539  -IDDFQKINGLYDISLSFRLLRQEGYNVSSDVFTKFTSEKGEFKEELSKDIRGLMALHEA  1363
              + D    N LY+++L FRLLRQEGY VS+DVF      +G+ +E+LS+DI+GLM L+EA
Sbjct  95    TVSDCH--NNLYELALGFRLLRQEGYYVSADVFNNLKDTEGKIQEKLSEDIKGLMGLYEA  152

Query  1362  SHLSIEGEDVLDEAAKFSRESLIANMVHLDECQASMVQNTLQYPYHKSLARFTAKTFIEN  1183
             S L I+GED+L+E   FS + L A   H D  QA +V+NTL +P+HKSLA+F AK+F+ +
Sbjct  153   SQLCIKGEDILEEIGNFSSQLLNAWNTHNDHSQARIVRNTLGHPHHKSLAKFMAKSFLSD  212

Query  1182  MRVENEWEATLVNLATMDYSITQSFYQEEFRQILRWWKSLGLKDEL--AKNQQLKWYIWT  1009
              +  + W      LA MD+++ +S +Q+E  Q+ +WWK LGL  EL  A+NQ LKWY+W 
Sbjct  213   FQGTDGWVNVFRELAKMDFNVVKSIHQKEMLQLSKWWKDLGLAKELKFARNQPLKWYMWP  272

Query  1008  LALIPDPSMSRERIELTKPIALVYLIDDIIDVYATFDQTKQFIDAINRWDLSVGEGLPDY  829
             LA++PDPS+S +R+ELTKPI+LVY+IDDI DV+ T D+   F +A+NRW+ +  E LPDY
Sbjct  273   LAVLPDPSLSEQRVELTKPISLVYIIDDIFDVHGTLDELTLFTEAVNRWEYAAVEQLPDY  332

Query  828   MKRCLVVLFDTTNDINNLVFEKYGWNPIDHLKRAWKCLCSAYITEAKWFATGKSPSANEY  649
             MK C   L   TN+I++ V+  +G NP++ L++AW CLC+A++ EAKWFA G  P A+EY
Sbjct  333   MKICFNALNGITNEISSKVYNDHGRNPMESLRKAWACLCNAFLVEAKWFADGHVPKADEY  392

Query  648   LQTGIITTGIPMVLITCFFLLGHGAFAGTTDIED----MITSVGAILRLLDDLDATQGEK  481
             L+ G+I++G+ +VL+  FFLLGHG      DI D    +I+SV  ILRL DDL + + E 
Sbjct  393   LKNGVISSGVHVVLVHMFFLLGHGITKRNVDIVDDFPEIISSVAKILRLWDDLGSAKDEN  452

Query  480   QDGNDASYVEYYVKEHEGLSISDGKQRIMNMVSEQWKLINKQCLSPTRIPESFSKSCLNI  301
             QDG+D SY+E Y+KE  G SI + +  +M+ +SE WK +N +CL+P     SF+K+CLN+
Sbjct  453   QDGHDGSYLECYMKEKPGTSIENARCHVMHTISETWKSLNNECLAPNPFSTSFTKACLNV  512

Query  300   ARMVPMMYNYSDTHCLPILQKQIMSM  223
             ARMVP+MY+Y D  CLP L++ + S+
Sbjct  513   ARMVPLMYSYDDNRCLPSLEEHMKSL  538



>ref|XP_010646906.1| PREDICTED: (3S,6E)-nerolidol synthase 1, chloroplastic-like isoform 
X1 [Vitis vinifera]
Length=545

 Score =   515 bits (1327),  Expect = 3e-172, Method: Compositional matrix adjust.
 Identities = 244/506 (48%), Positives = 348/506 (69%), Gaps = 9/506 (2%)
 Frame = -2

Query  1719  DEFLLKSEGKREWQRGLLYQFQEDDLQVLNVIDAIQHLGIDHHFHDQIGAILQRQYQKVK  1540
             +EF ++   K E  R +L +  ED L+ L +IDAIQ LGID+HFH +I  +LQR + K  
Sbjct  35    NEFYMEHAQKLEEVRSVLKEVGEDTLEALLMIDAIQRLGIDYHFHGEIEVVLQRLHTKFN  94

Query  1539  -IDDFQKINGLYDISLSFRLLRQEGYNVSSDVFTKFTSEKGEFKEELSKDIRGLMALHEA  1363
              + D    N LY++++ FRLLRQEGY VS+DVF      +G+ +E+LS+DI+GLM L+EA
Sbjct  95    TLSDCH--NNLYELAVGFRLLRQEGYYVSADVFNNLKDTEGKLQEKLSEDIKGLMGLYEA  152

Query  1362  SHLSIEGEDVLDEAAKFSRESLIANMVHLDECQASMVQNTLQYPYHKSLARFTAKTFIEN  1183
             S L I+GED+L+E   FS + L A   H D  QA +V+NTL +P+HKSLARF AK+F+ +
Sbjct  153   SQLCIKGEDILEEIGNFSSQLLNAWNTHNDHSQARIVRNTLGHPHHKSLARFMAKSFLSD  212

Query  1182  MRVENEWEATLVNLATMDYSITQSFYQEEFRQILRWWKSLGLKDEL--AKNQQLKWYIWT  1009
              +  + W      LA MD+++ +S +Q+E  Q+ +WWK LGL  EL  A+NQ LKWY+W 
Sbjct  213   FQGTDGWVNVFRELAKMDFNVVKSIHQKEMLQVSKWWKDLGLAKELKFARNQPLKWYMWP  272

Query  1008  LALIPDPSMSRERIELTKPIALVYLIDDIIDVYATFDQTKQFIDAINRWDLSVGEGLPDY  829
             LA++PDPS+S +R+ELTKPI+LVY+IDDI DV+ T D+   F +A+NRW+ +  E LPDY
Sbjct  273   LAVLPDPSLSEQRVELTKPISLVYIIDDIFDVHGTLDELTLFTEAVNRWEYAAVEQLPDY  332

Query  828   MKRCLVVLFDTTNDINNLVFEKYGWNPIDHLKRAWKCLCSAYITEAKWFATGKSPSANEY  649
             M  C   L   TN+I++ V+  +GWNP++ L++AW CLC+A++ EAKWFA G  P A+EY
Sbjct  333   MTICFNALNGITNEISSKVYNDHGWNPMESLRKAWACLCNAFLVEAKWFADGHVPKADEY  392

Query  648   LQTGIITTGIPMVLITCFFLLGHGAFAGTTDIED----MITSVGAILRLLDDLDATQGEK  481
             L+ G+I++G+ +VL+  FFLLGHG      D  D    +I+SV  ILRL DDL + + E 
Sbjct  393   LKNGVISSGVHVVLVHMFFLLGHGITKRNVDTVDDFPEIISSVAKILRLWDDLGSAKDEN  452

Query  480   QDGNDASYVEYYVKEHEGLSISDGKQRIMNMVSEQWKLINKQCLSPTRIPESFSKSCLNI  301
             QDG+D SY+E Y+KE  G SI + +  +M+ +SE WK +N +CL+P      F+K+CLN+
Sbjct  453   QDGHDGSYLECYMKEKPGTSIENARCHVMHTISETWKSLNNECLAPNPFSTCFTKACLNV  512

Query  300   ARMVPMMYNYSDTHCLPILQKQIMSM  223
             ARMVP+MY+Y D  CLP L++ + S+
Sbjct  513   ARMVPLMYSYDDNRCLPSLEEHMKSL  538



>ref|XP_003635413.1| PREDICTED: (3S,6E)-nerolidol synthase 1-like [Vitis vinifera]
Length=545

 Score =   515 bits (1326),  Expect = 4e-172, Method: Compositional matrix adjust.
 Identities = 244/506 (48%), Positives = 348/506 (69%), Gaps = 9/506 (2%)
 Frame = -2

Query  1719  DEFLLKSEGKREWQRGLLYQFQEDDLQVLNVIDAIQHLGIDHHFHDQIGAILQRQYQKVK  1540
             ++F ++   K E  R  L +  ED L+ L +IDAIQ LGID+HFH +I  +LQR + K  
Sbjct  35    NKFYMEHAQKLEEVRRALKEVGEDTLEALLMIDAIQRLGIDYHFHGEIEVVLQRLHTKFN  94

Query  1539  -IDDFQKINGLYDISLSFRLLRQEGYNVSSDVFTKFTSEKGEFKEELSKDIRGLMALHEA  1363
              + D    N LY+++L FRLLRQEGY VS+DVF      +G+ +E+LS+DI+GLM L+EA
Sbjct  95    TVSDCH--NNLYELALGFRLLRQEGYYVSADVFNNLKDTEGKLQEKLSQDIKGLMGLYEA  152

Query  1362  SHLSIEGEDVLDEAAKFSRESLIANMVHLDECQASMVQNTLQYPYHKSLARFTAKTFIEN  1183
             S L I+GED L+E   FS + L A   H D  QA +V+NTL +P+HKSLA+F AK+F+ +
Sbjct  153   SQLCIKGEDTLEEIGNFSSQLLNAWNTHNDHSQARIVRNTLGHPHHKSLAKFMAKSFLSD  212

Query  1182  MRVENEWEATLVNLATMDYSITQSFYQEEFRQILRWWKSLGLKDEL--AKNQQLKWYIWT  1009
              +  + W      LA MD+++ +S +Q+E  Q+ +WWK LGL  EL  A+NQ LKWY+W 
Sbjct  213   FQGTDGWVNVFRELAKMDFNVVKSIHQKEMLQVSKWWKDLGLAKELKFARNQPLKWYMWP  272

Query  1008  LALIPDPSMSRERIELTKPIALVYLIDDIIDVYATFDQTKQFIDAINRWDLSVGEGLPDY  829
             LA++PDPS+S +R+ELTKPI+LVY+IDDI DV+ T D+   F +A+NRW+ +  E LPDY
Sbjct  273   LAVLPDPSLSEQRVELTKPISLVYIIDDIFDVHGTLDELTLFTEAVNRWEYAAVEQLPDY  332

Query  828   MKRCLVVLFDTTNDINNLVFEKYGWNPIDHLKRAWKCLCSAYITEAKWFATGKSPSANEY  649
             MK C   L   TN+I++ V+  +GWNP++ L++AW CLC+A++ EAKWFA G  P A+EY
Sbjct  333   MKICFNALNGITNEISSKVYNDHGWNPMESLRKAWACLCNAFLVEAKWFADGHVPKADEY  392

Query  648   LQTGIITTGIPMVLITCFFLLGHGAFAGTTDIED----MITSVGAILRLLDDLDATQGEK  481
             L+ G+I++G+ +VL+  FFLLGHG      D+ D    +I+SV  ILRL DDL + + E 
Sbjct  393   LKNGVISSGVHVVLVHMFFLLGHGITKRNVDVVDDFPEIISSVAKILRLWDDLGSAKDEN  452

Query  480   QDGNDASYVEYYVKEHEGLSISDGKQRIMNMVSEQWKLINKQCLSPTRIPESFSKSCLNI  301
             QDG+D SY+E Y+KE  G SI + +  +M+ +SE WK +N +CL+P      F+K+CLN+
Sbjct  453   QDGHDGSYLECYMKEKPGTSIENARCHVMHTISETWKSLNNECLAPNPFSTCFTKACLNV  512

Query  300   ARMVPMMYNYSDTHCLPILQKQIMSM  223
             ARMVP+MY+Y D  CLP L++ + S+
Sbjct  513   ARMVPLMYSYDDNRCLPSLEEHMKSL  538



>ref|XP_010646919.1| PREDICTED: (3S,6E)-nerolidol synthase 1, chloroplastic-like isoform 
X1 [Vitis vinifera]
Length=493

 Score =   507 bits (1305),  Expect = 9e-170, Method: Compositional matrix adjust.
 Identities = 241/481 (50%), Positives = 338/481 (70%), Gaps = 8/481 (2%)
 Frame = -2

Query  1644  LQVLNVIDAIQHLGIDHHFHDQIGAILQRQYQKVKIDDFQKINGLYDISLSFRLLRQEGY  1465
             ++ + +IDAIQ LGIDHHF ++I A+LQ+QY K  I        LY+++L FRLLRQEGY
Sbjct  1     MESMMMIDAIQRLGIDHHFEEEIEAVLQKQYMKSSIHG-DCDEDLYEVALRFRLLRQEGY  59

Query  1464  NVSSDVFTKFTSEKGEFKEELSKDIRGLMALHEASHLSIEGEDVLDEAAKFSRESLIANM  1285
              V +DV   F +++G+FK+ L +DIRGLM L+EAS LSI GED+L+EA  FS   L A +
Sbjct  60    TVPADVLNNFKNKEGKFKQNLREDIRGLMGLYEASQLSI-GEDILEEAGNFSSLLLNACL  118

Query  1284  VHLDECQASMVQNTLQYPYHKSLARFTAKTFIENMRVENEWEATLVNLATMDYSITQSFY  1105
              HLD  QA++V+NTL++P+HKSLARF  K F+ + +  N W   L  LA +D+++ +S +
Sbjct  119   QHLDHHQAAVVKNTLEHPHHKSLARFMTKNFLTDFQGTNGWINALQELAKIDFNMVKSVH  178

Query  1104  QEEFRQILRWWKSLGLKDEL--AKNQQLKWYIWTLALIPDPSMSRERIELTKPIALVYLI  931
             Q+E  QI +WWK LGL +EL  A++Q LKWY+W +A+IPDP +S +RIELTKPI+L+Y+I
Sbjct  179   QKEMLQISKWWKDLGLTEELKFARDQPLKWYMWPMAIIPDPRLSEQRIELTKPISLIYII  238

Query  930   DDIIDVYATFDQTKQFIDAINRWDLSVGEGLPDYMKRCLVVLFDTTNDINNLVFEKYGWN  751
             DDI DV  T D+   F +A+NRWDLS  + LP+YMK C   L D TN+I+  V +++ WN
Sbjct  239   DDIFDVGGTLDELTLFTEAVNRWDLSAFKELPEYMKMCFKTLDDITNEISTKVHKEHKWN  298

Query  750   PIDHLKRAWKCLCSAYITEAKWFATGKSPSANEYLQTGIITTGIPMVLITCFFLLGHGAF  571
             P+  L++AW  LC+A++ EAKWFA+G  P A EYL+ G +++G+ +VL+  FFLLGHG  
Sbjct  299   PVGSLRKAWASLCNAFLVEAKWFASGHVPKAEEYLKNGAVSSGVHVVLVHLFFLLGHGIT  358

Query  570   AGTTDIED----MITSVGAILRLLDDLDATQGEKQDGNDASYVEYYVKEHEGLSISDGKQ  403
                 D+ D    +I+S   ILRL DDL + + E QDG+D SYVE Y+KEH G S+ + +Q
Sbjct  359   KENVDLVDDFPGIISSTATILRLWDDLGSAKDENQDGHDGSYVECYLKEHRGSSVENARQ  418

Query  402   RIMNMVSEQWKLINKQCLSPTRIPESFSKSCLNIARMVPMMYNYSDTHCLPILQKQIMSM  223
              + +M+S+ WK +NK+CLSP     SF+K  LNIARMVP+MY+Y D  CLP L++ + S+
Sbjct  419   IVAHMISDMWKRLNKECLSPNPFSTSFTKGSLNIARMVPLMYSYDDQQCLPGLEEHMKSL  478

Query  222   F  220
              
Sbjct  479   L  479



>emb|CAN83267.1| hypothetical protein VITISV_023827 [Vitis vinifera]
Length=481

 Score =   506 bits (1303),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 237/478 (50%), Positives = 335/478 (70%), Gaps = 9/478 (2%)
 Frame = -2

Query  1629  VIDAIQHLGIDHHFHDQIGAILQRQYQKVK-IDDFQKINGLYDISLSFRLLRQEGYNVSS  1453
             +IDAIQ LGID+HFH +I  +LQR + K   + D    N LY+++L FRLLRQEGY VS+
Sbjct  1     MIDAIQRLGIDYHFHGEIEVVLQRLHTKFNTVSDCH--NNLYELALGFRLLRQEGYYVSA  58

Query  1452  DVFTKFTSEKGEFKEELSKDIRGLMALHEASHLSIEGEDVLDEAAKFSRESLIANMVHLD  1273
             DVF      +G+ +E+LS+DI+GLM L+EAS L I+GED+L+E   FS + L A   H D
Sbjct  59    DVFNNLKDTEGKJQEKLSEDIKGLMGLYEASQLCIKGEDILEEIGNFSSQLLNAWNTHND  118

Query  1272  ECQASMVQNTLQYPYHKSLARFTAKTFIENMRVENEWEATLVNLATMDYSITQSFYQEEF  1093
               QA +V+NTL +P+HKSLA F AK+F+ + +  + W      LA MD+++ +S +Q+E 
Sbjct  119   HSQARIVRNTLGHPHHKSLAXFMAKSFLSDFQGTDGWVNVFRELAKMDFNVVKSIHQKEM  178

Query  1092  RQILRWWKSLGLKDEL--AKNQQLKWYIWTLALIPDPSMSRERIELTKPIALVYLIDDII  919
              Q+ +WWK LGL  EL  A+NQ LKWY+W LA++PDPS+S +R+ELTKPI+LVY+IDDI 
Sbjct  179   LQVSKWWKDLGLAKELKFARNQPLKWYMWPLAVLPDPSLSEQRVELTKPISLVYIIDDIF  238

Query  918   DVYATFDQTKQFIDAINRWDLSVGEGLPDYMKRCLVVLFDTTNDINNLVFEKYGWNPIDH  739
             DV+ T D+   F +A+NRW+ +  E LPDYMK C   L   TN+I++ V+  +GWNP++ 
Sbjct  239   DVHGTLDELTLFTEAVNRWEYAAVEQLPDYMKICFNALNGITNEISSKVYNDHGWNPMES  298

Query  738   LKRAWKCLCSAYITEAKWFATGKSPSANEYLQTGIITTGIPMVLITCFFLLGHGAFAGTT  559
             L++AW CLC+A++ EAKWFA G  P A+EYL+ G+I++G+ +VL+  FFLLGHG      
Sbjct  299   LRKAWACLCNAFLVEAKWFADGHVPKADEYLKNGVISSGVHVVLVHMFFLLGHGITKRNV  358

Query  558   DIED----MITSVGAILRLLDDLDATQGEKQDGNDASYVEYYVKEHEGLSISDGKQRIMN  391
             DI D    +I+SV  ILRL DDL + + E QDG+D SY+E Y+KE  G SI + +  +M+
Sbjct  359   DIVDDFPEIISSVAKILRLWDDLGSAKDENQDGHDGSYLECYMKEKPGTSIENARCHVMH  418

Query  390   MVSEQWKLINKQCLSPTRIPESFSKSCLNIARMVPMMYNYSDTHCLPILQKQIMSMFS  217
              +SE WK +NK+CL+P      F+K+CLN+ARMVP+MY+Y D  CLP L++ + S+ +
Sbjct  419   TISETWKRLNKECLAPNPFSTCFTKACLNVARMVPLMYSYDDNQCLPSLEEHMRSLVN  476



>ref|XP_010646706.1| PREDICTED: (3S,6E)-nerolidol synthase 1-like isoform X3 [Vitis 
vinifera]
Length=532

 Score =   504 bits (1298),  Expect = 5e-168, Method: Compositional matrix adjust.
 Identities = 247/507 (49%), Positives = 347/507 (68%), Gaps = 9/507 (2%)
 Frame = -2

Query  1722  KDEFLLKSEGKREWQRGLLYQFQEDDLQVLNVIDAIQHLGIDHHFHDQIGAILQRQYQKV  1543
             KDEF  +   K +  + +  +  ED ++ + +IDAIQ LGIDHHF ++I A+LQ+QY K 
Sbjct  15    KDEFYNEHAQKLKEVKHVFSKLGEDAMESMMMIDAIQRLGIDHHFEEEIEAVLQKQYMKS  74

Query  1542  KIDDFQKINGLYDISLSFRLLRQEGYNVSSDVFTKFTSEKGEFKEELSKDIRGLMALHEA  1363
              I        LY+++L FRLLRQEGY + +DV   F +++G+FK+ L +DIRGLM L+EA
Sbjct  75    SIHG-DCDEDLYEVALRFRLLRQEGYTLPADVLNNFKNKEGKFKQNLREDIRGLMGLYEA  133

Query  1362  SHLSIEGEDVLDEAAKFSRESLIANMVHLDECQASMVQNTLQYPYHKSLARFTAKTFIEN  1183
             S LSI GED+L+EA  FS   L A + HLD  QA++V+NTL++P+HKSLARF  K F+ +
Sbjct  134   SQLSI-GEDILEEAGNFSSLLLNACLQHLDRHQAAVVKNTLEHPHHKSLARFMTKNFLTD  192

Query  1182  MRVENEWEATLVNLATMDYSITQSFYQEEFRQILRWWKSLGLKDEL--AKNQQLKWYIWT  1009
              +  N W   L  LA +D+++ +S +Q+E  QI +WWK LGL +EL  A++Q LKWY+W 
Sbjct  193   FQGTNGWINALQELANIDFNMVKSVHQKEMLQISKWWKDLGLTEELKFARDQPLKWYMWP  252

Query  1008  LALIPDPSMSRERIELTKPIALVYLIDDIIDVYATFDQTKQFIDAINRWDLSVGEGLPDY  829
             +A+IPDP +S +RIELTKPI+L+Y+IDDI DV  T D+   F +A+NRWDLS  + LP+Y
Sbjct  253   MAIIPDPRLSEQRIELTKPISLIYIIDDIFDVGGTLDELTLFTEAVNRWDLSAFKELPEY  312

Query  828   MKRCLVVLFDTTNDINNLVFEKYGWNPIDHLKRAWKCLCSAYITEAKWFATGKSPSANEY  649
             MK C   L D TN+I+  V  K   NP+  L++AW  LC+A++ EAKWFA+G  P A EY
Sbjct  313   MKMCFKTLDDITNEISTKV-HKVHKNPVGSLRKAWASLCNAFLVEAKWFASGHVPKAEEY  371

Query  648   LQTGIITTGIPMVLITCFFLLGHGAFAGTTDIED----MITSVGAILRLLDDLDATQGEK  481
             L+ G +++G+ +VL+  FFLLGHG      D+ D    +I+S   ILRL DDL + + E 
Sbjct  372   LKNGAVSSGVHVVLVHLFFLLGHGITKENVDLVDDFPGIISSTATILRLWDDLGSAKDEN  431

Query  480   QDGNDASYVEYYVKEHEGLSISDGKQRIMNMVSEQWKLINKQCLSPTRIPESFSKSCLNI  301
             QDG+D SYVE Y+KEH G S+ + +Q + +M+S+ WK +NK+CLSP     SF+K  LNI
Sbjct  432   QDGHDGSYVECYLKEHRGSSVENARQIVAHMISDMWKRLNKECLSPNPFSTSFTKGSLNI  491

Query  300   ARMVPMMYNYSDTHCLPILQKQIMSMF  220
             ARMVP+MY+Y D  CLP L++ + S+ 
Sbjct  492   ARMVPLMYSYDDQQCLPGLEEHMKSLL  518



>emb|CBI41004.3| unnamed protein product [Vitis vinifera]
Length=550

 Score =   503 bits (1295),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 246/506 (49%), Positives = 346/506 (68%), Gaps = 9/506 (2%)
 Frame = -2

Query  1719  DEFLLKSEGKREWQRGLLYQFQEDDLQVLNVIDAIQHLGIDHHFHDQIGAILQRQYQKVK  1540
             DEF  +   K +  + +  +  ED ++ + +IDAIQ LGIDHHF ++I A+LQ+QY K  
Sbjct  34    DEFYNEHAQKLKEVKHVFSKLGEDAMESMMMIDAIQRLGIDHHFEEEIEAVLQKQYMKSS  93

Query  1539  IDDFQKINGLYDISLSFRLLRQEGYNVSSDVFTKFTSEKGEFKEELSKDIRGLMALHEAS  1360
             I        LY+++L FRLLRQEGY + +DV   F +++G+FK+ L +DIRGLM L+EAS
Sbjct  94    IHG-DCDEDLYEVALRFRLLRQEGYTLPADVLNNFKNKEGKFKQNLREDIRGLMGLYEAS  152

Query  1359  HLSIEGEDVLDEAAKFSRESLIANMVHLDECQASMVQNTLQYPYHKSLARFTAKTFIENM  1180
              LSI GED+L+EA  FS   L A + HLD  QA++V+NTL++P+HKSLARF  K F+ + 
Sbjct  153   QLSI-GEDILEEAGNFSSLLLNACLQHLDRHQAAVVKNTLEHPHHKSLARFMTKNFLTDF  211

Query  1179  RVENEWEATLVNLATMDYSITQSFYQEEFRQILRWWKSLGLKDEL--AKNQQLKWYIWTL  1006
             +  N W   L  LA +D+++ +S +Q+E  QI +WWK LGL +EL  A++Q LKWY+W +
Sbjct  212   QGTNGWINALQELANIDFNMVKSVHQKEMLQISKWWKDLGLTEELKFARDQPLKWYMWPM  271

Query  1005  ALIPDPSMSRERIELTKPIALVYLIDDIIDVYATFDQTKQFIDAINRWDLSVGEGLPDYM  826
             A+IPDP +S +RIELTKPI+L+Y+IDDI DV  T D+   F +A+NRWDLS  + LP+YM
Sbjct  272   AIIPDPRLSEQRIELTKPISLIYIIDDIFDVGGTLDELTLFTEAVNRWDLSAFKELPEYM  331

Query  825   KRCLVVLFDTTNDINNLVFEKYGWNPIDHLKRAWKCLCSAYITEAKWFATGKSPSANEYL  646
             K C   L D TN+I+  V  K   NP+  L++AW  LC+A++ EAKWFA+G  P A EYL
Sbjct  332   KMCFKTLDDITNEISTKV-HKVHKNPVGSLRKAWASLCNAFLVEAKWFASGHVPKAEEYL  390

Query  645   QTGIITTGIPMVLITCFFLLGHGAFAGTTDIED----MITSVGAILRLLDDLDATQGEKQ  478
             + G +++G+ +VL+  FFLLGHG      D+ D    +I+S   ILRL DDL + + E Q
Sbjct  391   KNGAVSSGVHVVLVHLFFLLGHGITKENVDLVDDFPGIISSTATILRLWDDLGSAKDENQ  450

Query  477   DGNDASYVEYYVKEHEGLSISDGKQRIMNMVSEQWKLINKQCLSPTRIPESFSKSCLNIA  298
             DG+D SYVE Y+KEH G S+ + +Q + +M+S+ WK +NK+CLSP     SF+K  LNIA
Sbjct  451   DGHDGSYVECYLKEHRGSSVENARQIVAHMISDMWKRLNKECLSPNPFSTSFTKGSLNIA  510

Query  297   RMVPMMYNYSDTHCLPILQKQIMSMF  220
             RMVP+MY+Y D  CLP L++ + S+ 
Sbjct  511   RMVPLMYSYDDQQCLPGLEEHMKSLL  536



>gb|ADD81294.1| linalool synthase [Actinidia arguta]
Length=574

 Score =   504 bits (1297),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 244/522 (47%), Positives = 351/522 (67%), Gaps = 8/522 (2%)
 Frame = -2

Query  1767  NSSSLRSEKMTVTLSKDEFLLKSEGKREWQRGLLYQFQEDDLQVLNVIDAIQHLGIDHHF  1588
             N S   + +    +  DEF LK E K +  R  L + +E  L+ L +ID +Q LGID+HF
Sbjct  50    NPSKQHNHQTGYRIFSDEFYLKHENKLKDVRRALREVEETPLEGLVMIDTLQRLGIDYHF  109

Query  1587  HDQIGAILQRQYQKVKIDDFQKINGLYDISLSFRLLRQEGYNVSSDVFTKFTSEKGEFKE  1408
               +IGA+LQ+Q Q++   D+ + + L+++S  FRLLRQEG+NV +DVF  F  ++G FK 
Sbjct  110   QGEIGALLQKQ-QRISTCDYPE-HDLFEVSTRFRLLRQEGHNVPADVFNNFRDKEGRFKS  167

Query  1407  ELSKDIRGLMALHEASHLSIEGEDVLDEAAKFSRESLIANMVHLDECQASMVQNTLQYPY  1228
             ELS+DIRGLM+L+EAS LSI+GED+LD+AA FS + L     +LD  QA +V+N L +PY
Sbjct  168   ELSRDIRGLMSLYEASQLSIQGEDILDQAADFSSQLLSGWATNLDHHQARLVRNALTHPY  227

Query  1227  HKSLARFTAKTFIENMRVENEWEATLVNLATMDYSITQSFYQEEFRQILRWWKSLGLKDE  1048
             HKSLA F A+ F  + + +N W   L  LA MD ++ QS +Q+E  Q+ +WWK  GL +E
Sbjct  228   HKSLATFMARNFNYDCKGQNGWVNNLQELAKMDLTMVQSMHQKEVLQVSQWWKGRGLANE  287

Query  1047  L--AKNQQLKWYIWTLALIPDPSMSRERIELTKPIALVYLIDDIIDVYATFDQTKQFIDA  874
             L   +NQ LKWY+W +A + DP  S ER+ELTKPI+ +Y+IDDI DVY T ++   F DA
Sbjct  288   LKLVRNQPLKWYMWPMAALTDPRFSEERVELTKPISFIYIIDDIFDVYGTLEELTLFTDA  347

Query  873   INRWDLSVGEGLPDYMKRCLVVLFDTTNDINNLVFEKYGWNPIDHLKRAWKCLCSAYITE  694
             +NRW+L+  E LPDYMK C   L+D TN+I   +++K+G NPID L+R W  LC+A++ E
Sbjct  348   VNRWELTAVEQLPDYMKICFKALYDITNEIAYKIYKKHGRNPIDSLRRTWASLCNAFLEE  407

Query  693   AKWFATGKSPSANEYLQTGIITTGIPMVLITCFFLLGHGAFAGTTDIED----MITSVGA  526
             AKWFA+G  P A EYL+ GII++G+ +V +  FFLLG      + ++ D    + +S+  
Sbjct  408   AKWFASGNLPKAEEYLKNGIISSGMHVVTVHMFFLLGGCFTEESVNLVDEHAGITSSIAT  467

Query  525   ILRLLDDLDATQGEKQDGNDASYVEYYVKEHEGLSISDGKQRIMNMVSEQWKLINKQCLS  346
             ILRL DDL + + E QDG D SY+E Y+K+H+G S+ + ++ ++ M+S+ WK +N++CL 
Sbjct  468   ILRLSDDLGSAKDEDQDGYDGSYLECYLKDHKGSSVENAREEVIRMISDAWKRLNEECLF  527

Query  345   PTRIPESFSKSCLNIARMVPMMYNYSDTHCLPILQKQIMSMF  220
             P     +F K  LNIARMVP+MY+Y D H LPIL++ + +M 
Sbjct  528   PNPFSATFRKGSLNIARMVPLMYSYDDNHNLPILEEHMKTML  569



>emb|CAN66667.1| hypothetical protein VITISV_032494 [Vitis vinifera]
Length=493

 Score =   500 bits (1288),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 239/481 (50%), Positives = 336/481 (70%), Gaps = 8/481 (2%)
 Frame = -2

Query  1644  LQVLNVIDAIQHLGIDHHFHDQIGAILQRQYQKVKIDDFQKINGLYDISLSFRLLRQEGY  1465
             ++ + +IDAIQ LGIDHHF ++I A+LQ+QY K  I        LY+++L FRLLRQEGY
Sbjct  1     MESMMMIDAIQRLGIDHHFEEEIEAVLQKQYMKSSIHG-DCDEDLYEVALRFRLLRQEGY  59

Query  1464  NVSSDVFTKFTSEKGEFKEELSKDIRGLMALHEASHLSIEGEDVLDEAAKFSRESLIANM  1285
              + +DV   F +++G+FK+ L +DIRGLM L+EAS LSI GED+L+EA  FS   L A +
Sbjct  60    TLPADVLNNFKNKEGKFKQNLREDIRGLMGLYEASQLSI-GEDILEEAGNFSSLLLNACL  118

Query  1284  VHLDECQASMVQNTLQYPYHKSLARFTAKTFIENMRVENEWEATLVNLATMDYSITQSFY  1105
              HLD  QA++V+NTL++P+HKSLARF  K F+ + +  N W   L  LA +D+++ +S +
Sbjct  119   QHLDXHQAAVVKNTLEHPHHKSLARFMTKNFLTDFQXTNGWINALQELAKIDFNMVKSVH  178

Query  1104  QEEFRQILRWWKSLGLKDEL--AKNQQLKWYIWTLALIPDPSMSRERIELTKPIALVYLI  931
             Q+E  QI +WWK LGL +EL  A++Q LK Y+W +A+IPDP +S +RIELTKPI+L+Y+I
Sbjct  179   QKEMLQISKWWKDLGLTEELKFARDQPLKXYMWPMAIIPDPRLSEQRIELTKPISLIYII  238

Query  930   DDIIDVYATFDQTKQFIDAINRWDLSVGEGLPDYMKRCLVVLFDTTNDINNLVFEKYGWN  751
             DDI DV  T D+   F +A+NRWDLS  + LP+YMK C   L D TN+I+  V + + WN
Sbjct  239   DDIFDVGGTLDELTLFTEAVNRWDLSAFKELPEYMKMCFKXLDDITNEISTKVHKXHKWN  298

Query  750   PIDHLKRAWKCLCSAYITEAKWFATGKSPSANEYLQTGIITTGIPMVLITCFFLLGHGAF  571
             P+  L++AW  LC+A++ EAKWFA+G  P A EYL+ G +++G+ +VL+  FFLLGHG  
Sbjct  299   PVGSLRKAWASLCNAFLVEAKWFASGHVPKAEEYLKNGAVSSGVHVVLVHLFFLLGHGIT  358

Query  570   AGTTDIED----MITSVGAILRLLDDLDATQGEKQDGNDASYVEYYVKEHEGLSISDGKQ  403
                 D+ D    +I+S   ILRL DDL + + E QDG+D SYVE Y+KEH G S+ + +Q
Sbjct  359   KENVDLVDDFPGIISSTATILRLWDDLGSAKDENQDGHDGSYVECYLKEHRGSSVENARQ  418

Query  402   RIMNMVSEQWKLINKQCLSPTRIPESFSKSCLNIARMVPMMYNYSDTHCLPILQKQIMSM  223
              + +M+S+ WK +NK+CLSP     SF+K  LNIARMVP+MY+Y D  CLP L++ + S+
Sbjct  419   IVAHMISDMWKRLNKECLSPNPFSTSFTKGSLNIARMVPLMYSYDDQQCLPGLEEHMKSL  478

Query  222   F  220
              
Sbjct  479   L  479



>ref|NP_001267928.1| (3S,6E)-nerolidol synthase 1, chloroplastic-like [Vitis vinifera]
 gb|ADR74210.1| (3S)-linalool/(E)-nerolidol synthase [Vitis vinifera]
Length=584

 Score =   504 bits (1297),  Expect = 4e-167, Method: Compositional matrix adjust.
 Identities = 244/506 (48%), Positives = 346/506 (68%), Gaps = 8/506 (2%)
 Frame = -2

Query  1719  DEFLLKSEGKREWQRGLLYQFQEDDLQVLNVIDAIQHLGIDHHFHDQIGAILQRQYQKVK  1540
             DEF  +   K +  + +  +  ED ++ + +IDAIQ LGIDHHF ++I A+LQ+QY K  
Sbjct  67    DEFYNEHAQKLKEVKHVFSKLGEDAMESMMMIDAIQRLGIDHHFEEEIEAVLQKQYMKSS  126

Query  1539  IDDFQKINGLYDISLSFRLLRQEGYNVSSDVFTKFTSEKGEFKEELSKDIRGLMALHEAS  1360
             I        LY+++L FRLLRQEGY   +DV   F +++G+FK+ L +DIRGLM L+EAS
Sbjct  127   IHG-DCDEDLYEVALRFRLLRQEGYTXPADVLNNFKNKEGKFKQNLREDIRGLMGLYEAS  185

Query  1359  HLSIEGEDVLDEAAKFSRESLIANMVHLDECQASMVQNTLQYPYHKSLARFTAKTFIENM  1180
              LSI GED+L+EA  FS   L A + HLD  QA++V+NTL++P+HKS ARF  K F+ + 
Sbjct  186   QLSI-GEDILEEAGNFSSLLLNACLQHLDXHQAAVVKNTLEHPHHKSXARFMTKNFLTDF  244

Query  1179  RVENEWEATLVNLATMDYSITQSFYQEEFRQILRWWKSLGLKDEL--AKNQQLKWYIWTL  1006
             +  N W   L  LA +D+++ +S +Q+E  QI +WWK LGL +EL  A++Q LK Y+W +
Sbjct  245   QXTNGWINALQELAKIDFNMVKSVHQKEMLQISKWWKDLGLTEELKFARDQPLKXYMWPM  304

Query  1005  ALIPDPSMSRERIELTKPIALVYLIDDIIDVYATFDQTKQFIDAINRWDLSVGEGLPDYM  826
             A+IPDP +S +RIELTKPI+L+Y+IDDI DV  T D+   F +A+NRWDLS  + LP+YM
Sbjct  305   AIIPDPRLSEQRIELTKPISLIYIIDDIFDVGGTLDELTLFTEAVNRWDLSAFKELPEYM  364

Query  825   KRCLVVLFDTTNDINNLVFEKYGWNPIDHLKRAWKCLCSAYITEAKWFATGKSPSANEYL  646
             K C   L D TN+I+  V +++ WNP+  L++AW  LC+A++ EAKWFA+G  P A EYL
Sbjct  365   KMCFKXLDDITNEISTKVHKEHKWNPVGSLRKAWASLCNAFLVEAKWFASGHVPKAEEYL  424

Query  645   QTGIITTGIPMVLITCFFLLGHGAFAGTTDIED----MITSVGAILRLLDDLDATQGEKQ  478
             + G +++G+ +VL+  FFLLGHG      D+ D    +I+S   ILRL DDL + + E Q
Sbjct  425   KNGAVSSGVHVVLVHLFFLLGHGITKENVDLVDDFPGIISSTATILRLWDDLGSAKDENQ  484

Query  477   DGNDASYVEYYVKEHEGLSISDGKQRIMNMVSEQWKLINKQCLSPTRIPESFSKSCLNIA  298
             DG+D SYVE Y+KEH G S+ + +Q + +M+S+ WK +NK+CLSP     SF+K  LNIA
Sbjct  485   DGHDGSYVECYLKEHRGSSVENARQIVAHMISDMWKRLNKECLSPNPFSTSFTKGSLNIA  544

Query  297   RMVPMMYNYSDTHCLPILQKQIMSMF  220
             RMVP+MY+Y D  CLP L++ + S+ 
Sbjct  545   RMVPLMYSYDDQQCLPGLEEHMKSLL  570



>ref|XP_003635177.1| PREDICTED: (3S,6E)-nerolidol synthase 1-like isoform X1 [Vitis 
vinifera]
Length=583

 Score =   502 bits (1293),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 246/506 (49%), Positives = 346/506 (68%), Gaps = 9/506 (2%)
 Frame = -2

Query  1719  DEFLLKSEGKREWQRGLLYQFQEDDLQVLNVIDAIQHLGIDHHFHDQIGAILQRQYQKVK  1540
             DEF  +   K +  + +  +  ED ++ + +IDAIQ LGIDHHF ++I A+LQ+QY K  
Sbjct  67    DEFYNEHAQKLKEVKHVFSKLGEDAMESMMMIDAIQRLGIDHHFEEEIEAVLQKQYMKSS  126

Query  1539  IDDFQKINGLYDISLSFRLLRQEGYNVSSDVFTKFTSEKGEFKEELSKDIRGLMALHEAS  1360
             I        LY+++L FRLLRQEGY + +DV   F +++G+FK+ L +DIRGLM L+EAS
Sbjct  127   IHG-DCDEDLYEVALRFRLLRQEGYTLPADVLNNFKNKEGKFKQNLREDIRGLMGLYEAS  185

Query  1359  HLSIEGEDVLDEAAKFSRESLIANMVHLDECQASMVQNTLQYPYHKSLARFTAKTFIENM  1180
              LSI GED+L+EA  FS   L A + HLD  QA++V+NTL++P+HKSLARF  K F+ + 
Sbjct  186   QLSI-GEDILEEAGNFSSLLLNACLQHLDRHQAAVVKNTLEHPHHKSLARFMTKNFLTDF  244

Query  1179  RVENEWEATLVNLATMDYSITQSFYQEEFRQILRWWKSLGLKDEL--AKNQQLKWYIWTL  1006
             +  N W   L  LA +D+++ +S +Q+E  QI +WWK LGL +EL  A++Q LKWY+W +
Sbjct  245   QGTNGWINALQELANIDFNMVKSVHQKEMLQISKWWKDLGLTEELKFARDQPLKWYMWPM  304

Query  1005  ALIPDPSMSRERIELTKPIALVYLIDDIIDVYATFDQTKQFIDAINRWDLSVGEGLPDYM  826
             A+IPDP +S +RIELTKPI+L+Y+IDDI DV  T D+   F +A+NRWDLS  + LP+YM
Sbjct  305   AIIPDPRLSEQRIELTKPISLIYIIDDIFDVGGTLDELTLFTEAVNRWDLSAFKELPEYM  364

Query  825   KRCLVVLFDTTNDINNLVFEKYGWNPIDHLKRAWKCLCSAYITEAKWFATGKSPSANEYL  646
             K C   L D TN+I+  V  K   NP+  L++AW  LC+A++ EAKWFA+G  P A EYL
Sbjct  365   KMCFKTLDDITNEISTKV-HKVHKNPVGSLRKAWASLCNAFLVEAKWFASGHVPKAEEYL  423

Query  645   QTGIITTGIPMVLITCFFLLGHGAFAGTTDIED----MITSVGAILRLLDDLDATQGEKQ  478
             + G +++G+ +VL+  FFLLGHG      D+ D    +I+S   ILRL DDL + + E Q
Sbjct  424   KNGAVSSGVHVVLVHLFFLLGHGITKENVDLVDDFPGIISSTATILRLWDDLGSAKDENQ  483

Query  477   DGNDASYVEYYVKEHEGLSISDGKQRIMNMVSEQWKLINKQCLSPTRIPESFSKSCLNIA  298
             DG+D SYVE Y+KEH G S+ + +Q + +M+S+ WK +NK+CLSP     SF+K  LNIA
Sbjct  484   DGHDGSYVECYLKEHRGSSVENARQIVAHMISDMWKRLNKECLSPNPFSTSFTKGSLNIA  543

Query  297   RMVPMMYNYSDTHCLPILQKQIMSMF  220
             RMVP+MY+Y D  CLP L++ + S+ 
Sbjct  544   RMVPLMYSYDDQQCLPGLEEHMKSLL  569



>gb|KDP20831.1| hypothetical protein JCGZ_21302 [Jatropha curcas]
Length=564

 Score =   501 bits (1291),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 241/512 (47%), Positives = 356/512 (70%), Gaps = 13/512 (3%)
 Frame = -2

Query  1731  TLSKDEFLLKSEGKR--EWQRGLLYQFQEDDLQVLNVIDAIQHLGIDHHFHDQIGAILQR  1558
              LS+D+  +K  G+R   +++ L     ED ++ L +IDAIQ LGI+++F ++I AIL+R
Sbjct  53    VLSQDDICVKHHGERLRAFKQTLAKTSCEDAVEGLVMIDAIQRLGIEYNFQEEIDAILKR  112

Query  1557  QYQKVKIDDFQKINGLYDISLSFRLLRQEGYNVSSDVFTKFTSEKGEFKEELSKDIRGLM  1378
             QY     +D+     L++ +L FRLLRQEGY+V   VF  F  E G+FK+EL+ DI+GLM
Sbjct  113   QYLIPTTNDYD----LHETALRFRLLRQEGYHVLPGVFNNFKDE-GKFKKELTDDIKGLM  167

Query  1377  ALHEASHLSIEGEDVLDEAAKFSRESLIANMVHLDECQASMVQNTLQYPYHKSLARFTAK  1198
              L+EAS LSI GED+LDEAA +S   L ++  HLD+ QA +V+NTLQYP+HKSL+RF AK
Sbjct  168   GLYEASQLSIVGEDILDEAADYSHRLLNSSTTHLDDTQARIVKNTLQYPHHKSLSRFMAK  227

Query  1197  TFIENMRVENEWEATLVNLATMDYSITQSFYQEEFRQILRWWKSLGLKDEL--AKNQQLK  1024
              FI + +  N W   L  LA +D  + QS +Q+E  +I RWWK +GL  EL  A+NQ LK
Sbjct  228   NFIRDFQRPNGWMNELQELAKIDMKMVQSQHQQEILKISRWWKEVGLSKELKFARNQPLK  287

Query  1023  WYIWTLALIPDPSMSRERIELTKPIALVYLIDDIIDVYATFDQTKQFIDAINRWDLSVGE  844
             WY+ ++  + DPS+S +R++LTKPI+ ++LIDDI DVY T D+   F D INRWD++  E
Sbjct  288   WYMCSMETLADPSLSEQRVDLTKPISFIFLIDDIFDVYGTLDELILFTDVINRWDIAAAE  347

Query  843   GLPDYMKRCLVVLFDTTNDINNLVFEKYGWNPIDHLKRAWKCLCSAYITEAKWFATGKSP  664
              LPD+M+ C + L + T++I++ V+++ GWNP+D L++ W  LC+A++ EAKWF +G+ P
Sbjct  348   QLPDHMRICFMALDNITDEISHKVYKQLGWNPVDSLRKTWASLCNAFLVEAKWFGSGQLP  407

Query  663   SANEYLQTGIITTGIPMVLITCFFLLGHGAFAGTTDIED----MITSVGAILRLLDDLDA  496
             +A EYL+ GII++G+ +VL+  FFLLGHG      ++ D    +++S  AILRL DDL +
Sbjct  408   NAEEYLKNGIISSGVHVVLVHIFFLLGHGVTKENVELIDNHPPIMSSTAAILRLWDDLGS  467

Query  495   TQGEKQDGNDASYVEYYVKEHEGLSISDGKQRIMNMVSEQWKLINKQCLSPTRIPESFSK  316
              + E QDG+D SYVE Y+KE++G S+   ++++ +M+S  WK +N++CLSPT    +F+K
Sbjct  468   AKDEDQDGHDGSYVECYMKEYKGCSVESVRKKVNDMISNAWKQLNQECLSPTPFSSTFNK  527

Query  315   SCLNIARMVPMMYNYSDTHCLPILQKQIMSMF  220
             +CLN+ARMVP+MY Y D   LP+L+  + S+ 
Sbjct  528   ACLNLARMVPLMYGYDDCQNLPLLESHVKSIL  559



>emb|CAN64072.1| hypothetical protein VITISV_038269 [Vitis vinifera]
Length=481

 Score =   498 bits (1283),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 234/476 (49%), Positives = 330/476 (69%), Gaps = 9/476 (2%)
 Frame = -2

Query  1629  VIDAIQHLGIDHHFHDQIGAILQRQYQKVK-IDDFQKINGLYDISLSFRLLRQEGYNVSS  1453
             +IDAIQ LGID+HFH +I  +LQR + K   + D    N LY+++  FRLLRQEGY VS+
Sbjct  1     MIDAIQRLGIDYHFHGEIEVVLQRLHTKFNTLSDCH--NNLYELAXGFRLLRQEGYXVSA  58

Query  1452  DVFTKFTSEKGEFKEELSKDIRGLMALHEASHLSIEGEDVLDEAAKFSRESLIANMVHLD  1273
             DVF      +G+ +E+LS+DI+GLM L+EAS L I+GED+L+E   FS + L     H D
Sbjct  59    DVFNNLKDTEGKJQEKLSEDIKGLMGLYEASQLCIKGEDILEEIGNFSSQLLNXWNTHND  118

Query  1272  ECQASMVQNTLQYPYHKSLARFTAKTFIENMRVENEWEATLVNLATMDYSITQSFYQEEF  1093
               QA +V+NTL +P+HKSLA F AK+F+ + +  + W      LA MD+++ +S +Q+E 
Sbjct  119   HSQARIVRNTLGHPHHKSLAXFMAKSFLSDFQGTDGWVNVFRELAKMDFNVVKSIHQKEM  178

Query  1092  RQILRWWKSLGLKDEL--AKNQQLKWYIWTLALIPDPSMSRERIELTKPIALVYLIDDII  919
              Q  +WWK LGL  EL  A+NQ LKWY+W LA++PDPS+S +R+ELTKPI+LVY+IDDI 
Sbjct  179   LQXSKWWKDLGLAKELKFARNQPLKWYMWPLAVLPDPSLSEQRVELTKPISLVYIIDDIF  238

Query  918   DVYATFDQTKQFIDAINRWDLSVGEGLPDYMKRCLVVLFDTTNDINNLVFEKYGWNPIDH  739
             DV+ T D+   F +A+NRW+ +  E LPDYMK C   L   TN+I++ V+  +GWNP++ 
Sbjct  239   DVHGTLDELTLFTEAVNRWEYAAVEQLPDYMKICFNALNGITNEISSKVYNDHGWNPMES  298

Query  738   LKRAWKCLCSAYITEAKWFATGKSPSANEYLQTGIITTGIPMVLITCFFLLGHGAFAGTT  559
             L++AW CLC+A++ EAKWFA G  P A+EYL+ G+I++G+ +VL+  FFLLGHG      
Sbjct  299   LRKAWACLCNAFLVEAKWFADGHVPKADEYLKNGVISSGVHVVLVHMFFLLGHGITKRNV  358

Query  558   DIED----MITSVGAILRLLDDLDATQGEKQDGNDASYVEYYVKEHEGLSISDGKQRIMN  391
             DI D    +I+SV  ILRL DDL + + E QDG+D SY+E Y+KE  G SI + +  +M+
Sbjct  359   DIVDDFPEIISSVAKILRLWDDLGSAKDENQDGHDGSYLECYMKEKPGTSIENARCHVMH  418

Query  390   MVSEQWKLINKQCLSPTRIPESFSKSCLNIARMVPMMYNYSDTHCLPILQKQIMSM  223
              +SE WK +N +CL+P      F+K+CLN+ARMVP+MY+Y D  CLP L++ + S+
Sbjct  419   TISETWKSLNNECLAPNPFSTCFTKACLNVARMVPLMYSYDDNRCLPSLEEHMKSL  474



>gb|KDP20833.1| hypothetical protein JCGZ_21304 [Jatropha curcas]
Length=581

 Score =   501 bits (1291),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 240/512 (47%), Positives = 355/512 (69%), Gaps = 13/512 (3%)
 Frame = -2

Query  1731  TLSKDEFLLKSEGKR--EWQRGLLYQFQEDDLQVLNVIDAIQHLGIDHHFHDQIGAILQR  1558
              LS+D+  +K  G+R   +++ L     ED  + L +IDAIQ LGI+ +F ++I AIL+R
Sbjct  70    VLSQDDICVKHHGERLRAFKQTLAKTSCEDAFEGLVMIDAIQRLGIECNFQEEIDAILKR  129

Query  1557  QYQKVKIDDFQKINGLYDISLSFRLLRQEGYNVSSDVFTKFTSEKGEFKEELSKDIRGLM  1378
             QY     +D+     L++ +L FRLLRQEGY+V   VF  F  E G+FK+EL+ DI+GLM
Sbjct  130   QYLIPTTNDYD----LHETALRFRLLRQEGYHVLPGVFNNFKDE-GKFKKELTDDIKGLM  184

Query  1377  ALHEASHLSIEGEDVLDEAAKFSRESLIANMVHLDECQASMVQNTLQYPYHKSLARFTAK  1198
              L EAS LSI GED+LDEA+ +S   L ++  HLD+ QA +V+NTLQYP+HKSL+RF AK
Sbjct  185   GLFEASQLSIVGEDILDEASDYSHRLLNSSTTHLDDTQARIVKNTLQYPHHKSLSRFMAK  244

Query  1197  TFIENMRVENEWEATLVNLATMDYSITQSFYQEEFRQILRWWKSLGLKDEL--AKNQQLK  1024
              FI + +  N W   L  LA +D  + QS +++E  +I RWWK +GL  EL  A+NQ LK
Sbjct  245   NFIRDFQRSNGWMNELQELAKIDIKMVQSQHKQEILKISRWWKDVGLSKELKFARNQPLK  304

Query  1023  WYIWTLALIPDPSMSRERIELTKPIALVYLIDDIIDVYATFDQTKQFIDAINRWDLSVGE  844
             W++W++A + DPS+S +R++LTKPI+ +YLIDDI DVY T D+   F + INRWD++  E
Sbjct  305   WHMWSMATLADPSLSEQRVDLTKPISFIYLIDDIFDVYGTLDELILFTEVINRWDIAAAE  364

Query  843   GLPDYMKRCLVVLFDTTNDINNLVFEKYGWNPIDHLKRAWKCLCSAYITEAKWFATGKSP  664
              LPD+M+ C + L + T++I++ V+++ GWNP+D L++ W  LC+A++ EAKWF +G+ P
Sbjct  365   QLPDHMRICFMALDNITDEISHKVYKQLGWNPVDSLRKTWASLCNAFLVEAKWFGSGQLP  424

Query  663   SANEYLQTGIITTGIPMVLITCFFLLGHGAFAGTTDIED----MITSVGAILRLLDDLDA  496
             +A EYL  GII++G+ +VL+  FFLLGHG      ++ D    +++S  AILRL DDL +
Sbjct  425   NAEEYLNNGIISSGVHVVLVHIFFLLGHGVTKENVELIDNHPPIMSSTAAILRLWDDLGS  484

Query  495   TQGEKQDGNDASYVEYYVKEHEGLSISDGKQRIMNMVSEQWKLINKQCLSPTRIPESFSK  316
              + E QDG+D SYVE Y+KE++G S+   ++++ +M+S  WK +N++CLSP R   +F+K
Sbjct  485   AKDEDQDGHDGSYVECYMKEYKGCSVESVRKKVKDMISNAWKQLNQECLSPNRFSSTFNK  544

Query  315   SCLNIARMVPMMYNYSDTHCLPILQKQIMSMF  220
             +CLN+ARMVP+MY+Y D   LP+L+  + S+ 
Sbjct  545   ACLNLARMVPLMYDYDDCQQLPLLESHVKSIL  576



>gb|AER36088.1| nerolidol synthase [Actinidia chinensis]
Length=573

 Score =   497 bits (1280),  Expect = 9e-165, Method: Compositional matrix adjust.
 Identities = 249/508 (49%), Positives = 339/508 (67%), Gaps = 10/508 (2%)
 Frame = -2

Query  1719  DEFLLKSEGKREWQRGLLYQFQEDDLQVLNVIDAIQHLGIDHHFHDQIGAILQRQYQKVK  1540
             DE  +K E K E  R  L + +E+ L+ L +IDA+Q LGID+HF  +IGA LQ+Q     
Sbjct  61    DELYVKYEEKLEDVRKALREVEENPLEGLVMIDALQRLGIDYHFRGEIGAFLQKQQIISS  120

Query  1539  IDDFQKINGLYDISLSFRLLRQEGYNVSSDVFTKFTSEKGEFKEELSKDIRGLMALHEAS  1360
               D    +GLY++S  FR LRQEG+NV++DVF  F  ++G F+ ELS DIRGLM+L+EAS
Sbjct  121   TPDGYPEHGLYEVSTLFRFLRQEGHNVTADVFNNFKDKEGRFRSELSTDIRGLMSLYEAS  180

Query  1359  HLSIEGEDVLDEAAKFSRESLIANMVHLDECQASMVQNTLQYPYHKSLARFTA-KTFIEN  1183
              L IEGED+LD+AA FS + L       +  +A +V NTL +PYHKSLA F   K    N
Sbjct  181   QLRIEGEDILDQAADFSSQLLGRWTKDPNHHEARLVSNTLTHPYHKSLATFMGQKLSYMN  240

Query  1182  MRVENEWEA--TLVNLATMDYSITQSFYQEEFRQILRWWKSLGLKDEL--AKNQQLKWYI  1015
              +  N W+    L  LA MD +I QS +Q+E  Q+ +WWK  GL +EL  A+NQ LKWY+
Sbjct  241   CKGPN-WDGVDNLQELAKMDLTIVQSIHQKEVFQVSQWWKDTGLANELKLARNQPLKWYM  299

Query  1014  WTLALIPDPSMSRERIELTKPIALVYLIDDIIDVYATFDQTKQFIDAINRWDLSVGEGLP  835
             W +A + DP  S ER+ELTKPI+ +Y+IDDI DVY T ++   F DA+NRW+LS  E LP
Sbjct  300   WPMAALTDPRFSEERVELTKPISFIYIIDDIFDVYGTIEELTLFTDAVNRWELSAVEQLP  359

Query  834   DYMKRCLVVLFDTTNDINNLVFEKYGWNPIDHLKRAWKCLCSAYITEAKWFATGKSPSAN  655
             DYMK C   L+D TN+I   +++K+G NPID L++ W  LC+A++ EAKWFA+G  P+A 
Sbjct  360   DYMKVCFKALYDVTNEIAYKIYKKHGQNPIDSLQKTWASLCNAFLVEAKWFASGHLPNAE  419

Query  654   EYLQTGIITTGIPMVLITCFFLLGHGAFAGTTDIED----MITSVGAILRLLDDLDATQG  487
             EYL+ GII++G+ +VL   FFLLG G    + D+ D    + TS+  ILRL DDL + + 
Sbjct  420   EYLKNGIISSGVHVVLAHMFFLLGDGITQESVDLVDDYPGISTSIATILRLSDDLGSAKD  479

Query  486   EKQDGNDASYVEYYVKEHEGLSISDGKQRIMNMVSEQWKLINKQCLSPTRIPESFSKSCL  307
             E QDG D SY+E Y+KEH+G S+   ++ ++ M+SE WK +NK+CLSP    ESF    L
Sbjct  480   EDQDGYDGSYIECYMKEHKGSSVDSAREEVIRMISEAWKCLNKECLSPNPFSESFRIGSL  539

Query  306   NIARMVPMMYNYSDTHCLPILQKQIMSM  223
             N+ARM+PMMY+Y D H LPIL++ + +M
Sbjct  540   NMARMIPMMYSYDDNHNLPILEEHMKAM  567



>gb|AGX26045.1| bifunctional terpenoid synthase [Camellia sinensis]
Length=575

 Score =   492 bits (1267),  Expect = 7e-163, Method: Compositional matrix adjust.
 Identities = 242/524 (46%), Positives = 345/524 (66%), Gaps = 9/524 (2%)
 Frame = -2

Query  1770  VNSSSLRSEKMTVTLS-KDEFLLKSEGKREWQRGLLYQFQEDDLQVLNVIDAIQHLGIDH  1594
             V++ S++ + +T   S  D+F +K E K +  + +L +  E+ L+ L +ID +Q LGID+
Sbjct  49    VSNPSIQKDYLTGYRSLTDDFCVKHEQKLKEAKRMLRKVGENPLEGLVMIDNLQRLGIDY  108

Query  1593  HFHDQIGAILQRQYQKVKIDDFQKINGLYDISLSFRLLRQEGYNVSSDVFTKFTSEKGEF  1414
             HF ++I A+LQ QY K           LY++S  FRLLRQEGYNV +DVF  F ++ G+F
Sbjct  109   HFQEEIEALLQSQYTKSNATTLGY--DLYEVSTRFRLLRQEGYNVPADVFNNFKAKNGKF  166

Query  1413  KEELSKDIRGLMALHEASHLSIEGEDVLDEAAKFSRESLIANMVHLDECQASMVQNTLQY  1234
             K EL+ D+RGLM+L+EAS LSIEGED+LD+AA FS + L   M HL   QA +V NTL  
Sbjct  167   KPELNADMRGLMSLYEASQLSIEGEDILDQAADFSTQVLNGLMPHLSHHQARVVSNTLGN  226

Query  1233  PYHKSLARFTAKTFIENMRVENEWEATLVNLATMDYSITQSFYQEEFRQILRWWKSLGLK  1054
             P+HKSLARF A+ F+ +    +EWE  L  LA MD+++ Q  +Q+E  Q+ +WWK  GL 
Sbjct  227   PHHKSLARFMARDFLSDYTNPSEWENVLQELAKMDFNMVQFTHQKEILQVSKWWKDTGLA  286

Query  1053  DEL--AKNQQLKWYIWTLALIPDPSMSRERIELTKPIALVYLIDDIIDVYATFDQTKQFI  880
              EL  A++Q LKWY+W +A + DP  S +R+ELTKPI+ +YLIDDI DVY T ++   F 
Sbjct  287   SELKFARDQPLKWYMWPMAALTDPRFSEQRVELTKPISFIYLIDDIFDVYGTLEELTLFT  346

Query  879   DAINRWDLSVGEGLPDYMKRCLVVLFDTTNDINNLVFEKYGWNPIDHLKRAWKCLCSAYI  700
             + +NRW+L   E LP+YMK C   L D TN I   V+ ++GWN ID L+R W  LC+A++
Sbjct  347   EVVNRWELGAVEQLPEYMKICFKALDDITNHIAYKVYREHGWNSIDSLRRTWASLCNAFL  406

Query  699   TEAKWFATGKSPSANEYLQTGIITTGIPMVLITCFFLLGHGAFAGTTDIED----MITSV  532
              EAKWF +G  P   EYL+ G+I++G+ +VL   FFLLGH       ++ +    ++TS 
Sbjct  407   VEAKWFDSGHLPKPEEYLKNGVISSGVHVVLAHMFFLLGHNITKQNVNLVNDNPGIVTST  466

Query  531   GAILRLLDDLDATQGEKQDGNDASYVEYYVKEHEGLSISDGKQRIMNMVSEQWKLINKQC  352
               ILRL DDL + + E QDG D SYV+ Y+KE+   S+   ++++++M+S+ WK +NK+C
Sbjct  467   ATILRLFDDLGSAKDENQDGKDGSYVQCYMKENNCSSVDTARKQVIHMISQAWKSLNKEC  526

Query  351   LSPTRIPESFSKSCLNIARMVPMMYNYSDTHCLPILQKQIMSMF  220
             LSP      F+K  LNIARMVP+MY+Y D   LP+L++ + SMF
Sbjct  527   LSPNPFSPVFTKGSLNIARMVPLMYSYDDKQNLPVLEEYMKSMF  570



>ref|XP_007213872.1| hypothetical protein PRUPE_ppa003380mg [Prunus persica]
 gb|EMJ15071.1| hypothetical protein PRUPE_ppa003380mg [Prunus persica]
Length=579

 Score =   492 bits (1267),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 238/517 (46%), Positives = 345/517 (67%), Gaps = 11/517 (2%)
 Frame = -2

Query  1737  TVTLSKDEFLLKSEGKREWQRGLLYQFQEDDLQVLNVIDAIQHLGIDHHFHDQIGAILQR  1558
             T+T   D+       K +  R +L +  E+ ++ LN+IDA+Q LGIDHHF ++I  ILQ+
Sbjct  57    TITKEDDDICFLHARKLDVFRHVLSKLGEEAVEGLNMIDAVQRLGIDHHFQEEIDQILQK  116

Query  1557  QYQKVKIDDFQKIN---GLYDISLSFRLLRQEGYNVSSDVFTKFTSEKGEFKEELSKDIR  1387
             Q+  +        N    L+++++ FRLLRQ+GY V  DVF KF   +G FK+ LS+DI+
Sbjct  117   QHLIITSGSAHGANHHSDLHEVAVRFRLLRQQGYFVPDDVFNKFKESEGSFKQMLSEDIK  176

Query  1386  GLMALHEASHLSIEGEDVLDEAAKFSRESLIANMVHLDECQASMVQNTLQYPYHKSLARF  1207
             GLM+L+EAS LSIEGED L+EA +FS   L  ++ HLD  QA +V NTL  P+HKSLA F
Sbjct  177   GLMSLYEASQLSIEGEDTLEEAGQFSWHLLNTSLSHLDHHQARVVGNTLSNPHHKSLATF  236

Query  1206  TAKTFIE-NMR-VENEWEATLVNLATMDYSITQSFYQEEFRQILRWWKSLGLKDEL--AK  1039
              AK F   N R   N W   L  +A  D++I QS +Q+E  QI +WWK LGL  EL  A+
Sbjct  237   MAKNFFATNSRGTNNRWLNILQEVAKTDFNIVQSLHQKEIFQISKWWKELGLAKELKFAR  296

Query  1038  NQQLKWYIWTLALIPDPSMSRERIELTKPIALVYLIDDIIDVYATFDQTKQFIDAINRWD  859
             +Q +KWYIW++A + DP+++ ER+ELTKPI+ +YLIDDI DVY T D+   F +A+NRW+
Sbjct  297   DQPVKWYIWSMACLADPNLTEERVELTKPISFIYLIDDIFDVYGTLDELILFTEAVNRWE  356

Query  858   LSVGEGLPDYMKRCLVVLFDTTNDINNLVFEKYGWNPIDHLKRAWKCLCSAYITEAKWFA  679
             +   E LPDYMK C   L D TN+I++ V++K+GWNP+  L++ W  LC+A++ EAKWF 
Sbjct  357   IGDIEHLPDYMKICFKALHDITNEISSKVYQKHGWNPLRSLRKTWGSLCNAFLVEAKWFK  416

Query  678   TGKSPSANEYLQTGIITTGIPMVLITCFFLLGHGAFAGTTDIED----MITSVGAILRLL  511
             +G  P A +YL+ GI+++G+ +V++  FFLLG G    + ++ +    +I+S  AILRL 
Sbjct  417   SGHLPKAEDYLKNGIVSSGVNVVMVHIFFLLGQGITKQSVELLNETPAIISSAAAILRLW  476

Query  510   DDLDATQGEKQDGNDASYVEYYVKEHEGLSISDGKQRIMNMVSEQWKLINKQCLSPTRIP  331
             DDL   + E QDG+D SY+  Y+ EH+G SI D ++  +N++SE+WK +NK+ +SP   P
Sbjct  477   DDLGTAEDENQDGHDGSYIRCYINEHQGCSIKDAQEITINLISEEWKRLNKELVSPNPFP  536

Query  330   ESFSKSCLNIARMVPMMYNYSDTHCLPILQKQIMSMF  220
              +F+ + LN+ARMVP+MY+Y    CLP L++ + SM 
Sbjct  537   VAFTNASLNLARMVPLMYSYDQNQCLPSLKEYMRSML  573



>gb|AEI52903.1| terpene synthase 3 [Populus trichocarpa]
Length=573

 Score =   489 bits (1260),  Expect = 7e-162, Method: Compositional matrix adjust.
 Identities = 232/516 (45%), Positives = 354/516 (69%), Gaps = 10/516 (2%)
 Frame = -2

Query  1749  SEKMTVTLSKDEFLLKSEGKREWQRGLLYQFQEDDLQVLNVIDAIQHLGIDHHFHDQIGA  1570
             +++  +T++ D+       K +  + +L +  E+ +Q L +IDAIQ L ID+HF ++I +
Sbjct  56    TKQYPITINNDDSDTGYAEKLQTFKHILRKEGEEPIQGLAMIDAIQRLSIDYHFQEEIDS  115

Query  1569  ILQRQYQKVKIDDFQKINGLYDISLSFRLLRQEGYNVSSDVFTKFTSEKGEFKEELSKDI  1390
             IL RQ   + +      N LY+++L FRLLRQ+GY+VS+ VF  F   +G FK++LS DI
Sbjct  116   ILTRQ--SMLLSTIHSDNNLYEVALRFRLLRQQGYHVSAGVFDNFKDNEGRFKQQLSSDI  173

Query  1389  RGLMALHEASHLSIEGEDVLDEAAKFSRESLIANMVHLDECQASMVQNTLQYPYHKSLAR  1210
              GL++L+EAS LSI GEDVLDEA  +S + L +++ HLD  QA +V+N+L +P+HKSLA 
Sbjct  174   MGLVSLYEASQLSIRGEDVLDEAGDYSYQLLRSSLTHLDYNQARLVRNSLDHPHHKSLAS  233

Query  1209  FTAKTFIENMRVENEWEATLVNLATMDYSITQSFYQEEFRQILRWWKSLGLKDEL--AKN  1036
             FTAK F  +    N W   L  LA  ++   QS +Q E  +I +WWK LGL  EL  A++
Sbjct  234   FTAKYFFNDE--PNGWIGELQELAKTEFKRVQSQHQHEIVEIFKWWKDLGLSTELRFARD  291

Query  1035  QQLKWYIWTLALIPDPSMSRERIELTKPIALVYLIDDIIDVYATFDQTKQFIDAINRWDL  856
             Q LKWY+W+++ + DPS+S +RIELTKP++++Y+IDDI DV+ T ++   F + INRWD+
Sbjct  292   QPLKWYMWSMSCLTDPSLSEQRIELTKPVSMIYIIDDIFDVHGTLNELVCFTEVINRWDI  351

Query  855   SVGEGLPDYMKRCLVVLFDTTNDINNLVFEKYGWNPIDHLKRAWKCLCSAYITEAKWFAT  676
             +  E LPDYMK C   L + TN+I+  +++++GWNP++ L++AW  LC A++ EA+WFA+
Sbjct  352   AAAEQLPDYMKICFKALNNITNEISYKIYKEHGWNPVESLRKAWASLCRAFLVEARWFAS  411

Query  675   GKSPSANEYLQTGIITTGIPMVLITCFFLLGHGAFAGTTDI----EDMITSVGAILRLLD  508
             GK PS  EYL+ GI+++G+ +VL+  FFLLG G      ++      +I+S   ILRL D
Sbjct  412   GKFPSGEEYLKNGIVSSGVHVVLVHIFFLLGQGISKENVELISNFPPIISSTATILRLWD  471

Query  507   DLDATQGEKQDGNDASYVEYYVKEHEGLSISDGKQRIMNMVSEQWKLINKQCLSPTRIPE  328
             DL + + E QDG+D SYVE Y++E+EG S+ D ++++++++S+ WK +N++CLSP   P 
Sbjct  472   DLGSAKDENQDGHDGSYVECYLRENEGSSLEDARKQVLHLISDAWKQLNQECLSPNPFPS  531

Query  327   SFSKSCLNIARMVPMMYNYSDTHCLPILQKQIMSMF  220
             +FSK+ LNIARMVP+MY+Y D H LP L++ + S+ 
Sbjct  532   TFSKASLNIARMVPLMYDYDDNHRLPSLEEHMKSLL  567



>ref|XP_004293480.1| PREDICTED: (3S,6E)-nerolidol synthase 2, chloroplastic/mitochondrial-like 
[Fragaria vesca subsp. vesca]
Length=521

 Score =   486 bits (1250),  Expect = 4e-161, Method: Compositional matrix adjust.
 Identities = 237/513 (46%), Positives = 339/513 (66%), Gaps = 14/513 (3%)
 Frame = -2

Query  1731  TLSKDEFLLKSEGKREWQRGLLYQFQE-DDLQVLNVIDAIQHLGIDHHFHDQIGAILQRQ  1555
             T + D+  ++   K E  R +L    E D L+ LN+IDA+Q LGID+HF  +I AIL +Q
Sbjct  8     TRTMDDIFVQHSRKLELLRNVLRNAAEVDALEGLNMIDAVQRLGIDYHFQREIDAILHKQ  67

Query  1554  YQKVKIDDFQKINGLYDISLSFRLLRQEGYNVSSDVFTKFTSEKGEFKEELSKDIRGLMA  1375
                V   D      L++++L FRLLRQ GY+V  DVF  F   KG FK+ L +DI+GLM+
Sbjct  68    MSIVSASD-----DLHEVALRFRLLRQHGYSVPEDVFNNFKESKGTFKQVLGEDIKGLMS  122

Query  1374  LHEASHLSIEGEDVLDEAAKFSRESLIANMVHLDECQASMVQNTLQYPYHKSLARFTAKT  1195
             L+EAS L  EGED L EA KFS   L  ++ HLD  QA +V NTL+ P+H+SLA F A+ 
Sbjct  123   LYEASQLGTEGEDTLVEAEKFSGHLLKTSLSHLDHHQARIVGNTLRNPHHRSLASFMARN  182

Query  1194  FIENMRV--ENEWEATLVNLATMDYSITQSFYQEEFRQILRWWKSLGLKDEL--AKNQQL  1027
             F    +    N W   L  +A +D+++ +S +Q E  QI +WWK LGL  EL  A++Q L
Sbjct  183   FFVTSQATRPNSWLTLLKEVAKIDFNMVRSRHQNEIVQISKWWKDLGLAKELKFARDQPL  242

Query  1026  KWYIWTLALIPDPSMSRERIELTKPIALVYLIDDIIDVYATFDQTKQFIDAINRWDLSVG  847
             KWYIW++A++ DP +S ER+ELTKPI+ VYLIDDI DVY T D    F +A+NRW+++  
Sbjct  243   KWYIWSMAVLTDPKLSEERVELTKPISFVYLIDDIFDVYGTLDDLYLFTEAVNRWEITAI  302

Query  846   EGLPDYMKRCLVVLFDTTNDINNLVFEKYGWNPIDHLKRAWKCLCSAYITEAKWFATGKS  667
             + LPDYMK C   L+D TN+ +  V++K+GWNP+  LK +W  LC+A++ EAKWFA+GK 
Sbjct  303   DHLPDYMKICFKALYDMTNEFSCKVYQKHGWNPLQSLKISWASLCNAFLVEAKWFASGKL  362

Query  666   PSANEYLQTGIITTGIPMVLITCFFLLGHGAFAGTTDIED----MITSVGAILRLLDDLD  499
             P + EYL+ GI+++G+ +VL+  FFLLG      + ++ +    +I+S  AILRL DDL 
Sbjct  363   PKSEEYLKNGIVSSGVNVVLVHMFFLLGQNITRKSVELLNETPAIISSSAAILRLWDDLG  422

Query  498   ATQGEKQDGNDASYVEYYVKEHEGLSISDGKQRIMNMVSEQWKLINKQCLSPTRIPESFS  319
             + + E QDGND SYV  Y++EHEG SI + +++ +NM+S++WK +N+  LSP   P +F+
Sbjct  423   SAKDENQDGNDGSYVRCYLEEHEGCSIEEAREKTINMISDEWKKLNRDLLSPNPFPATFT  482

Query  318   KSCLNIARMVPMMYNYSDTHCLPILQKQIMSMF  220
              + LN+ARM+P+MY+Y    CLP L++ +  M 
Sbjct  483   LASLNLARMIPLMYSYDGNQCLPSLKEYVKLML  515



>ref|XP_008224889.1| PREDICTED: (3S,6E)-nerolidol synthase 1-like [Prunus mume]
Length=580

 Score =   484 bits (1247),  Expect = 9e-160, Method: Compositional matrix adjust.
 Identities = 236/517 (46%), Positives = 344/517 (67%), Gaps = 11/517 (2%)
 Frame = -2

Query  1737  TVTLSKDEFLLKSEGKREWQRGLLYQFQEDDLQVLNVIDAIQHLGIDHHFHDQIGAILQR  1558
             T+T   D+       K +  R +L +  E+ ++ LN+IDA+Q LGIDHHF ++I  ILQ+
Sbjct  58    TITRDDDDICFLHALKLDVFRHVLRKLGEEAIEGLNMIDAVQRLGIDHHFQEEIDQILQK  117

Query  1557  QYQKVKIDDFQKIN---GLYDISLSFRLLRQEGYNVSSDVFTKFTSEKGEFKEELSKDIR  1387
             Q+  +        +    L+++++ FRLLRQ+GY V  DVF KF    G FK+ LS+DI+
Sbjct  118   QHLIITSGSAHGADHHSDLHEVAVRFRLLRQQGYFVPDDVFEKFKESDGSFKQMLSEDIK  177

Query  1386  GLMALHEASHLSIEGEDVLDEAAKFSRESLIANMVHLDECQASMVQNTLQYPYHKSLARF  1207
             GLM+L+EAS LSIEGED LDEA +FS   L  ++ HLD  QA +V NTL  P+HKSLA F
Sbjct  178   GLMSLYEASQLSIEGEDTLDEAGQFSWHLLNTSLSHLDHHQARVVGNTLSNPHHKSLATF  237

Query  1206  TAKTFIE-NMR-VENEWEATLVNLATMDYSITQSFYQEEFRQILRWWKSLGLKDEL--AK  1039
              AK F   N R + N W   L  +A  ++S+ QS +Q+E  QI +WWK LGL +EL  A+
Sbjct  238   MAKNFFSTNSRGMNNRWLNILQEVAKTEFSMVQSLHQKEIVQISKWWKELGLAEELKFAR  297

Query  1038  NQQLKWYIWTLALIPDPSMSRERIELTKPIALVYLIDDIIDVYATFDQTKQFIDAINRWD  859
             +Q +KWYIW++A + DP++S ER+ELTKPI+ +YLIDDI DVY T D+   F +A+ RW+
Sbjct  298   DQPVKWYIWSMACLTDPNLSEERVELTKPISFIYLIDDIFDVYGTLDELILFTEAVKRWE  357

Query  858   LSVGEGLPDYMKRCLVVLFDTTNDINNLVFEKYGWNPIDHLKRAWKCLCSAYITEAKWFA  679
             +   E LPDYMK C   L D TN+I++ V++K+GWNP+  L++ W  LC+A++ EAKWF 
Sbjct  358   IGDIEHLPDYMKICFKALHDMTNEISSKVYQKHGWNPLHSLRKTWGSLCTAFLVEAKWFK  417

Query  678   TGKSPSANEYLQTGIITTGIPMVLITCFFLLGHGAFAGTTDIED----MITSVGAILRLL  511
             +G  P A +YL+ GI+++G+ +V++  FFLLG G    + ++ D    +I+S  AILRL 
Sbjct  418   SGHLPKAEDYLKNGIVSSGVNVVMVHIFFLLGQGITKESVELLDETPAIISSAAAILRLW  477

Query  510   DDLDATQGEKQDGNDASYVEYYVKEHEGLSISDGKQRIMNMVSEQWKLINKQCLSPTRIP  331
             DDL + + E QDG+D SY+  Y+ +H+G SI D K+   N+++E+WK +NK+ +SP   P
Sbjct  478   DDLGSAEDENQDGHDGSYIRCYLNDHQGCSIEDAKEITTNLIAEEWKRLNKELVSPNPFP  537

Query  330   ESFSKSCLNIARMVPMMYNYSDTHCLPILQKQIMSMF  220
              +F+ + LN+ARMVP+MY+Y     LP L++ + SM 
Sbjct  538   VAFTNASLNLARMVPLMYSYDQNQRLPSLEEYMRSML  574



>ref|XP_009349841.1| PREDICTED: (3S,6E)-nerolidol synthase 1-like isoform X2 [Pyrus 
x bretschneideri]
Length=567

 Score =   482 bits (1240),  Expect = 6e-159, Method: Compositional matrix adjust.
 Identities = 240/532 (45%), Positives = 353/532 (66%), Gaps = 13/532 (2%)
 Frame = -2

Query  1776  QSVNSSSLRS--EKMTVTLSKDEFL-LKSEGKREWQRGLLYQFQEDDLQVLNVIDAIQHL  1606
              S+ S+ L+S   K   T SKD+ +  ++E K +  R  L +   + ++ L++IDA+Q L
Sbjct  34    HSLLSTPLKSLNSKTKYTSSKDDIICFQNEQKLDDLRHALKKVGGEAVESLDMIDAVQRL  93

Query  1605  GIDHHFHDQIGAILQRQY--QKVKIDDFQKINGLYDISLSFRLLRQEGYNVSSDVFTKFT  1432
             G+D+HF ++I  ILQRQ+               L++++L FRLLRQ GY VS DVF  F 
Sbjct  94    GLDYHFEEEIDQILQRQHIISSTTAHGTHHPTDLHEVALRFRLLRQHGYFVSDDVFNNFK  153

Query  1431  SEKGEFKEELSKDIRGLMALHEASHLSIEGEDVLDEAAKFSRESLIANMVHLDECQASMV  1252
             + +G F + LS+DIRGLM+L+EAS LSIEGE VL+EA KFS   L ++++HLD  QA +V
Sbjct  154   TREGNFDQMLSEDIRGLMSLYEASQLSIEGEVVLEEAGKFSGHFLNSSLLHLDHHQARVV  213

Query  1251  QNTLQYPYHKSLARFTAKTFIEN--MRVENEWEATLVNLATMDYSITQSFYQEEFRQILR  1078
             +NTL+ P+HKSLA F AK F  +      N W   L  +A  D ++ QS +Q+E  Q+ +
Sbjct  214   ENTLRNPHHKSLAPFMAKNFFVSSFQGTNNRWLNILQTVAKTDLNMVQSLHQKEVVQVSK  273

Query  1077  WWKSLGL--KDELAKNQQLKWYIWTLALIPDPSMSRERIELTKPIALVYLIDDIIDVYAT  904
             WWK LGL  K + A++Q +KWYIW++A + +P++S ERI+LTKPI+ +YLIDDI DVY T
Sbjct  274   WWKELGLCKKLKFARDQPIKWYIWSMACLTNPNLSDERIDLTKPISFIYLIDDIFDVYGT  333

Query  903   FDQTKQFIDAINRWDLSVGEGLPDYMKRCLVVLFDTTNDINNLVFEKYGWNPIDHLKRAW  724
              D+   F + +NRW++   E LPDYMK C   L+  TN+I+  V++K+GWNP+  LK+ W
Sbjct  334   LDELTLFTEVVNRWEIGSIEHLPDYMKICFKALYKMTNEISCKVYQKHGWNPLHSLKKTW  393

Query  723   KCLCSAYITEAKWFATGKSPSANEYLQTGIITTGIPMVLITCFFLLGHGAFAGTTD----  556
               LC+A++ EAKWF +G  P A EYL+ GII++G+ +V++  FFLLG G      +    
Sbjct  394   ASLCNAFLVEAKWFKSGHLPRAEEYLENGIISSGVNVVMVHIFFLLGEGITIQIVEFLNG  453

Query  555   IEDMITSVGAILRLLDDLDATQGEKQDGNDASYVEYYVKEHEGLSISDGKQRIMNMVSEQ  376
             I  +I+S  AILRL DDL + + E QDG+D SYV+ Y+ EH+G ++ + ++ + NM+SE+
Sbjct  454   IPAIISSTAAILRLWDDLGSAKDENQDGDDGSYVKLYLNEHQGKTVEEAQEHVKNMISEE  513

Query  375   WKLINKQCLSPTRIPESFSKSCLNIARMVPMMYNYSDTHCLPILQKQIMSMF  220
             WK +NK+ +SP  +P +F+K+ LN+ARMVP+MY+Y D   LP L + + SM 
Sbjct  514   WKKLNKELVSPNPLPAAFTKAALNLARMVPLMYSYDDNQRLPSLDEYMKSML  565



>ref|NP_001280833.1| (3S,6E)-nerolidol synthase 1-like [Malus domestica]
 gb|AGB14629.1| linalool synthase [Malus domestica]
Length=567

 Score =   481 bits (1239),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 236/521 (45%), Positives = 346/521 (66%), Gaps = 11/521 (2%)
 Frame = -2

Query  1749  SEKMTVTLSKDEFL-LKSEGKREWQRGLLYQFQEDDLQVLNVIDAIQHLGIDHHFHDQIG  1573
             + K   T SKD  +  ++E K +  R  L +   + ++ L++IDA+Q LG+D+HF ++I 
Sbjct  45    NSKTKYTSSKDGIICFQNEQKLDDLRHALIKVGGEAVESLDMIDAVQRLGLDYHFEEEID  104

Query  1572  AILQRQY--QKVKIDDFQKINGLYDISLSFRLLRQEGYNVSSDVFTKFTSEKGEFKEELS  1399
              ILQ+Q+               L++++L FRLLRQ GY VS DVF  F + +G F + L 
Sbjct  105   QILQKQHIISSTTAHGAHHPTDLHEVALRFRLLRQHGYFVSDDVFNNFKNREGNFNQMLR  164

Query  1398  KDIRGLMALHEASHLSIEGEDVLDEAAKFSRESLIANMVHLDECQASMVQNTLQYPYHKS  1219
             +DI+GLM+L+EAS LSIEGE VL+EA KFS   L +++ HLD  QA +V NTL+ P+HKS
Sbjct  165   EDIKGLMSLYEASQLSIEGEVVLEEAGKFSGHFLNSSLSHLDHHQARVVGNTLRNPHHKS  224

Query  1218  LARFTAKTFIEN--MRVENEWEATLVNLATMDYSITQSFYQEEFRQILRWWKSLGLKDEL  1045
             LA F AK F  +      N W   L  +A  D ++ QS +Q+E  Q+ +WWK LGL  EL
Sbjct  225   LAPFMAKNFFVSSFQGTNNRWLNILQTVAKTDLNMVQSLHQKEVAQVSKWWKELGLCKEL  284

Query  1044  --AKNQQLKWYIWTLALIPDPSMSRERIELTKPIALVYLIDDIIDVYATFDQTKQFIDAI  871
               A++Q +KWYIW++A + +P++S ERIELTKPI+ +YLIDDI DVY T D+   F + +
Sbjct  285   KFARDQPIKWYIWSMACLTNPNLSDERIELTKPISFIYLIDDIFDVYGTLDELTLFTEVV  344

Query  870   NRWDLSVGEGLPDYMKRCLVVLFDTTNDINNLVFEKYGWNPIDHLKRAWKCLCSAYITEA  691
             NRW++   E LPDYMK C   L+D TN+I+  V++K+GWNP+  LK+ W  LC+A++ EA
Sbjct  345   NRWEIGSIEHLPDYMKICFKALYDMTNEISCKVYQKHGWNPLHSLKKTWASLCNAFLVEA  404

Query  690   KWFATGKSPSANEYLQTGIITTGIPMVLITCFFLLGHGAFAGTTDIED----MITSVGAI  523
             KWF +G  P A EYL+ GII++G+ +V++  FFLLG G    + +  +    +I+S  AI
Sbjct  405   KWFKSGHLPMAEEYLKNGIISSGVNVVMVHIFFLLGEGITNQSVEFLNGTPAIISSTAAI  464

Query  522   LRLLDDLDATQGEKQDGNDASYVEYYVKEHEGLSISDGKQRIMNMVSEQWKLINKQCLSP  343
             LRL DDL + + E QDG+D SYV+ Y+ EH+G ++ + ++ + NM+SE+WK +NK+ +SP
Sbjct  465   LRLWDDLGSAKDENQDGDDGSYVKLYLNEHQGKTMEEAQEHVTNMISEEWKKLNKELVSP  524

Query  342   TRIPESFSKSCLNIARMVPMMYNYSDTHCLPILQKQIMSMF  220
               +P +F+K+ LN+ARMVP+MY+Y D  CLP L + + SM 
Sbjct  525   NPLPAAFTKASLNLARMVPLMYSYDDNQCLPSLDEYMKSML  565



>ref|XP_009349840.1| PREDICTED: (3S,6E)-nerolidol synthase 1-like isoform X1 [Pyrus 
x bretschneideri]
Length=567

 Score =   481 bits (1238),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 243/535 (45%), Positives = 353/535 (66%), Gaps = 19/535 (4%)
 Frame = -2

Query  1776  QSVNSSSLRS--EKMTVTLSKDEFL-LKSEGKREWQRGLLYQFQEDDLQVLNVIDAIQHL  1606
              S+ S+ L+S   K   T SKD+ +  ++E K +  R  L +   + ++ L++IDA+Q L
Sbjct  34    HSLLSTPLKSLNSKTKYTSSKDDIICFQNEQKLDDLRHALKKVGGEAVESLDMIDAVQRL  93

Query  1605  GIDHHFHDQIGAILQRQY--QKVKIDDFQKINGLYDISLSFRLLRQEGYNVSSDVFTKFT  1432
             G+D+HF ++I  ILQRQ+               L++++L FRLLRQ GY VS DVF  F 
Sbjct  94    GLDYHFEEEIDQILQRQHIISSTTAHGTHHPTDLHEVALRFRLLRQHGYFVSDDVFNNFK  153

Query  1431  SEKGEFKEELSKDIRGLMALHEASHLSIEGEDVLDEAAKFSRESLIANMVHLDECQASMV  1252
             + +G F + LS+DIRGLM+L+EAS LSIEGE VL+EA KFS   L ++++HLD  QA +V
Sbjct  154   TREGNFDQMLSEDIRGLMSLYEASQLSIEGEVVLEEAGKFSGHFLNSSLLHLDHHQARVV  213

Query  1251  QNTLQYPYHKSLARFTAKTFIEN--MRVENEWEATLVNLATMDYSITQSFYQEEFRQILR  1078
             +NTL+ P+HKSLA F AK F  +      N W   L  +A  D ++ QS +Q+E  Q+ +
Sbjct  214   ENTLRNPHHKSLAPFMAKNFFVSSFQGTNNRWLNILQTVAKTDLNMVQSLHQKEVVQVSK  273

Query  1077  WWKSLGL--KDELAKNQQLKWYIWTLALIPDPSMSRERIELTKPIALVYLIDDIIDVYAT  904
             WWK LGL  K + A++Q +KWYIW++A + +P++S ERI+LTKPI+ +YLIDDI DVY T
Sbjct  274   WWKELGLCKKLKFARDQPIKWYIWSMACLTNPNLSDERIDLTKPISFIYLIDDIFDVYGT  333

Query  903   FDQTKQFIDAINRWDLSVGEGLPDYMKRCLVVLFDTTNDINNLVFEKYGWNPIDHLKRAW  724
              D+   F + +NRW++   E LPDYMK C   L+  TN+I+  V++K+GWNP+  LK+ W
Sbjct  334   LDELTLFTEVVNRWEIGSIEHLPDYMKICFKALYKMTNEISCKVYQKHGWNPLHSLKKTW  393

Query  723   KCLCSAYITEAKWFATGKSPSANEYLQTGIITTGIPMVLITCFFLLGHGA-------FAG  565
               LC+A++ EAKWF +G  P A EYL+ GII++G+ +V+I  FFLLG G          G
Sbjct  394   ASLCNAFLVEAKWFKSGHLPRAEEYLKNGIISSGVNVVMIHIFFLLGEGITNQIVEFLNG  453

Query  564   TTDIEDMITSVGAILRLLDDLDATQGEKQDGNDASYVEYYVKEHEGLSISDGKQRIMNMV  385
             T  I   I+S  AILRL DDL + + E QDG+D SYV+ Y+ EH+G ++ + ++ + NM+
Sbjct  454   TPAI---ISSTAAILRLWDDLGSAKDENQDGDDGSYVKLYLNEHQGKTMEEAQEHVKNMI  510

Query  384   SEQWKLINKQCLSPTRIPESFSKSCLNIARMVPMMYNYSDTHCLPILQKQIMSMF  220
             SE+WK +NK+ +SP  +P +F+K+ LN+ARMVP+MY+Y D   LP L + + SM 
Sbjct  511   SEEWKKLNKELVSPNPLPAAFTKAALNLARMVPLMYSYDDNQRLPSLDEYMKSML  565



>sp|P0CV95.1|NES2_FRAAN RecName: Full=(3S,6E)-nerolidol synthase 2, chloroplastic/mitochondrial; 
Short=FaNES2; Flags: Precursor [Fragaria x ananassa]
Length=578

 Score =   480 bits (1236),  Expect = 4e-158, Method: Compositional matrix adjust.
 Identities = 232/498 (47%), Positives = 328/498 (66%), Gaps = 12/498 (2%)
 Frame = -2

Query  1692  KREWQRGLLYQFQE-DDLQVLNVIDAIQHLGIDHHFHDQIGAILQRQYQKVKIDDFQKIN  1516
             K E  R +L    E D L+ LN+IDA+Q LGID HF  +I  IL +Q   V   D     
Sbjct  80    KLELFRNVLRNVAELDALEGLNMIDAVQRLGIDFHFQREIDEILHKQMSNVSASD-----  134

Query  1515  GLYDISLSFRLLRQEGYNVSSDVFTKFTSEKGEFKEELSKDIRGLMALHEASHLSIEGED  1336
              L++++L FRLLRQ GY V  DVF  F   KG FK+ L +DI+GLM+L+EAS L  EGED
Sbjct  135   DLHEVALRFRLLRQHGYFVPEDVFNNFKDSKGTFKQVLGEDIKGLMSLYEASQLGTEGED  194

Query  1335  VLDEAAKFSRESLIANMVHLDECQASMVQNTLQYPYHKSLARFTAKTFIENMRVENEWEA  1156
              L EA KFS   L  ++ HLD   A +V NTL+ P+HKSLA F A+ F    +  N W  
Sbjct  195   TLVEAEKFSGHLLKTSLSHLDHHHARIVGNTLRNPHHKSLASFMARNFFVTTQATNSWLN  254

Query  1155  TLVNLATMDYSITQSFYQEEFRQILRWWKSLGLKDEL--AKNQQLKWYIWTLALIPDPSM  982
              L ++A  D+++ +S +Q E  QI +WWK LGL  EL  A++Q  KWYIW++A + DP +
Sbjct  255   LLKDVAKTDFNMVRSLHQNEIVQISKWWKELGLAKELKFARDQPQKWYIWSMACLTDPKL  314

Query  981   SRERIELTKPIALVYLIDDIIDVYATFDQTKQFIDAINRWDLSVGEGLPDYMKRCLVVLF  802
             S ER+ELTKPI+ VYLIDDI DVY T D    F +A+NRW+++  + LPDYMK C   L+
Sbjct  315   SEERVELTKPISFVYLIDDIFDVYGTLDDLILFTEAVNRWEITAIDHLPDYMKICFKALY  374

Query  801   DTTNDINNLVFEKYGWNPIDHLKRAWKCLCSAYITEAKWFATGKSPSANEYLQTGIITTG  622
             D TN+I+  V++K+GWNP+  LK +W  LC+A++ EAKWFA+G+ P + EYL+ GI+++G
Sbjct  375   DMTNEISCKVYQKHGWNPLQSLKISWASLCNAFLVEAKWFASGQLPKSKEYLKNGIVSSG  434

Query  621   IPMVLITCFFLLGHGAFAGTTDIED----MITSVGAILRLLDDLDATQGEKQDGNDASYV  454
             + +VL+  FF+LG      + ++ +    MI+S  AILRL DDL + + E QDGND SYV
Sbjct  435   VNVVLVHMFFILGQNITTKSVELLNETPAMISSSAAILRLWDDLGSAKDENQDGNDGSYV  494

Query  453   EYYVKEHEGLSISDGKQRIMNMVSEQWKLINKQCLSPTRIPESFSKSCLNIARMVPMMYN  274
               Y++EHEG SI + +++ +NM+S++WK +N++ LSP   P + + + LN+ARM+P+MY+
Sbjct  495   RCYLEEHEGCSIEEAREKTINMISDEWKKLNRELLSPNPFPATITLASLNLARMIPLMYS  554

Query  273   YSDTHCLPILQKQIMSMF  220
             Y    CLP L++ +  M 
Sbjct  555   YDGNQCLPSLKEYMKLML  572



>ref|XP_010999558.1| PREDICTED: (3S,6E)-nerolidol synthase 1-like [Populus euphratica]
 ref|XP_010999559.1| PREDICTED: (3S,6E)-nerolidol synthase 1-like [Populus euphratica]
Length=594

 Score =   481 bits (1237),  Expect = 5e-158, Method: Compositional matrix adjust.
 Identities = 232/516 (45%), Positives = 348/516 (67%), Gaps = 10/516 (2%)
 Frame = -2

Query  1749  SEKMTVTLSKDEFLLKSEGKREWQRGLLYQFQEDDLQVLNVIDAIQHLGIDHHFHDQIGA  1570
             +++  +T++ D+   +   K +  + +L +  E+ +Q L +IDAIQ L ID+HF ++I +
Sbjct  56    TKQYPITINNDDSDTEYAEKLQTFKHILRKEGEEPIQGLAMIDAIQRLSIDYHFQEEIDS  115

Query  1569  ILQRQYQKVKIDDFQKINGLYDISLSFRLLRQEGYNVSSDVFTKFTSEKGEFKEELSKDI  1390
             IL RQ   + +        LY+++L FRLLRQ+GY+VS+ VF  F   +G FK++LS DI
Sbjct  116   ILTRQ--SMLLSTIHSDTNLYEVALRFRLLRQQGYHVSAGVFDNFKDNEGRFKQKLSCDI  173

Query  1389  RGLMALHEASHLSIEGEDVLDEAAKFSRESLIANMVHLDECQASMVQNTLQYPYHKSLAR  1210
              GL++L+EAS LS+ GEDVLDEA  +S + L ++++HLD  QA +V+N+  +P+HKSLA 
Sbjct  174   MGLVSLYEASQLSVRGEDVLDEAGDYSYQLLRSSLIHLDYNQARLVRNSFNHPHHKSLAS  233

Query  1209  FTAKTFIENMRVENEWEATLVNLATMDYSITQSFYQEEFRQILRWWKSLGLKDEL--AKN  1036
             FTAK F  +    N W   L  LA  ++   QS +Q E  +IL+WWK LGL  EL  A++
Sbjct  234   FTAKYFFNDE--PNGWIGELQELAKTEFKRVQSQHQHEIVEILKWWKDLGLSTELRFARD  291

Query  1035  QQLKWYIWTLALIPDPSMSRERIELTKPIALVYLIDDIIDVYATFDQTKQFIDAINRWDL  856
             Q LKWY+W+++ + DPS+S +RIELTKP++++Y+IDDI DV  T D+   F + INRWD+
Sbjct  292   QPLKWYMWSVSCLTDPSLSEQRIELTKPLSMIYIIDDIFDVNGTLDELVCFTEVINRWDI  351

Query  855   SVGEGLPDYMKRCLVVLFDTTNDINNLVFEKYGWNPIDHLKRAWKCLCSAYITEAKWFAT  676
             +  E LPDYMK C   L + TN+I+  +++++GWNP D L++AW  LC A++ EA+WFA+
Sbjct  352   AAAEQLPDYMKICFKALNNITNEISYKIYKEHGWNPFDSLRKAWASLCRAFLVEARWFAS  411

Query  675   GKSPSANEYLQTGIITTGIPMVLITCFFLLGHGAFAGTTDI----EDMITSVGAILRLLD  508
             GK PS  EYL+ GI ++G+ +VL+  FFLLG        ++      +I+S   ILRL D
Sbjct  412   GKFPSGEEYLKNGIASSGVHVVLVHIFFLLGQNISKENVELISNFPPIISSTATILRLWD  471

Query  507   DLDATQGEKQDGNDASYVEYYVKEHEGLSISDGKQRIMNMVSEQWKLINKQCLSPTRIPE  328
             DL + + E QDG+D SYVE Y++E+EG S  D ++++++M+S+ WK +N+QCLSP     
Sbjct  472   DLGSAKDENQDGHDGSYVECYLRENEGSSFEDARKQVLHMISDAWKQLNQQCLSPNSFSS  531

Query  327   SFSKSCLNIARMVPMMYNYSDTHCLPILQKQIMSMF  220
             +FSK+ LNIARMVP+MY+Y D H LP L++ + S  
Sbjct  532   TFSKASLNIARMVPLMYDYDDNHRLPSLEEHMKSFL  567



>gb|AIC76501.1| terpene synthase [Prunus cerasoides var. campanulata]
Length=580

 Score =   480 bits (1235),  Expect = 7e-158, Method: Compositional matrix adjust.
 Identities = 235/517 (45%), Positives = 342/517 (66%), Gaps = 11/517 (2%)
 Frame = -2

Query  1737  TVTLSKDEFLLKSEGKREWQRGLLYQFQEDDLQVLNVIDAIQHLGIDHHFHDQIGAILQR  1558
             T+T   D+       K +  R +L +  E+ ++ LN+IDA+Q LGIDHHF ++I  ILQ+
Sbjct  58    TITREDDDICFLHARKLDVFRHVLSKLGEEAVEGLNMIDAVQRLGIDHHFQEEIDQILQK  117

Query  1557  QYQKVKIDDFQKIN---GLYDISLSFRLLRQEGYNVSSDVFTKFTSEKGEFKEELSKDIR  1387
             Q+  +        +    L+++++ FRLLRQ+GY V  DVF KF   +G FK+ LS+ I+
Sbjct  118   QHLIITSGSAHGADHHSDLHEVAVRFRLLRQQGYFVPDDVFNKFKESEGSFKKMLSEGIQ  177

Query  1386  GLMALHEASHLSIEGEDVLDEAAKFSRESLIANMVHLDECQASMVQNTLQYPYHKSLARF  1207
             GLM+L+EAS LSIEGED LDEA +FS   L  ++ HLD  QA +V NTL  P+ KSLA F
Sbjct  178   GLMSLYEASQLSIEGEDTLDEAGQFSCHLLSTSLSHLDHRQARVVGNTLSNPHLKSLATF  237

Query  1206  TAKTFIE-NMR-VENEWEATLVNLATMDYSITQSFYQEEFRQILRWWKSLGLKDEL--AK  1039
              AK F   N R   N W   L  +A  D+S+ QS +Q+E  QI +WWK LGL  EL  A+
Sbjct  238   MAKNFFATNSRGTNNRWLNILQEVAKTDFSMVQSLHQKEIVQISKWWKELGLAKELKFAR  297

Query  1038  NQQLKWYIWTLALIPDPSMSRERIELTKPIALVYLIDDIIDVYATFDQTKQFIDAINRWD  859
             +Q +KWYIW++A + DP +S ER+ELTKPI+ +YLIDDI DVY T D+   F +A+NRW+
Sbjct  298   DQPVKWYIWSMACLTDPKLSEERVELTKPISFIYLIDDIFDVYGTLDELILFTEAVNRWE  357

Query  858   LSVGEGLPDYMKRCLVVLFDTTNDINNLVFEKYGWNPIDHLKRAWKCLCSAYITEAKWFA  679
             +   + LPDYMK C   L D TN+I++ V++K+GWNP+  L++ W  LC+A++ EAKWF 
Sbjct  358   IGDIDHLPDYMKICFKALHDMTNEISSKVYQKHGWNPLHSLRKTWGSLCNAFLVEAKWFK  417

Query  678   TGKSPSANEYLQTGIITTGIPMVLITCFFLLGHGAFAGTTDIED----MITSVGAILRLL  511
             +G  P A +YL+ GI+++G+ +V++  FFLLG G    + ++ +    +I+S  AILRL 
Sbjct  418   SGHLPKAEDYLKNGIVSSGVNVVMVHIFFLLGQGITKQSVELLNETPAIISSAAAILRLW  477

Query  510   DDLDATQGEKQDGNDASYVEYYVKEHEGLSISDGKQRIMNMVSEQWKLINKQCLSPTRIP  331
             DDL +   E QDG+D SY+  Y+ EH+G SI D ++  +N++S++WK +NK+ +SP   P
Sbjct  478   DDLGSAADENQDGHDGSYIWCYLNEHQGCSIEDAQEITINLISKEWKRLNKELVSPNPFP  537

Query  330   ESFSKSCLNIARMVPMMYNYSDTHCLPILQKQIMSMF  220
              +F+ + LN+ARMVP+MY+Y    CLP L++ + SM 
Sbjct  538   VAFTNASLNLARMVPLMYSYDQNQCLPSLKEYMRSML  574



>sp|P0CV94.1|NES1_FRAAN RecName: Full=(3S,6E)-nerolidol synthase 1; Short=FaNES1 [Fragaria 
x ananassa]
Length=519

 Score =   477 bits (1228),  Expect = 9e-158, Method: Compositional matrix adjust.
 Identities = 227/483 (47%), Positives = 324/483 (67%), Gaps = 11/483 (2%)
 Frame = -2

Query  1650  DDLQVLNVIDAIQHLGIDHHFHDQIGAILQRQYQKVKIDDFQKINGLYDISLSFRLLRQE  1471
             D L+ LN+IDA+Q LGID++F  +I  IL +Q   V   D      L++++L FRLLRQ 
Sbjct  36    DALEGLNMIDAVQRLGIDYNFQREIDEILHKQMSIVSARD-----DLHEVALRFRLLRQH  90

Query  1470  GYNVSSDVFTKFTSEKGEFKEELSKDIRGLMALHEASHLSIEGEDVLDEAAKFSRESLIA  1291
             GY V  DVF  F   KG FK+ L +DI+GLM+L+EAS L  EGED+L EA KFS   L  
Sbjct  91    GYFVPEDVFNNFKDSKGTFKQVLGEDIKGLMSLYEASQLGTEGEDILVEAEKFSGHLLKT  150

Query  1290  NMVHLDECQASMVQNTLQYPYHKSLARFTAKTFIENMRVENEWEATLVNLATMDYSITQS  1111
             ++ HLD  +  +V NTL+ P+HKSLA F A+ F    +  N W   L  +A  D+++ +S
Sbjct  151   SLSHLDHHRVRIVANTLRNPHHKSLAPFMARNFFVTSQATNSWLNLLKEVAKTDFNMVRS  210

Query  1110  FYQEEFRQILRWWKSLGLKDEL--AKNQQLKWYIWTLALIPDPSMSRERIELTKPIALVY  937
              +Q E  Q+ +WWK LGL  EL  A++Q LKWYIW++A + DP +S ER+ELTKPI+ VY
Sbjct  211   LHQNEIVQMSKWWKELGLAKELKFARDQPLKWYIWSMACLTDPKLSEERVELTKPISFVY  270

Query  936   LIDDIIDVYATFDQTKQFIDAINRWDLSVGEGLPDYMKRCLVVLFDTTNDINNLVFEKYG  757
             LIDDI DVY T D    F +A+NRW+++  + LPDYMK C   L+D TN+ ++ V+ K+G
Sbjct  271   LIDDIFDVYGTLDDLILFTEAVNRWEITAIDHLPDYMKICFKALYDMTNEFSSKVYLKHG  330

Query  756   WNPIDHLKRAWKCLCSAYITEAKWFATGKSPSANEYLQTGIITTGIPMVLITCFFLLGHG  577
             WNP+  LK +W  LC+A++ EAKWFA+GK P + EYL+ GI+++G+ +VL+  FFLLG  
Sbjct  331   WNPLQSLKISWASLCNAFLVEAKWFASGKLPKSEEYLKNGIVSSGVNVVLVHMFFLLGQN  390

Query  576   AFAGTTDIED----MITSVGAILRLLDDLDATQGEKQDGNDASYVEYYVKEHEGLSISDG  409
                 + ++ +    +I+S  AILRL DDL + + E QDGND SYV  Y++EHEG SI + 
Sbjct  391   ITRKSVELLNETPAIISSSAAILRLWDDLGSAKDENQDGNDGSYVRCYLEEHEGCSIEEA  450

Query  408   KQRIMNMVSEQWKLINKQCLSPTRIPESFSKSCLNIARMVPMMYNYSDTHCLPILQKQIM  229
             +++ +NM+S++WK +N++ LSP   P SF+ + LN+ARM+P+MY+Y    CLP L++ + 
Sbjct  451   REKTINMISDEWKKLNRELLSPNPFPASFTLASLNLARMIPLMYSYDGNQCLPSLKEYMK  510

Query  228   SMF  220
              M 
Sbjct  511   LML  513



>ref|XP_008245818.1| PREDICTED: (3S,6E)-nerolidol synthase 1-like [Prunus mume]
Length=580

 Score =   478 bits (1231),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 235/517 (45%), Positives = 342/517 (66%), Gaps = 11/517 (2%)
 Frame = -2

Query  1737  TVTLSKDEFLLKSEGKREWQRGLLYQFQEDDLQVLNVIDAIQHLGIDHHFHDQIGAILQR  1558
             T+T   D+       K +  R +L +  E+ ++ LN+IDA+Q LGIDH F ++I  ILQ 
Sbjct  58    TITRDDDDICFLHALKLDVFRHVLRKLGEEAVEGLNMIDAVQRLGIDHLFQEEIDQILQE  117

Query  1557  QYQKVKIDDFQKIN---GLYDISLSFRLLRQEGYNVSSDVFTKFTSEKGEFKEELSKDIR  1387
             Q+  +        +    L+++++ FRLLRQ+GY V  DVF KF    G FK+ LS+DI+
Sbjct  118   QHLIITSGSAHGADHHSDLHEVAVRFRLLRQQGYFVPDDVFEKFKESDGSFKQMLSEDIK  177

Query  1386  GLMALHEASHLSIEGEDVLDEAAKFSRESLIANMVHLDECQASMVQNTLQYPYHKSLARF  1207
             GLM+L+EAS LSIEGED LDEA +FS   L  ++ HLD  QA +V NTL  P+HKSLA F
Sbjct  178   GLMSLYEASQLSIEGEDTLDEAGQFSWHLLNTSLSHLDHHQARVVGNTLSNPHHKSLATF  237

Query  1206  TAKTFIE-NMR-VENEWEATLVNLATMDYSITQSFYQEEFRQILRWWKSLGLKDEL--AK  1039
              AK F   N R + N W   L  +A  ++S+ QS +Q+E  QI +WWK LGL +EL  A+
Sbjct  238   MAKNFFSTNSRGMNNRWLNILQEVAKTEFSMVQSLHQKEIVQISKWWKELGLAEELKFAR  297

Query  1038  NQQLKWYIWTLALIPDPSMSRERIELTKPIALVYLIDDIIDVYATFDQTKQFIDAINRWD  859
             +Q +KWYIW++A + DP++S ER+ELTKPI+ +YLIDDI DVY T D+   F +A+ RW+
Sbjct  298   DQPVKWYIWSMACLTDPNLSEERVELTKPISFIYLIDDIFDVYGTLDELILFTEAVKRWE  357

Query  858   LSVGEGLPDYMKRCLVVLFDTTNDINNLVFEKYGWNPIDHLKRAWKCLCSAYITEAKWFA  679
             +   E LPDYMK C   L D TN+I++ V++K+GWNP+  L++ W  LC+A++ EAKWF 
Sbjct  358   IGDIEHLPDYMKICFKALHDMTNEISSKVYQKHGWNPLHSLRKTWGSLCTAFLVEAKWFK  417

Query  678   TGKSPSANEYLQTGIITTGIPMVLITCFFLLGHGAFAGTTDIED----MITSVGAILRLL  511
             +G  P A +YL+ GI+++G+ +V++  FFLLG G    + ++ D    +I+S  AILRL 
Sbjct  418   SGHLPKAEDYLKNGIVSSGVNVVMVHIFFLLGQGITKESVELLDETPAIISSAAAILRLW  477

Query  510   DDLDATQGEKQDGNDASYVEYYVKEHEGLSISDGKQRIMNMVSEQWKLINKQCLSPTRIP  331
             DDL + + E QDG+D SY+  Y+ +H+G SI D K+   N+++E+WK +NK+ +SP   P
Sbjct  478   DDLGSAEDENQDGHDGSYIRCYLNDHQGCSIEDAKEITTNLIAEEWKRLNKELVSPNPFP  537

Query  330   ESFSKSCLNIARMVPMMYNYSDTHCLPILQKQIMSMF  220
              +F+ + LN+ARMVP+MY+Y     LP L++ + SM 
Sbjct  538   VAFTNASLNLARMVPLMYSYDQNQRLPSLEEYMRSML  574



>ref|XP_009349839.1| PREDICTED: (3S,6E)-nerolidol synthase 1-like [Pyrus x bretschneideri]
Length=567

 Score =   478 bits (1229),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 244/545 (45%), Positives = 352/545 (65%), Gaps = 27/545 (5%)
 Frame = -2

Query  1812  HCRRRTPVVFRCQSVNSSSLRSEKMTVTLSKDEFL-LKSEGKREWQRGLLYQFQEDDLQV  1636
             H    TPV    +S+NS      K   T SKD+ +   +E K +  R  L +   + ++ 
Sbjct  34    HSLLSTPV----KSINS------KTKYTSSKDDLICFPNEQKLDDLRHALKKVGGEAVES  83

Query  1635  LNVIDAIQHLGIDHHFHDQIGAILQRQY--QKVKIDDFQKINGLYDISLSFRLLRQEGYN  1462
             L++IDA+Q LG+D+HF ++I  ILQ+Q+               L++++L FRLLRQ GY 
Sbjct  84    LDMIDAVQRLGLDYHFEEEIDQILQKQHIISSTTAHGAHHPTDLHEVALRFRLLRQHGYF  143

Query  1461  VSSDVFTKFTSEKGEFKEELSKDIRGLMALHEASHLSIEGEDVLDEAAKFSRESLIANMV  1282
             VS DVF  F + +G F + L +DIRGLM+L+EAS LSIEGE VL+EA KFS   L ++++
Sbjct  144   VSDDVFNNFKTREGNFNQMLREDIRGLMSLYEASQLSIEGEVVLEEAGKFSGHFLNSSLL  203

Query  1281  HLDECQASMVQNTLQYPYHKSLARFTAKTFIEN--MRVENEWEATLVNLATMDYSITQSF  1108
             HLD  QA +V+NTL+ P+HKSLA F AK F  +      N W   L  +A  D ++ QS 
Sbjct  204   HLDHHQARVVENTLRNPHHKSLAPFMAKNFFVSSFQGTNNRWLNILQTVAKTDLNMVQSL  263

Query  1107  YQEEFRQILRWWKSLGLKDEL--AKNQQLKWYIWTLALIPDPSMSRERIELTKPIALVYL  934
             +Q+E  Q+ +WWK LGL  EL  A++Q +KWYIW++A + +P++S ERIELTKPI+ +YL
Sbjct  264   HQKEVVQVSKWWKELGLCKELKFARDQPIKWYIWSMACLTNPNLSDERIELTKPISFIYL  323

Query  933   IDDIIDVYATFDQTKQFIDAINRWDLSVGEGLPDYMKRCLVVLFDTTNDINNLVFEKYGW  754
             IDDI DVY T D+   F + +N W++   E LPDYMK C    +D TN+I+  V++K+GW
Sbjct  324   IDDIFDVYGTLDELILFTEVVNGWEIGSIEHLPDYMKICFKAFYDMTNEISCKVYQKHGW  383

Query  753   NPIDHLKRAWKCLCSAYITEAKWFATGKSPSANEYLQTGIITTGIPMVLITCFFLLGHGA  574
             NP+  LK+ W  LC+A++ EAKWF +G  P A EYL+ GII++G+ +V++  FFLLG G 
Sbjct  384   NPLHSLKKTWASLCNAFLVEAKWFKSGHLPRAEEYLKNGIISSGVNVVMVHIFFLLGEGI  443

Query  573   -------FAGTTDIEDMITSVGAILRLLDDLDATQGEKQDGNDASYVEYYVKEHEGLSIS  415
                      GT  I   I+S  AILRL DDL + + E QDG+D SYV+ Y+ EH+G ++ 
Sbjct  444   TNQIVEFLNGTPAI---ISSTAAILRLWDDLGSAKDENQDGDDGSYVKLYLNEHQGKTME  500

Query  414   DGKQRIMNMVSEQWKLINKQCLSPTRIPESFSKSCLNIARMVPMMYNYSDTHCLPILQKQ  235
             + ++ + NM+SE+WK +NK+ +SP  +P +F+K+ LN+ARMVP+MY+Y D   LP L + 
Sbjct  501   EAQEHVKNMISEEWKKLNKELVSPNPLPAAFTKAALNLARMVPLMYSYDDNQRLPSLDEY  560

Query  234   IMSMF  220
             + SM 
Sbjct  561   MKSML  565



>ref|XP_007025895.1| 3S-linalool/(E)-nerolidol /(E,E)-geranyl linalool synthase, putative 
[Theobroma cacao]
 gb|EOY28517.1| 3S-linalool/(E)-nerolidol /(E,E)-geranyl linalool synthase, putative 
[Theobroma cacao]
Length=583

 Score =   478 bits (1230),  Expect = 4e-157, Method: Compositional matrix adjust.
 Identities = 235/512 (46%), Positives = 339/512 (66%), Gaps = 11/512 (2%)
 Frame = -2

Query  1752  RSEKMTVTLSKDEFLLKSEGKREWQRGLLYQFQEDDLQVLNVIDAIQHLGIDHHFHDQIG  1573
             RS   T+T   DEF ++   K E  + +  +  ED  Q L +IDAIQ LGIDHHF  +I 
Sbjct  60    RSGHPTIT---DEFRIEHANKLETFKRVFREVGEDPSQGLVMIDAIQRLGIDHHFQYEID  116

Query  1572  AILQRQYQKVKIDDFQKINGLYDISLSFRLLRQEGYNVSSDVFTKFTSEKGEFKEELSKD  1393
              +LQ+QY     +     + L++++L FRLLRQEGY V + VF +F   +G F+ EL +D
Sbjct  117   EVLQKQYMLSCTNGVHDYD-LHEVALRFRLLRQEGYFVPAGVFDRFKDREGSFRNELRRD  175

Query  1392  IRGLMALHEASHLSIEGEDVLDEAAKFSRESLIA-NMVHLDECQASMVQNTLQYPYHKSL  1216
             I+GLM L+EAS L++EGED+LD A +FS ++L       LD     +++ TL  PYHKSL
Sbjct  176   IKGLMELYEASQLAVEGEDILDRAKEFSSQALKTWQSRELDRFSERVIKTTLDQPYHKSL  235

Query  1215  ARFTAKTFIENMRVENEWEATLVNLATMDYSITQSFYQEEFRQILRWWKSLGLKDEL--A  1042
             +RFTA+  + N++  N W   L  LA MD++I QS +QEE  +I  WWK LGL  EL  A
Sbjct  236   SRFTARNLLTNVQGTNGWINVLQELAKMDFNIVQSLHQEEVVRISNWWKDLGLAKELEFA  295

Query  1041  KNQQLKWYIWTLALIPDPSMSRERIELTKPIALVYLIDDIIDVYATFDQTKQFIDAINRW  862
             ++Q LKWYIW++A + +P++S +RI+LTKPI+L+Y+IDDI DVY T D+   F  A+ RW
Sbjct  296   RDQPLKWYIWSMASLTNPNLSEQRIDLTKPISLIYIIDDIFDVYGTLDELTLFTQAVVRW  355

Query  861   DLSVGEGLPDYMKRCLVVLFDTTNDINNLVFEKYGWNPIDHLKRAWKCLCSAYITEAKWF  682
             D    + LPDYMK C   L D T++I++ V++++GWNP++ L++AW  LC A++ EA+WF
Sbjct  356   DYGSTDRLPDYMKICFKALDDITDEISHKVYKEHGWNPVNSLRKAWATLCRAFLVEARWF  415

Query  681   ATGKSPSANEYLQTGIITTGIPMVLITCFFLLGHGAFAGTTDIED----MITSVGAILRL  514
             A+GK P A EYL+ GI ++G+ +VLI  FFLLG G      ++ D    MI+S   ILRL
Sbjct  416   ASGKLPKAKEYLENGITSSGVHIVLIHIFFLLGQGLNNQHVELIDNNPGMISSTATILRL  475

Query  513   LDDLDATQGEKQDGNDASYVEYYVKEHEGLSISDGKQRIMNMVSEQWKLINKQCLSPTRI  334
              DDL + + E QDGND SYV+ Y+KEH+G+ +   ++ + +M+S  WK +N +CLS    
Sbjct  476   WDDLGSAKDENQDGNDGSYVDCYMKEHQGVEVESVRKHVTHMISNAWKRLNHKCLSQNSF  535

Query  333   PESFSKSCLNIARMVPMMYNYSDTHCLPILQK  238
                F+++ LNIARMVP+MY+Y++  CLP L++
Sbjct  536   SLPFARASLNIARMVPLMYSYNENQCLPSLEE  567



>ref|XP_002518583.1| 1,8-cineole synthase, chloroplast precursor, putative [Ricinus 
communis]
 sp|B9RXW4.1|TPS13_RICCO RecName: Full=Probable terpene synthase 13; Short=RcSeTPS13 [Ricinus 
communis]
 gb|EEF43970.1| 1,8-cineole synthase, chloroplast precursor, putative [Ricinus 
communis]
Length=572

 Score =   474 bits (1219),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 235/514 (46%), Positives = 333/514 (65%), Gaps = 13/514 (3%)
 Frame = -2

Query  1734  VTLSKDEFLLKSEGKREWQRGLLYQFQEDDLQVLNVIDAIQHLGIDHHFHDQIGAILQRQ  1555
             + L+ ++  +K    R ++  +L +  E   +VL +IDAIQ LGIDHHF D+I  ILQRQ
Sbjct  57    IHLTDEDVRIKERRTRAFKH-ILRKEGEGSHEVLAMIDAIQRLGIDHHFQDEIDEILQRQ  115

Query  1554  YQKVKIDDFQKINGLYDISLSFRLLRQEGYNVSSDVFTKFTSEKGEFKEELSKDIRGLMA  1375
             Y    I  +   N L+ ++L FRLLRQ GYNVS+ VF KF  ++G F ++LS DIRGLM 
Sbjct  116   Y---TIPSYYNDNDLHGLALRFRLLRQGGYNVSAGVFDKFKDKEGNFDQKLSDDIRGLME  172

Query  1374  LHEASHLSIEGED-VLDEAAKFSRESLIANMVHLDECQASMVQNTLQYPYHKSLARFTAK  1198
             L+EAS LSI  ED +LDEA  +S + L + M  LD+ QA +++NTL +P+HK+LARF A 
Sbjct  173   LYEASQLSIGAEDHILDEAGDYSHQLLSSWMTRLDDSQARIIKNTLDHPHHKNLARFRAT  232

Query  1197  TFIENMRVEN--EWEATLVNLATMDYSITQSFYQEEFRQILRWWKSLGLKDEL--AKNQQ  1030
              F     + N   W   L  LA +D+ + QS  Q+E  Q+  WWK LG+  EL   +NQ 
Sbjct  233   NFNRYFHMANIEGWMNELQELAKIDFQMVQSQNQQEIFQVAGWWKDLGISKELKFVRNQP  292

Query  1029  LKWYIWTLALIPDPSMSRERIELTKPIALVYLIDDIIDVYATFDQTKQFIDAINRWDLSV  850
             LKWYIW++A + DPS+S++RI+LTKPI+ +Y+IDDI DV  + D+   F + + RWD+  
Sbjct  293   LKWYIWSMATLSDPSLSQQRIDLTKPISFIYIIDDIFDVQGSLDELTLFTEIVKRWDVEA  352

Query  849   GEGLPDYMKRCLVVLFDTTNDINNLVFEKYGWNPIDHLKRAWKCLCSAYITEAKWFATGK  670
              E LP YM+ C   L   TN+I   V++++GWNP+  L+  W  LC A++ EA+WFA+G 
Sbjct  353   VEQLPGYMRACFKALDSVTNEIGYKVYKQHGWNPVHSLRETWASLCKAFLVEARWFASGH  412

Query  669   SPSANEYLQTGIITTGIPMVLITCFFLLGHGAFAGTTDI----EDMITSVGAILRLLDDL  502
              P+A EYLQ GI+++G+ +VL+  F+LLGHG      D       +ITS   ILRL DDL
Sbjct  413   LPAAEEYLQNGIVSSGVHVVLVHIFYLLGHGVTREGVDFIGNRPAIITSTATILRLWDDL  472

Query  501   DATQGEKQDGNDASYVEYYVKEHEGLSISDGKQRIMNMVSEQWKLINKQCLSPTRIPESF  322
               ++ E QDG+D SYVE YVKEH+G  +    +++  M+S+ WK +N++CL P     +F
Sbjct  473   GISKDENQDGHDGSYVECYVKEHKGSLVEIATKKVTVMISDAWKQLNQECLHPNPFSPNF  532

Query  321   SKSCLNIARMVPMMYNYSDTHCLPILQKQIMSMF  220
             +KSCLN+ARMVP+MY+Y D H LP+L+    S+ 
Sbjct  533   TKSCLNLARMVPLMYSYDDNHRLPVLEYYTKSLL  566



>sp|P0CV96.1|NES1_FRAVE RecName: Full=(3S,6E)-nerolidol synthase 1, chloroplastic; Short=FvNES1; 
Flags: Precursor [Fragaria vesca]
Length=580

 Score =   471 bits (1211),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 232/511 (45%), Positives = 332/511 (65%), Gaps = 12/511 (2%)
 Frame = -2

Query  1731  TLSKDEFLLKSEGKREWQRGLLYQFQE-DDLQVLNVIDAIQHLGIDHHFHDQIGAILQRQ  1555
             T +  +  ++   K E  R +L    E D L+ LN+IDA+Q LGID+HF  +I  IL +Q
Sbjct  69    TRTMGDIFVQHSQKLELFRNVLRNAAELDALEGLNMIDAVQRLGIDYHFQREIDEILHKQ  128

Query  1554  YQKVKIDDFQKINGLYDISLSFRLLRQEGYNVSSDVFTKFTSEKGEFKEELSKDIRGLMA  1375
                V   D      LY+++L FRLLRQ GY V  DVF  F   KG FK+ L +DI+GLM+
Sbjct  129   MGIVSACD-----DLYEVALRFRLLRQHGYFVPEDVFNNFKDSKGTFKQVLGEDIKGLMS  183

Query  1374  LHEASHLSIEGEDVLDEAAKFSRESLIANMVHLDECQASMVQNTLQYPYHKSLARFTAKT  1195
             L+EAS L  EGED L EA KFS   L  ++ HLD  +A +V NTL+ P+ KSLA F A+ 
Sbjct  184   LYEASQLGTEGEDTLVEAEKFSGHLLKTSLSHLDRHRARIVGNTLRNPHRKSLASFMARN  243

Query  1194  FIENMRVENEWEATLVNLATMDYSITQSFYQEEFRQILRWWKSLGLKDEL--AKNQQLKW  1021
             F    +  N W   L  +A  D+++ +S +Q+E  QI +WWK LGL  EL  A++Q LKW
Sbjct  244   FFVTSQATNSWLNLLKEVAKTDFNMVRSVHQKEIVQISKWWKELGLVKELKFARDQPLKW  303

Query  1020  YIWTLALIPDPSMSRERIELTKPIALVYLIDDIIDVYATFDQTKQFIDAINRWDLSVGEG  841
             Y W++A + DP +S ER+ELTKPI+ VYLIDDI DVY T D    F +A+NRW+++  + 
Sbjct  304   YTWSMAGLTDPKLSEERVELTKPISFVYLIDDIFDVYGTLDDLILFTEAVNRWEITAIDH  363

Query  840   LPDYMKRCLVVLFDTTNDINNLVFEKYGWNPIDHLKRAWKCLCSAYITEAKWFATGKSPS  661
             LPDYMK C   L+D TN+ +  V++K+GWNP+  LK +W  LC+A++ EAKWFA+G+ P 
Sbjct  364   LPDYMKICFKALYDMTNEFSCKVYQKHGWNPLRSLKISWASLCNAFLVEAKWFASGQLPK  423

Query  660   ANEYLQTGIITTGIPMVLITCFFLLGHGAFAGTTDIED----MITSVGAILRLLDDLDAT  493
             + EYL+ GI+++G+ + L+  FFLLG      + ++ +    MI+S  AILRL DDL + 
Sbjct  424   SEEYLKNGIVSSGVNVGLVHMFFLLGQNITRKSVELLNETPAMISSSAAILRLWDDLGSA  483

Query  492   QGEKQDGNDASYVEYYVKEHEGLSISDGKQRIMNMVSEQWKLINKQCLSPTRIPESFSKS  313
             + E QDGND SYV  Y++EHEG SI + +++ +NM+S++WK +N++ LSP   P +F+ +
Sbjct  484   KDENQDGNDGSYVRCYLEEHEGCSIEEAREKTINMISDEWKKLNRELLSPNPFPATFTSA  543

Query  312   CLNIARMVPMMYNYSDTHCLPILQKQIMSMF  220
              LN+ARM+P+MY+Y     LP L++ +  M 
Sbjct  544   SLNLARMIPLMYSYDGNQSLPSLKEYMKLML  574



>ref|XP_007025896.1| 3S-linalool/(E)-nerolidol /(E,E)-geranyl linalool synthase, putative 
[Theobroma cacao]
 gb|EOY28518.1| 3S-linalool/(E)-nerolidol /(E,E)-geranyl linalool synthase, putative 
[Theobroma cacao]
Length=584

 Score =   467 bits (1201),  Expect = 9e-153, Method: Compositional matrix adjust.
 Identities = 244/547 (45%), Positives = 351/547 (64%), Gaps = 31/547 (6%)
 Frame = -2

Query  1794  PVVFRC-----QSVNSSSL-----RSEKMTVTLSKDEFLLKSEGKREWQRGLLYQFQEDD  1645
             P++ RC       + S+ L     RS   T+T   DEF ++   K E  + +  +  ED 
Sbjct  36    PMIPRCSIARDHRIVSTPLEHFGQRSGHPTIT---DEFRIEHANKLEAFKRVFREVGEDP  92

Query  1644  LQVLNVIDAIQHLGIDHHFHDQIGAILQRQYQKVKIDDFQKINGLYD-----ISLSFRLL  1480
             LQ L ++DAIQ LGIDHHF  +I  +LQ+QY           NG++D     +SL FRLL
Sbjct  93    LQALAMVDAIQRLGIDHHFQYEIDEVLQKQYM------LSCTNGVHDYDLQEVSLRFRLL  146

Query  1479  RQEGYNVSSDVFTKFTSEKGEFKEELSKDIRGLMALHEASHLSIEGEDVLDEAAKFSRES  1300
             RQEGY V + VF +F   +G F+ EL +DI+GLM L+EAS L++EGED+LD A +FS ++
Sbjct  147   RQEGYFVPAGVFDRFKDREGGFRNELRRDIKGLMELYEASQLAVEGEDILDGAREFSSQA  206

Query  1299  LIA-NMVHLDECQASMVQNTLQYPYHKSLARFTAKTFIENMRVENEWEATLVNLATMDYS  1123
             L       LD+    +++ TL  PYHK L+RFTA+  + N +  N W   L  LA MD++
Sbjct  207   LKTWQSRELDQFSGRVIKTTLDQPYHKRLSRFTARNLLTNYQGTNGWINVLQELAKMDFN  266

Query  1122  ITQSFYQEEFRQILRWWKSLGLKDEL--AKNQQLKWYIWTLALIPDPSMSRERIELTKPI  949
             I QS +Q E  +I  WWK LGL  EL  A++Q LKWYIW++A + DPS+S +RI+LTKPI
Sbjct  267   IVQSLHQTEAIRISNWWKGLGLTKELELARDQPLKWYIWSMASLTDPSLSEQRIDLTKPI  326

Query  948   ALVYLIDDIIDVYATFDQTKQFIDAINRWDLSVGEGLPDYMKRCLVVLFDTTNDINNLVF  769
             +L+Y+IDDI D+Y T D+   F  A++RWD +  + LPDYMK C   L D T++I++ V+
Sbjct  327   SLIYIIDDIFDIYGTLDELTLFTQAVDRWDYAATDRLPDYMKICFKALDDITDEISHKVY  386

Query  768   EKYGWNPIDHLKRAWKCLCSAYITEAKWFATGKSPSANEYLQTGIITTGIPMVLITCFFL  589
             +K+GWNP++ L++AW  LC A++ EA+WFA+GK P A EYL+ GI ++G+ ++L+  FFL
Sbjct  387   KKHGWNPVNSLRKAWATLCRAFLVEARWFASGKLPKAKEYLENGITSSGVHIILVHSFFL  446

Query  588   LGHGAFAGTTDIED----MITSVGAILRLLDDLDATQGEKQDGNDASYVEYYVKEHEGLS  421
             LG G      ++ D    MI+S   ILRL DDL + + EKQDGND SYVE Y++EH+G+ 
Sbjct  447   LGQGLNNKNVELIDNNPSMISSTATILRLWDDLGSAKDEKQDGNDGSYVECYMEEHQGVE  506

Query  420   ISDGKQRIMNMVSEQWKLINKQCLSPTRIPESFSKSCLNIARMVPMMYNYSDTHCLPILQ  241
                 ++ + NM+S  WK +N +CLS       F+++ LNIARMVP+MY+Y +  CLP L+
Sbjct  507   YESARKHVTNMISNAWKRLNHECLSENPFSLPFARASLNIARMVPLMYSYDENQCLPSLE  566

Query  240   KQIMSMF  220
             + + S+ 
Sbjct  567   EYMKSLL  573



>ref|XP_004309665.1| PREDICTED: (3S,6E)-nerolidol synthase 1, chloroplastic-like [Fragaria 
vesca subsp. vesca]
Length=585

 Score =   461 bits (1187),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 236/549 (43%), Positives = 340/549 (62%), Gaps = 22/549 (4%)
 Frame = -2

Query  1815  LHCRRRTPVVFRCQSVNSSSLRSEK------MTV----TLSKDEFLLKSEGKREWQRGLL  1666
             L  +++ P  F+   V   SL S        M V    T +  +  ++   K E  R +L
Sbjct  36    LTPKKQLPATFQRWGVAEDSLLSSSSAPIKLMNVETKHTRTMGDIFVQHSQKLELFRNVL  95

Query  1665  YQFQE-DDLQVLNVIDAIQHLGIDHHFHDQIGAILQRQYQKVKIDDFQKINGLYDISLSF  1489
                 E D L+ LN+IDA+Q LGID HF  +I  IL +Q   V   D      L++++L F
Sbjct  96    RNVAELDALEGLNMIDAVQRLGIDFHFQREIDEILHKQMSIVSASD-----DLHEVALRF  150

Query  1488  RLLRQEGYNVSSDVFTKFTSEKGEFKEELSKDIRGLMALHEASHLSIEGEDVLDEAAKFS  1309
             RLLRQ GY V  DVF  F   KG FK+ L +DI+GLM+L+EAS L  EGED L EA KFS
Sbjct  151   RLLRQHGYFVPEDVFNNFKDSKGTFKQVLGEDIKGLMSLYEASQLGTEGEDTLVEAEKFS  210

Query  1308  RESLIANMVHLDECQASMVQNTLQYPYHKSLARFTAKTFIENMRVENEWEATLVNLATMD  1129
                L  ++ HLD  QA +V NTL+ P+HKSLA F A+ F    +  N     +  +  ++
Sbjct  211   GHLLKTSLSHLDHHQARIVGNTLRNPHHKSLASFMARNFFVTSQATNSXXQLMKLVVFLE  270

Query  1128  YSITQSFYQEEFRQILRWWKSLGLKDEL--AKNQQLKWYIWTLALIPDPSMSRERIELTK  955
              ++ Q   + E  ++ RWWK LGL  EL  A++Q LKWY W++A + DP +S ER+ELTK
Sbjct  271   LNLVQVLNENERVEVSRWWKELGLVKELKFARDQPLKWYTWSMAGLTDPKLSEERVELTK  330

Query  954   PIALVYLIDDIIDVYATFDQTKQFIDAINRWDLSVGEGLPDYMKRCLVVLFDTTNDINNL  775
             PI+ VYLIDDI DVY T D    F +A+NRW+++  + LPDYMK C   L+D TN+ +  
Sbjct  331   PISFVYLIDDIFDVYGTLDDLILFTEAVNRWEITAIDHLPDYMKICFKALYDMTNEFSCK  390

Query  774   VFEKYGWNPIDHLKRAWKCLCSAYITEAKWFATGKSPSANEYLQTGIITTGIPMVLITCF  595
             V++K+GWNP+  LK +W  LC+A++ EAKWFA+G+ P + EYL+ GI+++G+ + L+  F
Sbjct  391   VYQKHGWNPLRSLKISWASLCNAFLVEAKWFASGQLPKSEEYLKNGIVSSGVNVGLVHMF  450

Query  594   FLLGHGAFAGTTDIED----MITSVGAILRLLDDLDATQGEKQDGNDASYVEYYVKEHEG  427
             FLLG      + ++ +    MI+S  AILRL DDL + + E QDGND SYV  Y++EHEG
Sbjct  451   FLLGQNITRKSVELLNETPAMISSSAAILRLWDDLGSAKDENQDGNDGSYVRCYLEEHEG  510

Query  426   LSISDGKQRIMNMVSEQWKLINKQCLSPTRIPESFSKSCLNIARMVPMMYNYSDTHCLPI  247
              SI + +++ +NM+S++WK +N++ LSP   P +F+ + LN+ARM+P+MY+Y     LP 
Sbjct  511   CSIEEAREKTINMISDEWKKLNRELLSPNPFPATFTSASLNLARMIPLMYSYDGNQSLPS  570

Query  246   LQKQIMSMF  220
             L++ +  M 
Sbjct  571   LKEYMKLML  579



>ref|XP_008383955.1| PREDICTED: (3S,6E)-nerolidol synthase 1-like [Malus domestica]
Length=568

 Score =   460 bits (1184),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 234/564 (41%), Positives = 354/564 (63%), Gaps = 16/564 (3%)
 Frame = -2

Query  1872  ILNTMSSHASIPCFSIGTALHCRRRTPVVFRCQSVNSSSLR--SEKMTVTLSKDEFL-LK  1702
              L+++++ +  P  ++      +   P   +  S+ S+ L+  + K   T SKD  +  +
Sbjct  6     FLSSLATSSCTPPIALKNPSSKKWSIP---KDHSLLSTPLKPLNSKTKYTSSKDGIICFQ  62

Query  1701  SEGKREWQRGLLYQFQEDDLQVLNVIDAIQHLGIDHHFHDQIGAILQRQY--QKVKIDDF  1528
              E K +  R  L +     ++ L++IDA+Q LGID+HF D+I  ILQ+Q+          
Sbjct  63    HEQKLDDLRSALKKVGGQAVEGLDMIDAVQRLGIDYHFEDEIDQILQKQHIISSTTAHGA  122

Query  1527  QKINGLYDISLSFRLLRQEGYNVSSDVFTKFTSEKGEFKEELSKDIRGLMALHEASHLSI  1348
                  L++++L FRLLRQ GY VS DVF  F   +G F + LS+DI+GLM+L+EAS LS 
Sbjct  123   HDPTDLHEVALRFRLLRQHGYFVSDDVFNNFKEGEGNFNQMLSEDIKGLMSLYEASKLST  182

Query  1347  EGEDVLDEAAKFSRESLIANMVHLDECQASMVQNTLQYPYHKSLARFTAKTFIEN--MRV  1174
             EGE VL+EA KFS   L ++++HLD  QA +V+NTL+ P+HKSLA F AK F  +     
Sbjct  183   EGEVVLEEAGKFSGHFLNSSLLHLDHHQARVVENTLRNPHHKSLAPFMAKNFFVSGFQGT  242

Query  1173  ENEWEATLVNLATMDYSITQSFYQEEFRQILRWWKSLGLKDEL--AKNQQLKWYIWTLAL  1000
              N W   L  +A  D  + QS +Q+E  Q+ +WW+ LGL  EL  A++Q +KWY W++A 
Sbjct  243   YNRWLNILQTVAKTDLYMVQSLHQKEVVQVSKWWEELGLSKELKFARDQPIKWYNWSMAG  302

Query  999   IPDPSMSRERIELTKPIALVYLIDDIIDVYATFDQTKQFIDAINRWDLSVGEGLPDYMKR  820
             + +P++S ERIE TK ++ +YLIDDI DVY T D    F + +NRW++   E LPDYMK 
Sbjct  303   LTNPNLSDERIEFTKSVSFIYLIDDIFDVYGTLDDLTLFTEVVNRWEIGAIEHLPDYMKI  362

Query  819   CLVVLFDTTNDINNLVFEKYGWNPIDHLKRAWKCLCSAYITEAKWFATGKSPSANEYLQT  640
             C   L+D T++I+  V+EK+GWNP+  LK+ W  LC+A++ EAKWF +G  P A EYL+ 
Sbjct  363   CFKALYDMTDEISCKVYEKHGWNPLHSLKKTWASLCNAFLVEAKWFKSGHLPRAEEYLKN  422

Query  639   GIITTGIPMVLITCFFLLGHGAFAGTTDIED----MITSVGAILRLLDDLDATQGEKQDG  472
             GII++G+ ++L+  FFLLG G    + ++ +    +I+S  AILRL D   + + E QDG
Sbjct  423   GIISSGVNVMLVHIFFLLGEGITKQSVELLNGTPAIISSTAAILRLWDXXGSAKDENQDG  482

Query  471   NDASYVEYYVKEHEGLSISDGKQRIMNMVSEQWKLINKQCLSPTRIPESFSKSCLNIARM  292
             +D SY+ YY+ EH+G ++ + ++ + NM+S++WK +NK  +SP   P +F+K+ LN+ RM
Sbjct  483   DDGSYINYYLNEHQGKTMEEAQEHVTNMISQEWKKLNKVLVSPNPFPAAFTKASLNLTRM  542

Query  291   VPMMYNYSDTHCLPILQKQIMSMF  220
             VP+MY+Y D   LP L + + SM 
Sbjct  543   VPLMYSYDDNQRLPSLDEYVESML  566



>ref|XP_003528417.2| PREDICTED: (3S,6E)-nerolidol synthase 2, chloroplastic/mitochondrial-like 
[Glycine max]
Length=573

 Score =   460 bits (1184),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 221/487 (45%), Positives = 322/487 (66%), Gaps = 9/487 (2%)
 Frame = -2

Query  1653  EDDLQVLNVIDAIQHLGIDHHFHDQIGAILQRQY-QKVKIDDFQKINGLYDISLSFRLLR  1477
             E+ L+ L +IDA+Q L ID+HF ++I   L+RQY     I      + +++I+L FRLLR
Sbjct  82    ENSLRGLYMIDAMQRLNIDYHFQEEIEEFLRRQYVNSTTIAGGYYGDDIHEIALRFRLLR  141

Query  1476  QEGYNVSSDVFTKFTSEKGEFKEELSKDIRGLMALHEASHLSIEGEDVLDEAAKFSRESL  1297
             Q+G+ V  +VF KFT+++G+F ++L ++I+G++ L+EAS L I GED L EA +FS   L
Sbjct  142   QQGFFVPEEVFHKFTNKEGKFNQKLGENIKGMVELYEASPLGIAGEDTLAEAGEFSGPVL  201

Query  1296  IANM--VHLDECQASMVQNTLQYPYHKSLARFTAKTFIENMRVENEWEATLVNLATMDYS  1123
                +  + +   +A  V+ TL+ P+HKSL  FTA+ F  +    N W  +L  +A MD+S
Sbjct  202   KEKLDCIDIHNLEAKFVKRTLEQPFHKSLPMFTARNFFGDFDATNTWLGSLKEVAKMDFS  261

Query  1122  ITQSFYQEEFRQILRWWKSLGLKDEL--AKNQQLKWYIWTLALIPDPSMSRERIELTKPI  949
             + Q  Y  E  QI  WW  LGL +EL  A+NQ LKWYIW+LA   DP++S ER+ELTKPI
Sbjct  262   LLQCMYHREITQISNWWTGLGLANELMYARNQPLKWYIWSLACFTDPTLSEERVELTKPI  321

Query  948   ALVYLIDDIIDVYATFDQTKQFIDAINRWDLSVGEGLPDYMKRCLVVLFDTTNDINNLVF  769
             +L+Y+IDDI DVY T D+   F +A+ RWD++  E LPDYMK C  VL++ TN+I++ V+
Sbjct  322   SLIYIIDDIFDVYGTLDELTLFTEAVCRWDITAIEQLPDYMKACFGVLYNLTNEISSKVY  381

Query  768   EKYGWNPIDHLKRAWKCLCSAYITEAKWFATGKSPSANEYLQTGIITTGIPMVLITCFFL  589
             +K+GWNPID L+ AWK LC A++ EAKWFA+G  PSA EYL+ GI+++G+ +V++  FFL
Sbjct  382   QKHGWNPIDSLQHAWKSLCKAFLVEAKWFASGNLPSAEEYLKNGIVSSGVHIVMVHAFFL  441

Query  588   LGHGAFAGTTDI----EDMITSVGAILRLLDDLDATQGEKQDGNDASYVEYYVKEHEGLS  421
             LGHG       I     D+I+S   ILRL DDL   + E Q GND SYV   + +H   +
Sbjct  442   LGHGLTEENIKIIDRNPDIISSPATILRLWDDLGNAEDENQQGNDGSYVNCLMMDHPHYT  501

Query  420   ISDGKQRIMNMVSEQWKLINKQCLSPTRIPESFSKSCLNIARMVPMMYNYSDTHCLPILQ  241
                 ++R+M+ +S+ WK +N++CL       +F+K+ LN+ARMVP+MY+Y D   LP L+
Sbjct  502   TRTARKRVMSKISDAWKSLNQECLFGNHFHSTFTKASLNLARMVPLMYSYDDKQSLPGLE  561

Query  240   KQIMSMF  220
             +Q+ S+ 
Sbjct  562   EQVKSLL  568



>emb|CBI41007.3| unnamed protein product [Vitis vinifera]
Length=573

 Score =   459 bits (1182),  Expect = 4e-150, Method: Compositional matrix adjust.
 Identities = 225/506 (44%), Positives = 331/506 (65%), Gaps = 46/506 (9%)
 Frame = -2

Query  1719  DEFLLKSEGKREWQRGLLYQFQEDDLQVLNVIDAIQHLGIDHHFHDQIGAILQRQYQKVK  1540
             DEF +K   + +  R +  +  ED L+ L +IDAIQ LGID+HF ++I A+LQRQY K  
Sbjct  102   DEFYVKHAQRLDEIRNVFSEVGEDTLEGLMMIDAIQRLGIDYHFKEEIEAVLQRQYTKAS  161

Query  1539  IDDFQKINGLYDISLSFRLLRQEGYNVSSDVFTKFTSEKGEFKEELSKDIRGLMALHEAS  1360
                 + I  LY+++L FRLLRQEGY+V +DVF  F +++G+FK+ LSKDI+GL+ L+EAS
Sbjct  162   THG-ESIQDLYEVALRFRLLRQEGYHVPADVFNNFKNKEGKFKQNLSKDIKGLLGLYEAS  220

Query  1359  HLSIEGEDVLDEAAKFSRESLIANMVHLDECQASMVQNTLQYPYHKSLARFTAKTFIENM  1180
              LSIEGED+L+EA +FS   L A + HLD  +A++V +TL++P+HKSL RF AK+F+++ 
Sbjct  221   QLSIEGEDILEEAQRFSSTLLNAGLEHLDHHEATVVGHTLEHPHHKSLPRFMAKSFLKDF  280

Query  1179  RVENEWEATLVNLATMDYSITQSFYQEEFRQILRWWKSLGLKDEL--AKNQQLKWYIWTL  1006
             +  N W   L  LA  D+++ QS +Q+E  QI +WW+ LGL +EL  A++Q LKW++W +
Sbjct  281   QGPNGWLTVLQELAKADFNMVQSIHQQELLQISKWWQDLGLAEELKFARDQPLKWHMWPM  340

Query  1005  ALIPDPSMSRERIELTKPIALVYLIDDIIDVYATFDQTKQFIDAINRWDLSVGEGLPDYM  826
             A++PDPS+                                       WD++  E LP+YM
Sbjct  341   AVLPDPSL---------------------------------------WDIAAFETLPNYM  361

Query  825   KRCLVVLFDTTNDINNLVFEKYGWNPIDHLKRAWKCLCSAYITEAKWFATGKSPSANEYL  646
             K C   L + TN+I+N V++++GWNP+D L++ W  LC+A++ EAKWFA+G  P A+EYL
Sbjct  362   KICFKTLDEITNEISNKVYKEHGWNPVDSLRKTWMSLCNAFLVEAKWFASGHVPKAHEYL  421

Query  645   QTGIITTGIPMVLITCFFLLGHGAFAGTTDIED----MITSVGAILRLLDDLDATQGEKQ  478
             + G+I++G+ +VL+  FFLLGHG   G  D+ D    +I+S  AILRL DDL + + E Q
Sbjct  422   KNGVISSGVHVVLVHLFFLLGHGITRGNVDLVDDFPSIISSTAAILRLWDDLGSAKDENQ  481

Query  477   DGNDASYVEYYVKEHEGLSISDGKQRIMNMVSEQWKLINKQCLSPTRIPESFSKSCLNIA  298
             DG+D SY+E Y+KEH+G S+ + +Q +  M+S+  K +NK+CLS      SF+K  LNIA
Sbjct  482   DGHDGSYIECYIKEHQGSSMENARQNVTYMISDLRKRLNKECLSQHPFSTSFTKGSLNIA  541

Query  297   RMVPMMYNYSDTHCLPILQKQIMSMF  220
             RMVP+MY+Y D   LP L++ + S+ 
Sbjct  542   RMVPLMYSYDDNQSLPHLEEHMKSLL  567



>ref|XP_008245819.1| PREDICTED: (3S,6E)-nerolidol synthase 1-like [Prunus mume]
Length=536

 Score =   456 bits (1172),  Expect = 5e-149, Method: Compositional matrix adjust.
 Identities = 219/483 (45%), Positives = 320/483 (66%), Gaps = 11/483 (2%)
 Frame = -2

Query  1641  QVLNVIDAIQHLGIDHHFHDQIGAILQRQYQKVKIDDFQKINGLYDISLSFRLLRQEGYN  1462
             ++L  +DA+QHLG+DHHF ++I A LQ+QY     DD    + L ++SL FRLLRQ+GY+
Sbjct  40    ELLIAVDAMQHLGLDHHFREEIEAFLQKQYHARAYDDCN--HQLLEVSLRFRLLRQQGYH  97

Query  1461  VSSDVFTKFTSEKGEFKEELSKDIRGLMALHEASHLSIEGEDVLDEAAKFSRESLIANMV  1282
             V++DVF KF + +      L KDI GL+ L+EASHLS +GED LDEA K S + L A + 
Sbjct  98    VTTDVFNKFKNIEDLTSGLLDKDIEGLVGLYEASHLSFQGEDALDEAGKLSHQILTAWLP  157

Query  1281  H-LDECQASMVQNTLQYPYHKSLARFTAKTFIENMRVENEWEATLVNLATMDYSITQSFY  1105
             + LD+ +A +V ++L++PYHKSL RF AK F++  +   +W   L  LA +++++ +S  
Sbjct  158   NNLDDHRAPLVSHSLKHPYHKSLTRFMAKNFLDYFQGTEKWARVLQELAKLEFNLVESII  217

Query  1104  QEEFRQILRWWKSLGLKDEL--AKNQQLKWYIWTLALIPDPSMSRERIELTKPIALVYLI  931
             + E  QI +WWK LGL  EL   ++Q +KWY W +A + DPS+S ER+ELTK I+LVY+I
Sbjct  218   RNEILQISKWWKELGLTKELNFVRDQPIKWYTWPMACLTDPSLSEERVELTKSISLVYII  277

Query  930   DDIIDVYATFDQTKQFIDAINRWDLSVGEGLPDYMKRCLVVLFDTTNDINNLVFEKYGWN  751
             DDI DV+ T D+   F  A+ RWDL   + LPDYMK     L+D TN+ ++  ++++GWN
Sbjct  278   DDIFDVHGTLDELVLFTAAVERWDLDETDELPDYMKISFKALYDITNETSDRAYKRHGWN  337

Query  750   PIDHLKRAWKCLCSAYITEAKWFATGKSPSANEYLQTGIITTGIPMVLITCFFLLGHGAF  571
             PI+ LK++W  LC A++ EA+WF  G  P+A +YL+ G+I+TG+P VL   FF+LG G  
Sbjct  338   PIESLKKSWAILCKAFLLEAQWFRCGHLPNAEDYLKNGVISTGVPAVLTHAFFILGQGIT  397

Query  570   AGTTDIED------MITSVGAILRLLDDLDATQGEKQDGNDASYVEYYVKEHEGLSISDG  409
                 DI D      +I+S   ILRL DD  + + E Q+G D SY++ YV EHEG S  D 
Sbjct  398   QQAIDIVDNINTPGIISSTATILRLWDDFGSAKDENQNGYDGSYIQCYVNEHEGCSDEDA  457

Query  408   KQRIMNMVSEQWKLINKQCLSPTRIPESFSKSCLNIARMVPMMYNYSDTHCLPILQKQIM  229
             +  +++ +S++WK +N++C S     ESF+K  LN+ARMVPMMY+Y+  H LP L++ + 
Sbjct  458   RACVIHKISDEWKRLNQECFSSNPFSESFTKLALNVARMVPMMYDYNTQHRLPSLEENMK  517

Query  228   SMF  220
             S+ 
Sbjct  518   SLL  520



>ref|XP_010248179.1| PREDICTED: (3S,6E)-nerolidol synthase 1-like [Nelumbo nucifera]
 ref|XP_010248191.1| PREDICTED: (3S,6E)-nerolidol synthase 1-like [Nelumbo nucifera]
Length=609

 Score =   457 bits (1175),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 216/492 (44%), Positives = 330/492 (67%), Gaps = 8/492 (2%)
 Frame = -2

Query  1674  GLLYQFQEDDLQVLNVIDAIQHLGIDHHFHDQIGAILQRQYQKVKIDDFQKING-LYDIS  1498
             GLL +  ED L+ + +IDA+Q L IDHHF ++I  +L   Y +   D +Q   G L+D+S
Sbjct  111   GLLLKV-EDPLESMALIDALQRLCIDHHFEEEIRTVLSVLYTRFGSDIYQMGTGSLHDVS  169

Query  1497  LSFRLLRQEGYNVSSDVFTKFTSEKGEFKEELSKDIRGLMALHEASHLSIEGEDVLDEAA  1318
             L FRL RQ GY V +DVF KF   +G FK EL++D RG+++L EASHL I GED+LDEA 
Sbjct  170   LCFRLFRQAGYCVPTDVFDKFRDNRGRFKPELNEDTRGMLSLFEASHLGIHGEDILDEAN  229

Query  1317  KFSRESLIANMVHLDECQASMVQNTLQYPYHKSLARFTAKTFIENMRVENEWEATLVNLA  1138
             + + + L A+ ++L    A  V++TL++P++KSLA F  K++++N      W  +L  LA
Sbjct  230   ELAYKHLSASRLNLSPPLARAVEDTLKHPFNKSLASFKVKSYLKNFSSSYWWHNSLQELA  289

Query  1137  TMDYSITQSFYQEEFRQILRWWKSLGLKDEL--AKNQQLKWYIWTLALIPDPSMSRERIE  964
              +++++ QS +++E  Q+ +WW+ LGL DEL  A+NQ LKWY+W++ ++ DP  S +RI+
Sbjct  290   KVEFNLVQSLHRQEVAQVSQWWRDLGLSDELKFARNQPLKWYMWSMVVLRDPRFSEQRID  349

Query  963   LTKPIALVYLIDDIIDVYATFDQTKQFIDAINRWDLSVGEGLPDYMKRCLVVLFDTTNDI  784
             LTKPIAL+Y+IDDI DVY T D+   F + IN+W+L   E LP YM++C   L+  TN+I
Sbjct  350   LTKPIALIYIIDDIFDVYGTLDELVIFTEVINKWELVAAEQLPKYMRKCFKALYGITNEI  409

Query  783   NNLVFEKYGWNPIDHLKRAWKCLCSAYITEAKWFATGKSPSANEYLQTGIITTGIPMVLI  604
                VF++ GWNPI+ L++AW  LC+A++ EAKWF++ + P+  +YL+ GI+++G+ + LI
Sbjct  410   CTKVFKETGWNPINSLQKAWASLCNAFLVEAKWFSSRQLPNETDYLKNGIVSSGVHVALI  469

Query  603   TCFFLLGHGAFAGTTDIED----MITSVGAILRLLDDLDATQGEKQDGNDASYVEYYVKE  436
               FFLLG G    + D  D    +I+S  +ILRL DDL + + E Q+G D SY+E Y+K 
Sbjct  470   HIFFLLGQGITKESVDYLDAAPAIISSSASILRLWDDLGSAKDENQEGYDGSYIECYMKN  529

Query  435   HEGLSISDGKQRIMNMVSEQWKLINKQCLSPTRIPESFSKSCLNIARMVPMMYNYSDTHC  256
             H+G+SI   +  ++ M+S+ WK +N++CLSP     +F ++  N A+MV +MY+Y D   
Sbjct  530   HQGISIEGARNHVLGMISDSWKQLNQECLSPNPFSPTFIEAIHNFAKMVSVMYDYDDYRR  589

Query  255   LPILQKQIMSMF  220
             LP+L++ I S+ 
Sbjct  590   LPVLEEYINSLL  601



>ref|XP_008224887.1| PREDICTED: (3S,6E)-nerolidol synthase 1-like isoform X1 [Prunus 
mume]
Length=536

 Score =   453 bits (1166),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 217/483 (45%), Positives = 321/483 (66%), Gaps = 11/483 (2%)
 Frame = -2

Query  1641  QVLNVIDAIQHLGIDHHFHDQIGAILQRQYQKVKIDDFQKINGLYDISLSFRLLRQEGYN  1462
             ++L  +DA+QHLG++HHF +++ A LQ+QY     DD    + L ++SL FRLLRQ+GY+
Sbjct  40    ELLIAVDAMQHLGLEHHFREEMEAFLQKQYHARAYDDCN--HQLLEVSLRFRLLRQQGYH  97

Query  1461  VSSDVFTKFTSEKGEFKEELSKDIRGLMALHEASHLSIEGEDVLDEAAKFSRESLIANMV  1282
             V++DVF KF + +      L KDI GL+ L+EASHLS +GED LDEA K S + L A + 
Sbjct  98    VTTDVFNKFKNIEDLTSGLLYKDIEGLVGLYEASHLSFQGEDALDEAGKLSHQILTAWLP  157

Query  1281  H-LDECQASMVQNTLQYPYHKSLARFTAKTFIENMRVENEWEATLVNLATMDYSITQSFY  1105
             + LD+ +A +V ++L++PYHKSL RF AK F+++ +   +W   L  LA +++++ +S  
Sbjct  158   NNLDDHRAPLVSHSLKHPYHKSLTRFMAKNFLDHFQGTEKWARVLQELAKLEFNLVESII  217

Query  1104  QEEFRQILRWWKSLGLKDEL--AKNQQLKWYIWTLALIPDPSMSRERIELTKPIALVYLI  931
             + E  QI +WWK LGL  EL   ++Q +KWY W +A + DPS+S ER+ELTK I+LVY+I
Sbjct  218   RNEILQISKWWKELGLTKELNFVRDQPIKWYTWPMACLTDPSLSEERVELTKSISLVYII  277

Query  930   DDIIDVYATFDQTKQFIDAINRWDLSVGEGLPDYMKRCLVVLFDTTNDINNLVFEKYGWN  751
             DDI DV+ T D+   F  A+ RWDL   + LPDYMK     L+D TN+ ++  ++++GWN
Sbjct  278   DDIFDVHGTLDELVLFTAAVERWDLDETDELPDYMKISFKALYDITNETSDRAYKRHGWN  337

Query  750   PIDHLKRAWKCLCSAYITEAKWFATGKSPSANEYLQTGIITTGIPMVLITCFFLLGHGAF  571
             PI+ LK++W  LC A++ EA+WF  G  P+A +YL+ G+I+TG+P VL   FF+LG G  
Sbjct  338   PIESLKKSWAILCKAFLLEAQWFRCGHLPNAEDYLKNGVISTGVPAVLTHAFFILGQGIT  397

Query  570   AGTTDIED------MITSVGAILRLLDDLDATQGEKQDGNDASYVEYYVKEHEGLSISDG  409
                 DI D      +I+S   ILRL DD  + + E Q+G D SY++ YV EHEG S  D 
Sbjct  398   QQAIDIVDNINTPGIISSTATILRLWDDFGSAKDENQNGYDGSYIQCYVNEHEGCSDEDA  457

Query  408   KQRIMNMVSEQWKLINKQCLSPTRIPESFSKSCLNIARMVPMMYNYSDTHCLPILQKQIM  229
             +  +++ +S++WK +N++C S     ESF+K  LN+ARMVPMMY+Y+  H LP L++ + 
Sbjct  458   RACVIHKISDEWKRLNQECFSSNPFSESFTKLALNVARMVPMMYDYNTQHRLPSLEENMK  517

Query  228   SMF  220
             S+ 
Sbjct  518   SLL  520



>ref|XP_010106430.1| (3S,6E)-nerolidol synthase 1 [Morus notabilis]
 gb|EXC10518.1| (3S,6E)-nerolidol synthase 1 [Morus notabilis]
Length=576

 Score =   454 bits (1169),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 231/489 (47%), Positives = 317/489 (65%), Gaps = 24/489 (5%)
 Frame = -2

Query  1641  QVLNVIDAIQHLGIDHHFHDQIGAILQRQYQKVK--IDDFQKI-NGLYDISLSFRLLRQE  1471
             Q L VIDAIQ LGID+ F ++I  IL+ Q+       D+   I + L+D +L FRLLRQ+
Sbjct  91    QALKVIDAIQRLGIDYLFQEEIEKILRNQFMSFDHYTDNKHNIEDHLHDAALRFRLLRQQ  150

Query  1470  GYNVSSDVFTKFTSEKGE-FKEELSKDIRGLMALHEASHLSIEGEDVLDEAAKFSRESLI  1294
             GY V + +F K   +KG  FK EL KDI GLM L+EASHLSIEGEDVLDEA  FS + L 
Sbjct  151   GYFVPAGIFNKLKDKKGNNFKTELGKDINGLMELYEASHLSIEGEDVLDEAKIFSSQLLT  210

Query  1293  ANMVHL--DECQASMVQNTLQYPYHKSLARFTAKTFI---ENMRVENEWEATLVNLATMD  1129
             A+M  L  D  +A  + NTL+YP HK+LA+FTAK       +    N W   L  LA  +
Sbjct  211   ASMTCLGDDHRRARAIANTLEYPCHKTLAKFTAKNLFGTTSHFESANGWINVLQELAKYE  270

Query  1128  YSITQSFYQEEFRQILRWWKSLGLKDEL--AKNQQLKWYIWTLALIPDPSMSRERIELTK  955
             ++  QS ++ E  QI +WW+ +G+  EL  A++Q LKWYIW+   + DPS+S++R+ELTK
Sbjct  271   FNQVQSLHKREILQISQWWRDMGMAKELPFARDQPLKWYIWSTGCLTDPSLSQQRVELTK  330

Query  954   PIALVYLIDDIIDVYATFDQTKQFIDAINRWDLSVGEGLPDYMKRCLVVLFDTTNDINNL  775
             PI+ VY+IDDI DVY   D+   F +AINRWD++  E LP  MK C   L + TN+I++ 
Sbjct  331   PISFVYIIDDIFDVYGNLDELTLFTEAINRWDITAVEKLPHCMKICFKALDNLTNEISHK  390

Query  774   VFEKYGWNPIDHLKRAWKCLCSAYITEAKWFATGKSPSANEYLQTGIITTGIPMVLITCF  595
             V+++ GWNP   L++AW  LC A++ EAKWFA+G+ P   EYL+ G++++G+PMVL+  F
Sbjct  391   VYQECGWNPSHSLRKAWATLCDAFLVEAKWFASGQVPKTEEYLRNGVVSSGVPMVLLHLF  450

Query  594   FLLGHGAFAGTTDIED----MITSVGAILRLLDDLDATQGEKQDGNDASYVEYYVKEHEG  427
             FLLG      T D  D    +ITS  AIL           E Q+G+D SYVE Y+KE +G
Sbjct  451   FLLGQSITQDTVDFVDKMPGIITSTAAIL---------NDENQEGHDGSYVECYMKERQG  501

Query  426   LSISDGKQRIMNMVSEQWKLINKQCLSPTRIPESFSKSCLNIARMVPMMYNYSDTHCLPI  247
              SI + +Q I   +S+ WK +NK+CLSP  +P +F K+CLN+AR+VP+MY+Y D   LP 
Sbjct  502   SSIEEARQNITERISDAWKCLNKECLSPNPLPATFLKACLNVARLVPLMYSYDDNQHLPS  561

Query  246   LQKQIMSMF  220
             L++ + SMF
Sbjct  562   LEQHMKSMF  570



>ref|XP_010646705.1| PREDICTED: (3S,6E)-nerolidol synthase 1-like isoform X2 [Vitis 
vinifera]
Length=539

 Score =   453 bits (1166),  Expect = 4e-148, Method: Compositional matrix adjust.
 Identities = 232/506 (46%), Positives = 321/506 (63%), Gaps = 53/506 (10%)
 Frame = -2

Query  1719  DEFLLKSEGKREWQRGLLYQFQEDDLQVLNVIDAIQHLGIDHHFHDQIGAILQRQYQKVK  1540
             DEF  +   K +  + +  +  ED ++ + +IDAIQ LGIDHHF ++I A+LQ+QY K  
Sbjct  67    DEFYNEHAQKLKEVKHVFSKLGEDAMESMMMIDAIQRLGIDHHFEEEIEAVLQKQYMKSS  126

Query  1539  IDDFQKINGLYDISLSFRLLRQEGYNVSSDVFTKFTSEKGEFKEELSKDIRGLMALHEAS  1360
             I        LY+++L FRLLRQEGY + +DV   F +++G+FK+ L +DIRGLM L+EAS
Sbjct  127   IHG-DCDEDLYEVALRFRLLRQEGYTLPADVLNNFKNKEGKFKQNLREDIRGLMGLYEAS  185

Query  1359  HLSIEGEDVLDEAAKFSRESLIANMVHLDECQASMVQNTLQYPYHKSLARFTAKTFIENM  1180
              LSI GED+L+EA  FS   L A + HLD  QA++V+NTL++P+HKSLAR          
Sbjct  186   QLSI-GEDILEEAGNFSSLLLNACLQHLDRHQAAVVKNTLEHPHHKSLAR----------  234

Query  1179  RVENEWEATLVNLATMDYSITQSFYQEEFRQILRWWKSLGLKDEL--AKNQQLKWYIWTL  1006
                                               WWK LGL +EL  A++Q LKWY+W +
Sbjct  235   ----------------------------------WWKDLGLTEELKFARDQPLKWYMWPM  260

Query  1005  ALIPDPSMSRERIELTKPIALVYLIDDIIDVYATFDQTKQFIDAINRWDLSVGEGLPDYM  826
             A+IPDP +S +RIELTKPI+L+Y+IDDI DV  T D+   F +A+NRWDLS  + LP+YM
Sbjct  261   AIIPDPRLSEQRIELTKPISLIYIIDDIFDVGGTLDELTLFTEAVNRWDLSAFKELPEYM  320

Query  825   KRCLVVLFDTTNDINNLVFEKYGWNPIDHLKRAWKCLCSAYITEAKWFATGKSPSANEYL  646
             K C   L D TN+I+  V  K   NP+  L++AW  LC+A++ EAKWFA+G  P A EYL
Sbjct  321   KMCFKTLDDITNEISTKV-HKVHKNPVGSLRKAWASLCNAFLVEAKWFASGHVPKAEEYL  379

Query  645   QTGIITTGIPMVLITCFFLLGHGAFAGTTDIED----MITSVGAILRLLDDLDATQGEKQ  478
             + G +++G+ +VL+  FFLLGHG      D+ D    +I+S   ILRL DDL + + E Q
Sbjct  380   KNGAVSSGVHVVLVHLFFLLGHGITKENVDLVDDFPGIISSTATILRLWDDLGSAKDENQ  439

Query  477   DGNDASYVEYYVKEHEGLSISDGKQRIMNMVSEQWKLINKQCLSPTRIPESFSKSCLNIA  298
             DG+D SYVE Y+KEH G S+ + +Q + +M+S+ WK +NK+CLSP     SF+K  LNIA
Sbjct  440   DGHDGSYVECYLKEHRGSSVENARQIVAHMISDMWKRLNKECLSPNPFSTSFTKGSLNIA  499

Query  297   RMVPMMYNYSDTHCLPILQKQIMSMF  220
             RMVP+MY+Y D  CLP L++ + S+ 
Sbjct  500   RMVPLMYSYDDQQCLPGLEEHMKSLL  525



>ref|XP_008224888.1| PREDICTED: (3S,6E)-nerolidol synthase 1-like isoform X2 [Prunus 
mume]
Length=524

 Score =   452 bits (1164),  Expect = 4e-148, Method: Compositional matrix adjust.
 Identities = 217/483 (45%), Positives = 321/483 (66%), Gaps = 11/483 (2%)
 Frame = -2

Query  1641  QVLNVIDAIQHLGIDHHFHDQIGAILQRQYQKVKIDDFQKINGLYDISLSFRLLRQEGYN  1462
             ++L  +DA+QHLG++HHF +++ A LQ+QY     DD    + L ++SL FRLLRQ+GY+
Sbjct  28    ELLIAVDAMQHLGLEHHFREEMEAFLQKQYHARAYDDCN--HQLLEVSLRFRLLRQQGYH  85

Query  1461  VSSDVFTKFTSEKGEFKEELSKDIRGLMALHEASHLSIEGEDVLDEAAKFSRESLIANMV  1282
             V++DVF KF + +      L KDI GL+ L+EASHLS +GED LDEA K S + L A + 
Sbjct  86    VTTDVFNKFKNIEDLTSGLLYKDIEGLVGLYEASHLSFQGEDALDEAGKLSHQILTAWLP  145

Query  1281  H-LDECQASMVQNTLQYPYHKSLARFTAKTFIENMRVENEWEATLVNLATMDYSITQSFY  1105
             + LD+ +A +V ++L++PYHKSL RF AK F+++ +   +W   L  LA +++++ +S  
Sbjct  146   NNLDDHRAPLVSHSLKHPYHKSLTRFMAKNFLDHFQGTEKWARVLQELAKLEFNLVESII  205

Query  1104  QEEFRQILRWWKSLGLKDEL--AKNQQLKWYIWTLALIPDPSMSRERIELTKPIALVYLI  931
             + E  QI +WWK LGL  EL   ++Q +KWY W +A + DPS+S ER+ELTK I+LVY+I
Sbjct  206   RNEILQISKWWKELGLTKELNFVRDQPIKWYTWPMACLTDPSLSEERVELTKSISLVYII  265

Query  930   DDIIDVYATFDQTKQFIDAINRWDLSVGEGLPDYMKRCLVVLFDTTNDINNLVFEKYGWN  751
             DDI DV+ T D+   F  A+ RWDL   + LPDYMK     L+D TN+ ++  ++++GWN
Sbjct  266   DDIFDVHGTLDELVLFTAAVERWDLDETDELPDYMKISFKALYDITNETSDRAYKRHGWN  325

Query  750   PIDHLKRAWKCLCSAYITEAKWFATGKSPSANEYLQTGIITTGIPMVLITCFFLLGHGAF  571
             PI+ LK++W  LC A++ EA+WF  G  P+A +YL+ G+I+TG+P VL   FF+LG G  
Sbjct  326   PIESLKKSWAILCKAFLLEAQWFRCGHLPNAEDYLKNGVISTGVPAVLTHAFFILGQGIT  385

Query  570   AGTTDIED------MITSVGAILRLLDDLDATQGEKQDGNDASYVEYYVKEHEGLSISDG  409
                 DI D      +I+S   ILRL DD  + + E Q+G D SY++ YV EHEG S  D 
Sbjct  386   QQAIDIVDNINTPGIISSTATILRLWDDFGSAKDENQNGYDGSYIQCYVNEHEGCSDEDA  445

Query  408   KQRIMNMVSEQWKLINKQCLSPTRIPESFSKSCLNIARMVPMMYNYSDTHCLPILQKQIM  229
             +  +++ +S++WK +N++C S     ESF+K  LN+ARMVPMMY+Y+  H LP L++ + 
Sbjct  446   RACVIHKISDEWKRLNQECFSSNPFSESFTKLALNVARMVPMMYDYNTQHRLPSLEENMK  505

Query  228   SMF  220
             S+ 
Sbjct  506   SLL  508



>gb|AHY21667.1| nerolidol synthase [Populus nigra]
Length=528

 Score =   452 bits (1164),  Expect = 5e-148, Method: Compositional matrix adjust.
 Identities = 215/483 (45%), Positives = 324/483 (67%), Gaps = 14/483 (3%)
 Frame = -2

Query  1653  EDDLQVLNVIDAIQHLGIDHHFHDQIGAILQRQYQKVKIDDFQKINGLYDISLSFRLLRQ  1474
             +D L+ L + DA+Q LGID+HF ++I A L  QY  +   +   ++ ++ ++L FRLLRQ
Sbjct  45    KDPLEGLVMTDALQRLGIDYHFREEIEAFLNTQYMNLSSPNHPPLD-VFGVALRFRLLRQ  103

Query  1473  EGYNVSSDVFTKFTSEKGEFKEELSKDIRGLMALHEASHLSIEGEDVLDEAAKFSRESLI  1294
             EGYNVS +VF  F +E+G F      D++GLMAL+EAS LS+E ED+LDEA +FS + L 
Sbjct  104   EGYNVSQEVFNNFKNEEGNFHLIQENDVKGLMALYEASQLSMESEDILDEAGEFSAKLL-  162

Query  1293  ANMVHLDECQASMVQNTLQYPYHKSLARFTAKTFIENMRVENEWEATLVNLATMDYSITQ  1114
                   +  ++ +V NTL++PYHKSLARF  K F+ N+ + NE       LA +D  I +
Sbjct  163   ------NHHESEIVANTLKHPYHKSLARFMVKNFLNNIDIGNENIKVFSELAKIDCEIVR  216

Query  1113  SFYQEEFRQILRWWKSLGLKDEL--AKNQQLKWYIWTLALIPDPSMSRERIELTKPIALV  940
             S +Q+E  QI  WW+ LGL  EL  A++Q LKW++ +++++ DP++S +R+ELTKPI+LV
Sbjct  217   SIHQKEILQISNWWEDLGLAKELKFARDQPLKWHMRSMSVLIDPNLSEQRVELTKPISLV  276

Query  939   YLIDDIIDVYATFDQTKQFIDAINRWDLSVGEGLPDYMKRCLVVLFDTTNDINNLVFEKY  760
             Y+IDDI D+Y T +    F +A+N WDL+    LP+ MK  L  LFD T  I+  +FEK+
Sbjct  277   YIIDDIFDLYGTLNDLSIFTEAVNEWDLTAANQLPESMKISLKALFDITASISTKIFEKH  336

Query  759   GWNPIDHLKRAWKCLCSAYITEAKWFATGKSPSANEYLQTGIITTGIPMVLITCFFLLGH  580
             GWNPI+ L+++WK LC+A++ EAKWFA+GK P   EYL+ GI+++G+ +VL+  FFLLG 
Sbjct  337   GWNPIESLQKSWKKLCNAFLEEAKWFASGKLPKPEEYLRNGIVSSGVHVVLVHMFFLLGQ  396

Query  579   GAFAGTTDIED----MITSVGAILRLLDDLDATQGEKQDGNDASYVEYYVKEHEGLSISD  412
             G    T D  D    +I+    ILRL DDL   + E QDG+D SY+E Y++EH  +++  
Sbjct  397   GINKETVDFVDGFPPIISFTATILRLWDDLGTAKDENQDGHDGSYLECYIREHPNVTVER  456

Query  411   GKQRIMNMVSEQWKLINKQCLSPTRIPESFSKSCLNIARMVPMMYNYSDTHCLPILQKQI  232
              ++ + +++ + WK +N++CLSP+    SF+K+CLN+ARM+P+MY+Y D   L  L++ +
Sbjct  457   AREHVSHLICDAWKKLNQECLSPSPFSPSFTKACLNVARMIPLMYSYDDNPSLASLKEHM  516

Query  231   MSM  223
              S+
Sbjct  517   RSL  519



>ref|XP_011003385.1| PREDICTED: (3S,6E)-nerolidol synthase 1-like [Populus euphratica]
Length=527

 Score =   452 bits (1163),  Expect = 8e-148, Method: Compositional matrix adjust.
 Identities = 215/482 (45%), Positives = 321/482 (67%), Gaps = 14/482 (3%)
 Frame = -2

Query  1650  DDLQVLNVIDAIQHLGIDHHFHDQIGAILQRQYQKVKIDDFQKINGLYDISLSFRLLRQE  1471
             D L+ L +ID +Q LGID+HF ++I A L  QY      +   ++ ++ ++L FRLLRQE
Sbjct  45    DPLEGLVMIDTLQRLGIDYHFREEIEAFLNTQYMNFSSPNHLPLD-VFGVALRFRLLRQE  103

Query  1470  GYNVSSDVFTKFTSEKGEFKEELSKDIRGLMALHEASHLSIEGEDVLDEAAKFSRESLIA  1291
             GYNVS +VF  F +E+G F      D++GLMAL+EAS LS+E ED+LDEA  FS + L  
Sbjct  104   GYNVSQEVFNNFRNEEGNFHLIQENDVKGLMALYEASQLSMESEDILDEAGDFSAKLL--  161

Query  1290  NMVHLDECQASMVQNTLQYPYHKSLARFTAKTFIENMRVENEWEATLVNLATMDYSITQS  1111
                  +  ++ +V NTL++PYHKSLARF  K F+ N+ + NE       LA +D  I +S
Sbjct  162   -----NHHESEIVANTLKHPYHKSLARFMVKNFLNNIDIRNENIKVFSELAKIDCEIVRS  216

Query  1110  FYQEEFRQILRWWKSLGLKDEL--AKNQQLKWYIWTLALIPDPSMSRERIELTKPIALVY  937
              +Q+E  +I  WWK LGL  EL  A++Q LKW++W+++++ DP++S +R+ELTKPI+LVY
Sbjct  217   IHQKEILEISNWWKDLGLAKELKFARDQPLKWHMWSMSVLIDPNLSEQRVELTKPISLVY  276

Query  936   LIDDIIDVYATFDQTKQFIDAINRWDLSVGEGLPDYMKRCLVVLFDTTNDINNLVFEKYG  757
             +IDDI D+Y T +    F +A+N WDL+    LP+ MK  L  LFD T  I+  +FEK+G
Sbjct  277   IIDDIFDLYGTLNDLSIFTEAVNEWDLTAANQLPESMKISLKALFDITERISTKIFEKHG  336

Query  756   WNPIDHLKRAWKCLCSAYITEAKWFATGKSPSANEYLQTGIITTGIPMVLITCFFLLGHG  577
             WNPI+ L+++WK LC+A++ EAKWFA+GK P   EYL+ GI+++G+ +VL+  FFLLG G
Sbjct  337   WNPIESLQKSWKKLCNAFLEEAKWFASGKLPKPEEYLRNGIVSSGVHVVLVHMFFLLGQG  396

Query  576   AFAGTTDIED----MITSVGAILRLLDDLDATQGEKQDGNDASYVEYYVKEHEGLSISDG  409
                 T D  D    +I+ +  ILRL DDL   + E QDG+D SY+E Y++EH  +++   
Sbjct  397   INKETVDFVDGFPPIISFIATILRLWDDLGTAEDENQDGHDGSYLECYIREHPNVTVERA  456

Query  408   KQRIMNMVSEQWKLINKQCLSPTRIPESFSKSCLNIARMVPMMYNYSDTHCLPILQKQIM  229
             ++ + +++ + WK +N++CLS +    SF+K+CLN+ARM+P+MY+Y D   L  L++   
Sbjct  457   REHVSHLICDAWKKLNQECLSRSPFSPSFTKACLNVARMIPLMYSYDDNPSLASLKEYTR  516

Query  228   SM  223
             S+
Sbjct  517   SL  518



>emb|CDO99690.1| unnamed protein product [Coffea canephora]
Length=605

 Score =   454 bits (1168),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 233/526 (44%), Positives = 345/526 (66%), Gaps = 15/526 (3%)
 Frame = -2

Query  1728  LSKDEFLLKSEGKREWQRGLLYQFQEDDLQVLNVIDAIQHLGIDHHFHDQIGAILQRQYQ  1549
             L  DE  ++   K    R +L    ED L+ L ++DAIQ LGIDHHF ++I A++ RQ+ 
Sbjct  59    LVNDELYVRRTQKMMDVRHMLKTGGEDRLKDLRLVDAIQRLGIDHHFQEEIEALIWRQHV  118

Query  1548  KVKIDDFQKINGLYDISLSFRLLRQEGYNVSSDVFTKFTSEKGEFKEELSK-DIRGLMAL  1372
               K   F +  GL+++SL FRLLRQEGY V  DVF  F  EKG+F     K ++R LM L
Sbjct  119   SAKCC-FDQSEGLHEVSLCFRLLRQEGYYVPPDVFNNFKDEKGKFMASSGKVNVRALMEL  177

Query  1371  HEASHLSIEGEDVLDEAAKFSRESLIANMVHLDECQASMVQNTLQYPYHKSLARFTAKTF  1192
             +EA+ LSIEGED+LD+AA+FS + L A + +LDE  A++V+NTL++PY KS+ +F A  F
Sbjct  178   YEAAQLSIEGEDILDDAAEFSSQLLNALLKYLDEDNAALVKNTLKHPYRKSMYKFKANNF  237

Query  1191  IENMRVE--NEWEATLVNLATMDYSITQSFYQEEFRQILRWWKSLGLKDEL--AKNQQLK  1024
             + +  VE  N WE  L+ L+  D+ + Q  +++E  QI +WWK LGL  EL  A++Q LK
Sbjct  238   MGS-EVEGINGWENCLLELSNADFYMAQGIHRQELLQITKWWKDLGLARELKQARDQPLK  296

Query  1023  WYIWTLALIPDPSMSRERIELTKPIALVYLIDDIIDVYATFDQTKQFIDAINRWDLSVGE  844
             WY W +A++ D  +S ER+ELTK I+ +Y+IDDI D+Y   ++   F +A+NRWDL+  +
Sbjct  297   WYTWPMAMLNDLRLSDERVELTKSISFIYIIDDIFDLYGKPEELTLFAEAVNRWDLAAVD  356

Query  843   GLPDYMKRCLVVLFDTTNDINNLVFEKYGWNPIDHLKRAWKCLCSAYITEAKWFATGK--  670
              LPDYMK+C   L+DTTN+    + +K+G+NP   L++ W  LC+A++ E++WF +G   
Sbjct  357   QLPDYMKKCFRALYDTTNEAGIKIHKKHGFNPTKFLRKTWASLCNAFLVESRWFRSGSRD  416

Query  669   SPSANEYLQTGIITTGIPMVLITCFFLLGHGAF-AGTTDIED---MITSVGAILRLLDDL  502
              P A+EYL+ G +++G+ +VL   FFLLG GA   G  D+ D   +I+SV A+LRL DDL
Sbjct  417   QPMADEYLKNGKVSSGVHVVLEHVFFLLGFGATNEGPIDLSDASAIISSVAAMLRLWDDL  476

Query  501   DATQGEKQDGNDASYVEYYVKEHEGLSISDGKQRIMNMVSEQWKLINKQCLSPTRIPESF  322
              + + E Q+G+D SY++YY+KEH+G+++   ++ +   +SE+WK +NK+CL   R   SF
Sbjct  477   GSAKDEDQNGHDGSYIDYYMKEHQGVTLDIAREHVFKQISEEWKRLNKECLRLNRFSSSF  536

Query  321   SKSCLNIARMVPMMYNYSDTHCLPILQ--KQIMSMFSTINGESIRL  190
              ++ LN+ARMVP+MY+Y D   L  L   K +++  S  N  SI L
Sbjct  537   QRASLNLARMVPLMYSYDDNQRLLDLDEFKTVITSLSIGNSISITL  582



>ref|XP_007211378.1| hypothetical protein PRUPE_ppa002670mg [Prunus persica]
 gb|EMJ12577.1| hypothetical protein PRUPE_ppa002670mg [Prunus persica]
Length=646

 Score =   455 bits (1170),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 221/487 (45%), Positives = 323/487 (66%), Gaps = 14/487 (3%)
 Frame = -2

Query  1653  EDDLQVLNVIDAIQHLGIDHHFHDQIGAILQRQYQKVKIDDFQKINGLYDISLSFRLLRQ  1474
             ED+L +   +DA+QHLG+DHHF ++I A LQ+QY     D+    + L ++SL FRLLRQ
Sbjct  149   EDELLI--AVDAMQHLGLDHHFREEIEAFLQKQYHARAYDNCN--HQLLEVSLRFRLLRQ  204

Query  1473  EGYNVSSDVFTKFTSEKGEFKEELSKDIRGLMALHEASHLSIEGEDVLDEAAKFSRESLI  1294
             +GY+V++DVF KF + + + K  L KDI GL+ L+EASHLS +GED LDEA K S + L 
Sbjct  205   QGYHVTTDVFNKFKNIQ-DLKSGLDKDIEGLVGLYEASHLSFQGEDALDEAGKLSHQILT  263

Query  1293  ANMVH-LDECQASMVQNTLQYPYHKSLARFTAKTFIENMRVENEWEATLVNLATMDYSIT  1117
             A + + LD+ +A +V ++L++PYHKSL RF AK F++  +   +W + L  LA ++ ++ 
Sbjct  264   AWLPNNLDDHRAPLVAHSLKHPYHKSLTRFMAKNFLDYFQGTEKWASILQELAKLELNVV  323

Query  1116  QSFYQEEFRQILRWWKSLGLKDEL--AKNQQLKWYIWTLALIPDPSMSRERIELTKPIAL  943
             +S  + E  QI +WWK LGL  EL   ++Q +KWY W +A + DPS+S ER+ELTK I+L
Sbjct  324   ESIIRNEILQISKWWKELGLTKELNFVRDQPIKWYTWPMACLTDPSLSEERLELTKSISL  383

Query  942   VYLIDDIIDVYATFDQTKQFIDAINRWDLSVGEGLPDYMKRCLVVLFDTTNDINNLVFEK  763
             VY+IDDI DV+ T D+   F  A+ RWDL   + LPDYMK     L+D TN+ ++  +++
Sbjct  384   VYIIDDIFDVHGTLDELVLFTAAVERWDLDETDELPDYMKISFKALYDITNETSDRAYKR  443

Query  762   YGWNPIDHLKRAWKCLCSAYITEAKWFATGKSPSANEYLQTGIITTGIPMVLITCFFLLG  583
             +GWNPI+ LK++W  LC A++ EA+WF  G  P+A +YL+ G+I+TG+P VL   FF+LG
Sbjct  444   HGWNPIESLKKSWAILCKAFLLEAQWFRCGHLPNAEDYLKNGVISTGVPAVLTHAFFILG  503

Query  582   HGAFAGTTDIED------MITSVGAILRLLDDLDATQGEKQDGNDASYVEYYVKEHEGLS  421
              G      DI D      +I+S   ILRL DD  + + E Q+G D SY++ YV EHEG S
Sbjct  504   RGITQQAIDIVDNINTPGIISSTATILRLWDDFGSAKDENQNGYDGSYIQCYVNEHEGCS  563

Query  420   ISDGKQRIMNMVSEQWKLINKQCLSPTRIPESFSKSCLNIARMVPMMYNYSDTHCLPILQ  241
               D +  ++  +S++WK +N++C S     ESF+K  LN+ARMVPMMY+Y+  H LP L+
Sbjct  564   DEDARAYVIQKISDEWKRLNQECFSSNPFSESFTKLALNVARMVPMMYDYNTQHRLPSLE  623

Query  240   KQIMSMF  220
             + + S+ 
Sbjct  624   ENMKSLL  630



>ref|XP_006352599.1| PREDICTED: (3S,6E)-nerolidol synthase 1-like [Solanum tuberosum]
Length=564

 Score =   451 bits (1161),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 225/481 (47%), Positives = 326/481 (68%), Gaps = 13/481 (3%)
 Frame = -2

Query  1635  LNVIDAIQHLGIDHHFHDQIGAILQRQYQKVKIDDFQKINGLYDISLSFRLLRQEGYNVS  1456
             L ++DA+Q +G++HHF  +I +ILQ++Y++     F K    +DISL FRLLRQEGY+VS
Sbjct  82    LVLVDALQRMGVEHHFQQEIQSILQKEYEQSAC--FYKYQNHHDISLCFRLLRQEGYHVS  139

Query  1455  SDVFTKF-TSEKGEFKEELSKDIRGLMALHEASHLSIEGEDVLDEAAKFSRESLIANMVH  1279
             +DVF +F  ++ G F   LS+D+ GL+ L+EAS L +EGE +LDE A +S E L A + +
Sbjct  140   ADVFKRFKNNDDGTFGLNLSQDVNGLIDLYEASQLGVEGEHILDEVANYSGEHLNACLAN  199

Query  1278  LDEC-QASMVQNTLQYPYHKSLARFTAKTFIENMRVENEW-EATLVNLATMDYSITQSFY  1105
              D C +A +++ TL+YPYHKSLA   AK+FI N +  N W  +TL  LA MDYSIT+  +
Sbjct  200   SDSCDEARIIKETLKYPYHKSLASCKAKSFINNFKGINGWGRSTLQELANMDYSITKEIH  259

Query  1104  QEEFRQILRWWKSLGLKDELA--KNQQLKWYIWTLALIPDPSMSRERIELTKPIALVYLI  931
             Q E  Q+ RWWKSLGL +EL   ++Q LKWY W++A++ DP MS++RIEL K I+ VY+I
Sbjct  260   QHELAQVSRWWKSLGLAEELKLLRDQPLKWYTWSMAVLQDPRMSQQRIELAKCISFVYVI  319

Query  930   DDIIDVYATFDQTKQFIDAINRWDLSVGEGLPDYMKRCLVVLFDTTNDINNLVFEKYGWN  751
             DDI DVY T ++   F  A+NRW+LS    LP+YM+     L++T N +   +++ YG N
Sbjct  320   DDIFDVYGTIEELTLFTQAVNRWELSAMVDLPEYMRSPYKALYNTINSVGYNIYKIYGQN  379

Query  750   PIDHLKRAWKCLCSAYITEAKWFATGKSPSANEYLQTGIITTGIPMVLITCFFLLGHGAF  571
             P  +L+  W  LC+A++ EAKWFA+G  PS NEYL+ G++++G+  VL+  F+LLG G  
Sbjct  380   PTQNLRNTWGNLCNAFLKEAKWFASGVVPSTNEYLKNGLVSSGVQAVLVHMFYLLGLGVS  439

Query  570   A-GTTDIEDMITSVGAILRLLDDLDATQGEKQDGNDASYVEYYVKEHEGLSISDGKQRIM  394
             +    D+  + +SV  ILRL DDL + + E Q+G D SY+E Y+KE++  SI   ++ ++
Sbjct  440   SIHLEDVSAISSSVATILRLWDDLGSAKDEDQEGKDGSYIECYMKENKDTSIELAREHVI  499

Query  393   NMVSEQWKLINKQCL---SPTRIPESFSKSCLNIARMVPMMYNYSDTHCLPILQKQIMSM  223
             N++ ++WK +NK+ L   SP+    SFSK+ LN ARMVP+MY+Y D   LPILQ+ I SM
Sbjct  500   NLIEDEWKKLNKEHLHLMSPS--SRSFSKASLNSARMVPLMYSYDDNQSLPILQEYIKSM  557

Query  222   F  220
              
Sbjct  558   L  558



>gb|AIC76496.1| linalool/nerolidol synthase [Prunus cerasoides var. campanulata]
Length=561

 Score =   450 bits (1157),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 217/481 (45%), Positives = 315/481 (65%), Gaps = 11/481 (2%)
 Frame = -2

Query  1635  LNVIDAIQHLGIDHHFHDQIGAILQRQYQKVKIDDFQKINGLYDISLSFRLLRQEGYNVS  1456
             L  +DA+QHLG+DHHF ++I   LQ+QY     D+    + L ++SL FRLLRQ+GY+V+
Sbjct  69    LIAVDAMQHLGLDHHFREEIEVFLQKQYHARAYDNCN--HQLLEVSLRFRLLRQQGYHVT  126

Query  1455  SDVFTKFTSEKGEFKEELSKDIRGLMALHEASHLSIEGEDVLDEAAKFSRESLIANMVH-  1279
             +DVF KF + +      L KDI GL+ L+EASHLS +GED LDEA K S + L A + + 
Sbjct  127   TDVFNKFKNIEDLTSGLLDKDIEGLVGLYEASHLSFQGEDALDEAGKLSHQILTAWLPNN  186

Query  1278  LDECQASMVQNTLQYPYHKSLARFTAKTFIENMRVENEWEATLVNLATMDYSITQSFYQE  1099
             LD+ +A +V ++L++PYHKSL RF AK F+   +   +W + L  LA ++ ++ +S  + 
Sbjct  187   LDDHRAPLVAHSLRHPYHKSLTRFMAKNFLNYFQGTEKWASVLQELAKLELNVVESIIRN  246

Query  1098  EFRQILRWWKSLGLKDEL--AKNQQLKWYIWTLALIPDPSMSRERIELTKPIALVYLIDD  925
             E  QI +WWK LGL  EL   ++Q +KWY W +A + DPS+S ER+ELTK I+LVY+IDD
Sbjct  247   EILQISKWWKELGLTKELNFVRDQPIKWYTWPMACLTDPSLSEERVELTKSISLVYIIDD  306

Query  924   IIDVYATFDQTKQFIDAINRWDLSVGEGLPDYMKRCLVVLFDTTNDINNLVFEKYGWNPI  745
             I DV+ T D+   F  A+ RWDL   + LPDYMK     L+D TN+ ++  ++++GWNPI
Sbjct  307   IFDVHGTLDELVLFTAAVERWDLDETDELPDYMKISFKALYDITNETSDRAYKRHGWNPI  366

Query  744   DHLKRAWKCLCSAYITEAKWFATGKSPSANEYLQTGIITTGIPMVLITCFFLLGHGAFAG  565
             + LK++W  LC A++ EA+WF  G  P+A +YL+ G+I+TG+P VL   FF+LG G    
Sbjct  367   ESLKKSWAILCKAFLLEAQWFRCGHLPNAEDYLKNGVISTGVPAVLTHAFFILGQGITQQ  426

Query  564   TTDIED------MITSVGAILRLLDDLDATQGEKQDGNDASYVEYYVKEHEGLSISDGKQ  403
               DI D      +I+S   ILRL DD  + + E Q+G D SY++ YV EHEG S  D + 
Sbjct  427   AIDIVDNINTPGIISSTATILRLWDDFGSAKDENQNGYDGSYIQCYVNEHEGCSDEDARA  486

Query  402   RIMNMVSEQWKLINKQCLSPTRIPESFSKSCLNIARMVPMMYNYSDTHCLPILQKQIMSM  223
              ++  +S++WK +N++C S     ESF+K  LN+ARMVPMMY+Y+  H LP L++ + S+
Sbjct  487   YVVQKISDEWKRLNQECFSSNPFSESFTKLALNVARMVPMMYDYNTQHRLPSLEENMKSL  546

Query  222   F  220
              
Sbjct  547   L  547



>ref|XP_002513346.1| 1,8-cineole synthase, chloroplast precursor, putative [Ricinus 
communis]
 sp|B9RHX7.1|TPS4_RICCO RecName: Full=Probable terpene synthase 4; Short=RcSeTPS4 [Ricinus 
communis]
 gb|EEF48749.1| 1,8-cineole synthase, chloroplast precursor, putative [Ricinus 
communis]
Length=563

 Score =   449 bits (1156),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 227/491 (46%), Positives = 326/491 (66%), Gaps = 12/491 (2%)
 Frame = -2

Query  1662  QFQEDDLQVLNVIDAIQHLGIDHHFHDQIGAILQRQYQKVKIDDFQKINGLYDISLSFRL  1483
             + ++D  Q L +IDA+Q LGID+HF ++   +L+ QY K+     Q  + L D +L FRL
Sbjct  69    KVRKDHSQNLIMIDALQRLGIDYHFQEETQDVLEGQYNKIFAAHQQ--HHLSDAALRFRL  126

Query  1482  LRQEGYNV-SSDVFTKFTSEKGEFKEELSKDIRGLMALHEASHLSIEGEDVLDEAAKFSR  1306
             LRQ+GY V +SDVF++  + +G+FK+EL+ DI+GLM L+EAS LSI+ E++LDEA  FS 
Sbjct  127   LRQQGYYVPASDVFSELKNREGKFKQELAADIKGLMELYEASQLSIQEENILDEAGAFSA  186

Query  1305  ESLIANMVHLDECQASMVQNTLQYPYHKSLARFTAKTFIE--NMRVENEWEATLVNLATM  1132
               L     HL + Q  +V NTL++P+H++LAR T K F+   N + ENE+  T   LA +
Sbjct  187   HFLNCWTPHLCDHQTRIVSNTLKHPFHRTLARSTIKNFLHFYNFQGENEYIQTFTELAKL  246

Query  1131  DYSITQSFYQEEFRQILRWWKSLGLKDEL--AKNQQLKWYIWTLALIPDPSMSRERIELT  958
             D+++ QS +++E  Q+  WW +LGL  EL  A++Q  KW +W L  + DPS+S +RIEL 
Sbjct  247   DFNMIQSIHRQEINQVSNWWNNLGLASELKFARDQPEKWCMWPLVGVTDPSLSWQRIELA  306

Query  957   KPIALVYLIDDIIDVYATFDQTKQFIDAINRWDLSVGEGLPDYMKRCLVVLFDTTNDINN  778
             KP++LVYLIDDI D+  T DQ   F +A+NRW+++  E LP +MK C   L+D TN I  
Sbjct  307   KPVSLVYLIDDIFDLGGTPDQLTLFTEAVNRWEITATEDLPYHMKICFRALYDVTNQIAY  366

Query  777   LVFEKYGWNPIDHLKRAWKCLCSAYITEAKWFATGKSPSANEYLQTGIITTGIPMVLITC  598
              V++K+ +NPI  LK+AW  LC+A++ EAKWFA GK P A+EYL T I+T+G+ +VL+  
Sbjct  367   KVYKKHQYNPIHSLKKAWARLCNAFLEEAKWFAAGKLPKADEYLNTAIVTSGVHLVLVHT  426

Query  597   FFLLGHGAFAGT-----TDIEDMITSVGAILRLLDDLDATQGEKQDGNDASYVEYYVKEH  433
             FFL+G G    T      D   +I+SV  ILRL DDL + Q E QDG D SY+E Y+K+ 
Sbjct  427   FFLMGDGITDQTINLLNNDDPGIISSVATILRLWDDLGSAQDENQDGYDGSYIECYMKDF  486

Query  432   EGLSISDGKQRIMNMVSEQWKLINKQCLSPTRIPESFSKSCLNIARMVPMMYNYSDTHCL  253
              G S+ D +  +++M+S+ WK +N+ CLSP     SF ++ LN ARMVP+MY++   H L
Sbjct  487   PGTSVRDARNHVISMISDTWKKLNQHCLSPNPFSGSFIRATLNGARMVPLMYDFDSNHNL  546

Query  252   PILQKQIMSMF  220
             PILQ+ I S+ 
Sbjct  547   PILQQNIKSLL  557



>ref|XP_006449155.1| hypothetical protein CICLE_v10014632mg [Citrus clementina]
 ref|XP_006449156.1| hypothetical protein CICLE_v10014632mg [Citrus clementina]
 gb|ESR62395.1| hypothetical protein CICLE_v10014632mg [Citrus clementina]
 gb|ESR62396.1| hypothetical protein CICLE_v10014632mg [Citrus clementina]
Length=614

 Score =   451 bits (1159),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 231/514 (45%), Positives = 333/514 (65%), Gaps = 13/514 (3%)
 Frame = -2

Query  1731  TLSKDEFLLKSEGKREWQRGLLYQFQEDD-LQVLNVIDAIQHLGIDHHFHDQIGAILQRQ  1555
             + + D+  +    K E  + +L +  +DD  + L +ID +Q LGID++F D+I  ILQRQ
Sbjct  94    SFNNDDIHIDHAKKLEAVKHILIRVGDDDPFEGLAMIDTVQRLGIDYYFQDEIEQILQRQ  153

Query  1554  YQKVKIDDFQKINGLYDISLSFRLLRQEGYNVSSDVFTKFTSEKGEFKEELSKDIRGLMA  1375
                   +   + N L +++L FRLLRQ+GY VS DVF  F +++G+F + +S DI GLM+
Sbjct  154   SIMFS-NHGDRHNDLQEVALRFRLLRQQGYYVSPDVFNNFKNKEGKFTQNISGDINGLMS  212

Query  1374  LHEASHLSIEGEDVLDEAAKFSRESLIANMVHL-DECQASMVQNTLQYPYHKSLARFTAK  1198
             L+EAS LSI GEDVLDEA  FS   L     HL D   A +V++ L +PY K+LA  +A+
Sbjct  213   LYEASQLSIGGEDVLDEAGDFSVNLLGEYATHLADYDLAGLVKHLLLHPYRKTLA--SAR  270

Query  1197  TFIENMRVENE--WEATLVNLATMDYSITQSFYQEEFRQILRWWKSLGL--KDELAKNQQ  1030
              F       NE  W   L  LA MD+ + QS +Q+E  QI +WWK LGL  K E A++Q 
Sbjct  271   NFFHGNFQGNEYVWILDLKELANMDFKLVQSLHQKEIVQISKWWKELGLAKKLEFARDQP  330

Query  1029  LKWYIWTLALIPDPSMSRERIELTKPIALVYLIDDIIDVYATFDQTKQFIDAINRWDLSV  850
             LKWY+W++A   DPS+S +RIELTKPI+ +Y+IDDI DVY   D    F +A+NRWDL  
Sbjct  331   LKWYMWSMACFTDPSLSWQRIELTKPISFIYIIDDIFDVYGALDVLTLFTEAVNRWDLGG  390

Query  849   GEGLPDYMKRCLVVLFDTTNDINNLVFEKYGWNPIDHLKRAWKCLCSAYITEAKWFATGK  670
              E LP+ MK C   L D TN+I+N V++++G+NP+  L++AW  LC+A++TEAKWFA+G 
Sbjct  391   IEQLPECMKICFKALNDITNEISNKVYKEHGYNPVHSLRKAWGSLCNAFLTEAKWFASGH  450

Query  669   SPSANEYLQTGIITTGIPMVLITCFFLLGHGAFAGTTDIED----MITSVGAILRLLDDL  502
              P A EYL+ GI+++G+ + L+  FFLLGHG  + T  + D    +++SV  ILRL DDL
Sbjct  451   MPKAEEYLKNGIVSSGVHLGLVHVFFLLGHGITSETVRLIDSNPPIVSSVATILRLWDDL  510

Query  501   DATQGEKQDGNDASYVEYYVKEHEGLSISDGKQRIMNMVSEQWKLINKQCLSPTRIPESF  322
              + + E QDGND SY+ YY+ EH+ ++  D ++   + +S+ WK +N++CLSP     SF
Sbjct  511   GSAKDENQDGNDGSYIYYYMMEHQDVTAEDAQKHATDKISDAWKRLNQECLSPNPFSASF  570

Query  321   SKSCLNIARMVPMMYNYSDTHCLPILQKQIMSMF  220
             +++ LN ARMVP+MY Y D   LP L++ + S+ 
Sbjct  571   TRASLNTARMVPLMYGYDDNQRLPRLEEYVKSLL  604



>ref|XP_002305633.2| hypothetical protein POPTR_0004s02970g [Populus trichocarpa]
 gb|EEE86144.2| hypothetical protein POPTR_0004s02970g [Populus trichocarpa]
Length=527

 Score =   447 bits (1151),  Expect = 5e-146, Method: Compositional matrix adjust.
 Identities = 213/483 (44%), Positives = 320/483 (66%), Gaps = 14/483 (3%)
 Frame = -2

Query  1653  EDDLQVLNVIDAIQHLGIDHHFHDQIGAILQRQYQKVKIDDFQKINGLYDISLSFRLLRQ  1474
             +D L+ L +ID +Q LGID+H  ++I A L  QY      +   ++ ++ ++L FRLLRQ
Sbjct  44    KDPLEGLVMIDTLQRLGIDYHLREEIEAFLNTQYMNFSSPNHLPLD-VFGVALRFRLLRQ  102

Query  1473  EGYNVSSDVFTKFTSEKGEFKEELSKDIRGLMALHEASHLSIEGEDVLDEAAKFSRESLI  1294
             EGYNVS +VF  F +E+G F      D++GLMAL+EAS LS+E ED+LDEA +FS + L 
Sbjct  103   EGYNVSQEVFNNFKNEEGNFHLIQENDVKGLMALYEASQLSMESEDILDEAGEFSAKLL-  161

Query  1293  ANMVHLDECQASMVQNTLQYPYHKSLARFTAKTFIENMRVENEWEATLVNLATMDYSITQ  1114
                   +  ++ +V NTL++PYHKSLARF  K F+ N+ + NE       LA +D  I +
Sbjct  162   ------NHHESEIVANTLKHPYHKSLARFMVKNFLNNIDIRNENIKVFSELAKIDCEIVR  215

Query  1113  SFYQEEFRQILRWWKSLGLKDEL--AKNQQLKWYIWTLALIPDPSMSRERIELTKPIALV  940
             S +Q+E  QI  WWK LGL  EL  A++Q LKW++W+++++ DP++S +R+ELTKPI+LV
Sbjct  216   SIHQKEILQISNWWKDLGLAKELKFARDQPLKWHMWSMSVLIDPNLSEQRVELTKPISLV  275

Query  939   YLIDDIIDVYATFDQTKQFIDAINRWDLSVGEGLPDYMKRCLVVLFDTTNDINNLVFEKY  760
             Y+IDDI D+Y T +    F +A+N WDL+    LP+ MK  L  LFD T  I+  + EK+
Sbjct  276   YIIDDIFDLYGTLNDLSIFTEAVNEWDLTAANQLPESMKISLKALFDITESISTKILEKH  335

Query  759   GWNPIDHLKRAWKCLCSAYITEAKWFATGKSPSANEYLQTGIITTGIPMVLITCFFLLGH  580
             GWNPI+ L+++WK LC+A++ EAKWFA+GK P   EYL+ GI+++G+ +VL+  FFLLG 
Sbjct  336   GWNPIESLQKSWKKLCNAFLEEAKWFASGKLPKPEEYLRNGIVSSGVHVVLVHMFFLLGQ  395

Query  579   GAFAGTTD----IEDMITSVGAILRLLDDLDATQGEKQDGNDASYVEYYVKEHEGLSISD  412
             G    T D       +I+    ILRL DDL   + E QDG+D SY+E Y++EH  +++  
Sbjct  396   GINKETVDFVVGFPPIISFTATILRLWDDLGTAKDENQDGHDGSYLECYIREHPNVTVER  455

Query  411   GKQRIMNMVSEQWKLINKQCLSPTRIPESFSKSCLNIARMVPMMYNYSDTHCLPILQKQI  232
              ++ + +++ + WK +N++CLS +    SF+K+CLN+ARM+P+MY+Y D   L  L++ +
Sbjct  456   AREHVSHLICDAWKKLNQECLSRSPFSPSFTKACLNVARMIPLMYSYDDNPGLASLKEHM  515

Query  231   MSM  223
              S+
Sbjct  516   RSL  518



>ref|XP_006493821.1| PREDICTED: (3S,6E)-nerolidol synthase 1-like isoform X1 [Citrus 
sinensis]
Length=579

 Score =   449 bits (1154),  Expect = 8e-146, Method: Compositional matrix adjust.
 Identities = 233/503 (46%), Positives = 327/503 (65%), Gaps = 18/503 (4%)
 Frame = -2

Query  1707  LKSEGKREWQRGLLYQFQEDD-LQVLNVIDAIQHLGIDHHFHDQIGAILQRQYQKVKIDD  1531
             +K   K E  + +L +  +DD  + L +ID +Q LGID++F D+I  IL+RQY  +   D
Sbjct  74    IKHAKKLEVIKHILIKLGDDDSFEGLAMIDVVQRLGIDYYFQDEIELILRRQYS-IFFTD  132

Query  1530  FQKINGLYDISLSFRLLRQEGYNVSSDVFTKFTSEKGEFKEELSKDIRGLMALHEASHLS  1351
               + N L +++L FRLLRQ+GY VS DVF +F +++GEFK+ +S+DI GLM+L+EAS LS
Sbjct  133   GDRYNDLQEVALRFRLLRQQGYYVSPDVFNRFRNKEGEFKQNVSEDINGLMSLYEASQLS  192

Query  1350  IEGEDVLDEAAKFSRESLIANMVHLDECQASMVQNTLQYPYHKSLARFTAKTFIENMRVE  1171
             I GEDVLDEA  FS   L AN        A +V++ L +PY KSL+   AK F       
Sbjct  193   IGGEDVLDEAGHFSATHL-ANY-----DLAGVVEHLLLHPYRKSLS--PAKNFFHGNFQG  244

Query  1170  NE--WEATLVNLATMDYSITQSFYQEEFRQILRWWKSLGL--KDELAKNQQLKWYIWTLA  1003
             NE  W   L  LA MD+ + QS +Q+E  QI  WW+ LGL  K E A+ Q +KWY+W++A
Sbjct  245   NEYIWILDLEELANMDFKLVQSLHQKEIVQISSWWRELGLAKKLEFAREQPVKWYVWSMA  304

Query  1002  LIPDPSMSRERIELTKPIALVYLIDDIIDVYATFDQTKQFIDAINRWDLSVGEGLPDYMK  823
                DP++S +RIELTKPI+ VY+IDDI DVY   D    F +AINRWDL   + LP+YMK
Sbjct  305   CFTDPNLSWQRIELTKPISFVYIIDDIFDVYGALDALTLFTEAINRWDLGDIDQLPEYMK  364

Query  822   RCLVVLFDTTNDINNLVFEKYGWNPIDHLKRAWKCLCSAYITEAKWFATGKSPSANEYLQ  643
              C   L D TN+I N V++++G+NP+  L++AW  LC+A++ EAKWFA+G  P A EYL+
Sbjct  365   ICFKALNDITNEIRNKVYKEHGYNPVHSLRKAWGSLCNAFLIEAKWFASGHLPKAEEYLE  424

Query  642   TGIITTGIPMVLITCFFLLGHGAFAGTTDIED----MITSVGAILRLLDDLDATQGEKQD  475
              GI+++G+ +VL+  FFLLGHG    T  + D    +++SV  ILR+ DDL + + E Q 
Sbjct  425   NGIVSSGVHLVLVHIFFLLGHGITNETVQLIDSNPLIVSSVAPILRIWDDLGSAKDENQG  484

Query  474   GNDASYVEYYVKEHEGLSISDGKQRIMNMVSEQWKLINKQCLSPTRIPESFSKSCLNIAR  295
             G D S + YY+ EH  L+  D  +  M+ +S+ WK +NK+CLSP     SF+++ LN AR
Sbjct  485   GKDGSSIYYYMMEHRDLTAEDAHKHAMDKISDAWKRLNKECLSPNPFSASFTRASLNSAR  544

Query  294   MVPMMYNYSDTHCLPILQKQIMS  226
             MVP+MY+Y D+  LP L++ I S
Sbjct  545   MVPLMYSYDDSQRLPSLEEYIKS  567



>gb|AII32468.1| terpene synthase [Populus trichocarpa]
Length=528

 Score =   446 bits (1147),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 213/483 (44%), Positives = 320/483 (66%), Gaps = 14/483 (3%)
 Frame = -2

Query  1653  EDDLQVLNVIDAIQHLGIDHHFHDQIGAILQRQYQKVKIDDFQKINGLYDISLSFRLLRQ  1474
             +D L+ L +ID +Q LGID+H  ++I A L  QY      +   ++ ++ ++L FRLLRQ
Sbjct  45    KDPLEGLVMIDTLQRLGIDYHLREEIEAFLNTQYMNFSSPNHLPLD-VFGVALRFRLLRQ  103

Query  1473  EGYNVSSDVFTKFTSEKGEFKEELSKDIRGLMALHEASHLSIEGEDVLDEAAKFSRESLI  1294
             EGYNVS +VF  F +E+G F      D++GLMAL+EAS LS+E ED+LDEA +FS + L 
Sbjct  104   EGYNVSQEVFNNFKNEEGNFHLIQENDVKGLMALYEASQLSMESEDILDEAGEFSAKLL-  162

Query  1293  ANMVHLDECQASMVQNTLQYPYHKSLARFTAKTFIENMRVENEWEATLVNLATMDYSITQ  1114
                   +  ++ +V NTL++PYHKSLARF  K F+ N+ + NE       LA +D  I +
Sbjct  163   ------NHHESEIVANTLKHPYHKSLARFMVKNFLNNIDIRNENIKVFSELAKIDCEIVR  216

Query  1113  SFYQEEFRQILRWWKSLGLKDEL--AKNQQLKWYIWTLALIPDPSMSRERIELTKPIALV  940
             S +Q+E  QI  WWK LGL  EL  A+NQ LKW++W+++++ DP++S +R+ELTKPI+LV
Sbjct  217   SIHQKEILQISNWWKDLGLAKELKFARNQPLKWHMWSMSVLIDPNLSEQRVELTKPISLV  276

Query  939   YLIDDIIDVYATFDQTKQFIDAINRWDLSVGEGLPDYMKRCLVVLFDTTNDINNLVFEKY  760
             Y+IDDI D+Y T +    F +A+N WDL+    LP+ MK  L+ LFD T  I+  + EK+
Sbjct  277   YIIDDIFDLYGTLNDLSIFTEAVNEWDLTPANQLPESMKISLMALFDITESISTKILEKH  336

Query  759   GWNPIDHLKRAWKCLCSAYITEAKWFATGKSPSANEYLQTGIITTGIPMVLITCFFLLGH  580
             GWNPI+ L+++WK LC+A++ EAKWFA+GK     EYL+ GI+++G+ +VL+  FFLLG 
Sbjct  337   GWNPIESLQKSWKKLCNAFLEEAKWFASGKLSKPEEYLRNGIVSSGVHVVLVHMFFLLGQ  396

Query  579   GAFAGTTDIED----MITSVGAILRLLDDLDATQGEKQDGNDASYVEYYVKEHEGLSISD  412
             G    T D  D    +I+    ILRL DDL   + E Q+G+D SY+E Y++EH  +++  
Sbjct  397   GINKETVDFVDGFPPIISFTATILRLWDDLGTAKDENQNGHDGSYLECYIREHPNVTVER  456

Query  411   GKQRIMNMVSEQWKLINKQCLSPTRIPESFSKSCLNIARMVPMMYNYSDTHCLPILQKQI  232
              ++ +  ++ + WK +N++CLS +    SF+K+CLN+ARM+P+MY+Y D   L  L++ +
Sbjct  457   AREHVSQLICDAWKKLNQECLSRSPFSPSFTKACLNVARMIPLMYSYDDNPGLASLKEHM  516

Query  231   MSM  223
              S+
Sbjct  517   RSL  519



>ref|XP_002305635.2| hypothetical protein POPTR_0004s02990g [Populus trichocarpa]
 gb|EEE86146.2| hypothetical protein POPTR_0004s02990g [Populus trichocarpa]
Length=528

 Score =   446 bits (1146),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 212/483 (44%), Positives = 319/483 (66%), Gaps = 14/483 (3%)
 Frame = -2

Query  1653  EDDLQVLNVIDAIQHLGIDHHFHDQIGAILQRQYQKVKIDDFQKINGLYDISLSFRLLRQ  1474
             +D L+ L +ID +Q LGID+HF ++I A L  QY      +   ++ +  ++L FRLLRQ
Sbjct  45    KDPLEGLVMIDTLQRLGIDYHFREEIEAFLNTQYMNFSSPNHLPLD-VCGVALRFRLLRQ  103

Query  1473  EGYNVSSDVFTKFTSEKGEFKEELSKDIRGLMALHEASHLSIEGEDVLDEAAKFSRESLI  1294
             EGYNVS +VF  F +E+G F      D++GLMAL+EAS LS+E ED+LDEA +FS + L 
Sbjct  104   EGYNVSQEVFNNFKNEEGNFHLIQENDVKGLMALYEASQLSMESEDILDEAGEFSAKLL-  162

Query  1293  ANMVHLDECQASMVQNTLQYPYHKSLARFTAKTFIENMRVENEWEATLVNLATMDYSITQ  1114
                   +  ++ +V NTL++PYHKSLARF  K F+ N+ + NE       LA +D  I +
Sbjct  163   ------NHHESEIVANTLKHPYHKSLARFMVKNFLNNIDIRNENIKVFSELAKIDCEIVR  216

Query  1113  SFYQEEFRQILRWWKSLGLKDEL--AKNQQLKWYIWTLALIPDPSMSRERIELTKPIALV  940
             S +Q+E  QI  WWK LGL  EL  A++Q LKW++W+++++ DP++S +R+ELTKPI+LV
Sbjct  217   SIHQKEILQISNWWKDLGLAKELKFARDQPLKWHMWSMSVLIDPNLSEQRVELTKPISLV  276

Query  939   YLIDDIIDVYATFDQTKQFIDAINRWDLSVGEGLPDYMKRCLVVLFDTTNDINNLVFEKY  760
             Y+IDDI D+Y T +    F +A+N WDL+    LP+ MK  L  LFD T  I+  + E++
Sbjct  277   YIIDDIFDLYGTLNDLSIFTEAVNEWDLTAANQLPESMKISLKALFDITESISTKILERH  336

Query  759   GWNPIDHLKRAWKCLCSAYITEAKWFATGKSPSANEYLQTGIITTGIPMVLITCFFLLGH  580
             GWNPI+ L+++WK LC+A++ EAKWFA+GK P   EYL+ GI+++G+ +VL+  FFLLG 
Sbjct  337   GWNPIESLQKSWKKLCNAFLEEAKWFASGKLPKPEEYLRNGIVSSGVHVVLVHMFFLLGQ  396

Query  579   GAFAGTTDIED----MITSVGAILRLLDDLDATQGEKQDGNDASYVEYYVKEHEGLSISD  412
             G    T D  D    +I+    ILRL DDL   + E Q+G+D SY+E Y++EH  +++  
Sbjct  397   GINKETVDFVDGFPPIISFTATILRLWDDLGTAKDENQNGHDGSYLECYIREHPNVTVER  456

Query  411   GKQRIMNMVSEQWKLINKQCLSPTRIPESFSKSCLNIARMVPMMYNYSDTHCLPILQKQI  232
              ++ +  ++ + WK +N++CLS +    SF+ +CLN+ARM+P+MY+Y D   L  L++ +
Sbjct  457   AREHVSQLICDAWKKLNQECLSRSPFSRSFTNACLNVARMIPLMYSYDDNPSLASLKEHM  516

Query  231   MSM  223
              S+
Sbjct  517   RSL  519



>ref|XP_006493822.1| PREDICTED: (3S,6E)-nerolidol synthase 1-like isoform X2 [Citrus 
sinensis]
Length=479

 Score =   444 bits (1141),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 226/476 (47%), Positives = 314/476 (66%), Gaps = 17/476 (4%)
 Frame = -2

Query  1629  VIDAIQHLGIDHHFHDQIGAILQRQYQKVKIDDFQKINGLYDISLSFRLLRQEGYNVSSD  1450
             +ID +Q LGID++F D+I  IL+RQY  +   D  + N L +++L FRLLRQ+GY VS D
Sbjct  1     MIDVVQRLGIDYYFQDEIELILRRQY-SIFFTDGDRYNDLQEVALRFRLLRQQGYYVSPD  59

Query  1449  VFTKFTSEKGEFKEELSKDIRGLMALHEASHLSIEGEDVLDEAAKFSRESLIANMVHLDE  1270
             VF +F +++GEFK+ +S+DI GLM+L+EAS LSI GEDVLDEA  FS   L AN      
Sbjct  60    VFNRFRNKEGEFKQNVSEDINGLMSLYEASQLSIGGEDVLDEAGHFSATHL-ANY-----  113

Query  1269  CQASMVQNTLQYPYHKSLARFTAKTFIENMRVENE--WEATLVNLATMDYSITQSFYQEE  1096
               A +V++ L +PY KSL+   AK F       NE  W   L  LA MD+ + QS +Q+E
Sbjct  114   DLAGVVEHLLLHPYRKSLS--PAKNFFHGNFQGNEYIWILDLEELANMDFKLVQSLHQKE  171

Query  1095  FRQILRWWKSLGL--KDELAKNQQLKWYIWTLALIPDPSMSRERIELTKPIALVYLIDDI  922
               QI  WW+ LGL  K E A+ Q +KWY+W++A   DP++S +RIELTKPI+ VY+IDDI
Sbjct  172   IVQISSWWRELGLAKKLEFAREQPVKWYVWSMACFTDPNLSWQRIELTKPISFVYIIDDI  231

Query  921   IDVYATFDQTKQFIDAINRWDLSVGEGLPDYMKRCLVVLFDTTNDINNLVFEKYGWNPID  742
              DVY   D    F +AINRWDL   + LP+YMK C   L D TN+I N V++++G+NP+ 
Sbjct  232   FDVYGALDALTLFTEAINRWDLGDIDQLPEYMKICFKALNDITNEIRNKVYKEHGYNPVH  291

Query  741   HLKRAWKCLCSAYITEAKWFATGKSPSANEYLQTGIITTGIPMVLITCFFLLGHGAFAGT  562
              L++AW  LC+A++ EAKWFA+G  P A EYL+ GI+++G+ +VL+  FFLLGHG    T
Sbjct  292   SLRKAWGSLCNAFLIEAKWFASGHLPKAEEYLENGIVSSGVHLVLVHIFFLLGHGITNET  351

Query  561   TDIED----MITSVGAILRLLDDLDATQGEKQDGNDASYVEYYVKEHEGLSISDGKQRIM  394
               + D    +++SV  ILR+ DDL + + E Q G D S + YY+ EH  L+  D  +  M
Sbjct  352   VQLIDSNPLIVSSVAPILRIWDDLGSAKDENQGGKDGSSIYYYMMEHRDLTAEDAHKHAM  411

Query  393   NMVSEQWKLINKQCLSPTRIPESFSKSCLNIARMVPMMYNYSDTHCLPILQKQIMS  226
             + +S+ WK +NK+CLSP     SF+++ LN ARMVP+MY+Y D+  LP L++ I S
Sbjct  412   DKISDAWKRLNKECLSPNPFSASFTRASLNSARMVPLMYSYDDSQRLPSLEEYIKS  467



>ref|XP_006493063.1| PREDICTED: (3S,6E)-nerolidol synthase 1-like [Citrus sinensis]
Length=579

 Score =   447 bits (1149),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 232/509 (46%), Positives = 330/509 (65%), Gaps = 18/509 (4%)
 Frame = -2

Query  1719  DEFLLKSEGKREWQRGLLYQFQEDD-LQVLNVIDAIQHLGIDHHFHDQIGAILQRQYQKV  1543
             D+  +K   K E  + +L +  +DD  + L +ID +Q LGID++F D+I  IL+RQY  +
Sbjct  70    DDIHIKHAKKLEVIKHILIKLGDDDSFEGLAMIDVVQRLGIDYYFQDEIELILRRQYS-I  128

Query  1542  KIDDFQKINGLYDISLSFRLLRQEGYNVSSDVFTKFTSEKGEFKEELSKDIRGLMALHEA  1363
                D  + N L +++L FRLLRQ+GY VS DVF +F +++GEFK+ +S+DI GLM+L+EA
Sbjct  129   FFTDGDRYNDLQEVALRFRLLRQQGYYVSPDVFNRFRNKEGEFKQNVSEDINGLMSLYEA  188

Query  1362  SHLSIEGEDVLDEAAKFSRESLIANMVHLDECQASMVQNTLQYPYHKSLARFTAKTFIEN  1183
             S LSI GEDVLDEA  FS   L AN        A +V++ L +PY KSL+   AK F   
Sbjct  189   SQLSIGGEDVLDEAGHFSATHL-ANY-----DLAGVVEHLLLHPYRKSLS--PAKNFFHG  240

Query  1182  MRVENEWEATL--VNLATMDYSITQSFYQEEFRQILRWWKSLGL--KDELAKNQQLKWYI  1015
                 NE+   L    LA MD+ + QS +Q+E  QI  WW+ LGL  K E A+ Q +KWY+
Sbjct  241   NFQGNEYIRILDLQELANMDFKLVQSLHQKEIVQISSWWRELGLAKKLEFAREQPVKWYV  300

Query  1014  WTLALIPDPSMSRERIELTKPIALVYLIDDIIDVYATFDQTKQFIDAINRWDLSVGEGLP  835
             W++A   DP++S +RIELTKPI+ VY+IDDI DVY   D    F +AINRWDL   + LP
Sbjct  301   WSMACFTDPNLSWQRIELTKPISFVYIIDDIFDVYGALDALTLFTEAINRWDLGDIDQLP  360

Query  834   DYMKRCLVVLFDTTNDINNLVFEKYGWNPIDHLKRAWKCLCSAYITEAKWFATGKSPSAN  655
             +YMK C   L + TN+I+N V++++G+NP+  L++AW  LC+A++ EAKWFA+G  P A 
Sbjct  361   EYMKICFKALNNITNEISNKVYKEHGYNPVHSLRKAWGSLCNAFLIEAKWFASGHLPKAE  420

Query  654   EYLQTGIITTGIPMVLITCFFLLGHGAFAGTTDIED----MITSVGAILRLLDDLDATQG  487
             EYL+ GI+++G+ +VL+  FFLLGHG    T  + D    +++SV  ILR+ DDL + + 
Sbjct  421   EYLENGIVSSGVHLVLVHIFFLLGHGVTNETVQLIDSNPPIVSSVATILRIWDDLGSAKD  480

Query  486   EKQDGNDASYVEYYVKEHEGLSISDGKQRIMNMVSEQWKLINKQCLSPTRIPESFSKSCL  307
             E Q G D S + YY+ EH  L+  D  +  M+ +S+ WK +NK+CLSP     SF+++ L
Sbjct  481   ENQGGKDGSSIYYYMMEHRDLTAEDAHKHAMDKISDAWKRLNKECLSPNPFSASFTRASL  540

Query  306   NIARMVPMMYNYSDTHCLPILQKQIMSMF  220
             N ARMVP+MY+Y D+  LP L++ I S  
Sbjct  541   NSARMVPLMYSYDDSQRLPSLEEYIKSFL  569



>ref|XP_009368862.1| PREDICTED: (3S,6E)-nerolidol synthase 1-like [Pyrus x bretschneideri]
Length=562

 Score =   446 bits (1148),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 223/527 (42%), Positives = 340/527 (65%), Gaps = 19/527 (4%)
 Frame = -2

Query  1764  SSSLRSEKMTVTLSKDEFLLKSEGKREWQRGLLYQFQEDDLQVLNVIDAIQHLGIDHHFH  1585
             S  + +  +T    +D+   + E K E  R LL +  E+ L   N+IDAIQ LGID+HF 
Sbjct  36    SKPMSTIPLTPPCLQDDIRSQHEQKLEVFRNLLSRVGEESL---NMIDAIQRLGIDYHFE  92

Query  1584  DQIGAILQRQYQKVKIDDFQKINGLYDISLSFRLLRQEGYNVSSDVFTKFTSEKGEFKEE  1405
             +QI  I+      +      + N L+++SL FRLLRQ G+ V  DV   F  ++G++ ++
Sbjct  93    EQIDLIVSSHANALS----HQQNDLHEVSLRFRLLRQHGHFVPEDVLNLFKEKEGKYFKQ  148

Query  1404  L--SKDIRGLMALHEASHLSIEGEDVLDEAAKFSRESLIANMVHLDECQASMVQNTLQYP  1231
             +  S++++GLM+++EAS LS+EGED L EA K S   L  ++ +L   +A +V+NTL  P
Sbjct  149   MLNSEEVKGLMSVYEASQLSMEGEDALHEAGKLSGHLLNRSLSYLGPHEARLVENTLGCP  208

Query  1230  YHKSLARFTAKTFI---ENMRVENEWEATLVNLATMDYSITQSFYQEEFRQILRWWKSLG  1060
             +H+SLA F AK F        V N W   L  +A  D+++ QS + +E  QI +WWK LG
Sbjct  209   HHRSLAAFMAKNFFLSNSQAGVNNRWLNMLQEVAKTDFNLVQSLHHKEIVQISKWWKELG  268

Query  1059  LKDEL--AKNQQLKWYIWTLALIPDPSMSRERIELTKPIALVYLIDDIIDVYATFDQTKQ  886
             L  EL  A+++ +KWYIW++A + DP++S ERI+LTKPI+ +YLIDDI DVY T D+   
Sbjct  269   LTRELKFARDEPVKWYIWSMACLTDPNLSEERIQLTKPISFIYLIDDIFDVYGTLDELTL  328

Query  885   FIDAINRWDLSVGEGLPDYMKRCLVVLFDTTNDINNLVFEKYGWNPIDHLKRAWKCLCSA  706
             F +A+NRW++   E LPDYMK C   L++ TN+I+  V++K+GWNP+  LK+AW  LC+A
Sbjct  329   FTEAVNRWEIGAIEHLPDYMKICFEALYNITNEISCEVYQKHGWNPLHSLKKAWGSLCNA  388

Query  705   YITEAKWFATGKSPSANEYLQTGIITTGIPMVLITCFFLLGHGAFAGTTDIED----MIT  538
             ++ EAKWF +G  P A +YL+ GI+++G+ +V++  FFLLG G    + ++ +    +++
Sbjct  389   FLVEAKWFKSGHLPKAEDYLKNGIVSSGVNVVMVHIFFLLGQGITKQSVELLNETPAIVS  448

Query  537   SVGAILRLLDDLDATQGEKQDGNDASYVEYYVKEHEGLSISDGKQRIMNMVSEQWKLINK  358
             S  AILRL DD  + + E Q G+D SYV  Y++EH G S+ + ++  +NM+S++WK +NK
Sbjct  449   STAAILRLWDDFGSAEDENQSGHDGSYVRCYLQEHPGSSMEEPQENTVNMISKEWKNLNK  508

Query  357   QCLSPT-RIPESFSKSCLNIARMVPMMYNYSDTHCLPILQKQIMSMF  220
             + +SP    P +F+K+ LN+ARMVP+MYNY D   LP L+  + SM 
Sbjct  509   ELVSPNYPFPATFTKASLNLARMVPLMYNYDDNQHLPSLEVYMKSML  555



>ref|XP_006467945.1| PREDICTED: (3S,6E)-nerolidol synthase 2, chloroplastic/mitochondrial-like 
[Citrus sinensis]
Length=590

 Score =   444 bits (1141),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 221/487 (45%), Positives = 318/487 (65%), Gaps = 10/487 (2%)
 Frame = -2

Query  1650  DDLQVLNVIDAIQHLGIDHHFHDQIGAILQRQYQKVKIDDFQKINGLYDISLSFRLLRQE  1471
             +  + L +IDA+Q LGI++ F D+I  ILQRQY  +       ++ L +++L FRLLRQE
Sbjct  96    NSFEGLVMIDAVQRLGIEYLFKDEIEEILQRQY-IISSTCGGHLHDLQEVALRFRLLRQE  154

Query  1470  GYNVSSDVFTKFTSEKGEFKE-ELSKDIRGLMALHEASHLSIEGEDVLDEAAKFSRESLI  1294
             GY V +D+F  F  ++G F +  +S+DI  LM ++EAS LSI GE+ LDEA +FS + L 
Sbjct  155   GYYVPADMFNNFMIKEGRFSQFNVSEDIGRLMEVYEASQLSIAGEEGLDEAGQFSAKMLN  214

Query  1293  ANMVHLDECQASMVQNTLQYPYHKSLARFTAK-TFIENMRVENEWE-ATLVNLATMDYSI  1120
               M HLD  QA  + NTL++PYHKSL RF AK  F  N + E  W    L  +A  D+++
Sbjct  215   ECMTHLDHNQALAIGNTLRHPYHKSLPRFMAKDVFFGNFQGERRWMLHVLKEIAKKDFNM  274

Query  1119  TQSFYQEEFRQILRWWKSLGLKDEL--AKNQQLKWYIWTLALIPDPSMSRERIELTKPIA  946
               + + +E  Q+ +WWK LGL  +L  A++Q LKWYIW++A + DPS+S +R+ELTKPI+
Sbjct  275   VHALHHKEIVQVTKWWKDLGLAKKLPFARDQPLKWYIWSMACLTDPSLSEQRVELTKPIS  334

Query  945   LVYLIDDIIDVYATFDQTKQFIDAINRWDLSVGEGLPDYMKRCLVVLFDTTNDINNLVFE  766
             L+Y+IDDI DVY T D+   F + I RWDL+    LP+YMK C   L D TN+I+  V++
Sbjct  335   LIYIIDDIFDVYGTLDELILFTETITRWDLAAMGQLPEYMKICFKALDDITNEISYKVYK  394

Query  765   KYGWNPIDHLKRAWKCLCSAYITEAKWFATGKSPSANEYLQTGIITTGIPMVLITCFFLL  586
             K+G+NP+  L+ AW  LC A++ EAKWFA+G  P + EYL+ GI ++G+ + L+  FFLL
Sbjct  395   KHGYNPVQSLRNAWTSLCKAFLVEAKWFASGHMPESEEYLKNGIESSGVHVALVHIFFLL  454

Query  585   GHGAFAGTTDIED----MITSVGAILRLLDDLDATQGEKQDGNDASYVEYYVKEHEGLSI  418
             GHG    T ++ D    +I+S   ILRL DDL + + E QDG D SY+ YY+KEH   + 
Sbjct  455   GHGITEETVELIDSNPAIISSTATILRLWDDLGSAKDENQDGKDGSYIHYYMKEHRYSAA  514

Query  417   SDGKQRIMNMVSEQWKLINKQCLSPTRIPESFSKSCLNIARMVPMMYNYSDTHCLPILQK  238
              + ++  +N +S+ WK +NK+CL P     SF+++ LN+ARMVP+MY+Y D   LP L+ 
Sbjct  515   EEAQKSAINKISDAWKRLNKECLCPNPFSASFTRASLNLARMVPLMYSYDDNQRLPSLEH  574

Query  237   QIMSMFS  217
              I S+ S
Sbjct  575   FIKSLLS  581



>ref|XP_006420934.1| hypothetical protein CICLE_v10004558mg [Citrus clementina]
 gb|ESR34174.1| hypothetical protein CICLE_v10004558mg [Citrus clementina]
Length=619

 Score =   442 bits (1138),  Expect = 6e-143, Method: Compositional matrix adjust.
 Identities = 231/507 (46%), Positives = 328/507 (65%), Gaps = 18/507 (4%)
 Frame = -2

Query  1719  DEFLLKSEGKREWQRGLLYQFQEDD-LQVLNVIDAIQHLGIDHHFHDQIGAILQRQYQKV  1543
             D+  +K   K E  + +L +  +DD  + L +ID +Q LGID++F D+I  IL+RQY  +
Sbjct  110   DDIHIKHAKKLEVIKHILIKLGDDDSFEGLAMIDVVQRLGIDYYFQDEIELILRRQYS-I  168

Query  1542  KIDDFQKINGLYDISLSFRLLRQEGYNVSSDVFTKFTSEKGEFKEELSKDIRGLMALHEA  1363
                   + N L +++L FRLLRQ+GY VS+DVF +F +++GEFK+ +S+DI GLM+L+EA
Sbjct  169   FFTAGDRYNDLQEVALRFRLLRQQGYYVSADVFNRFRNKEGEFKQNISEDINGLMSLYEA  228

Query  1362  SHLSIEGEDVLDEAAKFSRESLIANMVHLDECQASMVQNTLQYPYHKSLARFTAKTFIEN  1183
             S LSI GED LDEA  FS   L AN        A +V++ L +PY KSL+   AK F   
Sbjct  229   SQLSIGGEDGLDEAGHFSATHL-ANY-----DLAGVVEHLLLHPYRKSLS--PAKNFFHG  280

Query  1182  MRVENE--WEATLVNLATMDYSITQSFYQEEFRQILRWWKSLGL--KDELAKNQQLKWYI  1015
                 +E  W   L  LA MD+ + QS +Q+E  QI  WW+ LGL  K E A+ Q +KWY+
Sbjct  281   NFQGSEYIWILDLHELANMDFKLVQSLHQKEIVQISSWWRELGLAKKLEFAREQPVKWYV  340

Query  1014  WTLALIPDPSMSRERIELTKPIALVYLIDDIIDVYATFDQTKQFIDAINRWDLSVGEGLP  835
             W++A   DP++S +RIELTKPI+ VY+IDDI DV    D    F +AINRWDL   + LP
Sbjct  341   WSMACFTDPNLSWQRIELTKPISFVYIIDDIFDVCGALDALTLFTEAINRWDLGDIDQLP  400

Query  834   DYMKRCLVVLFDTTNDINNLVFEKYGWNPIDHLKRAWKCLCSAYITEAKWFATGKSPSAN  655
             +YMK C   L D TN+I+N V++++G+NP+  L++AW  LC+A++ EAKWFA+G  P A 
Sbjct  401   EYMKICFKALNDITNEISNKVYKEHGYNPVHSLRKAWGSLCNAFLIEAKWFASGHLPKAE  460

Query  654   EYLQTGIITTGIPMVLITCFFLLGHGAFAGTTDIED----MITSVGAILRLLDDLDATQG  487
             EYL+ GI+++G+ +VL+  FFLLGHG    T  + D    +++SV  ILR+ DDL + + 
Sbjct  461   EYLENGIVSSGVHLVLVHIFFLLGHGITNETVQLIDSNPPIVSSVATILRIWDDLGSAKD  520

Query  486   EKQDGNDASYVEYYVKEHEGLSISDGKQRIMNMVSEQWKLINKQCLSPTRIPESFSKSCL  307
             E Q G D SY+ YY+ EH  L+  D  +  M+ +S+ WK +NK+CLSP     SF+ + L
Sbjct  521   ENQGGKDGSYIYYYMMEHRDLTAEDAHKHAMDKISDAWKRLNKECLSPNPFSASFTGASL  580

Query  306   NIARMVPMMYNYSDTHCLPILQKQIMS  226
             N ARMVP+MY+Y D+  LP L++ I S
Sbjct  581   NCARMVPLMYSYDDSQRLPSLEEYIKS  607



>ref|XP_008371218.1| PREDICTED: (3S,6E)-nerolidol synthase 1-like [Malus domestica]
Length=552

 Score =   440 bits (1131),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 218/527 (41%), Positives = 334/527 (63%), Gaps = 19/527 (4%)
 Frame = -2

Query  1764  SSSLRSEKMTVTLSKDEFLLKSEGKREWQRGLLYQFQEDDLQVLNVIDAIQHLGIDHHFH  1585
             S  + +  +T    +D+   + E K E  R LL +  E+ L   N+IDAIQ LGID+HF 
Sbjct  26    SKPMSTIPLTPPCLQDDIRFQHEQKLEVFRNLLSRVGEESL---NMIDAIQRLGIDYHFE  82

Query  1584  DQIGAILQRQYQKVKIDDFQKINGLYDISLSFRLLRQEGYNVSSDVFTKFTSEKGEFKEE  1405
             +QI  I+      +      + N L+++SL FRLLRQ G+ V  DVF  F   +G++ ++
Sbjct  83    EQIDLIISSHANALS----HQQNDLHEVSLRFRLLRQHGHFVPEDVFNNFKEREGKYFKQ  138

Query  1404  L--SKDIRGLMALHEASHLSIEGEDVLDEAAKFSRESLIANMVHLDECQASMVQNTLQYP  1231
             +  S++++GLM+++EAS LS+EGED LDEA K S   L  ++ +L   +A +V+NTL  P
Sbjct  139   ILNSEEVKGLMSVYEASQLSMEGEDALDEAGKLSGHLLXRSLSYLGPHEARLVENTLGCP  198

Query  1230  YHKSLARFTAKTFI---ENMRVENEWEATLVNLATMDYSITQSFYQEEFRQILRWWKSLG  1060
             +H+SLA F A  F        + N W   L  +A  D+++ QS + +E  QI  WWK LG
Sbjct  199   HHQSLAAFMAXNFXLPNSQAGMNNRWLNMLQEVAKTDFNLVQSLHHKEIVQISXWWKELG  258

Query  1059  LKDEL--AKNQQLKWYIWTLALIPDPSMSRERIELTKPIALVYLIDDIIDVYATFDQTKQ  886
             L  EL  A+++ +KWY W++A + DP++S ERI+LTKPI+ +YLIDDI DVY T D+   
Sbjct  259   LTRELKFARDEPVKWYXWSMACLTDPNLSEERIQLTKPISFIYLIDDIFDVYGTLDELTL  318

Query  885   FIDAINRWDLSVGEGLPDYMKRCLVVLFDTTNDINNLVFEKYGWNPIDHLKRAWKCLCSA  706
             F +A+NRW++   E LPDYMK C   L++ TN+I+  V++K+GWNP+   K+AW  LC+A
Sbjct  319   FTEAVNRWEIGAIEHLPDYMKICFEALYNITNEISXEVYQKHGWNPLHSXKKAWGSLCNA  378

Query  705   YITEAKWFATGKSPSANEYLQTGIITTGIPMVLITCFFLLGHGAFAGTTDIED----MIT  538
             ++ EAKWF +G  P A +YL+ GI+++G+ +V++  FFLLG G    + ++ +    +++
Sbjct  379   FLVEAKWFKSGHXPKAEDYLKNGIVSSGVNVVMVHIFFLLGQGITKXSVELXNETPAIVS  438

Query  537   SVGAILRLLDDLDATQGEKQDGNDASYVEYYVKEHEGLSISDGKQRIMNMVSEQWKLINK  358
             S  AILRL DD  + + E Q G+D SYV  Y++EH G S+ + ++  + M+S++WK +NK
Sbjct  439   STAAILRLWDDFGSAEDENQSGHDXSYVRCYLQEHPGSSMEEAQENTVXMISKEWKNLNK  498

Query  357   QCLSPT-RIPESFSKSCLNIARMVPMMYNYSDTHCLPILQKQIMSMF  220
             + +SP    P +F+ + LN+ARMVP+MYNY     LP L+  + SM 
Sbjct  499   ELVSPNYPFPATFTNASLNLARMVPLMYNYDXNQHLPSLEVYMKSML  545



>emb|CBI33221.3| unnamed protein product [Vitis vinifera]
Length=508

 Score =   438 bits (1126),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 215/444 (48%), Positives = 303/444 (68%), Gaps = 8/444 (2%)
 Frame = -2

Query  1719  DEFLLKSEGKREWQRGLLYQFQEDDLQVLNVIDAIQHLGIDHHFHDQIGAILQRQYQKVK  1540
             DEF  +   K +  + +  +  ED ++ + +IDAIQ LGIDHHF ++I A+LQ+QY K  
Sbjct  67    DEFYNEHAQKLKEVKHVFSKLGEDAMESMMMIDAIQRLGIDHHFEEEIEAVLQKQYMKSS  126

Query  1539  IDDFQKINGLYDISLSFRLLRQEGYNVSSDVFTKFTSEKGEFKEELSKDIRGLMALHEAS  1360
             I        LY+++L FRLLRQEGY V +DV   F +++G+FK+ L +DIRGLM L+EAS
Sbjct  127   IHG-DCDEDLYEVALRFRLLRQEGYTVPADVLNNFKNKEGKFKQNLREDIRGLMGLYEAS  185

Query  1359  HLSIEGEDVLDEAAKFSRESLIANMVHLDECQASMVQNTLQYPYHKSLARFTAKTFIENM  1180
              LSI GED+L+EA  FS   L A + HLD  QA++V+NTL++P+HKSLARF  K F+ + 
Sbjct  186   QLSI-GEDILEEAGNFSSLLLNACLQHLDRHQAAVVKNTLEHPHHKSLARFMTKNFLTDF  244

Query  1179  RVENEWEATLVNLATMDYSITQSFYQEEFRQILRWWKSLGLKDEL--AKNQQLKWYIWTL  1006
             +  N W      LA +D++  +S +Q+E  QI +WWK LGL +EL  A++Q LKWY+W +
Sbjct  245   QGTNGWINAFQELAKIDFNTVKSVHQKEMLQISKWWKDLGLTEELKFARDQPLKWYMWPM  304

Query  1005  ALIPDPSMSRERIELTKPIALVYLIDDIIDVYATFDQTKQFIDAINRWDLSVGEGLPDYM  826
             A+IPDP +S +RIELTKPI+L+Y+IDDI DV  T D+   F +A+NRWDLS  + LP+YM
Sbjct  305   AIIPDPRLSEQRIELTKPISLIYIIDDIFDVGGTLDELTLFTEAVNRWDLSAFKELPEYM  364

Query  825   KRCLVVLFDTTNDINNLVFEKYGWNPIDHLKRAWKCLCSAYITEAKWFATGKSPSANEYL  646
             K C   L D TN+I+  V +++ WNP+  L++AW  LC+A++ EAKWFA+G  P A EYL
Sbjct  365   KMCFKTLDDITNEISTKVHKEHKWNPVGSLRKAWASLCNAFLVEAKWFASGHVPKAEEYL  424

Query  645   QTGIITTGIPMVLITCFFLLGHGAFAGTTDIED----MITSVGAILRLLDDLDATQGEKQ  478
             + G +++G+ +VL+  FFLLGHG      D+ D    +I+S   ILRL DDL + + E Q
Sbjct  425   KNGAVSSGVHVVLVHLFFLLGHGITKENVDLVDDFPGIISSTATILRLWDDLGSGKDENQ  484

Query  477   DGNDASYVEYYVKEHEGLSISDGK  406
             DG+D SYVE Y+KEH G S+ + +
Sbjct  485   DGHDGSYVECYLKEHRGSSVENAR  508



>ref|XP_006449154.1| hypothetical protein CICLE_v10014707mg [Citrus clementina]
 gb|ESR62394.1| hypothetical protein CICLE_v10014707mg [Citrus clementina]
Length=588

 Score =   439 bits (1128),  Expect = 8e-142, Method: Compositional matrix adjust.
 Identities = 221/494 (45%), Positives = 319/494 (65%), Gaps = 11/494 (2%)
 Frame = -2

Query  1650  DDLQVLNVIDAIQHLGIDHHFHDQIGAILQRQYQKVKIDDFQKINGLYDISLSFRLLRQE  1471
             +  + L +IDA+Q LGI++ F D+I  ILQRQY  +       ++ L +++L FRLLRQE
Sbjct  96    NSFEGLVMIDAVQRLGIEYLFKDEIEEILQRQYI-ISSTCGGHLHDLQEVALRFRLLRQE  154

Query  1470  GYNVSSDVFTKFTSEKGEFKE-ELSKDIRGLMALHEASHLSIEGEDVLDEAAKFSRESLI  1294
             GY V +D+F  F  ++G F    +S+DI  LM ++EAS LSI GE+ LDEA  FS + L 
Sbjct  155   GYYVPADMFNNFRIKEGRFSRINVSEDIGTLMEVYEASQLSIAGEEGLDEAGHFSAKMLN  214

Query  1293  ANMVHLDECQASMVQNTLQYPYHKSLARFTAK-TFIENMRVENEWEATLVNLATMDYSIT  1117
               M HLD   A  + NTL++PYHKSL RF AK  F+ N + E      L  +A  D+++ 
Sbjct  215   ECMTHLDHYHALAIGNTLRHPYHKSLPRFMAKDVFLSNFQGERRLH-VLKEIAKKDFNMV  273

Query  1116  QSFYQEEFRQILRWWKSLGLKDEL--AKNQQLKWYIWTLALIPDPSMSRERIELTKPIAL  943
             Q+ +Q+E  Q+ +WWK LGL  +L  A++Q LKWYIW++A + DPS+S +R+EL KPI+L
Sbjct  274   QALHQKEIVQVTKWWKDLGLTKKLPFARDQPLKWYIWSMACLTDPSLSEQRVELAKPISL  333

Query  942   VYLIDDIIDVYATFDQTKQFIDAINRWDLSVGEGLPDYMKRCLVVLFDTTNDINNLVFEK  763
             +Y+IDDI DVY T D+   F + I RWDL+    LP+YMK C   L D TN+I+  V++K
Sbjct  334   IYIIDDIFDVYGTLDELILFTETITRWDLAAMGQLPEYMKICFKALDDITNEISYKVYKK  393

Query  762   YGWNPIDHLKRAWKCLCSAYITEAKWFATGKSPSANEYLQTGIITTGIPMVLITCFFLLG  583
             +G+NP+  L+ AW  LC A++ EAKWFA+G  P A EYL+ GI ++G+ + L   FFLLG
Sbjct  394   HGYNPVQSLRNAWTSLCKAFLVEAKWFASGHMPEAEEYLRNGIESSGVHVALAHFFFLLG  453

Query  582   HGAFAGTTDIED----MITSVGAILRLLDDLDATQGEKQDGNDASYVEYYVKEHEGLSIS  415
             HG    T ++ D    +I+S   ILRL DDL + + E Q+G D SY+ YY+KEH   +  
Sbjct  454   HGITKETVELIDGNPAIISSTATILRLWDDLGSAKDENQEGKDGSYIHYYMKEHRYSAAE  513

Query  414   DGKQRIMNMVSEQWKLINKQCLSPTRIPESFSKSCLNIARMVPMMYNYSDTHCLPILQKQ  235
             + ++  +N +S+ WK +NK+CL P     SF+++ LN+ARMVP+MY+Y D   LP L+  
Sbjct  514   EAQKSAINKISDAWKRLNKECLCPNPFSASFTRASLNLARMVPLMYSYDDNQRLPSLEHY  573

Query  234   IMS-MFSTINGESI  196
             I S +F ++  E +
Sbjct  574   IKSLLFESVPTEGV  587



>ref|XP_010057691.1| PREDICTED: (3S,6E)-nerolidol synthase 1-like [Eucalyptus grandis]
Length=535

 Score =   437 bits (1123),  Expect = 8e-142, Method: Compositional matrix adjust.
 Identities = 232/540 (43%), Positives = 335/540 (62%), Gaps = 18/540 (3%)
 Frame = -2

Query  1782  RCQSVNSSSLRSEKMTVTLSKDEFLLKSEGKREWQRGLLYQFQEDDLQVLNVIDAIQHLG  1603
             R   + SSS+  E+      +D+  +K + K +     L +   + ++ L ++D IQ LG
Sbjct  3     RPNQMQSSSIAKEQTY----RDDSRIKHDEKTKSLIDFLNKVVNEPVESLIIVDMIQRLG  58

Query  1602  IDHHFHDQIGAILQRQYQKVKIDDFQKINGLYDISLSFRLLRQEGYNVSSDVFTKFTSEK  1423
             +   F +QI AIL+ QY      +  K + +Y+I+L FRLLRQEGY+V +DVF  F  + 
Sbjct  59    VKSLFREQIKAILRWQYTHFSSLNHGK-DDVYEIALRFRLLRQEGYHVPADVFEYFNDKG  117

Query  1422  GEFKEELSKDIRGLMALHEASHLSIEGEDVLDEAAKFSRESLIANMV-HLDECQASMVQN  1246
               F  +L  +I+G+M L+EAS +S+EGED+LDEA  FS   L A +   LD  QA M+++
Sbjct  118   KGFVMKLEGNIKGMMELYEASQMSMEGEDILDEAGCFSSNCLNALLTCDLDHEQARMIES  177

Query  1245  TLQYPYHKSLARFTA-KTFIENMRVENEWEATLVNLATMDYSITQSFYQEEFRQILRWWK  1069
             TLQYPY KS AR  A ++F+ +M   N W    + +A     I Q  +QEE  QI +WWK
Sbjct  178   TLQYPYRKSFARLLAPQSFVNDMPGANSWMEDSLEVANRKRRIDQYVHQEEIHQINKWWK  237

Query  1068  SLGL--KDELAKNQQLKWYIWTLALIPDPSMSRERIELTKPIALVYLIDDIIDVYATFDQ  895
              LGL  K E A++Q LKWY+W++A++ DPS+S  R+EL KPI+LVY+IDDI DV+ T D+
Sbjct  238   ELGLGEKMEFARDQPLKWYMWSVAILTDPSLSELRVELIKPISLVYIIDDIFDVHGTVDE  297

Query  894   TKQFIDAINRWDLSVGEGLPDYMKRCLVVLFDTTNDINNLVFEKYGWNPIDHLKRAWKCL  715
                F + I RWD +  E LP+YMK C  VL D  ND   ++FEK+GWNP   LK+ W  L
Sbjct  298   LILFTEVIKRWDNACAEQLPEYMKICFKVLNDIANDFGKIIFEKHGWNPTRFLKQMWANL  357

Query  714   CSAYITEAKWFATGKSPSANEYLQTGIITTGIPMVLITCFFLLGHGAFAGTTD-------  556
             C+A++ E +W A+GK P A++YL+  IIT+G+P+VL   FFL+G      + D       
Sbjct  358   CNAFLVEFQWNASGKLPKADDYLKNAIITSGVPLVLTHLFFLMGQNIANQSMDSKKEEVQ  417

Query  555   IEDMITSVGAILRLLDDLDATQGEKQDGNDASYVEYYVKEHEGLSISDGKQRIMNMVSEQ  376
             + ++I  V  ILRL DDL   Q E Q+G D SYVE Y++E+EG S    ++ +M ++S+ 
Sbjct  418   LPNIIFLVAEILRLWDDLGCAQDENQNGYDGSYVECYLRENEGSSYQSAREHVMKLISKL  477

Query  375   WKLINKQCLSPTRIPESFSKSCLNIARMVPMMYNYSDTHCLPILQKQIMSMFSTINGESI  196
             WKL+NK+CLSP      F ++C+N A+MV +MYNY D H L +LQ  + S+  T + E+I
Sbjct  478   WKLLNKECLSPCPFSAPFLEACVNAAKMVSLMYNYEDKHGLGLLQDHMKSL--TCDHETI  535



>dbj|BAP75559.1| linalool synthase [Citrus unshiu]
Length=588

 Score =   437 bits (1124),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 221/494 (45%), Positives = 319/494 (65%), Gaps = 11/494 (2%)
 Frame = -2

Query  1650  DDLQVLNVIDAIQHLGIDHHFHDQIGAILQRQYQKVKIDDFQKINGLYDISLSFRLLRQE  1471
             +  + L +IDA+Q L I++ F D+I  ILQRQY  +       ++ L +++L FRLLRQE
Sbjct  96    NSFEGLVMIDAVQRLRIEYLFKDEIEEILQRQYI-ISSTCGGHLHDLQEVALRFRLLRQE  154

Query  1470  GYNVSSDVFTKFTSEKGEFKE-ELSKDIRGLMALHEASHLSIEGEDVLDEAAKFSRESLI  1294
             GY V +D+F  F  ++G F    +S+DI  LM ++EAS LSI GE+ LDEA  FS + L 
Sbjct  155   GYYVPADMFNNFRIKEGRFSRINVSEDIGTLMEVYEASQLSIAGEEGLDEAGHFSAKMLN  214

Query  1293  ANMVHLDECQASMVQNTLQYPYHKSLARFTAK-TFIENMRVENEWEATLVNLATMDYSIT  1117
               M HLD   A  + NTL++PYHKSL RF AK  F+ N + E      L  +A  D+++ 
Sbjct  215   ECMTHLDHYHALAIGNTLRHPYHKSLPRFMAKDVFLSNFQGERRLH-VLKEIAKKDFNMV  273

Query  1116  QSFYQEEFRQILRWWKSLGLKDEL--AKNQQLKWYIWTLALIPDPSMSRERIELTKPIAL  943
             Q+ +Q+E  Q+ +WWK LGL  +L  A++Q LKWYIW++A + DPS+S +R+ELTKPI+L
Sbjct  274   QALHQKEIVQVTKWWKDLGLTKKLPFARDQPLKWYIWSMACLTDPSLSEQRVELTKPISL  333

Query  942   VYLIDDIIDVYATFDQTKQFIDAINRWDLSVGEGLPDYMKRCLVVLFDTTNDINNLVFEK  763
             +Y+IDDI DVY T D+   F + I RWDL+    LP+YMK C   L D TN+I+  V++K
Sbjct  334   IYIIDDIFDVYGTLDELILFTETITRWDLAAMGQLPEYMKICFKALDDITNEISCKVYKK  393

Query  762   YGWNPIDHLKRAWKCLCSAYITEAKWFATGKSPSANEYLQTGIITTGIPMVLITCFFLLG  583
             +G+NP+  L+ AW  LC A++ EAKWFA+G  P A EYL+ GI ++G+ + L   FFLLG
Sbjct  394   HGYNPVQSLRNAWTSLCKAFLVEAKWFASGHMPEAEEYLRNGIESSGVHVALAHFFFLLG  453

Query  582   HGAFAGTTDIED----MITSVGAILRLLDDLDATQGEKQDGNDASYVEYYVKEHEGLSIS  415
             HG    T ++ D    +I+S   ILRL DDL + + E Q+G D SY+ YY+KEH   +  
Sbjct  454   HGITKETVELIDGNPAIISSTATILRLWDDLGSAKDENQEGKDGSYIHYYMKEHRYSAAE  513

Query  414   DGKQRIMNMVSEQWKLINKQCLSPTRIPESFSKSCLNIARMVPMMYNYSDTHCLPILQKQ  235
             + ++  +N +S+ WK +NK+CL P     SF+++ LN+ARMVP+MY+Y D   LP L+  
Sbjct  514   EAQKSAINKISDAWKRLNKECLCPNPFSASFTRASLNLARMVPLMYSYDDNQRLPSLEHY  573

Query  234   IMS-MFSTINGESI  196
             I S +F ++  E +
Sbjct  574   IKSLLFESVPTEGV  587



>gb|ABR24417.1| nerolidol/linalool synthase 1 [Antirrhinum majus]
Length=566

 Score =   436 bits (1121),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 223/513 (43%), Positives = 325/513 (63%), Gaps = 13/513 (3%)
 Frame = -2

Query  1731  TLSKDEFLLKSEGKREWQRGLLYQFQEDD-LQVLNVIDAIQHLGIDHHFHDQIGAILQRQ  1555
             T + D F ++ + K E  + LL   +E++ +  L  +DAIQ LG++H+F + I  IL+  
Sbjct  56    TRTPDNFSMEYDKKIEEIKNLLRSKREEEPIDRLMFVDAIQRLGVNHNFEELIETILRNY  115

Query  1554  YQKVKIDDFQKINGLYDISLSFRLLRQEGYNVSSDVFTKFTSEKGEFKEELSKDIRGLMA  1375
             Y+    +     + L+D+SL FRL+RQ GY++SSDVF KF  + G F+ EL +D RGLM 
Sbjct  116   YESTSAN-ICGFHTLHDVSLFFRLMRQHGYDISSDVFNKFKGDDGRFRGELQRDTRGLME  174

Query  1374  LHEASHLSIEGEDVLDEAAKFSRESLIANMVHLDECQASMVQNTLQYPYHKSLARFTAKT  1195
             L+EAS L  EGE  LDEA  FS ++L   +  +D     +V N LQ+PY KS+ R T + 
Sbjct  175   LYEASQLRFEGEYTLDEAESFSSQNLNKYLADMDCSSCRLVTNKLQHPYRKSIGRLTTRY  234

Query  1194  FIENMRVENEWEATLVNLATMDYSITQSFYQEEFRQILRWWKSLGLKDEL--AKNQQLKW  1021
                + R +N+W  TL  LA MD  + +S YQ+E  Q+  WWK L + + L  A+NQ LKW
Sbjct  235   ---DFRGKNQWGKTLHELAAMDLRMRKSEYQKELFQVSEWWKELRIAENLSLARNQPLKW  291

Query  1020  YIWTLA-LIPDPSMSRERIELTKPIALVYLIDDIIDVYATFDQTKQFIDAINRWDLSVGE  844
             Y  ++A LI D ++S +RIELTK I  +YLIDDI DVY + ++   F +A+++WD +  E
Sbjct  292   YTCSMAILIDDITLSEQRIELTKSITFIYLIDDIFDVYGSPEELVIFAEAVSKWDYAAVE  351

Query  843   GLPDYMKRCLVVLFDTTNDINNLVFEKYGWNPIDHLKRAWKCLCSAYITEAKWFATGKSP  664
              LPDYMK C   L DTTN+I   ++EKYG+NPID LK  W  LC+A++ EAKWFA+G  P
Sbjct  352   TLPDYMKLCYKSLLDTTNEIGYKIYEKYGYNPIDSLKTTWASLCNAFLEEAKWFASGNLP  411

Query  663   SANEYLQTGIITTGIPMVLITCFFLLGHGAFAGTT----DIEDMITSVGAILRLLDDLDA  496
             +A +YL+ G +++G+ +V++  FFLLG G   G+     D   +++SV  ILRL DDL +
Sbjct  412   NATKYLENGKVSSGVYVVMVHLFFLLGLGGTCGSAIHLNDTSKLMSSVATILRLWDDLGS  471

Query  495   TQGEKQDGNDASYVEYYVKEHEGLSISDGKQRIMNMVSEQWKLINKQCLSPTRIP-ESFS  319
              + E QDG D SY+E Y+KEH  LS    +Q  ++++S +WKL+NK+C +   +   S  
Sbjct  472   AKDEHQDGKDGSYIECYMKEHISLSTEQAQQHAIDLISSEWKLLNKECFNLNHVSTSSIK  531

Query  318   KSCLNIARMVPMMYNYSDTHCLPILQKQIMSMF  220
             K+ LN ARMVP+MY+Y +   LPIL++ +  M 
Sbjct  532   KAALNTARMVPLMYSYDENQGLPILEEYVKIML  564



>ref|XP_010098578.1| (3S,6E)-nerolidol synthase 1 [Morus notabilis]
 gb|EXB75238.1| (3S,6E)-nerolidol synthase 1 [Morus notabilis]
Length=590

 Score =   436 bits (1122),  Expect = 7e-141, Method: Compositional matrix adjust.
 Identities = 232/489 (47%), Positives = 322/489 (66%), Gaps = 15/489 (3%)
 Frame = -2

Query  1641  QVLNVIDAIQHLGIDHHFHDQIGAILQRQYQKVKIDDFQKIN---GLYDISLSFRLLRQE  1471
             Q L VIDAIQ LGID+ F ++I  IL  Q+         K N    L+D +L FRLLRQ+
Sbjct  96    QALKVIDAIQRLGIDYLFQEEIEKILGNQFMSFDHYTSNKHNIEDHLHDTALRFRLLRQQ  155

Query  1470  GYNVSSDVFTKFTSEKGE-FKEELSKDIRGLMALHEASHLSIEGEDVLDEAAKFSRESLI  1294
             GY V + +F K   +KG  FK ELSKD+ GLM L+EASH+SIEGEDVLDEA  FS + L 
Sbjct  156   GYFVPAGIFNKLKDKKGNNFKTELSKDMNGLMELYEASHVSIEGEDVLDEANIFSSQLLT  215

Query  1293  ANMVHL--DECQASMVQNTLQYPYHKSLARFTAKTFI---ENMRVENEWEATLVNLATMD  1129
             A+M  L  D  +A  + NTL+YP HK+LA+FTAK       +    N W   L  LA  +
Sbjct  216   ASMTCLGDDHRRARAIANTLEYPCHKTLAKFTAKNLFGATSHFGSANGWINVLQELAKYE  275

Query  1128  YSITQSFYQEEFRQILRWWKSLGLKDEL--AKNQQLKWYIWTLALIPDPSMSRERIELTK  955
             ++  QS ++ E  QI +WW+ +GL  EL  A++Q LKWYIW++  + DPS+S+ R+ELTK
Sbjct  276   FNQVQSLHKREILQISQWWRDIGLAKELTFARDQPLKWYIWSVGCLTDPSLSQHRVELTK  335

Query  954   PIALVYLIDDIIDVYATFDQTKQFIDAINRWDLSVGEGLPDYMKRCLVVLFDTTNDINNL  775
             PIA +Y+IDD+ DVY   D+   F +AINRWD++  E LP +MK C   L + TN+I++ 
Sbjct  336   PIAFIYVIDDLFDVYGNLDELTLFTEAINRWDITAVEKLPHHMKICFKALDNLTNEISHK  395

Query  774   VFEKYGWNPIDHLKRAWKCLCSAYITEAKWFATGKSPSANEYLQTGIITTGIPMVLITCF  595
             V++++GWNP   L++ W  LC A++ EAKWFA+G+ P   EYL+ G++++G+ +VL+  F
Sbjct  396   VYQEHGWNPSHSLRKTWATLCDAFLVEAKWFASGQVPKTEEYLRNGVVSSGVHVVLVHVF  455

Query  594   FLLGHGAFAGTTDIED----MITSVGAILRLLDDLDATQGEKQDGNDASYVEYYVKEHEG  427
             FLLG      T D  D    +ITS  AILRL DDL + + E Q+G+D SYVE Y+KE +G
Sbjct  456   FLLGQSITQDTVDFVDKMPGIITSTAAILRLWDDLGSAKDENQEGHDGSYVECYMKERQG  515

Query  426   LSISDGKQRIMNMVSEQWKLINKQCLSPTRIPESFSKSCLNIARMVPMMYNYSDTHCLPI  247
              SI + +Q I   +S+ WK +NK+CLSP  +P +F K+CLN+AR+VP+MY+Y D   LP 
Sbjct  516   SSIEEARQNITERISDAWKCLNKECLSPNPLPATFLKACLNVARLVPLMYSYDDNQRLPS  575

Query  246   LQKQIMSMF  220
             L++ + SMF
Sbjct  576   LEQHMKSMF  584



>ref|XP_006352644.1| PREDICTED: (3S,6E)-nerolidol synthase 1, chloroplastic-like [Solanum 
tuberosum]
Length=552

 Score =   434 bits (1117),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 217/479 (45%), Positives = 322/479 (67%), Gaps = 9/479 (2%)
 Frame = -2

Query  1635  LNVIDAIQHLGIDHHFHDQIGAILQRQYQKVKIDDFQKINGLYDISLSFRLLRQEGYNVS  1456
             L ++D +Q +GI+HHF ++I +ILQ++Y++     F K    +D+SL FRLLRQ+GY+VS
Sbjct  70    LVLVDTLQRMGIEHHFQEEIQSILQKEYEQSAC--FLKYQTPFDVSLCFRLLRQQGYHVS  127

Query  1455  SDVFTKF-TSEKGEFKEELSKDIRGLMALHEASHLSIEGEDVLDEAAKFSRESLIANMVH  1279
             +DVF KF  ++ G F  +LS+D+ GL+ L+EAS L +EGE +L E A FS + L A + +
Sbjct  128   ADVFKKFKNNDDGTFGLKLSQDVNGLIGLYEASQLGVEGEYILKEIANFSVDHLNACLAN  187

Query  1278  LDEC-QASMVQNTLQYPYHKSLARFTAKTFIENMRVENEW-EATLVNLATMDYSITQSFY  1105
              D C +A +++ TL+YPYHKSLA   AK+FI N +  N W ++TL  LA ++YSITQ  +
Sbjct  188   NDSCDEARIIKETLKYPYHKSLASCKAKSFINNFKGINGWGKSTLQELANIEYSITQEIH  247

Query  1104  QEEFRQILRWWKSLGLKDELA--KNQQLKWYIWTLALIPDPSMSRERIELTKPIALVYLI  931
             Q E  Q+  WW+SLGL ++L   ++Q LKWY W +A++ DP MS++RIEL K I+ VY+I
Sbjct  248   QHELAQVSGWWRSLGLAEDLKLLRDQPLKWYTWPMAVLTDPKMSQQRIELAKCISFVYVI  307

Query  930   DDIIDVYATFDQTKQFIDAINRWDLSVGEGLPDYMKRCLVVLFDTTNDINNLVFEKYGWN  751
             DDI DVY T ++   F  A+NRW+L     LP+YM+     L+DT NDI   + + YG N
Sbjct  308   DDIFDVYGTVEELTLFTQAVNRWELVAMLDLPEYMRSTYKALYDTINDIGYNIHKIYGQN  367

Query  750   PIDHLKRAWKCLCSAYITEAKWFATGKSPSANEYLQTGIITTGIPMVLITCFFLLGHGAF  571
             P  +L+ AW  LC+A++ EAKWFA+G  P+ +EYL+ GI+++G+  VL+  F+LLG G  
Sbjct  368   PTQNLQNAWVSLCNAFLKEAKWFASGVVPTTDEYLKNGIVSSGVHAVLVHMFYLLGLGVS  427

Query  570   A-GTTDIEDMITSVGAILRLLDDLDATQGEKQDGNDASYVEYYVKEHEGLSISDGKQRIM  394
             +    D+  + +SV  ILRL DDL + + E Q+G D SY+E Y+KE++  SI   +  ++
Sbjct  428   SIHLEDVSAISSSVATILRLWDDLGSAKDENQEGKDGSYIECYMKENKDTSIELARGNVI  487

Query  393   NMVSEQWKLINKQCLS-PTRIPESFSKSCLNIARMVPMMYNYSDTHCLPILQKQIMSMF  220
              ++ ++WK +NK+ L   ++   SFSK+ LN AR+VP+MYNY D   LP+LQ+ I SM 
Sbjct  488   KLIEDEWKKLNKEHLHLMSQFLGSFSKASLNCARIVPLMYNYDDNQSLPVLQEYIKSML  546



>ref|XP_010327233.1| PREDICTED: (3S,6E)-nerolidol synthase 1-like isoform X1 [Solanum 
lycopersicum]
 gb|AEP82769.1| terpene synthase [Solanum lycopersicum]
Length=560

 Score =   435 bits (1118),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 221/475 (47%), Positives = 318/475 (67%), Gaps = 12/475 (3%)
 Frame = -2

Query  1623  DAIQHLGIDHHFHDQIGAILQRQYQKVKIDDFQKINGLYDISLSFRLLRQEGYNVSSDVF  1444
             D +Q +GI+HHF  +I +ILQ++Y++     F K    +DISL FRLLRQEGY+VS+DVF
Sbjct  87    DTLQRMGIEHHFQQEIQSILQKEYEQNTC--FLKYQNHHDISLCFRLLRQEGYHVSADVF  144

Query  1443  TKF-TSEKGEFKEELSKDIRGLMALHEASHLSIEGEDVLDEAAKFSRESLIANMVHLDEC  1267
              K   ++ G F   L++D+ GL+ L+EAS L +EGE +LDE AKFS + L A + + DE 
Sbjct  145   KKLKNNDDGTFGLNLNQDVNGLIGLYEASQLGVEGEYILDEIAKFSGDHLNACLANSDE-  203

Query  1266  QASMVQNTLQYPYHKSLARFTAKTFIENMRVENEW-EATLVNLATMDYSITQSFYQEEFR  1090
              A +++ TL+YPYHKSL+R+  K+FI N +  N W + TL  LA MDY IT+  +Q E  
Sbjct  204   -ARIIKETLKYPYHKSLSRWKNKSFINNFKGINGWGKNTLKELANMDYFITKEIHQHELA  262

Query  1089  QILRWWKSLGLKDELA--KNQQLKWYIWTLALIPDPSMSRERIELTKPIALVYLIDDIID  916
             Q+ RWWKSLGL +EL   ++Q LKWY W +A++ DP MS+ERIEL K I+ VY+IDDI D
Sbjct  263   QVFRWWKSLGLAEELKLLRDQPLKWYTWPMAMLTDPKMSQERIELAKCISFVYVIDDIFD  322

Query  915   VYATFDQTKQFIDAINRWDLSVGEGLPDYMKRCLVVLFDTTNDINNLVFEKYGWNPIDHL  736
             VY T ++   F  A++RW+LS    LP+YM+     L++T N I   +++ YG NP  +L
Sbjct  323   VYGTIEELTLFTQAVHRWELSAMMDLPEYMRSLYKALYNTINSIGYNIYKIYGQNPTQNL  382

Query  735   KRAWKCLCSAYITEAKWFATGKSPSANEYLQTGIITTGIPMVLITCFFLLGHGAFA-GTT  559
             +  W  LCSA++ EAKWFA G  P+ +EYL+ G++++G+ + LI  F++LG G  +    
Sbjct  383   QNTWAHLCSAFLIEAKWFACGMVPTTDEYLKNGLVSSGVYVALIHLFYILGLGVSSMHLQ  442

Query  558   DIEDMITSVGAILRLLDDLDATQGEKQDGNDASYVEYYVKEHEGLSISDGKQRIMNMVSE  379
             DI  M TS+  ILRL DDL + + E Q+G D SYVEYY+KE++  S+   ++ ++ ++ +
Sbjct  443   DISLMSTSIAKILRLWDDLGSAKDENQEGKDGSYVEYYMKENKDSSMELAREHVIKLIED  502

Query  378   QWKLINKQ--CLSPTRIPESFSKSCLNIARMVPMMYNYSDTHCLPILQKQIMSMF  220
             +WK +NK+  CL  ++   SFSK+ LN ARMV +MY+Y D   LPILQ+ I SM 
Sbjct  503   EWKQLNKEHFCLM-SQSTRSFSKASLNSARMVSLMYSYDDKQSLPILQEYIKSML  556



>ref|XP_004248509.2| PREDICTED: (3S,6E)-nerolidol synthase 1-like [Solanum lycopersicum]
 gb|AEP82767.1| linalool/nerolidol synthase [Solanum lycopersicum]
Length=563

 Score =   434 bits (1116),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 216/477 (45%), Positives = 320/477 (67%), Gaps = 13/477 (3%)
 Frame = -2

Query  1623  DAIQHLGIDHHFHDQIGAILQRQYQKVKIDDFQKINGLYDISLSFRLLRQEGYNVSSDVF  1444
             D +Q +GI+HHF  +I +ILQ++Y++     F K    +DISL FRLLRQEGY+VS+DVF
Sbjct  88    DTLQRMGIEHHFQQEIQSILQKEYEQNTC--FLKYQNHHDISLCFRLLRQEGYHVSADVF  145

Query  1443  TKF-TSEKGEFKEELSKDIRGLMALHEASHLSIEGEDVLDEAAKFSRESLIANMVHLDEC  1267
              K   ++ G F   L++D+ GL+ L+EAS L +EGE +LDE AKFS + L A +V+ DE 
Sbjct  146   KKLKNNDDGTFGLNLNQDVNGLIGLYEASQLGVEGEYILDEIAKFSGDHLNACLVNSDE-  204

Query  1266  QASMVQNTLQYPYHKSLARFTAKTFIENMRVENEW-EATLVNLATMDYSITQSFYQEEFR  1090
              A +++ TL+YPYHKSL+R+ AK+FI N +  N W ++TL  LA MDYSIT+  +Q E  
Sbjct  205   -ARIIKETLKYPYHKSLSRWKAKSFINNFKGINGWGKSTLQELANMDYSITKEIHQHELI  263

Query  1089  QILRWWKSLGLKDELA--KNQQLKWYIWTLALIPDPSMSRERIELTKPIALVYLIDDIID  916
             Q+ RWW SLGL ++L   ++Q LKWY W + ++ DP MS++RIEL K I+ VY++DDI D
Sbjct  264   QVSRWWSSLGLAEDLKLLRDQPLKWYTWPMTMLTDPKMSQQRIELAKCISFVYVVDDIFD  323

Query  915   VYATFDQTKQFIDAINRWDLSVGEGLPDYMKRCLVVLFDTTNDINNLVFEKYGWNPIDHL  736
             VY T ++   F  A+NRW+L V + LP+YM+     L+DT N I   +++ YG NP  +L
Sbjct  324   VYGTIEELTLFTQAVNRWELCVMKDLPEYMRATYKALYDTINSIGYNIYKIYGQNPTQNL  383

Query  735   KRAWKCLCSAYITEAKWFATGKSPSANEYLQTGIITTGIPMVLITCFFLLGHGAFAGTT-  559
             + AW  LC+A++ EAKWFA+G+ P+ +EYL+ G++++G+ +VL+  F+LLG G     + 
Sbjct  384   RNAWANLCNAFLKEAKWFASGELPTTDEYLKNGLVSSGVHVVLVHMFYLLGFGLNNQNSI  443

Query  558   ---DIEDMITSVGAILRLLDDLDATQGEKQDGNDASYVEYYVKEHEGLSISDGKQRIMNM  388
                D   M +SV  ILRL DDL + + E Q+GND SY+E Y+K  +  SI   ++ ++ +
Sbjct  444   YLEDSSAMASSVATILRLWDDLGSAKDENQEGNDGSYIECYMKGQKNASIELAREYVVKL  503

Query  387   VSEQWKLINKQCLSPTRIP-ESFSKSCLNIARMVPMMYNYSDTHCLPILQKQIMSMF  220
             + ++WK +NK+  +       S+SK+ LN+ARMVP+MYNY D   L +LQ+ I +M 
Sbjct  504   IEDEWKQLNKKHFNLMNGSLGSYSKASLNLARMVPLMYNYDDKQSLHVLQEYINTML  560



>gb|KCW74867.1| hypothetical protein EUGRSUZ_E03605 [Eucalyptus grandis]
Length=483

 Score =   430 bits (1106),  Expect = 6e-140, Method: Compositional matrix adjust.
 Identities = 221/485 (46%), Positives = 310/485 (64%), Gaps = 14/485 (3%)
 Frame = -2

Query  1617  IQHLGIDHHFHDQIGAILQRQYQKVKIDDFQKINGLYDISLSFRLLRQEGYNVSSDVFTK  1438
             IQ LG+   F +QI AIL+ QY      +  K + +Y+I+L FRLLRQEGY+V +DVF  
Sbjct  2     IQRLGVKSLFREQIKAILRWQYTHFSSLNHGK-DDVYEIALRFRLLRQEGYHVPADVFEY  60

Query  1437  FTSEKGEFKEELSKDIRGLMALHEASHLSIEGEDVLDEAAKFSRESLIANMV-HLDECQA  1261
             F  +   F  +L  +I+G+M L+EAS +S+EGED+LDEA  FS   L A +   LD  QA
Sbjct  61    FNDKGKGFVMKLEGNIKGMMELYEASQMSMEGEDILDEAGCFSSNCLNALLTCDLDHEQA  120

Query  1260  SMVQNTLQYPYHKSLARFTA-KTFIENMRVENEWEATLVNLATMDYSITQSFYQEEFRQI  1084
              M+++TLQYPY KS AR  A ++F+ +M   N W    + +A     I Q  +QEE  QI
Sbjct  121   RMIESTLQYPYRKSFARLLAPQSFVNDMPGANSWMEDSLEVANRKRRIDQYVHQEEIHQI  180

Query  1083  LRWWKSLGL--KDELAKNQQLKWYIWTLALIPDPSMSRERIELTKPIALVYLIDDIIDVY  910
              +WWK LGL  K E A++Q LKWY+W++A++ DPS+S  R+EL KPI+LVY+IDDI DV+
Sbjct  181   NKWWKELGLGEKMEFARDQPLKWYMWSVAILTDPSLSELRVELIKPISLVYIIDDIFDVH  240

Query  909   ATFDQTKQFIDAINRWDLSVGEGLPDYMKRCLVVLFDTTNDINNLVFEKYGWNPIDHLKR  730
              T D+   F + I RWD +  E LP+YMK C  VL D  ND   ++FEK+GWNP   LK+
Sbjct  241   GTVDELILFTEVIKRWDNACAEQLPEYMKICFKVLNDIANDFGKIIFEKHGWNPTRFLKQ  300

Query  729   AWKCLCSAYITEAKWFATGKSPSANEYLQTGIITTGIPMVLITCFFLLGHGAFAGTTD--  556
              W  LC+A++ E +W A+GK P A++YL+  IIT+G+P+VL   FFL+G      + D  
Sbjct  301   MWANLCNAFLVEFQWNASGKLPKADDYLKNAIITSGVPLVLTHLFFLMGQNIANQSMDSK  360

Query  555   -----IEDMITSVGAILRLLDDLDATQGEKQDGNDASYVEYYVKEHEGLSISDGKQRIMN  391
                  + ++I  V  ILRL DDL   Q E Q+G D SYVE Y++E+EG S    ++ +M 
Sbjct  361   KEEVQLPNIIFLVAEILRLWDDLGCAQDENQNGYDGSYVECYLRENEGSSYQSAREHVMK  420

Query  390   MVSEQWKLINKQCLSPTRIPESFSKSCLNIARMVPMMYNYSDTHCLPILQKQIMSMFSTI  211
             ++S+ WKL+NK+CLSP      F ++C+N A+MV +MYNY D H L +LQ  + S+  T 
Sbjct  421   LISKLWKLLNKECLSPCPFSAPFLEACVNAAKMVSLMYNYEDKHGLGLLQDHMKSL--TC  478

Query  210   NGESI  196
             + E+I
Sbjct  479   DHETI  483



>gb|AFQ20809.1| S-(+)-linalool synthase [Cinnamomum osmophloeum]
Length=585

 Score =   434 bits (1115),  Expect = 7e-140, Method: Compositional matrix adjust.
 Identities = 218/511 (43%), Positives = 332/511 (65%), Gaps = 13/511 (3%)
 Frame = -2

Query  1731  TLSKDEFLLKSEGKREWQRGLLYQFQEDDLQVLNVIDAIQHLGIDHHFHDQIGAILQRQY  1552
             TLS D   +K   K    R ++   ++   Q++ +ID +Q LGID+HF ++I +IL    
Sbjct  72    TLSLDGLSIKQREKVNQVREIVQNLKDPAEQMV-MIDNLQRLGIDYHFREEIESILCSLS  130

Query  1551  QKVKIDDFQKINGLYDISLSFRLLRQEGYNVSSDVFTKFTSEKGEFKEELSKDIRGLMAL  1372
             +    DD   I+ ++D++L FRLLR+ GY  S DVF  F  ++G FK +L+ DIRGLM+L
Sbjct  131   EN---DD--AISSIHDVALRFRLLREHGYYASPDVFNSFKDKEGRFKLQLTTDIRGLMSL  185

Query  1371  HEASHLSIEGEDVLDEAAKFSRESLIANMVHLDECQASMVQNTLQYPYHKSLARFTAKTF  1192
             +E+S LS EGED+LDE   F+ ++LIA+M  ++      V++ L++P+H SL RF  K  
Sbjct  186   YESSKLSTEGEDILDEVNDFASKNLIASMEFIEPDLEREVRHVLEHPFHMSLPRFNIKKH  245

Query  1191  IENMRVEN-EWEATLVNLATMDYSITQSFYQEEFRQILRWWKSLGLKDEL--AKNQQLKW  1021
             +++++ ++ + +  +  LA +D++I QS +Q E +++ +WW+ LGL  EL  A++Q LKW
Sbjct  246   LKDLQGKDVKTDGPIQELAILDFNILQSMHQSELKEVTKWWRDLGLSQELRFARDQPLKW  305

Query  1020  YIWTLALIPDPSMSRERIELTKPIALVYLIDDIIDVYATFDQTKQFIDAINRWDLSVGEG  841
             Y+W LA++P+P  SR RIELTKPIALVY+IDDI DVY T D+   F +A+NRWD S    
Sbjct  306   YMWPLAVLPNPKFSRYRIELTKPIALVYIIDDIYDVYGTLDELVVFTEAVNRWDPSDINQ  365

Query  840   LPDYMKRCLVVLFDTTNDINNLVFEKYGWNPIDHLKRAWKCLCSAYITEAKWFATGKSPS  661
             LP  MK C + L + TN+I  +V +++GWNPI+ LK+ W  LC+A++ EAKWFA G SP 
Sbjct  366   LPRSMKLCFMALHNITNEIAYMVLKEHGWNPINSLKKTWTDLCNAFLVEAKWFAEGDSPK  425

Query  660   ANEYLQTGIITTGIPMVLITCFFLLGHGAFAGTTDIED----MITSVGAILRLLDDLDAT  493
             A+EYL+ G+ ++G+  VL+  FFL+G+G    + D+ D    +I+    ILRL DDL + 
Sbjct  426   ADEYLRNGVTSSGVAAVLVHLFFLVGNGITRESVDLVDSIPKLISCPAMILRLWDDLGSA  485

Query  492   QGEKQDGNDASYVEYYVKEHEGLSISDGKQRIMNMVSEQWKLINKQCLSPTRIPESFSKS  313
             + E Q G D SYVE Y+KE+   S+   ++ + +M+S  WK +NK+CLSP     +F ++
Sbjct  486   KDENQKGYDGSYVECYLKENATSSLESARRHVRHMISNAWKELNKECLSPYPFSPTFIEA  545

Query  312   CLNIARMVPMMYNYSDTHCLPILQKQIMSMF  220
              LN  RMV +MY+Y +   LP L++ I S+ 
Sbjct  546   SLNTTRMVQVMYSYDNDQRLPALEQHITSLL  576



>ref|XP_008383953.1| PREDICTED: (3S,6E)-nerolidol synthase 1-like isoform X1 [Malus 
domestica]
Length=534

 Score =   432 bits (1110),  Expect = 8e-140, Method: Compositional matrix adjust.
 Identities = 214/483 (44%), Positives = 313/483 (65%), Gaps = 17/483 (4%)
 Frame = -2

Query  1635  LNVIDAIQHLGIDHHFHDQIGAILQRQYQKVKIDDFQKINGLYDISLSFRLLRQEGYNVS  1456
             L  +DA+Q LG+D+HF ++I AIL++Q  +   D+     G+  +SL FRLLRQ+GY+V+
Sbjct  44    LIAVDAMQRLGVDYHFQEEIEAILKKQCTRAXGDEGSDELGV--VSLRFRLLRQQGYHVT  101

Query  1455  SDVFTKFTSEKGEFKEELSKDIRGLMALHEASHLSIEGEDVLDEAAKFSRESLIANMVH-  1279
             +D F KF +      EE   DI GL+ L+EASHLS  GE+ LDEA + S + L   M + 
Sbjct  102   TDAFXKFKN-----NEEFXVDISGLVGLYEASHLSFPGEETLDEAGRRSHQLLTDWMKNN  156

Query  1278  LDECQASMVQNTLQYPYHKSLARFTAKTFIENMRVENEWEATLVNLATMDYSITQSFYQE  1099
             LD+ QAS V  +L++PYHKSL RF AK F+ N   + +W   L  LA +++++ +S  + 
Sbjct  157   LDDHQASAVAYSLEHPYHKSLTRFRAKNFLNNFEGKQKWVNVLRELAKLEFNMVESLIRN  216

Query  1098  EFRQILRWWKSLGLKDEL--AKNQQLKWYIWTLALIPDPSMSRERIELTKPIALVYLIDD  925
             E +Q+ +WWK LGL  EL   ++Q +KWY W +  + DPS+S ER+ELTK I+LVY+IDD
Sbjct  217   EVQQVSKWWKELGLTKELKFVRDQPIKWYTWPMXCLADPSLSEERVELTKSISLVYIIDD  276

Query  924   IIDVYATFDQTKQFIDAINRWDLSVGEGLPDYMKRCLVVLFDTTNDINNLVFEKYGWNPI  745
             I DV  T D+   F  A+ RWD+     LP+YMK C   L+D TN+ + +V +++GWNP+
Sbjct  277   IFDVQGTLDELILFTAAVERWDIDATGELPNYMKICFKALYDITNETSYIVHKRHGWNPL  336

Query  744   DHLKRAWKCLCSAYITEAKWFATGKSPSANEYLQTGIITTGIPMVLITCFFLLGHGAFAG  565
             + LK++W  LC A++ EA+WF+ G  P++ EYL  G I++G+P+VL   FFLLG G    
Sbjct  337   ESLKKSWATLCKAFLLEARWFSCGHLPNSEEYLNNGFISSGVPVVLTHAFFLLGQGISKE  396

Query  564   TTDIED------MITSVGAILRLLDDLDATQGEKQDGNDASYVEYYVKEHEGLSISDGKQ  403
             T  I D      +I+S   ILRL DD  + + E QDGND SY+  YV E++G S  D + 
Sbjct  397   TVRIVDNINISSIISSTATILRLWDDFGSAKDEDQDGNDGSYIACYVNENQGCSDEDARA  456

Query  402   RIMNMVSEQWKLINKQCLSPTR-IPESFSKSCLNIARMVPMMYNYSDTHCLPILQKQIMS  226
              +++ +SE+WK +NK+CLS +     SF+K  LN+ARMVP+MY+Y+  H LP L++ + S
Sbjct  457   FVVHRISEEWKFLNKECLSASNPFSASFTKLALNVARMVPLMYDYNSQHSLPSLEENMKS  516

Query  225   MFS  217
             + S
Sbjct  517   LLS  519



>gb|AFK09263.1| S-(+)-linalool synthase [Cinnamomum osmophloeum]
Length=585

 Score =   433 bits (1114),  Expect = 9e-140, Method: Compositional matrix adjust.
 Identities = 218/511 (43%), Positives = 333/511 (65%), Gaps = 13/511 (3%)
 Frame = -2

Query  1731  TLSKDEFLLKSEGKREWQRGLLYQFQEDDLQVLNVIDAIQHLGIDHHFHDQIGAILQRQY  1552
             TLS D   +K   K    R ++   ++   Q++ +ID +Q LGID+HF ++I +IL    
Sbjct  72    TLSLDGLSIKQREKVNQVREIVQNLKDPAEQMV-MIDNLQRLGIDYHFREEIESILCSLS  130

Query  1551  QKVKIDDFQKINGLYDISLSFRLLRQEGYNVSSDVFTKFTSEKGEFKEELSKDIRGLMAL  1372
             +    DD   I+ ++D++L FRLLR+ GY  S DVF  F  ++G FK +L+ DI+GLM+L
Sbjct  131   EN---DD--AISSIHDVALRFRLLREHGYYASPDVFNSFKDKEGRFKLQLTTDIKGLMSL  185

Query  1371  HEASHLSIEGEDVLDEAAKFSRESLIANMVHLDECQASMVQNTLQYPYHKSLARFTAKTF  1192
             +E+S LS EGED+LDE   F+ ++LIA+M  ++      V++ L++P+H SL RF  K  
Sbjct  186   YESSKLSTEGEDILDEVNDFASKNLIASMEFIEPDLEREVRHVLEHPFHMSLPRFNIKKH  245

Query  1191  IENMRVEN-EWEATLVNLATMDYSITQSFYQEEFRQILRWWKSLGLKDEL--AKNQQLKW  1021
             +++++ ++ + +  +  LA +D++I QS +Q E +++ +WW+ LGL  EL  A++Q LKW
Sbjct  246   LKDLQGKDVKTDGPIQELAILDFNILQSMHQSELKEVTKWWRDLGLSQELRFARDQPLKW  305

Query  1020  YIWTLALIPDPSMSRERIELTKPIALVYLIDDIIDVYATFDQTKQFIDAINRWDLSVGEG  841
             Y+W LA++P+P  SR RIELTKPIALVY+IDDI DVY T D+   F +A+NRWD S    
Sbjct  306   YMWPLAVLPNPKFSRYRIELTKPIALVYIIDDIYDVYGTLDELVVFTEAVNRWDPSDINQ  365

Query  840   LPDYMKRCLVVLFDTTNDINNLVFEKYGWNPIDHLKRAWKCLCSAYITEAKWFATGKSPS  661
             LP  MK C + L + TN+I  +V +++GWNPI+ LK+ W  LC+A++ EAKWFA G SP 
Sbjct  366   LPRNMKLCFMALHNITNEIAYMVLKEHGWNPINSLKKTWTDLCNAFLVEAKWFAEGDSPK  425

Query  660   ANEYLQTGIITTGIPMVLITCFFLLGHGAFAGTTDIED----MITSVGAILRLLDDLDAT  493
             A+EYL+ G+ ++G+  VL+  FFL+G+G    + D+ D    +I+    ILRL DDL + 
Sbjct  426   ADEYLRNGVTSSGVAAVLVHLFFLVGNGITRESVDLVDSIPKLISCPAMILRLWDDLGSA  485

Query  492   QGEKQDGNDASYVEYYVKEHEGLSISDGKQRIMNMVSEQWKLINKQCLSPTRIPESFSKS  313
             + E Q G D SYVE Y+KE+   S+   ++ + +M+S  WK +NK+CLSP     +F ++
Sbjct  486   KDENQKGYDGSYVECYLKENATSSLESARRHVRHMISNAWKELNKECLSPYPFSPTFIEA  545

Query  312   CLNIARMVPMMYNYSDTHCLPILQKQIMSMF  220
              LN ARMV +MY+Y +   LP L++ I S+ 
Sbjct  546   SLNTARMVQVMYSYDNDQRLPALEQHITSLL  576



>gb|AFK09265.1| S-(+)-linalool synthase [Cinnamomum osmophloeum]
Length=585

 Score =   432 bits (1112),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 216/511 (42%), Positives = 332/511 (65%), Gaps = 13/511 (3%)
 Frame = -2

Query  1731  TLSKDEFLLKSEGKREWQRGLLYQFQEDDLQVLNVIDAIQHLGIDHHFHDQIGAILQRQY  1552
             TLS D   +K   K    R ++   ++   Q++ +ID +Q LG D+HF ++I +IL    
Sbjct  72    TLSLDGLSIKQRAKVNQVREIVQNLKDPAEQMV-MIDNLQRLGTDYHFQEEIESILCSLS  130

Query  1551  QKVKIDDFQKINGLYDISLSFRLLRQEGYNVSSDVFTKFTSEKGEFKEELSKDIRGLMAL  1372
             +    DD   I+ ++D++L FRLLR+ GY  S DVF  F  ++G FK +L+ D++GLM+L
Sbjct  131   EN---DD--AISSIHDVALRFRLLREHGYYASPDVFNSFKDKEGRFKLQLTTDMKGLMSL  185

Query  1371  HEASHLSIEGEDVLDEAAKFSRESLIANMVHLDECQASMVQNTLQYPYHKSLARFTAKTF  1192
             +E+S LS EGED+LDE   F+ ++LIA+M  ++      V++ L++P+H SL RF  K  
Sbjct  186   YESSKLSTEGEDILDEVNDFASKNLIASMEFIEPDLEREVRHVLEHPFHMSLPRFNIKKH  245

Query  1191  IENMRVEN-EWEATLVNLATMDYSITQSFYQEEFRQILRWWKSLGLKDEL--AKNQQLKW  1021
             +++++ ++ + +A +  LA +D++I QS +Q E +++ +WW+ LGL  EL  A++Q LKW
Sbjct  246   LKDLQGKDVKADALIQELAILDFNILQSMHQSELKEVTKWWRDLGLSQELRFARDQPLKW  305

Query  1020  YIWTLALIPDPSMSRERIELTKPIALVYLIDDIIDVYATFDQTKQFIDAINRWDLSVGEG  841
             Y+W LA++P+P  SR RIELTKPIALVY+IDDI D Y T D+   F +A+NRWD S    
Sbjct  306   YVWPLAVLPNPKFSRYRIELTKPIALVYIIDDIYDFYGTLDELVVFTEAVNRWDPSDINQ  365

Query  840   LPDYMKRCLVVLFDTTNDINNLVFEKYGWNPIDHLKRAWKCLCSAYITEAKWFATGKSPS  661
             LP  MK C + L + TN+I  +V +++GWNPI+ LK+ W  LC+A++ EAKWFA G SP 
Sbjct  366   LPRNMKLCFMALHNITNEIAYMVLKEHGWNPINSLKKTWTDLCNAFLVEAKWFAEGDSPK  425

Query  660   ANEYLQTGIITTGIPMVLITCFFLLGHGAFAGTTDIED----MITSVGAILRLLDDLDAT  493
             A+EYL+ G+ ++G+  VL+  FFL+G+G    + D+ D    +I+    ILRL DDL + 
Sbjct  426   ADEYLRNGVTSSGVATVLVHLFFLVGNGITRESVDLVDSIPKLISCPAMILRLWDDLGSA  485

Query  492   QGEKQDGNDASYVEYYVKEHEGLSISDGKQRIMNMVSEQWKLINKQCLSPTRIPESFSKS  313
             + E Q G D SYVE Y+KE+   S+   ++ + +M+S  WK +NK+CLSP     +F ++
Sbjct  486   KDENQKGYDGSYVECYLKENATSSLESARRHVRHMISNAWKELNKECLSPCPFSPTFIEA  545

Query  312   CLNIARMVPMMYNYSDTHCLPILQKQIMSMF  220
              LN  RMV +MY+Y +   LP L++ I S+F
Sbjct  546   SLNTTRMVQVMYSYDNDQRLPALEQHIASLF  576



>ref|XP_007159218.1| hypothetical protein PHAVU_002G219100g [Phaseolus vulgaris]
 gb|ESW31212.1| hypothetical protein PHAVU_002G219100g [Phaseolus vulgaris]
Length=568

 Score =   432 bits (1110),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 215/485 (44%), Positives = 313/485 (65%), Gaps = 7/485 (1%)
 Frame = -2

Query  1653  EDDLQVLNVIDAIQHLGIDHHFHDQIGAILQRQYQKV-KIDDFQKINGLYDISLSFRLLR  1477
             E  L+ L +ID +Q L ID+HF ++I A L +QY     I      + ++D +L FRLLR
Sbjct  79    EKSLKDLYMIDVMQRLNIDYHFKEEIEAFLGKQYVNCSNIIGSGYGDHIHDTALLFRLLR  138

Query  1476  QEGYNVSSDVFTKFTSEKGEFKEELSKDIRGLMALHEASHLSIEGEDVLDEAAKFSRESL  1297
             Q+GY V +DVF KFT+++ +FK EL ++I+G++ ++EAS L I GED+L EA KFS + L
Sbjct  139   QQGYFVPADVFEKFTNKERKFKPELGENIKGMIEMYEASQLGIAGEDILAEAEKFSGKIL  198

Query  1296  IANMVHLDECQASMVQNTLQYPYHKSLARFTAKTFIENMRVENEWEATLVNLATMDYSIT  1117
                +  +D   A  V+ TL++P+HKSL  FTA+ F+ +   +N   ++   +A MD+S+ 
Sbjct  199   KEKVDCIDSHGAKFVKTTLEHPFHKSLPLFTARNFLGDFHDKNPRLSSFCQIAKMDFSLL  258

Query  1116  QSFYQEEFRQILRWWKSLGLKDEL--AKNQQLKWYIWTLALIPDPSMSRERIELTKPIAL  943
             Q     E  Q+ +WW  LGL +EL  A+NQ LKWYIW+LA   DP++S ERIELTKPI+L
Sbjct  259   QGSCHREIGQVSKWWSGLGLANELIYARNQPLKWYIWSLACFSDPTLSEERIELTKPISL  318

Query  942   VYLIDDIIDVYATFDQTKQFIDAINRWDLSVGEGLPDYMKRCLVVLFDTTNDINNLVFEK  763
             +Y+IDDI DVY T D+   F +A+ RWD++  E LPDYMK C  VL++ TN+I++ V+EK
Sbjct  319   IYIIDDIFDVYGTLDELTLFTEAVCRWDITAIEELPDYMKTCFRVLYNLTNEISSKVYEK  378

Query  762   YGWNPIDHLKRAWKCLCSAYITEAKWFATGKSPSANEYLQTGIITTGIPMVLITCFFLLG  583
             +GWNPI  L+ AWK LC A++ EAKWF +GK PSA EYL+ G +++G+ +V++  FFLLG
Sbjct  379   HGWNPIHSLQNAWKSLCKAFLVEAKWFGSGKLPSAEEYLENGTVSSGVHIVMVHAFFLLG  438

Query  582   HGAFAGTTDIED----MITSVGAILRLLDDLDATQGEKQDGNDASYVEYYVKEHEGLSIS  415
              G       I D    +I+S   ILRL DDL   + E Q  ND SYV   + E    +  
Sbjct  439   QGLTEENAKIIDKGPAIISSPATILRLWDDLGNAEDENQKSNDGSYVNCVMMEKPEYTKM  498

Query  414   DGKQRIMNMVSEQWKLINKQCLSPTRIPESFSKSCLNIARMVPMMYNYSDTHCLPILQKQ  235
               ++ +MN + + WK +N++ LS      +F+ S LN+ARMVP+MY+Y     LP L+++
Sbjct  499   VAREIMMNKICDAWKRLNQEWLSDKHFHSTFTNSALNLARMVPLMYSYDHNQSLPGLEEK  558

Query  234   IMSMF  220
             + S+ 
Sbjct  559   VKSLL  563



>gb|AFK09264.1| S-(+)-linalool synthase [Cinnamomum osmophloeum]
Length=585

 Score =   432 bits (1111),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 218/511 (43%), Positives = 333/511 (65%), Gaps = 13/511 (3%)
 Frame = -2

Query  1731  TLSKDEFLLKSEGKREWQRGLLYQFQEDDLQVLNVIDAIQHLGIDHHFHDQIGAILQRQY  1552
             TLS D   +K   K    R ++   ++   Q++ +ID +Q LGID+ F ++I +IL    
Sbjct  72    TLSLDGLSIKQREKVNQVREIVQNLKDPAEQMV-MIDNLQRLGIDYQFREEIESILCSLS  130

Query  1551  QKVKIDDFQKINGLYDISLSFRLLRQEGYNVSSDVFTKFTSEKGEFKEELSKDIRGLMAL  1372
             +    DD   I+ ++D++L FRLLR+ GY  S DVF  F  ++G FK +L+ DI+G M+L
Sbjct  131   EN---DD--AISSIHDVALRFRLLREHGYYASPDVFNSFKDKEGRFKLQLTTDIKGSMSL  185

Query  1371  HEASHLSIEGEDVLDEAAKFSRESLIANMVHLDECQASMVQNTLQYPYHKSLARFTAKTF  1192
             +E+S LS EGED+LDE   F+ ++LIA+M  ++      V++ L++P+H SL RF  K  
Sbjct  186   YESSKLSTEGEDILDEVNDFASKNLIASMEFIEPDLEREVRHVLEHPFHMSLPRFNIKKH  245

Query  1191  IENMRVEN-EWEATLVNLATMDYSITQSFYQEEFRQILRWWKSLGLKDEL--AKNQQLKW  1021
             +++++ ++ + +A +  LA +D++I QS +Q E +++ +WW+ LGL  EL  A++Q LKW
Sbjct  246   LKDLQGKDVKTDAPIQELAILDFNILQSMHQSELKEVTKWWRDLGLSQELRFARDQPLKW  305

Query  1020  YIWTLALIPDPSMSRERIELTKPIALVYLIDDIIDVYATFDQTKQFIDAINRWDLSVGEG  841
             Y+W LA++P+P  SR RIELTKPIALVY+IDDI DVY T D+   F +A+NRWD S    
Sbjct  306   YMWPLAVLPNPKFSRYRIELTKPIALVYIIDDIYDVYGTLDELVVFTEAVNRWDPSDINQ  365

Query  840   LPDYMKRCLVVLFDTTNDINNLVFEKYGWNPIDHLKRAWKCLCSAYITEAKWFATGKSPS  661
             LP  MK C + L +TTN+I  +V +++GWNPI+ LK+ W  LC+A++ EAKWFA G SP 
Sbjct  366   LPRNMKLCFMALHNTTNEIAYMVLKEHGWNPINSLKKTWTDLCNAFLVEAKWFAEGDSPK  425

Query  660   ANEYLQTGIITTGIPMVLITCFFLLGHGAFAGTTDIED----MITSVGAILRLLDDLDAT  493
             A+EYL+ G+ ++G+  VL+  FFL+G+G    + D+ D    +I+    ILRL DDL + 
Sbjct  426   ADEYLRNGVTSSGVATVLVHLFFLVGNGITRESVDLVDSTPKLISCPAMILRLWDDLGSA  485

Query  492   QGEKQDGNDASYVEYYVKEHEGLSISDGKQRIMNMVSEQWKLINKQCLSPTRIPESFSKS  313
             + E Q G D SYVE Y+KE+   S+   ++ + +M+S  WK +NK+CLSP     +F ++
Sbjct  486   KDENQKGYDGSYVECYLKENATSSLESARRHVRHMISNAWKELNKECLSPYTFSPTFIEA  545

Query  312   CLNIARMVPMMYNYSDTHCLPILQKQIMSMF  220
              LN  RMV +MY+Y +   LP L++ I S+F
Sbjct  546   SLNTTRMVQVMYSYDNDQRLPALEQHIASLF  576



>ref|XP_006352642.1| PREDICTED: (3S,6E)-nerolidol synthase 2, chloroplastic/mitochondrial-like 
[Solanum tuberosum]
Length=566

 Score =   431 bits (1109),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 220/483 (46%), Positives = 320/483 (66%), Gaps = 15/483 (3%)
 Frame = -2

Query  1635  LNVIDAIQHLGIDHHFHDQIGAILQRQYQKVKIDDFQKINGLYDISLSFRLLRQEGYNVS  1456
             L ++DA+Q +GI+HHF ++I +ILQ++Y++     F K    +DISL FRLLRQEGY+VS
Sbjct  82    LVLVDALQRMGIEHHFQEEIQSILQKEYEQSAC--FYKYQNHHDISLCFRLLRQEGYHVS  139

Query  1455  SDVFTKF-TSEKGEFKEELSKD-IRGLMALHEASHLSIEGEDVLDEAAKFSRESLIANMV  1282
             +DVF +F  ++ G F   LS+D + GL+ L+EAS L +EGE +LDE A FS + L A + 
Sbjct  140   ADVFKRFKNNDDGTFGLNLSQDDVNGLIGLYEASQLGVEGEHILDEVANFSGDHLNACLA  199

Query  1281  HLDEC-QASMVQNTLQYPYHKSLARFTAKTFIENMRVENEW-EATLVNLATMDYSITQSF  1108
             + D C +A +++ TL+YPYHKSLA   AK+FI N +  N W  +TL  LA MDYSIT+  
Sbjct  200   NSDSCDEARIIKETLKYPYHKSLASCKAKSFINNFKGINGWGRSTLQELANMDYSITKEI  259

Query  1107  YQEEFRQILRWWKSLGLKDELA--KNQQLKWYIWTLALIPDPSMSRERIELTKPIALVYL  934
             +Q E  Q+ R+    GL +EL   ++Q LKWY W +A++ DP MS++RIEL K I+ VY+
Sbjct  260   HQHELAQVSRYLSLSGLAEELKLLRDQPLKWYTWPMAVLQDPRMSQQRIELAKCISFVYV  319

Query  933   IDDIIDVYATFDQTKQFIDAINRWDLSVGEGLPDYMKRCLVVLFDTTNDINNLVFEKYGW  754
             IDDI DVY T ++   F  A+NRW+L+    LP+YM+     L++T N I   V++ YG 
Sbjct  320   IDDIFDVYGTIEELTLFTQAVNRWELNAMTDLPEYMRSTYKALYNTINSIGYNVYKIYGQ  379

Query  753   NPIDHLKRAWKCLCSAYITEAKWFATGKSPSANEYLQTGIITTGIPMVLITCFFLLGHGA  574
             NP  +L+  W  LC+A++ EAKWFA+G  PS NEYL+ G++++G+  +L+  F++LG G 
Sbjct  380   NPTQNLRNTWGNLCNAFLKEAKWFASGVVPSTNEYLKNGVVSSGVGTILVHMFYILGLGV  439

Query  573   FAGT--TDIEDMITSVGAILRLLDDLDATQGEKQDGNDASYVEYYVKEHEGLSISDGKQR  400
              +     DI  M +S   ILRL DDL + + E Q+G D SY+E Y+KE++  SI   ++ 
Sbjct  440   NSNIHLEDISSMSSSGAMILRLWDDLGSAKDENQEGKDGSYIECYMKENKDASIELAREH  499

Query  399   IMNMVSEQWKLINKQCL---SPTRIPESFSKSCLNIARMVPMMYNYSDTHCLPILQKQIM  229
             ++ ++ ++WK +NK+ L   SP+    SFSK+ LN ARMVP+MY+Y D   LPILQ+ I 
Sbjct  500   VIKLIEDEWKKLNKEHLHLMSPS--SRSFSKASLNSARMVPLMYSYDDNQSLPILQEYIK  557

Query  228   SMF  220
             SM 
Sbjct  558   SML  560



>gb|AFK09266.1| S-(+)-linalool synthase [Cinnamomum osmophloeum]
Length=585

 Score =   431 bits (1108),  Expect = 6e-139, Method: Compositional matrix adjust.
 Identities = 216/511 (42%), Positives = 333/511 (65%), Gaps = 13/511 (3%)
 Frame = -2

Query  1731  TLSKDEFLLKSEGKREWQRGLLYQFQEDDLQVLNVIDAIQHLGIDHHFHDQIGAILQRQY  1552
             TLS D   +K   K    R ++   ++   Q++ +ID +Q LGID+HF ++I +IL    
Sbjct  72    TLSLDGLSIKQREKVNQVREIVQNLKDPAEQMV-MIDNLQRLGIDYHFREEIESILCSLS  130

Query  1551  QKVKIDDFQKINGLYDISLSFRLLRQEGYNVSSDVFTKFTSEKGEFKEELSKDIRGLMAL  1372
             +    DD   I+ ++D++L FRLLR+ G+  S DVF  F  ++G FK +L+ DI+GLM+L
Sbjct  131   EN---DD--AISSIHDVALRFRLLREHGHYASPDVFNSFKDKEGRFKLQLTTDIKGLMSL  185

Query  1371  HEASHLSIEGEDVLDEAAKFSRESLIANMVHLDECQASMVQNTLQYPYHKSLARFTAKTF  1192
             +E+S LS EGED+LDE   F+ ++LIA+M  ++      V++ L++P+H SL RF  K  
Sbjct  186   YESSKLSTEGEDILDEVNDFASKNLIASMEFIEPDLEREVRHVLEHPFHMSLPRFNIKKH  245

Query  1191  IENMRVEN-EWEATLVNLATMDYSITQSFYQEEFRQILRWWKSLGLKDEL--AKNQQLKW  1021
             +++++ ++ + +A +  LA +D++I QS +Q E +++ +WW+ LGL  EL  A++Q LKW
Sbjct  246   LKDLQGKDVKTDAPIQELAILDFNILQSMHQSELKEVTKWWRDLGLSQELRFARDQPLKW  305

Query  1020  YIWTLALIPDPSMSRERIELTKPIALVYLIDDIIDVYATFDQTKQFIDAINRWDLSVGEG  841
             Y+W LA++P+P  SR RIELTKPIALVY+IDDI DVY T D+   F +A+NRWD S    
Sbjct  306   YMWPLAVLPNPKFSRYRIELTKPIALVYIIDDIYDVYGTLDELVVFTEAVNRWDPSDINQ  365

Query  840   LPDYMKRCLVVLFDTTNDINNLVFEKYGWNPIDHLKRAWKCLCSAYITEAKWFATGKSPS  661
             LP  MK C + L + TN++  +V +++GWNPI+ LK+ W  LC+A++ EAKWFA G SP 
Sbjct  366   LPRNMKLCFMALHNITNEVAYMVLKEHGWNPINSLKKTWTDLCNAFLVEAKWFAEGDSPK  425

Query  660   ANEYLQTGIITTGIPMVLITCFFLLGHGAFAGTTDIED----MITSVGAILRLLDDLDAT  493
             A+EYL+ G+ ++G+  VL+  FFL+G+G    + D+ D    +I+    ILRL DDL + 
Sbjct  426   ADEYLRNGVTSSGVATVLVHLFFLVGNGITRESVDLVDSIPKLISCPAMILRLWDDLGSA  485

Query  492   QGEKQDGNDASYVEYYVKEHEGLSISDGKQRIMNMVSEQWKLINKQCLSPTRIPESFSKS  313
             + E Q G D SYVE Y+KE+   S+   ++ + +M+S  WK +NK+CLSP     +F ++
Sbjct  486   KDENQKGYDGSYVECYLKENATSSLESARRHVRHMISNAWKELNKECLSPYPFSPTFIEA  545

Query  312   CLNIARMVPMMYNYSDTHCLPILQKQIMSMF  220
              LN  RMV +MY+Y +   LP L++ I S+ 
Sbjct  546   SLNTTRMVQVMYSYDNDQRLPALEQHITSLL  576



>gb|AFK09262.1| S-(+)-linalool synthase [Cinnamomum micranthum f. kanehirae]
Length=593

 Score =   431 bits (1109),  Expect = 6e-139, Method: Compositional matrix adjust.
 Identities = 216/511 (42%), Positives = 334/511 (65%), Gaps = 13/511 (3%)
 Frame = -2

Query  1731  TLSKDEFLLKSEGKREWQRGLLYQFQEDDLQVLNVIDAIQHLGIDHHFHDQIGAILQRQY  1552
             T+  D  ++K   K    R ++ Q  +D  + + +ID +Q LGID+HF ++I +IL    
Sbjct  72    TIILDGLIIKQREKVNQVREIV-QNLKDPAEKMVMIDNLQRLGIDYHFREEIESILCSLS  130

Query  1551  QKVKIDDFQKINGLYDISLSFRLLRQEGYNVSSDVFTKFTSEKGEFKEELSKDIRGLMAL  1372
             +    DD   ++ ++D++L FRLLR+ GY+ S DVF  F  ++G FK +L+ DI+GLM+L
Sbjct  131   EN---DD--AVSSIHDVALRFRLLREHGYHASLDVFNSFKDKEGRFKLQLTADIKGLMSL  185

Query  1371  HEASHLSIEGEDVLDEAAKFSRESLIANMVHLDECQASMVQNTLQYPYHKSLARFTAKTF  1192
             +E+S LS EGED+LDE   F+ ++LIA+M  ++      V++ L++P+H SL RF  K  
Sbjct  186   YESSKLSTEGEDILDEVNDFASKNLIASMEFIEPDLEREVRHVLEHPFHMSLPRFNIKKH  245

Query  1191  IENMRVEN-EWEATLVNLATMDYSITQSFYQEEFRQILRWWKSLGLKDEL--AKNQQLKW  1021
             +++++ ++ + +A +  LA +D++I QS +Q E +++ +WW  LGL  EL  A++Q LKW
Sbjct  246   LKDLQGKDGKTDAPIQELAILDFNILQSMHQSELKEVAKWWGDLGLSQELRFARDQPLKW  305

Query  1020  YIWTLALIPDPSMSRERIELTKPIALVYLIDDIIDVYATFDQTKQFIDAINRWDLSVGEG  841
             Y+W LA++P+P  SR RIELTKPIALVY+IDDI DVY T D+   F +A+NRWD S    
Sbjct  306   YMWPLAVLPNPKFSRYRIELTKPIALVYIIDDIYDVYGTLDELVVFTEAVNRWDPSDINQ  365

Query  840   LPDYMKRCLVVLFDTTNDINNLVFEKYGWNPIDHLKRAWKCLCSAYITEAKWFATGKSPS  661
             LP  MK C + L + TN+I  +V +++GWNPI+ LK+ W+ LC+A++ EAKWFA G SP 
Sbjct  366   LPRNMKLCFMALHNITNEIAYMVLKEHGWNPINSLKKTWRDLCNAFLVEAKWFAEGDSPK  425

Query  660   ANEYLQTGIITTGIPMVLITCFFLLGHGAFAGTTDIED----MITSVGAILRLLDDLDAT  493
             A+EYL+ G+ ++G+  VL+  FFL+G+G    + D+ D    +I+    ILRL DDL + 
Sbjct  426   ADEYLRNGVTSSGVATVLVHLFFLVGNGITRESVDLVDSIPKLISRPAVILRLWDDLGSA  485

Query  492   QGEKQDGNDASYVEYYVKEHEGLSISDGKQRIMNMVSEQWKLINKQCLSPTRIPESFSKS  313
             + E Q G D SYVE Y+KE+   S+   ++ + +M+S  WK +NK+CLSP     +F ++
Sbjct  486   KDENQKGYDGSYVECYLKENATSSLESARRHVRHMISNAWKELNKECLSPYPFSPTFIEA  545

Query  312   CLNIARMVPMMYNYSDTHCLPILQKQIMSMF  220
              LN  RMV +MY+Y +   LP L++ I S+ 
Sbjct  546   SLNTTRMVQVMYSYDNDQRLPALEQHITSLL  576



>ref|XP_009626821.1| PREDICTED: (3S,6E)-nerolidol synthase 1 [Nicotiana tomentosiformis]
Length=568

 Score =   430 bits (1106),  Expect = 7e-139, Method: Compositional matrix adjust.
 Identities = 231/559 (41%), Positives = 342/559 (61%), Gaps = 19/559 (3%)
 Frame = -2

Query  1845  SIPCFSIGTALHCRRRTPVVFRCQSVNSSSLRSEKMTVT--------LSKDEFLLKSEGK  1690
             S  C  I ++        +   C S N  +++ + +  T         ++D F  K    
Sbjct  10    SYLCMHISSSCPNGSSKFIQVSCGSSNKRAVQEDLLRTTSHRPTPTNFNQDGFHRKFALV  69

Query  1689  REWQRGLLYQFQEDDLQVLNVIDAIQHLGIDHHFHDQIGAILQRQYQKVKIDDFQKINGL  1510
              + +  L      + L  L +IDA+Q +GID+HF ++I ++L+ +Y  V+   F K    
Sbjct  70    EDVKHELKTNVNHNRLDNLVLIDALQRMGIDYHFQEEIESVLEEEY--VQSACFLKYQTH  127

Query  1509  YDISLSFRLLRQEGYNVSSDVFTKFTSE-KGEFKEELSKDIRGLMALHEASHLSIEGEDV  1333
             +++SL FRLLRQ+GY V +DVF KF ++  G F   LS+DI GL+ L+EA+ L +EGE +
Sbjct  128   FEVSLCFRLLRQQGYYVPADVFKKFKNKYDGTFGLNLSQDISGLIGLYEAAQLGVEGEHI  187

Query  1332  LDEAAKFSRESLIANMVHLDECQASMVQNTLQYPYHKSLARFTAKTFIENMRVENEW-EA  1156
             LDE A FS + L A + H D  QA ++ +TL+YPYHKSLA + AK FI N R  N W  +
Sbjct  188   LDEVANFSGQKLNAYLEHNDCVQARIINDTLKYPYHKSLASYKAKNFITNFRGVNGWGRS  247

Query  1155  TLVNLATMDYSITQSFYQEEFRQILRWWKSLGLKDELA--KNQQLKWYIWTLALIPDPSM  982
             TL  LA +D+SI +  +Q E  Q+ RWW+SLGL ++L   ++Q LKWY W +AL  DP M
Sbjct  248   TLQELANIDFSIAREIHQHEMSQVSRWWRSLGLVEDLKLLRDQPLKWYAWPMALFADPRM  307

Query  981   SRERIELTKPIALVYLIDDIIDVYATFDQTKQFIDAINRWDLSVGEGLPDYMKRCLVVLF  802
             S +RIEL K I+ +Y+IDDI DVY T ++   F +A+NRW+L     LP+YM+     L+
Sbjct  308   SLQRIELAKCISFIYVIDDIFDVYGTVEELTLFTEAVNRWELDAMVDLPEYMRTPYRALY  367

Query  801   DTTNDINNLVFEKYGWNPIDHLKRAWKCLCSAYITEAKWFATGKSPSANEYLQTGIITTG  622
             DT N I   +++ YGWNP ++L++ W  LC+A++ EAKWFA G  P+A+EYL+ G++++G
Sbjct  368   DTINGIGYNIYKIYGWNPTENLRKTWGNLCNAFLKEAKWFADGVIPAADEYLKNGLVSSG  427

Query  621   IPMVLITCFFLLGHGAFAGTTDI--ED---MITSVGAILRLLDDLDATQGEKQDGNDASY  457
             + ++ +  F+LLG G     + I  ED   M +S   ILRL DDL + + E Q+GND SY
Sbjct  428   VHVLSVHMFYLLGFGVTNNESSINLEDTSAMASSGAMILRLWDDLGSAKDENQEGNDGSY  487

Query  456   VEYYVKEHEGLSISDGKQRIMNMVSEQWKLINKQCLSPTRIPESFSKSCLNIARMVPMMY  277
             +E Y+K  +  S    +  +  ++ ++WK +NK+ L  +R   SF+K+ LN ARMVP+MY
Sbjct  488   IECYMKGQKIASFELARNHVFKLIEDEWKQLNKEHLRLSRSLGSFTKALLNFARMVPLMY  547

Query  276   NYSDTHCLPILQKQIMSMF  220
             NY D H LPILQ+ I SM 
Sbjct  548   NYDDKHSLPILQEYIKSML  566



>ref|XP_006467943.1| PREDICTED: (3S,6E)-nerolidol synthase 1, chloroplastic-like isoform 
X1 [Citrus sinensis]
 ref|XP_006467944.1| PREDICTED: (3S,6E)-nerolidol synthase 1, chloroplastic-like isoform 
X2 [Citrus sinensis]
 gb|KDO75633.1| hypothetical protein CISIN_1g007889mg [Citrus sinensis]
Length=586

 Score =   430 bits (1106),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 234/514 (46%), Positives = 338/514 (66%), Gaps = 13/514 (3%)
 Frame = -2

Query  1731  TLSKDEFLLKSEGKREWQRGLLYQFQEDD-LQVLNVIDAIQHLGIDHHFHDQIGAILQRQ  1555
             + + D+  +    K +  + +L +  +DD  + L +ID +Q LGID++F D+I  ILQRQ
Sbjct  66    SFNNDDIHIDHAKKLDAVKHILIRVGDDDPFEGLAMIDTVQRLGIDYYFQDEIEQILQRQ  125

Query  1554  YQKVKIDDFQKINGLYDISLSFRLLRQEGYNVSSDVFTKFTSEKGEFKEELSKDIRGLMA  1375
                V  +   + N L +++L FRLLRQ+GY VS DVF  F +++G+ K+ +S DI GLM+
Sbjct  126   -SIVFSNHGDRHNDLQEVALRFRLLRQQGYYVSPDVFNNFRNKEGKSKQNISGDINGLMS  184

Query  1374  LHEASHLSIEGEDVLDEAAKFSRESLIANMVHL-DECQASMVQNTLQYPYHKSLARFTAK  1198
             L+EAS LSI GEDVLDEA  FS   L     HL D   A +V++ L +PY KSL+  +A+
Sbjct  185   LYEASQLSIVGEDVLDEAGDFSVNLLSEYATHLADYDLAGLVKHLLLHPYRKSLS--SAR  242

Query  1197  TFIENMRVENE--WEATLVNLATMDYSITQSFYQEEFRQILRWWKSLGL--KDELAKNQQ  1030
              F       NE  W   L  LA MD+ + QS +Q+E  QI +WWK LGL  K E A++Q 
Sbjct  243   NFFHGNFQGNEYVWILDLKELANMDFKLVQSLHQKEIVQISKWWKELGLAKKLEFARDQP  302

Query  1029  LKWYIWTLALIPDPSMSRERIELTKPIALVYLIDDIIDVYATFDQTKQFIDAINRWDLSV  850
             LKWY+W++A   DPS+S +RIELTKPI+ +Y+IDDI D+Y   D    F +AINRWDL  
Sbjct  303   LKWYMWSMACFTDPSLSWQRIELTKPISFIYIIDDIFDIYGALDVLTLFTEAINRWDLGG  362

Query  849   GEGLPDYMKRCLVVLFDTTNDINNLVFEKYGWNPIDHLKRAWKCLCSAYITEAKWFATGK  670
              E LP+ MK C   L D TN+I+N V++++G+NP+  L++AW  LC+A++TEAKWFA+G+
Sbjct  363   IEQLPECMKICFKALNDITNEISNKVYKEHGYNPVHSLRKAWGSLCNAFLTEAKWFASGQ  422

Query  669   SPSANEYLQTGIITTGIPMVLITCFFLLGHGAFAGTTDIED----MITSVGAILRLLDDL  502
              P A EYL+ GI+++G+ + L+  FFLLGHG  + T  + D    +++SV  ILRL DDL
Sbjct  423   LPKAEEYLKNGIVSSGVHLGLVHIFFLLGHGITSETVRLIDSNPPIVSSVATILRLWDDL  482

Query  501   DATQGEKQDGNDASYVEYYVKEHEGLSISDGKQRIMNMVSEQWKLINKQCLSPTRIPESF  322
              + + E QDGND SY+ YY+ EH+ ++  D ++  M+ +S+ WK +N++CLSP     SF
Sbjct  483   GSAKDENQDGNDGSYIYYYMMEHQDVTAEDAQKHAMDKISDAWKRLNQECLSPNPFSASF  542

Query  321   SKSCLNIARMVPMMYNYSDTHCLPILQKQIMSMF  220
             +++ LNIARMVP+MY+Y D   LP L++ I S+ 
Sbjct  543   TRASLNIARMVPLMYSYDDNQRLPRLEEYIKSLL  576



>gb|AFQ20808.1| S-(+)-linalool synthase [Cinnamomum osmophloeum]
Length=585

 Score =   430 bits (1106),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 217/511 (42%), Positives = 331/511 (65%), Gaps = 13/511 (3%)
 Frame = -2

Query  1731  TLSKDEFLLKSEGKREWQRGLLYQFQEDDLQVLNVIDAIQHLGIDHHFHDQIGAILQRQY  1552
             TLS D   +K   K    R ++   +    Q++ +ID +Q LGID+HF ++I +IL    
Sbjct  72    TLSLDGLSIKQREKVNQVREIVQNLKNPAEQMV-MIDNLQRLGIDYHFREEIESILCSLS  130

Query  1551  QKVKIDDFQKINGLYDISLSFRLLRQEGYNVSSDVFTKFTSEKGEFKEELSKDIRGLMAL  1372
             +    DD   I+ ++D++L FRLLR+ GY  S DVF  F  ++G FK +L+ DI+GLM+L
Sbjct  131   EN---DD--AISSIHDVALRFRLLREHGYYASPDVFNSFKDKEGRFKLQLTTDIKGLMSL  185

Query  1371  HEASHLSIEGEDVLDEAAKFSRESLIANMVHLDECQASMVQNTLQYPYHKSLARFTAKTF  1192
             +E+S LS EGED+LDE   F+ ++LIA+M  ++      V++ L++P+H SL RF  K  
Sbjct  186   YESSKLSTEGEDILDEVNDFASKNLIASMEFIEPDLEREVRHVLKHPFHMSLPRFNIKKH  245

Query  1191  IENMRVEN-EWEATLVNLATMDYSITQSFYQEEFRQILRWWKSLGLKDEL--AKNQQLKW  1021
             +++++ ++ + +A +  LA +D++I QS +Q E  ++ +WW+ LGL  EL  A++Q LKW
Sbjct  246   LKDLQGKDVKTDAPIQELAILDFNILQSLHQSELNEVTKWWRDLGLSQELRFARDQPLKW  305

Query  1020  YIWTLALIPDPSMSRERIELTKPIALVYLIDDIIDVYATFDQTKQFIDAINRWDLSVGEG  841
             Y+W +A++P+P  SR RI LTKPIALVY+IDDI DVY T D+   F +A+NRWD S    
Sbjct  306   YMWPVAVLPNPKFSRYRIVLTKPIALVYIIDDIYDVYGTLDELVIFTEAVNRWDPSDINQ  365

Query  840   LPDYMKRCLVVLFDTTNDINNLVFEKYGWNPIDHLKRAWKCLCSAYITEAKWFATGKSPS  661
             LP  MK C + L + TN+I  +V +++GWNPI+ LK+ W  LC+A++ EAKWFA G SP 
Sbjct  366   LPRNMKLCFMALHNITNEIAYMVLKEHGWNPINSLKKTWTDLCNAFLVEAKWFAEGDSPK  425

Query  660   ANEYLQTGIITTGIPMVLITCFFLLGHGAFAGTTDIED----MITSVGAILRLLDDLDAT  493
             A+EYL+ G+ ++G+  VL+  FFL+G+G    + D+ D    +I+    ILRL DDL + 
Sbjct  426   ADEYLRNGVTSSGVATVLVHLFFLVGNGITRESVDLVDSIPKLISCPAMILRLWDDLGSA  485

Query  492   QGEKQDGNDASYVEYYVKEHEGLSISDGKQRIMNMVSEQWKLINKQCLSPTRIPESFSKS  313
             + E Q G D SYVE Y+KE+   S+   ++ + +M+S  WK +NK+CLSP     +F ++
Sbjct  486   KDENQKGYDGSYVECYLKENATSSLESARRHVRHMISNAWKELNKECLSPYPFSPTFIEA  545

Query  312   CLNIARMVPMMYNYSDTHCLPILQKQIMSMF  220
              LN  RMV +MY+Y +   LP L++ I S+F
Sbjct  546   SLNTTRMVQVMYSYDNDQRLPALEQHIASLF  576



>ref|XP_010059433.1| PREDICTED: (3S,6E)-nerolidol synthase 1-like [Eucalyptus grandis]
Length=540

 Score =   428 bits (1101),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 225/521 (43%), Positives = 325/521 (62%), Gaps = 14/521 (3%)
 Frame = -2

Query  1719  DEFLLKSEGKREWQRGLLYQFQEDDLQVLNVIDAIQHLGIDHHFHDQIGAILQRQYQKVK  1540
             D+  +K E K +   G L     + ++ L ++D I  LGI   F +QI AILQ QY+   
Sbjct  20    DDSGIKHEEKVKSITGFLNNVVSEPVESLIIVDMIMRLGIKSLFQEQIKAILQWQYKHFT  79

Query  1539  IDDFQKINGLYDISLSFRLLRQEGYNVSSDVFTKFTSEKGEFKEELSKDIRGLMALHEAS  1360
               +  K + +Y+I+L FRLLRQEGY V +DVF  F  +   F  +L  + +G+M L+EAS
Sbjct  80    SLNHGK-DDVYEIALRFRLLRQEGYYVPADVFEYFKDKGKGFIMKLEGNAKGMMELYEAS  138

Query  1359  HLSIEGEDVLDEAAKFSRESLIANMV-HLDECQASMVQNTLQYPYHKSLARFTAK-TFIE  1186
              +SIEG D+LDEA  FS + L   +   LD  Q  M+++TL+YPY KS AR  A  +F+ 
Sbjct  139   QMSIEGVDILDEAECFSSKCLNELLTCDLDPEQVRMIESTLRYPYRKSFARSLAPLSFVN  198

Query  1185  NMRVENEWEATLVNLATMDYSITQSFYQEEFRQILRWWKSLGLKDEL--AKNQQLKWYIW  1012
             +M V N W   L+ +A  +  I QS +++E  QI  WWK LGL +E+   ++Q LKWY+W
Sbjct  199   DMLVANSWMEDLLEVANRERRIIQSLHRKEIHQINMWWKELGLGEEMEFVRDQPLKWYMW  258

Query  1011  TLALIPDPSMSRERIELTKPIALVYLIDDIIDVYATFDQTKQFIDAINRWDLSVGEGLPD  832
             ++A++ DPS+S  R+EL KPI+LVY+IDDI DVY   D+   F + I RWD +  E LP 
Sbjct  259   SMAILTDPSLSELRVELIKPISLVYIIDDIFDVYGKADELILFTEVIERWDNACAEQLPQ  318

Query  831   YMKRCLVVLFDTTNDINNLVFEKYGWNPIDHLKRAWKCLCSAYITEAKWFATGKSPSANE  652
             YMK+C  VL D TND+ N++FEK+G NP   LK+ W  LC+A++ E +W A+GK P A++
Sbjct  319   YMKKCFKVLSDITNDLGNIIFEKHGRNPTRFLKQMWANLCNAFLVEFQWNASGKMPKADD  378

Query  651   YLQTGIITTGIPMVLITCFFLLGHGAFAGTTD-------IEDMITSVGAILRLLDDLDAT  493
             YL+  IIT+G+P+VL   FFL+G      + D       + + I  V  ILRL DDL   
Sbjct  379   YLKNAIITSGVPLVLAHLFFLMGQNIANQSMDSKKEEVPLPNTIFLVAEILRLWDDLGCA  438

Query  492   QGEKQDGNDASYVEYYVKEHEGLSISDGKQRIMNMVSEQWKLINKQCLSPTRIPESFSKS  313
             Q E Q+G D SYVE Y++E++G S    ++ +M ++S+ WKL+NK+CLSP      F ++
Sbjct  439   QDENQNGYDGSYVECYLRENQGSSYQSARKHVMELISKSWKLLNKECLSPCPFSAPFLEA  498

Query  312   CLNIARMVPMMYNYSDTHCLPILQKQIMSMFSTINGESIRL  190
             C+N A+MV +MYNY D H L +LQ  + S+  T + E++ L
Sbjct  499   CVNAAKMVSLMYNYEDKHGLGLLQDHMKSL--TCDHETLLL  537



>gb|AFQ20810.1| S-(+)-linalool synthase [Cinnamomum osmophloeum]
Length=585

 Score =   428 bits (1101),  Expect = 7e-138, Method: Compositional matrix adjust.
 Identities = 217/511 (42%), Positives = 329/511 (64%), Gaps = 13/511 (3%)
 Frame = -2

Query  1731  TLSKDEFLLKSEGKREWQRGLLYQFQEDDLQVLNVIDAIQHLGIDHHFHDQIGAILQRQY  1552
             TLS D   +K   K    R ++   ++   Q++ +ID +Q LGID+HF ++I +IL    
Sbjct  72    TLSLDGLSIKQRAKVNQVREIVQNLKDPAEQMV-MIDNLQRLGIDYHFQEEIESILCSLS  130

Query  1551  QKVKIDDFQKINGLYDISLSFRLLRQEGYNVSSDVFTKFTSEKGEFKEELSKDIRGLMAL  1372
             +    DD   I+ + D++L FRLLR+ GY  S DVF  F  ++G FK +L+ DI+GLM+L
Sbjct  131   EN---DD--AISSIDDVALRFRLLREHGYYASPDVFNSFKDKEGRFKLQLTTDIKGLMSL  185

Query  1371  HEASHLSIEGEDVLDEAAKFSRESLIANMVHLDECQASMVQNTLQYPYHKSLARFTAKTF  1192
             +E+S LS EGED+LDE   F+ ++LIA+M  ++      V++ L++P+H SL RF  K  
Sbjct  186   YESSKLSTEGEDILDEVNDFASKNLIASMEFIEPDLEREVRHVLEHPFHMSLPRFNIKKH  245

Query  1191  IENMRVEN-EWEATLVNLATMDYSITQSFYQEEFRQILRWWKSLGLKDEL--AKNQQLKW  1021
             ++ ++ ++ + +A +  LA +D++I QS +Q E +++ +WW+ LGL  EL  A++Q LKW
Sbjct  246   LKELQGKDVKTDAPIQELAILDFNILQSMHQSELKEVTKWWRDLGLSQELRFARDQPLKW  305

Query  1020  YIWTLALIPDPSMSRERIELTKPIALVYLIDDIIDVYATFDQTKQFIDAINRWDLSVGEG  841
             Y+W LA++P+P  SR RIELTKPIALVY+IDDI DVY T D+   F +A+NRWD S    
Sbjct  306   YMWPLAVLPNPKFSRYRIELTKPIALVYIIDDIYDVYGTLDELVVFTEAVNRWDPSDINQ  365

Query  840   LPDYMKRCLVVLFDTTNDINNLVFEKYGWNPIDHLKRAWKCLCSAYITEAKWFATGKSPS  661
             LP  MK C + L + TN+I  +V +++GWNPI+ LK+ W  LC+A++ EAKWFA G SP 
Sbjct  366   LPRNMKLCFMALHNITNEIAYMVLKEHGWNPINSLKKTWTDLCNAFLVEAKWFAEGDSPK  425

Query  660   ANEYLQTGIITTGIPMVLITCFFLLGHGAFAGTTDIED----MITSVGAILRLLDDLDAT  493
             A+EYL+ G+ ++G+  VL+  FFL+G+G    + D+ D    +I+    ILRL DDL + 
Sbjct  426   ADEYLRNGVTSSGVATVLVHLFFLVGNGITRESVDLVDSIPKLISCPAMILRLWDDLGSA  485

Query  492   QGEKQDGNDASYVEYYVKEHEGLSISDGKQRIMNMVSEQWKLINKQCLSPTRIPESFSKS  313
             + E Q G D SYVE Y+KE+   S+   +  + +M+   WK +NK+CLSP     +F ++
Sbjct  486   KDENQKGYDGSYVECYLKENATSSLESARGHVRHMIFNAWKELNKECLSPYPFSPTFIEA  545

Query  312   CLNIARMVPMMYNYSDTHCLPILQKQIMSMF  220
              LN  RMV +MY+Y +   LP L++ I S+ 
Sbjct  546   SLNTTRMVQVMYSYDNDQRLPALEQHITSLL  576



>gb|AFQ20812.1| S-(+)-linalool synthase [Cinnamomum osmophloeum]
Length=585

 Score =   428 bits (1100),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 215/511 (42%), Positives = 331/511 (65%), Gaps = 13/511 (3%)
 Frame = -2

Query  1731  TLSKDEFLLKSEGKREWQRGLLYQFQEDDLQVLNVIDAIQHLGIDHHFHDQIGAILQRQY  1552
             TLS D   +K   K    R ++   ++   Q++ +ID +Q LGID+HF ++I +IL    
Sbjct  72    TLSLDGLSIKQREKVNQVREIVQNLKDPAEQMV-MIDNLQRLGIDYHFREEIESILCSLS  130

Query  1551  QKVKIDDFQKINGLYDISLSFRLLRQEGYNVSSDVFTKFTSEKGEFKEELSKDIRGLMAL  1372
             +    DD   I+ ++D++L FRLLR+ GY  S DVF  F  ++G FK +L+ DI+GLM+L
Sbjct  131   EN---DD--AISSIHDVALRFRLLREHGYYASPDVFNSFKDKEGRFKLQLTTDIKGLMSL  185

Query  1371  HEASHLSIEGEDVLDEAAKFSRESLIANMVHLDECQASMVQNTLQYPYHKSLARFTAKTF  1192
             +E+S LS EGED+LDE   F+ ++LIA+M  ++      V++ L++P+H SL RF  K  
Sbjct  186   YESSKLSTEGEDILDEVNDFASKNLIASMEFIEPDLEREVRHVLEHPFHMSLPRFNIKKH  245

Query  1191  IENMRVEN-EWEATLVNLATMDYSITQSFYQEEFRQILRWWKSLGLKDEL--AKNQQLKW  1021
             +++++ ++ + +  +  LA +D++I QS +Q E +++ +WW+ LGL  EL  A++Q LKW
Sbjct  246   LKDLQGKDVKTDGPIQELAILDFNILQSMHQSELKEVTKWWRDLGLSQELRFARDQPLKW  305

Query  1020  YIWTLALIPDPSMSRERIELTKPIALVYLIDDIIDVYATFDQTKQFIDAINRWDLSVGEG  841
             Y+W LA++P+P  SR RIELTKPIALVY+IDDI DVY T D+   F +A+NRWD +    
Sbjct  306   YMWPLAVLPNPKFSRYRIELTKPIALVYIIDDIYDVYGTLDELVVFTEAVNRWDPTDINQ  365

Query  840   LPDYMKRCLVVLFDTTNDINNLVFEKYGWNPIDHLKRAWKCLCSAYITEAKWFATGKSPS  661
             LP  MK C + L + TN+I  +V +++GWNPI+ LK+ W  LC+A++ EAKWFA G SP 
Sbjct  366   LPRNMKLCFMALHNITNEIAYMVLKEHGWNPINSLKKTWTDLCNAFLVEAKWFAEGDSPK  425

Query  660   ANEYLQTGIITTGIPMVLITCFFLLGHGAFAGTTDIED----MITSVGAILRLLDDLDAT  493
             A+EYL+ G+ ++G+  VL+  FFL+G+G    + D+ D    +I+    ILRL DDL + 
Sbjct  426   ADEYLRNGVTSSGVAAVLVHLFFLVGNGITRESVDLVDSIPKLISCPAMILRLWDDLGSA  485

Query  492   QGEKQDGNDASYVEYYVKEHEGLSISDGKQRIMNMVSEQWKLINKQCLSPTRIPESFSKS  313
             + E Q G D SYVE Y+KE+   S+   ++ + +M+   WK +NK+CLSP     +F ++
Sbjct  486   KDENQKGYDGSYVECYLKENATSSLESARRHVRHMIFNAWKELNKECLSPYPFSPTFIEA  545

Query  312   CLNIARMVPMMYNYSDTHCLPILQKQIMSMF  220
              LN  RMV +MY+Y +   LP L++ I S+ 
Sbjct  546   SLNTTRMVQVMYSYDNDQRLPALEQHITSLL  576



>gb|ABR24418.1| nerolidol/linalool synthase 2 [Antirrhinum majus]
Length=596

 Score =   428 bits (1101),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 218/513 (42%), Positives = 324/513 (63%), Gaps = 13/513 (3%)
 Frame = -2

Query  1731  TLSKDEFLLKSEGKREWQRGLL-YQFQEDDLQVLNVIDAIQHLGIDHHFHDQIGAILQRQ  1555
             T + D   L+ + K E  + LL  + +E+ +  L  +DAIQ LG++H+F + I  IL+  
Sbjct  86    TRTPDNISLEYDKKIEEIKNLLQSKREEEPIDRLMFVDAIQRLGVNHNFEEMIETILRNY  145

Query  1554  YQKVKIDDFQKINGLYDISLSFRLLRQEGYNVSSDVFTKFTSEKGEFKEELSKDIRGLMA  1375
             Y+    +     + L+D+SL F L+RQ GY++SS+VF KF  + G F+ EL +D RGLM 
Sbjct  146   YESTSAN-ICGFHTLHDVSLFFCLMRQHGYDISSNVFNKFKGDDGRFRGELQRDTRGLME  204

Query  1374  LHEASHLSIEGEDVLDEAAKFSRESLIANMVHLDECQASMVQNTLQYPYHKSLARFTAKT  1195
             L+EAS L  EGE  LDEA  FS ++L   +  +D     +V N LQ+PY KS+ R T + 
Sbjct  205   LYEASQLRFEGEYTLDEAESFSSQNLNKYLADMDCSSRRLVTNKLQHPYRKSIGRLTTRY  264

Query  1194  FIENMRVENEWEATLVNLATMDYSITQSFYQEEFRQILRWWKSLGLKDEL--AKNQQLKW  1021
                + R +N+W  TL  LA MD  + +S YQ+E  Q+  WWK+L + + L  A+NQ LKW
Sbjct  265   ---DFRGKNQWGKTLQELAAMDLRMRKSEYQKELFQVSEWWKALRIAENLSLARNQPLKW  321

Query  1020  YIWTLA-LIPDPSMSRERIELTKPIALVYLIDDIIDVYATFDQTKQFIDAINRWDLSVGE  844
             Y W++A LI D ++S +RIELTK I  +YL+DDI DVY + ++     +A+++WD +  E
Sbjct  322   YTWSMAILIDDITLSEQRIELTKFITFIYLLDDIFDVYGSPEELVILAEAVSKWDYAAVE  381

Query  843   GLPDYMKRCLVVLFDTTNDINNLVFEKYGWNPIDHLKRAWKCLCSAYITEAKWFATGKSP  664
              LPDYMK C   L DTTN+I   ++EKYG+NPID LK  W  LC+A++ EAKWFA+G  P
Sbjct  382   TLPDYMKLCYKSLLDTTNEIGYKIYEKYGYNPIDSLKTTWASLCNAFLEEAKWFASGNLP  441

Query  663   SANEYLQTGIITTGIPMVLITCFFLLGHGAFAGTT----DIEDMITSVGAILRLLDDLDA  496
             +A +YL+ G +++G+ +V++  FFL G G   G+     D   +++SV  ILRL DDL +
Sbjct  442   NATKYLENGKVSSGVYVVMVHLFFLFGLGGTCGSAIHLNDTSKLMSSVATILRLWDDLGS  501

Query  495   TQGEKQDGNDASYVEYYVKEHEGLSISDGKQRIMNMVSEQWKLINKQCLSPTRIP-ESFS  319
              + E QDG D SY+E Y+KEH  LS+   +Q  ++++S +WKL+NK+C S   +   S  
Sbjct  502   AKDEHQDGKDGSYIECYMKEHTSLSLEQAQQHAIDLISSEWKLLNKECFSLNHVSTSSLK  561

Query  318   KSCLNIARMVPMMYNYSDTHCLPILQKQIMSMF  220
             K+ LN A++VP+MY+Y +   LPIL++ +  M 
Sbjct  562   KAALNTAKIVPLMYSYDENQRLPILEEYVKFML  594



>gb|AFQ20811.1| S-(+)-linalool synthase [Cinnamomum osmophloeum]
Length=585

 Score =   427 bits (1099),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 216/511 (42%), Positives = 332/511 (65%), Gaps = 13/511 (3%)
 Frame = -2

Query  1731  TLSKDEFLLKSEGKREWQRGLLYQFQEDDLQVLNVIDAIQHLGIDHHFHDQIGAILQRQY  1552
             TLS D   +K   K    R ++   ++   Q++ +ID +Q LGID+HF ++I +IL    
Sbjct  72    TLSLDGLSIKQREKVNQVREIVQNLKDPAEQMV-MIDNLQRLGIDYHFREEIESILCSLS  130

Query  1551  QKVKIDDFQKINGLYDISLSFRLLRQEGYNVSSDVFTKFTSEKGEFKEELSKDIRGLMAL  1372
             +    DD   I+ ++D++L FRLLR+ GY  S DVF  F  ++G FK +L+ DI+GLM+L
Sbjct  131   EN---DD--AISSIHDVALRFRLLREHGYYASPDVFNSFKDKEGRFKLQLTTDIKGLMSL  185

Query  1371  HEASHLSIEGEDVLDEAAKFSRESLIANMVHLDECQASMVQNTLQYPYHKSLARFTAKTF  1192
             +E+S LS EGED+LDE   F+ ++LIA+M  ++      V++ L++P+H SL RF  K  
Sbjct  186   YESSKLSTEGEDILDEVNDFASKNLIASMEFIEPDLEREVRHVLEHPFHMSLPRFNIKKH  245

Query  1191  IENMRVEN-EWEATLVNLATMDYSITQSFYQEEFRQILRWWKSLGLKDEL--AKNQQLKW  1021
             +++++ ++ + +  +  LA +D++I QS +Q E +++ +WW+ LGL  EL  A++Q LKW
Sbjct  246   LKDLQGKDVKTDGPIQELAILDFNILQSMHQSELKEVTKWWRDLGLSQELRFARDQPLKW  305

Query  1020  YIWTLALIPDPSMSRERIELTKPIALVYLIDDIIDVYATFDQTKQFIDAINRWDLSVGEG  841
             Y+W+LA++P+P  SR RIELTKPIALVY+IDDI DVY T D+   F +A+NRWD S    
Sbjct  306   YMWSLAVLPNPKFSRYRIELTKPIALVYIIDDIYDVYGTLDELVVFTEAVNRWDPSDINQ  365

Query  840   LPDYMKRCLVVLFDTTNDINNLVFEKYGWNPIDHLKRAWKCLCSAYITEAKWFATGKSPS  661
             LP  MK C + L + TN+I  +V +++GWNPI+ LK+ W  L +A++ EAKWFA G SP 
Sbjct  366   LPRNMKLCFMALHNITNEIAYMVLKEHGWNPINSLKKTWTDLRNAFLVEAKWFAEGDSPK  425

Query  660   ANEYLQTGIITTGIPMVLITCFFLLGHGAFAGTTDIED----MITSVGAILRLLDDLDAT  493
             A+EYL+ G+ ++G+  VL+  FFL+G+G    + D+ D    +I+    ILRL DDL + 
Sbjct  426   ADEYLRNGVTSSGVAAVLVHLFFLVGNGITRESVDLVDSIPKLISCPAMILRLWDDLGSA  485

Query  492   QGEKQDGNDASYVEYYVKEHEGLSISDGKQRIMNMVSEQWKLINKQCLSPTRIPESFSKS  313
             + E Q G D SY E Y+KE+   S+   ++ + +M+S  WK +NK+CLSP     +F ++
Sbjct  486   KDENQKGYDGSYAECYLKENATSSLESARRHVRHMISNAWKELNKECLSPYPFSPTFIEA  545

Query  312   CLNIARMVPMMYNYSDTHCLPILQKQIMSMF  220
              LN ARMV +MY+Y +   LP L++ I S+ 
Sbjct  546   SLNTARMVQVMYSYDNDQRLPALEQHITSLL  576



>ref|XP_010059435.1| PREDICTED: (3S,6E)-nerolidol synthase 1-like [Eucalyptus grandis]
Length=472

 Score =   423 bits (1088),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 215/470 (46%), Positives = 302/470 (64%), Gaps = 12/470 (3%)
 Frame = -2

Query  1617  IQHLGIDHHFHDQIGAILQRQYQKVKIDDFQKINGLYDISLSFRLLRQEGYNVSSDVFTK  1438
             IQ LGI   F +QI AIL+ QY      +  K N +Y+I+L FRLLRQEGY+V +DVF  
Sbjct  2     IQRLGIKPLFQEQIKAILRWQYTHFTSLNHGKDN-VYEIALRFRLLRQEGYDVPADVFEY  60

Query  1437  FTSEKGEFKEELSKDIRGLMALHEASHLSIEGEDVLDEAAKFSRESLIANMV-HLDECQA  1261
             F  +   F  ++  +++G+M L+EAS +SIEGED+LDEA  FS + L   +   LD  Q 
Sbjct  61    FKDKGKGFIMKVEGNVKGMMELYEASQMSIEGEDILDEAECFSSKCLNELLTCDLDPEQV  120

Query  1260  SMVQNTLQYPYHKSLARFTAK-TFIENMRVENEWEATLVNLATMDYSITQSFYQEEFRQI  1084
              M+++TL+YPY KS AR  A  +F+ +M   N W   L+ +A  +  I QS +Q+E  QI
Sbjct  121   RMIESTLRYPYRKSFARSLAPLSFVNDMLGLNSWIEDLLEVANRERRIVQSVHQKENHQI  180

Query  1083  LRWWKSLGLKDEL--AKNQQLKWYIWTLALIPDPSMSRERIELTKPIALVYLIDDIIDVY  910
               WWK  GL +E+  A++Q LKWY+W++A++ DPS+S  R+EL KPI+LVY+IDDI DVY
Sbjct  181   NTWWKESGLGEEMKFARDQPLKWYLWSIAILTDPSLSELRVELVKPISLVYIIDDIFDVY  240

Query  909   ATFDQTKQFIDAINRWDLSVGEGLPDYMKRCLVVLFDTTNDINNLVFEKYGWNPIDHLKR  730
                D+   F   I RWD +  E LP+YMK+C  VL D TND  N++FEK+GWNP   LK+
Sbjct  241   GKVDELILFTGVIKRWDDACAEQLPEYMKKCFKVLSDITNDFGNIIFEKHGWNPTRFLKQ  300

Query  729   AWKCLCSAYITEAKWFATGKSPSANEYLQTGIITTGIPMVLITCFFLLGHGAFAGTTD--  556
              W  LC+A++ E +W A+G  P A++YL+ GIIT+G+P+VL   FFL+G      + D  
Sbjct  301   MWANLCNAFLVEFQWNASGTLPKADDYLKNGIITSGVPLVLTHLFFLMGQNIANQSMDSK  360

Query  555   -----IEDMITSVGAILRLLDDLDATQGEKQDGNDASYVEYYVKEHEGLSISDGKQRIMN  391
                  + + I  V  ILRL DDL   Q E Q+G D SYVE Y++E++G S    ++ +M 
Sbjct  361   KEEVPLPNTIFLVAEILRLWDDLGCAQDENQNGYDGSYVECYLRENQGSSYQSAREHVME  420

Query  390   MVSEQWKLINKQCLSPTRIPESFSKSCLNIARMVPMMYNYSDTHCLPILQ  241
             ++S+ WKL+NK+CLSP      F ++C+N A+MV +MYNY D H L +LQ
Sbjct  421   LISKSWKLLNKECLSPCPFSAPFLEACVNAAKMVSLMYNYEDKHGLGLLQ  470



>gb|AFK09261.1| S-(+)-linalool synthase [Cinnamomum camphora]
Length=585

 Score =   426 bits (1096),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 215/511 (42%), Positives = 333/511 (65%), Gaps = 13/511 (3%)
 Frame = -2

Query  1731  TLSKDEFLLKSEGKREWQRGLLYQFQEDDLQVLNVIDAIQHLGIDHHFHDQIGAILQRQY  1552
             T+  D  L+K   K    R ++ Q  +D  + + +ID +Q LGID+HF ++I +IL    
Sbjct  72    TIILDGLLIKQREKVNQVREIV-QNLKDPAEKMVMIDNLQRLGIDYHFREEIESILCSLS  130

Query  1551  QKVKIDDFQKINGLYDISLSFRLLRQEGYNVSSDVFTKFTSEKGEFKEELSKDIRGLMAL  1372
             +    DD   ++ ++D++L FRLLR+ GY+ S D+F  F  ++G FK +L+ DI+GLM+L
Sbjct  131   EN---DD--AVSSIHDVALRFRLLREHGYHASPDMFNSFKDKEGRFKLQLTADIKGLMSL  185

Query  1371  HEASHLSIEGEDVLDEAAKFSRESLIANMVHLDECQASMVQNTLQYPYHKSLARFTAKTF  1192
             +E+S LS EGED+LDE   F+ ++LIA+M  ++      V++ L++P+H SL RF  K  
Sbjct  186   YESSKLSTEGEDILDEVDDFASKNLIASMEFIEPDLEREVRHVLEHPFHMSLPRFNIKKH  245

Query  1191  IENMRVEN-EWEATLVNLATMDYSITQSFYQEEFRQILRWWKSLGLKDEL--AKNQQLKW  1021
             +++++ ++ + +A +  LA +D++I QS +Q E +++ +WW  LGL  EL  A++Q LKW
Sbjct  246   LKDLQGKDGKTDAPIQELAILDFNILQSMHQSELKEVTKWWGDLGLSQELRFARDQPLKW  305

Query  1020  YIWTLALIPDPSMSRERIELTKPIALVYLIDDIIDVYATFDQTKQFIDAINRWDLSVGEG  841
             Y+W LA++P+P  SR RIELTKPIALVY+IDDI DVY T D+   F +A+NRWD S    
Sbjct  306   YMWPLAVLPNPKFSRYRIELTKPIALVYIIDDIYDVYGTLDELVVFTEAVNRWDPSDINQ  365

Query  840   LPDYMKRCLVVLFDTTNDINNLVFEKYGWNPIDHLKRAWKCLCSAYITEAKWFATGKSPS  661
             LP  MK C + L + TN+I  +V +++GWNPI+ LK+ W+ LC+A++ EAKWFA G SP 
Sbjct  366   LPRNMKLCFMALHNITNEIAYMVLKEHGWNPINSLKKTWRDLCNAFLVEAKWFAEGDSPK  425

Query  660   ANEYLQTGIITTGIPMVLITCFFLLGHGAFAGTTDIED----MITSVGAILRLLDDLDAT  493
             A+EYL+ G+ ++G+  VL+  FFL+G+G    + D+ D    +I+    ILRL DDL + 
Sbjct  426   ADEYLRNGVTSSGVATVLVHLFFLVGNGITRESVDLVDSIPKLISCPAMILRLWDDLGSA  485

Query  492   QGEKQDGNDASYVEYYVKEHEGLSISDGKQRIMNMVSEQWKLINKQCLSPTRIPESFSKS  313
             + E Q G D SYVE Y+KE+   S+   ++ + +M+S  WK +NK+CLSP     +F ++
Sbjct  486   KDENQKGYDGSYVECYLKENATSSLESARRHVRHMISNAWKELNKECLSPYPFSPTFIEA  545

Query  312   CLNIARMVPMMYNYSDTHCLPILQKQIMSMF  220
              LN  RMV +MY+Y +   L  L++ I S+ 
Sbjct  546   SLNTTRMVQVMYSYDNDQRLLALEQHITSLL  576



>gb|KCW74831.1| hypothetical protein EUGRSUZ_E03566 [Eucalyptus grandis]
Length=483

 Score =   422 bits (1086),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 215/476 (45%), Positives = 304/476 (64%), Gaps = 12/476 (3%)
 Frame = -2

Query  1617  IQHLGIDHHFHDQIGAILQRQYQKVKIDDFQKINGLYDISLSFRLLRQEGYNVSSDVFTK  1438
             IQ LG+   F +QI AIL  QY      +  K + +Y+I+L FRLLRQEGY V +DVF  
Sbjct  2     IQRLGVKSLFREQIKAILAWQYTHFSSLNHGK-DDVYEIALRFRLLRQEGYCVPADVFEY  60

Query  1437  FTSEKGEFKEELSKDIRGLMALHEASHLSIEGEDVLDEAAKFSRESLIANMV-HLDECQA  1261
             F  +   F  +L  +I+G+M L+EAS +S EGED+LDEA  FS + L A +   LD  QA
Sbjct  61    FNEKGKGFVMKLEGNIKGMMELYEASQMSTEGEDILDEAECFSSKCLNALLTCDLDNEQA  120

Query  1260  SMVQNTLQYPYHKSLARFTA-KTFIENMRVENEWEATLVNLATMDYSITQSFYQEEFRQI  1084
              M+++TLQYPY KS AR  A ++F+ +M+  N W   L+ +A     I Q  +Q+E  QI
Sbjct  121   RMIESTLQYPYRKSFARLLAPQSFVNDMQGANSWMEDLLEVANRKRRIDQYVHQKEIHQI  180

Query  1083  LRWWKSLGL--KDELAKNQQLKWYIWTLALIPDPSMSRERIELTKPIALVYLIDDIIDVY  910
              +WWK LGL  K E A++Q LKWY+W++A++ DPS+S  R+EL+KPI+LVY+IDDI DV+
Sbjct  181   NKWWKELGLGEKMEFARDQPLKWYMWSMAILTDPSLSELRVELSKPISLVYIIDDIFDVH  240

Query  909   ATFDQTKQFIDAINRWDLSVGEGLPDYMKRCLVVLFDTTNDINNLVFEKYGWNPIDHLKR  730
              T D+   F + I RWD +  E LP+YMK C  VL D  ND   ++FEK+GWNP   LK+
Sbjct  241   GTVDELILFTELIKRWDNACAEQLPEYMKICFKVLNDIANDFGRIIFEKHGWNPTRFLKQ  300

Query  729   AWKCLCSAYITEAKWFATGKSPSANEYLQTGIITTGIPMVLITCFFLLGHGAFAGTTD--  556
              W  LC+A++ E +W A+GK P A++YL+  IIT+G+P+VL    FL+G      + D  
Sbjct  301   MWANLCNAFLVEFQWNASGKLPKADDYLKNAIITSGVPLVLTHLLFLMGQNIANQSMDSK  360

Query  555   -----IEDMITSVGAILRLLDDLDATQGEKQDGNDASYVEYYVKEHEGLSISDGKQRIMN  391
                  + ++I  +  ILRL DDL   Q E Q+G D SYV+ Y+ E+EG S    ++ +M 
Sbjct  361   KEEVQLPNIIFLIAEILRLWDDLGCAQDENQNGYDGSYVDCYLGENEGSSYQSAREHVMK  420

Query  390   MVSEQWKLINKQCLSPTRIPESFSKSCLNIARMVPMMYNYSDTHCLPILQKQIMSM  223
             ++S+ WKL+NK+CLSP      F ++C+N A+MV +MYNY D H L +LQ  + S+
Sbjct  421   LISKLWKLLNKECLSPCPSSAPFLEACVNAAKMVSLMYNYEDKHGLGLLQDHMKSL  476



>sp|Q84NC8.1|TPS1_ANTMA RecName: Full=Tricyclene synthase 0e23, chloroplastic; Short=Am0e23; 
AltName: Full=(E)-beta-ocimene synthase 0e23; AltName: 
Full=Terpenoid synthase 0e23; Flags: Precursor [Antirrhinum 
majus]
 gb|AAO42614.1| (E)-b-ocimene synthase [Antirrhinum majus]
Length=579

 Score =   424 bits (1089),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 216/509 (42%), Positives = 322/509 (63%), Gaps = 9/509 (2%)
 Frame = -2

Query  1716  EFLLKSEGKREWQRGLLYQFQEDD-LQVLNVIDAIQHLGIDHHFHDQIGAILQRQYQKVK  1540
             E  +  EGK +  R LL+   E+D ++ L  +DA Q LG++HHF  +I  IL++ Y  +K
Sbjct  70    ELPMDYEGKIQGTRHLLHLKDENDPIESLIFVDATQRLGVNHHFQKEIEEILRKSYATMK  129

Query  1539  IDDFQKINGLYDISLSFRLLRQEGYNVSSDVFTKFTSEKGEFKEELSKDIRGLMALHEAS  1360
                  K + L+D+SL F L+RQ G  VS+DVF  F  E G FKEEL +D RGL+ L+EA+
Sbjct  130   SPSICKYHTLHDVSLFFCLMRQHGRYVSADVFNNFKGESGRFKEELKRDTRGLVELYEAA  189

Query  1359  HLSIEGEDVLDEAAKFSRESLIANMVHLDECQASMVQNTLQYPYHKSLARFTAKTFIENM  1180
              LS EGE +LDEA  FSR+ L  N+  +++     V N L+YP+HKS+ARFT   + +++
Sbjct  190   QLSFEGERILDEAENFSRQILHGNLASMEDNLRRSVGNKLRYPFHKSIARFTGINYDDDL  249

Query  1179  RVENEWEATLVNLATMDYSITQSFYQEEFRQILRWWKSLGL--KDELAKNQQLKWYIWTL  1006
                 EW  TL  LA MD  + +S YQEE  Q+ +WW  LGL  K  LA+N+  ++Y+W++
Sbjct  250   GGMYEWGKTLRELALMDLQVERSVYQEELLQVSKWWNELGLYKKLTLARNRPFEFYMWSM  309

Query  1005  ALIPD-PSMSRERIELTKPIALVYLIDDIIDVYATFDQTKQFIDAINRWDLSVGEGLPDY  829
              ++ D  ++S +R+ELTK +A +YLIDDI DVY T D+   F +A+N+WD S  + LPD 
Sbjct  310   VILTDYINLSEQRVELTKSVAFIYLIDDIFDVYGTLDELIIFTEAVNKWDYSATDTLPDN  369

Query  828   MKRCLVVLFDTTNDINNLVFEKYGWNPIDHLKRAWKCLCSAYITEAKWFATGKSPSANEY  649
             MK C + L DT N  +  ++EKYG NPID LK  WK LCSA++ EAKW A+G  PSANEY
Sbjct  370   MKMCYMTLLDTINGTSQKIYEKYGHNPIDSLKTTWKSLCSAFLVEAKWSASGSLPSANEY  429

Query  648   LQTGIITTGIPMVLITCFFLLGHGAF-AGTTDIED---MITSVGAILRLLDDLDATQGEK  481
             L+   +++G+ +VLI  FFL+G G    G+ ++ D   +++S+  I+R+ +DL   + E 
Sbjct  430   LENEKVSSGVYVVLIHLFFLMGLGGTNRGSIELNDTRELMSSIAIIVRIWNDLGCAKNEH  489

Query  480   QDGNDASYVEYYVKEHEGLSISDGKQRIMNMVSEQWKLINKQCLSPTRIP-ESFSKSCLN  304
             Q+G D SY++ Y KEH  L+ +   +  + +V+ +WK +NK+  +       SF ++ LN
Sbjct  490   QNGKDGSYLDCYKKEHINLTAAQVHEHALELVAIEWKRLNKESFNLNHDSVSSFKQAALN  549

Query  303   IARMVPMMYNYSDTHCLPILQKQIMSMFS  217
              ARMVP+MY+Y +    P+L++ +  M S
Sbjct  550   FARMVPLMYSYDNNRRGPVLEEYVKFMLS  578



>ref|XP_009368652.1| PREDICTED: (3S,6E)-nerolidol synthase 1-like [Pyrus x bretschneideri]
Length=536

 Score =   421 bits (1083),  Expect = 7e-136, Method: Compositional matrix adjust.
 Identities = 207/482 (43%), Positives = 312/482 (65%), Gaps = 17/482 (4%)
 Frame = -2

Query  1635  LNVIDAIQHLGIDHHFHDQIGAILQRQYQKVKIDDFQKINGLYDISLSFRLLRQEGYNVS  1456
             L  +DA+Q LG+D+HF ++I AI++ Q  +   D+    + L  +SL FRLLRQ+GY+V+
Sbjct  44    LIAVDAVQRLGVDYHFQEEIEAIMKTQCTRAYNDECS--DELRVVSLRFRLLRQQGYHVT  101

Query  1455  SDVFTKFTSEKGEFKEELSKDIRGLMALHEASHLSIEGEDVLDEAAKFSRESLIANM-VH  1279
             +DVF KF +      E+L  DI GL+ L+EASH+S +GE+ L E  + S + L A M  +
Sbjct  102   TDVFNKFKN-----NEKLEVDINGLVELYEASHMSFQGEEALVEEGRRSHQLLTAWMHNN  156

Query  1278  LDECQASMVQNTLQYPYHKSLARFTAKTFIENMRVENEWEATLVNLATMDYSITQSFYQE  1099
             LD+ +AS V  +L++PYHKSL RF AK F+ +   +  W   L  L  +++++ +S  + 
Sbjct  157   LDDHRASAVAYSLEHPYHKSLTRFMAKNFLLSFEGKENWVNDLKELGKLEFNMVESLIRN  216

Query  1098  EFRQILRWWKSLGLKDEL--AKNQQLKWYIWTLALIPDPSMSRERIELTKPIALVYLIDD  925
             E +Q+ +WWK LGL +EL   ++Q +KWY W +A + DP++S ER+ELTK I+LVY+IDD
Sbjct  217   EIQQVSKWWKELGLTEELKFVRDQPIKWYTWPMACLADPNLSEERVELTKSISLVYIIDD  276

Query  924   IIDVYATFDQTKQFIDAINRWDLSVGEGLPDYMKRCLVVLFDTTNDINNLVFEKYGWNPI  745
             I DV+ T D+   F  A+ RWD+     LP+YMK C   L+D TN+ ++ V +K+GWNPI
Sbjct  277   IFDVHGTLDELILFTAAVERWDIDATGELPNYMKICFKALYDITNETSHTVHKKHGWNPI  336

Query  744   DHLKRAWKCLCSAYITEAKWFATGKSPSANEYLQTGIITTGIPMVLITCFFLLGHGAFAG  565
             + LK++W  LC A++ EA+WF+ G  P+  EYL  G I++G+P+VL   FFLLG G    
Sbjct  337   ESLKKSWATLCKAFLLEARWFSCGHLPNTEEYLNNGFISSGVPVVLTHGFFLLGQGITKE  396

Query  564   TTDIED------MITSVGAILRLLDDLDATQGEKQDGNDASYVEYYVKEHEGLSISDGKQ  403
             T  I D      +I+S   ILRL DD  + + E QDG D SY++ YV E++G S  D + 
Sbjct  397   TVHILDNLNISSLISSTATILRLWDDFGSAKDEGQDGYDGSYIKCYVNENQGCSDEDARA  456

Query  402   RIMNMVSEQWKLINKQCLSPTR-IPESFSKSCLNIARMVPMMYNYSDTHCLPILQKQIMS  226
              +++ +SE+WK +N++C S +     SF+K  LN+ARMVP+MY+Y+  H LP L++ + S
Sbjct  457   FVVHRISEEWKFLNQECFSASNPFSASFTKLALNVARMVPLMYDYNSQHRLPSLEENMKS  516

Query  225   MF  220
             + 
Sbjct  517   LL  518



>ref|XP_010059419.1| PREDICTED: (3S,6E)-nerolidol synthase 1-like [Eucalyptus grandis]
Length=589

 Score =   422 bits (1085),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 208/508 (41%), Positives = 313/508 (62%), Gaps = 13/508 (3%)
 Frame = -2

Query  1704  KSEGKREWQRGLLYQFQEDDLQVLNVIDAIQHLGIDHHFHDQIGAILQRQYQKVKIDDFQ  1525
             + E + E  + LL Q + D L+ L  +DA+Q L ID+HF D+I AILQR           
Sbjct  76    RHERRLEEVKQLLKQVRGDSLESLVTVDALQRLAIDYHFEDEIEAILQRHLLISSSRSHS  135

Query  1524  K---INGLYDISLSFRLLRQEGYNVSSDVFTKF---TSEKGEFKEELSKDIRGLMALHEA  1363
             +    + L++ +L FRLLRQ GY V SDVF +F    ++  + K+    DI G  +L EA
Sbjct  136   RPIDADNLHEAALRFRLLRQGGYPVPSDVFQRFLHKMNDGTQNKKPQGNDILGFTSLFEA  195

Query  1362  SHLSIEGEDVLDEAAKFSRESLIANMVHLDECQASMVQNTLQYPYHKSLARFTAKTFIEN  1183
             S L IEGED LD+  + +R+ L +++  LD  QA  V N+L  P+HKSLARFTA  F+ N
Sbjct  196   SQLGIEGEDALDQVGESTRQRLHSSLADLDHVQARFVSNSLGNPFHKSLARFTANDFLRN  255

Query  1182  MRVEN-EWEATLVNLATMDYSITQSFYQEEFRQILRWWKSLGLKDEL--AKNQQLKWYIW  1012
                 +  W   L  LA +D +I +S +Q E  Q+  WWK LG+  EL  A++Q +KWY+W
Sbjct  256   FVGHSCSWTKNLGELAHLDMNIVRSVHQREILQVSNWWKELGMAKELKYARDQPMKWYMW  315

Query  1011  TLALIPDPSMSRERIELTKPIALVYLIDDIIDVYATFDQTKQFIDAINRWDLSVGEGLPD  832
              +A++ +  +S+ER+ +TKPI+ +Y+IDDI DVY T +    F D ++RW+ +  + +PD
Sbjct  316   PMAILTETGLSQERVLVTKPISFIYIIDDIFDVYGTIEDLTAFTDVVDRWECTEKDNIPD  375

Query  831   YMKRCLVVLFDTTNDINNLVFEKYGWNPIDHLKRAWKCLCSAYITEAKWFATGKSPSANE  652
             YM+ C   L D TN+ +  V++ +GWNP+  L++ W  L +A++ EA+W A+G SP+  +
Sbjct  376   YMRMCFHALDDITNEFSLAVYKNHGWNPLCSLRKTWASLLNAFLVEARWLASGHSPTTQD  435

Query  651   YLQTGIITTGIPMVLITCFFLLGHGAFAGTTD----IEDMITSVGAILRLLDDLDATQGE  484
             YL   I+++G+ ++L+  FF+LG      + D    I ++++S  +ILRL DDL + + E
Sbjct  436   YLDNAIVSSGVHVLLVHLFFILGERITPESVDHLENIPEIVSSTASILRLWDDLGSAEDE  495

Query  483   KQDGNDASYVEYYVKEHEGLSISDGKQRIMNMVSEQWKLINKQCLSPTRIPESFSKSCLN  304
              QDG D SYVE Y +E +G S    +  +  M+SE WK +NK CL P    +SFSK+ LN
Sbjct  496   FQDGRDGSYVECYKREFQGSSEEAARDHVKKMISEAWKRLNKACLYPQPFTKSFSKASLN  555

Query  303   IARMVPMMYNYSDTHCLPILQKQIMSMF  220
              ARMVP+MYNY D+H LP+L+  + S+ 
Sbjct  556   TARMVPLMYNYDDSHSLPLLEHHMKSLL  583



>ref|XP_008364116.1| PREDICTED: (3S,6E)-nerolidol synthase 1-like [Malus domestica]
Length=536

 Score =   418 bits (1075),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 206/482 (43%), Positives = 308/482 (64%), Gaps = 17/482 (4%)
 Frame = -2

Query  1635  LNVIDAIQHLGIDHHFHDQIGAILQRQYQKVKIDDFQKINGLYDISLSFRLLRQEGYNVS  1456
             L  +DA+Q LG+D+ F ++I AI++ QY +   D  +  + L  +SL FRLLRQ+GY+V+
Sbjct  44    LIAVDAVQRLGVDYRFQEEIEAIMKTQYTRAYND--ESSDELRVVSLRFRLLRQQGYHVT  101

Query  1455  SDVFTKFTSEKGEFKEELSKDIRGLMALHEASHLSIEGEDVLDEAAKFSRESLIANMVH-  1279
              DVF KF +      E+L  DI GL+ L+EASH+S  GE+ L EA + S + L A M + 
Sbjct  102   IDVFNKFKN-----NEKLKVDINGLVGLYEASHMSFPGEEALVEAGRRSHQLLTAWMPNN  156

Query  1278  LDECQASMVQNTLQYPYHKSLARFTAKTFIENMRVENEWEATLVNLATMDYSITQSFYQE  1099
             LD+ +AS V  +L++P+HKSL RF AK F+ +   +  W   L  L  +++++ +S  + 
Sbjct  157   LDDHRASAVAYSLEHPHHKSLTRFMAKNFLHSFEGKENWVNDLRELGKLEFNMVESLIRN  216

Query  1098  EFRQILRWWKSLGLKDEL--AKNQQLKWYIWTLALIPDPSMSRERIELTKPIALVYLIDD  925
             E +Q+ +WWK LGL +EL   ++Q +KWY W +A + DP++S ER+ELTK I+LVY+IDD
Sbjct  217   EIQQVSKWWKELGLTEELKFVRDQPIKWYTWPMACLTDPNLSEERVELTKSISLVYIIDD  276

Query  924   IIDVYATFDQTKQFIDAINRWDLSVGEGLPDYMKRCLVVLFDTTNDINNLVFEKYGWNPI  745
             I DV+ T D+   F  A+ RWD+     LP+YMK C   L+D TN+ + +V +K+GWNPI
Sbjct  277   IFDVHGTLDELILFTAAVERWDIDATGELPNYMKICFKALYDITNETSYIVHKKHGWNPI  336

Query  744   DHLKRAWKCLCSAYITEAKWFATGKSPSANEYLQTGIITTGIPMVLITCFFLLGHGAFAG  565
             + LK++W  LC A++ EA+WF+ G  P   EYL  G I++G+P+VL   FFLLG G    
Sbjct  337   ESLKKSWATLCKAFLLEARWFSCGHLPXTEEYLNNGXISSGVPVVLTHGFFLLGQGITKE  396

Query  564   TTDIED------MITSVGAILRLLDDLDATQGEKQDGNDASYVEYYVKEHEGLSISDGKQ  403
             T  I D      +I+S   ILRL DD  + + E QDG D SY+  YV E++G S  D + 
Sbjct  397   TVHILDNLNISSLISSTATILRLWDDFGSAKDEGQDGYDGSYIXCYVNENQGCSDEDARA  456

Query  402   RIMNMVSEQWKLINKQCLSPTR-IPESFSKSCLNIARMVPMMYNYSDTHCLPILQKQIMS  226
              +++ +SE+WK +N++C S +     SF+K  LN+ RMVP+MY+Y+  H LP L++ + S
Sbjct  457   FVVHRISEEWKFLNQECFSASNPFSASFTKLALNVVRMVPLMYDYNSQHRLPSLEENMKS  516

Query  225   MF  220
             + 
Sbjct  517   LL  518



>ref|XP_011096217.1| PREDICTED: tricyclene synthase Oc15, chloroplastic-like [Sesamum 
indicum]
Length=576

 Score =   419 bits (1077),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 225/564 (40%), Positives = 336/564 (60%), Gaps = 27/564 (5%)
 Frame = -2

Query  1854  SHASIPCFSIGTALHCRR--RTPVVFRCQS---------VNSSSLRSEKMTVTLSKDEFL  1708
             SH  +PC         RR  R P V    +         +N++S+        L  D+  
Sbjct  8     SHLFLPCSLKARPGLARREEREPAVGVVSAYGAGKQKWNINTASVAPTSEASRLHPDKLE  67

Query  1707  LKSEGKREWQRGLLYQFQEDDL-QVLNVIDAIQHLGIDHHFHDQIGAILQRQYQKVKIDD  1531
             ++ E K E  R +L    ED+  + L ++DAIQ +G+  ++ ++I  +L+++Y       
Sbjct  68    IEYEQKIEEIRHVLQTKGEDESSESLVLVDAIQRVGLSSYYEEEIQTLLRKRYV-TSCAS  126

Query  1530  FQKINGLYDISLSFRLLRQEGYNVSSDVFTKFTSEKGEFKEELSKDIRGLMALHEASHLS  1351
               K + L D+SL FRLLRQ GY  S DVF  F  ++G F+  LS+DIRGLM L+E + L+
Sbjct  127   IYKYDSLRDVSLLFRLLRQHGYCSSPDVFNNFKGKEGRFRRNLSQDIRGLMELYEVAQLN  186

Query  1350  IEGEDVLDEAAKFS----RESLIANMVHLDECQASMVQNTLQYPYHKSLARFTAKTFIEN  1183
              +GE +LDEAA FS    RE  +AN+   D   + +V   L+YPYHK++AR T K F+++
Sbjct  187   FQGEYILDEAASFSGQLLREYCLANV---DNNMSRLVTGKLRYPYHKTIARLTRKDFLQD  243

Query  1182  MRVENEWEATLVNLATMDYSITQSFYQEEFRQILRWW---KSLGLKDELAKNQQLKWYIW  1012
             +   N W  TL  LA MD    QS +Q E   I +WW           L +NQ LKWY W
Sbjct  244   VEGINGWGKTLRELAVMDLRKGQSVFQGELAHISKWWDELGLAKKLKLLVRNQLLKWYTW  303

Query  1011  TLA-LIPDPSMSRERIELTKPIALVYLIDDIIDVYATFDQTKQFIDAINRWDLSVGEGLP  835
             +++ LI D S+S +R+ELTK +A +YLIDDI DV  T D+   F +A+N+WD +  + LP
Sbjct  304   SMSILIDDFSLSLQRVELTKSVAFIYLIDDIFDVVGTLDELIIFTEAVNKWDYAAIDMLP  363

Query  834   DYMKRCLVVLFDTTNDINNLVFEKYGWNPIDHLKRAWKCLCSAYITEAKWFATGKSPSAN  655
             DYMK C   L DTTN I + V++++G++PID LK +W  LC+AY+ EAKWFA+G  P+A 
Sbjct  364   DYMKMCYRALLDTTNRIGHEVYKRHGYDPIDSLKTSWGSLCNAYLMEAKWFASGDLPTAA  423

Query  654   EYLQTGIITTGIPMVLITCFFL--LGHGAFAGTTDIEDMITSVGAILRLLDDLDATQGEK  481
             +YL+ G ++TG+ +VL+  FFL  LG+G     TD+ ++ + V  ILRL DDL + + E 
Sbjct  424   KYLENGKVSTGVYVVLVHLFFLLGLGNGGRIRLTDVSELASCVATILRLWDDLGSAKDEH  483

Query  480   QDGNDASYVEYYVKEHEGLSISDGKQRIMNMVSEQWKLINKQCLSPTRIPES-FSKSCLN  304
             QDG D SY EYY  +H GLS++  +  +++ ++ +WK +NK+C        S F+++ LN
Sbjct  484   QDGRDGSYTEYYRNDHPGLSMAQARDHVIHAIASEWKSLNKECFGLNHFSASHFTRAALN  543

Query  303   IARMVPMMYNYSDTHCLPILQKQI  232
              AR+VP+MY Y +   LP+L++ +
Sbjct  544   FARIVPLMYGYDENKQLPVLEEHV  567



>emb|CAN81698.1| hypothetical protein VITISV_037651 [Vitis vinifera]
Length=508

 Score =   416 bits (1069),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 201/403 (50%), Positives = 281/403 (70%), Gaps = 9/403 (2%)
 Frame = -2

Query  1677  RGLLYQFQEDDLQVLNVIDAIQHLGIDHHFHDQIGAILQRQYQKVK-IDDFQKINGLYDI  1501
             R +L +  ED L+ L +IDAIQ LGID+HFH +I  +LQR + K   + D    N LY++
Sbjct  9     RSVLKEVGEDTLEALLMIDAIQRLGIDYHFHGEIEVVLQRLHTKFNTLSDCH--NNLYEL  66

Query  1500  SLSFRLLRQEGYNVSSDVFTKFTSEKGEFKEELSKDIRGLMALHEASHLSIEGEDVLDEA  1321
             +L FRLLRQEGY VS+DVF      +G+ +E+LS+DI+GLM L+EAS L I+GED+L+E 
Sbjct  67    ALGFRLLRQEGYYVSADVFNNLKDTEGKJQEKLSEDIKGLMGLYEASQLCIKGEDILEEI  126

Query  1320  AKFSRESLIANMVHLDECQASMVQNTLQYPYHKSLARFTAKTFIENMRVENEWEATLVNL  1141
               FS + L A   H D  QA +V+NTL +P+HKSLARF AK+F+ + +  + W      L
Sbjct  127   GNFSSQLLNAWNTHNDHSQARIVRNTLGHPHHKSLARFMAKSFLSDFQGTDGWVNVFREL  186

Query  1140  ATMDYSITQSFYQEEFRQILRWWKSLGLKDEL--AKNQQLKWYIWTLALIPDPSMSRERI  967
             A MD+++ +S +Q+E  Q+ +WWK LGL  EL  A+NQ LKWY+W LA++PDPS+S +R+
Sbjct  187   AKMDFNVVKSIHQKEMLQVSKWWKDLGLAKELKFARNQPLKWYMWPLAVLPDPSLSEQRV  246

Query  966   ELTKPIALVYLIDDIIDVYATFDQTKQFIDAINRWDLSVGEGLPDYMKRCLVVLFDTTND  787
             ELTKPI+LVY+IDDI DV+ T D+   F +A+NRW+ +  E LPDYMK C   L   TN+
Sbjct  247   ELTKPISLVYIIDDIFDVHGTLDELTLFTEAVNRWEYAAVEQLPDYMKICFNALNGITNE  306

Query  786   INNLVFEKYGWNPIDHLKRAWKCLCSAYITEAKWFATGKSPSANEYLQTGIITTGIPMVL  607
             I++ V+  +GWNP++ L++AW CLC+A++ EAKWFA G  P A+EYL+ G+I++G+ +VL
Sbjct  307   ISSKVYNDHGWNPMESLRKAWACLCNAFLVEAKWFADGHVPKADEYLKNGVISSGVHVVL  366

Query  606   ITCFFLLGHGAFAGTTDIED----MITSVGAILRLLDDLDATQ  490
             +  FFLLGHG      DI D    +I+SV  ILRL DDL + +
Sbjct  367   VHMFFLLGHGITKRNVDIVDDFPEIISSVAKILRLWDDLGSAK  409



>gb|AGB14626.1| (E)-nerolidol synthase [Malus domestica]
Length=536

 Score =   416 bits (1069),  Expect = 8e-134, Method: Compositional matrix adjust.
 Identities = 204/482 (42%), Positives = 309/482 (64%), Gaps = 17/482 (4%)
 Frame = -2

Query  1635  LNVIDAIQHLGIDHHFHDQIGAILQRQYQKVKIDDFQKINGLYDISLSFRLLRQEGYNVS  1456
             L  +D +Q LG+D+ F ++I AI++ Q  +   D  +  + L  +SL FRLLRQ+GY+V+
Sbjct  44    LIAVDTVQRLGVDYRFQEEIEAIMKTQCTRAYND--ESSDELRVVSLRFRLLRQQGYHVT  101

Query  1455  SDVFTKFTSEKGEFKEELSKDIRGLMALHEASHLSIEGEDVLDEAAKFSRESLIANMVH-  1279
              DVF KF +      E+L  DI GL+ L+EASH+S  GE+ L EA + S + L A M + 
Sbjct  102   IDVFNKFKN-----NEKLKVDINGLVGLYEASHMSFPGEEALVEAGRRSHQLLTAWMPNN  156

Query  1278  LDECQASMVQNTLQYPYHKSLARFTAKTFIENMRVENEWEATLVNLATMDYSITQSFYQE  1099
             LD+ +AS V  +L++P+HKSL RF AK F+ +   +  W   L  L  +++++ +S  + 
Sbjct  157   LDDHRASAVAYSLEHPHHKSLTRFMAKNFLHSFEGKENWVNDLRELGKLEFNMVESLIRN  216

Query  1098  EFRQILRWWKSLGLKDEL--AKNQQLKWYIWTLALIPDPSMSRERIELTKPIALVYLIDD  925
             E +Q+ +WWK LGL +EL   ++Q +KWY W +A + DP++S ER+ELTK I+LVY+IDD
Sbjct  217   EIQQVSKWWKELGLTEELKFVRDQPIKWYTWPMACLADPNLSEERVELTKSISLVYIIDD  276

Query  924   IIDVYATFDQTKQFIDAINRWDLSVGEGLPDYMKRCLVVLFDTTNDINNLVFEKYGWNPI  745
             I DV+ T D+   F  A+ RWD+     LP+YMK C   L+D TN+ + +V +K+GWNPI
Sbjct  277   IFDVHGTLDELILFTAAVERWDIDATGELPNYMKICFKALYDITNETSYIVHKKHGWNPI  336

Query  744   DHLKRAWKCLCSAYITEAKWFATGKSPSANEYLQTGIITTGIPMVLITCFFLLGHGAFAG  565
             + LK++W  LC A++ EA+WF+ G  P+  EYL  G+I++G+P+VL   FFLLG G    
Sbjct  337   ESLKKSWATLCKAFLLEARWFSCGHLPNTEEYLNNGLISSGVPVVLTHGFFLLGQGITKE  396

Query  564   TTDIED------MITSVGAILRLLDDLDATQGEKQDGNDASYVEYYVKEHEGLSISDGKQ  403
             T  I D      +++S   ILRL DD  + + E QDG D SY+  YV E++G S  D + 
Sbjct  397   TVHILDNLNISSLVSSTATILRLWDDFGSAKDEGQDGYDGSYIACYVNENQGCSDEDARA  456

Query  402   RIMNMVSEQWKLINKQCLSPTR-IPESFSKSCLNIARMVPMMYNYSDTHCLPILQKQIMS  226
              +++ +SE+WK +N++C S +     SF+K  LN+ARMVP+MY+Y+  H LP L++ + S
Sbjct  457   FVVHRISEEWKFLNQECFSASNPFSASFTKLALNVARMVPLMYDYNSQHRLPSLEENMKS  516

Query  225   MF  220
             + 
Sbjct  517   LL  518



>ref|XP_010059440.1| PREDICTED: (3S,6E)-nerolidol synthase 1-like [Eucalyptus grandis]
Length=589

 Score =   418 bits (1074),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 209/513 (41%), Positives = 316/513 (62%), Gaps = 23/513 (4%)
 Frame = -2

Query  1704  KSEGKREWQRGLLYQFQEDDLQVLNVIDAIQHLGIDHHFHDQIGAILQ--------RQYQ  1549
             + E + E  + LL Q + D L+ L ++DA+Q L ID+HF D+I AILQ        R + 
Sbjct  76    RHERRLEEVKRLLKQVRGDSLESLVMVDALQRLAIDYHFEDEIEAILQGHLLISSSRSHS  135

Query  1548  KVKIDDFQKINGLYDISLSFRLLRQEGYNVSSDVFTKF---TSEKGEFKEELSKDIRGLM  1378
             +  ID     + L++ +L FRLLRQ GY V SDVF +F    ++  + K+    DI G  
Sbjct  136   R-PID----ADNLHEAALRFRLLRQGGYPVPSDVFQRFLHKMNDGTQNKKPQGNDILGFT  190

Query  1377  ALHEASHLSIEGEDVLDEAAKFSRESLIANMVHLDECQASMVQNTLQYPYHKSLARFTAK  1198
             +L EAS L IEGED LD+  + +R+ L +++  LD  +   V+N+L  P+HKSLARFTA 
Sbjct  191   SLFEASQLGIEGEDALDQVGESTRQRLHSSLADLDHVRDRFVRNSLGNPFHKSLARFTAN  250

Query  1197  TFIENMRVEN-EWEATLVNLATMDYSITQSFYQEEFRQILRWWKSLGLKDEL--AKNQQL  1027
              F+ N    +  W   L  LA +D +I +S +Q E  Q+  WWK LG+  EL  A++Q +
Sbjct  251   DFLRNFVGHSYSWTKNLGELAHLDMNIVRSVHQREILQVSNWWKELGMAKELKYARDQPM  310

Query  1026  KWYIWTLALIPDPSMSRERIELTKPIALVYLIDDIIDVYATFDQTKQFIDAINRWDLSVG  847
             KWY+W +A++ +  +S+ER+ +TKPI+ +Y+IDDI DVY T +    F D +NRW+ +  
Sbjct  311   KWYMWPMAILTETGLSQERVLVTKPISFIYIIDDIFDVYGTIEDLTAFTDVVNRWECTEK  370

Query  846   EGLPDYMKRCLVVLFDTTNDINNLVFEKYGWNPIDHLKRAWKCLCSAYITEAKWFATGKS  667
             + +PDYM+ C   L D TN+ +  V++ +GWNP+  L++ W  L +A++ EA+W A+G S
Sbjct  371   DNIPDYMRMCFHALDDITNEFSLAVYKNHGWNPLCSLRKTWASLLNAFLVEARWLASGHS  430

Query  666   PSANEYLQTGIITTGIPMVLITCFFLLGHGAFAGTTD----IEDMITSVGAILRLLDDLD  499
             P+  +YL   I+++G+ ++L+  FF+LG      + D    I ++++S  +ILRL DDL 
Sbjct  431   PTTQDYLDNAIVSSGVHVLLVHLFFILGERITPESVDHLENIPEIVSSTASILRLWDDLG  490

Query  498   ATQGEKQDGNDASYVEYYVKEHEGLSISDGKQRIMNMVSEQWKLINKQCLSPTRIPESFS  319
             + + E QDG D SYVE Y +E +G S    +  +  M+SE WK +NK CL P     SFS
Sbjct  491   SAEDEFQDGRDGSYVECYKREFQGSSEEAARDHVKKMISEAWKRLNKACLYPQPFTNSFS  550

Query  318   KSCLNIARMVPMMYNYSDTHCLPILQKQIMSMF  220
             K+ LN ARMVP+MYNY D+H LP+L+  + S+ 
Sbjct  551   KASLNTARMVPLMYNYDDSHSLPLLEHHMKSLL  583



>ref|XP_004504948.1| PREDICTED: (3S,6E)-nerolidol synthase 1-like [Cicer arietinum]
Length=558

 Score =   416 bits (1070),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 217/486 (45%), Positives = 326/486 (67%), Gaps = 10/486 (2%)
 Frame = -2

Query  1653  EDDLQVLNVIDAIQHLGIDHHFHDQIGAILQRQYQKVKIDDFQKINGLYDISLSFRLLRQ  1474
             E+ L+ L +IDA+Q L ID+HF  +I   L  QY  V      K + L++ SL FRLLRQ
Sbjct  72    ENSLKGLCMIDAMQRLNIDYHFQQEIETFLTTQY--VTNSSAWKHDDLHETSLHFRLLRQ  129

Query  1473  EGYNVSSDVFTKFTSEKGEFKEELSKDIRGLMALHEASHLSIEGEDVLDEAAKFSRESLI  1294
             +G+  S +VF KFT+++ +F  +LS++I G++ L EAS LSI GED+LDEA +FS + L 
Sbjct  130   QGHFQSPEVFNKFTNKEEKFNPKLSENINGMINLFEASQLSIAGEDILDEAEEFSMKILK  189

Query  1293  ANMVHLDECQASMVQNTLQYPYHKSLARFTAKT-FIENMRVENEWEATLVNLATMDYSIT  1117
               ++HL+  +A  V+ TL+ P+HK+L+ FTA+   + ++   N W  +L  +A +D+S+ 
Sbjct  190   EKLIHLNNHEAMFVRRTLENPFHKNLSMFTARNNCLGHLYGTNAWFDSLKEVAKLDFSLL  249

Query  1116  QSFYQEEFRQILRWWKSLGLKDEL--AKNQQLKWYIWTLALIPDPSMSRERIELTKPIAL  943
             Q  +Q E  QI +WW+ LGL +EL  A+NQ LKWY+W+LA + DP++S ER+ELTKPI+L
Sbjct  250   QCLHQREIVQISKWWRELGLNNELPYARNQPLKWYMWSLACLTDPNLSEERVELTKPISL  309

Query  942   VYLIDDIIDVYATFDQTKQFIDAINRWDLSVG-EGLPDYMKRCLVVLFDTTNDINNLVFE  766
             +Y+IDDI D+Y T ++   F +A++RWD+++  E LPDYMK C  VL+D TN+I+  V++
Sbjct  310   IYIIDDIFDIYGTIEELTLFTEAVSRWDINITMEQLPDYMKICFRVLYDLTNEISFKVYQ  369

Query  765   KYGWNPIDHLKRAWKCLCSAYITEAKWFATGKSPSANEYLQTGIITTGIPMVLITCFFLL  586
             ++GW+PID LK  W+ LC A++ EAKWF +GK PSA EYL+ GII++G+ ++L+  FFLL
Sbjct  370   RHGWDPIDSLKMTWESLCKAFLVEAKWFGSGKLPSAEEYLKNGIISSGVHILLVHIFFLL  429

Query  585   GHGAFAGTTD----IEDMITSVGAILRLLDDLDATQGEKQDGNDASYVEYYVKEHEGLSI  418
             G G      +    I  +I+S   ILRL DDL   + E QDGND SYV   + +H     
Sbjct  430   GKGLTKENVERIHKIPPIISSPATILRLWDDLGNAEDENQDGNDGSYVSCLMMDHPDYCT  489

Query  417   SDGKQRIMNMVSEQWKLINKQCLSPTRIPESFSKSCLNIARMVPMMYNYSDTHCLPILQK  238
                +  +MN +S+ WK +N++CL  +   ++F+K+ LN+ARMVP+MY+Y D + LP L+ 
Sbjct  490   KRARDDVMNKISDAWKNLNQECLFYSHFHKTFTKASLNLARMVPLMYSYDDNNSLPGLEG  549

Query  237   QIMSMF  220
              + S+ 
Sbjct  550   LLHSLL  555



>sp|Q84ND0.1|TPS2_ANTMA RecName: Full=Tricyclene synthase Oc15, chloroplastic; Short=AmOc15; 
AltName: Full=Myrcene synthase Oc15; AltName: Full=Terpenoid 
synthase Oc15; Flags: Precursor [Antirrhinum majus]
 gb|AAO41726.1| myrcene synthase Oc15 [Antirrhinum majus]
Length=581

 Score =   417 bits (1071),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 209/509 (41%), Positives = 320/509 (63%), Gaps = 9/509 (2%)
 Frame = -2

Query  1716  EFLLKSEGKREWQRGLLYQFQEDD-LQVLNVIDAIQHLGIDHHFHDQIGAILQRQYQKVK  1540
             E  +  EGK +  R LL+   E+D ++ L  +DA   LG++HHF  +I  IL++ Y  +K
Sbjct  72    ELPMDYEGKIKETRHLLHLKGENDPIESLIFVDATLRLGVNHHFQKEIEEILRKSYATMK  131

Query  1539  IDDFQKINGLYDISLSFRLLRQEGYNVSSDVFTKFTSEKGEFKEELSKDIRGLMALHEAS  1360
                  + + L+++SL FRL+RQ G  VS+DVF  F  E G FKEEL +D RGL+ L+EA+
Sbjct  132   SPIICEYHTLHEVSLFFRLMRQHGRYVSADVFNNFKGESGRFKEELKRDTRGLVELYEAA  191

Query  1359  HLSIEGEDVLDEAAKFSRESLIANMVHLDECQASMVQNTLQYPYHKSLARFTAKTFIENM  1180
              LS EGE +LDEA  FSR+ L  N+  +++     V N L+YP+H S+ARFT + + +++
Sbjct  192   QLSFEGERILDEAENFSRQILHGNLAGMEDNLRRSVGNKLRYPFHTSIARFTGRNYDDDL  251

Query  1179  RVENEWEATLVNLATMDYSITQSFYQEEFRQILRWWKSLGL--KDELAKNQQLKWYIWTL  1006
                 EW  TL  LA MD  + +S YQEE  Q+ +WW  LGL  K  LA+N+  ++Y W++
Sbjct  252   GGMYEWGKTLRELALMDLQVERSVYQEELLQVSKWWNELGLYKKLNLARNRPFEFYTWSM  311

Query  1005  ALIPD-PSMSRERIELTKPIALVYLIDDIIDVYATFDQTKQFIDAINRWDLSVGEGLPDY  829
              ++ D  ++S +R+ELTK +A +YLIDDI DVY T D+   F +A+N+WD S  + LP+ 
Sbjct  312   VILADYINLSEQRVELTKSVAFIYLIDDIFDVYGTLDELIIFTEAVNKWDYSATDTLPEN  371

Query  828   MKRCLVVLFDTTNDINNLVFEKYGWNPIDHLKRAWKCLCSAYITEAKWFATGKSPSANEY  649
             MK C + L DT N  +  ++EK+G+NPID LK  WK LCSA++ EAKW A+G  PSANEY
Sbjct  372   MKMCCMTLLDTINGTSQKIYEKHGYNPIDSLKTTWKSLCSAFLVEAKWSASGSLPSANEY  431

Query  648   LQTGIITTGIPMVLITCFFLLGHGAFAGTT----DIEDMITSVGAILRLLDDLDATQGEK  481
             L+   +++G+ +VL+  F L+G G  +  +    D +++++S+  I RL +DL + + E 
Sbjct  432   LENEKVSSGVYVVLVHLFCLMGLGGTSRGSIELNDTQELMSSIAIIFRLWNDLGSAKNEH  491

Query  480   QDGNDASYVEYYVKEHEGLSISDGKQRIMNMVSEQWKLINKQCLSPTRIP-ESFSKSCLN  304
             Q+G D SY+  Y KEH  L+ +   +  + +V+ +WK +NK+  +       SF ++ LN
Sbjct  492   QNGKDGSYLNCYKKEHINLTAAQAHEHALELVAIEWKRLNKESFNLNHDSVSSFKQAALN  551

Query  303   IARMVPMMYNYSDTHCLPILQKQIMSMFS  217
             +ARMVP+MY+Y      P+L++ +  M S
Sbjct  552   LARMVPLMYSYDHNQRGPVLEEYVKFMLS  580



>ref|XP_004504950.1| PREDICTED: (3S,6E)-nerolidol synthase 1-like [Cicer arietinum]
Length=558

 Score =   416 bits (1068),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 217/486 (45%), Positives = 323/486 (66%), Gaps = 10/486 (2%)
 Frame = -2

Query  1653  EDDLQVLNVIDAIQHLGIDHHFHDQIGAILQRQYQKVKIDDFQKINGLYDISLSFRLLRQ  1474
             E+ L+ L +IDA+Q L ID+HF  +I   L  QY  V      K + L++ SL FRLLRQ
Sbjct  72    ENSLKGLCMIDAMQRLNIDYHFQQEIETFLTTQY--VTNSSAWKHDDLHETSLHFRLLRQ  129

Query  1473  EGYNVSSDVFTKFTSEKGEFKEELSKDIRGLMALHEASHLSIEGEDVLDEAAKFSRESLI  1294
             +G+  S +VF KF +++ +F  +LS++I G++ L EAS LSI GED+LDEA +FS + L 
Sbjct  130   QGHFQSPEVFNKFKNKEEKFNPKLSENINGMINLFEASQLSIAGEDILDEAEEFSMKILK  189

Query  1293  ANMVHLDECQASMVQNTLQYPYHKSLARFTAKT-FIENMRVENEWEATLVNLATMDYSIT  1117
               +VHL+  +A  V+ TL+ P+HK+L  FTA+   + ++   N W  +L  +A +D+S+ 
Sbjct  190   EKLVHLNNHEAMFVRRTLENPFHKNLTIFTARNNCLGHLYGTNTWFDSLKEVAKLDFSLL  249

Query  1116  QSFYQEEFRQILRWWKSLGLKDEL--AKNQQLKWYIWTLALIPDPSMSRERIELTKPIAL  943
             Q  +Q E  QI +WW+ LGL +EL  A+NQ LKWY+W+LA + DP++S ER+ELTKPI+L
Sbjct  250   QCLHQREIVQISKWWRELGLNNELPYARNQPLKWYMWSLACLTDPNLSEERVELTKPISL  309

Query  942   VYLIDDIIDVYATFDQTKQFIDAINRWDLSVG-EGLPDYMKRCLVVLFDTTNDINNLVFE  766
             +Y+IDDI D+Y T ++   F +A++RWD++   E LPDYMK C  VL+D TN+I+  V++
Sbjct  310   IYIIDDIFDIYGTIEELTLFTEAVSRWDINTAMEQLPDYMKTCFRVLYDLTNEISFKVYQ  369

Query  765   KYGWNPIDHLKRAWKCLCSAYITEAKWFATGKSPSANEYLQTGIITTGIPMVLITCFFLL  586
             ++GW+PID LK  W+ LC A++ EAKWF +GK PSA EYL+ GII++G+ ++L+  FFLL
Sbjct  370   RHGWDPIDSLKMTWESLCKAFLVEAKWFGSGKLPSAEEYLKNGIISSGVHILLVHIFFLL  429

Query  585   GHGAFAGTTD----IEDMITSVGAILRLLDDLDATQGEKQDGNDASYVEYYVKEHEGLSI  418
             G G      +    I  +I+S   ILRL DDL   + E QDGND SYV   + +H     
Sbjct  430   GKGLTKENVERIHKIPPIISSPATILRLWDDLGNAEDENQDGNDGSYVSCLIMDHPDYCT  489

Query  417   SDGKQRIMNMVSEQWKLINKQCLSPTRIPESFSKSCLNIARMVPMMYNYSDTHCLPILQK  238
                +  +MN +S+ WK +N++CL  +   ++F+K+ LN+ARMVP+MY+Y D + LP L+ 
Sbjct  490   KRARDDVMNKISDAWKNLNQECLFDSHFHKTFTKASLNLARMVPLMYSYDDNNSLPGLEG  549

Query  237   QIMSMF  220
              + S+ 
Sbjct  550   LLHSLL  555



>ref|XP_010098579.1| (3S,6E)-nerolidol synthase 1 [Morus notabilis]
 gb|EXB75239.1| (3S,6E)-nerolidol synthase 1 [Morus notabilis]
Length=557

 Score =   415 bits (1067),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 218/492 (44%), Positives = 301/492 (61%), Gaps = 54/492 (11%)
 Frame = -2

Query  1641  QVLNVIDAIQHLGIDHHFHDQIGAILQRQY--------QKVKIDDFQKINGLYDISLSFR  1486
             Q L VIDAIQ LGID+ F ++I  IL+ Q+            I+D      L+D +L FR
Sbjct  96    QALKVIDAIQRLGIDYLFQEEIEKILRNQFMLFDHYTGNTHNIEDH-----LHDAALRFR  150

Query  1485  LLRQEGYNVSSDVFTKFTSEKGE-FKEELSKDIRGLMALHEASHLSIEGEDVLDEAAKFS  1309
             LLRQ+GY VS+ +F K   +KG  FK ELSKD+ GLM L+EASH+SIEGEDVLDEA  FS
Sbjct  151   LLRQQGYFVSAGIFNKLKDKKGNNFKTELSKDMNGLMELYEASHVSIEGEDVLDEANIFS  210

Query  1308  RESLIANMVHL--DECQASMVQNTLQYPYHKSLARFTAKTFI---ENMRVENEWEATLVN  1144
              + L A+M  L  D  +A  + NTL+YP HK+LA+FTAK       +    N W   L  
Sbjct  211   SQLLTASMTCLGDDHRRARAIANTLEYPCHKTLAKFTAKNLFGATSHFGSANGWINVLQE  270

Query  1143  LATMDYSITQSFYQEEFRQILRWWKSLGLKDELAKNQQLKWYIWTLALIPDPSMSRERIE  964
             LA  +++  QS ++ E  QI                                 +S+ R+E
Sbjct  271   LAKYEFNQVQSLHKREILQI-------------------------------SHLSQHRVE  299

Query  963   LTKPIALVYLIDDIIDVYATFDQTKQFIDAINRWDLSVGEGLPDYMKRCLVVLFDTTNDI  784
             LTKPIA +Y+IDD+ DVY   D+   F +AINRWD++  E LP YMK C   L + TN+I
Sbjct  300   LTKPIAFIYVIDDLFDVYGNLDELTLFTEAINRWDITAVEKLPHYMKICFKALDNLTNEI  359

Query  783   NNLVFEKYGWNPIDHLKRAWKCLCSAYITEAKWFATGKSPSANEYLQTGIITTGIPMVLI  604
             ++ V++++GWNP   L++ W  LC A++ EAKWFA+G+ P   EYL+ G++++G+PMVL+
Sbjct  360   SHKVYQEHGWNPSHSLRKTWATLCDAFLVEAKWFASGQVPKTEEYLRNGVVSSGVPMVLV  419

Query  603   TCFFLLGHGAFAGTTDIED----MITSVGAILRLLDDLDATQGEKQDGNDASYVEYYVKE  436
               FFLLG      T +  D    +ITS  AILRL DDL + + E Q+G+D SYVE Y+KE
Sbjct  420   HLFFLLGQSITQDTVNFVDKMPGIITSTAAILRLWDDLGSAKDENQEGHDGSYVECYMKE  479

Query  435   HEGLSISDGKQRIMNMVSEQWKLINKQCLSPTRIPESFSKSCLNIARMVPMMYNYSDTHC  256
              +G SI + +Q I   +S+ WK +NK+CLSP  +P +F K+CLN+AR+VP+MY+Y D   
Sbjct  480   RQGSSIEEARQNITERISDAWKCLNKECLSPNPLPATFLKACLNVARLVPLMYSYDDNQR  539

Query  255   LPILQKQIMSMF  220
             LP L++ + SMF
Sbjct  540   LPSLEQYMKSMF  551



>sp|Q84NC9.1|TPS3_ANTMA RecName: Full=Tricyclene synthase 1e20, chloroplastic; Short=Am1e20; 
AltName: Full=Myrcene synthase 1e20; AltName: Full=Terpenoid 
synthase 1e20; Flags: Precursor [Antirrhinum majus]
 gb|AAO41727.1| myrcene synthase 1e20 [Antirrhinum majus]
Length=584

 Score =   416 bits (1069),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 209/509 (41%), Positives = 320/509 (63%), Gaps = 9/509 (2%)
 Frame = -2

Query  1716  EFLLKSEGKREWQRGLLYQFQEDD-LQVLNVIDAIQHLGIDHHFHDQIGAILQRQYQKVK  1540
             E  +  EGK +  R LL+   E+D ++ L  +DA   LG++HHF  +I  IL++ Y  +K
Sbjct  75    ELPMDYEGKIKETRHLLHLKGENDPIESLIFVDATLRLGVNHHFQKEIEEILRKSYATMK  134

Query  1539  IDDFQKINGLYDISLSFRLLRQEGYNVSSDVFTKFTSEKGEFKEELSKDIRGLMALHEAS  1360
                  + + L+++SL FRL+RQ G  VS+DVF  F  E G FKEEL +D RGL+ L+EA+
Sbjct  135   SPIICEYHTLHEVSLFFRLMRQHGRYVSADVFNNFKGESGRFKEELKRDTRGLVELYEAA  194

Query  1359  HLSIEGEDVLDEAAKFSRESLIANMVHLDECQASMVQNTLQYPYHKSLARFTAKTFIENM  1180
              LS EGE +LDEA  FSR+ L  N+  +++     V N L+YP+H S+ARFT + + +++
Sbjct  195   QLSFEGERILDEAENFSRQILHGNLAGMEDNLRRSVGNKLRYPFHTSIARFTGRNYDDDL  254

Query  1179  RVENEWEATLVNLATMDYSITQSFYQEEFRQILRWWKSLGL--KDELAKNQQLKWYIWTL  1006
                 EW  TL  LA MD  + +S YQEE  Q+ +WW  LGL  K  LA+N+  ++Y W++
Sbjct  255   GGMYEWGKTLRELALMDLQVERSVYQEELLQVSKWWNELGLYKKLNLARNRPFEFYTWSM  314

Query  1005  ALIPD-PSMSRERIELTKPIALVYLIDDIIDVYATFDQTKQFIDAINRWDLSVGEGLPDY  829
              ++ D  ++S +R+ELTK +A +YLIDDI DVY T D+   F +A+N+WD S  + LP+ 
Sbjct  315   VILADYINLSEQRVELTKSVAFIYLIDDIFDVYGTLDELIIFTEAVNKWDYSATDTLPEN  374

Query  828   MKRCLVVLFDTTNDINNLVFEKYGWNPIDHLKRAWKCLCSAYITEAKWFATGKSPSANEY  649
             MK C + L DT N  +  ++EK+G+NPID LK  WK LCSA++ EAKW A+G  PSANEY
Sbjct  375   MKMCCMTLLDTINGTSQKIYEKHGYNPIDSLKTTWKSLCSAFLVEAKWSASGSLPSANEY  434

Query  648   LQTGIITTGIPMVLITCFFLLGHGAFAGTT----DIEDMITSVGAILRLLDDLDATQGEK  481
             L+   +++G+ +VL+  F L+G G  +  +    D +++++S+  I RL +DL + + E 
Sbjct  435   LENEKVSSGVYVVLVHLFCLMGLGGTSRGSIELNDTQELMSSIAIIFRLWNDLGSAKNEH  494

Query  480   QDGNDASYVEYYVKEHEGLSISDGKQRIMNMVSEQWKLINKQCLSPTRIP-ESFSKSCLN  304
             Q+G D SY+  Y KEH  L+ +   +  + +V+ +WK +NK+  +       SF ++ LN
Sbjct  495   QNGKDGSYLNCYKKEHINLTAAQAHEHALELVAIEWKRLNKESFNLNHDSVSSFKQAALN  554

Query  303   IARMVPMMYNYSDTHCLPILQKQIMSMFS  217
             +ARMVP+MY+Y      P+L++ +  M S
Sbjct  555   LARMVPLMYSYDHNQRGPVLEEYVKFMLS  583



>gb|KEH31175.1| (3S)-linalool/(E)-nerolidol/(E,E)-geranyl linalool synthase [Medicago 
truncatula]
Length=570

 Score =   414 bits (1064),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 223/536 (42%), Positives = 339/536 (63%), Gaps = 28/536 (5%)
 Frame = -2

Query  1800  RTPVVFRCQSVNSSSLRSEKMTVTLSKDEFLLKSEGKREWQRGLLYQFQEDDLQVLNVID  1621
             R   + + + ++SS+  SEK+         L+K E         L    E+ L+ L +ID
Sbjct  49    RRSTLIKHRDLSSSNNHSEKLE--------LVKHE---------LRNVGENSLKGLYMID  91

Query  1620  AIQHLGIDHHFHDQIGAILQRQYQKVKIDDFQKINGLYDISLSFRLLRQEGYNVSSDVFT  1441
             A+Q L ID+HF ++I + L+RQY           + L++ +L FRLLRQ+G+ V ++VF 
Sbjct  92    AMQRLNIDYHFEEEIESFLRRQYVTSACGGSNH-HDLHETALHFRLLRQQGHFVPAEVFN  150

Query  1440  KFTSEKGEFKEELSKDIRGLMALHEASHLSIEGEDVLDEAAKFSRESLIANMVHLDECQA  1261
             K+T+E+ +F  +L ++I G++ L EASHL++ GED+LDEA KFSR+ L   M   D  +A
Sbjct  151   KYTNEEEKFNPKLGENINGMIDLFEASHLNLAGEDILDEAGKFSRKILKERMTQFDH-EA  209

Query  1260  SMVQNTLQYPYHKSLARFTAKTFIENMRVENEWEATLVNLATMDYSITQSFYQEEFRQIL  1081
               V+ TL+YP+HK+L  FTA+ F  ++   N W  ++  +A MD+S+ Q  + +E  Q+ 
Sbjct  210   MFVRRTLEYPFHKNLPIFTARNFYGHLYSTNVWFGSMKEVAKMDFSLLQGLHHQEIVQVS  269

Query  1080  RWWKSLGLKDEL--AKNQQLKWYIWTLALIPDPSMSRERIELTKPIALVYLIDDIIDVYA  907
             +WW+ LGL +EL  A+NQ LKWY+W+LA + DP++S ERIELTKPI+L+Y+IDDI D+Y 
Sbjct  270   KWWRELGLANELPYARNQPLKWYMWSLACLTDPTLSEERIELTKPISLIYIIDDIFDIYG  329

Query  906   TFDQTKQFIDAINRWDLSVG-EGLPDYMKRCLVVLFDTTNDINNLVFEKYGWNPIDHLKR  730
             T D+   F + I+RWD+    E LP+YMK    VL+D TN++++ +++K+GWNP D L++
Sbjct  330   TLDELTLFTEVISRWDIDTDMEKLPNYMKTSFRVLYDLTNELSSKIYKKHGWNPKDSLRK  389

Query  729   AWKCLCSAYITEAKWFATGKSPSANEYLQTGIITTGIPMVLITCFFLLGHGAFAGTTDIE  550
              W+ LC A++ EAKWF +GK PSA EYL+ GI+++G+ +VL+  FFLLG G         
Sbjct  390   TWESLCKAFLVEAKWFGSGKLPSAEEYLKNGIVSSGVHIVLVHIFFLLGKGLTKENVHTI  449

Query  549   D----MITSVGAILRLLDDLDATQGEKQDGNDASYVEYYVKEHEGLSISDGKQR--IMNM  388
             D    +I+S   ILRL DDL   + E Q GND SYV   + +H     +  +    +MN 
Sbjct  450   DTTPSIISSPATILRLWDDLGNAEDENQQGNDGSYVNCLMMDHPEYYCTRRRATVDVMNK  509

Query  387   VSEQWKLINKQCLSPTRIPESFSKSCLNIARMVPMMYNYSDTHCLPILQKQIMSMF  220
             V+  WK +N++CL  T   ++F+K+ LN+ARMVP+MY+Y D H L  L+  + S+ 
Sbjct  510   VTNAWKSLNQECLFDTYFHKAFTKASLNLARMVPLMYSYDDKHSLRGLEGYVHSLL  565



>ref|XP_008441674.1| PREDICTED: (3S,6E)-nerolidol synthase 1-like [Cucumis melo]
Length=546

 Score =   411 bits (1057),  Expect = 9e-132, Method: Compositional matrix adjust.
 Identities = 207/496 (42%), Positives = 312/496 (63%), Gaps = 19/496 (4%)
 Frame = -2

Query  1653  EDDLQVLNVIDAIQHLGIDHHFHDQIGAILQRQYQKVKID---DFQKINGLYDISLSFRL  1483
             +D L+ LN+IDA+Q LG+++ F  +I AIL+  Y  + +D   D    N L++++L FRL
Sbjct  46    DDPLESLNLIDAVQRLGLEYRFQTEIDAILEHHY-AIFVDHDGDCMNDNDLHEVALRFRL  104

Query  1482  LRQEGYNVSSDVFTKFTSEKGEFKEELSKDIRGLMALHEASHLSIEGEDVLDEAAKFSRE  1303
             LRQ GY VSSDVF  F +E G FK+ L  DI+GLM+L+EAS L + GE+ L+EA  FS +
Sbjct  105   LRQRGYFVSSDVFNIFMNEDGHFKQNLEHDIKGLMSLYEASQLCLPGENKLNEAQNFSSK  164

Query  1302  SLIANMVH--LDECQASMVQNTLQYPYHKSLARFTAKTFIENMRVE------NEWEATLV  1147
              L   + +  +D  +A+ V  TL  PYH S ++F  K +      E      N+W     
Sbjct  165   ILREYITNDNIDNKEANHVARTLANPYHTSFSKFMVKDYFGVGDDELLHATNNKWVHAFQ  224

Query  1146  NLATMDYSITQSFYQEEFRQILRWWKSLGLKDEL--AKNQQLKWYIWTLALIPDPSMSRE  973
              +A MD++I Q+ +Q+E  Q  RWWK  GL   L  A++Q LKWYI +L  + DP  S E
Sbjct  225   QVAKMDFNIAQNMHQQELVQFTRWWKETGLGKALPFARDQPLKWYICSLVCLIDPCFSDE  284

Query  972   RIELTKPIALVYLIDDIIDVYATFDQTKQFIDAINRWDLSVGEGLPDYMKRCLVVLFDTT  793
             RIEL+K ++ VYLIDD+ D+Y + DQ   F +A+ RWD+++ E LP+ M+ C   L+D T
Sbjct  285   RIELSKAVSFVYLIDDMFDIYGSLDQLTLFTEAVRRWDIAMTEALPECMRICFKSLYDMT  344

Query  792   NDINNLVFEKYGWNPIDHLKRAWKCLCSAYITEAKWFATGKSPSANEYLQTGIITTGIPM  613
             N+I++ +++K+GWNPI+ L+++W  LC A++ E +WF  G+SPSA EYL+ G+++TG+ +
Sbjct  345   NEISSKIYKKHGWNPINSLQKSWAKLCDAFLVEGRWFDCGESPSAEEYLKNGVVSTGVHV  404

Query  612   VLITCFFLLGHGAFAGTTDIED----MITSVGAILRLLDDLDATQGEKQDGNDASYVEYY  445
             VL+  FF LG      T  + D    +I+S   ILRL DDL   + E Q+G D SYV YY
Sbjct  405   VLVHAFFFLGQSITNQTVHLLDNDPLIISSPATILRLHDDLGTAKDENQEGYDGSYVNYY  464

Query  444   VKEHEGLSISDGKQRIMNMVSEQWKLINKQCLS-PTRIPESFSKSCLNIARMVPMMYNYS  268
             +  ++ +S+   ++ + N++S  WK +NK+CLS  +  P +F ++ L+IAR VP++Y Y 
Sbjct  465   MIHNQDVSVDTTRKHMANLISNSWKNLNKECLSFNSPFPAAFIQASLSIARFVPILYGYD  524

Query  267   DTHCLPILQKQIMSMF  220
                 LP L+K + SM 
Sbjct  525   KNQRLPTLEKLVKSML  540



>emb|CBI33220.3| unnamed protein product [Vitis vinifera]
Length=490

 Score =   409 bits (1050),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 201/416 (48%), Positives = 285/416 (69%), Gaps = 8/416 (2%)
 Frame = -2

Query  1719  DEFLLKSEGKREWQRGLLYQFQEDDLQVLNVIDAIQHLGIDHHFHDQIGAILQRQYQKVK  1540
             DEF  +   K +  + +  +  ED ++ + +IDAIQ LGIDHHF ++I A+LQ+QY K  
Sbjct  67    DEFYNEHAQKLKEVKHVFSKLGEDAMESMMMIDAIQRLGIDHHFEEEIEAVLQKQYMKSS  126

Query  1539  IDDFQKINGLYDISLSFRLLRQEGYNVSSDVFTKFTSEKGEFKEELSKDIRGLMALHEAS  1360
             I        LY+++L FRLLRQEGY V +DV   F +++G+FK+ L +DIRGLM L+EAS
Sbjct  127   IHG-DCDEDLYEVALRFRLLRQEGYTVPADVLNNFKNKEGKFKQNLREDIRGLMGLYEAS  185

Query  1359  HLSIEGEDVLDEAAKFSRESLIANMVHLDECQASMVQNTLQYPYHKSLARFTAKTFIENM  1180
              LSI GED+L+EA  FS   L A + HLD  QA++V+NTL++P+HKSLARF  K F+ + 
Sbjct  186   QLSI-GEDILEEAGNFSSLLLNACLQHLDHHQAAVVKNTLEHPHHKSLARFMTKNFLTDF  244

Query  1179  RVENEWEATLVNLATMDYSITQSFYQEEFRQILRWWKSLGLKDEL--AKNQQLKWYIWTL  1006
             +  N W   L  LA +D+++ +S +Q+E  QI +WWK LGL +EL  A++Q LKWY+W +
Sbjct  245   QGTNGWINALQELAKIDFNMVKSVHQKEMLQISKWWKDLGLTEELKFARDQPLKWYMWPM  304

Query  1005  ALIPDPSMSRERIELTKPIALVYLIDDIIDVYATFDQTKQFIDAINRWDLSVGEGLPDYM  826
             A+IPDP +S +RIELTKPI+L+Y+IDDI DV  T D+   F +A+NRWDLS  + LP+YM
Sbjct  305   AIIPDPRLSEQRIELTKPISLIYIIDDIFDVGGTLDELTLFTEAVNRWDLSAFKELPEYM  364

Query  825   KRCLVVLFDTTNDINNLVFEKYGWNPIDHLKRAWKCLCSAYITEAKWFATGKSPSANEYL  646
             K C   L D TN+I+  V +++ WNP+  L++AW  LC+A++ EAKWFA+G  P A EYL
Sbjct  365   KMCFKTLDDITNEISTKVHKEHKWNPVGSLRKAWASLCNAFLVEAKWFASGHVPKAEEYL  424

Query  645   QTGIITTGIPMVLITCFFLLGHGAFAGTTDIED----MITSVGAILRLLDDLDATQ  490
             + G +++G+ +VL+  FFLLGHG      D+ D    +I+S   ILRL DDL + +
Sbjct  425   KNGAVSSGVHVVLVHLFFLLGHGITKENVDLVDDFPGIISSTATILRLWDDLGSAK  480



>dbj|BAP75560.1| linalool synthase [Citrus unshiu]
Length=581

 Score =   410 bits (1053),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 224/509 (44%), Positives = 318/509 (62%), Gaps = 20/509 (4%)
 Frame = -2

Query  1719  DEFLLKSEGKREWQRGLLYQFQEDD-LQVLNVIDAIQHLGIDHHFHDQIGAILQRQYQKV  1543
             D+  +K   K E  + +L +  +DD  + L +ID +Q LGID++F D+I  IL+RQY  +
Sbjct  70    DDIHIKHAKKLEVIKHILIKLGDDDSFEGLAMIDVVQRLGIDYYFQDEIELILRRQYS-I  128

Query  1542  KIDDFQKINGLYDISLSFRLLRQEGYNVSSDVFTKFTSEKGEFKEELSKDIRGLMALHEA  1363
                D  + N L +++L FRLLRQ+GY VS+DVF +F +++GEFK+ +S+DI GLM+L+EA
Sbjct  129   FFTDGDRYNDLQEVALRFRLLRQQGYYVSADVFNRFRNKEGEFKQNISEDINGLMSLYEA  188

Query  1362  SHLSIEGEDVLDEAAKFSRESLIANMVHLDECQASMVQNTLQYPYHKSLARFTAKTFIEN  1183
             S LSI GED LDEA  FS   L AN        A +V++ L YPY KSL+   AK F   
Sbjct  189   SQLSIGGEDGLDEAGHFSATHL-ANY-----DLAGVVEHLLLYPYRKSLS--PAKNFFHG  240

Query  1182  MRVENE--WEATLVNLATMDYSITQSFYQEEFRQILRWWKSLGL--KDELAKNQQLKWYI  1015
                 +E  W   L  LA MD+ + QS +Q+E  QI  WW+ LGL  K E A+ Q +KWY+
Sbjct  241   NFQGSEYIWILDLQELANMDFKLVQSLHQKEIVQISSWWRELGLAKKLEFAREQPVKWYV  300

Query  1014  WTLALIPDPSMSRERIELTKPIALVYLIDDIIDVYATFDQTKQFIDAINRWDLSVGEGLP  835
             W++A   DP++S +RIELTKPI+ VY+IDDI  V    D    F + INRWDL   + LP
Sbjct  301   WSMACFTDPNLSWQRIELTKPISFVYIIDDIFYVCGALDALTLFTEPINRWDLGDIDQLP  360

Query  834   DYMKRCLVVLFDTTNDINNLVFEK-YGWNPIDHLKRA-WKCLCSAYITEAKWFATGKSPS  661
             +YMK C   L D TN+I+    ++  G      L++   + LC+A++ EAKWFA+G  P 
Sbjct  361   EYMKICFKALNDITNEISKQGVQRSMGITLCTPLRKGVGEVLCNAFLIEAKWFASGHLPK  420

Query  660   ANEYLQTGIITTGIPMVLITCFFLLGHGAFAGTTDIED----MITSVGAILRLLDDLDAT  493
             A EYL+ GI+++G+ +VL+  FFLLGHG    T  + D    +++SV  ILR+ DDL + 
Sbjct  421   AEEYLENGIVSSGVHLVLVHIFFLLGHGITNETVQLIDSNPPIVSSVATILRIWDDLGSA  480

Query  492   QGEKQDGNDASYVEYYVKEHEGLSISDGKQRIMNMVSEQWKLINKQCLSPTRIPESFSKS  313
             + E Q G D SY+ YY+ EH  L+  D  +  M+ +S+ WK +NK+CLSP     SF+++
Sbjct  481   KDENQGGKDGSYIYYYMMEHRDLTAEDAHKHAMDKISDAWKRLNKECLSPNPFSASFTRA  540

Query  312   CLNIARMVPMMYNYSDTHCLPILQKQIMS  226
               N ARMVP+MY+Y D+  LP L++ I S
Sbjct  541   SFNCARMVPLMYSYDDSQRLPSLEEYIKS  569



>gb|KCW74839.1| hypothetical protein EUGRSUZ_E03574 [Eucalyptus grandis]
Length=472

 Score =   405 bits (1042),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 208/458 (45%), Positives = 291/458 (64%), Gaps = 12/458 (3%)
 Frame = -2

Query  1617  IQHLGIDHHFHDQIGAILQRQYQKVKIDDFQKINGLYDISLSFRLLRQEGYNVSSDVFTK  1438
             IQ LG+   F + I AIL+ QY      +  K + +Y+I+L FRLLRQEGY+V +DVF  
Sbjct  2     IQRLGVKSLFREHIKAILRWQYTHFSSLNHGK-DDVYEIALRFRLLRQEGYHVPADVFEY  60

Query  1437  FTSEKGEFKEELSKDIRGLMALHEASHLSIEGEDVLDEAAKFSRESLIANMV-HLDECQA  1261
             F  +   F  +L  +I+G+M L+EAS +S EGED+LDEA  FS + L A +   LD  QA
Sbjct  61    FNDKGKGFVMKLEGNIKGMMELYEASQMSTEGEDILDEAGCFSSKCLNALLTCDLDHEQA  120

Query  1260  SMVQNTLQYPYHKSLARFTA-KTFIENMRVENEWEATLVNLATMDYSITQSFYQEEFRQI  1084
              M+++TL YPY KS AR  A ++F+ +M   N W   L+ +A     I Q  +QEE  QI
Sbjct  121   RMIESTLPYPYRKSFARLLAPQSFVNDMPGANSWMEDLLEVANRKRRIDQYVHQEEIHQI  180

Query  1083  LRWWKSLGL--KDELAKNQQLKWYIWTLALIPDPSMSRERIELTKPIALVYLIDDIIDVY  910
              +WWK LGL  K E A++Q LKWY+W++A++ DPS+S  R+EL KPI+LVY+IDDI DV+
Sbjct  181   NKWWKELGLGEKMEFARDQPLKWYMWSMAILTDPSLSELRVELIKPISLVYIIDDIFDVH  240

Query  909   ATFDQTKQFIDAINRWDLSVGEGLPDYMKRCLVVLFDTTNDINNLVFEKYGWNPIDHLKR  730
              T D+   F + I RWD +  E LP+YMK C  VL D  ND   ++FEK+GWNP   LK+
Sbjct  241   GTVDELILFTEVIKRWDNACAEQLPEYMKICFKVLNDIANDFGKIIFEKHGWNPTRFLKQ  300

Query  729   AWKCLCSAYITEAKWFATGKSPSANEYLQTGIITTGIPMVLITCFFLLGHGAFAGTTD--  556
              W  LC+A++ E +W A+GK P A++YL+  IIT+G+P+VL   FFL+G      + D  
Sbjct  301   MWANLCNAFLVEFQWNASGKLPKADDYLKNAIITSGVPLVLTHLFFLMGQNIANQSMDSK  360

Query  555   -----IEDMITSVGAILRLLDDLDATQGEKQDGNDASYVEYYVKEHEGLSISDGKQRIMN  391
                  + ++I  V  ILRL DDL   Q E Q+G D SYVE Y++E+EG S    ++ +M 
Sbjct  361   KEEVQLPNIIFLVAEILRLWDDLGCAQDENQNGYDGSYVECYLRENEGSSYQSAREHVMK  420

Query  390   MVSEQWKLINKQCLSPTRIPESFSKSCLNIARMVPMMY  277
             + S+  KL+NK+CLSP      F ++C+N A+MV +MY
Sbjct  421   LTSKLCKLLNKECLSPCPFSAPFLEACVNAAKMVSLMY  458



>ref|XP_011096166.1| PREDICTED: tricyclene synthase Oc15, chloroplastic-like [Sesamum 
indicum]
Length=583

 Score =   409 bits (1051),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 217/521 (42%), Positives = 326/521 (63%), Gaps = 24/521 (5%)
 Frame = -2

Query  1719  DEFLLKSEGKREWQRGLLYQFQEDDL-QVLNVIDAIQHLGIDHHFHDQIGAILQRQYQKV  1543
             D F ++ E K +  R LL    EDD  + L ++DAIQ  G+  ++ ++I +++Q+ Y   
Sbjct  67    DNFAIEYEEKIDEIRQLLRSKGEDDPSESLVLVDAIQRGGLSSYYEEEIESLIQKHY---  123

Query  1542  KIDDFQKINGLY---DISLSFRLLRQEGYNVSSDVFTKFTSEKGEFKEELSKDIRGLMAL  1372
              +     I G Y   D+SL FRLLRQ G+ +S DVF  F  + G F+  LS+DIRGLM L
Sbjct  124   -VASCASIYGYYSLRDVSLLFRLLRQHGHYISPDVFNNFKGKDGRFRRNLSQDIRGLMEL  182

Query  1371  HEASHLSIEGEDVLDEAAKFS----RESLIANMVHLDECQASMVQNTLQYPYHKSLARFT  1204
             +E + LS +GE +LDEAA FS    RE  +AN+   D   + MV   L+YPYHK++ R T
Sbjct  183   YEVAQLSFQGEYILDEAASFSGHILREYCLANV---DNNLSRMVTGKLRYPYHKTIPRLT  239

Query  1203  AKTFIENMRVENEWEATLVNLATMDYSITQSFYQEEFRQILRWWKSLGL--KDELAKNQQ  1030
              K F++++   N W  TL  LA MD    QS +Q E  Q+ +WW  LGL  K +L +NQ 
Sbjct  240   RKDFLQDIEGINGWGKTLRELALMDLRKGQSVFQGELAQVSKWWNELGLAKKLKLVRNQL  299

Query  1029  LKWYIWTLA-LIPDPSMSRERIELTKPIALVYLIDDIIDVYATFDQTKQFIDAINRWDLS  853
              KWY W+++ LI D S+S +R+E+TK  A +YLIDDI DV  T ++   F +A+N+W+ +
Sbjct  300   PKWYTWSMSVLIDDFSLSLQRVEITKSTAFIYLIDDIFDVVGTLNELTIFTEAVNKWEYA  359

Query  852   VGEGLPDYMKRCLVVLFDTTNDINNLVFEKYGWNPIDHLKRAWKCLCSAYITEAKWFATG  673
                 LPDYMK C   L DTTNDI   +++++G NPID LK +W  LC+AY+ EAKWFA+G
Sbjct  360   AVNMLPDYMKMCYRALLDTTNDIGREIYKRHGHNPIDSLKTSWASLCNAYLVEAKWFASG  419

Query  672   KSPSANEYLQTGIITTGIPMVLITCFFLLGHGAFAGTT----DIEDMITSVGAILRLLDD  505
              SP+A+ +L+ G ++TG+ + L+  FFLLG G   G T    DI  +++ V  I RL +D
Sbjct  420   VSPTADMHLENGKVSTGVYVALVHLFFLLGLGRTDGGTINFPDISQLLSDVATIFRLCND  479

Query  504   LDATQGEKQDGNDASYVEYYVKEHEGLSISDGKQRIMNMVSEQWKLINKQCLSPTR-IPE  328
             L   +   +DG D SY++  +K+H G+S++  ++R++++++ QWK +NK+C         
Sbjct  480   LGGAKDGNEDGTDGSYIDLCMKDHPGVSVAQARERVVDVIASQWKSLNKECFRLNHSSAS  539

Query  327   SFSKSCLNIARMVPMMYNYSDTHCLPILQKQI-MSMFSTIN  208
             SF K+ LN+AR+VP+MY+Y D   LP+L++ +  ++F+  N
Sbjct  540   SFKKASLNLARIVPLMYDYDDNQRLPVLEEYVKFTLFNQTN  580



>gb|AEZ53170.1| linalool synthase, partial [Rosa rugosa]
Length=428

 Score =   402 bits (1034),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 196/420 (47%), Positives = 278/420 (66%), Gaps = 6/420 (1%)
 Frame = -2

Query  1461  VSSDVFTKFTSEKGEFKEELSKDIRGLMALHEASHLSIEGEDVLDEAAKFSRESLIANMV  1282
             V  DVF  F    G FK+ L +DI+GLM+L+EAS L  EGED L EA KFS   L  ++ 
Sbjct  3     VLDDVFNNFKESNGMFKKALGEDIKGLMSLYEASQLGTEGEDTLFEAGKFSGHLLKTSLS  62

Query  1281  HLDECQASMVQNTLQYPYHKSLARFTAKTFIENMRVENEWEATLVNLATMDYSITQSFYQ  1102
             HLD  QA +V NTL+ P+HK+LA F A+ F    +  N W   L  +A  D+S+ QS +Q
Sbjct  63    HLDHHQARIVGNTLENPHHKTLASFMARKFFVTSQGTNTWLNLLKEVAKTDFSMVQSLHQ  122

Query  1101  EEFRQILRWWKSLGLKDEL--AKNQQLKWYIWTLALIPDPSMSRERIELTKPIALVYLID  928
              E  QI +WWK LGL  EL  A++Q LKWYIW +A + DP +S ER+ELTKPI+ +YLID
Sbjct  123   NEIVQISKWWKELGLAKELKFARDQPLKWYIWAMACLTDPKLSEERVELTKPISFIYLID  182

Query  927   DIIDVYATFDQTKQFIDAINRWDLSVGEGLPDYMKRCLVVLFDTTNDINNLVFEKYGWNP  748
             DI DV  T D+   F +A+NRWD++  + LPDYMK CL  L D TN+ +  V++++GWNP
Sbjct  183   DIFDVNGTLDELILFTEAVNRWDITAIDHLPDYMKICLKALDDITNEFSYKVYKRHGWNP  242

Query  747   IDHLKRAWKCLCSAYITEAKWFATGKSPSANEYLQTGIITTGIPMVLITCFFLLGHGAFA  568
             + +LK+ W  LC+A++ EAKWFA+GK P + EYL+ GI+++G+ ++++   FLLG     
Sbjct  243   LQYLKKMWASLCNAFLVEAKWFASGKLPKSEEYLKNGIVSSGVIVIVVHFLFLLGQNITK  302

Query  567   GT----TDIEDMITSVGAILRLLDDLDATQGEKQDGNDASYVEYYVKEHEGLSISDGKQR  400
                    D   +I+S   ILRL DDL + + E QDGND SYV  Y+++H+G SI + +++
Sbjct  303   QNVEVLNDTPAIISSTATILRLWDDLGSAKDENQDGNDGSYVRCYLEQHQGCSIEEAREK  362

Query  399   IMNMVSEQWKLINKQCLSPTRIPESFSKSCLNIARMVPMMYNYSDTHCLPILQKQIMSMF  220
              +NM+S++WK +N++ LSP   P +F+ + LN+AR VP+MYNY    CLP L++ + SM 
Sbjct  363   TVNMISDEWKKLNRELLSPNPFPATFTSASLNLARTVPLMYNYDGNQCLPSLKEYMKSML  422



>emb|CBI23482.3| unnamed protein product [Vitis vinifera]
Length=559

 Score =   406 bits (1044),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 200/424 (47%), Positives = 289/424 (68%), Gaps = 9/424 (2%)
 Frame = -2

Query  1740  MTVTLSKDEFLLKSEGKREWQRGLLYQFQEDDLQVLNVIDAIQHLGIDHHFHDQIGAILQ  1561
             +T+ L ++EF ++   K E  R +L +  ED L+ L +IDAIQ LGID+HFH +I  +LQ
Sbjct  128   LTIFLWQNEFYMEHAQKLEEVRSVLKEVGEDTLEALLMIDAIQRLGIDYHFHGEIEVVLQ  187

Query  1560  RQYQKVK-IDDFQKINGLYDISLSFRLLRQEGYNVSSDVFTKFTSEKGEFKEELSKDIRG  1384
             R + K   + D    N LY+++L FRLLRQEGY+VS+DVF      +G+ +E+LS+DI+G
Sbjct  188   RLHTKFNTVSDCH--NNLYELALGFRLLRQEGYHVSADVFNNLKDTEGKLQEKLSEDIKG  245

Query  1383  LMALHEASHLSIEGEDVLDEAAKFSRESLIANMVHLDECQASMVQNTLQYPYHKSLARFT  1204
             LM L+EAS L I+GED+L+E   FS + L A   H D  QA +V+NTL +P+HKSLARF 
Sbjct  246   LMGLYEASQLCIKGEDILEEIGNFSSQLLNAWDTHNDHSQARIVRNTLGHPHHKSLARFM  305

Query  1203  AKTFIENMRVENEWEATLVNLATMDYSITQSFYQEEFRQILRWWKSLGLKDEL--AKNQQ  1030
             AK+F+ + +  + W+     LA MD+++ +S +Q+E  Q+ +WWK LGL +EL  A++Q 
Sbjct  306   AKSFLSDFQGTDGWKNVFRELAKMDFNVVKSIHQKEMLQVSKWWKDLGLTEELKFARDQP  365

Query  1029  LKWYIWTLALIPDPSMSRERIELTKPIALVYLIDDIIDVYATFDQTKQFIDAINRWDLSV  850
             LK Y+W +A+IPDP +S +RIELTKPI+L+Y+IDDI DV  T D+   F +A+NRWDLS 
Sbjct  366   LKCYMWPMAIIPDPRLSEQRIELTKPISLIYIIDDIFDVGGTLDELTLFTEAVNRWDLSA  425

Query  849   GEGLPDYMKRCLVVLFDTTNDINNLVFEKYGWNPIDHLKRAWKCLCSAYITEAKWFATGK  670
              + LP+YMK C   L D TN+I+  V +++ WNP+  L++AW  LC+A++ EAKWFA+G 
Sbjct  426   FKELPEYMKMCFKTLDDITNEISTKVHKEHKWNPVGSLRKAWASLCNAFLVEAKWFASGH  485

Query  669   SPSANEYLQTGIITTGIPMVLITCFFLLGHGAFAGTTDIED----MITSVGAILRLLDDL  502
              P   EYL+ G +++G+ +VL+  FFLLGHG      D+ D    +I+S   ILRL DDL
Sbjct  486   VPKDEEYLKNGAVSSGVHVVLVHLFFLLGHGITKDNVDLVDDFPGIISSTATILRLWDDL  545

Query  501   DATQ  490
              + +
Sbjct  546   GSAK  549



>ref|XP_002263720.2| PREDICTED: (3S,6E)-nerolidol synthase 1-like [Vitis vinifera]
Length=398

 Score =   397 bits (1021),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 185/381 (49%), Positives = 263/381 (69%), Gaps = 6/381 (2%)
 Frame = -2

Query  1344  GEDVLDEAAKFSRESLIANMVHLDECQASMVQNTLQYPYHKSLARFTAKTFIENMRVENE  1165
             GED+L+EA  FS   L A + HLD  QA++V+NTL++P+HKS ARF  K F+ + +  N 
Sbjct  5     GEDILEEAGNFSSLLLNACLQHLDRHQAAVVKNTLEHPHHKSWARFMTKNFLTDFQGTNG  64

Query  1164  WEATLVNLATMDYSITQSFYQEEFRQILRWWKSLGLKDEL--AKNQQLKWYIWTLALIPD  991
             W   L  LA +D+++ +S +Q+E  QI +WWK LGL +EL  A++Q LK Y+W +A+IPD
Sbjct  65    WINALQELAKIDFNMVKSVHQKEMLQISKWWKDLGLTEELKFARDQPLKCYMWPMAIIPD  124

Query  990   PSMSRERIELTKPIALVYLIDDIIDVYATFDQTKQFIDAINRWDLSVGEGLPDYMKRCLV  811
             P +S +RIELTKPI+L+Y+IDDI DV  T D+   F +A+NRWDLS  + LP+YMK C  
Sbjct  125   PRLSEQRIELTKPISLIYIIDDIFDVGGTLDELTLFTEAVNRWDLSAFKELPEYMKMCFK  184

Query  810   VLFDTTNDINNLVFEKYGWNPIDHLKRAWKCLCSAYITEAKWFATGKSPSANEYLQTGII  631
              L D TN+I+  V +++ WNP+  L++AW  LC+A++ EAKWFA+G  P   EYL+ G +
Sbjct  185   TLDDITNEISTKVHKEHKWNPVGSLRKAWASLCNAFLVEAKWFASGHVPKDEEYLKNGAV  244

Query  630   TTGIPMVLITCFFLLGHGAFAGTTDIED----MITSVGAILRLLDDLDATQGEKQDGNDA  463
             ++G+ +VL+  FFLLGHG      D+ D    +I+S   ILRL DDL + + E QDG+D 
Sbjct  245   SSGVHVVLVHLFFLLGHGITKDNVDLVDDFPGIISSTATILRLWDDLGSAKDENQDGHDG  304

Query  462   SYVEYYVKEHEGLSISDGKQRIMNMVSEQWKLINKQCLSPTRIPESFSKSCLNIARMVPM  283
             SYVE Y+KEH G S+ + +Q + +M+S+ WK +NK+CLSP     SF+K  LNIARMVP+
Sbjct  305   SYVECYLKEHRGSSVENARQIVAHMISDMWKRLNKECLSPNPFSTSFTKGSLNIARMVPL  364

Query  282   MYNYSDTHCLPILQKQIMSMF  220
             MY+Y D  CLP L++ + S+ 
Sbjct  365   MYSYDDQQCLPGLEEHMKSLL  385



>ref|XP_010686920.1| PREDICTED: (3S,6E)-nerolidol synthase 1-like [Beta vulgaris subsp. 
vulgaris]
Length=541

 Score =   402 bits (1033),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 201/491 (41%), Positives = 307/491 (63%), Gaps = 20/491 (4%)
 Frame = -2

Query  1650  DDLQV--LNVIDAIQHLGIDHHFHDQIGAILQRQYQKVKIDDFQKINGLYDISLSFRLLR  1477
             D+ QV  L +IDAIQ LG++++F + I A L R++ KV+    +  + L+D++L FRLLR
Sbjct  55    DEYQVEELVMIDAIQRLGLEYYFQEDINAAL-RKWSKVE----ESGHNLHDVALRFRLLR  109

Query  1476  QEGYNVSSDVFTKFTSEKGEFKEELSKDIRGLMALHEASHLSIEGEDVLDEAAKFSRESL  1297
             Q GYNV +D F  F +E G FK EL KD +GL++L EAS L+I G+++LDEAA F+   L
Sbjct  110   QAGYNVQADTFDNFKNEDGRFKRELCKDTKGLLSLFEASELNIPGDEILDEAAYFTWNLL  169

Query  1296  IANMVHLDECQASMVQNTLQYPYHKSLARFTAKTFIENMRVE----------NEWEATLV  1147
              +++ ++ E  A ++  TL  P+HKSL R T K  + N               +W   + 
Sbjct  170   KSSLSNVHENVAVIINKTLISPHHKSLPRLTVKKELPNFETSLNFLHDGLDTQDWIKEIQ  229

Query  1146  NLATMDYSITQSFYQEEFRQILRWWKSLGLKD--ELAKNQQLKWYIWTLALIPDPSMSRE  973
             +LA +D +  Q   Q E  QI +WWK L + +  E A+NQ +KW++W+   +P P M+  
Sbjct  230   DLARIDINKAQITLQSETTQISKWWKELDMAEVLEHARNQPVKWHMWSFVALPSPDMAEL  289

Query  972   RIELTKPIALVYLIDDIIDVYATFDQTKQFIDAINRWDLSVGEGLPDYMKRCLVVLFDTT  793
             R+ELTK I+ +Y+IDDI DVY   +    F +A+NRW  +   GLP+YMK CL  LFDTT
Sbjct  290   RVELTKAISFIYIIDDIFDVYGKLEDLIPFTEAVNRWKYADMNGLPNYMKICLKALFDTT  349

Query  792   NDINNLVFEKYGWNPIDHLKRAWKCLCSAYITEAKWFATGKSPSANEYLQTGIITTGIPM  613
              +++  V+  +GWNP  +L+ AW  LC+A++ EA+WFA  + P+  EYL+ G++++G+ +
Sbjct  350   AEMSKKVYINHGWNPEGYLQNAWSELCNAFLVEARWFANERLPTTEEYLKNGLVSSGVYV  409

Query  612   VLITCFFLLGHGAFAGTTDIEDMITSVGAILRLLDDLDATQGEKQDGNDASYVEYYVKEH  433
             V  T F LLG          E ++++ G ILRL DDL + + E QDG+D S+V  Y+ EH
Sbjct  410   VFATLFSLLGEARHLWNAHPE-IVSATGTILRLWDDLGSAKDENQDGHDGSFVACYMNEH  468

Query  432   EGLSISDGKQRIMNMVSEQWKLINKQCLSPTRIPESFSKSCLNIARMVPMMYNYSDTHCL  253
              G S    ++ ++ M+S+ WK +N+QCLS +    +F  + LN+ARM+P+MY+Y D H L
Sbjct  469   HGSSDESARECVVEMISDAWKRLNEQCLSHSPFSSNFKTAFLNLARMIPVMYSYDDNHRL  528

Query  252   PILQKQIMSMF  220
             P+L+K + S+ 
Sbjct  529   PVLEKHMTSLL  539



>ref|XP_004504907.1| PREDICTED: (3S,6E)-nerolidol synthase 2, chloroplastic/mitochondrial-like 
isoform X1 [Cicer arietinum]
Length=559

 Score =   401 bits (1030),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 214/487 (44%), Positives = 320/487 (66%), Gaps = 11/487 (2%)
 Frame = -2

Query  1653  EDDLQVLNVIDAIQHLGIDHHFHDQIGAILQRQYQKVKIDDFQKINGLYDISLSFRLLRQ  1474
             E+ L+ L +IDA+Q L ID+HF  +I   L  QY  V      K + L++ SL FRLLRQ
Sbjct  72    ENSLKGLCMIDAMQRLNIDYHFQQEIETFLTTQY--VTNSSAWKHDDLHETSLHFRLLRQ  129

Query  1473  EGYNVSSDVFTKFTSEKGEFKEELSKDIRGLMALHEASHLSIEGEDVLDEAAKFSRESLI  1294
             +G+  S +VF KF +++ +F  +LS++I G++ L EAS LSI GED+LDEA +FS + L 
Sbjct  130   QGHFQSPEVFNKFKNKEEKFNPKLSENINGMINLFEASQLSIAGEDILDEAEEFSMKILK  189

Query  1293  ANMVHLDECQASMVQNTLQYPYHKSLARFTAKT-FIENMRVENEWEATLVNLATMDYSIT  1117
               +VHL+  +A  V+ TL+ P+HK+L  FTA+   + ++   N W  +L  +A +D+S+ 
Sbjct  190   EKLVHLNNHEAMFVRRTLENPFHKNLPIFTARNNCLGHLYGTNTWFDSLKEVAKLDFSLL  249

Query  1116  QSFYQEEFRQILRWWKSLGLKDEL--AKNQQLKWYIWTLALIPDPSMSRERIELTKPIAL  943
             Q  +Q E  QI +WW+ L L +EL  A+NQ LKWY+W+LA + DP++S ER+ELTKPI+L
Sbjct  250   QCLHQREIVQISKWWRELDLNNELPYARNQPLKWYMWSLACLTDPNLSEERVELTKPISL  309

Query  942   VYLIDDIIDVY-ATFDQTKQFIDAINRWDLSVG-EGLPDYMKRCLVVLFDTTNDINNLVF  769
             +Y+IDDI D+Y  T ++   F +A++RWD++   E LPDYMK C  VL+D TN+I+  V+
Sbjct  310   IYIIDDIFDIYNGTIEELTLFTEAVSRWDINTAMEQLPDYMKTCFRVLYDLTNEISFKVY  369

Query  768   EKYGWNPIDHLKRAWKCLCSAYITEAKWFATGKSPSANEYLQTGIITTGIPMVLITCFFL  589
             +++GW+PID LK  W+ LC A++ EAKWF +GK PSA EYL+ GII++G+ ++L+  FFL
Sbjct  370   QRHGWDPIDSLKMTWESLCKAFLVEAKWFGSGKLPSAEEYLKNGIISSGVHILLVHIFFL  429

Query  588   LGHGAFAGTTD----IEDMITSVGAILRLLDDLDATQGEKQDGNDASYVEYYVKEHEGLS  421
             LG G      +    I  +I+S   ILRL DDL   + E QDG D SYV   + +H    
Sbjct  430   LGKGLTKENVERIHKIPPIISSPATILRLWDDLGNAEDENQDGIDGSYVSCLMMDHPDYC  489

Query  420   ISDGKQRIMNMVSEQWKLINKQCLSPTRIPESFSKSCLNIARMVPMMYNYSDTHCLPILQ  241
                 +  +M  +S+ WK +N++CL  +   ++F+K+ LN+ARMVP+MY+Y D + LP L+
Sbjct  490   TKRARDDVMTKISDAWKNLNQECLFDSHFHKTFTKASLNLARMVPLMYSYDDNNSLPGLE  549

Query  240   KQIMSMF  220
               + S+ 
Sbjct  550   GLLHSLL  556



>ref|XP_007148287.1| hypothetical protein PHAVU_006G195600g [Phaseolus vulgaris]
 gb|ESW20281.1| hypothetical protein PHAVU_006G195600g [Phaseolus vulgaris]
Length=523

 Score =   399 bits (1024),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 209/520 (40%), Positives = 316/520 (61%), Gaps = 13/520 (3%)
 Frame = -2

Query  1728  LSKDEFLLKSEGKREWQRGLLYQFQEDDLQVLNVIDAIQHLGIDHHFHDQIGAILQRQYQ  1549
             LS D +L ++   +E ++       ED ++   VID IQ LGI+HHF ++I A+LQ Q  
Sbjct  3     LSDDIYLEQALVLKEVKQAFQKLVSEDYMECFYVIDIIQRLGIEHHFQEEIEALLQNQCS  62

Query  1548  KV--KIDDFQKINGLYDISLSFRLLRQEGYNVSSDVFTKFTSEKGEFKEELSKDIRGLMA  1375
                  I DF   + LY+++L FRLLRQ GY+V +DVF    S K EF+ +  +D++ L+A
Sbjct  63    IFISHISDFANHHKLYELALLFRLLRQRGYHVPADVFEGLKSNKREFRAKHGEDVKSLIA  122

Query  1374  LHEASHLSIEGEDVLDEAAKFSRESLIANMV-HLDECQASMVQNTLQYPYHKSLARF--T  1204
             LHEA+ LSIEGED LD+A     + L + +  H +  +A  V NTLQ P H  L+RF  T
Sbjct  123   LHEAAQLSIEGEDSLDDAGFLCCQLLHSWLKRHREHHEAIYVANTLQNPLHYGLSRFRDT  182

Query  1203  AKTFIENMRVENEWEATLVNLATMDYSITQSFYQEEFRQILRWWKSLGL--KDELAKNQQ  1030
                 + + + + EW   +  LA ++  I +   Q E  Q+ RWWK +G+  +++    + 
Sbjct  183   TSLALSDYKTKKEW-TCIEKLAEINSCIVRMMNQNEIIQVYRWWKDVGMVREEKFCMYEP  241

Query  1029  LKWYIWTLALIPDPSMSRERIELTKPIALVYLIDDIIDVYATFDQTKQFIDAINRWDLSV  850
             LKWY+W +A   DP  S +RIELTK I+L+Y+IDDI DVY T DQ   F DA+ RW+L  
Sbjct  242   LKWYLWPMACFTDPRFSDQRIELTKSISLIYIIDDIFDVYGTLDQLTLFRDAVYRWELGG  301

Query  849   GEGLPDYMKRCLVVLFDTTNDINNLVFEKYGWNPIDHLKRAWKCLCSAYITEAKWFATGK  670
              E LPD+MK CL VL+D TND    V++++G NPID LKR+W  L +A++ EA W   G 
Sbjct  302   AEQLPDFMKMCLSVLYDITNDFAEKVYKRHGLNPIDTLKRSWVRLLNAFMEEAHWLKGGD  361

Query  669   SPSANEYLQTGIITTGIPMVLITCFFLLGHG----AFAGTTDIEDMITSVGAILRLLDDL  502
              P + EYL  GI+++G+ +VL+  FFL  H     + A   +   +I SV  ILRL DDL
Sbjct  362   LPRSEEYLNNGIVSSGVHVVLLHAFFLFDHSINMESVAVMDNFPQIIYSVAKILRLSDDL  421

Query  501   DATQGEKQDGNDASYVEYYVKEHEGLSISDGKQRIMNMVSEQWKLINKQCLSPTRIPESF  322
             +  + + + G D SY++ Y+ EH+ +S  D +  + +++  +WK +N+Q L+   +P SF
Sbjct  422   EGAKKKDEKGVDGSYLDCYMNEHQHVSAEDAQNHVSHLIQSEWKRLNEQILTQNELPSSF  481

Query  321   SKSCLNIARMVPMMYNY-SDTHCLPILQKQIMSMFSTING  205
             +  CLN ARMVP+MY+Y ++  CL I+++++  + +  +G
Sbjct  482   TNFCLNAARMVPLMYDYTTNNPCLSIMREELKMVLNVDSG  521



>gb|AAV36466.1| wound-inducible putative chloroplast terpene synthase 3 [Medicago 
truncatula]
 gb|KEH31174.1| (3S)-linalool/(E)-nerolidol/(E,E)-geranyl linalool synthase [Medicago 
truncatula]
Length=573

 Score =   399 bits (1026),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 198/468 (42%), Positives = 297/468 (63%), Gaps = 16/468 (3%)
 Frame = -2

Query  1641  QVLNVIDAIQHLGIDHHFHDQIGAILQRQYQKVKIDDFQK--INGLYDISLSFRLLRQEG  1468
             + L+++D+IQ LG++++F ++I A L+R++  ++  +FQ+    GL   +  FR+LRQEG
Sbjct  76    ECLSMVDSIQRLGMEYNFEEEIEATLERKHTMLRFQNFQRNEYQGLSQAAFQFRMLRQEG  135

Query  1467  YNVSSDVFTKFTSEKGEFKEELSKDIRGLMALHEASHLSIEGEDVLDEAAKFSRESLI--  1294
             Y +S D+F KF   KG+ K   S+DI G++AL EAS LSIEGED LD   +F  + L   
Sbjct  136   YYISPDIFDKFCDNKGKLKYTFSEDINGMIALFEASQLSIEGEDCLDNVGQFCGQYLNDW  195

Query  1293  ANMVHLDECQASMVQNTLQYPYHKSLARFTAKTFIENMRVENE-WEATLVNLATMDYSIT  1117
             ++  H    QA  V +TL YP HK+L+RFT       M+ +N  W  ++   + +D  + 
Sbjct  196   SSTFH-GHPQAKFVAHTLMYPTHKTLSRFTPTI----MQSQNATWTNSIQQFSKIDTQMV  250

Query  1116  QSFYQEEFRQILRWWKSLGL-KD-ELAKNQQLKWYIWTLALIPDPSMSRERIELTKPIAL  943
              S + +E   + +WWK LGL KD E A+++ +KWY W++A +PDP  S ERIELTKP++L
Sbjct  251   SSSHLKEIFAVSKWWKDLGLPKDLEFARDEPIKWYSWSMACLPDPQFSEERIELTKPLSL  310

Query  942   VYLIDDIIDVYATFDQTKQFIDAINRWDLSVGEGLPDYMKRCLVVLFDTTNDINNLVFEK  763
             +Y+IDDI D Y   D+   F DA+ RWDLS  E LPD MK C   L+D TN+     + K
Sbjct  311   IYIIDDIFDFYGNIDELTLFTDAVKRWDLSAIEQLPDCMKVCFKALYDITNEFALRTYIK  370

Query  762   YGWNPIDHLKRAWKCLCSAYITEAKWFATGKSPSANEYLQTGIITTGIPMVLITCFFLLG  583
             +GWNP+  L ++W  L +A++ EAKWFA+G  P + EYL+  I++TG+ ++L+  FF +G
Sbjct  371   HGWNPLTSLIKSWVRLLNAFLQEAKWFASGNVPKSEEYLKNAIVSTGVHVILVHAFFCMG  430

Query  582   HGAFAGTTDIED----MITSVGAILRLLDDLDATQGEKQDGNDASYVEYYVKEHEGLSIS  415
              G    T  + D    +I++   ILRL DDL+  +    +GND SY + Y+K++ G+SI 
Sbjct  431   QGITEKTVSLMDDFPTIISTTAKILRLCDDLEGDKDVNCEGNDGSYSKCYMKDNPGVSIG  490

Query  414   DGKQRIMNMVSEQWKLINKQCLSPTRIPESFSKSCLNIARMVPMMYNY  271
               K+ +   +S+ WK +NK+CL+   +P SF+K CLN ARMVP+MYNY
Sbjct  491   LTKEHMSEQISDAWKQLNKECLNTNPLPSSFTKLCLNAARMVPIMYNY  538



>ref|XP_004145158.1| PREDICTED: (3S,6E)-nerolidol synthase 1-like [Cucumis sativus]
 ref|XP_004153857.1| PREDICTED: (3S,6E)-nerolidol synthase 1-like [Cucumis sativus]
Length=555

 Score =   398 bits (1023),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 207/496 (42%), Positives = 316/496 (64%), Gaps = 19/496 (4%)
 Frame = -2

Query  1653  EDDLQVLNVIDAIQHLGIDHHFHDQIGAILQRQYQKVKIDDFQKING--LYDISLSFRLL  1480
             +D L+ LN+IDA+Q LG+D+ F  +I AIL+R Y      +   +N   L++++L FRLL
Sbjct  55    DDPLETLNLIDAVQRLGLDYRFQTEIDAILERHYAIFVGQEGDGMNDDDLHEVALRFRLL  114

Query  1479  RQEGYNVSSDVFTKFTSEKGEFKEELSKDIRGLMALHEASHLSIEGEDVLDEAAKFS---  1309
             RQ GY VSSDVF  F  E+G FK+ L  DI+GLM+L+EAS L + GE+ + EA  FS   
Sbjct  115   RQRGYFVSSDVFNVFMDEEGHFKQNLEHDIKGLMSLYEASQLCLPGENRMKEAQNFSSKI  174

Query  1308  -RESLIANMVHLDECQASMVQNTLQYPYHKSLARFTAKTFIEN-----MRVENEWEATLV  1147
              RE +I N  ++D+ +A+ V+ TL+ PYH S ++F  K +            N+W     
Sbjct  175   LREYIITNE-NIDKKEANHVERTLENPYHTSFSKFMVKDYFREGDELLHATNNKWVHAFQ  233

Query  1146  NLATMDYSITQSFYQEEFRQILRWWKSLGLKDEL--AKNQQLKWYIWTLALIPDPSMSRE  973
              +A +D++I Q+ +Q+E  Q   WWK  GL   L  A++Q LKWYI +L  + DP  S E
Sbjct  234   KVAKVDFNIAQNMHQQELVQFTLWWKETGLGKTLPFARDQPLKWYICSLVCLIDPCFSDE  293

Query  972   RIELTKPIALVYLIDDIIDVYATFDQTKQFIDAINRWDLSVGEGLPDYMKRCLVVLFDTT  793
             RI+L+KP++ +YLIDD+ DVY + DQ   F +A+ RWD+++ E LP+ M+ C   L+D T
Sbjct  294   RIQLSKPVSFIYLIDDMFDVYGSLDQLTLFTEAVRRWDITMTEALPECMRICFKSLYDMT  353

Query  792   NDINNLVFEKYGWNPIDHLKRAWKCLCSAYITEAKWFATGKSPSANEYLQTGIITTGIPM  613
             N+I++ +++K+GWNPI+ L+++W  LC A++ E +WF  G+SPSA+EYL+ G++++G+ +
Sbjct  354   NEISSKIYKKHGWNPINSLQKSWAKLCDAFLVEGRWFDCGESPSADEYLKNGVVSSGVHV  413

Query  612   VLITCFFLLGHGAFAGTTDIED----MITSVGAILRLLDDLDATQGEKQDGNDASYVEYY  445
             VL+  FFLLG      T  + D    +I+S   ILRL DDL + + E Q+G D SYV YY
Sbjct  414   VLVHAFFLLGQSITNQTVHLLDNDPLIISSPATILRLHDDLGSAKDENQEGYDGSYVNYY  473

Query  444   VKEHEGLSISDGKQRIMNMVSEQWKLINKQCLS-PTRIPESFSKSCLNIARMVPMMYNYS  268
             +  ++ +SI   ++ + N++S  WK +NK+CLS     P +F ++ L+IAR VP++Y Y 
Sbjct  474   MIHNQDVSIDTTRKHMANLISNSWKNLNKECLSFNNPFPAAFIQASLSIARFVPILYGYD  533

Query  267   DTHCLPILQKQIMSMF  220
                 LP L+K + SM 
Sbjct  534   QNQKLPTLEKIVKSML  549



>gb|EYU33926.1| hypothetical protein MIMGU_mgv1a004820mg [Erythranthe guttata]
Length=508

 Score =   395 bits (1016),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 210/496 (42%), Positives = 312/496 (63%), Gaps = 22/496 (4%)
 Frame = -2

Query  1656  QEDDLQVLNVIDAIQHLGIDHHFHDQIGAILQRQYQKVKIDDFQKINGLYDISLSFRLLR  1477
             QED ++ L ++DAIQ  GI HH+ ++I  IL   Y K   D     + ++D +LSFRLLR
Sbjct  7     QEDPMESLILVDAIQRSGIGHHYREEIHTILTHYYTKNPRD--SSSSTIHDAALSFRLLR  64

Query  1476  QEGYNVSSDVFTKFTSEKGEFKEELSKDIRGLMALHEASHLSIEGEDVLDEAAKFSRESL  1297
             Q+G +VS++VF  F   KG+F+ E+ +DI GL+ L+EA+ L  EGE++L EA  FS + L
Sbjct  65    QQGCHVSAEVFNNF---KGKFRGEVRQDITGLLELYEATQLGFEGENILVEAEDFSSKLL  121

Query  1296  IANMVHLDECQASMVQNT-LQYPYHKSLARFT-AKTFI--ENMRVE--NEWEATLVNLAT  1135
                    +  + S   NT L++P HKS+ RFT    F+   ++R    N WE  L+ LA 
Sbjct  122   HKCTQETEYSKWSRHINTRLKHPCHKSITRFTETNNFLVRSDLRGSGVNRWEKPLMELAE  181

Query  1134  MDYSITQSFYQEEFRQILRWWKSLGLKDEL--AKNQQLKWYIWTL-ALIPDPSMSRERIE  964
             ++  + +  YQEE  Q+ +WW  LGL  EL  A+NQ +KWY W++  LI D  +S++RIE
Sbjct  182   VELLLAKPIYQEELLQVHKWWDGLGLTTELKLARNQPIKWYTWSMTGLINDIRLSKQRIE  241

Query  963   LTKPIALVYLIDDIIDVYATFDQTKQFIDAINRWDLSVGEGLPDYMKRCLVVLFDTTNDI  784
             LTK IA +YLIDDI D+Y T D+   F +A+++WD +  + LP+YMK     L DTTN+I
Sbjct  242   LTKSIAFIYLIDDIFDLYGTPDELAIFTEAVDKWDYAAIDMLPEYMKMSYKALLDTTNEI  301

Query  783   NNLVFEKYGWNPIDHLKRAWKCLCSAYITEAKWFATGKSPSANEYLQTGIITTGIPMVLI  604
               ++FEK+G NPI+ LK  W  LC A+  EAKWFA G  P A EYL  G +++G+ + L+
Sbjct  302   ARMIFEKHGHNPINTLKETWASLCKAFSVEAKWFAGGDLPRAEEYLANGKVSSGVHVALV  361

Query  603   TCFFLLGHGAF--AGTTDIED---MITSVGAILRLLDDLDATQGEKQDGNDASYVEYYVK  439
               F++LG G     G   +E+   +I+SV AILRL DDL + + E+Q+G D SYVEYY++
Sbjct  362   HLFYILGLGGTQNQGAILLEENSTLISSVAAILRLSDDLGSAKDEQQNGKDGSYVEYYMR  421

Query  438   EHEGLSISDGKQRIMNMVSEQWKLINKQCLSPTRIPESFS---KSCLNIARMVPMMYNYS  268
             ++ GLS     + ++NM++ +W+L+NK+C        + S   ++CLN+ARMV +MY+Y 
Sbjct  422   DNHGLSFKQALEHVINMIASEWRLLNKECFDVNHYSPTLSFYREACLNLARMVSLMYSYD  481

Query  267   DTHCLPILQKQIMSMF  220
             D   LP+L++ +  M 
Sbjct  482   DNQRLPVLEEYVDFML  497



>gb|KCW74829.1| hypothetical protein EUGRSUZ_E03562 [Eucalyptus grandis]
Length=566

 Score =   398 bits (1022),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 200/505 (40%), Positives = 297/505 (59%), Gaps = 30/505 (6%)
 Frame = -2

Query  1704  KSEGKREWQRGLLYQFQEDDLQVLNVIDAIQHLGIDHHFHDQIGAILQRQYQKVKIDDFQ  1525
             + E + E  + LL Q + D L+ L  +DA++ L ID+HF D+I AILQR           
Sbjct  76    RHERRLEEVKQLLKQVRGDSLESLVTVDALRRLAIDYHFEDEIEAILQRHLLISSSRSHS  135

Query  1524  K---INGLYDISLSFRLLRQEGYNVSSDVFTKFTSEKGEFKEELSKDIRGLMALHEASHL  1354
             +    + L++ +L FRLLRQ GY                       DI G  +L EAS L
Sbjct  136   RPIDADNLHEAALRFRLLRQAGYP--------------------GNDILGFTSLFEASQL  175

Query  1353  SIEGEDVLDEAAKFSRESLIANMVHLDECQASMVQNTLQYPYHKSLARFTAKTFIENMRV  1174
              IEGED LD+  + +R+ L +++  LD  Q   V+N+L  P+HKSLARFTA  F+ N   
Sbjct  176   GIEGEDALDQVGESTRQRLHSSLADLDHVQTRFVRNSLGNPFHKSLARFTANDFLRNFVG  235

Query  1173  EN-EWEATLVNLATMDYSITQSFYQEEFRQILRWWKSLGLKDEL--AKNQQLKWYIWTLA  1003
              +  W   L  LA +D +I +S +Q E  Q+  WWK LG+  EL  A+NQ +KWYIW +A
Sbjct  236   HSCSWTKNLGELAHLDMNIVRSVHQREILQVSNWWKELGMAKELKYARNQPMKWYIWPMA  295

Query  1002  LIPDPSMSRERIELTKPIALVYLIDDIIDVYATFDQTKQFIDAINRWDLSVGEGLPDYMK  823
             ++ +  +S+ER+ +TKPI+ +Y+IDDI DVY T      F D +NRW+ +  + +PDYM+
Sbjct  296   ILTETGLSQERVLVTKPISFIYIIDDIFDVYGTIGDLTAFTDVVNRWECTEKDNIPDYMR  355

Query  822   RCLVVLFDTTNDINNLVFEKYGWNPIDHLKRAWKCLCSAYITEAKWFATGKSPSANEYLQ  643
              C   L D TN+ +  V++  G NP+  L++ W  L +A++ EA+W A+G SP+  +YL 
Sbjct  356   TCFHALDDITNEFSLAVYKNQGGNPLCPLRKPWASLLNAFLVEARWLASGHSPTTQDYLD  415

Query  642   TGIITTGIPMVLITCFFLLGHGAFAGTTD----IEDMITSVGAILRLLDDLDATQGEKQD  475
               I+++G+ ++L+  FF+LG      + D    I ++++S  +ILRL DDL + + E QD
Sbjct  416   NAIVSSGVHVLLVHLFFILGERITPESVDHLENIPEIVSSTASILRLWDDLGSAEDEFQD  475

Query  474   GNDASYVEYYVKEHEGLSISDGKQRIMNMVSEQWKLINKQCLSPTRIPESFSKSCLNIAR  295
             G D SYVE Y +E  G S    +  +  M+SE WK +NK CL P    +SFS++ LN AR
Sbjct  476   GRDGSYVECYKREFHGSSEEAARDHVKKMISEAWKRLNKACLYPQTFTKSFSRASLNTAR  535

Query  294   MVPMMYNYSDTHCLPILQKQIMSMF  220
             MVP+MYNY D+H LP+L+  + S+ 
Sbjct  536   MVPLMYNYDDSHSLPLLEHHMKSLL  560



>gb|KHN19069.1| (3S,6E)-nerolidol synthase 1, partial [Glycine soja]
Length=533

 Score =   396 bits (1018),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 207/485 (43%), Positives = 310/485 (64%), Gaps = 12/485 (2%)
 Frame = -2

Query  1653  EDDLQVLNVIDAIQHLGIDHHFHDQIGAILQRQYQ--KVKIDDFQKINGLYDISLSFRLL  1480
             ED ++ + ++D IQ LGI+HHF ++I A LQ+Q+      + DF   + L +++L FRLL
Sbjct  24    EDPMESMYMVDTIQRLGIEHHFEEEIEAALQKQHLIFSSHLSDFANNHKLCEVALPFRLL  83

Query  1479  RQEGYNVSSDVFTKFTSEKGEFKEELSKDIRGLMALHEASHLSIEGEDVLDEAAKFSRES  1300
             RQ G+ V +DVF    S K EF+E+  +D++GL++L+EA+ L IEGED LD+A     + 
Sbjct  84    RQRGHYVLADVFDNLKSNKKEFREKHGEDVKGLISLYEATQLGIEGEDSLDDAGYLCHQL  143

Query  1299  LIANMV-HLDECQASMVQNTLQYPYHKSLARFTAKT--FIENMRVENEWEATLVNLATMD  1129
             L A +  H +  +A  V  TLQ+P H  L+RF   T   + + + + EWE  L  LA ++
Sbjct  144   LHAWLTRHEEHNEAMYVAKTLQHPLHYDLSRFRDDTSILLNDFKTKREWEC-LEELAEIN  202

Query  1128  YSITQSFYQEEFRQILRWWKSLGLKDEL--AKNQQLKWYIWTLALIPDPSMSRERIELTK  955
              SI +   Q E  Q+ +WWK LGL +E+  A+ Q LKWY+W +A   DP  S +RIELTK
Sbjct  203   SSIVRFVNQNEITQVYKWWKDLGLNNEVKFARYQPLKWYMWPMACFTDPRFSEQRIELTK  262

Query  954   PIALVYLIDDIIDVYATFDQTKQFIDAINRWDLSVGEGLPDYMKRCLVVLFDTTNDINNL  775
             PI+LVY+IDDI DVY T DQ   F DAI RW+L+  E LPD+MK CL VL++ TND    
Sbjct  263   PISLVYIIDDIFDVYGTLDQLTLFTDAIKRWELASTEQLPDFMKMCLRVLYEITNDFAEK  322

Query  774   VFEKYGWNPIDHLKRAWKCLCSAYITEAKWFATGKSPSANEYLQTGIITTGIPMVLITCF  595
             +++K+G+NPI+ LKR+W  L +A++ EA W  +G  P + EYL  GI++TG+ +VL+  F
Sbjct  323   IYKKHGFNPIETLKRSWVRLLNAFLEEAHWLNSGHLPRSAEYLNNGIVSTGVHVVLVHSF  382

Query  594   FLLGHG----AFAGTTDIEDMITSVGAILRLLDDLDATQGEKQDGNDASYVEYYVKEHEG  427
             FL+ +       A   ++  +I SV  ILRL DDL+  + E Q+G D SY++ Y+ EH+ 
Sbjct  383   FLMDYSINNEIVAIVDNVPQIIHSVAKILRLSDDLEGAKSEDQNGLDGSYIDCYMNEHQD  442

Query  426   LSISDGKQRIMNMVSEQWKLINKQCLSPTRIPESFSKSCLNIARMVPMMYNYSDTHCLPI  247
             +S  D ++ + +++S +WK +N++ L+  ++P SF+  CLN ARMVP+MY+Y     L  
Sbjct  443   VSAEDAQRHVAHLISCEWKRLNREILTQNQLPSSFTNFCLNAARMVPLMYHYRSNPGLST  502

Query  246   LQKQI  232
             LQ+ +
Sbjct  503   LQEHV  507



>gb|KGN64586.1| hypothetical protein Csa_1G066550 [Cucumis sativus]
Length=598

 Score =   397 bits (1021),  Expect = 9e-126, Method: Compositional matrix adjust.
 Identities = 198/477 (42%), Positives = 302/477 (63%), Gaps = 9/477 (2%)
 Frame = -2

Query  1644  LQVLNVIDAIQHLGIDHHFHDQIGAILQRQYQKVKIDD-FQKINGLYDISLSFRLLRQEG  1468
             L+VLN+ID IQ LGIDH F ++I AIL+ QY  +     F     L++++L FRLLRQ G
Sbjct  111   LEVLNMIDGIQRLGIDHCFKEEIEAILKEQYTIMATHHYFDTKCSLHEVALRFRLLRQHG  170

Query  1467  YNVSSDVFTKFTSEKGEFKEELSKDIRGLMALHEASHLSIEGEDVLDEAAKFSRESLIAN  1288
             Y + SDVF  FT++ GE  +++ +DI GL +++EA  L + GE+ L+   +F    L   
Sbjct  171   YFIPSDVFESFTAKNGELNKKVFEDIEGLTSVYEACQLCLPGEEKLEIIGEFCGHILRTQ  230

Query  1287  MVHLDECQASMVQNTLQYPYHKSLARFTAKTFIENMRVENEWEATLVNLATMDYSITQSF  1108
             + +L+   A  V +TL  P+HKSLA+   KT     +  N+W      LA +D++  Q  
Sbjct  231   IRNLENGMAKHVGDTLTNPFHKSLAKLFIKTHF-GFKATNKWIFAFQKLAKLDFNRAQKS  289

Query  1107  YQEEFRQILRWWKSLGLKDEL--AKNQQLKWYIWTLALIPDPSMSRERIELTKPIALVYL  934
             YQ E  Q++ WWK  GL +EL  +++Q LKWYI +L  + DP  S ER+ELTK I+ +YL
Sbjct  290   YQHEISQLILWWKKTGLSEELKFSRHQPLKWYICSLVCLGDPKFSEERVELTKSISFIYL  349

Query  933   IDDIIDVYATFDQTKQFIDAINRWDLSVGEGLPDYMKRCLVVLFDTTNDINNLVFEKYGW  754
             +DDI D+Y + ++ + F  AI RW+L     LP  MK C + L++TTN++++    K+GW
Sbjct  350   LDDIYDLYGSIEELRLFTQAIQRWNLEAINSLPHPMKFCYIKLYETTNELSHKFSLKHGW  409

Query  753   NPIDHLKRAWKCLCSAYITEAKWFATGKSPSANEYLQTGIITTGIPMVLITCFFLLGHGA  574
             NPI  L+++W  LC A++ EA+WFA+G  PSA EYL+ G +++G+ +VL   FFLLG G 
Sbjct  410   NPIHCLQKSWTSLCEAFLVEAEWFASGHFPSAKEYLENGEVSSGVHVVLEHTFFLLGQGI  469

Query  573   FAGTTDIED----MITSVGAILRLLDDLDATQGEKQDGNDASYVEYYVKEHEGLSISDGK  406
                T  + D    +++S  +ILRL DDL + + E Q+G D SY++YY+KE+  +S+   +
Sbjct  470   NNKTLQLLDTNPAIVSSTASILRLSDDLGSAKDENQEGYDGSYIDYYMKENPEISVDSAQ  529

Query  405   QRIMNMVSEQWKLINKQCLSPTR-IPESFSKSCLNIARMVPMMYNYSDTHCLPILQK  238
             QR+ +M+S+ WK +N++ LSP    PE+F ++  N+AR VP++Y Y +   LP L+K
Sbjct  530   QRVNHMISDAWKRLNQESLSPNNPFPETFIQASQNMARFVPVLYGYDENQNLPTLEK  586



>ref|XP_008441685.1| PREDICTED: (3S,6E)-nerolidol synthase 1-like [Cucumis melo]
Length=578

 Score =   396 bits (1017),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 204/469 (43%), Positives = 294/469 (63%), Gaps = 13/469 (3%)
 Frame = -2

Query  1650  DDLQVLNVIDAIQHLGIDHHFHDQIGAILQRQYQKVKIDDFQKINGLYDISLSFRLLRQE  1471
             D  + LN+IDA Q LGID+HF ++I A+LQRQY       F     L+  +L FRL RQ+
Sbjct  91    DPWECLNLIDATQRLGIDYHFQEEIEAVLQRQYVLFNAVQFNPETDLHKAALLFRLFRQQ  150

Query  1470  GYNVSSDVFTKFTSEKGEFKEELSKDIRGLMALHEASHLSIEGEDV-LDEAAKFSRESLI  1294
             GY VS+DVF  F  +KG+FKE+L +DI+GL +L+EASHL I G+++ L+EA  FSR  L 
Sbjct  151   GYLVSADVFKSFMDKKGKFKEDLREDIKGLSSLYEASHLCIHGDEIILEEAEIFSRRLLN  210

Query  1293  ANMVHLDECQ-ASMVQNTLQYPYHKSLARFTAKTFIEN-MRVENEWEATLVNLATMDYSI  1120
             A      E + A+ V+NTL YP+HKS+ + T   + E+ M+  N+W     + A M+   
Sbjct  211   AR----GEAELANFVRNTLSYPHHKSVVQLTTLNYFEDHMQCPNKWIHIFQDAAKMELYC  266

Query  1119  TQSFYQEEFRQILRWWKSLGLKDEL--AKNQQLKWYIWTLALIPDPSMSRERIELTKPIA  946
             +Q   Q E  Q + WWK   L  EL  A++Q +KWY+ +L  + D   S +RI+L K I 
Sbjct  267   SQRLRQNEVAQFMEWWKDTELGKELNFARDQPIKWYMASLVCLTDSFYSEQRIQLAKSIT  326

Query  945   LVYLIDDIIDVYATFDQTKQFIDAINRWDLSVGEGLPDYMKRCLVVLFDTTNDINNLVFE  766
              +YLIDD+ DV+ T D+   F +A+ RWDL+  EGLPD MK CL  LF+ T++I+  +++
Sbjct  327   FIYLIDDLFDVFGTLDELTLFTEAVYRWDLAAAEGLPDCMKICLRSLFEVTDEISYQIYQ  386

Query  765   KYGWNPIDHLKRAWKCLCSAYITEAKWFATGKSPSANEYLQTGIITTGIPMVLITCFFLL  586
             K+ WNPI  L +AW  LC A++ EA+W + G SPSA EYL+ GI++TGIP+ L+  F LL
Sbjct  387   KHSWNPIHFLHKAWAKLCKAFLVEAEWLSCGHSPSAEEYLKNGIVSTGIPLTLLHAFLLL  446

Query  585   GHGAFAGTTDIE----DMITSVGAILRLLDDLDATQGEKQDGNDASYVEYYVKEHEGLSI  418
             G      T  I     D+++S   +LRL DD    + E Q+G D SY+EYY+KE+  +S 
Sbjct  447   GQQITDDTVQIVDDDLDIVSSTATVLRLWDDFGTAEDETQEGRDGSYLEYYMKENPSISY  506

Query  417   SDGKQRIMNMVSEQWKLINKQCLSPTRIPESFSKSCLNIARMVPMMYNY  271
              + +Q  M  +S  WK +N++ L   + P  F+++CLN+AR VP+ YNY
Sbjct  507   EETQQHTMKKISNAWKTLNRESLLSNQFPSKFNQACLNVARAVPLAYNY  555



>ref|NP_001276223.1| uncharacterized protein LOC100789381 [Glycine max]
 gb|AEE92791.1| nerol synthase [Glycine max]
Length=534

 Score =   394 bits (1013),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 207/485 (43%), Positives = 309/485 (64%), Gaps = 12/485 (2%)
 Frame = -2

Query  1653  EDDLQVLNVIDAIQHLGIDHHFHDQIGAILQRQYQ--KVKIDDFQKINGLYDISLSFRLL  1480
             ED ++ + ++D IQ LGI+HHF ++I A LQ+Q+      + DF   + L +++L FRLL
Sbjct  25    EDPMESMYMVDTIQRLGIEHHFEEEIEAALQKQHLIFSSHLSDFANNHKLCEVALPFRLL  84

Query  1479  RQEGYNVSSDVFTKFTSEKGEFKEELSKDIRGLMALHEASHLSIEGEDVLDEAAKFSRES  1300
             RQ G+ V +DVF    S K EF+E+  +D++GL++L+EA+ L IEGED LD+A     + 
Sbjct  85    RQRGHYVLADVFDNLKSNKKEFREKHGEDVKGLISLYEATQLGIEGEDSLDDAGYLCHQL  144

Query  1299  LIANMV-HLDECQASMVQNTLQYPYHKSLARFTAKT--FIENMRVENEWEATLVNLATMD  1129
             L A +  H +  +A  V  TLQ+P H  L+RF   T   + + + + EWE  L  LA ++
Sbjct  145   LHAWLTRHEEHNEAMYVAKTLQHPLHYDLSRFRDDTSILLNDFKTKREWEC-LEELAEIN  203

Query  1128  YSITQSFYQEEFRQILRWWKSLGLKDEL--AKNQQLKWYIWTLALIPDPSMSRERIELTK  955
              SI +   Q E  Q+ +WWK LGL +E+  A+ Q LKWY+W +A   DP  S +RIELTK
Sbjct  204   SSIVRFVNQNEITQVYKWWKDLGLNNEVKFARYQPLKWYMWPMACFTDPRFSEQRIELTK  263

Query  954   PIALVYLIDDIIDVYATFDQTKQFIDAINRWDLSVGEGLPDYMKRCLVVLFDTTNDINNL  775
             PI+LVY+IDDI DVY T DQ   F DAI RW+L+  E LPD+MK CL VL++ TND    
Sbjct  264   PISLVYIIDDIFDVYGTLDQLTLFTDAIKRWELASTEQLPDFMKMCLRVLYEITNDFAEK  323

Query  774   VFEKYGWNPIDHLKRAWKCLCSAYITEAKWFATGKSPSANEYLQTGIITTGIPMVLITCF  595
             + +K+G+NPI+ LKR+W  L +A++ EA W  +G  P + EYL  GI++TG+ +VL+  F
Sbjct  324   ICKKHGFNPIETLKRSWVRLLNAFLEEAHWLNSGHLPRSAEYLNNGIVSTGVHVVLVHSF  383

Query  594   FLLGHG----AFAGTTDIEDMITSVGAILRLLDDLDATQGEKQDGNDASYVEYYVKEHEG  427
             FL+ +       A   ++  +I SV  ILRL DDL+  + E Q+G D SY++ Y+ EH+ 
Sbjct  384   FLMDYSINNEIVAIVDNVPQIIHSVAKILRLSDDLEGAKSEDQNGLDGSYIDCYMNEHQD  443

Query  426   LSISDGKQRIMNMVSEQWKLINKQCLSPTRIPESFSKSCLNIARMVPMMYNYSDTHCLPI  247
             +S  D ++ + +++S +WK +N++ L+  ++P SF+  CLN ARMVP+MY+Y     L  
Sbjct  444   VSAGDAQRHVAHLISCEWKRLNREILTQNQLPSSFTNFCLNAARMVPLMYHYRSNPGLST  503

Query  246   LQKQI  232
             LQ+ +
Sbjct  504   LQEHV  508



>ref|XP_008441664.1| PREDICTED: (3S,6E)-nerolidol synthase 1-like [Cucumis melo]
Length=590

 Score =   395 bits (1014),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 199/483 (41%), Positives = 303/483 (63%), Gaps = 11/483 (2%)
 Frame = -2

Query  1656  QEDDLQVLNVIDAIQHLGIDHHFHDQIGAILQRQYQKVKIDDF--QKINGLYDISLSFRL  1483
             + D L+VLN+ID IQ LGIDH F ++I AILQ+QY  +    +       L++++L FRL
Sbjct  97    KNDSLEVLNMIDGIQRLGIDHCFKEEIEAILQKQYTIMATHHYLIDTKCSLHEVALRFRL  156

Query  1482  LRQEGYNVSSDVFTKFTSEKGEFKEELSKDIRGLMALHEASHLSIEGEDVLDEAAKFSRE  1303
             LRQ GY + SDVF  F  + GE  ++  +DI GL +++EA  L + GED LD+  +FS  
Sbjct  157   LRQRGYFIPSDVFESFMDKNGELNKKGIEDIEGLTSVYEAWQLCLPGEDKLDKIGEFSGH  216

Query  1302  SLIANMVHLDECQASMVQNTLQYPYHKSLARFTAKTFIENMRVENEWEATLVNLATMDYS  1123
              L   + +L+   A  V +TL  P+HKSLA+   K +    +  N+W     NLA +D++
Sbjct  217   ILRTQIGNLENGMAKHVGDTLTNPFHKSLAKLYIKNYF-GYQATNKWIFAFQNLAKLDFN  275

Query  1122  ITQSFYQEEFRQILRWWKSLGLKDEL--AKNQQLKWYIWTLALIPDPSMSRERIELTKPI  949
               Q  Y+ E  Q+L WWK  GL +EL  +++Q LKWYI ++  + DP  S ER+ELTK I
Sbjct  276   RVQKLYRHEISQLLLWWKKAGLCEELKFSRDQPLKWYICSVVCLADPKFSEERVELTKSI  335

Query  948   ALVYLIDDIIDVYATFDQTKQFIDAINRWDLSVGEGLPDYMKRCLVVLFDTTNDINNLVF  769
             + +YL+DDI D+Y + ++ + F  AI RWDL     LP  MK C + L++TT ++ +   
Sbjct  336   SFIYLLDDIYDLYGSIEELRLFTQAIQRWDLEAVHSLPHPMKFCYIKLYETTKELGHKFS  395

Query  768   EKYGWNPIDHLKRAWKCL-CSAYITEAKWFATGKSPSANEYLQTGIITTGIPMVLITCFF  592
              K+GWNPI  L+++   + C A++ EA+WFA+G  PSA EYL+ G +++G+ +VL   FF
Sbjct  396   LKHGWNPIHSLQKSVPFVTCEAFLVEAEWFASGHFPSAKEYLENGAVSSGVHVVLEHIFF  455

Query  591   LLGHGAFAGTTDIED----MITSVGAILRLLDDLDATQGEKQDGNDASYVEYYVKEHEGL  424
             LLG G    T  + D     ++S  +ILRL DDL + + E Q+G D SY++YY+KE+  +
Sbjct  456   LLGQGINNKTLQLLDTNPATVSSTASILRLSDDLGSAKDENQEGYDGSYIDYYLKENPEI  515

Query  423   SISDGKQRIMNMVSEQWKLINKQCLSPTR-IPESFSKSCLNIARMVPMMYNYSDTHCLPI  247
             S+   +QR+++M+S+ WK +N++ LSP    PE+F ++  N+AR VP++Y Y + H LP 
Sbjct  516   SVDSARQRVIHMISDAWKRLNQESLSPNNPFPETFIQASQNMARFVPVLYGYDENHNLPT  575

Query  246   LQK  238
             L+K
Sbjct  576   LEK  578



>ref|XP_004151014.1| PREDICTED: (3S,6E)-nerolidol synthase 1-like [Cucumis sativus]
Length=565

 Score =   394 bits (1012),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 206/484 (43%), Positives = 299/484 (62%), Gaps = 18/484 (4%)
 Frame = -2

Query  1650  DDLQVLNVIDAIQHLGIDHHFHDQIGAILQRQYQKVKIDDFQKINGLYDISLSFRLLRQE  1471
             D  + LN+IDA Q LGID+HF ++I A+LQRQY       +     L+  +L FRL RQ+
Sbjct  78    DPWECLNLIDATQRLGIDYHFQEEIEAVLQRQYVLFNAIQYNPDTDLHKAALLFRLFRQQ  137

Query  1470  GYNVSSDVFTKFTSEKGEFKEELSKDIRGLMALHEASHLSIEGEDV-LDEAAKFSRESLI  1294
             GY VS+DVF  F  +KG+FKEEL +D++GL +L+EAS L I+G+++ L+EA  FSR  L 
Sbjct  138   GYLVSADVFKSFMDKKGKFKEELREDVKGLSSLYEASQLCIDGDEIILEEAEVFSRHWLN  197

Query  1293  ANMVHLDECQASMVQNTLQYPYHKSLARF-TAKTFIENMRVENEWEATLVNLATMDYSIT  1117
             A     +   A+ V NT+ YP+HKS+ +F T   F ++M+  N+W     + A M+   +
Sbjct  198   ARS---EADLANFVHNTIAYPHHKSVVQFMTLNYFEDHMQCPNKWIHIFQDAAKMELHSS  254

Query  1116  QSFYQEEFRQILRWWK--SLGLKDELAKNQQLKWYIWTLALIPDPSMSRERIELTKPIAL  943
             Q   Q E  Q ++WWK   LG     A++Q +KWY+ +L  + D   S +RI+L K I  
Sbjct  255   QRLRQNEVAQFMKWWKDTELGKGLSFARDQPIKWYVASLVCLTDSFYSEQRIQLAKSITF  314

Query  942   VYLIDDIIDVYATFDQTKQFIDAINRWDLSVGEGLPDYMKRCLVVLFDTTNDINNLVFEK  763
             +YLIDD+ DV+ T ++   F +A+ RWDL+  EGLPD MK CL  LF+ TN+I   +++K
Sbjct  315   IYLIDDLFDVFGTLNELTLFTEAVYRWDLAAAEGLPDSMKICLRCLFEVTNEICYHIYQK  374

Query  762   YGWNPIDHLKRAWKCLCSAYITEAKWFATGKSPSANEYLQTGIITTGIPMVLITCFFLLG  583
             +GWNPI  L + W  LC A++ EA+W + G SPSA +YL+ GI+TTGIP+ L+  F LLG
Sbjct  375   HGWNPIHFLHKEWAKLCKAFLVEAEWLSCGHSPSAEDYLKNGIVTTGIPLTLLHAFLLLG  434

Query  582   HGAFAGTT----DIEDMITSVGAILRLLDDLDATQGEKQDGNDASYVEYYVKEHEGLSIS  415
                   T     D  D+++S   +LRL DDL   + EKQ+G D SY+EYY+KE+  +S  
Sbjct  435   QQITDETVQLFDDDLDIVSSTATVLRLWDDLGTAKDEKQEGRDGSYLEYYMKENPSISYE  494

Query  414   DGKQRIMNMVSEQWKLINKQCLSPTRIPESFSKSCLNIARMVPMMYNYSDTHCLPILQKQ  235
             + +Q  M  +S  WK +N++ L   + P  F+++CLN+AR VP+ YNY          K 
Sbjct  495   ETQQHTMKRISNAWKTLNRESLLSNQFPSKFNQACLNVARAVPLAYNYDRN-------KS  547

Query  234   IMSM  223
             I+SM
Sbjct  548   ILSM  551



>gb|KGN64589.1| hypothetical protein Csa_1G068570 [Cucumis sativus]
Length=574

 Score =   394 bits (1012),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 206/484 (43%), Positives = 299/484 (62%), Gaps = 18/484 (4%)
 Frame = -2

Query  1650  DDLQVLNVIDAIQHLGIDHHFHDQIGAILQRQYQKVKIDDFQKINGLYDISLSFRLLRQE  1471
             D  + LN+IDA Q LGID+HF ++I A+LQRQY       +     L+  +L FRL RQ+
Sbjct  87    DPWECLNLIDATQRLGIDYHFQEEIEAVLQRQYVLFNAIQYNPDTDLHKAALLFRLFRQQ  146

Query  1470  GYNVSSDVFTKFTSEKGEFKEELSKDIRGLMALHEASHLSIEGEDV-LDEAAKFSRESLI  1294
             GY VS+DVF  F  +KG+FKEEL +D++GL +L+EAS L I+G+++ L+EA  FSR  L 
Sbjct  147   GYLVSADVFKSFMDKKGKFKEELREDVKGLSSLYEASQLCIDGDEIILEEAEVFSRHWLN  206

Query  1293  ANMVHLDECQASMVQNTLQYPYHKSLARF-TAKTFIENMRVENEWEATLVNLATMDYSIT  1117
             A     +   A+ V NT+ YP+HKS+ +F T   F ++M+  N+W     + A M+   +
Sbjct  207   ARS---EADLANFVHNTIAYPHHKSVVQFMTLNYFEDHMQCPNKWIHIFQDAAKMELHSS  263

Query  1116  QSFYQEEFRQILRWWK--SLGLKDELAKNQQLKWYIWTLALIPDPSMSRERIELTKPIAL  943
             Q   Q E  Q ++WWK   LG     A++Q +KWY+ +L  + D   S +RI+L K I  
Sbjct  264   QRLRQNEVAQFMKWWKDTELGKGLSFARDQPIKWYVASLVCLTDSFYSEQRIQLAKSITF  323

Query  942   VYLIDDIIDVYATFDQTKQFIDAINRWDLSVGEGLPDYMKRCLVVLFDTTNDINNLVFEK  763
             +YLIDD+ DV+ T ++   F +A+ RWDL+  EGLPD MK CL  LF+ TN+I   +++K
Sbjct  324   IYLIDDLFDVFGTLNELTLFTEAVYRWDLAAAEGLPDSMKICLRCLFEVTNEICYHIYQK  383

Query  762   YGWNPIDHLKRAWKCLCSAYITEAKWFATGKSPSANEYLQTGIITTGIPMVLITCFFLLG  583
             +GWNPI  L + W  LC A++ EA+W + G SPSA +YL+ GI+TTGIP+ L+  F LLG
Sbjct  384   HGWNPIHFLHKEWAKLCKAFLVEAEWLSCGHSPSAEDYLKNGIVTTGIPLTLLHAFLLLG  443

Query  582   HGAFAGTT----DIEDMITSVGAILRLLDDLDATQGEKQDGNDASYVEYYVKEHEGLSIS  415
                   T     D  D+++S   +LRL DDL   + EKQ+G D SY+EYY+KE+  +S  
Sbjct  444   QQITDETVQLFDDDLDIVSSTATVLRLWDDLGTAKDEKQEGRDGSYLEYYMKENPSISYE  503

Query  414   DGKQRIMNMVSEQWKLINKQCLSPTRIPESFSKSCLNIARMVPMMYNYSDTHCLPILQKQ  235
             + +Q  M  +S  WK +N++ L   + P  F+++CLN+AR VP+ YNY          K 
Sbjct  504   ETQQHTMKRISNAWKTLNRESLLSNQFPSKFNQACLNVARAVPLAYNYDRN-------KS  556

Query  234   IMSM  223
             I+SM
Sbjct  557   ILSM  560



>ref|XP_010665800.1| PREDICTED: (3S,6E)-nerolidol synthase 1-like [Beta vulgaris subsp. 
vulgaris]
Length=555

 Score =   393 bits (1009),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 198/499 (40%), Positives = 313/499 (63%), Gaps = 23/499 (5%)
 Frame = -2

Query  1680  QRGLLYQFQEDDLQVLNVIDAIQHLGIDHHFHDQIGAILQRQYQKVKIDDFQKINGLYDI  1501
             + G  YQ +E     L ++DAIQ LG +++F + I A L R++ KV+    +  + L+D+
Sbjct  52    KEGDEYQIEE-----LVMVDAIQRLGHEYYFQEDINAAL-RKWSKVE----EGGHNLHDV  101

Query  1500  SLSFRLLRQEGYNVSSDVFTKFTSEKGEFKEELSKDIRGLMALHEASHLSIEGEDVLDEA  1321
             +L FRLLRQ GYNV +D F  F +E G+FK+EL KD +GL++L EAS L+I G+++LDEA
Sbjct  102   ALRFRLLRQAGYNVQADTFDNFKNEDGKFKQELCKDTKGLLSLFEASELNILGDEILDEA  161

Query  1320  AKFSRESLIANMVHLDECQASMVQNTLQYPYHKSLARFTAK----------TFIENMRVE  1171
             A F+   L +++ ++ E  A +++ TL  P+HKSL R TAK           F+ +    
Sbjct  162   AYFTWNLLKSSLSNIHENAAVIIKTTLINPHHKSLPRLTAKKELPNFETSLNFLHDCSDT  221

Query  1170  NEWEATLVNLATMDYSITQSFYQEEFRQILRWWKSLGLKD--ELAKNQQLKWYIWTLALI  997
              +W   + +LA  D +  Q   Q E  QI +WWK LG+ +  E A+N+ +KW++W+   +
Sbjct  222   QDWIKEIQDLARTDINKAQITLQSETTQISKWWKELGMAEVLEHARNEPIKWHMWSSVAL  281

Query  996   PDPSMSRERIELTKPIALVYLIDDIIDVYATFDQTKQFIDAINRWDLSVGEGLPDYMKRC  817
             P P M+  R+ELTK I+ +Y+IDDI DVY   ++   F++A+NRW+ +   GLP+YMK C
Sbjct  282   PSPDMAELRVELTKAISFIYIIDDIFDVYGKLEELILFVEAVNRWEYADMNGLPNYMKIC  341

Query  816   LVVLFDTTNDINNLVFEKYGWNPIDHLKRAWKCLCSAYITEAKWFATGKSPSANEYLQTG  637
             L  LFDTT +++  V+  +GWN   +L+  W  LC+A++ EA+WFA  + P+ +EYL+ G
Sbjct  342   LKALFDTTAEMSKKVYINHGWNAEGYLQNVWSELCNAFLVEARWFANERLPTTDEYLKNG  401

Query  636   IITTGIPMVLITCFFLLGHGAFAGTTDIEDMITSVGAILRLLDDLDATQGEKQDGNDASY  457
             ++++G+ +V  T F LLG          E +++  G ILRL DDL + + E QDG+D S+
Sbjct  402   LVSSGVYVVFGTLFSLLGEAKHLWNAHPE-IVSVTGTILRLSDDLGSAKDENQDGHDGSF  460

Query  456   VEYYVKEHEGLSISDGKQRIMNMVSEQWKLINKQCLSPTRIPESFSKSCLNIARMVPMMY  277
             +  Y+ EH+G S    ++ ++ M+S+ WK +N+QCLS +        + LN+ARM+P+MY
Sbjct  461   LACYMNEHDGSSDEIARECVVEMISDAWKRLNEQCLSHSPFSSDLKIAFLNLARMIPVMY  520

Query  276   NYSDTHCLPILQKQIMSMF  220
             +Y D H LP+L+K + S+ 
Sbjct  521   SYDDNHRLPVLEKHMKSLL  539



>gb|AES70355.2| (3S)-linalool/(E)-nerolidol/(E,E)-geranyl linalool synthase [Medicago 
truncatula]
Length=515

 Score =   392 bits (1006),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 205/493 (42%), Positives = 306/493 (62%), Gaps = 14/493 (3%)
 Frame = -2

Query  1653  EDDLQVLNVIDAIQHLGIDHHFHDQIGAILQRQYQKVKID--DFQKINGLYDISLSFRLL  1480
             ED  +  ++ID IQ LGI+H+F ++I   L++Q+  +  +  DF   + LY+++L+FRLL
Sbjct  23    EDPTENFHLIDIIQRLGIEHYFVEEIKVALEKQFLILSSNPIDFVSSHELYEVALAFRLL  82

Query  1479  RQEGYNVSSDVFTKFTSEKGEFKEELSKDIRGLMALHEASHLSIEGEDVLDEAAKFSRES  1300
             RQ GY V++++F      K   + +  +D++GL+AL+EAS LSIEGED L++    S E 
Sbjct  83    RQGGYYVNAELFDCLKCSKKSLRVKYGEDVKGLIALYEASQLSIEGEDGLNDLGYLSCEL  142

Query  1299  LIANMV-HLDECQASMVQNTLQYPYHKSLARFTAKT-FIENMRVENEWEATLVNLATMDY  1126
             L A +  H D  QA  V NTLQYP H  L+RF  K+ FI +++ +N+W   L  LA M+ 
Sbjct  143   LQAWLPRHQDHIQAIYVSNTLQYPIHYGLSRFMDKSIFINDLKAKNKW-ICLDELAKMNS  201

Query  1125  SITQSFYQEEFRQILRWWKSLGLKDEL--AKNQQLKWYIWTLALIPDPSMSRERIELTKP  952
             SI +   + E  ++ +WW+ LGL  E+  A    LKWY+W +A   DP  S ER+ELTKP
Sbjct  202   SIVKFMNKNESVEVFKWWEDLGLAKEMKFAGYNPLKWYMWPMACFTDPCFSNERVELTKP  261

Query  951   IALVYLIDDIIDVYATFDQTKQFIDAINRWDLSVGEGLPDYMKRCLVVLFDTTNDINNLV  772
             I+LVY+IDDI DV+ T DQ   F +A+NRW++   E LP++MK  L  L+  TN+   +V
Sbjct  262   ISLVYIIDDIFDVHGTLDQLTLFTEAVNRWEMDGAENLPNFMKVSLSSLYKVTNNFAEMV  321

Query  771   FEKYGWNPIDHLKRAWKCLCSAYITEAKWFATGKSPSANEYLQTGIITTGIPMVLITCFF  592
             ++K+G+NPID LK +W  L +A++ EA W  +G  P+  EYL  GI++TG+ +VLI  FF
Sbjct  322   YKKHGFNPIDTLKISWVRLLNAFLKEAHWLNSGILPTTEEYLNNGIVSTGVHVVLIHAFF  381

Query  591   LLGH--GAFAGTTDIED-----MITSVGAILRLLDDLDATQGEKQDGNDASYVEYYVKEH  433
             L+ H  G    T  I D     +I SV  ILRL DDL+  +   Q+G D SY+  Y+ EH
Sbjct  382   LMDHAKGITKETLSILDEEFPNIIYSVAKILRLSDDLEGVKSGDQNGLDGSYLNCYMSEH  441

Query  432   EGLSISDGKQRIMNMVSEQWKLINKQCLSPTRIPESFSKSCLNIARMVPMMYNYSDTHCL  253
             + +S  D ++ +  M+  +WK +N++ L+P   P SF+  CLN ARMVP+MY+Y     L
Sbjct  442   QDISCEDVQRHVAEMILNEWKCLNQEILNPYVFPSSFTNFCLNAARMVPLMYHYKSNPSL  501

Query  252   PILQKQIMSMFST  214
               L++ + S+  +
Sbjct  502   SSLKEHVKSLIKS  514



>gb|KDP42342.1| hypothetical protein JCGZ_02815 [Jatropha curcas]
Length=548

 Score =   392 bits (1006),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 194/505 (38%), Positives = 311/505 (62%), Gaps = 17/505 (3%)
 Frame = -2

Query  1698  EGKREWQRGLLYQFQEDDLQV----LNVIDAIQHLGIDHHFHDQIGAILQRQYQKVKIDD  1531
             E K  +++ L    +EDD  +    L +ID++Q LGI++HF D+I  +L+ QY+K+    
Sbjct  43    EAKNAFRKAL----EEDDGHLSPESLRMIDSVQRLGIEYHFQDEINEVLETQYKKISTGY  98

Query  1530  FQKINGLYDISLSFRLLRQEGYNVSSDVFTKFTSEKGEFKEELSKDIRGLMALHEASHLS  1351
               + + L  ++L FRLLRQ+GY V ++VF KF ++ G+FK+EL KD +GL+ L+EAS LS
Sbjct  99    THEKHDLSQVALRFRLLRQQGYWVPAEVFNKFKNKDGKFKQELVKDTQGLLELYEASQLS  158

Query  1350  IEGEDVLDEAAKFSRESLIANMVHLDECQASMVQNTLQYPYHKSLARFTAKTFIENMRVE  1171
             I GED+LDEA  FS   L A+ +HLD+C+A +V N L+ PYHK+L R   K  + N+++ 
Sbjct  159   I-GEDILDEARVFSGPFLTASTLHLDDCEAGIVLNALKNPYHKTLTRSMVKNNLHNLKLS  217

Query  1170  -NEWEATLVNLATMDYSITQSFYQEEFRQILRWWKS---LGLKDELAKNQQLKWYIWTLA  1003
              N+ +   + LA  D+++ QS +++E   I +WWK       + +  + + L+W  W +A
Sbjct  218   SNKSKDVFMELAKFDFNMLQSLHRDEIVHISKWWKDNFRFAAEMKFGREETLEWISWPMA  277

Query  1002  LIPDPSMSRERIELTKPIALVYLIDDIIDVYATFDQTKQFIDAINRWDLSVGEGLPDYMK  823
              + DP++S +R+EL K ++L +LI+D+   Y + DQ   F+ A+NRWD++    LP+YMK
Sbjct  278   TLADPNLSAQRLELAKVVSLFHLIEDVFHFYGSIDQLTLFVQAVNRWDIAAANYLPEYMK  337

Query  822   RCLVVLFDTTNDINNLVFEKYGWNPIDHLKRAWKCLCSAYITEAKWFATGKSPSANEYLQ  643
              CL  L+D T++I + ++   G NP   L+ AW  LC+A++  AKW A G+ P A  YL+
Sbjct  338   MCLRTLYDITDEIADKIYNGCGHNPKRSLRNAWTKLCNAFLGAAKWAAVGQLPKAEHYLK  397

Query  642   TGIITTGIPMVLITCFFLLGHGAFAGTTDI----EDMITSVGAILRLLDDLDATQGEKQD  475
                 T+ + +V +  FFLLG      T ++     D+I+S  +I  L + L  T+ E ++
Sbjct  398   MANRTSAVNVVFLHIFFLLGEALTTKTINLVDNDPDIISSAASIFTLSESLKTTKDEDRN  457

Query  474   GNDASYVEYYVKEHEGLSISDGKQRIMNMVSEQWKLINKQCLSPTRIPESFSKSCLNIAR  295
             G   SY++ Y++E+   S+ D K   M M+S+ WK +NKQCLSP     SF+++ LN AR
Sbjct  458   GGFGSYMKCYMREYPLSSVEDSKLHSMEMISDSWKRLNKQCLSPNPFSPSFTRAALNCAR  517

Query  294   MVPMMYNYSDTHCLPILQKQIMSMF  220
             + P++Y + + H LP LQK + S+ 
Sbjct  518   LAPLVYGFDNNHNLPSLQKSMKSLL  542



>gb|AGS83387.1| terpene synthase [Phaseolus lunatus]
Length=569

 Score =   391 bits (1004),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 212/516 (41%), Positives = 321/516 (62%), Gaps = 26/516 (5%)
 Frame = -2

Query  1749  SEKMTVTLSKDEFLLKSEGKR------------EWQRGLLYQFQEDDLQVLNVIDAIQHL  1606
             S+   + L KD  + KS   R            E + GLL   ++     L ++D+IQ L
Sbjct  37    SKSHNIALKKDIHIPKSGKVRDDLQIRHAKTLEEVKGGLLGNARQSADHGLFMVDSIQRL  96

Query  1605  GIDHHFHDQIGAILQRQYQKVKIDDFQ--KINGLYDISLSFRLLRQEGYNVSSDVFTKFT  1432
             GI+HHF ++I AILQR +  ++++  Q      L +++L FRLLRQEGY + +D+F KF 
Sbjct  97    GIEHHFEEEIEAILQRNHLMLRVNSHQGNDYQELSEVALQFRLLRQEGYYIHADIFDKFW  156

Query  1431  SEKGEFKEELSKDIRGLMALHEASHLSIEGEDVLDEAAKFSRESLIANMVHL-DECQASM  1255
               KG+ K    +DI GL+AL EAS LS+EGED L EA + SR+ L   +    D  Q  +
Sbjct  157   DNKGKLKLTFCEDINGLIALFEASQLSMEGEDNLHEAEESSRQYLNMWLTKFHDHPQVKV  216

Query  1254  VQNTLQYPYHKSLARFTAKTFIENMRVE-NEWEATLVNLATMDYSITQSFYQEEFRQILR  1078
             V ++L+YP+HKSL+RFT+   I +++++  EW ++L  L+ +D  +  S + +E   + +
Sbjct  217   VTDSLRYPFHKSLSRFTS---INSLQLQKTEWTSSLKELSRIDAEMISSLHLKEIFAVSK  273

Query  1077  WWKSLGLKDEL--AKNQQLKWYIWTLALIPDPSMSRERIELTKPIALVYLIDDIIDVYAT  904
             WWK LGL + L  A+++ +KWY+W +A +PDP  S  RIE+TKPI+LVY+IDDI D  A 
Sbjct  274   WWKELGLTNGLMFARDEPIKWYMWPMACLPDPRFSEARIEITKPISLVYIIDDIFDFCAN  333

Query  903   FDQTKQFIDAINRWDLSVGEGLPDYMKRCLVVLFDTTNDINNLVFEKYGWNPIDHLKRAW  724
              D+   F +A+ RWD++  E LP+YMK C + L+  TN+    V  K+GWNPI  L ++W
Sbjct  334   IDELILFTEAVKRWDMAAVEQLPEYMKGCFLALYSITNEFAFKVNIKHGWNPITTLVKSW  393

Query  723   KCLCSAYITEAKWFATGKSPSANEYLQTGIITTGIPMVLITCFFLLGHGAFAGTTDIED-  547
               L +A++ EAKWF +G  P A EYL+ GI++TG+ ++L+  FFL+G G    T  + D 
Sbjct  394   VRLLNAFLEEAKWFGSGYVPKAEEYLKNGIVSTGVHLILVHSFFLIGQGITEETVTLLDE  453

Query  546   ---MITSVGAILRLLDDLDATQGEKQDGNDASYVEYYVKEHEGLSISDGKQRIMNMVSEQ  376
                +I++   ILRL DDL+  Q    DGND SY++ Y++EH  +SI + ++ +  ++S  
Sbjct  454   LPTLISTTSTILRLCDDLEGDQDVNGDGNDGSYLKCYMREHPEVSIEEAREHVSELISNA  513

Query  375   WKLINKQCLS-PTRIPESFSKSCLNIARMVPMMYNY  271
             WK +N++CL+     P SF+K CLN ARMVP+MY+Y
Sbjct  514   WKRLNQECLTDANSFPSSFTKVCLNAARMVPLMYSY  549



>ref|XP_010547042.1| PREDICTED: S-(+)-linalool synthase, chloroplastic-like [Tarenaya 
hassleriana]
Length=572

 Score =   391 bits (1004),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 207/538 (38%), Positives = 315/538 (59%), Gaps = 22/538 (4%)
 Frame = -2

Query  1806  RRRTPVVFRCQSVNSSSLRSEKMTVTLSKDEFLLKSEGKREWQRGLLYQFQEDDLQVLNV  1627
             R R   VF   S ++    SE    T+ K   +L S+              E+  + L +
Sbjct  46    RLRASYVFASFSSSTDKPNSESHEFTIKKLRNILASKNG------------ENQFESLEM  93

Query  1626  IDAIQHLGIDHHFHDQIGAILQRQYQKVKIDDFQKINGLYDISLSFRLLRQEGYNVSSDV  1447
             IDAIQ LGIDHHF  ++  IL   Y++         + L +++L FRLLRQ G+++    
Sbjct  94    IDAIQRLGIDHHFRCEVEEILGTLYKQGCRYGCYGHHDLREVALCFRLLRQGGHHIPQST  153

Query  1446  FTKFTSEKGEFKEELSKDIRGLMALHEASHLSIEGEDVLDEAAKFSRESLIANMVHLDEC  1267
             F     + G FK+EL  DI+GL+ L EAS LSIEGE++LD A +F+   L    +  +  
Sbjct  154   FDVIRDKDGGFKDELQNDIKGLLELFEASQLSIEGEEMLDNAREFAVNRLKELCLTTETG  213

Query  1266  QASMVQNTLQYPYHKSLARFTAKTFIE---NMRVENEWEATLVNLATMDYSITQSFYQEE  1096
             Q  ++ + L  P HK+L+R T K FI    N+  E EW  +L ++A +D+   +S +QEE
Sbjct  214   QRQIILDILDRPLHKTLSRLTNKRFISMRSNIGGEKEWWQSLQSVAEIDFKTLKSLHQEE  273

Query  1095  FRQILRWWKSLGLKDEL--AKNQQLKWYIWTLALIPDPSMSRERIELTKPIALVYLIDDI  922
               Q  +WW+ LGL  +L  A++Q LKW  W++A++ D  +S +R++LTKPI+L+Y+IDDI
Sbjct  274   ISQNFKWWRDLGLAKKLRKARDQPLKWCTWSMAILQDRDLSDQRLDLTKPISLIYVIDDI  333

Query  921   IDVYATFDQTKQFIDAINRWDLSVGEGLPDYMKRCLVVLFDTTNDINNLVFEKYGWNPID  742
              DVY   ++   F   + RWD    E LP +M+ C   L   T +I+  V++KYGWNP+D
Sbjct  334   FDVYGGLEELTSFTHVVERWDYEELENLPSHMRVCFEALDMVTVEISLKVYQKYGWNPMD  393

Query  741   HLKRAWKCLCSAYITEAKWFATGKSPSANEYLQTGIITTGIPMVLITCFFLLGHGAFAGT  562
              L+++W  LC A++ EAKWF  G  PS  EYL+ G+ ++G  +V++  FFLLG       
Sbjct  394   SLRKSWGRLCRAFLVEAKWFEKGYLPSTEEYLENGMESSGAHLVMLHVFFLLGGEITKEK  453

Query  561   TDI----EDMITSVGAILRLLDDLDATQGEKQDGNDASYVEYYVKEHEGLSISDGKQRIM  394
              ++      +++S  AILRL DDL   + E QDG D SY+E Y+ +++G +I + +  ++
Sbjct  454   VELIESNPKIVSSTAAILRLWDDLGTAKDENQDGFDGSYIECYMNQNKGSTIGEARTHVV  513

Query  393   NMVSEQWKLINKQCLSPTRIPE-SFSKSCLNIARMVPMMYNYSDTHCLPILQKQIMSM  223
              M+S+ WK +N++CL+P      SF+K+CLN+AR VPMMY+Y D H LP L + + S 
Sbjct  514   QMISKAWKCLNEECLNPKPFSRSSFAKACLNLARTVPMMYSYDDHHRLPHLDEYLKSF  571



>ref|XP_003528418.1| PREDICTED: (3S,6E)-nerolidol synthase 1-like [Glycine max]
Length=588

 Score =   390 bits (1002),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 205/511 (40%), Positives = 317/511 (62%), Gaps = 18/511 (4%)
 Frame = -2

Query  1686  EWQRGLLYQFQEDDLQVLNVIDAIQHLGIDHHFHDQIGAILQRQYQKVKIDDFQ--KING  1513
             E +R L+ + +++    L+++D+IQ LGI++HF ++I  IL+++   +++ + Q      
Sbjct  74    EVKRELVSKTRQNADHGLSMVDSIQRLGIEYHFEEEIETILKKKLLMLRVHNHQGRAYQE  133

Query  1512  LYDISLSFRLLRQEGYNVSSDVFTKFTSEKGEFKEELSKDIRGLMALHEASHLSIEGEDV  1333
             L +++L FRLLRQEGY + +D+F KF   +G+ K     DI GL+ L EAS LSIEGED 
Sbjct  134   LSEVALQFRLLRQEGYYIHADIFDKFWGNEGKLKLTFCDDINGLIGLFEASQLSIEGEDY  193

Query  1332  LDEAAKFSRESLIANMVHLDE-CQASMVQNTLQYPYHKSLARFTAKTFIENMRVEN-EWE  1159
             L EA +  R+ L   +    E  Q  +V ++L+YP H+SL+RFT      ++++E+ EW 
Sbjct  194   LHEAEECCRQYLNTWLSRFHEHPQVKVVADSLRYPIHRSLSRFTPTN---SLQIESTEWI  250

Query  1158  ATLVNLATMDYSITQSFYQEEFRQILRWWKSLGL-KD-ELAKNQQLKWYIWTLALIPDPS  985
              +L  L+ +D  +  S + +E   + +WWK LGL KD +LA+++ +KWY+W +A +PDP 
Sbjct  251   RSLQELSKIDTEMVSSLHLKEMFAVSKWWKELGLAKDLKLARDEPIKWYMWAMACLPDPR  310

Query  984   MSRERIELTKPIALVYLIDDIIDVYATFDQTKQFIDAINRWDLSVGEGLPDYMKRCLVVL  805
              S ERIELTKP++LVY+IDDI D     D+   F +A+ RWD++  E LPDYMK C   L
Sbjct  311   FSEERIELTKPLSLVYIIDDIFDFCGNIDELTLFTEAVKRWDMAATEQLPDYMKGCFKAL  370

Query  804   FDTTNDINNLVFEKYGWNPIDHLKRAWKCLCSAYITEAKWFATGKSPSANEYLQTGIITT  625
             +D TN+    +  K+GWNPI  L ++W  L +A++ EAKWFA+G  P A++YL+ GI++T
Sbjct  371   YDITNEFAFKIQIKHGWNPISTLIKSWVRLLNAFLEEAKWFASGLVPKADDYLKNGIVST  430

Query  624   GIPMVLITCFFLLGHGAFAGTTDIED----MITSVGAILRLLDDLDATQ--GEKQDGNDA  463
             G  M+L+  FF +G      T  + D    +I++   ILRL DDL+  Q    K D ND 
Sbjct  431   GAHMILVHSFFFMGDAITQETITLMDEFPSIISATATILRLCDDLEGDQDVNVKGDDNDG  490

Query  462   SYVEYYVKEHEGLSISDGKQRIMNMVSEQWKLINKQCL--SPTRIPESFSKSCLNIARMV  289
             SY++ Y+KEH   S+   ++ +  ++S+ WK +N++CL       P SF+K CLN ARMV
Sbjct  491   SYIKCYMKEHPATSVEQAREHVAELISDAWKRLNQECLMTDANLFPSSFTKLCLNAARMV  550

Query  288   PMMYNYSDTHCLPILQKQIMSMFSTINGESI  196
             P+MY Y DT+    L++ + S+      +SI
Sbjct  551   PLMYGY-DTNSPSKLEEYVKSLLCGGAMQSI  580



>gb|KHN07696.1| (3S,6E)-nerolidol synthase 1 [Glycine soja]
Length=496

 Score =   386 bits (992),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 201/492 (41%), Positives = 306/492 (62%), Gaps = 18/492 (4%)
 Frame = -2

Query  1629  VIDAIQHLGIDHHFHDQIGAILQRQYQKVKIDDFQ--KINGLYDISLSFRLLRQEGYNVS  1456
             ++D+IQ LGI++HF ++I  IL+++   +++ + Q      L +++L FRLLRQEGY + 
Sbjct  1     MVDSIQRLGIEYHFEEEIETILKKKLLMLRVHNHQGRAYQELSEVALQFRLLRQEGYYIH  60

Query  1455  SDVFTKFTSEKGEFKEELSKDIRGLMALHEASHLSIEGEDVLDEAAKFSRESLIANMVHL  1276
             +D+F KF   +G+ K     DI GL+ L EAS LSIEGED L EA +  R+ L   +   
Sbjct  61    ADIFDKFWGNEGKLKLTFCDDINGLIGLFEASQLSIEGEDYLHEAEECCRQYLNTWLSRF  120

Query  1275  DE-CQASMVQNTLQYPYHKSLARFTAKTFIENMRVEN-EWEATLVNLATMDYSITQSFYQ  1102
              E  Q  +V ++L+YP H+SL+RFT      ++++E+ EW  +L  L+ +D  +  S + 
Sbjct  121   HEHPQVKVVADSLRYPIHRSLSRFTPTN---SLQIESTEWIRSLQELSKIDTEMVSSLHL  177

Query  1101  EEFRQILRWWKSLGL-KD-ELAKNQQLKWYIWTLALIPDPSMSRERIELTKPIALVYLID  928
             +E   + +WWK LGL KD +LA+++ +KWY+W +A +PDP  S ERIELTKP++LVY+ID
Sbjct  178   KEMFAVSKWWKELGLAKDLKLARDEPIKWYMWAMACLPDPRFSEERIELTKPLSLVYIID  237

Query  927   DIIDVYATFDQTKQFIDAINRWDLSVGEGLPDYMKRCLVVLFDTTNDINNLVFEKYGWNP  748
             DI D     D+   F +A+ RWD++  E LPDYMK C   L+D TN+    +  K+GWNP
Sbjct  238   DIFDFCGNIDELTLFTEAVKRWDMAATEQLPDYMKGCFKALYDITNEFAFKIQIKHGWNP  297

Query  747   IDHLKRAWKCLCSAYITEAKWFATGKSPSANEYLQTGIITTGIPMVLITCFFLLGHGAFA  568
             I  L ++W  L +A++ EAKWFA+G  P A++YL+ GI++TG  M+L+  FF +G     
Sbjct  298   ISTLIKSWVRLLNAFLEEAKWFASGLVPKADDYLKNGIVSTGAHMILVHSFFFMGDAITQ  357

Query  567   GTTDIED----MITSVGAILRLLDDLDATQ--GEKQDGNDASYVEYYVKEHEGLSISDGK  406
              T  + D    +I++   ILRL DDL+  Q    K D ND SY++ Y+KEH   S+   +
Sbjct  358   ETITLMDEFPSIISATATILRLCDDLEGDQDVNVKGDDNDGSYIKCYMKEHPATSVEQAR  417

Query  405   QRIMNMVSEQWKLINKQCL--SPTRIPESFSKSCLNIARMVPMMYNYSDTHCLPILQKQI  232
             + +  ++S+ WK +N++CL       P SF+K CLN ARMVP+MY Y DT+    L++ +
Sbjct  418   EHVAELISDAWKRLNQECLMTDANLFPSSFTKLCLNAARMVPLMYGY-DTNSPSKLEEYV  476

Query  231   MSMFSTINGESI  196
              S+      +SI
Sbjct  477   KSLLCGGAMQSI  488



>ref|XP_011096134.1| PREDICTED: tricyclene synthase Oc15, chloroplastic-like isoform 
X1 [Sesamum indicum]
Length=525

 Score =   387 bits (994),  Expect = 9e-123, Method: Compositional matrix adjust.
 Identities = 203/463 (44%), Positives = 294/463 (63%), Gaps = 7/463 (2%)
 Frame = -2

Query  1722  KDEFLLKSEGKREWQRGLLYQFQEDDL-QVLNVIDAIQHLGIDHHFHDQIGAILQRQYQK  1546
             +++F  + E K E  R +L    EDD  + L ++DAIQ  G+  H+  +IG IL+++Y+ 
Sbjct  64    QEKFAKEYEQKIEEIRQVLQSKGEDDPSESLVLVDAIQRGGLSSHYEQEIGTILRKRYE-  122

Query  1545  VKIDDFQKINGLYDISLSFRLLRQEGYNVSSDVFTKFTSEKGEFKEELSKDIRGLMALHE  1366
                        L+D+SL FRLLR+ G  +S DVF  F  + G F+  L +DIRGLM L+E
Sbjct  123   ASCSCTYGYYCLHDVSLFFRLLREHGLYISPDVFNNFKGKDGRFRRNLRQDIRGLMELYE  182

Query  1365  ASHLSIEGEDVLDEAAKFSRESLIANMVHLDECQASMVQNTLQYPYHKSLARFTAKTFIE  1186
             A+ LS +GE +LDEAA FS   L   +  +D   + ++   L+YPYHK++A+ T K F++
Sbjct  183   AAQLSFQGELILDEAASFSSHLLRECLPEMDNDLSRIITGKLKYPYHKTIAKLTRKDFLQ  242

Query  1185  NMRVENEWEATLVNLATMDYSITQSFYQEEFRQILRWWKSLGLKDE--LAKNQQLKWYIW  1012
             ++   N W  TL  LA MD    QS YQ E  Q+ +WW  LGL  E  LA+NQ LKWY W
Sbjct  243   DLEGSNGWAKTLRELALMDLRKGQSVYQGELAQVSKWWNELGLAKEIKLARNQLLKWYTW  302

Query  1011  TLA-LIPDPSMSRERIELTKPIALVYLIDDIIDVYATFDQTKQFIDAINRWDLSVGEGLP  835
             +++ LI D S+S +R+ELTK IA VYLIDDI DV  T D+   F +A+N+W+ +  + LP
Sbjct  303   SMSILIDDFSLSLQRVELTKSIAFVYLIDDIFDVVGTLDELTIFTEAVNKWEYAAIDMLP  362

Query  834   DYMKRCLVVLFDTTNDINNLVFEKYGWNPIDHLKRAWKCLCSAYITEAKWFATGKSPSAN  655
             DYMK C   L DTTN I + +++++G++PID LK +W  LC+AY+ EAKWFA+G  P+A 
Sbjct  363   DYMKMCYRALLDTTNGIGHEIYKRHGYDPIDSLKTSWGSLCNAYLMEAKWFASGDLPTAA  422

Query  654   EYLQTGIITTGIPMVLITCFF--LLGHGAFAGTTDIEDMITSVGAILRLLDDLDATQGEK  481
             +YL+ G +TTG  +VL+  FF   LG+G   G TD+  + +SV  ILRL DDL + + E 
Sbjct  423   KYLENGKVTTGAYVVLVHLFFLSGLGNGGGIGLTDVSRLASSVATILRLWDDLGSAKDEH  482

Query  480   QDGNDASYVEYYVKEHEGLSISDGKQRIMNMVSEQWKLINKQC  352
             QDG D SY E Y  +H GLS++  +  +++ ++ +WK +NK+C
Sbjct  483   QDGRDGSYTECYRNDHRGLSMAQARDHVIDAITSEWKSLNKEC  525



>gb|KEH34552.1| (3S)-linalool/(E)-nerolidol/(E,E)-geranyl linalool synthase [Medicago 
truncatula]
Length=519

 Score =   385 bits (990),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 207/497 (42%), Positives = 311/497 (63%), Gaps = 16/497 (3%)
 Frame = -2

Query  1653  EDDLQVLNVIDAIQHLGIDHHFHDQIGAILQRQYQKVKID--DFQKINGLYDISLSFRLL  1480
             ED ++   +ID IQ  GI+H+F ++I   L++ +  +  +  DF   + LY+ SL+FRLL
Sbjct  23    EDSMESFYLIDIIQRFGIEHYFAEEIKVALEKLHLILNTNPIDFVNSHELYEFSLAFRLL  82

Query  1479  RQEGYNVSSDVFTKFTSEKGEFKEELSKDIRGLMALHEASHLSIEGEDVLDEAAKFSRES  1300
             RQ G+ V++D+F      K  F+E+  +D++GL+AL+EAS LSI+GED L++     RE 
Sbjct  83    RQGGHYVNADLFDSLKCNKRMFEEKHGEDLKGLIALYEASQLSIDGEDSLNDVGYLCRE-  141

Query  1299  LIANMVHLDE--CQASMVQNTLQYPYHKSLARFTAK-TFIENMRVENEWEATLVNLATMD  1129
             L+ N +  ++   +A  V NTLQ P H  L+RF  K TFI +++ E +    L  LA ++
Sbjct  142   LLHNWLSRNQEHNEAIHVVNTLQNPLHYGLSRFMDKSTFIHDLKAEKDL-ICLEELAKIN  200

Query  1128  YSITQSFYQEEFRQILRWWKSLGLKDEL--AKNQQLKWYIWTLALIPDPSMSRERIELTK  955
              +I +   Q E  ++ +WWK LGL  E+  ++ Q LKWY W +A   DP+ S +RIELTK
Sbjct  201   STIVRFRNQNETIEVSKWWKELGLAKEVKFSEYQPLKWYTWPMACFTDPNFSEQRIELTK  260

Query  954   PIALVYLIDDIIDVYATFDQTKQFIDAINRWDLSVGEGLPDYMKRCLVVLFDTTNDINNL  775
             PI+L+Y+IDDI DV+AT DQ   F DA+NRW+ +  E LP++MK  L  L+D TN    +
Sbjct  261   PISLIYVIDDIFDVHATLDQLTIFTDAVNRWEFTGTEQLPNFMKIALNALYDITNSFAEM  320

Query  774   VFEKYGWNPIDHLKRAWKCLCSAYITEAKWFATGKSPSANEYLQTGIITTGIPMVLITCF  595
             V++K+G+NPID LK++W  L +A++ EA W  +G  P A +YL  GI++TG+ +VLI  F
Sbjct  321   VYKKHGFNPIDTLKKSWILLLNAFMEEAHWLNSGHLPRAEDYLNNGIVSTGVHVVLIHAF  380

Query  594   FLLGH--GAFAGTTDIED-----MITSVGAILRLLDDLDATQGEKQDGNDASYVEYYVKE  436
             FLL H  G    T DI D     +I SV  ILRL DDL+  +  +Q+G D SY++ Y+ E
Sbjct  381   FLLDHVNGITKKTIDILDEKFPNVIYSVAKILRLSDDLEGAKSGEQNGLDGSYLDCYMSE  440

Query  435   HEGLSISDGKQRIMNMVSEQWKLINKQCLSPTRIPESFSKSCLNIARMVPMMYNYSDTHC  256
             H+ +S  D ++ + +M+S +WK +N++ L   +   SFS  CLN ARMVP+MY+Y     
Sbjct  441   HQDISGEDVQRHVAHMISNEWKCLNQEILVANQFSSSFSNFCLNAARMVPLMYHYKSNPS  500

Query  255   LPILQKQIMSMFSTING  205
             L  LQ+ + S+ +   G
Sbjct  501   LSNLQEHVKSLINVSVG  517



>ref|XP_010533841.1| PREDICTED: S-(+)-linalool synthase, chloroplastic-like [Tarenaya 
hassleriana]
Length=584

 Score =   387 bits (994),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 198/498 (40%), Positives = 312/498 (63%), Gaps = 12/498 (2%)
 Frame = -2

Query  1677  RGLLYQFQEDDLQVLNVIDAIQHLGIDHHFHDQIGAILQRQYQKVKIDDFQKINGLYDIS  1498
             R  L +  E  L+ L ++DAIQ L I+HH   +I   L++ + +    ++     L ++S
Sbjct  82    RSTLSEKGEPTLETLEMVDAIQRLSIEHHVFIEIKETLRKLHMQRHRYNYHG-RDLREVS  140

Query  1497  LSFRLLRQEGYNVSSD-VFTKFTSEKGEFKEELSKDIRGLMALHEASHLSIEGEDVLDEA  1321
             L FRLLRQEGY+VS++ +F  F  +   FK EL  DI+GL+ L EAS LSIEGED+L+ A
Sbjct  141   LCFRLLRQEGYHVSAESLFGDFQDKDRGFKGELENDIKGLLELFEASQLSIEGEDILENA  200

Query  1320  AKFSRESLIANMVHLDECQASMVQNTLQYPYHKSLARFTAKTFIENMRVEN---EWEATL  1150
              +F+  +L+   +  +  Q  ++ + L  PYHK+L+R TAK FIE + V +   EW  +L
Sbjct  201   REFAGNNLVRLSLIRESYQGRVITDVLHKPYHKTLSRITAKRFIEVIDVVHGGKEWLQSL  260

Query  1149  VNLATMDYSITQSFYQEEFRQILRWWKSLGLKDEL--AKNQQLKWYIWTLALIPDPSMSR  976
             + +A +D S+ ++ +QEE   IL+WW+ LGL  E+  A++Q LKW+ WT+A+  DP +S+
Sbjct  261   LQVAEIDQSLLKTLHQEEASIILKWWRELGLTGEVRKARDQPLKWHAWTVAVNQDPGLSQ  320

Query  975   ERIELTKPIALVYLIDDIIDVYATFDQTKQFIDAINRWDLSVGEGLPDYMKRCLVVLFDT  796
              R+ + K I LVY++DDI DVY   D+   F   + RW+    E LP++MK     L   
Sbjct  321   LRVAMAKVIPLVYILDDIFDVYGGIDELTIFTQVVERWNYGDLEKLPNHMKVFFKTLDMI  380

Query  795   TNDINNLVFEKYGWNPIDHLKRAWKCLCSAYITEAKWFATGKSPSANEYLQTGIITTGIP  616
             T +I++ +++++GWNPI  L+++W  LC A++ EA+WF +G  P+  EYL+ GI+++G+ 
Sbjct  381   TMEISHKIYKEHGWNPIKSLQKSWARLCEAFLVEARWFESGYLPNKEEYLENGIVSSGVH  440

Query  615   MVLITCFFLLGHGAFAGTTDIED----MITSVGAILRLLDDLDATQGEKQDGNDASYVEY  448
             +V++  F+LLG        ++ +    +++SV  ILRL DDL + + EKQDG D SYV  
Sbjct  441   LVMLHFFYLLGEEITDEKAELMENNPKIVSSVATILRLHDDLGSAKDEKQDGFDGSYVRC  500

Query  447   YVKEHEGLSISDGKQRIMNMVSEQWKLINKQCLSPTRIP-ESFSKSCLNIARMVPMMYNY  271
             YV +H+G ++ + +   + M+SE WK +N++CL+P      SF+K+CLN+AR VP+MY Y
Sbjct  501   YVNQHQGSTVEEARTHSLQMISEAWKRLNEECLNPNPFSGSSFAKACLNVARTVPLMYTY  560

Query  270   SDTHCLPILQKQIMSMFS  217
                H LP L   + S+ S
Sbjct  561   DGDHRLPGLDDYLKSLVS  578



>ref|XP_004166431.1| PREDICTED: (3S,6E)-nerolidol synthase 1-like [Cucumis sativus]
Length=831

 Score =   394 bits (1012),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 206/484 (43%), Positives = 299/484 (62%), Gaps = 18/484 (4%)
 Frame = -2

Query  1650  DDLQVLNVIDAIQHLGIDHHFHDQIGAILQRQYQKVKIDDFQKINGLYDISLSFRLLRQE  1471
             D  + LN+IDA Q LGID+HF ++I A+LQRQY       +     L+  +L FRL RQ+
Sbjct  344   DPWECLNLIDATQRLGIDYHFQEEIEAVLQRQYVLFNAIQYNPDTDLHKAALLFRLFRQQ  403

Query  1470  GYNVSSDVFTKFTSEKGEFKEELSKDIRGLMALHEASHLSIEGEDV-LDEAAKFSRESLI  1294
             GY VS+DVF  F  +KG+FKEEL +D++GL +L+EAS L I+G+++ L+EA  FSR  L 
Sbjct  404   GYLVSADVFKSFMDKKGKFKEELREDVKGLSSLYEASQLCIDGDEIILEEAEVFSRHWLN  463

Query  1293  ANMVHLDECQASMVQNTLQYPYHKSLARF-TAKTFIENMRVENEWEATLVNLATMDYSIT  1117
             A     +   A+ V NT+ YP+HKS+ +F T   F ++M+  N+W     + A M+   +
Sbjct  464   ARS---EADLANFVHNTIAYPHHKSVVQFMTLNYFEDHMQCPNKWIHIFQDAAKMELHSS  520

Query  1116  QSFYQEEFRQILRWWK--SLGLKDELAKNQQLKWYIWTLALIPDPSMSRERIELTKPIAL  943
             Q   Q E  Q ++WWK   LG     A++Q +KWY+ +L  + D   S +RI+L K I  
Sbjct  521   QRLRQNEVAQFMKWWKDTELGKGLSFARDQPIKWYVASLVCLTDSFYSEQRIQLAKSITF  580

Query  942   VYLIDDIIDVYATFDQTKQFIDAINRWDLSVGEGLPDYMKRCLVVLFDTTNDINNLVFEK  763
             +YLIDD+ DV+ T ++   F +A+ RWDL+  EGLPD MK CL  LF+ TN+I   +++K
Sbjct  581   IYLIDDLFDVFGTLNELTLFTEAVYRWDLAAAEGLPDSMKICLRCLFEVTNEICYHIYQK  640

Query  762   YGWNPIDHLKRAWKCLCSAYITEAKWFATGKSPSANEYLQTGIITTGIPMVLITCFFLLG  583
             +GWNPI  L + W  LC A++ EA+W + G SPSA +YL+ GI+TTGIP+ L+  F LLG
Sbjct  641   HGWNPIHFLHKEWAKLCKAFLVEAEWLSCGHSPSAEDYLKNGIVTTGIPLTLLHAFLLLG  700

Query  582   HGAFAGTT----DIEDMITSVGAILRLLDDLDATQGEKQDGNDASYVEYYVKEHEGLSIS  415
                   T     D  D+++S   +LRL DDL   + EKQ+G D SY+EYY+KE+  +S  
Sbjct  701   QQITDETVQLFDDDLDIVSSTATVLRLWDDLGTAKDEKQEGRDGSYLEYYMKENPSISYE  760

Query  414   DGKQRIMNMVSEQWKLINKQCLSPTRIPESFSKSCLNIARMVPMMYNYSDTHCLPILQKQ  235
             + +Q  M  +S  WK +N++ L   + P  F+++CLN+AR VP+ YNY          K 
Sbjct  761   ETQQHTMKRISNAWKTLNRESLLSNQFPSKFNQACLNVARAVPLAYNYDRN-------KS  813

Query  234   IMSM  223
             I+SM
Sbjct  814   ILSM  817



>ref|XP_010533843.1| PREDICTED: S-(+)-linalool synthase, chloroplastic-like [Tarenaya 
hassleriana]
Length=533

 Score =   385 bits (988),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 195/500 (39%), Positives = 298/500 (60%), Gaps = 15/500 (3%)
 Frame = -2

Query  1677  RGLLYQFQEDDLQVLNVIDAIQHLGIDHHFHDQIGAILQRQYQKVKIDDFQKINGLYDIS  1498
             R +L    ED  + + +IDAIQ L IDHHF  ++  ILQ+ YQ+     +   +GL +++
Sbjct  31    RNMLTAKGEDPFEAMEIIDAIQRLCIDHHFRYEMEEILQKLYQQCSRYQYYG-HGLREVA  89

Query  1497  LSFRLLRQEGYNVSSD-VFTKFTSEKGEFKEELSKDIRGLMALHEASHLSIEGEDVLDEA  1321
             L FRLLRQ G++VS++  F+    E G F+ E   D+ GL+ L EAS LS EGE  L++ 
Sbjct  90    LCFRLLRQAGHHVSAENAFSGIRDENGRFRGEFQYDVEGLIELFEASQLSTEGEKTLEDG  149

Query  1320  AKFSRESLIANMVHLDECQASMVQNTLQYPYHKSLARFTAKTFIENMR--VENEWEATLV  1147
               F+   L       +  +  ++ N L  P HKSL+R T   FI       EN+W   L+
Sbjct  150   RDFAVNQLTKLCSAEESHRGRVIMNVLNQPSHKSLSRLTVNRFISMTSDDGENKWLQPLL  209

Query  1146  NLATMDYSITQSFYQEEFRQILRWWKSLGLKDEL--AKNQQLKWYIWTLALIPDPSMSRE  973
              +A +D+ + ++ +Q+E  + L+WW+ L L  EL  A++Q LKWY W++A++ DP +S  
Sbjct  210   QVAKIDFDMLKALHQDEISKTLKWWRELSLTKELKKARDQPLKWYTWSMAVLQDPGLSEI  269

Query  972   RIELTKPIALVYLIDDIIDVYATFDQTKQFIDAINRWDL---SVGEGLPDYMKRCLVVLF  802
             R++L KPI+ VY+IDDI D+Y   D+   F   + RWD    ++ E LP+YMK CL  L 
Sbjct  270   RLDLVKPISFVYIIDDIFDIYGGIDELTIFTQVMERWDRDEDNLVEKLPNYMKVCLEALD  329

Query  801   DTTNDINNLVFEKYGWNPIDHLKRAWKCLCSAYITEAKWFATGKSPSANEYLQTGIITTG  622
               T +I+  V +K+GWNPI+ L+++W  L  A++ EAKWF +G  PS  EY++ G +++G
Sbjct  330   VVTMEISLKVHKKHGWNPINSLRKSWARLFKAFLVEAKWFESGYLPSKEEYIENGRVSSG  389

Query  621   IPMVLITCFFLLGHGAFAGTTDIED-----MITSVGAILRLLDDLDATQGEKQDGNDASY  457
             +P+VL+  FF+LG         + D     +++S   ILRL DD  + + E QD  D SY
Sbjct  390   VPLVLLHLFFMLGEETTKEKVQLTDESNPLIVSSAATILRLCDDFGSAKDENQDEYDGSY  449

Query  456   VEYYVKEHEGLSISDGKQRIMNMVSEQWKLINKQCLSPTRIP-ESFSKSCLNIARMVPMM  280
             +E Y+K+H+G +I + +   + M+S  WK +N++CL P      SF+K+CLN+AR VP+M
Sbjct  450   MECYMKQHQGSTIEEARAHSLQMISNAWKRLNEECLDPNPFSGSSFAKACLNVARTVPLM  509

Query  279   YNYSDTHCLPILQKQIMSMF  220
             Y Y D H LP L   + S+ 
Sbjct  510   YTYDDDHRLPGLDDYLKSLM  529



>ref|XP_004309674.1| PREDICTED: (3S,6E)-nerolidol synthase 1-like [Fragaria vesca 
subsp. vesca]
Length=533

 Score =   385 bits (988),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 187/421 (44%), Positives = 277/421 (66%), Gaps = 10/421 (2%)
 Frame = -2

Query  1452  DVFTKFTSEKGEFKEELS----KDIRGLMALHEASHLSIEGEDVLDEAAKFSRESLIANM  1285
             D FT   S   ++ + LS    +DI+GLM+L+EAS L  EGED L EA KFS   L  ++
Sbjct  6     DPFTSHGSSALDYGKVLSNILGEDIKGLMSLYEASQLGTEGEDTLVEAEKFSGHLLKTSL  65

Query  1284  VHLDECQASMVQNTLQYPYHKSLARFTAKTFIENMRVENEWEATLVNLATMDYSITQSFY  1105
              HLD  +A +V NTL+ P+HKSLA F A+ F    +  N W   L  +A  D+++ +S +
Sbjct  66    SHLDHHRARIVGNTLRNPHHKSLASFMARNFFVTSQATNSWLNLLKEVAKTDFNMVRSLH  125

Query  1104  QEEFRQILRWWKSLGLKDEL--AKNQQLKWYIWTLALIPDPSMSRERIELTKPIALVYLI  931
             Q E  QI +WWK LGL  EL  A++Q LKWYI ++A + DP +S ER+ELTK I+ V LI
Sbjct  126   QNEIVQISKWWKELGLAKELKLARDQPLKWYILSMACLTDPKLSEERVELTKLISFVCLI  185

Query  930   DDIIDVYATFDQTKQFIDAINRWDLSVGEGLPDYMKRCLVVLFDTTNDINNLVFEKYGWN  751
             DDI DVY T D+   F +A+NRW+++  + LPD MK C   L+D TN+I+  V+ K+GWN
Sbjct  186   DDIFDVYGTLDELILFTEAVNRWEITAIDHLPDNMKICFRALYDITNEISCKVYLKHGWN  245

Query  750   PIDHLKRAWKCLCSAYITEAKWFATGKSPSANEYLQTGIITTGIPMVLITCFFLLGHGAF  571
             P+  LK +W  LC+A++ EAKWFA+G+ P + EYL+ GI+++G+ + L+  FFLLG    
Sbjct  246   PLQSLKISWASLCNAFLVEAKWFASGQLPKSEEYLKNGIVSSGVNVGLVHMFFLLGQNIT  305

Query  570   AGTTDIED----MITSVGAILRLLDDLDATQGEKQDGNDASYVEYYVKEHEGLSISDGKQ  403
               + ++ +    +I+S  AILRL +DL + + E QDGND SYV  Y++EHEG SI + ++
Sbjct  306   RKSVELLNETPAIISSSAAILRLWNDLGSAKDENQDGNDGSYVRCYLEEHEGCSIEEARE  365

Query  402   RIMNMVSEQWKLINKQCLSPTRIPESFSKSCLNIARMVPMMYNYSDTHCLPILQKQIMSM  223
             + +NM+S++WK +N++ LSP   P +F+ + LN+AR++P+MY+Y     LP L++ +  M
Sbjct  366   KTINMISDEWKKLNRELLSPNPFPATFTLASLNLARIIPLMYSYDGNQSLPSLKEYMKLM  425

Query  222   F  220
              
Sbjct  426   L  426



>ref|XP_003600104.1| Linalool synthase [Medicago truncatula]
Length=524

 Score =   384 bits (987),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 205/502 (41%), Positives = 306/502 (61%), Gaps = 23/502 (5%)
 Frame = -2

Query  1653  EDDLQVLNVIDAIQHLGIDHHFHDQIGAILQRQYQKVKID--DFQKINGLYDISLSFRLL  1480
             ED  +  ++ID IQ LGI+H+F ++I   L++Q+  +  +  DF   + LY+++L+FRLL
Sbjct  23    EDPTENFHLIDIIQRLGIEHYFVEEIKVALEKQFLILSSNPIDFVSSHELYEVALAFRLL  82

Query  1479  RQEGYNVSSDVFTKFTSEKGEFKEELSKDIRGLMALHEASHLSIEGEDVLDEAAKFSRES  1300
             RQ GY V++++F      K   + +  +D++GL+AL+EAS LSIEGED L++    S E 
Sbjct  83    RQGGYYVNAELFDCLKCSKKSLRVKYGEDVKGLIALYEASQLSIEGEDGLNDLGYLSCEL  142

Query  1299  LIANMV-HLDECQASMVQNTLQYPYHKSLARFTAKT-FIENMRVENEWEATLVNLATMDY  1126
             L A +  H D  QA  V NTLQYP H  L+RF  K+ FI +++ +N+W   L  LA M+ 
Sbjct  143   LQAWLPRHQDHIQAIYVSNTLQYPIHYGLSRFMDKSIFINDLKAKNKW-ICLDELAKMNS  201

Query  1125  SITQSFYQEEFRQILR---------WWKSLGLKDEL--AKNQQLKWYIWTLALIPDPSMS  979
             SI +   + E  ++ +         WW+ LGL  E+  A    LKWY+W +A   DP  S
Sbjct  202   SIVKFMNKNESVEVFKYDIHFFLHLWWEDLGLAKEMKFAGYNPLKWYMWPMACFTDPCFS  261

Query  978   RERIELTKPIALVYLIDDIIDVYATFDQTKQFIDAINRWDLSVGEGLPDYMKRCLVVLFD  799
              ER+ELTKPI+LVY+IDDI DV+ T DQ   F +A+NRW++   E LP++MK  L  L+ 
Sbjct  262   NERVELTKPISLVYIIDDIFDVHGTLDQLTLFTEAVNRWEMDGAENLPNFMKVSLSSLYK  321

Query  798   TTNDINNLVFEKYGWNPIDHLKRAWKCLCSAYITEAKWFATGKSPSANEYLQTGIITTGI  619
              TN+   +V++K+G+NPID LK +W  L +A++ EA W  +G  P+  EYL  GI++TG+
Sbjct  322   VTNNFAEMVYKKHGFNPIDTLKISWVRLLNAFLKEAHWLNSGILPTTEEYLNNGIVSTGV  381

Query  618   PMVLITCFFLLGH--GAFAGTTDIED-----MITSVGAILRLLDDLDATQGEKQDGNDAS  460
              +VLI  FFL+ H  G    T  I D     +I SV  ILRL DDL+  +   Q+G D S
Sbjct  382   HVVLIHAFFLMDHAKGITKETLSILDEEFPNIIYSVAKILRLSDDLEGVKSGDQNGLDGS  441

Query  459   YVEYYVKEHEGLSISDGKQRIMNMVSEQWKLINKQCLSPTRIPESFSKSCLNIARMVPMM  280
             Y+  Y+ EH+ +S  D ++ +  M+  +WK +N++ L+P   P SF+  CLN ARMVP+M
Sbjct  442   YLNCYMSEHQDISCEDVQRHVAEMILNEWKCLNQEILNPYVFPSSFTNFCLNAARMVPLM  501

Query  279   YNYSDTHCLPILQKQIMSMFST  214
             Y+Y     L  L++ + S+  +
Sbjct  502   YHYKSNPSLSSLKEHVKSLIKS  523



>gb|KDP42343.1| hypothetical protein JCGZ_02816 [Jatropha curcas]
Length=569

 Score =   385 bits (989),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 200/537 (37%), Positives = 327/537 (61%), Gaps = 20/537 (4%)
 Frame = -2

Query  1794  PVVFRCQSVNSSSLRSEKMTVTLSKDEFLLKSEGKREWQRGLLYQFQEDD----LQVLNV  1627
             P+    Q+  S  L +E +   +    F   +E K  +++ L    +EDD    L+ L +
Sbjct  35    PIPSSAQAARSRVLENEILD-NICNRRFKKLTEAKNAFRKVL----EEDDDHLSLESLEM  89

Query  1626  IDAIQHLGIDHHFHDQIGAILQRQYQKVKIDDFQKINGLYDISLSFRLLRQEGYNVSSDV  1447
             ID++Q LGI++HF D+I  +L+  Y+K       + + L  +++ FRLLRQ+GY V +DV
Sbjct  90    IDSVQRLGIEYHFQDEINEVLENHYKKTSSGYTHQKHDLSQVAIRFRLLRQQGYCVPADV  149

Query  1446  FTKFTSEKGEFKEELSKDIRGLMALHEASHLSIEGEDVLDEAAKFSRESLIANMVHLDEC  1267
             F KF +++G+FK+EL+ DI+GLM L+EAS LS+EGED+LDEA  FS   L A+ +HLD+ 
Sbjct  150   FKKFKNKEGKFKQELACDIKGLMELYEASQLSVEGEDILDEARVFSGPLLSASTLHLDDY  209

Query  1266  QASMVQNTLQYPYHKSLARFTAKTFIENMRV-ENEWEATLVNLATMDYSITQSFYQEEFR  1090
             QA +V NTL+ P+HK+LAR      I+N+++  N+ E   + LA +D+++ QSF+++E  
Sbjct  210   QAGIVLNTLKNPFHKNLAR---SMVIKNLKLGSNKSEDVFMELAKLDFNMFQSFHRDEIV  266

Query  1089  QILRWWKS-LGLKDEL--AKNQQLKWYIWTLALIPDPSMSRERIELTKPIALVYLIDDII  919
              I +WW++  G   E+   + + L+W  W LA + DP++S +R+EL K ++L +LI D+ 
Sbjct  267   HISKWWRNKFGFAAEMKFGREEPLEWLSWPLATLADPNLSAQRVELAKVVSLFHLIQDVF  326

Query  918   DVYATFDQTKQFIDAINRWDLSVGEGLPDYMKRCLVVLFDTTNDINNLVFEKYGWNPIDH  739
               Y + DQ   F+ A+NRWD++  + LP+YM  CL  L++ T++I + ++ + G+NP   
Sbjct  327   YFYGSIDQLTLFVQAVNRWDIAAAKDLPEYMIMCLRALYEITDEIAHKIYTECGYNPKRS  386

Query  738   LKRAWKCLCSAYITEAKWFATGKSPSANEYLQTGIITTGIPMVLITCFFLLGHGAFAGTT  559
             L+ AW  LC+A++  AKW A G+ P A  YL+    T+ + +VL+  FFLLG      T 
Sbjct  387   LQNAWIKLCNAFLGTAKWAAVGQLPKAEYYLKIANDTSAVNVVLVHIFFLLGEALTMKTI  446

Query  558   DIED----MITSVGAILRLLDDLDATQGEKQDGNDASYVEYYVKEHEGLSISDGKQRIMN  391
             ++ D    +I+S  +I  L      T+ E ++G   SY++ Y++++   S+ + K   + 
Sbjct  447   NLVDNDPGIISSAASIFCLSGGPKITKDEDRNGGSGSYMKCYMRQYPFSSVQEAKMHTVE  506

Query  390   MVSEQWKLINKQCLSPTRIPESFSKSCLNIARMVPMMYNYSDTHCLPILQKQIMSMF  220
             M+S +WK +NKQCLSP      F+K+ LN AR+ P+M  + +   LP LQK + S+ 
Sbjct  507   MISNKWKQLNKQCLSPNPFSPCFNKAALNCARLAPLMCGFDNNENLPSLQKHMKSLL  563



>ref|XP_011096219.1| PREDICTED: tricyclene synthase Oc15, chloroplastic-like [Sesamum 
indicum]
Length=572

 Score =   383 bits (984),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 212/559 (38%), Positives = 329/559 (59%), Gaps = 21/559 (4%)
 Frame = -2

Query  1854  SHASIPCFSIGTA---LHCRRRTPVVFRCQSVNSS----SLRSEKMTVTLSKDEFLLKSE  1696
             SH  +PC S+ T        +R P V    +  +     ++ +      L  D+  ++ E
Sbjct  8     SHLFLPC-SLKTRPGLAKIGKREPAVGVVSAYGAGKQKWNINTASEASRLHPDKLEIEYE  66

Query  1695  GKREWQRGLLYQFQEDDL-QVLNVIDAIQHLGIDHHFHDQIGAILQRQYQKVKIDDFQKI  1519
              K E  R +L    ED+  + L ++DAIQ +G+  ++ ++I  +L++ Y         K 
Sbjct  67    QKIEEIRHVLQTKGEDESSESLVLVDAIQRVGLSSYYEEEIQTLLRKLYV-TSCASIYKY  125

Query  1518  NGLYDISLSFRLLRQEGYNVSSDVFTKFTSEKGEFKEELSKDIRGLMALHEASHLSIEGE  1339
               L D+SL FRLLRQ GY +S DVF  F  ++G F+  LS+DIRGLM L+E + L+ +GE
Sbjct  126   YSLRDVSLLFRLLRQHGYYISPDVFNNFKGKEGRFRRNLSQDIRGLMELYEVAQLNFQGE  185

Query  1338  DVLDEAAKFSRESLIAN-MVHLDECQASMVQNTLQYPYHKSLARFTAKTFIENMRVENEW  1162
              +LDEAA FS + L    + ++D+  + MV   L+YPYHK++ R T K F+++    N W
Sbjct  186   CILDEAASFSSQLLHEYCLANVDDNLSRMVIRRLRYPYHKTIPRLTRKDFLQDFDGINGW  245

Query  1161  EATLVNLATMDYSITQSFYQEEFRQILRWWKSLGL--KDELAKNQQLKWYIWTLA-LIPD  991
               TL  LA MD    QS YQ E  Q+  WW  LGL  K +L +NQ  KWY W+++ LI D
Sbjct  246   GKTLNELALMDLRKGQSVYQGELAQVSDWWNELGLAQKLKLVRNQPPKWYTWSMSILIDD  305

Query  990   PSMSRERIELTKPIALVYLIDDIIDVYATFDQTKQFIDAINRWDLSVGEGLPDYMKRCLV  811
              S+S +R+ LTK +  +YLIDDI DV    D+   F +AIN+WD +  + LPDYMK C  
Sbjct  306   FSLSLQRMSLTKSVTFIYLIDDIFDVVGKLDELTIFTEAINKWDYAAVDMLPDYMKMCYR  365

Query  810   VLFDTTNDINNLVFEKYGWNPIDHLKRAWKCLCSAYITEAKWFATGKSPSANEYLQTGII  631
              L DTTNDI++ +++++G NPI+ LK +W  LC+AY+ EAKWFA+G SP+A+ +L+ G +
Sbjct  366   ALLDTTNDISHEIYKRHGHNPINSLKTSWASLCNAYLLEAKWFASGVSPTADMHLENGKV  425

Query  630   TTGI----PMVLITCFFLLGHGAFAGTTDIEDMITSVGAILRLLDDLDATQGEKQDGNDA  463
             +TG+     ++         +G      DI  +++ V  I RL +DL       + G D 
Sbjct  426   STGVYVVLVLLFFLLGLGRTNGGTINLPDISQLLSCVATIFRLWNDLGGANDGNEYGTDG  485

Query  462   SYVEYYVKEHEGLSISDGKQRIMNMVSEQWKLINKQ--CLSPTRIPESFSKSCLNIARMV  289
             SY++ Y+K+H G+S++  ++R +++++ QWK +NK+  CL+      SF ++ LN+AR+V
Sbjct  486   SYIDLYMKDHPGVSVAQARERAVDIIASQWKSLNKESFCLNDFS-ASSFKRASLNLARIV  544

Query  288   PMMYNYSDTHCLPILQKQI  232
             P+MY+Y D   LP+L + +
Sbjct  545   PLMYDYDDEQQLPVLDEYV  563



>ref|XP_007159220.1| hypothetical protein PHAVU_002G219300g [Phaseolus vulgaris]
 gb|ESW31214.1| hypothetical protein PHAVU_002G219300g [Phaseolus vulgaris]
Length=568

 Score =   382 bits (981),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 199/485 (41%), Positives = 312/485 (64%), Gaps = 18/485 (4%)
 Frame = -2

Query  1686  EWQRGLLYQFQEDDLQVLNVIDAIQHLGIDHHFHDQIGAILQRQYQKVKID-----DFQK  1522
             E ++GLL   ++     L ++D+IQ LGI+HHF ++I AIL+R+   ++++     D+Q+
Sbjct  60    EVKQGLLGNARKSADHGLFMVDSIQRLGIEHHFEEEIEAILKRKQLMLRVNSHKGNDYQE  119

Query  1521  INGLYDISLSFRLLRQEGYNVSSDVFTKFTSEKGEFKEELSKDIRGLMALHEASHLSIEG  1342
             ++   +++L FRLLRQEGY + +D+F KF   KG+ K    +DI GL+AL EAS LSIEG
Sbjct  120   LS---EVALQFRLLRQEGYYIHADIFDKFLDNKGKLKFTFCEDINGLVALFEASQLSIEG  176

Query  1341  EDVLDEAAKFSRESLIANMVHL-DECQASMVQNTLQYPYHKSLARFTAKTFIENMRVENE  1165
             ED L EA + SR+ L   +    D  Q  +V ++L+YP+HKSL RF +   +++ + E  
Sbjct  177   EDNLHEAEESSRQYLNMWLSRFHDHPQVKVVADSLRYPFHKSLPRFISINSLQSQKTE--  234

Query  1164  WEATLVNLATMDYSITQSFYQEEFRQILRWWKSLGLKDEL--AKNQQLKWYIWTLALIPD  991
             W ++L  L+ +D  +  S + +E   + +WWK LGL + L  A+++ +KWY+W +  +PD
Sbjct  235   WTSSLKELSRIDADMISSLHLKEIFAVSKWWKELGLANGLTFARDEPIKWYMWPMECLPD  294

Query  990   PSMSRERIELTKPIALVYLIDDIIDVYATFDQTKQFIDAINRWDLSVGEGLPDYMKRCLV  811
             P +S  RIE+TKPI+LVY++DDI D  A  D+   F +A+ RWD++  E LP+YMK   +
Sbjct  295   PRLSEARIEITKPISLVYILDDIFDFCANIDELILFTEAVKRWDMAAMEQLPEYMKGSFL  354

Query  810   VLFDTTNDINNLVFEKYGWNPIDHLKRAWKCLCSAYITEAKWFATGKSPSANEYLQTGII  631
              L+  TN+    V  K+GWNPI  L ++W  L +A++ EA+WF +G  P A EYL+ GI+
Sbjct  355   ALYSITNEFAFKVNIKHGWNPISTLVKSWVGLLNAFLEEARWFGSGYVPKAEEYLKNGIV  414

Query  630   TTGIPMVLITCFFLLGHGAFAGTTDIED----MITSVGAILRLLDDLDATQGEKQDGNDA  463
             +TG+ ++L+  FFL+G G    T  + D    +I++   ILRL DDL+  Q    DGND 
Sbjct  415   STGVHLILVHSFFLIGEGITEETVTLLDELPTLISTTATILRLCDDLEGDQDVNGDGNDG  474

Query  462   SYVEYYVKEHEGLSISDGKQRIMNMVSEQWKLINKQCLSPTR-IPESFSKSCLNIARMVP  286
             SY++ Y++EH  +SI + ++ +  ++S+ WK +N++CL+     P SF+K CLN ARMVP
Sbjct  475   SYLKCYMREHPEVSIEEAREHVSELISKAWKNLNQECLTDANPFPSSFTKVCLNAARMVP  534

Query  285   MMYNY  271
             +MY+Y
Sbjct  535   LMYSY  539



>ref|XP_010547053.1| PREDICTED: S-(+)-linalool synthase, chloroplastic-like [Tarenaya 
hassleriana]
Length=570

 Score =   382 bits (981),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 193/479 (40%), Positives = 292/479 (61%), Gaps = 9/479 (2%)
 Frame = -2

Query  1653  EDDLQVLNVIDAIQHLGIDHHFHDQIGAILQRQYQKVKIDDFQKINGLYDISLSFRLLRQ  1474
             E+  + L +IDAIQ LGIDHHF  +I  IL   Y++         + L +++L FRLLRQ
Sbjct  87    ENRFESLEMIDAIQRLGIDHHFRCEIEEILGTLYKQGGRYGCYGHHDLREVALCFRLLRQ  146

Query  1473  EGYNVSSDVFTKFTSEKGEFKEELSKDIRGLMALHEASHLSIEGEDVLDEAAKFSRESLI  1294
               ++V    F     + G FK+EL  DI+GL+ L EAS LSIEGE++LD A +F+   L 
Sbjct  147   GAHHVPQSTFDVIRDKDGGFKDELQNDIKGLLELFEASQLSIEGEEMLDNAREFAVNRLK  206

Query  1293  ANMVHLDECQASMVQNTLQYPYHKSLARFTAKTFIE--NMRVENEWEATLVNLATMDYSI  1120
                +  +  Q  ++ + L  P HK+L+R T K FI   N+  E EW  +L ++A +D+  
Sbjct  207   ELCLTTETGQRQVILDILDRPLHKTLSRLTNKRFISMSNIGGEKEWWQSLQSVAEIDFKT  266

Query  1119  TQSFYQEEFRQILRWWKSLGLKDEL--AKNQQLKWYIWTLALIPDPSMSRERIELTKPIA  946
              +S +QEE  Q  +WW+ LGL  +L  A++Q LKW  W++A++ D  +S +R++LTKPI+
Sbjct  267   LKSLHQEEISQTFKWWRDLGLAKKLRKARDQPLKWCTWSMAILQDRGLSDQRLDLTKPIS  326

Query  945   LVYLIDDIIDVYATFDQTKQFIDAINRWDLSVGEGLPDYMKRCLVVLFDTTNDINNLVFE  766
             L+Y+IDDI DVY   ++   F   + RWD    E L  +M+ C   L   T +I+  V++
Sbjct  327   LIYVIDDIFDVYGGLEELTSFTHVVERWDYEELENLLSHMRVCFEALDMVTVEISLKVYQ  386

Query  765   KYGWNPIDHLKRAWKCLCSAYITEAKWFATGKSPSANEYLQTGIITTGIPMVLITCFFLL  586
             KYGWNP+D L+++W  LC A++ EAKWF  G  PS  EYL+ G+ ++G+ +V++  FFLL
Sbjct  387   KYGWNPMDSLRKSWGRLCKAFLVEAKWFERGYLPSTEEYLENGMESSGVHLVMLHVFFLL  446

Query  585   GHGAFAGTTDI----EDMITSVGAILRLLDDLDATQGEKQDGNDASYVEYYVKEHEGLSI  418
             G        ++      +++S   ILRL DDL   + E QDG D SY+E Y+ +++G + 
Sbjct  447   GEEITKEKVELIESNPKIVSSTATILRLWDDLGTAKDENQDGFDGSYIECYMNQNKGSTT  506

Query  417   SDGKQRIMNMVSEQWKLINKQCLSPTRIPE-SFSKSCLNIARMVPMMYNYSDTHCLPIL  244
              + +  +  M+S+ WK +N++CL+P      SF+K+CLN+AR VPMMY+Y D H LP L
Sbjct  507   GEARTHVFQMISKAWKCLNEECLNPKPFSRSSFAKACLNLARTVPMMYSYDDHHRLPHL  565



>gb|AES63645.2| (3S)-linalool/(E)-nerolidol/(E,E)-geranyl linalool synthase [Medicago 
truncatula]
Length=520

 Score =   380 bits (976),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 208/523 (40%), Positives = 309/523 (59%), Gaps = 18/523 (3%)
 Frame = -2

Query  1740  MTVTLSKDEFLLKSEGKREWQRGLLYQFQEDDLQVLNVIDAIQHLGIDHHFHDQIGAILQ  1561
             M V   K   +LK E K+ +++  L    ED ++ L +ID IQ LGI+HHF ++I A LQ
Sbjct  1     MDVNYVKQALILK-EAKQAYKK--LLASDEDPMKSLCMIDIIQRLGIEHHFAEEIEAALQ  57

Query  1560  RQYQKVKID--DFQKINGLYDISLSFRLLRQEGYNVSSDVFTKFTSEKGEFKEELSKDIR  1387
              Q++    +  DF   + L++++L+FRLLRQ G+ V SD+F      K  F E+  +D++
Sbjct  58    NQHKMFSRNAIDFVHSHELHEVALTFRLLRQGGHYVKSDIFDSLMFNKRNFSEKFGEDVK  117

Query  1386  GLMALHEASHLSIEGEDVLDEAAKFSRESLIANMV-HLDECQASMVQNTLQYPYHKSLAR  1210
              L+A++EAS LSIEGED LD+    S E L   +  H +   A  V NTL+YP H  L+R
Sbjct  118   SLIAMYEASQLSIEGEDDLDDIGHLSSELLHGWLSSHQNHSDALYVTNTLRYPLHYGLSR  177

Query  1209  FTAKT-FIENMRVENEWEATLVNLATMDYSITQSFYQEEFRQILRWWKSLGLKDE--LAK  1039
                K+ F+  ++  NEW   L  LA ++ SI +   Q E  ++ +WWK L +  E   A 
Sbjct  178   LMEKSIFLSYLKATNEW-TCLEELAKINSSIVRFMNQNEIIEVSKWWKDLEMAKEPKFAH  236

Query  1038  NQQLKWYIWTLALIPDPSMSRERIELTKPIALVYLIDDIIDVYATFDQTKQFIDAINRWD  859
              Q LKWY+W +    DPS S +RIELTK I+LVY+IDDI DVY T DQ   F+D + RW 
Sbjct  237   YQPLKWYMWPMVCFTDPSFSDQRIELTKVISLVYVIDDIFDVYGTLDQLTLFVDLVTRWK  296

Query  858   LSVGEGLPDYMKRCLVVLFDTTNDINNLVFEKYGWNPIDHLKRAWKCLCSAYITEAKWFA  679
             L+  E LPD++K CL  ++  TND    V++K+G NPI  LK++W    ++ + +A W  
Sbjct  297   LADTEELPDFVKICLSFIYKITNDFAEKVYKKHGLNPIKTLKKSWIRYLNSALKDAHWLN  356

Query  678   TGKSPSANEYLQTGIITTGIPMVLITCFFLLGHGAFAGTTDI-------EDMITSVGAIL  520
             +G  P A+EYL  GI++ G+ +VL+  FFL  H     T  I        + + SV  IL
Sbjct  357   SGHLPKADEYLNNGIVSPGVHVVLVHAFFLFDHIQDVTTETIAILDDGCPNTMYSVAKIL  416

Query  519   RLLDDLDATQGEKQDGNDASYVEYYVKEHEGLSISDGKQRIMNMVSEQWKLINKQCLSPT  340
             RL DDL+  +   Q+G D SY++ Y+ EH+ +S  + ++ + NM+S +WK +N++ ++P 
Sbjct  417   RLSDDLEGAKSVDQNGLDGSYLDCYMNEHQEISAQEAQRHVANMISNEWKRLNQEIITPN  476

Query  339   RI-PESFSKSCLNIARMVPMMYNYSDTHCLPILQKQIMSMFST  214
              I   SF+K CLN+ARMVP+MY+Y     L  LQ  + S+ + 
Sbjct  477   PIFSSSFTKFCLNVARMVPLMYHYQSNPSLSNLQDLVKSLVNV  519



>ref|XP_004486251.1| PREDICTED: (3S,6E)-nerolidol synthase 1-like [Cicer arietinum]
Length=540

 Score =   380 bits (976),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 205/524 (39%), Positives = 312/524 (60%), Gaps = 25/524 (5%)
 Frame = -2

Query  1740  MTVTLSKDEFLLKSEGKREWQRGLLYQFQEDDLQVLNVIDAIQHLGIDHHFHDQIGAILQ  1561
             M V   K   +L+ E K+ +++   +   ED ++ L +ID IQ LGI+HHF ++I    +
Sbjct  26    MDVIYVKQALILE-EAKKVYKK---FACGEDPMESLYMIDIIQRLGIEHHFAEEI----E  77

Query  1560  RQY---QKVKIDDFQKINGLYDISLSFRLLRQEGYNVSSDVFTKFTSEKGEFKEELSKDI  1390
             +QY     +   +F K + LYD++L+FRLLRQ G+ V+ D+F      K   +E+   D+
Sbjct  78    KQYLILNNINPIEFVKSHELYDVALTFRLLRQGGHYVNPDLFDSLMCNKRNLREKYGNDM  137

Query  1389  RGLMALHEASHLSIEGEDVLDEAAKFSRESLIANMVHLDEC-QASMVQNTLQYPYHKSLA  1213
             +GL+A++EAS LS+EGED+L +   FS E L   +     C +A  V NTLQYP H  L+
Sbjct  138   KGLIAMYEASQLSMEGEDILKDIGNFSSELLHTWLSRNQNCNEAIYVANTLQYPLHYGLS  197

Query  1212  RF--TAKTFIENMRVENEWEATLVNLATMDYSITQSFYQEEFRQILRWWKSLGLKDE--L  1045
             RF      F+  ++  NEW   L  LA ++ +I +   Q E  ++ +WWK LG+  E   
Sbjct  198   RFMDNNNIFLSGLKANNEW-TCLEELANINSNIVRIMNQNEIIEVSKWWKDLGMSKEAKF  256

Query  1044  AKNQQLKWYIWTLALIPDPSMSRERIELTKPIALVYLIDDIIDVYATFDQTKQFIDAINR  865
                + LKWY+W +    DP+ S +RIELTK I+L+Y++DDI DV+ T DQ   F DA  R
Sbjct  257   VMYEPLKWYMWPMTCFTDPNFSEQRIELTKVISLIYVVDDIFDVHGTLDQLTLFTDAAKR  316

Query  864   WDLSVGEGLPDYMKRCLVVLFDTTNDINNLVFEKYGWNPIDHLKRAWKCLCSAYITEAKW  685
             W+L+  E LPD+MK CL +++  TN+    V++K+G NPID LK++W+   ++ + EA W
Sbjct  317   WELAGTEKLPDFMKNCLSLIYKITNEFAEKVYKKHGLNPIDTLKKSWERFLNSVLKEAHW  376

Query  684   FATGKSPSANEYLQTGIITTGIPMVLITCFFLLGHGAFAGTTDIED-----MITSVGAIL  520
               +G    A+EYL+ GI++TG+ +VL+  FFL  H     T  I D     +I SV  IL
Sbjct  377   LNSGYLAKADEYLKNGIVSTGVHLVLVHSFFLFDHIIQEQTIAILDHQFPNIIYSVAKIL  436

Query  519   RLLDDLDATQGEKQDGNDASYVEYYVKEHEGLSISDGKQRIMNMVSEQWKLINKQCLSPT  340
             RL DDL+  +   Q+G D SY++ Y+ EH+ +S  + ++ + NM+S +WK +N++ ++P 
Sbjct  437   RLSDDLEGAKSGDQNGLDGSYIDCYINEHQDISSEEAQRHVANMISNEWKRLNQEIINPN  496

Query  339   RI-PESFSKSCLNIARMVPMMYNYSDTH--CLPILQKQIMSMFS  217
              I P SF   CLN ARMVP+MY+Y       L  LQ+ + S+ S
Sbjct  497   PIFPSSFINFCLNAARMVPLMYHYGSNSNPSLSNLQQFVKSLIS  540



>ref|XP_008446523.1| PREDICTED: (3S,6E)-nerolidol synthase 1-like [Cucumis melo]
Length=588

 Score =   380 bits (976),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 192/483 (40%), Positives = 291/483 (60%), Gaps = 14/483 (3%)
 Frame = -2

Query  1644  LQVLNVIDAIQHLGIDHHFHDQIGAILQRQYQKVKIDDFQKINGLYDISLSFRLLRQEGY  1465
             L+ L +IDA Q LGID+ F ++I  +L+RQY  +    F     L+  +L FRLLRQ+ Y
Sbjct  100   LECLEIIDAAQRLGIDNQFEEEIEDVLKRQYALINAYHFDGDVDLHKAALLFRLLRQQRY  159

Query  1464  NVSSDVFTKFTSEKGEFKEELSKDIRGLMALHEASHLSIEGEDVLDEAAKFSRESLIANM  1285
              VS DVF  F +EKG+FKE+L  D+ G+ +L+EAS L I G+D+L+EA  FS   L    
Sbjct  160   LVSQDVFKVFLNEKGKFKEKLKADLNGMTSLYEASQLRIHGDDILEEAEDFSSHCLNNWA  219

Query  1284  VHLD-ECQASMVQNTLQYPYHKSLARFTAKTFIENMRVENEWEATLVNLATMDYSITQSF  1108
               +D +  AS V NTL +P+H+S+A+F    +  +    N+W   L ++   ++  TQ+ 
Sbjct  220   KRIDNQSSASFVMNTLAHPHHRSVAQFMVPNYFGDKPWTNKWLNLLQDVGRTNFITTQTL  279

Query  1107  YQEEFRQILRWWKSLGLKDEL--AKNQQLKWYIWTLALIPDPSMSRERIELTKPIALVYL  934
              Q E    L+WW+  GL  EL  A+NQ ++ Y+ ++  +PDP  S +R++L K ++L+Y+
Sbjct  280   RQHEIALFLKWWEETGLAKELNFARNQPIQRYLGSVLCLPDPCYSEQRLQLAKSMSLIYV  339

Query  933   IDDIIDVYATFDQTKQFIDAI-------NRWDLSVGEGLPDYMKRCLVVLFDTTNDINNL  775
             IDDI DV+ T DQ + F  A+        RWD+   E LP+ M+ C   L + TN+++  
Sbjct  340   IDDIFDVHGTLDQLRLFTQAVIRILLCTCRWDMDAVESLPNSMQLCFKCLLEVTNELSLK  399

Query  774   VFEKYGWNPIDHLKRAWKCLCSAYITEAKWFATGKSPSANEYLQTGIITTGIPMVLITCF  595
             V++K+GWNP+  L++ W  LC A++ EA+W + G SPSA EYL+ G++++G+  +L+  F
Sbjct  400   VYKKHGWNPVGSLRKTWVKLCKAFLLEAEWLSCGHSPSAEEYLRNGVVSSGVDAILVHTF  459

Query  594   FLLGHGAFAGTTDI----EDMITSVGAILRLLDDLDATQGEKQDGNDASYVEYYVKEHEG  427
             FLLG      T ++     D++ S G ILRL DD+   + EKQ G D SY EYY+KEH  
Sbjct  460   FLLGQQVNNRTVELLDNDSDIVLSSGMILRLWDDMGNAKDEKQMGRDGSYAEYYMKEHPN  519

Query  426   LSISDGKQRIMNMVSEQWKLINKQCLSPTRIPESFSKSCLNIARMVPMMYNYSDTHCLPI  247
             +S    +Q I   +SE WK +N + L     P SF+++ LNIAR VP+ YNY     +  
Sbjct  520   ISSEATQQHIKKKISEAWKTLNTEHLFSNIFPTSFTQASLNIARAVPLAYNYGRNQSIMT  579

Query  246   LQK  238
             ++K
Sbjct  580   VEK  582



>gb|KEH34358.1| (3S)-linalool/(E)-nerolidol/(E,E)-geranyl linalool synthase [Medicago 
truncatula]
Length=519

 Score =   378 bits (970),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 202/488 (41%), Positives = 303/488 (62%), Gaps = 14/488 (3%)
 Frame = -2

Query  1629  VIDAIQHLGIDHHFHDQIGAILQRQYQ--KVKIDDFQKINGLYDISLSFRLLRQEGYNVS  1456
             +ID IQ L I+H+F ++I   L++ Y       +DF  I+ LY+++L+FRLLRQ G+ V+
Sbjct  31    LIDIIQRLNIEHYFVEEIKVALEKLYSILNTNPNDFMSIHELYEVALAFRLLRQGGHYVN  90

Query  1455  SDVFTKFTSEKGEFKEELSKDIRGLMALHEASHLSIEGEDVLDEAAKFSRESLIANMV-H  1279
             +D+F      K  F+E+  +D++GL+AL+EAS LSIEGED L++     RE L   +  H
Sbjct  91    ADLFDSLKCNKRMFEEKHGEDVKGLVALYEASQLSIEGEDSLNDLGYVCRELLHGWLSRH  150

Query  1278  LDECQASMVQNTLQYPYHKSLARFTAKT-FIENMRVENEWEATLVNLATMDYSITQSFYQ  1102
              +  QA  V NTLQ P H  L+RF  K+ FI + + E +    L  LA ++ +I +   Q
Sbjct  151   QEHNQAIYVANTLQNPLHYGLSRFMDKSAFIHDSKDEKDL-LCLEELAKINSTIVRFMNQ  209

Query  1101  EEFRQILRWWKSLGLKDEL--AKNQQLKWYIWTLALIPDPSMSRERIELTKPIALVYLID  928
              E  ++ +WW  L L  E+  +  Q LKWY W +A   DP+ S +RIELTKPI+L+Y+ID
Sbjct  210   NETTEVSKWWNELELAKEVKFSGYQPLKWYTWPMACFTDPNFSEQRIELTKPISLIYVID  269

Query  927   DIIDVYATFDQTKQFIDAINRWDLSVGEGLPDYMKRCLVVLFDTTNDINNLVFEKYGWNP  748
             DI DV+ T DQ   F DAINRW+++  E LP++MK  L  L++ T++  ++V++K+G+NP
Sbjct  270   DIFDVHGTLDQLTIFTDAINRWEITGTEQLPNFMKISLNALYEITSNFADMVYKKHGFNP  329

Query  747   IDHLKRAWKCLCSAYITEAKWFATGKSPSANEYLQTGIITTGIPMVLITCFFLLG--HGA  574
             ID LK++W  L +A++ EA W  +G  P A +YL  GI++TG+ +VL+  FFLL   HG 
Sbjct  330   IDTLKKSWIRLLNAFMEEAHWLNSGHLPRAEDYLNNGIVSTGVHVVLVHAFFLLDHVHGI  389

Query  573   FAGTTDIED-----MITSVGAILRLLDDLDATQGEKQDGNDASYVEYYVKEHEGLSISDG  409
                T DI D     +I SV  ILRL DDL+  +   Q+G D SY++ Y+ EH+ +S  D 
Sbjct  390   TKETIDILDEKFPNVIYSVAKILRLSDDLEGAKSGDQNGLDGSYLDCYMSEHQDISGEDV  449

Query  408   KQRIMNMVSEQWKLINKQCLSPTRIPESFSKSCLNIARMVPMMYNYSDTHCLPILQKQIM  229
             ++ + +M+S +WK +N++ L   +   SFS  CLN ARMVP+MY+Y     L  LQ+ + 
Sbjct  450   QRHVAHMISNEWKRLNQEILVANQFSSSFSNFCLNAARMVPLMYHYKSNPSLSNLQEHVK  509

Query  228   SMFSTING  205
             S+ +   G
Sbjct  510   SLINASGG  517



>ref|XP_003593394.1| Linalool synthase [Medicago truncatula]
Length=627

 Score =   380 bits (975),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 211/545 (39%), Positives = 315/545 (58%), Gaps = 18/545 (3%)
 Frame = -2

Query  1806  RRRTPVVFRCQSVNSSSLRSEKMTVTLSKDEFLLKSEGKREWQRGLLYQFQEDDLQVLNV  1627
             +R    +    S+  SS       V   K   +LK E K+ +++  L    ED ++ L +
Sbjct  86    KRLKQEIMTPNSIFPSSFTKFCQDVNYVKQALILK-EAKQAYKK--LLASDEDPMKSLCM  142

Query  1626  IDAIQHLGIDHHFHDQIGAILQRQYQKVKID--DFQKINGLYDISLSFRLLRQEGYNVSS  1453
             ID IQ LGI+HHF ++I A LQ Q++    +  DF   + L++++L+FRLLRQ G+ V S
Sbjct  143   IDIIQRLGIEHHFAEEIEAALQNQHKMFSRNAIDFVHSHELHEVALTFRLLRQGGHYVKS  202

Query  1452  DVFTKFTSEKGEFKEELSKDIRGLMALHEASHLSIEGEDVLDEAAKFSRESLIANMV-HL  1276
             D+F      K  F E+  +D++ L+A++EAS LSIEGED LD+    S E L   +  H 
Sbjct  203   DIFDSLMFNKRNFSEKFGEDVKSLIAMYEASQLSIEGEDDLDDIGHLSSELLHGWLSSHQ  262

Query  1275  DECQASMVQNTLQYPYHKSLARFTAKT-FIENMRVENEWEATLVNLATMDYSITQSFYQE  1099
             +   A  V NTL+YP H  L+R   K+ F+  ++  NEW   L  LA ++ SI +   Q 
Sbjct  263   NHSDALYVTNTLRYPLHYGLSRLMEKSIFLSYLKATNEW-TCLEELAKINSSIVRFMNQN  321

Query  1098  EFRQILRWWKSLGLKDE--LAKNQQLKWYIWTLALIPDPSMSRERIELTKPIALVYLIDD  925
             E  ++ +WWK L +  E   A  Q LKWY+W +    DPS S +RIELTK I+LVY+IDD
Sbjct  322   EIIEVSKWWKDLEMAKEPKFAHYQPLKWYMWPMVCFTDPSFSDQRIELTKVISLVYVIDD  381

Query  924   IIDVYATFDQTKQFIDAINRWDLSVGEGLPDYMKRCLVVLFDTTNDINNLVFEKYGWNPI  745
             I DVY T DQ   F+D + RW L+  E LPD++K CL  ++  TND    V++K+G NPI
Sbjct  382   IFDVYGTLDQLTLFVDLVTRWKLADTEELPDFVKICLSFIYKITNDFAEKVYKKHGLNPI  441

Query  744   DHLKRAWKCLCSAYITEAKWFATGKSPSANEYLQTGIITTGIPMVLITCFFLLGHGAFAG  565
               LK++W    ++ + +A W  +G  P A+EYL  GI++ G+ +VL+  FFL  H     
Sbjct  442   KTLKKSWIRYLNSALKDAHWLNSGHLPKADEYLNNGIVSPGVHVVLVHAFFLFDHIQDVT  501

Query  564   TTDI-------EDMITSVGAILRLLDDLDATQGEKQDGNDASYVEYYVKEHEGLSISDGK  406
             T  I        + + SV  ILRL DDL+  +   Q+G D SY++ Y+ EH+ +S  + +
Sbjct  502   TETIAILDDGCPNTMYSVAKILRLSDDLEGAKSVDQNGLDGSYLDCYMNEHQEISAQEAQ  561

Query  405   QRIMNMVSEQWKLINKQCLSPTRI-PESFSKSCLNIARMVPMMYNYSDTHCLPILQKQIM  229
             + + NM+S +WK +N++ ++P  I   SF+K CLN+ARMVP+MY+Y     L  LQ  + 
Sbjct  562   RHVANMISNEWKRLNQEIITPNPIFSSSFTKFCLNVARMVPLMYHYQSNPSLSNLQDLVK  621

Query  228   SMFST  214
             S+ + 
Sbjct  622   SLVNV  626



>ref|XP_004485671.1| PREDICTED: (3S,6E)-nerolidol synthase 1-like [Cicer arietinum]
Length=517

 Score =   375 bits (963),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 207/526 (39%), Positives = 313/526 (60%), Gaps = 27/526 (5%)
 Frame = -2

Query  1740  MTVTLSKDEFLLKSEGKREWQRGLLYQFQEDDLQVLNVIDAIQHLGIDHHFHDQIGAILQ  1561
             M V   K   +L+ E K+ +++   +   ED ++ L +ID IQ LGI+HHF ++I    +
Sbjct  1     MDVIYVKQALILE-EAKKVYKK---FACSEDPMESLYMIDIIQRLGIEHHFAEEI----E  52

Query  1560  RQY---QKVKIDDFQKINGLYDISLSFRLLRQEGYNVSSDVFTKFTSEKGEFKEELSKDI  1390
             +QY     +   +F   + LYD++L+FRLLRQ G+ V+ D+F      K  F+E+   D+
Sbjct  53    KQYLILNNINPIEFVNSHELYDVALTFRLLRQGGHYVNPDLFDSLMCNKRNFREKYGNDM  112

Query  1389  RGLMALHEASHLSIEGEDVLDEAAKFSRESLIANMVHLDEC-QASMVQNTLQYPYHKSLA  1213
             +GL+A++EAS LS+EGED+L++   FS E L   +     C +A  V NTLQYP H  L+
Sbjct  113   KGLIAMYEASQLSMEGEDILNDIGNFSSELLHTWLSRNQNCNEAIYVANTLQYPLHYGLS  172

Query  1212  RF--TAKTFIENMRVENEWEATLVNLATMDYSITQSFYQEEFRQILRWWKS-LGLKDE--  1048
             RF      F+  ++  NEW   L  LA ++ +I +   Q E  ++ +WWK  +G+  E  
Sbjct  173   RFMDNNNIFLSGLKANNEW-TCLEELANINSNIVRIMNQNEIIEVSKWWKEDIGMSKEPK  231

Query  1047  LAKNQQLKWYIWTLALIPDPSMSRERIELTKPIALVYLIDDIIDVYATFDQTKQFIDAIN  868
                 Q LKWY+W +    DP+ S +RIELTK I+L+Y++DDI DV+ T DQ   F DA  
Sbjct  232   FVMYQPLKWYMWPMTCFTDPNFSEQRIELTKVISLIYVVDDIFDVHGTLDQLTLFTDAAK  291

Query  867   RWDLSVGEGLPDYMKRCLVVLFDTTNDINNLVFEKYGWNPIDHLKRAWKCLCSAYITEAK  688
             RW+L+  E LPD+MK CL +++  TN+    V++K+G NPID LK++W+   ++ + EA 
Sbjct  292   RWELAGTEKLPDFMKNCLSLIYKITNEFAEKVYKKHGLNPIDTLKKSWERFLNSVLKEAH  351

Query  687   WFATGKSPSANEYLQTGIITTGIPMVLITCFFLLGHGAFAGTTDIED-----MITSVGAI  523
             WF +G    A+EYL+ GI +TG+ +VL+  FFL  H     T  I D     +I SV  I
Sbjct  352   WFNSGYLAKADEYLKNGIDSTGVHLVLVHSFFLFNHIIQEQTIAILDHEFPNIIYSVATI  411

Query  522   LRLLDDLD-ATQGEKQDGNDASYVEYYVKEHEGLSISDGKQRIMNMVSEQWKLINKQCLS  346
             LRL DDL+ A +   Q+G D SY++ Y  EH+ +S  + +  + NM+S +WK +N++ ++
Sbjct  412   LRLSDDLEGAAKSGDQNGLDGSYIDCYTNEHQDISSEEAQTHVANMISNEWKRLNQEIIN  471

Query  345   PTRI-PESFSKSCLNIARMVPMMYNYSDTH--CLPILQKQIMSMFS  217
             P  I P SF   CLN+ARMVP+MY+Y       L  LQ+ + S+ S
Sbjct  472   PNPIFPSSFINFCLNVARMVPLMYHYGSNSNPSLSNLQQFVKSLIS  517



>ref|XP_007148288.1| hypothetical protein PHAVU_006G195700g [Phaseolus vulgaris]
 gb|ESW20282.1| hypothetical protein PHAVU_006G195700g [Phaseolus vulgaris]
Length=581

 Score =   376 bits (966),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 203/546 (37%), Positives = 316/546 (58%), Gaps = 18/546 (3%)
 Frame = -2

Query  1794  PVVFRCQSVNSSSLRSEKMTVTLSKDEFLLKSEGKREWQRGLLYQFQEDDLQVLNVIDAI  1615
             P +  C    S SL++   T  +   +  L  E K    + +    +E+ ++ L++ID I
Sbjct  41    PFLKACPKPKSVSLKAYSSTDVIYVKQASLLKEAKHLSNKLI----RENPMESLHMIDII  96

Query  1614  QHLGIDHHFHDQIGAILQRQY-----QKVKIDDFQKINGLYDISLSFRLLRQEGYNVSSD  1450
             Q LGI+HHF  +I  +LQ+Q           D F   + LY+++L+FRLLRQ GY V++D
Sbjct  97    QRLGIEHHFEQEIQLVLQKQQLILSNHPCDFDFFSSHDQLYEVALAFRLLRQGGYYVNAD  156

Query  1449  VFTKFTSEKGEFKEELSKDIRGLMALHEASHLSIEGEDVLDEAAKFSRESLIANMV-HLD  1273
             +F    +EK +FKE   +D++ L AL+EAS L ++ ED +D+    S + L A +  H +
Sbjct  157   LFDILKNEKRKFKEIYGEDVKVLSALYEASQLGVQ-EDSVDDVGYLSLQLLHAWLRRHEE  215

Query  1272  ECQASMVQNTLQYPYHKSLARFT-AKTFIENMRVENEWEATLVNLATMDYSITQSFYQEE  1096
               QA  V  TL  P H   +RF  A  F       NEW   L  LA ++  +     Q+E
Sbjct  216   HPQAIHVTKTLHSPLHHGFSRFRDANIFPIQFNTNNEWIGCLEELAEINSCVVSLMNQKE  275

Query  1095  FRQILRWWKSLGLKDE--LAKNQQLKWYIWTLALIPDPSMSRERIELTKPIALVYLIDDI  922
               ++ +WWK+L +  E      Q LKWY+W +A + +P +S++RI+LTK I+L+Y++DDI
Sbjct  276   ITEVYKWWKTLEMAKEEKFRSYQPLKWYMWPMACLTNPCLSQQRIQLTKFISLIYIVDDI  335

Query  921   IDVYATFDQTKQFIDAINRWDLSVGEGLPDYMKRCLVVLFDTTNDINNLVFEKYGWNPID  742
              D Y T DQ   F DAI RW+L   E LP +MK CL VL+DTTND    V++K+G NPID
Sbjct  336   FDAYGTLDQLTLFTDAIIRWELGGTEQLPGFMKMCLSVLYDTTNDFAEEVYKKHGLNPID  395

Query  741   HLKRAWKCLCSAYITEAKWFATGKSPSANEYLQTGIITTGIPMVLITCFFLLGHG----A  574
              LKR+W  L +A++ EA W   G  P + EYL  GI+++G+ ++L+  FFLL       +
Sbjct  396   TLKRSWVRLLNAFMEEAHWLKGGDLPRSEEYLNNGIVSSGVHVLLLYAFFLLDQSINMES  455

Query  573   FAGTTDIEDMITSVGAILRLLDDLDATQGEKQDGNDASYVEYYVKEHEGLSISDGKQRIM  394
              A   +   +I SV  ILRL DDL+  + + + G D SY++ Y+ EH+ +S  D +  + 
Sbjct  456   VAVMDNFPQIIYSVAKILRLSDDLEGAKKKDEKGVDGSYLDCYMNEHQHVSAEDAQNHVS  515

Query  393   NMVSEQWKLINKQCLSPTRIPESFSKSCLNIARMVPMMYNYSDTHCLPILQKQIMSMFST  214
             +++  +WK +N+Q L+  ++  SF+  CLN ARMVP+MY+ ++   L I+Q+ +M++  T
Sbjct  516   HLIQSEWKRLNQQILTQNQLSSSFANICLNGARMVPLMYHTTNNPYLSIMQEHVMTLLHT  575

Query  213   INGESI  196
                E++
Sbjct  576   AGAETV  581



>gb|KEH34554.1| (3S)-linalool/(E)-nerolidol/(E,E)-geranyl linalool synthase [Medicago 
truncatula]
Length=519

 Score =   373 bits (958),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 199/496 (40%), Positives = 301/496 (61%), Gaps = 14/496 (3%)
 Frame = -2

Query  1653  EDDLQVLNVIDAIQHLGIDHHFHDQIGAILQRQYQKVKID--DFQKINGLYDISLSFRLL  1480
             ED ++   +ID IQ  GI+H+F ++I   L++ +  +  +  DF   + +Y+++L+FRLL
Sbjct  23    EDPMESFYLIDIIQRFGIEHYFAEEIKVALEKLHLTLNTNSIDFASSHEIYEVALAFRLL  82

Query  1479  RQEGYNVSSDVFTKFTSEKGEFKEELSKDIRGLMALHEASHLSIEGEDVLDEAAKFSRES  1300
             RQ G+ V++D+F      K   KE+  +D++GL+AL+EAS LSIEGED L++     RE 
Sbjct  83    RQGGHYVNADLFDSLKWNKRMLKEKHGEDVKGLIALYEASQLSIEGEDSLNDVGYLCREL  142

Query  1299  LIANMVHLDE-CQASMVQNTLQYPYHKSLARFTAK-TFIENMRVENEWEATLVNLATMDY  1126
             L   +    E  +A  V NTLQ P H  L+RF  K T I +++ E +    L  LA ++ 
Sbjct  143   LHGWLSRNQEHNEAIHVANTLQNPLHYGLSRFMDKSTLIHDLKEEKDL-ICLEELAKINS  201

Query  1125  SITQSFYQEEFRQILRWWKSLGLKDEL--AKNQQLKWYIWTLALIPDPSMSRERIELTKP  952
             +I       E  ++ +WWK LGL  E+  +  Q LKWY W +A   DP+ S +R+ELTKP
Sbjct  202   NIVGFMNHNETIEVSKWWKELGLAKEVKFSGYQPLKWYTWPMACFTDPNFSEQRVELTKP  261

Query  951   IALVYLIDDIIDVYATFDQTKQFIDAINRWDLSVGEGLPDYMKRCLVVLFDTTNDINNLV  772
             I+L+Y+IDD+ DV+ T DQ     DA+NRW+++  E LP++MK  L  L+D TN+   +V
Sbjct  262   ISLIYVIDDLFDVHGTLDQLTILTDAVNRWEITGTEQLPNFMKIALNALYDITNNFAEMV  321

Query  771   FEKYGWNPIDHLKRAWKCLCSAYITEAKWFATGKSPSANEYLQTGIITTGIPMVLITCFF  592
             ++K+G+NPID LK++W  L +A++ EA W  +   P A +YL  GI++TG+ +VLI  FF
Sbjct  322   YKKHGFNPIDTLKKSWVLLLNAFMEEAHWLNSSHLPRAEDYLNNGIVSTGVHVVLIHAFF  381

Query  591   LLGH--GAFAGTTDIED-----MITSVGAILRLLDDLDATQGEKQDGNDASYVEYYVKEH  433
             LL H  G    T DI D     +I SV  ILRL DDL+  +   Q+G D SY++ Y+ EH
Sbjct  382   LLDHVNGITKQTIDILDEKFPNVIYSVAKILRLSDDLEGAKSGDQNGLDGSYLDCYMSEH  441

Query  432   EGLSISDGKQRIMNMVSEQWKLINKQCLSPTRIPESFSKSCLNIARMVPMMYNYSDTHCL  253
             + +S  D +  + +M+S +WK +N++ L   +   SFS  CLN ARMVP+MY+Y     L
Sbjct  442   QDISSEDVQGHVAHMISNEWKFLNQEILVANQFSSSFSNFCLNAARMVPLMYHYKSKPSL  501

Query  252   PILQKQIMSMFSTING  205
               LQ+ + S+ +   G
Sbjct  502   SNLQEHVKSLINVSVG  517



>ref|XP_011071312.1| PREDICTED: uncharacterized protein LOC105156792 [Sesamum indicum]
Length=1087

 Score =   387 bits (994),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 215/543 (40%), Positives = 326/543 (60%), Gaps = 27/543 (5%)
 Frame = -2

Query  1806  RRRTPVVFRCQSVNSSSLRSEKMTVTLSKDEFLLKSEGKREWQRGLLYQFQEDDLQVLNV  1627
               R P+   C S  ++     K  V   + + LL+S+ K +   G            L  
Sbjct  552   HHRIPLAAPCTSTETTLGSDYKQKVEEVR-QLLLESKDKDQINNGT---------DSLVC  601

Query  1626  IDAIQHLGIDHHFHDQIGAILQRQYQKVKIDDFQKINGLYDISLSFRLLRQEGYNVSSDV  1447
             +D I  LG DH+F ++I  IL++QY        +    L+D+SL FRLLRQ GY VS+DV
Sbjct  602   VDDIHRLGFDHYFEEEIEIILRQQYYNYN-HRAKSSTCLHDVSLFFRLLRQHGYYVSADV  660

Query  1446  FTKFTSEKGEFKEELSKDIRGLMALHEASHLSIEGEDVLDEAAKFSRESLIANMVHLDE-  1270
             F  F    G+F EEL +DIRGL AL+EA+ LS +GE ++DEA  FSR  L   +++ ++ 
Sbjct  661   FNNFKGNDGKFLEELKQDIRGLHALYEAAQLSFKGESIIDEAQDFSRLHLSGYLLNQNQN  720

Query  1269  --CQASM---VQNTLQYPYHKSLARFT-AKTFIEN---MRVENEWEATLVNLATMDYSIT  1117
               C   +   ++ TL +P+HK++ R + AK+++     ++    WE +L  L  MD+ I 
Sbjct  721   MCCDHQLQEAIRYTLTHPHHKTIPRLSRAKSWLHGDHLLKGSKVWEKSLRELVNMDFLIA  780

Query  1116  QSFYQEEFRQILRWWKSLGLKDEL--AKNQQLKWYIWTLALIPDPSMSRERIELTKPIAL  943
             +S +Q E  QI +WWK LGL ++L  A+NQ +KWY W++A I DP +S +RIELTKPIA 
Sbjct  781   KSLHQHELLQISKWWKDLGLGEKLPKARNQAVKWYTWSMASIDDPRLSFQRIELTKPIAF  840

Query  942   VYLIDDIIDVYATFDQTKQFIDAINRWDLSVGEGLPDYMKRCLVVLFDTTNDINNLVFEK  763
             +YLIDDI D+Y T D+   F  AINRWD +  + LP+YM+     L DTTN+I + + +K
Sbjct  841   IYLIDDIFDLYGTIDELTLFTQAINRWDDTAIDMLPEYMRMSYKALVDTTNEIAHNIKKK  900

Query  762   YGWNPIDHLKRAWKCLCSAYITEAKWFATGKSPSANEYLQTGIITTGIPMVLITCFFLLG  583
             +G NPI+ LK  W  LC A++ EA+WFA+G+ P+A EYL+ G ++TG  +VL+  FFLLG
Sbjct  901   HGHNPINALKATWASLCDAFLVEARWFASGELPTAQEYLKNGKVSTGAHVVLVHLFFLLG  960

Query  582   HGAFAGTTDIE---DMITSVGAILRLLDDLDATQGEKQDGNDASYVEYYVKEHEGLSISD  412
              G      ++     + +S+  ILRL DDL +++ E QDG D SY+  Y+K+   +S   
Sbjct  961   LGGLNDEINLNHTSKLTSSIATILRLWDDLGSSKDEHQDGQDGSYITCYMKDEPNVSAKQ  1020

Query  411   GKQRIMNMVSEQWKLINKQCLSPTRIPES-FSKSCLNIARMVPMMYNYSDTHCLPILQKQ  235
              +Q +++M+  +W+ +N++C     +  + F +S LNIARM+P+MY Y     LP+L++ 
Sbjct  1021  ARQHVVDMILNEWRNLNQECCRLNHLSAACFKRSSLNIARMIPLMYTYDQNQRLPLLEEY  1080

Query  234   IMS  226
             + S
Sbjct  1081  MRS  1083


 Score =   385 bits (989),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 209/509 (41%), Positives = 323/509 (63%), Gaps = 34/509 (7%)
 Frame = -2

Query  1671  LLYQFQEDDLQVLNVIDAIQHLGIDHHFHDQIGAILQRQYQ----KVKIDDFQKINGLYD  1504
             LL +  E+ +  L  +DAIQ +GIDHHF ++I  IL RQY+     V   D      L+ 
Sbjct  8     LLQEENENPMDGLMFVDAIQRVGIDHHFEEEIEMILGRQYKFWGKSVCFHD------LHH  61

Query  1503  ISLSFRLLRQEGYNVSSDVFTKFTSEKGEFKEELSKDIRGLMALHEASHLSIEGEDVLDE  1324
             +SL FRLLRQ+GY VS+DVF  F  + G+F EEL +D+RGLMAL+EA+ LS +GE ++DE
Sbjct  62    VSLFFRLLRQQGYYVSADVFNNFKGKDGKFLEELKQDVRGLMALYEAAQLSFKGETIIDE  121

Query  1323  AAKFSRESLIANMVHLDE---CQASM---VQNTLQYPYHKSLARFTAKTFIEN--MRVEN  1168
             A  FSR  L   ++H ++   C   +   ++NTL +P+HK++ R TAK F+    ++   
Sbjct  122   AQDFSRLHLSGYLLHQNQNLCCDHELQEAIRNTLTHPHHKTIPRLTAKAFLHGDLLKGSK  181

Query  1167  EWEATLVNLATMDYSITQSFYQEEFRQILRWWKSLGLKDELA--KNQQLKWYIWTLA-LI  997
             +W  +L  LA M++ I +S +Q+E  QI +WWK +GL +++A  +NQ +KWY  ++A L+
Sbjct  182   QWHKSLRELANMEFLIGKSMHQDELVQISKWWKDIGLAEQVANARNQPIKWYAGSMAILM  241

Query  996   PDPSMSRERIELTKPIALVYLIDDIIDVYATFDQTKQFIDAINRWDLSVGEGLPDYMKRC  817
              DP++  +RIELTK IA +YL+DDI D+Y T DQ   F  AI+RWD S  + LP YM+  
Sbjct  242   NDPTLCFQRIELTKVIAFIYLLDDIFDLYGTIDQLTLFTHAIHRWDYSAVDMLPSYMRMS  301

Query  816   LVVLFDTTNDINNLVFEKYGWNPIDHLKRAWKCLCSAYITEAKWFA-----TGKS-PSAN  655
                L  TTN I N + + +G NPI ++K  W  LC+A++ EA+WFA     TG   P++ 
Sbjct  302   YKALLHTTNQIANKIQKLHGHNPIAYMKATWGSLCNAFLVEARWFASSSLSTGDEWPTSK  361

Query  654   EYLQTGIITTGIPMVLITCFFLLGHGAFAGTTDIE-----DMITSVGAILRLLDDLDATQ  490
             EYL+ G ++TG+ +VL+  FFLLG G  + + +I       + +S+  ILRL DDL +++
Sbjct  362   EYLENGKVSTGVHVVLVHLFFLLGLGGLSSSDEINLNNTSKLTSSLATILRLWDDLGSSK  421

Query  489   GEKQDGNDASYVEYYVKEHEGLSISDGKQRIMNMVSEQWKLINKQC--LSPTRIPESFSK  316
              E+QDG D SY++YY+K+   LS+++ +Q + +M++ +WK +N +C  L       SF +
Sbjct  422   DEQQDGEDGSYIDYYMKDEPELSVNEARQHVFHMITNEWKNVNGECFRLKQYSSATSFKR  481

Query  315   SCLNIARMVPMMYNYSDTHCLPILQKQIM  229
             + LN+ARM+ + Y Y +   LP+L++ ++
Sbjct  482   ASLNLARMIALTYGYDENQRLPLLEQYLL  510



>gb|KEH34550.1| (3S)-linalool/(E)-nerolidol/(E,E)-geranyl linalool synthase [Medicago 
truncatula]
Length=495

 Score =   369 bits (948),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 205/492 (42%), Positives = 297/492 (60%), Gaps = 21/492 (4%)
 Frame = -2

Query  1629  VIDAIQHLGIDHHFHDQIGAILQRQY---QKVKIDDFQKINGLYDISLSFRLLRQEGYNV  1459
             ++D IQ  GI+H+F ++I   L+  +       I DF   + LY+++L+FRLLRQ G+ V
Sbjct  6     LMDIIQRFGIEHYFAEEIKVALENLHLILNTNPIIDFVSSHELYEVALAFRLLRQGGHYV  65

Query  1458  SSDVFTKFTSEKGEFKEELSKDIRGLMALHEASHLSIEGEDVLDEAAKFSRESLIA----  1291
             ++D+F      K  F+E+  +D++GL+AL+EAS LSIEGED L++      E L A    
Sbjct  66    NADLFDSLKCNKRMFEEKHGEDVKGLIALYEASQLSIEGEDSLNDVGYLCCELLHAWLSR  125

Query  1290  NMVHLDECQASMVQNTLQYPYHKSLARFTAK-TFIENMRVENEWEATLVNLATMDYSITQ  1114
             N  H D   A  V NTLQ P H  L+RF  K TF+ +++ E +    L  LA ++  I +
Sbjct  126   NQEHKD---ALYVANTLQNPLHYGLSRFMDKNTFMHDLKAEKDL-ICLEELAKINSGIVR  181

Query  1113  SFYQEEFRQILRWWKSLGLKDEL--AKNQQLKWYIWTLALIPDPSMSRERIELTKPIALV  940
                Q E  ++ +WWK LGL  E+  +  Q LKWY W +A   DP+ S +RIELTKPI+L+
Sbjct  182   FMNQNETIEVSKWWKELGLDKEVKFSGYQPLKWYTWPMACFTDPNFSEQRIELTKPISLI  241

Query  939   YLIDDIIDVYATFDQTKQFIDAINRWDLSVGEGLPDYMKRCLVVLFDTTNDINNLVFEKY  760
             Y+IDDI DV+ T DQ   F DAINRW+ +  E LP++MK  L  L+D TN     V++K+
Sbjct  242   YVIDDIFDVHGTLDQLTIFTDAINRWETTGTEQLPNFMKISLNALYDITNKFAENVYKKH  301

Query  759   GWNPIDHLKRAWKCLCSAYITEAKWFATGKSPSANEYLQTGIITTGIPMVLITCFFLLGH  580
             G+NPID LK++W  L +A++ EA W  +G  P A +YL  GI++TG+ +VL   FFLL H
Sbjct  302   GFNPIDTLKKSWIRLLNAFMEEAHWLNSGHLPKAEDYLNNGIVSTGVHVVLEHAFFLLDH  361

Query  579   --GAFAGTTDIED-----MITSVGAILRLLDDLDATQGEKQDGNDASYVEYYVKEHEGLS  421
               G    T DI D     +I SV  ILRL DDL+  +   Q+G D SY++ Y+ EH+ +S
Sbjct  362   VSGITKETIDILDENFPNVIYSVAKILRLSDDLEGAKSGDQNGLDGSYLDCYMSEHQDIS  421

Query  420   ISDGKQRIMNMVSEQWKLINKQCLSPTRIPESFSKSCLNIARMVPMMYNYSDTHCLPILQ  241
               D ++ + +M+S +WK +N++ L   +   SFS  CLN ARMVP+MY+Y     L  LQ
Sbjct  422   SEDVQRHVAHMISNEWKCLNQEILVTNQFSSSFSNFCLNAARMVPLMYHYKSNPSLSNLQ  481

Query  240   KQIMSMFSTING  205
             + + S+ +   G
Sbjct  482   EHVNSLINVSVG  493



>ref|XP_006301761.1| hypothetical protein CARUB_v10022222mg [Capsella rubella]
 gb|EOA34659.1| hypothetical protein CARUB_v10022222mg [Capsella rubella]
Length=573

 Score =   371 bits (952),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 183/484 (38%), Positives = 296/484 (61%), Gaps = 17/484 (4%)
 Frame = -2

Query  1635  LNVIDAIQHLGIDHHFHDQIGAILQRQYQKVKIDDFQKIN--GLYDISLSFRLLRQEGYN  1462
             L++IDAIQ LGID HF  +I   L   Y++       K N   L++++L FRLLRQEG+ 
Sbjct  95    LDMIDAIQVLGIDLHFKREIEQTLHIIYKEC-----TKFNMYDLHEVALCFRLLRQEGHY  149

Query  1461  VSSDVFTKFTSEKGEFKEELSKDIRGLMALHEASHLSIEGEDVLDEAAKFSRESLIANMV  1282
             V   +F     +KG FK ++   ++GL+ L+EAS L +EGE+ LD   +F+   L     
Sbjct  150   VQESIFENILDKKGGFKNDIKIYVKGLIELYEASELGVEGEETLDGVREFTFSCLGELCS  209

Query  1281  HLDECQASMVQNTLQYPYHKSLARFTAKTFIENMRV----ENEWEATLVNLATMDYSITQ  1114
                  Q   +  +L  P HK+L R T+K FI  ++     + EW  +L+ +A +D SI +
Sbjct  210   GRVSHQKREIMKSLVQPRHKTLTRLTSKRFISMIKPADQEDQEWLQSLLRVAEIDSSILK  269

Query  1113  SFYQEEFRQILRWWKSLGLKDEL--AKNQQLKWYIWTLALIPDPSMSRERIELTKPIALV  940
             S  +EE  Q  +WW  LGL  EL  A++Q LKW+ W++ ++ DP+++ +R++LTKPI+LV
Sbjct  270   SLTREEMSQTSKWWAELGLHKELDKARSQPLKWHTWSMEILQDPTLTEQRLDLTKPISLV  329

Query  939   YLIDDIIDVYATFDQTKQFIDAINRWDLSVGEGLPDYMKRCLVVLFDTTNDINNLVFEKY  760
             Y+IDDI DVY   ++   F   + RWD    E LP YM+ C   L   T +I+  +++ +
Sbjct  330   YVIDDIFDVYGELEELIIFTQVVERWDHKGLETLPRYMRVCFEALDMITTEISMKIYKLH  389

Query  759   GWNPIDHLKRAWKCLCSAYITEAKWFATGKSPSANEYLQTGIITTGIPMVLITCFFLLGH  580
             GWNP + L+++W  LC +++ EAKWF++G  P+  EY++ G++++G+ +V++  +FLLG 
Sbjct  390   GWNPTNSLRKSWTSLCMSFLIEAKWFSSGYLPNTEEYMKNGVVSSGVHLVMLHVYFLLGE  449

Query  579   GAFAGTTDI----EDMITSVGAILRLLDDLDATQGEKQDGNDASYVEYYVKEHEGLSISD  412
                    ++      ++++   ILRL DDL + + E QDG D SY+E Y+ E++G ++ +
Sbjct  450   ELTREKVELIESNPSIVSAAATILRLWDDLGSAKDENQDGADGSYIECYLNEYKGSTVDE  509

Query  411   GKQRIMNMVSEQWKLINKQCLSPTRIPESFSKSCLNIARMVPMMYNYSDTHCLPILQKQI  232
              +  + + +S+ WK +N++CL+P+   +SFSK+CLNIAR VP MY+Y D   LP L+K +
Sbjct  510   ARTHVFHKISKAWKCLNRECLNPSPFSKSFSKACLNIARTVPSMYSYDDEQRLPGLEKYL  569

Query  231   MSMF  220
              S+ 
Sbjct  570   KSLM  573



>ref|XP_006851183.1| hypothetical protein AMTR_s00043p00183580 [Amborella trichopoda]
 gb|ERN12764.1| hypothetical protein AMTR_s00043p00183580 [Amborella trichopoda]
Length=588

 Score =   369 bits (948),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 190/485 (39%), Positives = 286/485 (59%), Gaps = 10/485 (2%)
 Frame = -2

Query  1707  LKSEGKREWQRGL--LYQFQEDDLQVLNVIDAIQHLGIDHHFHDQIGAILQRQYQKVKID  1534
             LK+   R+ +R L  +     D+++++ +ID IQ LGI +HF  +I   L   Y+     
Sbjct  76    LKATSFRDLKRKLKKVISGISDEVKIMALIDHIQRLGIAYHFEMEIETALGGIYRGFSAH  135

Query  1533  DFQKINGLYDISLSFRLLRQEGYNVSSDVFTKFTSEKGEFKEELSKDIRGLMALHEASHL  1354
                  + L   SL FRLLRQ GYNVSS+VF KF    G FK  LS+D+ G++ L+EASHL
Sbjct  136   GSN--DNLLVASLKFRLLRQHGYNVSSNVFNKFKDGNGNFKPSLSEDVIGMLNLYEASHL  193

Query  1353  SIEGEDVLDEAAKFSRESLIANMVHLDECQASMVQNTLQYPYHKSLARFTAKTFIENMRV  1174
              IEGED++DEA  F  E L  +M  ++   A +V++ L+ P H    R   + +IE  + 
Sbjct  194   RIEGEDIMDEALGFCVEHLSTSMHRVEPNIAKIVRHALKLPLHFRTPRLETRHYIEVYKE  253

Query  1173  ENEWEATLVNLATMDYSITQSFYQEEFRQILRWWKSLGLKDELA--KNQQLKWYIWTLAL  1000
             + +    L+  A  D+++ QS Y+ E +++ RWW+ L +  ELA  ++Q   W++W +A+
Sbjct  254   DPQRNQDLLEFAQRDFNMVQSLYKGELKEVSRWWRELDMAKELAFARDQIHHWFMWPVAI  313

Query  999   IPDPSMSRERIELTKPIALVYLIDDIIDVYATFDQTKQFIDAINRWDLSVGEGLPDYMKR  820
             +P+P  S  R+++TK I+ +YLIDDI DVY + D+ + F  AI RWDLS   GLP YMK 
Sbjct  314   VPEPQYSECRVDMTKAISFIYLIDDIYDVYGSMDELELFTQAITRWDLSEIHGLPKYMKV  373

Query  819   CLVVLFDTTNDINNLVFEKYGWNPIDHLKRAWKCLCSAYITEAKWFATGKSPSANEYLQT  640
             C + L D T DI   + +K+G++  D+L++AW  LC AY+ EAKWF +G+ P A EYL+ 
Sbjct  374   CYLALHDVTRDIARKIHKKHGFDITDYLRQAWTSLCEAYLVEAKWFRSGQVPRAKEYLKN  433

Query  639   GIITTGIPMVLITCFFLLGHGAFAGTTDI----EDMITSVGAILRLLDDLDATQGEKQDG  472
              + +TG+ + LI  +FL+GH     T  +       I     ILRL DDL  +  E++ G
Sbjct  434   AVTSTGVHVALIHMYFLMGHKVTRETAQLISNGPQFIRCPATILRLWDDLSTSMEERERG  493

Query  471   NDASYVEYYVKEHEGLSISDGKQRIMNMVSEQWKLINKQCLSPTRIPESFSKSCLNIARM  292
             +DASY+E Y+KEHE  S    ++   N++   WK +  + L     P SF+ S LNI+RM
Sbjct  494   DDASYIESYMKEHEDESEESAREHTTNLIITMWKRLIHESLKQNPFPHSFTISVLNISRM  553

Query  291   VPMMY  277
               ++Y
Sbjct  554   AQVVY  558



>ref|XP_006377269.1| hypothetical protein POPTR_0011s03490g [Populus trichocarpa]
 gb|ERP55066.1| hypothetical protein POPTR_0011s03490g [Populus trichocarpa]
Length=444

 Score =   363 bits (932),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 176/388 (45%), Positives = 267/388 (69%), Gaps = 6/388 (2%)
 Frame = -2

Query  1749  SEKMTVTLSKDEFLLKSEGKREWQRGLLYQFQEDDLQVLNVIDAIQHLGIDHHFHDQIGA  1570
             +++  +T++ D+       K +  + +L +  E+ +Q L +IDAIQ L ID+HF ++I +
Sbjct  56    TKQYPITINNDDSDTGYAEKLQTFKHILRKEGEEPIQGLAMIDAIQRLSIDYHFQEEIDS  115

Query  1569  ILQRQYQKVKIDDFQKINGLYDISLSFRLLRQEGYNVSSDVFTKFTSEKGEFKEELSKDI  1390
             IL RQ   + +      N LY+++L FRLLRQ+GY+VS+ VF  F   +G FK++LS DI
Sbjct  116   ILTRQ--SMLLSTIHSDNNLYEVALRFRLLRQQGYHVSAGVFDTFKDNEGRFKQQLSSDI  173

Query  1389  RGLMALHEASHLSIEGEDVLDEAAKFSRESLIANMVHLDECQASMVQNTLQYPYHKSLAR  1210
              GL++L+EAS LSI GEDVLDEA  +S + L +++ HLD  QA +V+N+L +P+HKSLA 
Sbjct  174   MGLVSLYEASQLSIRGEDVLDEAGDYSYQLLHSSLTHLDYNQARLVRNSLDHPHHKSLAS  233

Query  1209  FTAKTFIENMRVENEWEATLVNLATMDYSITQSFYQEEFRQILRWWKSLGLKDEL--AKN  1036
             FTAK +  +    N W + L  LA  ++   QS +Q E  +IL+WWK LGL  EL  A++
Sbjct  234   FTAKYYFND--DPNGWISELQELAKTEFQRVQSQHQHEIVEILKWWKDLGLSTELRFARD  291

Query  1035  QQLKWYIWTLALIPDPSMSRERIELTKPIALVYLIDDIIDVYATFDQTKQFIDAINRWDL  856
             Q LKWY+ +++ + DPS+S +RIELTKP++++Y+IDDI DV+ T D+   F + INRWD+
Sbjct  292   QPLKWYMCSMSCLTDPSLSEQRIELTKPVSMIYIIDDIFDVHGTLDELVCFTEVINRWDI  351

Query  855   SVGEGLPDYMKRCLVVLFDTTNDINNLVFEKYGWNPIDHLKRAWKCLCSAYITEAKWFAT  676
             +  E LPDYMK C   L + TN+I+  +++++GWNP+D L++AW  LC A++ EA+WFA+
Sbjct  352   AAAEQLPDYMKICFKALNNITNEISYKIYKEHGWNPVDSLRKAWASLCRAFLVEARWFAS  411

Query  675   GKSPSANEYLQTGIITTGIPMVLITCFF  592
             GK PS  EYL+ GI+++G+ +VL+T  F
Sbjct  412   GKLPSGEEYLKNGIVSSGVHVVLVTSSF  439



>ref|XP_003619707.1| Linalool synthase [Medicago truncatula]
 gb|AES75925.1| (3S)-linalool/(E)-nerolidol/(E,E)-geranyl linalool synthase [Medicago 
truncatula]
Length=519

 Score =   365 bits (936),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 199/493 (40%), Positives = 297/493 (60%), Gaps = 14/493 (3%)
 Frame = -2

Query  1653  EDDLQVLNVIDAIQHLGIDHHFHDQIGAILQRQYQKVKID--DFQKINGLYDISLSFRLL  1480
             ED ++   +ID IQ   I+H+F D+I A L+  +  +  +  DF   + LY ++L+FRLL
Sbjct  23    EDPMECFYLIDIIQKFDIEHYFVDEIKAALENLHLILNTNPIDFVSSHELYQVALAFRLL  82

Query  1479  RQEGYNVSSDVFTKFTSEKGEFKEELSKDIRGLMALHEASHLSIEGEDVLDEAAKFSRES  1300
             RQ G+ V++D+F      K  F+E   +D++GL+AL+EAS LSIEGED L++      E 
Sbjct  83    RQGGHYVNADLFDSLKCNKRMFEETHGEDVKGLIALYEASQLSIEGEDHLNDVGYLCCEL  142

Query  1299  LIANMVHLDE-CQASMVQNTLQYPYHKSLARFTAKT-FIENMRVENEWEATLVNLATMDY  1126
             L A +    E  +A  V N LQ P H  L+RF  +  FI N++ E +    L  LA ++ 
Sbjct  143   LHAWLSRNQEHNEALYVANALQNPLHYGLSRFMDRNIFIHNLKAEKDL-ICLKELANINS  201

Query  1125  SITQSFYQEEFRQILRWWKSLGLKDEL--AKNQQLKWYIWTLALIPDPSMSRERIELTKP  952
             SI +   Q E  ++ +WW  LGL  E+  ++ Q LKWY W +A   DP+ S +RIELTKP
Sbjct  202   SIVRFMNQNETTEVSKWWNELGLAKEVKFSEYQPLKWYTWPMACFTDPNFSEQRIELTKP  261

Query  951   IALVYLIDDIIDVYATFDQTKQFIDAINRWDLSVGEGLPDYMKRCLVVLFDTTNDINNLV  772
             I+L+Y+IDDI DV+ T DQ   F DAI RW+++  E LP++MK  L  L+D TN+    V
Sbjct  262   ISLIYVIDDIFDVHGTLDQLTIFTDAIKRWEITGTEQLPNFMKISLNALYDITNNFAEKV  321

Query  771   FEKYGWNPIDHLKRAWKCLCSAYITEAKWFATGKSPSANEYLQTGIITTGIPMVLITCFF  592
             ++K+G+NPID LK++W  L +A++ EA+W  +   P A +YL  GI++TG+ +VL+  FF
Sbjct  322   YKKHGFNPIDTLKKSWIRLLNAFMEEARWLNSSHLPRAEDYLNNGIVSTGVHVVLVHAFF  381

Query  591   LLGH--GAFAGTTDIED-----MITSVGAILRLLDDLDATQGEKQDGNDASYVEYYVKEH  433
             LL H  G    T DI D     +I SV  ILRL DDL+  +   Q+G D SY++ +  EH
Sbjct  382   LLDHVNGITKETVDILDEKFPNVIYSVAKILRLSDDLEGAKSGDQNGLDGSYLDCFKSEH  441

Query  432   EGLSISDGKQRIMNMVSEQWKLINKQCLSPTRIPESFSKSCLNIARMVPMMYNYSDTHCL  253
             + +S  + ++ +  M+S +WK +N++ L   +   SFS  CLN ARMV +MY+Y     L
Sbjct  442   QDISGEEVQRHVARMISNEWKCLNQEILVTNKFSSSFSNFCLNAARMVLLMYHYKSNSSL  501

Query  252   PILQKQIMSMFST  214
               LQ+ + S+ + 
Sbjct  502   SNLQEHVKSLINV  514



>gb|KCW74835.1| hypothetical protein EUGRSUZ_E03570 [Eucalyptus grandis]
Length=404

 Score =   360 bits (925),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 178/397 (45%), Positives = 254/397 (64%), Gaps = 11/397 (3%)
 Frame = -2

Query  1380  MALHEASHLSIEGEDVLDEAAKFSRESLIANMV-HLDECQASMVQNTLQYPYHKSLARFT  1204
             M L+EAS +SIEG+D+LDEA  FS + L   +   LD  Q  M+++TL+YPY KS AR  
Sbjct  1     MELYEASQMSIEGDDILDEAKCFSSKCLNELLTCDLDPEQVRMIESTLRYPYRKSFARSL  60

Query  1203  AK-TFIENMRVENEWEATLVNLATMDYSITQSFYQEEFRQILRWWKSLGLKDEL--AKNQ  1033
             A  +F+ +M   N W   L+ +A  +  I QS +Q+E  QI  WWK  GL +E+  A++Q
Sbjct  61    APLSFVNDMPGVNSWIEDLLEVANRERRIVQSMHQKENHQINTWWKESGLGEEMKFARDQ  120

Query  1032  QLKWYIWTLALIPDPSMSRERIELTKPIALVYLIDDIIDVYATFDQTKQFIDAINRWDLS  853
              LKWY+W++A++ DP +S  R+EL KPI+LVY+IDDI DVY   D+   F   I RWD +
Sbjct  121   PLKWYLWSIAILTDPGLSELRVELVKPISLVYIIDDIFDVYGKVDELILFTGVIKRWDDA  180

Query  852   VGEGLPDYMKRCLVVLFDTTNDINNLVFEKYGWNPIDHLKRAWKCLCSAYITEAKWFATG  673
               E LP+YMK+C  VL D TND  N++FEK+GWNP   LK+ W  LC+A++ E +W A+G
Sbjct  181   CAEQLPEYMKKCFKVLSDITNDFGNIIFEKHGWNPTRFLKQMWANLCNAFLVEFQWNASG  240

Query  672   KSPSANEYLQTGIITTGIPMVLITCFFLLGHGAFAGTTD-------IEDMITSVGAILRL  514
               P A++YL+ GIIT+G+P+VL   FF +G      + D       + + I  V  ILRL
Sbjct  241   TLPKADDYLKNGIITSGVPLVLAHLFFQMGQNIANQSMDSKKEEVPLPNTIFLVAEILRL  300

Query  513   LDDLDATQGEKQDGNDASYVEYYVKEHEGLSISDGKQRIMNMVSEQWKLINKQCLSPTRI  334
              DDL   Q E Q+G D SYVE Y++E++G S    ++ +M ++S+ WKL+NK+CLSP   
Sbjct  301   WDDLGCAQNENQNGYDGSYVECYLRENQGSSYQSAREHVMELISKSWKLLNKECLSPCPF  360

Query  333   PESFSKSCLNIARMVPMMYNYSDTHCLPILQKQIMSM  223
                F ++C+N A+MV +MYNY D + L +LQ  + S+
Sbjct  361   SAPFLEACVNAAKMVSLMYNYEDKNGLGLLQDHMKSL  397



>ref|XP_010059416.1| PREDICTED: (3S,6E)-nerolidol synthase 1-like [Eucalyptus grandis]
Length=418

 Score =   358 bits (918),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 169/405 (42%), Positives = 252/405 (62%), Gaps = 7/405 (2%)
 Frame = -2

Query  1413  KEELSKDIRGLMALHEASHLSIEGEDVLDEAAKFSRESLIANMVHLDECQASMVQNTLQY  1234
             K+    DI G  +L EAS L IEGED LD+  + +R+ L +++  LD  Q   V+N+L  
Sbjct  8     KKPQGNDILGFTSLFEASQLGIEGEDALDQVGESTRQRLHSSLADLDHVQTRFVRNSLGN  67

Query  1233  PYHKSLARFTAKTFIENMRVEN-EWEATLVNLATMDYSITQSFYQEEFRQILRWWKSLGL  1057
             P+HKSLARFTA  F+ N    +  W   L  LA +D +I +S +Q E  Q+  WWK LG+
Sbjct  68    PFHKSLARFTANDFLRNFVGHSCSWTKNLGELAHLDMNIVRSVHQREILQVSNWWKELGM  127

Query  1056  KDEL--AKNQQLKWYIWTLALIPDPSMSRERIELTKPIALVYLIDDIIDVYATFDQTKQF  883
               EL  A+NQ +KWYIW +A++ +  +S+ER+ +TKPI+ +Y+IDDI DVY T      F
Sbjct  128   AKELKYARNQPMKWYIWPMAILTETGLSQERVLVTKPISFIYIIDDIFDVYGTIGDLTAF  187

Query  882   IDAINRWDLSVGEGLPDYMKRCLVVLFDTTNDINNLVFEKYGWNPIDHLKRAWKCLCSAY  703
              D +NRW+ +  + +PDYM+ C   L D TN+ +  V++  G NP+  L++ W  L +A+
Sbjct  188   TDVVNRWECTEKDNIPDYMRTCFHALDDITNEFSLAVYKNQGGNPLCPLRKPWASLLNAF  247

Query  702   ITEAKWFATGKSPSANEYLQTGIITTGIPMVLITCFFLLGHGAFAGTTD----IEDMITS  535
             + EA+W A+G SP+  +YL   I+++G+ ++L+  FF+LG      + D    I ++++S
Sbjct  248   LVEARWLASGHSPTTQDYLDNAIVSSGVHVLLVHLFFILGERITPESVDHLENIPEIVSS  307

Query  534   VGAILRLLDDLDATQGEKQDGNDASYVEYYVKEHEGLSISDGKQRIMNMVSEQWKLINKQ  355
               +ILRL DDL + + E QDG D SYVE Y +E  G S    +  +  M+SE WK +NK 
Sbjct  308   TASILRLWDDLGSAEDEFQDGRDGSYVECYKREFHGSSEEAARDHVKKMISEAWKRLNKA  367

Query  354   CLSPTRIPESFSKSCLNIARMVPMMYNYSDTHCLPILQKQIMSMF  220
             CL P    +SFS++ LN ARMVP+MYNY D+H LP+L+  + S+ 
Sbjct  368   CLYPQTFTKSFSRASLNTARMVPLMYNYDDSHSLPLLEHHMKSLL  412



>emb|CBI40952.3| unnamed protein product [Vitis vinifera]
Length=388

 Score =   355 bits (910),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 173/352 (49%), Positives = 246/352 (70%), Gaps = 4/352 (1%)
 Frame = -2

Query  1719  DEFLLKSEGKREWQRGLLYQFQEDDLQVLNVIDAIQHLGIDHHFHDQIGAILQRQYQKVK  1540
             DEF  +   K +  + +  +  ED ++ + +IDAIQ LGIDHHF ++I A+LQ+QY K  
Sbjct  34    DEFYNEHAQKLKEVKHVFSKLGEDAMESMMMIDAIQRLGIDHHFEEEIEAVLQKQYMKSS  93

Query  1539  IDDFQKINGLYDISLSFRLLRQEGYNVSSDVFTKFTSEKGEFKEELSKDIRGLMALHEAS  1360
             I        LY+++L FRLLRQEGY V +DV   F +++G+FK+ L +DIRGLM L+EAS
Sbjct  94    IHG-DCDEDLYEVALRFRLLRQEGYTVPADVLNNFKNKEGKFKQNLREDIRGLMGLYEAS  152

Query  1359  HLSIEGEDVLDEAAKFSRESLIANMVHLDECQASMVQNTLQYPYHKSLARFTAKTFIENM  1180
              LSI GED+L+EA  FS   L A + HLD  QA++V+NTL++P+HKS ARF  K F+ + 
Sbjct  153   QLSI-GEDILEEAGNFSSLLLNACLQHLDRHQAAVVKNTLEHPHHKSWARFMTKNFLTDF  211

Query  1179  RVENEWEATLVNLATMDYSITQSFYQEEFRQILRWWKSLGLKDEL--AKNQQLKWYIWTL  1006
             +  N W   L  LA +D+++ +S +Q+E  QI +WWK LGL +EL  A++Q LKWY+W +
Sbjct  212   QGTNGWINALQELAKIDFNMVKSVHQKEMLQISKWWKDLGLTEELKFARDQPLKWYMWPM  271

Query  1005  ALIPDPSMSRERIELTKPIALVYLIDDIIDVYATFDQTKQFIDAINRWDLSVGEGLPDYM  826
             A+IPDP +S +RIELTKPI+L+Y+IDDI DV  T D+   F +A+NRWDLS  + LP+YM
Sbjct  272   AIIPDPRLSEQRIELTKPISLIYIIDDIFDVGGTLDELTLFTEAVNRWDLSAFKELPEYM  331

Query  825   KRCLVVLFDTTNDINNLVFEKYGWNPIDHLKRAWKCLCSAYITEAKWFATGK  670
             K C   L D TN+I+  V +++ WNP+  L++AW  LC+A++ EAKWFA+G+
Sbjct  332   KMCFKTLDDITNEISTKVHKEHKWNPVGSLRKAWASLCNAFLVEAKWFASGQ  383



>ref|NP_176361.2| terpene synthase 14 [Arabidopsis thaliana]
 sp|Q84UV0.2|LINS_ARATH RecName: Full=S-(+)-linalool synthase, chloroplastic; AltName: 
Full=Terpenoid synthase 14; Short=AtTPS14; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AEE33873.1| terpene synthase 14 [Arabidopsis thaliana]
Length=569

 Score =   358 bits (920),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 176/472 (37%), Positives = 278/472 (59%), Gaps = 14/472 (3%)
 Frame = -2

Query  1635  LNVIDAIQHLGIDHHFHDQIGAILQRQYQKVKIDDFQKINGLYDISLSFRLLRQEGYNVS  1456
             L +ID IQ LGID HF  +I   L   Y+    +  Q    L++I+L FRLLRQEG+ V 
Sbjct  94    LEMIDVIQSLGIDLHFRQEIEQTLHMIYK----EGLQFNGDLHEIALRFRLLRQEGHYVQ  149

Query  1455  SDVFTKFTSEKGEFKEELSKDIRGLMALHEASHLSIEGEDVLDEAAKFSRESLIANMVHL  1276
               +F     +KG FK+ +  D++GL  L EAS L +EGE+ LD A +F+   L       
Sbjct  150   EIIFKNILDKKGGFKDVVKNDVKGLTELFEASELRVEGEETLDGAREFTYSRLNELCSGR  209

Query  1275  DECQASMVQNTLQYPYHKSLARFTAKTFIENMRV----ENEWEATLVNLATMDYSITQSF  1108
             +  Q   +  +L  P HK++   T+K F   +++    + EW  +L+ +A +D    +S 
Sbjct  210   ESHQKQEIMKSLAQPRHKTVRGLTSKRFTSMIKIAGQEDPEWLQSLLRVAEIDSIRLKSL  269

Query  1107  YQEEFRQILRWWKSLGLKD--ELAKNQQLKWYIWTLALIPDPSMSRERIELTKPIALVYL  934
              Q E  Q  +WW  LGL+   E A++Q LKW+ W++ ++ DP+++ +R++LTKPI+LVY+
Sbjct  270   TQGEMSQTFKWWTELGLEKDVEKARSQPLKWHTWSMKILQDPTLTEQRLDLTKPISLVYV  329

Query  933   IDDIIDVYATFDQTKQFIDAINRWDLSVGEGLPDYMKRCLVVLFDTTNDINNLVFEKYGW  754
             IDDI DVY   ++   F   + RWD    + LP YM+ C   L   T +I+  +++ +GW
Sbjct  330   IDDIFDVYGELEELTIFTRVVERWDHKGLKTLPKYMRVCFEALDMITTEISMKIYKSHGW  389

Query  753   NPIDHLKRAWKCLCSAYITEAKWFATGKSPSANEYLQTGIITTGIPMVLITCFFLLGHGA  574
             NP   L+++W  LC A++ EAKWF +G  P+  EY++ G++++G+ +V++  + LLG   
Sbjct  390   NPTYALRQSWASLCKAFLVEAKWFNSGYLPTTEEYMKNGVVSSGVHLVMLHAYILLGEEL  449

Query  573   FAGTTDI----EDMITSVGAILRLLDDLDATQGEKQDGNDASYVEYYVKEHEGLSISDGK  406
                  ++      +++S   ILRL DDL + + E QDG D SYVE Y+ E++G ++ + +
Sbjct  450   TKEKVELIESNPGIVSSAATILRLWDDLGSAKDENQDGTDGSYVECYLNEYKGSTVDEAR  509

Query  405   QRIMNMVSEQWKLINKQCLSPTRIPESFSKSCLNIARMVPMMYNYSDTHCLP  250
               +   +S  WK +N++CL+P     SFSK+CLNIAR VP+MY+Y D   LP
Sbjct  510   THVAQKISRAWKRLNRECLNPCPFSRSFSKACLNIARTVPLMYSYDDDQRLP  561



>gb|AAO85533.1| linalool synthase [Arabidopsis thaliana]
Length=569

 Score =   356 bits (914),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 175/472 (37%), Positives = 276/472 (58%), Gaps = 14/472 (3%)
 Frame = -2

Query  1635  LNVIDAIQHLGIDHHFHDQIGAILQRQYQKVKIDDFQKINGLYDISLSFRLLRQEGYNVS  1456
             L +ID IQ LG D HF   I   L   Y+    +  Q    L++I+L FRLLRQEG+ V 
Sbjct  94    LEMIDVIQSLGTDLHFRQGIEQTLHMIYK----EGLQFNGDLHEIALRFRLLRQEGHYVQ  149

Query  1455  SDVFTKFTSEKGEFKEELSKDIRGLMALHEASHLSIEGEDVLDEAAKFSRESLIANMVHL  1276
               +F     +KG FK+ +  D++GL  L EAS L +EGE+ LD A +F+   L       
Sbjct  150   ESIFKNILDKKGGFKDVVKNDVKGLTELFEASELRVEGEETLDGAREFTYSRLNELCSGR  209

Query  1275  DECQASMVQNTLQYPYHKSLARFTAKTFIENMRV----ENEWEATLVNLATMDYSITQSF  1108
             +  Q   +  +L  P HK++   T+K F   +++    + EW  +L+ +A +D    +S 
Sbjct  210   ESHQKQEIMKSLAQPRHKTVRGLTSKRFTSMIKIAGQEDPEWLQSLLRVAEIDSIRLKSL  269

Query  1107  YQEEFRQILRWWKSLGLKD--ELAKNQQLKWYIWTLALIPDPSMSRERIELTKPIALVYL  934
              Q E  Q  +WW  LGL+   E A++Q LKW+ W++ ++ DP+++ +R++LTKPI+LVY+
Sbjct  270   TQGEMSQTFKWWTELGLEKDVEKARSQPLKWHTWSMKILQDPTLTEQRLDLTKPISLVYV  329

Query  933   IDDIIDVYATFDQTKQFIDAINRWDLSVGEGLPDYMKRCLVVLFDTTNDINNLVFEKYGW  754
             IDDI DVY   ++   F   + RWD    + LP YM+ C   L   T +I+  +++ +GW
Sbjct  330   IDDIFDVYGELEELTIFTRVVERWDHKGLKTLPKYMRVCFEALDMITTEISMKIYKSHGW  389

Query  753   NPIDHLKRAWKCLCSAYITEAKWFATGKSPSANEYLQTGIITTGIPMVLITCFFLLGHGA  574
             NP   L+++W  LC A++ EAKWF +G  P+  EY++ G++++G+ +V++  + LLG   
Sbjct  390   NPTYALRQSWASLCKAFLVEAKWFNSGYLPTTEEYMKNGVVSSGVHLVMLHAYILLGEEL  449

Query  573   FAGTTDI----EDMITSVGAILRLLDDLDATQGEKQDGNDASYVEYYVKEHEGLSISDGK  406
                  ++      +++S   ILRL DDL + + E QDG D SYVE Y+ E++G ++ + +
Sbjct  450   TKEKVELIESNPGIVSSAATILRLWDDLGSAKDENQDGTDGSYVECYLNEYKGSTVDEAR  509

Query  405   QRIMNMVSEQWKLINKQCLSPTRIPESFSKSCLNIARMVPMMYNYSDTHCLP  250
               +   +S  WK +N++CL+P     SFSK+CLNIAR VP+MY+Y D   LP
Sbjct  510   THVAQKISRAWKRLNRECLNPCPFSRSFSKACLNIARTVPLMYSYDDDQRLP  561



>ref|XP_006841714.1| hypothetical protein AMTR_s00003p00254990 [Amborella trichopoda]
 gb|ERN03389.1| hypothetical protein AMTR_s00003p00254990 [Amborella trichopoda]
Length=550

 Score =   355 bits (911),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 188/483 (39%), Positives = 292/483 (60%), Gaps = 8/483 (2%)
 Frame = -2

Query  1650  DDLQVLNVIDAIQHLGIDHHFHDQIGAILQRQYQKVKIDDFQKINGLYDISLSFRLLRQE  1471
             DD + + +ID IQ L I +HF  +IG  L R Y+   + D    + LY +SL FRLLRQ 
Sbjct  62    DDTETMVLIDNIQRLSISYHFEAEIGERLDRIYRSGIVGDCD--DDLYIVSLGFRLLRQH  119

Query  1470  GYNVSSDVFTKFTSEKGEFKEELSKDIRGLMALHEASHLSIEGEDVLDEAAKFSRESLIA  1291
             GY VS+DVF KF  E G F   LSKD+ G+++L+EASHL I+GE+ +DEA  FS + L A
Sbjct  120   GYRVSADVFNKFKDESGNFNSCLSKDVIGILSLYEASHLGIQGEEYMDEALAFSLKHLKA  179

Query  1290  NMVHLDECQASMVQNTLQYPYHKSLARFTAKTFIENMRVENEWEATLVNLATMDYSITQS  1111
             +   L+   A  V++ L+ P H  + R  +  +I+    +      L+  A MD+++ Q+
Sbjct  180   SGSRLEPELAKTVKHALELPMHFRMPRLESMYYIKVSERDLGRNQDLLEFAVMDFNMVQA  239

Query  1110  FYQEEFRQILRWWKSLGLKDEL--AKNQQLKWYIWTLALIPDPSMSRERIELTKPIALVY  937
              +++E +++ RWW+ LGL D L  A+++  +W++W + +  +   S  R++LTK +A ++
Sbjct  240   MHKQELKEVTRWWRDLGLADMLTFARDKIHEWFMWPVVISSESEFSVGRVDLTKVVAFIH  299

Query  936   LIDDIIDVYATFDQTKQFIDAINRWDLSVGEGLPDYMKRCLVVLFDTTNDINNLVFEKYG  757
             +IDDI D+Y T D+ +QF DAI RWD  V  GLP+YMK C +VL+D  +DI+  +F+ +G
Sbjct  300   IIDDIYDIYGTLDELQQFTDAIKRWDPMVTRGLPEYMKTCYLVLYDVASDISFKIFKNHG  359

Query  756   WNPIDHLKRAWKCLCSAYITEAKWFATGKSPSANEYLQTGIITTGIPMVLITCFFLLGHG  577
              N + HL++AW  LC A++ EA WF  G  PS  EYL+ G+ ++G+ + L+  F LL   
Sbjct  360   LNVMGHLRQAWTSLCEAFLVEATWFNCGYVPSKEEYLKNGVTSSGVHVALVHAFLLLSPH  419

Query  576   AFAGTTDI----EDMITSVGAILRLLDDLDATQGEKQDGNDASYVEYYVKEHEGLSISDG  409
                 T ++      +I S  +ILRL DDL AT  EK+ G D SY+E Y+K+H+  +  + 
Sbjct  420   VTRETVELASHNSQLILSPASILRLWDDLSATVDEKERGYDPSYIECYIKQHKDETEENA  479

Query  408   KQRIMNMVSEQWKLINKQCLSPTRIPESFSKSCLNIARMVPMMYNYSDTHCLPILQKQIM  229
             KQ   ++++  WK +N++CL P+  P S +K  LN +RMV +MY          L+ Q+ 
Sbjct  480   KQHTRDLIATMWKKLNQECLDPSPFPHSITKMALNSSRMVQVMYQSEIDSVGSTLKDQMK  539

Query  228   SMF  220
             S+ 
Sbjct  540   SLL  542



>ref|XP_003573593.1| PREDICTED: (3S,6E)-nerolidol synthase 1 [Brachypodium distachyon]
Length=549

 Score =   353 bits (905),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 176/483 (36%), Positives = 292/483 (60%), Gaps = 14/483 (3%)
 Frame = -2

Query  1677  RGLLYQFQEDDLQVLNVIDAIQHLGIDHHFHDQIGAILQRQYQKVKIDDFQKINGLYDIS  1498
             + LL Q  +    ++  +D ++ L IDH+F D+I +++ R    +  DD      L+D +
Sbjct  69    QALLRQHPKSSHGMITTVDHLKRLCIDHYFQDEIDSVVDRCVDLIHTDD------LFDAT  122

Query  1497  LSFRLLRQEGYNVSSD-VFTKFTSEKGEFKEELSKDIRGLMALHEASHLSIEGEDVLDEA  1321
             LS RL+R+ GY+VS+D V  KF +  GEF    SKDI+GL++L + SHL++ GE  L +A
Sbjct  123   LSLRLMREAGYHVSADEVLGKFANGNGEFNHGHSKDIKGLLSLQDMSHLNM-GEASLYKA  181

Query  1320  AKFSRESLIANMVHLDECQASMVQNTLQYPYHKSLARFTAKTFIENMRVENEWEATLVNL  1141
              +FS + L +   +L+   A  V+ +L +PYH SL ++ A+  +  ++        +  L
Sbjct  182   KEFSSKHLRSATKYLEPNLARYVRQSLDHPYHVSLNQYKARHHLSYLQSLPTRNTAMEEL  241

Query  1140  ATMDYSITQSFYQEEFRQILRWWKSLGLKDEL--AKNQQLKWYIWTLALIPDPSMSRERI  967
             A  ++ + +  +Q E +++ RWW  LGL  E+  A++Q LKWY+W + ++P    SR RI
Sbjct  242   ALAEFQLNKMMHQREMQEVKRWWMDLGLAQEIPAARDQVLKWYMWPMTVLPGLPFSRYRI  301

Query  966   ELTKPIALVYLIDDIIDVYATFDQTKQFIDAINRWDLSVGEGLPDYMKRCLVVLFDTTND  787
             E+TK I+L+Y++DDI D+ AT ++   F  AI +WD +  + LP YM  C   L+  TND
Sbjct  302   EMTKIISLIYIVDDIFDLVATQEELSLFNRAIKKWDFAAADSLPTYMISCFKALYTVTND  361

Query  786   INNLVFEKYGWNPIDHLKRAWKCLCSAYITEAKWFATGKSPSANEYLQTGIITTGIPMVL  607
             I +++  ++G NPIDHLK+AW  L   ++ E KW ++ ++P+  +YL+ GI+T+G P+V 
Sbjct  362   IVDMIRNEHGLNPIDHLKKAWATLFDGFMVETKWLSSNQAPAPEDYLRNGIVTSGAPLVF  421

Query  606   ITCFFLLGHGAFAGTTD-IEDMITSVGAILRLLDDLDATQGEKQDGNDASYVEYYVKEHE  430
                FF+LGHG      D I  +++    I+RL+DD+ + + E QDG D SY E Y++E+ 
Sbjct  422   QHLFFMLGHGLTEIDRDRIPRIVSCPAKIMRLMDDMGSAKDEAQDGLDGSYKELYMRENP  481

Query  429   GLSISDGKQRIMNMVSEQWKLINKQCLSPTRIPESFSKSCLNIARMVPMMYNYSDTHCLP  250
               ++   ++ ++ MV+ +W+ IN++C S +    +F  + LN ARMV +MY Y D   LP
Sbjct  482   HDNV---EEHMLEMVAGEWEEINRECFSKSSFSPTFVGASLNFARMVGIMYGYDDEQRLP  538

Query  249   ILQ  241
             +L+
Sbjct  539   VLE  541



>ref|NP_001267920.1| geraniol synthase [Vitis vinifera]
 gb|ADR74218.1| geraniol synthase [Vitis vinifera]
Length=595

 Score =   354 bits (909),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 178/471 (38%), Positives = 279/471 (59%), Gaps = 15/471 (3%)
 Frame = -2

Query  1650  DDLQVLNVIDAIQHLGIDHHFHDQIGAILQRQYQKVKIDDFQKINGLYDISLSFRLLRQE  1471
             D    + ++D ++ LG+ +HF D+I A+LQR        D+     L+  +L FRLLRQ 
Sbjct  101   DSRAAMEMVDTVERLGLSYHFEDEINALLQR------FCDWNASEDLFTTALRFRLLRQN  154

Query  1470  GYNVSSDVFTKFTSEKGEFKEELSKDIRGLMALHEASHLSIEGEDVLDEAAKFSRESLIA  1291
             G+   SDVF KF  + G+FKE L++DIRG+++LHEASHL  + E+VL EA +F+R  LI 
Sbjct  155   GFPTHSDVFGKFMDKNGKFKESLTEDIRGMLSLHEASHLGAKNEEVLAEAKEFTRIHLIQ  214

Query  1290  NMVHLDECQASMVQNTLQYPYHKSLARFTAKTFIENMRVENEWEATLVNLATMDYSITQS  1111
             +M H++   +S V   L+ P H  + R  A+ +I     E+      + LA +D+ + QS
Sbjct  215   SMPHMEPHFSSHVGRALELPRHLRMVRLEARNYIGEYSRESNPNLAFLELAKLDFDMVQS  274

Query  1110  FYQEEFRQILRWWKSLGLKDEL--AKNQQLKWYIWTLALIPDPSMSRERIELTKPIALVY  937
              +Q+E  +ILRWWK LGL D+L  A+++ ++ ++WT+ + PDP  S  RIELTK IA++ 
Sbjct  275   LHQKELAEILRWWKQLGLVDKLDFARDRPMECFLWTVGIFPDPRHSSCRIELTKAIAILL  334

Query  936   LIDDIIDVYATFDQTKQFIDAINRWDLSVGEGLPDYMKRCLVVLFDTTNDINNLVFEKYG  757
             +IDDI D Y + D+   F DA+ RWDL   + LP+YMK C + L++TTNDI   + +++G
Sbjct  335   VIDDIYDSYGSLDELALFTDAVKRWDLGAMDQLPEYMKICYMALYNTTNDIAYRILKEHG  394

Query  756   WNPIDHLKRAWKCLCSAYITEAKWFATGKSPSANEYLQTGIITTGIPMVLITCFFLLGHG  577
             W+ I+HLKR W  +  A++ EA  F  G  PS  EYL   + T G  M L+  FFL+G G
Sbjct  395   WSVIEHLKRTWMDIFGAFLAEAYCFKGGHVPSLEEYLTNAVTTGGTYMALVHAFFLMGQG  454

Query  576   A----FAGTTDIEDMITSVGAILRLLDDLDATQGEKQDGNDASYVEYYVKEHEGLSISDG  409
                   A      ++ +  G ILRL DDL   + E++ G++AS +E Y +E E  ++ + 
Sbjct  455   VTRENMAMLKPYPNIFSCSGKILRLWDDLGTAREEQERGDNASSIECYKREREMDTVLED  514

Query  408   ---KQRIMNMVSEQWKLINKQCLSPTRIPESFSKSCLNIARMVPMMYNYSD  265
                ++ I  M+   W  +N + ++ + +P S  K+  N++R   ++Y + D
Sbjct  515   EACRKHIRQMIQSLWVELNGELVASSALPLSIIKAAFNLSRTAQVIYQHGD  565



>ref|NP_001185286.1| terpene synthase 14 [Arabidopsis thaliana]
 gb|AEE33874.1| terpene synthase 14 [Arabidopsis thaliana]
Length=562

 Score =   351 bits (900),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 175/472 (37%), Positives = 277/472 (59%), Gaps = 21/472 (4%)
 Frame = -2

Query  1635  LNVIDAIQHLGIDHHFHDQIGAILQRQYQKVKIDDFQKINGLYDISLSFRLLRQEGYNVS  1456
             L +ID IQ LGID HF  +I   L   Y+    +  Q    L++I+L FRLLRQEG+ V 
Sbjct  94    LEMIDVIQSLGIDLHFRQEIEQTLHMIYK----EGLQFNGDLHEIALRFRLLRQEGHYVQ  149

Query  1455  SDVFTKFTSEKGEFKEELSKDIRGLMALHEASHLSIEGEDVLDEAAKFSRESLIANMVHL  1276
              +       +KG FK+ +  D++GL  L EAS L +EGE+ LD A +F+   L       
Sbjct  150   EN-------KKGGFKDVVKNDVKGLTELFEASELRVEGEETLDGAREFTYSRLNELCSGR  202

Query  1275  DECQASMVQNTLQYPYHKSLARFTAKTFIENMRV----ENEWEATLVNLATMDYSITQSF  1108
             +  Q   +  +L  P HK++   T+K F   +++    + EW  +L+ +A +D    +S 
Sbjct  203   ESHQKQEIMKSLAQPRHKTVRGLTSKRFTSMIKIAGQEDPEWLQSLLRVAEIDSIRLKSL  262

Query  1107  YQEEFRQILRWWKSLGLKD--ELAKNQQLKWYIWTLALIPDPSMSRERIELTKPIALVYL  934
              Q E  Q  +WW  LGL+   E A++Q LKW+ W++ ++ DP+++ +R++LTKPI+LVY+
Sbjct  263   TQGEMSQTFKWWTELGLEKDVEKARSQPLKWHTWSMKILQDPTLTEQRLDLTKPISLVYV  322

Query  933   IDDIIDVYATFDQTKQFIDAINRWDLSVGEGLPDYMKRCLVVLFDTTNDINNLVFEKYGW  754
             IDDI DVY   ++   F   + RWD    + LP YM+ C   L   T +I+  +++ +GW
Sbjct  323   IDDIFDVYGELEELTIFTRVVERWDHKGLKTLPKYMRVCFEALDMITTEISMKIYKSHGW  382

Query  753   NPIDHLKRAWKCLCSAYITEAKWFATGKSPSANEYLQTGIITTGIPMVLITCFFLLGHGA  574
             NP   L+++W  LC A++ EAKWF +G  P+  EY++ G++++G+ +V++  + LLG   
Sbjct  383   NPTYALRQSWASLCKAFLVEAKWFNSGYLPTTEEYMKNGVVSSGVHLVMLHAYILLGEEL  442

Query  573   FAGTTDI----EDMITSVGAILRLLDDLDATQGEKQDGNDASYVEYYVKEHEGLSISDGK  406
                  ++      +++S   ILRL DDL + + E QDG D SYVE Y+ E++G ++ + +
Sbjct  443   TKEKVELIESNPGIVSSAATILRLWDDLGSAKDENQDGTDGSYVECYLNEYKGSTVDEAR  502

Query  405   QRIMNMVSEQWKLINKQCLSPTRIPESFSKSCLNIARMVPMMYNYSDTHCLP  250
               +   +S  WK +N++CL+P     SFSK+CLNIAR VP+MY+Y D   LP
Sbjct  503   THVAQKISRAWKRLNRECLNPCPFSRSFSKACLNIARTVPLMYSYDDDQRLP  554



>ref|XP_010657362.1| PREDICTED: geraniol synthase isoform X1 [Vitis vinifera]
Length=511

 Score =   348 bits (893),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 176/486 (36%), Positives = 286/486 (59%), Gaps = 15/486 (3%)
 Frame = -2

Query  1650  DDLQVLNVIDAIQHLGIDHHFHDQIGAILQRQYQKVKIDDFQKINGLYDISLSFRLLRQE  1471
             D    + ++D ++ LG+ +HF  +I A+LQR        D+     L+  +L FRLLRQ 
Sbjct  17    DSRAAMEMVDTVERLGLSYHFEGEINALLQR------FCDWNASEDLFTTALRFRLLRQN  70

Query  1470  GYNVSSDVFTKFTSEKGEFKEELSKDIRGLMALHEASHLSIEGEDVLDEAAKFSRESLIA  1291
             G+   SDVF KF  + G+FKE L++DI G+++LHEASHL  + E+VL EA +F+R  LI 
Sbjct  71    GFPTHSDVFGKFMDKNGKFKESLTEDIWGMLSLHEASHLGAKNEEVLAEAKEFTRIHLIQ  130

Query  1290  NMVHLDECQASMVQNTLQYPYHKSLARFTAKTFIENMRVENEWEATLVNLATMDYSITQS  1111
             +M H++   +S V   L+ P H  +AR  A+ +I+    E+   + L+ LA +D+ + QS
Sbjct  131   SMPHMEPHFSSHVGRALELPRHLRMARLEARNYIDEYSRESNPNSVLLELAKLDFDMVQS  190

Query  1110  FYQEEFRQILRWWKSLGLKDEL--AKNQQLKWYIWTLALIPDPSMSRERIELTKPIALVY  937
              +Q+E  +I+RWWK LGL D+L  A+++ ++ ++WT+ + PDP  S  RIELTK IA++ 
Sbjct  191   LHQKELAEIVRWWKQLGLVDKLDFARDRPMECFLWTVGIFPDPRHSSCRIELTKAIAILL  250

Query  936   LIDDIIDVYATFDQTKQFIDAINRWDLSVGEGLPDYMKRCLVVLFDTTNDINNLVFEKYG  757
             +IDDI D Y + D+   F DA+ RWDL   + LP+YMK C + L++TTNDI   + +++G
Sbjct  251   VIDDIYDSYGSLDELALFTDAVKRWDLGAMDQLPEYMKICYMALYNTTNDIAYRILKEHG  310

Query  756   WNPIDHLKRAWKCLCSAYITEAKWFATGKSPSANEYLQTGIITTGIPMVLITCFFLLGHG  577
             W+ I+ LKR W  +  A++ EA  F  G  PS  EYL   + T G  M L+  FFL+G G
Sbjct  311   WSVIEDLKRTWMDIFGAFLAEAYCFKGGHVPSLEEYLTNAVTTGGTYMALVHAFFLMGQG  370

Query  576   A----FAGTTDIEDMITSVGAILRLLDDLDATQGEKQDGNDASYVEYYVKEHEGLSISDG  409
                   A      ++ +  G ILRL DDL   + E++ G++AS +E Y +E E  ++ + 
Sbjct  371   VTRENMAMLKPYPNIFSCSGKILRLWDDLGTAREEQERGDNASSIECYKREREMDTVLED  430

Query  408   ---KQRIMNMVSEQWKLINKQCLSPTRIPESFSKSCLNIARMVPMMYNYSDTHCLPILQK  238
                ++ I  M+   W  +N + ++ + +P S  K+  N++R   ++Y + D +    ++ 
Sbjct  431   EACRKHIRQMIQSLWVELNGELVASSALPLSIIKAAFNLSRTAQVIYQHGDDNKTSSVED  490

Query  237   QIMSMF  220
              + ++ 
Sbjct  491   HVQALL  496



>gb|KDP32232.1| hypothetical protein JCGZ_13839 [Jatropha curcas]
Length=551

 Score =   348 bits (892),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 182/465 (39%), Positives = 274/465 (59%), Gaps = 20/465 (4%)
 Frame = -2

Query  1635  LNVIDAIQHLGIDHHFHDQIGAILQRQYQKVKIDDFQKING--LYDISLSFRLLRQEGYN  1462
             + +ID+IQ LGI +HF ++I  +L+R  +         ING  L   +L FRLLR  G  
Sbjct  80    MKLIDSIQRLGIGYHFEEEISMLLERILE-------WNINGHDLLTSALRFRLLRHNGLP  132

Query  1461  VSSDVFTKFTSEKGEFKEELSKDIRGLMALHEASHLSIEGEDVLDEAAKFSRESLIANMV  1282
             V SDVF KF ++ G+FKE LSKD  GL++LHEAS+L  + E  L  A +F+R  L   + 
Sbjct  133   VYSDVFRKFMNKNGKFKESLSKDTMGLLSLHEASYLGSKDEAELVHAMEFTRNYLQGYI-  191

Query  1281  HLDECQASMVQNTLQYPYHKSLARFTAKTFIENMRVENEWEATLVNLATMDYSITQSFYQ  1102
                  Q   +   L+ P H  + R  A+ +I+   ++     TL  LA +DY+  QS +Q
Sbjct  192   ----AQNKKIGQALELPRHLRMTRLEARNYIDEYSLQTNHSQTLFQLAKLDYNAVQSLHQ  247

Query  1101  EEFRQILRWWKSLGLKDEL--AKNQQLKWYIWTLALIPDPSMSRERIELTKPIALVYLID  928
             +E  +I+RWWK LGL ++L  A+++ L+ Y+WT+ + P P  S  RI+LTK +A++ +ID
Sbjct  248   KELVEIVRWWKELGLVEKLGFARDRPLECYLWTVGIFPQPYDSNSRIQLTKTVAILLVID  307

Query  927   DIIDVYATFDQTKQFIDAINRWDLSVGEGLPDYMKRCLVVLFDTTNDINNLVFEKYGWNP  748
             DI D Y +F     F DA+ RWDLS  E LP+YMK C + L++TTNDI  +V ++ GW+ 
Sbjct  308   DIFDTYGSFSDLILFTDAVRRWDLSAIESLPEYMKICYMALYNTTNDIAYMVLKQNGWSI  367

Query  747   IDHLKRAWKCLCSAYITEAKWFATGKSPSANEYLQTGIITTGIPMVLITCFFLLGHGAFA  568
             + HLKR W  +  A++TEAKWF  G  P+  EYL  G+ T G  M L+  FFLLG G   
Sbjct  368   VPHLKRTWIDMFEAFLTEAKWFKNGYVPTLEEYLVNGVTTGGTYMALVHSFFLLGQGVTK  427

Query  567   GTTDI----EDMITSVGAILRLLDDLDATQGEKQDGNDASYVEYYVKEHEGLSISDGKQR  400
              T  +     D+ TS G ILRL DDL  ++ E++ G+ AS +E ++KE       +G++ 
Sbjct  428   ETITMLEPYPDLFTSAGKILRLWDDLGTSREEQERGDVASSIECFMKEKAISCEGEGRKE  487

Query  399   IMNMVSEQWKLINKQCLSPTRIPESFSKSCLNIARMVPMMYNYSD  265
             +  ++   W  +N + ++P+R+P S   +  N+AR   ++Y + D
Sbjct  488   VRQLIRNLWVELNGELIAPSRMPLSTINASFNLARTAQIVYQHGD  532



>ref|XP_002451414.1| hypothetical protein SORBIDRAFT_04g001760 [Sorghum bicolor]
 gb|EES04390.1| hypothetical protein SORBIDRAFT_04g001760 [Sorghum bicolor]
Length=477

 Score =   345 bits (884),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 173/477 (36%), Positives = 291/477 (61%), Gaps = 20/477 (4%)
 Frame = -2

Query  1635  LNVIDAIQHLGIDHHFHDQIGAILQRQYQKVKIDDFQKINGLYDISLSFRLLRQEGYNVS  1456
             +  +D ++ L IDH+F ++I + +      +   D          +LSFRL+R+ G++VS
Sbjct  1     MATVDNLKRLCIDHYFEEEIESAMSSTCMDLLHSDDLLD-----ATLSFRLMRETGHHVS  55

Query  1455  SD-VFTKFTSEKGEFKEELSKDIRGLMALHEASHLSIEGEDVLDEAAKFSRESLIANMVH  1279
             +D V  +FT+  G+F   LSKD  GL++LH+ SHL I  E  L EA +FSR+ L + + +
Sbjct  56    ADDVLRRFTNGAGKFSLALSKDTMGLLSLHDMSHLDIGEEQTLHEAKEFSRKHLASAISN  115

Query  1278  LDECQASMVQNTLQYPYHKSLARFTAK---TFIENMRVENEWEATLVNLATMDYSITQSF  1108
             ++   A  V+ +L +PYH SL ++ A+   ++++N+   +   A +  LA  ++ + +  
Sbjct  116   MEPGLARYVRQSLDHPYHLSLMQYKARHHLSYLQNLPSRST--AAMEELAVAEFQLNKML  173

Query  1107  YQEEFRQILRWWKSLGLKDEL--AKNQQLKWYIWTLALIPDPSMSRERIELTKPIALVYL  934
             +Q E ++I RWW +LGL  E+  A++Q LKWY W++ ++   S S+ R+E+TK I++ Y+
Sbjct  174   HQMEMKEIKRWWMNLGLAQEIPVARDQVLKWYTWSMTILQGSSFSKYRVEITKIISIAYV  233

Query  933   IDDIIDVYATFDQTKQFIDAINRWDLSVGEGLPDYMKRCLVVLFDTTNDINNLVFEKYGW  754
             +DDI D+  T ++   F +AI  WD++  + LP YM+ C   L+  TN++ ++   ++G 
Sbjct  234   VDDIFDLVGTLEELSLFTEAIKMWDVAAADSLPCYMRSCYKALYTVTNEMADMAENEHGL  293

Query  753   NPIDHLKRAWKCLCSAYITEAKWFATGKSPSANEYLQTGIITTGIPMVLITCFFLLGH--  580
             NPIDHL++AW  L  A++ EAKW AT + PSA+EYL+ G+IT+ +P+  +   FLLGH  
Sbjct  294   NPIDHLRKAWAMLFDAFMVEAKWLATDQVPSADEYLRNGVITSVVPLAFVHILFLLGHHH  353

Query  579   ---GAFAGTTD-IEDMITSVGAILRLLDDLDATQGEKQDGNDASYVEYYVKEHEGLSISD  412
                G  A  +D I   ITS+  ILRL DD+ + + E Q+G D SY E Y++EH   +  D
Sbjct  354   AASGNAAELSDSIPPAITSLSKILRLWDDMGSAKDEAQEGLDGSYRELYLREHPA-AAGD  412

Query  411   GKQRIMNMVSEQWKLINKQCLSPTRIPESFSKSCLNIARMVPMMYNYSDTHCLPILQ  241
              ++ +  +++++W+ +N++C S        +++CLN ARMV +MY Y   H LP+L+
Sbjct  413   VEEHMRRLIAKEWQELNRECFSRRTFSSCLAQACLNAARMVSVMYMYDKEHRLPVLE  469



>ref|XP_002451418.1| hypothetical protein SORBIDRAFT_04g001800 [Sorghum bicolor]
 gb|EES04394.1| hypothetical protein SORBIDRAFT_04g001800 [Sorghum bicolor]
Length=595

 Score =   348 bits (894),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 176/514 (34%), Positives = 320/514 (62%), Gaps = 19/514 (4%)
 Frame = -2

Query  1755  LRSEKMTVTLSKDEFLLKSEGKREWQRGLLYQFQEDDLQVLNVIDAIQHLGIDHHFHDQI  1576
             +R   M+ +L +++F L+ EG  + Q+ +L+Q Q++  +++  ID ++ L IDH+F ++I
Sbjct  56    IRPMAMSNSLLRNDFDLQ-EGLTDVQK-ILHQRQKNAREMMITIDNLKRLCIDHYFKEEI  113

Query  1575  GAILQRQYQKVKIDDFQKINGLYDISLSFRLLRQEGYNVSS-DVFTKFTSEKG-EFKEEL  1402
              +++          D    + L+D +L+FRLLR+ G++VS+ DV  +FT +   EFK  L
Sbjct  114   ESVMSSTCM-----DLIHSDDLFDATLAFRLLREAGHDVSANDVSQRFTKDDSCEFKLPL  168

Query  1401  SKDIRGLMALHEASHLSIEGEDVLDEAAKFSRESLIANMVHLDECQASMVQNTLQYPYHK  1222
             SKDIRGL++LH+ SHL+I GE +L +A +FS + L + + +L+   A  V+ +L +PYH 
Sbjct  169   SKDIRGLLSLHDMSHLNIGGEALLYKAKEFSSKHLASAIRYLEPSLAEYVRQSLDHPYHL  228

Query  1221  SLARFTAK---TFIENMRVENEWEATLVNLATMDYSITQSFYQEEFRQILRWWKSLGLKD  1051
             SL ++ A+   T+++++ +    +  +  LA  ++ + +  +Q+E ++I RWW  LGL  
Sbjct  229   SLMQYKARHHLTYLQSLPIR---DTAVEKLAVTEFQLNKLMHQKEIQEIKRWWMDLGLVQ  285

Query  1050  EL--AKNQQLKWYIWTLALIPDPSMSRERIELTKPIALVYLIDDIIDVYATFDQTKQFID  877
             E+   ++Q LKWY+W++  +   S SR R+E+TK IAL+Y++DDI D+  T ++   F +
Sbjct  286   EIPIVRDQVLKWYMWSMTTLQGYSFSRYRVEITKIIALIYVVDDIFDLVGTLEELSHFTE  345

Query  876   AINRWDLSVGEGLPDYMKRCLVVLFDTTNDINNLVFEKYGWNPIDHLKRAWKCLCSAYIT  697
             A+  W+ +  + LP YM+ C   L+  TN+I ++  +++G NP++HL++AW  L  A++ 
Sbjct  346   AVKVWNTAAADSLPSYMRSCYKALYTITNEIADMAKQEHGLNPVNHLRKAWVVLFDAFMV  405

Query  696   EAKWFATGKSPSANEYLQTGIITTGIPMVLITCFFLLGHGAFAGTT--DIEDMITSVGAI  523
             EAKW    + P+A +YL+ G++T+G+P+ L+  F +LG      T    +  +I+    I
Sbjct  406   EAKWLTMDQVPTAEDYLRNGVVTSGLPLTLVHIFIMLGCDQSTETLIDHMPSVISCPAKI  465

Query  522   LRLLDDLDATQGEKQDGNDASYVEYYVKEHEGLSISDGKQRIMNMVSEQWKLINKQCLSP  343
             LRL DD+ + + E Q+G D SY ++Y+ E+     SD +  + ++++ +W+ +N++CL  
Sbjct  466   LRLWDDMGSAKDEAQEGIDGSYRDFYLMENPRCGPSDAEAHMRSLIAREWEELNRECLCR  525

Query  342   TRIPESFSKSCLNIARMVPMMYNYSDTHCLPILQ  241
                  +F+ +CLNI RM+ +MY+Y+  H L +L+
Sbjct  526   RTFSSNFTHACLNITRMISVMYSYNKEHRLLVLE  559



>ref|XP_010908315.1| PREDICTED: probable terpene synthase 11 [Elaeis guineensis]
Length=567

 Score =   347 bits (889),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 187/519 (36%), Positives = 297/519 (57%), Gaps = 16/519 (3%)
 Frame = -2

Query  1800  RTPVVFRCQSVNSSSLRSEKMTVTLSKDEFLLKSEGKREWQRGLLYQFQEDDLQVLNV-I  1624
             R    F+C    S     + M V L    F  + E  +E  R +L  F   DL+   V +
Sbjct  37    RVSDTFKCIQCYSLPTSQDNM-VHLEASSFNPRIEELKEGVRKIL--FNNIDLRAAMVLV  93

Query  1623  DAIQHLGIDHHFHDQIGAILQRQYQKVKIDDFQKINGLYDISLSFRLLRQEGYNVSSDVF  1444
             D +QHLGI +HF ++   +L R Y     DD      L+  +L FRLLRQ GY+V+ DVF
Sbjct  94    DTLQHLGIGYHFEEETNGVLDRCYGTRSDDD-----DLFITALRFRLLRQGGYSVTPDVF  148

Query  1443  TKFTSEKGEFKEELSKDIRGLMALHEASHLSIEGEDVLDEAAKFSRESLIANMVHLDECQ  1264
              KF   KG FK+ L+K+   L++LHEAS L  + E+VL +A +F++  L  + +  +   
Sbjct  149   HKFMDNKGNFKDPLAKNRMALLSLHEASFLGAKDEEVLSQAMEFTKHHLQKSKLVSETSV  208

Query  1263  ASMVQNTLQYPYHKSLARFTAKTFIENMRVENEWEATLVNLATMDYSITQSFYQEEFRQI  1084
             A  +   L++P  + + R  A++FIE  R E    + ++ LAT+D+++ QS YQ+E  ++
Sbjct  209   ARDIGLALEFPRQRRMERLEARSFIEKYRKECGRSSAMLELATLDFNMVQSLYQKEIAEL  268

Query  1083  LRWWKSLGLKDEL--AKNQQLKWYIWTLALIPDPSMSRERIELTKPIALVYLIDDIIDVY  910
               WW+ LG+  +L  A+++ L+ ++WT+ L P+P +S  RIE+TK +A++ +IDD+ D Y
Sbjct  269   ESWWRDLGVTKKLSFARDRPLECFLWTVGLFPEPCLSTCRIEVTKAVAILVVIDDMYDSY  328

Query  909   ATFDQTKQFIDAINRWDLSVGEGLPDYMKRCLVVLFDTTNDINNLVFEKYGWNPIDHLKR  730
              + +    F +AI RW++   E LP+YMK C V L++T ND+   V ++YGW  I HL++
Sbjct  329   GSLEDLNLFTNAIQRWEIGEIEKLPEYMKICYVALYNTINDVGYKVLKEYGWFIIPHLRK  388

Query  729   AWKCLCSAYITEAKWFATGKSPSANEYLQTGIITTGIPMVLITCFFLLGHGAFAGTTDIE  550
              W  LC AY TEA+WF+ G  P+  +Y+  G+ + G  + L+  FFL G      T+ + 
Sbjct  389   TWVDLCEAYFTEARWFSNGVVPNLEDYVSNGVTSVGTYVALVLAFFLTGKQVNKETSSLV  448

Query  549   D----MITSVGAILRLLDDLDATQGEKQDGNDASYVEYYVKEHEGLSISDGKQRIMNMVS  382
             +    + TS G I RL DDL     E+Q G+ AS +E Y+ E+   S  + +  I N+++
Sbjct  449   NSWPKLFTSAGRIFRLWDDLGTAMAEQQRGDVASSIECYMNEN-STSQDEARVHIRNLIN  507

Query  381   EQWKLINKQCLSPTRIPESFSKSCLNIARMVPMMYNYSD  265
               W+ +NK+C + T++P S  K+ LN+AR    MY + D
Sbjct  508   SSWQDLNKECYAMTQLPRSIIKASLNLARTSQDMYRHGD  546



>gb|EMT19528.1| Linalool synthase, chloroplastic [Aegilops tauschii]
Length=550

 Score =   345 bits (886),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 185/488 (38%), Positives = 291/488 (60%), Gaps = 22/488 (5%)
 Frame = -2

Query  1677  RGLLYQFQEDDLQVLNVIDAIQHLGIDHHFHDQIGAILQRQYQKVKIDDFQKINGLYDIS  1498
             + LL+        +L  +D ++ L IDH+F D+I  I+      +  DD      L D +
Sbjct  68    QALLHHHPTSGRGLLTTVDHLKRLCIDHYFQDEIDTIMDSCADLIHGDD------LLDAT  121

Query  1497  LSFRLLRQEGYNVSSD-VFTKFTSEKGEFKEELSKDIRGLMALHEASHLSIEGEDVLDEA  1321
             LS RL+R+ GY+VS+D V  KF  + G+F   LSKDIRGL++L + SHL++ GE  L +A
Sbjct  122   LSLRLMREAGYSVSADDVLRKFAHDNGDFNLGLSKDIRGLLSLQDMSHLNM-GESSLYKA  180

Query  1320  AKFSRESLIANMVHLDECQASMVQNTLQYPYHKSLARFTAK---TFIENMRVENEWEATL  1150
              +FS   L   + +L+   A  V+ +L +PYH SL ++ A+   ++++N+   N     +
Sbjct  181   NEFSSRHLRFAIKYLEPNLARYVRQSLDHPYHVSLMQYKARHHLSYMQNLPTRN---MAI  237

Query  1149  VNLATMDYSITQSFYQEEFRQILRWWKSLGLKDEL--AKNQQLKWYIWTLALIPDPSMSR  976
              NLA  ++ I +  +Q E +++ RWW  LGL  ++  A++Q LKWY+W + ++   S SR
Sbjct  238   ENLARAEFRIKKLQHQREMQEVKRWWMDLGLAQDVPAARDQVLKWYMWPMTVLEGFSFSR  297

Query  975   ERIELTKPIALVYLIDDIIDVYATFDQTKQFIDAINRWDLSVGEGLPDYMKRCLVVLFDT  796
              RIE+TK I++VY++DDI D+ AT ++   F +AI  WDL   + LP+YM  C   L+ T
Sbjct  298   YRIEITKIISIVYIVDDIFDLVATQEELSLFNEAIKMWDLEAADSLPNYMISCYKALYTT  357

Query  795   TNDINNLVFEKYGWNPIDHLKRAWKCLCSAYITEAKWFATGKSPSANEYLQTGIITTGIP  616
             TNDI  +V +++G NPI+HLK+AW  L   ++ E KW +T   P++ +YL+ GIIT+G P
Sbjct  358   TNDIAYMVRKEHGANPINHLKKAWATLFDGFMIEGKWLSTNNVPTSEDYLRNGIITSGAP  417

Query  615   MVLITCFFLLGHGAFAGTTD-IEDMITSVGAILRLLDDLDATQGEKQDGNDASYVEYYVK  439
             +V +   F+LGH    G  D I  +I+    I+RL DD+ + + E Q+G D SY E Y +
Sbjct  418   LVFLHLLFMLGHDLIEGNKDNIHRVISCPAKIMRLWDDMGSAKDESQEGLDGSYKELYQR  477

Query  438   EHEGLSISDGKQRIMNMVSEQWKLINKQCLSPTR--IPESFSKSCLNIARMVPMMYNYSD  265
             E+      D  + ++ M++ +W+ +NK+C S  +  +  SF  + LN ARMV +MY Y D
Sbjct  478   ENPH---GDADEHMLEMIASEWECLNKECFSGMKSTLSHSFITASLNFARMVRVMYGYDD  534

Query  264   THCLPILQ  241
                LPIL+
Sbjct  535   EQKLPILE  542



>ref|XP_002451416.1| hypothetical protein SORBIDRAFT_04g001780 [Sorghum bicolor]
 gb|EES04392.1| hypothetical protein SORBIDRAFT_04g001780 [Sorghum bicolor]
Length=553

 Score =   345 bits (886),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 169/494 (34%), Positives = 308/494 (62%), Gaps = 17/494 (3%)
 Frame = -2

Query  1698  EGKREWQRGLLYQFQEDDLQVLNVIDAIQHLGIDHHFHDQIGAILQRQYQKVKIDDFQKI  1519
             EG  + Q+ +L+Q Q++  +++  ID ++ L IDH+F ++I + +          D    
Sbjct  61    EGLTDIQK-ILHQRQKNAREMMITIDNLKRLCIDHYFEEEIESAMSSTCM-----DLIHS  114

Query  1518  NGLYDISLSFRLLRQEGYNVSS-DVFTKFTSEKGEFKEELSKDIRGLMALHEASHLSIEG  1342
             + L+D +L+FRLLR+ G++VS+ DV  +FT + GEFK  LS DIRGL++LH+ SHL I G
Sbjct  115   DDLFDATLAFRLLREAGHDVSANDVLRRFTDDSGEFKLPLSMDIRGLLSLHDMSHLDIGG  174

Query  1341  EDVLDEAAKFSRESLIANMVHLDECQASMVQNTLQYPYHKSLARFTAK---TFIENMRVE  1171
             E +L +A +FS + L + + +L+   A  V+ +L +PYH SL ++ A+   T++++M + 
Sbjct  175   EVLLYKAKEFSSKHLASAIRYLEPSLAEYVRQSLDHPYHLSLMQYKARHHLTYLQSMPIR  234

Query  1170  NEWEATLVNLATMDYSITQSFYQEEFRQILRWWKSLGLKDEL--AKNQQLKWYIWTLALI  997
             +     +  LA  ++ + +  +Q+E +++ RWW  LGL  E+   ++Q +KWY+W++  +
Sbjct  235   D---TVVEKLAVAEFQLNKLLHQQEIQEVKRWWMDLGLVQEIPVVRDQVMKWYMWSMTAV  291

Query  996   PDPSMSRERIELTKPIALVYLIDDIIDVYATFDQTKQFIDAINRWDLSVGEGLPDYMKRC  817
                S SR R+E+TK IALVY++DDI D+  T ++   F +A+  W+++  + LP  M+ C
Sbjct  292   QGCSFSRYRVEITKIIALVYVVDDIFDLVGTLEELSLFTEAVKVWNMAAADSLPRCMRSC  351

Query  816   LVVLFDTTNDINNLVFEKYGWNPIDHLKRAWKCLCSAYITEAKWFATGKSPSANEYLQTG  637
              + L+  TN+I ++V +++G N ++HL++AW  L   ++ EAKW AT + P+A +YL+ G
Sbjct  352   YMALYTVTNEITDMVEKEHGLNHVNHLRKAWAVLFDGFMVEAKWLATEQVPTAEDYLRNG  411

Query  636   IITTGIPMVLITCFFLLGH--GAFAGTTDIEDMITSVGAILRLLDDLDATQGEKQDGNDA  463
             ++T+G+P+  +  F +LG+     A    +  +I+    ILRL DD+ + + E Q+G D 
Sbjct  412   VVTSGVPLTFVHIFIMLGYDQSIEALIDQMPSVISCPAKILRLWDDMGSAKDEAQEGLDG  471

Query  462   SYVEYYVKEHEGLSISDGKQRIMNMVSEQWKLINKQCLSPTRIPESFSKSCLNIARMVPM  283
             SY+++Y+ E+     SD +  + N+++ +W+ +N++CL       + +++CLN ARM+ +
Sbjct  472   SYMDFYLMENPRCGPSDVEAHMRNLIAREWEELNRECLCKRTFSSNLTQTCLNAARMISV  531

Query  282   MYNYSDTHCLPILQ  241
             MY+Y+    L +L+
Sbjct  532   MYSYNKEQRLLVLE  545



>ref|XP_006648251.1| PREDICTED: LOW QUALITY PROTEIN: probable terpene synthase 13-like 
[Oryza brachyantha]
Length=581

 Score =   346 bits (887),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 172/474 (36%), Positives = 285/474 (60%), Gaps = 12/474 (3%)
 Frame = -2

Query  1635  LNVIDAIQHLGIDHHFHDQIGAILQRQYQKVKIDDFQKINGLYDISLSFRLLRQEGYNVS  1456
             L  +D ++ L IDH+F D++ + +        +++      L D +L+FRL+R+ G +VS
Sbjct  101   LATVDHLRRLCIDHYFQDEVDSAMDDA--SCLLEELAHGGDLLDATLAFRLMREAGRHVS  158

Query  1455  SD-VFTKFTSEKGEFKEELSKDIRGLMALHEASHLSIEGEDVLDEAAKFSRESLIANMVH  1279
             +D V  +FT + G+F+ + SKDIRGL++L + SH+S+  E  L +A +FS   L + M +
Sbjct  159   ADEVLGRFTDDNGDFRLDYSKDIRGLLSLQDISHMSMGEEASLCKAKEFSTRHLESAMNY  218

Query  1278  LDECQASMVQNTLQYPYHKSLARFTAKTFIENMRVENEWEATLVNLATMDYSITQSFYQE  1099
             L+   A  V+++L +PYH SL ++ A+  +  ++        +  LA  D+ + +  +Q 
Sbjct  219   LEPNLARYVRHSLDHPYHVSLMQYKARHHLSYLQTLPTRCTAMEELALADFQLNKMLHQM  278

Query  1098  EFRQILRWWKSLGLKDEL--AKNQQLKWYIWTLALIPDPSMSRERIELTKPIALVYLIDD  925
             E ++I RWW  LGL  E+  A++Q  KWY+W +  I   S+SR RIELTK ++ VY++DD
Sbjct  279   EMQEIKRWWMDLGLAQEIPVARDQVQKWYVWMMTAIQGASLSRCRIELTKIVSFVYVVDD  338

Query  924   IIDVYATFDQTKQFIDAINRWDLSVGEGLPDYMKRCLVVLFDTTNDINNLVFEKYGWNPI  745
             I D+  T ++   F  AI  WDL+  + LP  M+ C   L   TNDI ++V  ++G NPI
Sbjct  339   IFDLVGTHEELYCFTQAIKMWDLAAADSLPSCMRSCYRALHTITNDIADMVEREHGVNPI  398

Query  744   DHLKRAWKCLCSAYITEAKWFATGKSPSANEYLQTGIITTGIPMVLITCFFLLGHGAFAG  565
             +HLK++W  L   ++TE KW ++G+ P++++YL+ G++T+G+P+V +   F+LGH     
Sbjct  399   NHLKKSWAMLFDGFMTETKWLSSGQVPASDDYLRNGVVTSGVPLVFVHLLFMLGHDLGKD  458

Query  564   TTDIEDMITSV----GAILRLLDDLDATQGEKQDGNDASYVEYYVKEHEGLSISDGKQRI  397
                  D I SV      ILRL DDL + + E Q+G D SY E Y+KE+ GL+  + ++ +
Sbjct  459   AAQFIDRIPSVISCPAKILRLWDDLGSAKDEAQEGLDGSYKELYLKENPGLAAVEAEEHV  518

Query  396   MNMVSEQWKLINKQCLSPTR---IPESFSKSCLNIARMVPMMYNYSDTHCLPIL  244
               +++ +W+ +N++C S +R    P  F+++ LN ARMV +MY Y     LP+L
Sbjct  519   QRLIASEWEELNRECFSSSRRPAFPAGFTRAALNGARMVGVMYGYDGEQRLPVL  572



>dbj|BAJ85660.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ90726.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=544

 Score =   345 bits (884),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 180/490 (37%), Positives = 293/490 (60%), Gaps = 18/490 (4%)
 Frame = -2

Query  1677  RGLLYQFQEDDLQVLNVIDAIQHLGIDHHFHDQIGAILQRQYQKVKIDDFQKINGLYDIS  1498
             +G+L+Q  +++ +V+  ID ++ L IDH+F D+I   +      V  DD      L D +
Sbjct  60    KGMLHQNHKENRKVMTDIDHLKRLCIDHYFQDEIDDGMDACLNLVHSDD------LLDAT  113

Query  1497  LSFRLLRQEGYNVSSD-VFTKFTSEKGEFKEELSKDIRGLMALHEASHLSIEGEDVLDEA  1321
             LS RLLR+ G+++S+D V  KF +E  +F  + +KDIRGL++L + SHL++ GE  L +A
Sbjct  114   LSLRLLREAGHDISADEVLQKFVNENDDFNLDHTKDIRGLLSLQDISHLNM-GEASLYKA  172

Query  1320  AKFSRESLIANMVHLDECQASMVQNTLQYPYHKSLARFTAKTFIENMRVENEWEATLVNL  1141
               FSR+ L + + HLD   A  V+++L +PYH SL ++ A+  +  ++        +  L
Sbjct  173   NDFSRKHLTSAIKHLDLNLARYVRHSLDHPYHVSLTQYKARHHLSYLQSLPTRNTAMEEL  232

Query  1140  ATMDYSITQSFYQEEFRQILRWWKSLGLKDEL--AKNQQLKWYIWTLALIPDPSMSRERI  967
             A  D+ + +  +Q E +++ RWW  LGL  E+   ++Q LKWY++ + ++   S SR RI
Sbjct  233   ALADFQLNKLQHQMEMQEVKRWWMGLGLAQEIPATRDQILKWYMFPMTILQGQSFSRYRI  292

Query  966   ELTKPIALVYLIDDIIDVYATFDQTKQFIDAINRWDLSVGEGLPDYMKRCLVVLFDTTND  787
             E+TK IA+V ++DDI DV AT ++  +F +AI  WDL+    LP YM+ C   L+  TND
Sbjct  293   EITKIIAIVSIVDDIFDVIATQEELSRFTEAIKMWDLAAAASLPSYMRSCYSALYTITND  352

Query  786   INNLVFEKYGWNPIDHLKRAWKCLCSAYITEAKWFATGKSPSANEYLQTGIITTGIPMVL  607
             I ++   ++G NPIDHLK+ W  L  A++ EAKW +  + PS ++YL  G++TTG P+ L
Sbjct  353   IADMAEREHGLNPIDHLKKDWTMLFDAFLLEAKWLSANQVPSLDDYLSNGVVTTGGPLAL  412

Query  606   ITCFFLLGHGAFAGTTD-----IEDMITSVGAILRLLDDLDATQGEKQDGNDASYVEYYV  442
             +  F +LGH      T+     I  +I+    ILRL DD+ + + E QDG D SY E Y+
Sbjct  413   VHLFSMLGHDPTRDATNLTAGCIPPIISCPSKILRLWDDMGSAKDEAQDGLDGSYKELYL  472

Query  441   KEHEGLSISDGKQRIMNMVSEQWKLINKQCLSPTRIPESFSKSCLNIARMVPMMYNYSDT  262
             KE+ G    + +  +  ++  +W+ +N++C S    P S ++  LN+ARMV +++ Y + 
Sbjct  473   KENPG---GNAEGHMRALIGSEWEELNRECFSRRAFPPSMTRISLNLARMVRVLFGYGEG  529

Query  261   HCLPILQKQI  232
               LP+L++ I
Sbjct  530   QTLPVLEEYI  539



>gb|ADR74217.1| geraniol synthase [Vitis vinifera]
Length=591

 Score =   345 bits (886),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 175/471 (37%), Positives = 277/471 (59%), Gaps = 15/471 (3%)
 Frame = -2

Query  1650  DDLQVLNVIDAIQHLGIDHHFHDQIGAILQRQYQKVKIDDFQKINGLYDISLSFRLLRQE  1471
             D    + ++D ++ LG+ +HF D+I A+LQR        D+     L+  +L FRLLRQ 
Sbjct  97    DSRAAMEMVDTVERLGLSYHFEDEINALLQR------FCDWNASEDLFTTALRFRLLRQN  150

Query  1470  GYNVSSDVFTKFTSEKGEFKEELSKDIRGLMALHEASHLSIEGEDVLDEAAKFSRESLIA  1291
             G+   SDVF KF  + G+FKE L++DI G+++LHEASHL  + E+VL EA +F+R  LI 
Sbjct  151   GFPTHSDVFGKFMDKNGKFKESLTEDIWGMLSLHEASHLGAKNEEVLAEAKEFTRIHLIQ  210

Query  1290  NMVHLDECQASMVQNTLQYPYHKSLARFTAKTFIENMRVENEWEATLVNLATMDYSITQS  1111
             +M H++   +S V   L+ P H  + R  A+ +I     E+      + LA +D+ + QS
Sbjct  211   SMPHMEPHFSSHVGRALELPRHLRMVRLEARNYIGEYSRESNPNLAFLELAKLDFDMVQS  270

Query  1110  FYQEEFRQILRWWKSLGLKDEL--AKNQQLKWYIWTLALIPDPSMSRERIELTKPIALVY  937
              +Q+E  +I+RWWK LGL D+L  A+++ ++ ++WT+ + PDP  S  RIELTK IA++ 
Sbjct  271   LHQKELAEIVRWWKQLGLVDKLDFARDRPMECFLWTVGIFPDPRHSSCRIELTKAIAILL  330

Query  936   LIDDIIDVYATFDQTKQFIDAINRWDLSVGEGLPDYMKRCLVVLFDTTNDINNLVFEKYG  757
             +IDDI D Y + D+   F DA+ RWDL   + LP+YMK C + L++TTNDI   + +++G
Sbjct  331   VIDDIYDSYGSLDELALFTDAVKRWDLGAMDQLPEYMKICYMALYNTTNDIAYRILKEHG  390

Query  756   WNPIDHLKRAWKCLCSAYITEAKWFATGKSPSANEYLQTGIITTGIPMVLITCFFLLGHG  577
             W+ I+ LKR W  +  A++ EA  F  G  PS  EYL   + T G  M L+  FFL+G G
Sbjct  391   WSVIEDLKRTWMDIFGAFLAEAYCFKGGHVPSLEEYLTNAVTTGGTYMALVHAFFLMGQG  450

Query  576   A----FAGTTDIEDMITSVGAILRLLDDLDATQGEKQDGNDASYVEYYVKEHEGLSISDG  409
                   A      ++ +  G ILRL DDL   + E++ G++AS +E Y +E E  ++ + 
Sbjct  451   VTRENMAMLKPYPNIFSCSGKILRLWDDLGTAREEQERGDNASSIECYKREREMDTVLED  510

Query  408   ---KQRIMNMVSEQWKLINKQCLSPTRIPESFSKSCLNIARMVPMMYNYSD  265
                ++ I  M+   W  +N + ++ + +P S  K+  N++R   ++Y + D
Sbjct  511   EACRKHIRQMIQSLWVELNGELVASSALPLSIIKAAFNLSRTAQVIYQHGD  561



>gb|KCW74834.1| hypothetical protein EUGRSUZ_E03569 [Eucalyptus grandis]
Length=399

 Score =   339 bits (869),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 156/383 (41%), Positives = 242/383 (63%), Gaps = 7/383 (2%)
 Frame = -2

Query  1347  EGEDVLDEAAKFSRESLIANMVHLDECQASMVQNTLQYPYHKSLARFTAKTFIENMRVEN  1168
             +G D+L    + +R+ L +++  LD  QA  V N+L  P+HKSLARFTA  F+ N    +
Sbjct  11    QGNDILGFTRESTRQRLHSSLADLDHVQARFVSNSLGNPFHKSLARFTANDFLRNFVGHS  70

Query  1167  -EWEATLVNLATMDYSITQSFYQEEFRQILRWWKSLGLKDEL--AKNQQLKWYIWTLALI  997
               W   L  LA +D +I +S +Q E  Q+  WWK LG+  EL  A++Q +KWY+W +A++
Sbjct  71    CSWTKNLGELAHLDMNIVRSVHQREILQVSNWWKELGMAKELKYARDQPMKWYMWPMAIL  130

Query  996   PDPSMSRERIELTKPIALVYLIDDIIDVYATFDQTKQFIDAINRWDLSVGEGLPDYMKRC  817
              +  +S+ER+ +TKPI+ +Y+IDDI DVY T +    F D ++RW+ +  + +PDYM+ C
Sbjct  131   TETGLSQERVLVTKPISFIYIIDDIFDVYGTIEDLTAFTDVVDRWECTEKDNIPDYMRMC  190

Query  816   LVVLFDTTNDINNLVFEKYGWNPIDHLKRAWKCLCSAYITEAKWFATGKSPSANEYLQTG  637
                L D TN+ +  V++ +GWNP+  L++ W  L +A++ EA+W A+G SP+  +YL   
Sbjct  191   FHALDDITNEFSLAVYKNHGWNPLCSLRKTWASLLNAFLVEARWLASGHSPTTQDYLDNA  250

Query  636   IITTGIPMVLITCFFLLGHGAFAGTTD----IEDMITSVGAILRLLDDLDATQGEKQDGN  469
             I+++G+ ++L+  FF+LG      + D    I ++++S  +ILRL DDL + + E QDG 
Sbjct  251   IVSSGVHVLLVHLFFILGERITPESVDHLENIPEIVSSTASILRLWDDLGSAEDEFQDGR  310

Query  468   DASYVEYYVKEHEGLSISDGKQRIMNMVSEQWKLINKQCLSPTRIPESFSKSCLNIARMV  289
             D SYVE Y +E +G S    +  +  M+SE WK +NK CL P    +SFSK+ LN ARMV
Sbjct  311   DGSYVECYKREFQGSSEEAARDHVKKMISEAWKRLNKACLYPQPFTKSFSKASLNTARMV  370

Query  288   PMMYNYSDTHCLPILQKQIMSMF  220
             P+MYNY D+H LP+L+  + S+ 
Sbjct  371   PLMYNYDDSHSLPLLEHHMKSLL  393



>ref|XP_011096135.1| PREDICTED: tricyclene synthase Oc15, chloroplastic-like isoform 
X2 [Sesamum indicum]
Length=492

 Score =   342 bits (876),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 188/429 (44%), Positives = 270/429 (63%), Gaps = 8/429 (2%)
 Frame = -2

Query  1722  KDEFLLKSEGKREWQRGLLYQFQEDDL-QVLNVIDAIQHLGIDHHFHDQIGAILQRQYQK  1546
             +++F  + E K E  R +L    EDD  + L ++DAIQ  G+  H+  +IG IL+++Y+ 
Sbjct  64    QEKFAKEYEQKIEEIRQVLQSKGEDDPSESLVLVDAIQRGGLSSHYEQEIGTILRKRYE-  122

Query  1545  VKIDDFQKINGLYDISLSFRLLRQEGYNVSSDVFTKFTSEKGEFKEELSKDIRGLMALHE  1366
                        L+D+SL FRLLR+ G  +S DVF  F  + G F+  L +DIRGLM L+E
Sbjct  123   ASCSCTYGYYCLHDVSLFFRLLREHGLYISPDVFNNFKGKDGRFRRNLRQDIRGLMELYE  182

Query  1365  ASHLSIEGEDVLDEAAKFSRESLIANMVHLDECQASMVQNTLQYPYHKSLARFTAKTFIE  1186
             A+ LS +GE +LDEAA FS   L   +  +D   + ++   L+YPYHK++A+ T K F++
Sbjct  183   AAQLSFQGELILDEAASFSSHLLRECLPEMDNDLSRIITGKLKYPYHKTIAKLTRKDFLQ  242

Query  1185  NMRVENEWEATLVNLATMDYSITQSFYQEEFRQILRWWKSLGLKDE--LAKNQQLKWYIW  1012
             ++   N W  TL  LA MD    QS YQ E  Q+ +WW  LGL  E  LA+NQ LKWY W
Sbjct  243   DLEGSNGWAKTLRELALMDLRKGQSVYQGELAQVSKWWNELGLAKEIKLARNQLLKWYTW  302

Query  1011  TLA-LIPDPSMSRERIELTKPIALVYLIDDIIDVYATFDQTKQFIDAINRWDLSVGEGLP  835
             +++ LI D S+S +R+ELTK IA VYLIDDI DV  T D+   F +A+N+W+ +  + LP
Sbjct  303   SMSILIDDFSLSLQRVELTKSIAFVYLIDDIFDVVGTLDELTIFTEAVNKWEYAAIDMLP  362

Query  834   DYMKRCLVVLFDTTNDINNLVFEKYGWNPIDHLKRAWKCLCSAYITEAKWFATGKSPSAN  655
             DYMK C   L DTTN I + +++++G++PID LK +W  LC+AY+ EAKWFA+G  P+A 
Sbjct  363   DYMKMCYRALLDTTNGIGHEIYKRHGYDPIDSLKTSWGSLCNAYLMEAKWFASGDLPTAA  422

Query  654   EYLQTGIITTGIPMVLITCFF--LLGHGAFAGTTDIEDMITSVGAILRLLDDLDATQGEK  481
             +YL+ G +TTG  +VL+  FF   LG+G   G TD+  + +SV  ILRL DDL + +  K
Sbjct  423   KYLENGKVTTGAYVVLVHLFFLSGLGNGGGIGLTDVSRLASSVATILRLWDDLGSAK-LK  481

Query  480   QDGNDASYV  454
              + +D  +V
Sbjct  482   TNHHDMEFV  490



>gb|KCW74836.1| hypothetical protein EUGRSUZ_E03571, partial [Eucalyptus grandis]
Length=420

 Score =   339 bits (870),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 185/464 (40%), Positives = 270/464 (58%), Gaps = 56/464 (12%)
 Frame = -2

Query  1617  IQHLGIDHHFHDQIGAILQRQYQKVKIDDFQKINGLYDISLSFRLLRQEGYNVSSDVFTK  1438
             IQ LG++  F +QI AIL+ QY      +  K + +Y+I+L FRLLRQEGY V +DVF  
Sbjct  2     IQRLGVESLFREQIKAILKWQYTHFSSLNHGK-DDVYEIALWFRLLRQEGYRVPADVFEY  60

Query  1437  FTSEKGEFKEELSKDIRGLMALHEASHLSIEGEDVLDEAAKFSRESLIANMV-HLDECQA  1261
             F  +   F  +L  +I+G+M L++AS +S E ED+LDEA  FS + L A +   LD  QA
Sbjct  61    FNDKGKGFVMKLEGNIKGMMELYKASQMSTEEEDILDEAECFSSKCLNALLTCDLDHEQA  120

Query  1260  SMVQNTLQYPYHKSLARFTA-KTFIENMRVENEWEATLVNLATMDYSITQSFYQEEFRQI  1084
              M+++TLQYPY KS AR  A ++F+ +M   N W   L+ +A     I Q  +Q+E  QI
Sbjct  121   RMIESTLQYPYRKSFARLLAPQSFVNDMPGANSWMEDLLEVANKKRRIDQFVHQKEIHQI  180

Query  1083  LRWWKSLGLKDEL--AKNQQLKWYIWTLALIPDPSMSRERIELTKPIALVYLIDDIIDVY  910
              +WWK LGL +++  A++Q LKWY+W++A++ DPS+S  R+EL KPI+LVY+IDDI DV+
Sbjct  181   NKWWKELGLGEKMKCARDQPLKWYMWSMAILTDPSLSELRVELIKPISLVYIIDDIFDVH  240

Query  909   ATFDQTKQFIDAINRWDLSVGEGLPDYMKRCLVVLFDTTNDINNLVFEKYGWNPIDHLKR  730
              T D    F +AI R+                                            
Sbjct  241   GTVDGLILFTEAIKRY--------------------------------------------  256

Query  729   AWKCLCSAYITEAKWFATGKSPSANEYLQTGIITTGIPMVLITCFFLLGHGAFAGTTD--  556
              W  LC+A++ E +W A+GK P A++YL+  IIT+G+P+VL   FFL+G      + D  
Sbjct  257   IWANLCNAFLVEFQWNASGKLPKADDYLKNAIITSGVPLVLTHLFFLMGQNIANQSMDSK  316

Query  555   -----IEDMITSVGAILRLLDDLDATQGEKQDGNDASYVEYYVKEHEGLSISDGKQRIMN  391
                  + ++I  +  ILRL DDL   Q E Q+G D SYV+ Y++E++G S     + +M 
Sbjct  317   KEEVQLPNIIFLMAEILRLWDDLGCAQDENQNGYDGSYVDCYLRENQGSSYQSASEHVMK  376

Query  390   MVSEQWKLINKQCLSPTRIPESFSKSCLNIARMVPMMYNYSDTH  259
             ++S+ WKL+NK+CLSP      F ++C+N A+MV +MYNY D H
Sbjct  377   LISKLWKLLNKECLSPCPFSVPFLEACVNAAKMVSLMYNYEDKH  420



>ref|XP_009385198.1| PREDICTED: probable terpene synthase 11 [Musa acuminata subsp. 
malaccensis]
Length=590

 Score =   345 bits (884),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 173/472 (37%), Positives = 281/472 (60%), Gaps = 10/472 (2%)
 Frame = -2

Query  1629  VIDAIQHLGIDHHFHDQIGAILQRQYQKVKIDDFQKINGLYDISLSFRLLRQEGYNVSSD  1450
             ++D IQ LGI H F D++  IL R     + D+    + L+  +L FRLLRQ GYNV +D
Sbjct  93    LVDTIQRLGISHQFEDELELILDRNPSAAQGDE----DDLFSTTLRFRLLRQRGYNVDTD  148

Query  1449  VFTKFTSEKGEFKEELSKDIRGLMALHEASHLSIEGEDVLDEAAKFSRESLIANMVHLDE  1270
             VF +F   KG FKE LSKD+ GL++LHEAS+L +  E+VL +A  FS E L  +M++L  
Sbjct  149   VFHEFMDRKGHFKESLSKDLAGLLSLHEASYLGVRDEEVLSQAMGFSEEHLRRSMLNLRP  208

Query  1269  CQASMVQNTLQYPYHKSLARFTAKTFIENMRVENEWEATLVNLATMDYSITQSFYQEEFR  1090
              +A  V   L++P  + + R  A+++I     E+   + ++ LAT+D+++ QS  + E  
Sbjct  209   VRAREVNLALEFPRQRRMVRSEARSYIGKYAQESGRISDVLQLATLDFNLVQSQLRIEIA  268

Query  1089  QILRWWKSLGLKDEL--AKNQQLKWYIWTLALIPDPSMSRERIELTKPIALVYLIDDIID  916
              +  WWK LGL ++L  A+++ L+ ++WT+ L P+P  S+ RIE+ K IA++ +IDD+ D
Sbjct  269   VLRSWWKELGLAEKLSFARDRPLECFLWTVGLFPEPRFSQCRIEIAKTIAILLVIDDVYD  328

Query  915   VYATFDQTKQFIDAINRWDLSVGEGLPDYMKRCLVVLFDTTNDINNLVFEKYGWNPIDHL  736
             +  + D+   F DA+ RW +   E LP+YMK C + L++TTN+I   V +++G   I  L
Sbjct  329   IQGSLDELILFTDAVRRWGVEAMEDLPEYMKICYMALYNTTNEIGYRVLKEHGRCIIREL  388

Query  735   KRAWKCLCSAYITEAKWFATGKSPSANEYLQTGIITTGIPMVLITCFFLLGHGAFAGTTD  556
             ++ W  LC  ++ EA+WF+ G  P   EY+  G+ T G  M  +  F+L+G G    ++D
Sbjct  389   RKTWVDLCEGFLVEARWFSGGVVPEMEEYVGNGVSTAGTYMAFVHAFYLIGSGVNKQSSD  448

Query  555   IED----MITSVGAILRLLDDLDATQGEKQDGNDASYVEYYVKEHEGLSISDGKQRIMNM  388
             + +    + TS G ILRL DDL   + E++ G+ AS ++ Y+KE +G S ++ +  + ++
Sbjct  449   VVNSCPKLFTSAGRILRLWDDLGTAKVEQERGDVASSIDCYMKEGDGASEAESRLHVRSL  508

Query  387   VSEQWKLINKQCLSPTRIPESFSKSCLNIARMVPMMYNYSDTHCLPILQKQI  232
             +   W  +N + L+ T +P S   + LN+AR    MY + D   LP + + I
Sbjct  509   IHSSWLDLNGEALAATSLPRSTVDAALNLARAAQAMYQHGDDGRLPSVDQHI  560



>ref|XP_010657363.1| PREDICTED: R-linalool synthase, chloroplastic-like isoform X1 
[Vitis vinifera]
 ref|XP_010657364.1| PREDICTED: R-linalool synthase, chloroplastic-like isoform X1 
[Vitis vinifera]
Length=587

 Score =   344 bits (883),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 177/473 (37%), Positives = 275/473 (58%), Gaps = 17/473 (4%)
 Frame = -2

Query  1650  DDLQVLNVIDAIQHLGIDHHFHDQIGAILQRQYQKVKIDDFQKINGLYDISLSFRLLRQE  1471
             D    + ++D ++ LG+ +HF D+I A+LQR        D+     L+  SL FRLLRQ 
Sbjct  91    DSRAAMEMVDTVERLGLSYHFEDEIKALLQR------FCDWNSSEDLFTTSLRFRLLRQN  144

Query  1470  GYNVSSDVFTKFTSEKGEFKEELSKDIRGLMALHEASHLSIEGEDVLDEAAKFSRESLIA  1291
             G+   SDVF KF  + G+FKE L++DI G+++LHEASHL  + E+VL EA +F+R  LI 
Sbjct  145   GFPTHSDVFGKFMDKNGKFKESLTEDIWGMLSLHEASHLGAKNEEVLAEAKEFTRIHLIQ  204

Query  1290  NMVHLDECQASMVQNTLQYPYHKSLARFTAKTFIENMRVENEWEATLVNLATMDYSITQS  1111
             +M H++   +S V   L+ P H  +AR   + +I     E+     L+ LA +D+ + QS
Sbjct  205   SMPHMEPHFSSHVGRALELPRHLRMARLEVRNYIGEYSRESNPNLALLELAKLDFDMVQS  264

Query  1110  FYQEEFRQILRWWKSLGLKDEL--AKNQQLKWYIWTLALIPDPSMSRERIELTKPIALVY  937
              +Q+E  +I+RWWK LGL D+L  A+++ ++ ++WT+ + PDP  S  RIELTK IA++ 
Sbjct  265   LHQKELAEIVRWWKQLGLVDKLDFARDRPMECFLWTVGIFPDPRHSSCRIELTKAIAILL  324

Query  936   LIDDIIDVYATFDQTKQFIDAINRWDLSVGEGLPDYMKRCLVVLFDTTNDINNLVFEKYG  757
             +IDDI D Y + D+   F DA+ RWDL   + LP+YMK C + L++TTNDI   + +++ 
Sbjct  325   VIDDIYDSYGSLDELALFTDAVKRWDLGAMDQLPEYMKICYMALYNTTNDIAYRILKEHR  384

Query  756   WNPIDHLKRAWKCLCSAYITEAKWFATGKSPSANEYLQTGIITTGIPMVLITCFFLLGHG  577
             W+ I+ LKR W  +  A++ EA  F  G  PS  EYL   + T G  M L+  FFL+G G
Sbjct  385   WSVIEDLKRTWMDIFGAFLAEAHCFKGGHVPSLEEYLNNAVTTGGTYMALVHAFFLMGQG  444

Query  576   A----FAGTTDIEDMITSVGAILRLLDDLDATQGEKQDGNDASYVEYYVKEHEG-----L  424
                   A      ++ +  G ILRL DDL   + E++ G++AS +E Y +E E      L
Sbjct  445   VTRENMAMLKPYPNIFSCSGKILRLWDDLGTAREEQERGDNASSIECYKREREREMDTVL  504

Query  423   SISDGKQRIMNMVSEQWKLINKQCLSPTRIPESFSKSCLNIARMVPMMYNYSD  265
                  ++ I  M+   W  +N + ++ + +P S  K+  N++R   ++Y + D
Sbjct  505   DDEACRKHIRQMIQSLWVELNGELVASSALPLSIIKAAFNLSRTAQVIYQHGD  557



>ref|XP_008383954.1| PREDICTED: (3S,6E)-nerolidol synthase 1-like isoform X2 [Malus 
domestica]
Length=446

 Score =   340 bits (871),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 172/391 (44%), Positives = 250/391 (64%), Gaps = 16/391 (4%)
 Frame = -2

Query  1635  LNVIDAIQHLGIDHHFHDQIGAILQRQYQKVKIDDFQKINGLYDISLSFRLLRQEGYNVS  1456
             L  +DA+Q LG+D+HF ++I AIL++Q  +   D+     G+  +SL FRLLRQ+GY+V+
Sbjct  44    LIAVDAMQRLGVDYHFQEEIEAILKKQCTRAXGDEGSDELGV--VSLRFRLLRQQGYHVT  101

Query  1455  SDVFTKFTSEKGEFKEELSKDIRGLMALHEASHLSIEGEDVLDEAAKFSRESLIANMVH-  1279
             +D F KF +      EE   DI GL+ L+EASHLS  GE+ LDEA + S + L   M + 
Sbjct  102   TDAFXKFKN-----NEEFXVDISGLVGLYEASHLSFPGEETLDEAGRRSHQLLTDWMKNN  156

Query  1278  LDECQASMVQNTLQYPYHKSLARFTAKTFIENMRVENEWEATLVNLATMDYSITQSFYQE  1099
             LD+ QAS V  +L++PYHKSL RF AK F+ N   + +W   L  LA +++++ +S  + 
Sbjct  157   LDDHQASAVAYSLEHPYHKSLTRFRAKNFLNNFEGKQKWVNVLRELAKLEFNMVESLIRN  216

Query  1098  EFRQILRWWKSLGLKDEL--AKNQQLKWYIWTLALIPDPSMSRERIELTKPIALVYLIDD  925
             E +Q+ +WWK LGL  EL   ++Q +KWY W +  + DPS+S ER+ELTK I+LVY+IDD
Sbjct  217   EVQQVSKWWKELGLTKELKFVRDQPIKWYTWPMXCLADPSLSEERVELTKSISLVYIIDD  276

Query  924   IIDVYATFDQTKQFIDAINRWDLSVGEGLPDYMKRCLVVLFDTTNDINNLVFEKYGWNPI  745
             I DV  T D+   F  A+ RWD+     LP+YMK C   L+D TN+ + +V +++GWNP+
Sbjct  277   IFDVQGTLDELILFTAAVERWDIDATGELPNYMKICFKALYDITNETSYIVHKRHGWNPL  336

Query  744   DHLKRAWKCLCSAYITEAKWFATGKSPSANEYLQTGIITTGIPMVLITCFFLLGHGAFAG  565
             + LK++W  LC A++ EA+WF+ G  P++ EYL  G I++G+P+VL   FFLLG G    
Sbjct  337   ESLKKSWATLCKAFLLEARWFSCGHLPNSEEYLNNGFISSGVPVVLTHAFFLLGQGISKE  396

Query  564   TTDIED------MITSVGAILRLLDDLDATQ  490
             T  I D      +I+S   ILRL DD  + +
Sbjct  397   TVRIVDNINISSIISSTATILRLWDDFGSAK  427



>ref|XP_002886523.1| linalool synthase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH62782.1| linalool synthase [Arabidopsis lyrata subsp. lyrata]
Length=575

 Score =   343 bits (879),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 181/512 (35%), Positives = 292/512 (57%), Gaps = 42/512 (8%)
 Frame = -2

Query  1677  RGLLYQFQEDDLQVLNVIDAIQHLGIDHHFHDQIGAILQRQYQKVKIDDFQKINGLYDIS  1498
             + +L   ++D  + L +I+AIQ LGID +F  +I   L   Y++     F     L +++
Sbjct  80    KNILVSNRDDPFENLEMINAIQGLGIDLYFRHEIDQTLHMIYKEPT--HFYG-RDLREVA  136

Query  1497  LSFRLLRQEGYNVSSDVFTKFTSEKGEFKEELSKDIRGLMALHEASHLSIEGEDVLDEAA  1318
             L FRLLRQEGY V   +F     +KG  +++   D++ L+ L+EAS L +EGE+ LD   
Sbjct  137   LCFRLLRQEGYYVQESIFENILDKKGGLEDDPKNDVKVLIELYEASELRVEGEETLDGVR  196

Query  1317  KFSRESLIANMVHLDECQASMVQNTLQYPYHKSLARFTAKTFIENMRV----ENEWEATL  1150
              F+   L          Q   + ++L  P HK+L R T+  F+  +++    + EW  +L
Sbjct  197   DFTFNCLNELCSGRKSHQEREIMSSLAQPRHKTLRRLTSIRFMSMIKIAGQEDKEWLQSL  256

Query  1149  VNLATMDYSITQSFYQEEFRQILRWWKSLGLKDEL--AKNQQLKWYIWTLALIPDPSMSR  976
             + +A +D    +S  QEE  QI +WW+ L L+ EL  A+NQ LKWY W++ ++ DP+++ 
Sbjct  257   LLVAEIDSIRLKSLIQEEMSQIFKWWRELNLEKELEKARNQPLKWYTWSMEILQDPTLTE  316

Query  975   ERIELTKPIALVYLIDDIIDVYATFDQTKQFIDAINRWDLSVGEGLPDYMKRCLVVLFDT  796
             +R++LTKPI+LVY+IDDI DVY               WD    E LP YMK C   L   
Sbjct  317   QRLDLTKPISLVYVIDDIFDVYG-------------EWDHKGLETLPRYMKVCFEALDMI  363

Query  795   TNDINNLVFEKYGWNPIDHLKRA----------------WKCLCSAYITEAKWFATGKSP  664
             T +I+  + + +GWNP D+L+++                W  LC A++ EAKWF +G  P
Sbjct  364   TMEISMKICKSHGWNPTDYLRKSLNWFKPYLQYNIFVSQWASLCKAFLIEAKWFHSGYLP  423

Query  663   SANEYLQTGIITTGIPMVLITCFFLLGHGAFAGTTDI----EDMITSVGAILRLLDDLDA  496
             +  EY++ G++++G+ +V++  + LLG        ++      +++S   ILRL DDL +
Sbjct  424   NTEEYMKNGVVSSGVHLVMLHAYILLGEELTKEKVELIESNPGIVSSAATILRLWDDLGS  483

Query  495   TQGEKQDGNDASYVEYYVKEHEGLSISDGKQRIMNMVSEQWKLINKQCLSPTRIPESFSK  316
              + E QDG D SYVE Y+ E++G ++ + +  ++  +S++WK +N++CL+P+    SFSK
Sbjct  484   AKDENQDGTDGSYVECYLNEYKGSTVDEARTHVVQKISKEWKRLNRECLNPSPFSRSFSK  543

Query  315   SCLNIARMVPMMYNYSDTHCLPILQKQIMSMF  220
             +CLNIAR VP+MY+Y D   LP L + + S+ 
Sbjct  544   ACLNIARTVPLMYSYDDDQRLPGLDEYLKSLM  575



>gb|KCW74869.1| hypothetical protein EUGRSUZ_E03610 [Eucalyptus grandis]
Length=399

 Score =   337 bits (864),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 155/383 (40%), Positives = 241/383 (63%), Gaps = 7/383 (2%)
 Frame = -2

Query  1347  EGEDVLDEAAKFSRESLIANMVHLDECQASMVQNTLQYPYHKSLARFTAKTFIENMRVEN  1168
             +G D+L    + +R+ L +++  LD  +   V+N+L  P+HKSLARFTA  F+ N    +
Sbjct  11    QGNDILGFTRESTRQRLHSSLADLDHVRDRFVRNSLGNPFHKSLARFTANDFLRNFVGHS  70

Query  1167  -EWEATLVNLATMDYSITQSFYQEEFRQILRWWKSLGLKDEL--AKNQQLKWYIWTLALI  997
               W   L  LA +D +I +S +Q E  Q+  WWK LG+  EL  A++Q +KWY+W +A++
Sbjct  71    YSWTKNLGELAHLDMNIVRSVHQREILQVSNWWKELGMAKELKYARDQPMKWYMWPMAIL  130

Query  996   PDPSMSRERIELTKPIALVYLIDDIIDVYATFDQTKQFIDAINRWDLSVGEGLPDYMKRC  817
              +  +S+ER+ +TKPI+ +Y+IDDI DVY T +    F D +NRW+ +  + +PDYM+ C
Sbjct  131   TETGLSQERVLVTKPISFIYIIDDIFDVYGTIEDLTAFTDVVNRWECTEKDNIPDYMRMC  190

Query  816   LVVLFDTTNDINNLVFEKYGWNPIDHLKRAWKCLCSAYITEAKWFATGKSPSANEYLQTG  637
                L D TN+ +  V++ +GWNP+  L++ W  L +A++ EA+W A+G SP+  +YL   
Sbjct  191   FHALDDITNEFSLAVYKNHGWNPLCSLRKTWASLLNAFLVEARWLASGHSPTTQDYLDNA  250

Query  636   IITTGIPMVLITCFFLLGHGAFAGTTD----IEDMITSVGAILRLLDDLDATQGEKQDGN  469
             I+++G+ ++L+  FF+LG      + D    I ++++S  +ILRL DDL + + E QDG 
Sbjct  251   IVSSGVHVLLVHLFFILGERITPESVDHLENIPEIVSSTASILRLWDDLGSAEDEFQDGR  310

Query  468   DASYVEYYVKEHEGLSISDGKQRIMNMVSEQWKLINKQCLSPTRIPESFSKSCLNIARMV  289
             D SYVE Y +E +G S    +  +  M+SE WK +NK CL P     SFSK+ LN ARMV
Sbjct  311   DGSYVECYKREFQGSSEEAARDHVKKMISEAWKRLNKACLYPQPFTNSFSKASLNTARMV  370

Query  288   PMMYNYSDTHCLPILQKQIMSMF  220
             P+MYNY D+H LP+L+  + S+ 
Sbjct  371   PLMYNYDDSHSLPLLEHHMKSLL  393



>ref|XP_010042378.1| PREDICTED: (3S,6E)-nerolidol synthase 1-like, partial [Eucalyptus 
grandis]
Length=370

 Score =   335 bits (859),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 161/371 (43%), Positives = 238/371 (64%), Gaps = 12/371 (3%)
 Frame = -2

Query  1278  LDECQASMVQNTLQYPYHKSLARFTA-KTFIENMRVENEWEATLVNLATMDYSITQSFYQ  1102
             LD  QA M+++ LQYPY KS AR  A ++F+ +M     W   L+ +A  +  I QS +Q
Sbjct  2     LDHEQARMIESALQYPYRKSFARLLAPQSFVNDMSGVKSWMEDLLEVANRNRRIDQSVHQ  61

Query  1101  EEFRQILRWWKSLGLKDEL--AKNQQLKWYIWTLALIPDPSMSRERIELTKPIALVYLID  928
             +E  QI +WWK LGL +++  A++Q LKWY+W++A++ +PS+S  R+EL KPI+LVY+ID
Sbjct  62    KEIHQINKWWKELGLGEKMKFARDQPLKWYMWSMAILTNPSLSELRVELIKPISLVYIID  121

Query  927   DIIDVYATFDQTKQFIDAINRWDLSVGEGLPDYMKRCLVVLFDTTNDINNLVFEKYGWNP  748
             DI DV+   D+   F + I RWD +  E LP+YMK+C  VL D  ND   ++FEK+GWNP
Sbjct  122   DIFDVHGMVDELILFTEVIKRWDYACAEQLPEYMKKCFKVLNDIANDFGKIIFEKHGWNP  181

Query  747   IDHLKRAWKCLCSAYITEAKWFATGKSPSANEYLQTGIITTGIPMVLITCFFLLGHGAFA  568
                LK  W  LC+A++ E +W A+GK P A++YL+ GIIT+G+P+VL   FFL+G     
Sbjct  182   TRFLKHMWANLCNAFLVEFQWNASGKLPKADDYLKNGIITSGVPLVLTHLFFLMGQNIAN  241

Query  567   GTTD-------IEDMITSVGAILRLLDDLDATQGEKQDGNDASYVEYYVKEHEGLSISDG  409
              + D       + ++I  +  ILRL DDL   Q E Q+G D SYV+ Y+ E++G S    
Sbjct  242   QSMDSKKEEVQLPNIIFLIAEILRLWDDLGCAQDENQNGYDGSYVDCYLGENQGSSYQSA  301

Query  408   KQRIMNMVSEQWKLINKQCLSPTRIPESFSKSCLNIARMVPMMYNYSDTHCLPILQKQIM  229
             ++ +M ++S+ WKL+NK+CLSP      F ++C+N A+MV +MYNY D   L +LQ  + 
Sbjct  302   REHVMKLISKLWKLLNKECLSPCPSSAPFLEACVNAAKMVSLMYNYEDKRGLGLLQDHMK  361

Query  228   SMFSTINGESI  196
             S+  T + E+I
Sbjct  362   SL--TCDHETI  370



>gb|EMT19527.1| Linalool synthase, chloroplastic [Aegilops tauschii]
Length=536

 Score =   340 bits (873),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 181/474 (38%), Positives = 291/474 (61%), Gaps = 22/474 (5%)
 Frame = -2

Query  1638  VLNVIDAIQHLGIDHHFHDQIGAILQRQYQKVKIDDFQKINGLYDISLSFRLLRQEGYNV  1459
             +L  +D ++ L IDH+F D+I  I+      +  DD      L D +LS RL+R+ GY V
Sbjct  76    LLTTVDHLKRLCIDHYFQDKIDTIIDSCADLIHSDD------LLDATLSLRLMREAGYYV  129

Query  1458  SSD-VFTKFTSEKGEFKEELSKDIRGLMALHEASHLSIEGEDVLDEAAKFSRESLIANMV  1282
             S+D V  KF ++ GEF   LSKDIRGL++L + SHL++ GE  L +A +FS + L   + 
Sbjct  130   SADDVLQKFRNDNGEFNLGLSKDIRGLLSLQDISHLNM-GESSLYKANEFSSKHLRFAIK  188

Query  1281  HLDECQASMVQNTLQYPYHKSLARFTAK---TFIENMRVENEWEATLVNLATMDYSITQS  1111
             +L+   A  V+ +L +PYH SL ++ A+   +++++M   N     + NLA  +++I + 
Sbjct  189   YLEPNLAIYVRRSLDHPYHVSLMQYKARHHLSYLQSMPTRN---MAIENLAFAEFTIKKL  245

Query  1110  FYQEEFRQILRWWKSLGLKDEL--AKNQQLKWYIWTLALIPDPSMSRERIELTKPIALVY  937
              +Q E +++ RWW  LGL  E+  A++Q LKWY+W + ++   S SR RIE+TK I++VY
Sbjct  246   QHQREMQEVKRWWMDLGLAQEIPAARDQVLKWYMWPMTVLEGFSFSRYRIEITKIISMVY  305

Query  936   LIDDIIDVYATFDQTKQFIDAINRWDLSVGEGLPDYMKRCLVVLFDTTNDINNLVFEKYG  757
             ++DDI D+ AT ++   F +AI  WDL+  + LP YM  C   L+  T+DI ++V +++G
Sbjct  306   IVDDIFDLVATQEELSLFTEAIKTWDLAAIDSLPSYMISCYKALYTITSDIADMVRKEHG  365

Query  756   WNPIDHLKRAWKCLCSAYITEAKWFATGKSPSANEYLQTGIITTGIPMVLITCFFLLGHG  577
              +PI+HLK+AW  L   ++TE KW +T + P++ +YL+ G++T+G P+V +  FF+LGH 
Sbjct  366   VSPINHLKKAWATLFDGFMTEGKWLSTNQVPTSEDYLRNGVVTSGAPLVFMHLFFMLGHE  425

Query  576   AFAGTT-DIEDMITSVGAILRLLDDLDATQGEKQDGNDASYVEYYVKEHEGLSISDGKQR  400
                G   DI  +I+    I+RL DD+ + + E Q+G D SY E Y +E+      D ++ 
Sbjct  426   LPEGNNDDIHRVISCPAKIMRLWDDMGSAKDESQNGLDGSYKELYQRENPH---GDAEKH  482

Query  399   IMNMVSEQWKLINKQCLSPT--RIPESFSKSCLNIARMVPMMYNYSDTHCLPIL  244
             ++ M+  +W+ +N++C S T   +  SF  + LN ARMV +MY Y D   LP+L
Sbjct  483   MLEMIGSEWEGLNRECFSGTTSTLSHSFITASLNFARMVRVMYGYDDEQKLPVL  536



>ref|XP_008679963.1| PREDICTED: (3S,6E)-nerolidol synthase 1-like isoform X2 [Zea 
mays]
Length=590

 Score =   339 bits (869),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 181/527 (34%), Positives = 306/527 (58%), Gaps = 20/527 (4%)
 Frame = -2

Query  1782  RCQSVNSSSLRSEKMTVTLSKDEFLLKSEGKREWQRGLLYQFQEDDLQ---VLNVIDAIQ  1612
             R  S+ + S  +      L  D+F L+ EG  +  R +L Q Q+       ++  +D ++
Sbjct  63    RGDSIVTRSSAAANTLPLLRNDDFDLR-EGLTD-VRNVLRQRQKSGCSSRDMMVTVDNLK  120

Query  1611  HLGIDHHFHDQIGAILQRQYQKVKIDDFQKINGLYDISLSFRLLRQEGYNVSSD-VFTKF  1435
              L IDH+F ++I   +      +   D      L+D +L+FRLLR+ G+ VS+D V  +F
Sbjct  121   RLCIDHYFQEEIERAMGACCMGLIHSD-----DLFDATLAFRLLREAGHGVSADDVLRRF  175

Query  1434  TSEK---GEFKEELSKDIRGLMALHEASHLSIEGEDVLDEAAKFSRESLIANMVHLDECQ  1264
             T +    GEF+ +LSKDIRGL++LH+ SHL + GE++L +A  FSR  L + + +L+   
Sbjct  176   TDDDDSGGEFRLDLSKDIRGLLSLHDMSHLDMGGEELLCKARVFSRHHLASAVRYLEPSL  235

Query  1263  ASMVQNTLQYPYHKSLARFTAKTFIENMRVENEWEATLVNLATMDYSITQSFYQEEFRQI  1084
                V+ +L +PYH SL ++ A+  +  ++     +  L  L   ++ + +S +Q+E + I
Sbjct  236   GEYVRQSLDHPYHLSLTQYKARHHLAYLQSLPVRDTALERLVAAEFQLNRSLHQKEMQAI  295

Query  1083  LRWWKSLGLKDEL--AKNQQLKWYIWTLALIPDPSMSRERIELTKPIALVYLIDDIIDVY  910
              RWW  LGL  E+   ++Q LKWY+W++  +   S SR R+++TK IALVY++DDI D+ 
Sbjct  296   KRWWMELGLVQEIPVVRDQVLKWYMWSMTALQGRSFSRHRVQITKIIALVYVVDDIFDLV  355

Query  909   ATFDQTKQFIDAINRWDLSVGEGLPDYMKRCLVVLFDTTNDINNLVFEKYGWNPIDHLKR  730
             AT D+   F +A+  W+ +  E LP YM+ C   L+  TN+I +   +++G N ++HL++
Sbjct  356   ATLDELSLFAEAVKMWNSTAAESLPSYMRSCYKALYTVTNEIADTAEKEHGLNHVNHLRK  415

Query  729   AWKCLCSAYITEAKWFATGKSPSANEYLQTGIITTGIPMVLITCFFLLGHGAFAGTTDIE  550
             AW  L   ++ EA+W AT K P+A +YL  G++T+G+P+  +  F +LG      T  + 
Sbjct  416   AWAALFDGFMVEARWLATDKVPTAEDYLTNGVVTSGVPLTFVHIFIMLGCDDDQSTQALV  475

Query  549   DMITSV----GAILRLLDDLDATQGEKQDGNDASYVEYYVKEHEGLSISDGKQRIMNMVS  382
             D + SV      ILRL DD+ + + E Q+G D SY ++Y+ E+   S SD +  + ++++
Sbjct  476   DHMPSVISCPAKILRLWDDMGSAEDEAQEGFDGSYRDFYLMENPRCSRSDAEAHMRSLIA  535

Query  381   EQWKLINKQCLSPTRIPESFSKSCLNIARMVPMMYNYSDTHCLPILQ  241
              +W+ +N++CL       SF+  CLN ARM+ +MY+Y+    L +L+
Sbjct  536   REWEELNRECLCKRTFSSSFTHVCLNAARMISVMYSYNKEQRLLVLE  582



>ref|XP_004954742.1| PREDICTED: (3S,6E)-nerolidol synthase 1, chloroplastic-like [Setaria 
italica]
Length=543

 Score =   338 bits (866),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 166/483 (34%), Positives = 288/483 (60%), Gaps = 13/483 (3%)
 Frame = -2

Query  1668  LYQFQEDDLQVLNVIDAIQHLGIDHHFHDQIGAILQRQYQKVKIDDFQKINGLYDISLSF  1489
             L+ +++   + + V+D ++ L IDH+F ++I + +      V  DD      L+D +L+F
Sbjct  59    LHGYRKSGRETMAVVDNLKRLCIDHYFEEEIESAMGACMDLVHSDD------LFDATLAF  112

Query  1488  RLLRQEGYNVSSD-VFTKFTSEKGEFKEELSKDIRGLMALHEASHLSIEGEDVLDEAAKF  1312
             RL+R+ G++VS+D V  +FT + GEFK  LS DIRGL++LH+ SHL +  E  L +A +F
Sbjct  113   RLMREAGHDVSADDVLRRFTDDTGEFKLALSNDIRGLLSLHDMSHLDMGDEASLSKAKEF  172

Query  1311  SRESLIANMVHLDECQASMVQNTLQYPYHKSLARFTAKTFIENMRVENEWEATLVNLATM  1132
             S + L + + +L+   A  V+ +L +PYH SL ++ A+  +  ++        +  LA  
Sbjct  173   SSKHLESAIRYLEPGLARYVRQSLDHPYHLSLMQYKARHHLSYLQTLPTRNTAMEELAIS  232

Query  1131  DYSITQSFYQEEFRQILRWWKSLGLKDEL--AKNQQLKWYIWTLALIPDPSMSRERIELT  958
             ++ + +  +Q+E +++ RWW  LGL  E+   ++Q LKWY+W +     PS SR R+E T
Sbjct  233   EFQLNKRLHQKEMQEVKRWWTDLGLSREIPVVRDQVLKWYMWPMTTFQGPSSSRYRVETT  292

Query  957   KPIALVYLIDDIIDVYATFDQTKQFIDAINRWDLSVGEGLPDYMKRCLVVLFDTTNDINN  778
             K I+LVY++DDI D+  T ++   F +AI  W+    + LP  ++ C   ++ TTN+I +
Sbjct  293   KIISLVYVVDDIFDLVGTPEELSLFTEAIKMWNTVAADSLPSGIRSCYKAIYTTTNEIAD  352

Query  777   LVFEKYGWNPIDHLKRAWKCLCSAYITEAKWFATGKSPSANEYLQTGIITTGIPMVLITC  598
             +V E+ G+NPI+HL+ AW  L   ++ EA+W AT + P+A +YL+ G +T+G+P+ L   
Sbjct  353   MVEEERGFNPINHLRHAWAVLFDGFMVEARWLATDQVPTAEDYLRNGAVTSGVPLTLALV  412

Query  597   FFLLGHGAFAGTTDIEDMITSV----GAILRLLDDLDATQGEKQDGNDASYVEYYVKEHE  430
             F +LG+       ++ D I S+      ILRL DDL + + E Q+G D SY ++Y+ E+ 
Sbjct  413   FAMLGYDQSNEAAELADHIPSIISCPAKILRLWDDLGSAEDEAQEGLDGSYRDFYLMENP  472

Query  429   GLSISDGKQRIMNMVSEQWKLINKQCLSPTRIPESFSKSCLNIARMVPMMYNYSDTHCLP  250
               + +D ++ +  +++ +W+ +N++C S       F++  LN ARMV +MY+Y     L 
Sbjct  473   SCTQADAEEHMRGLIAREWEELNRECFSRRTFASRFTQVSLNAARMVGVMYSYDKEQRLL  532

Query  249   ILQ  241
             +L+
Sbjct  533   VLE  535



>ref|XP_008679962.1| PREDICTED: (3S,6E)-nerolidol synthase 1-like isoform X1 [Zea 
mays]
Length=591

 Score =   338 bits (868),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 181/528 (34%), Positives = 306/528 (58%), Gaps = 21/528 (4%)
 Frame = -2

Query  1782  RCQSVNSSSLRSEKMTVTLSKDEFLLKSEGKREWQRGLLYQFQEDDLQ---VLNVIDAIQ  1612
             R  S+ + S  +      L  D+F L+ EG  +  R +L Q Q+       ++  +D ++
Sbjct  63    RGDSIVTRSSAAANTLPLLRNDDFDLR-EGLTD-VRNVLRQRQKSGCSSRDMMVTVDNLK  120

Query  1611  HLGIDHHFHDQIGAILQRQYQKVKIDDFQKINGLYDISLSFRLLRQEGYNVSS--DVFTK  1438
              L IDH+F ++I   +      +   D      L+D +L+FRLLR+ G+ VS+  DV  +
Sbjct  121   RLCIDHYFQEEIERAMGACCMGLIHSD-----DLFDATLAFRLLREAGHGVSAADDVLRR  175

Query  1437  FTSEK---GEFKEELSKDIRGLMALHEASHLSIEGEDVLDEAAKFSRESLIANMVHLDEC  1267
             FT +    GEF+ +LSKDIRGL++LH+ SHL + GE++L +A  FSR  L + + +L+  
Sbjct  176   FTDDDDSGGEFRLDLSKDIRGLLSLHDMSHLDMGGEELLCKARVFSRHHLASAVRYLEPS  235

Query  1266  QASMVQNTLQYPYHKSLARFTAKTFIENMRVENEWEATLVNLATMDYSITQSFYQEEFRQ  1087
                 V+ +L +PYH SL ++ A+  +  ++     +  L  L   ++ + +S +Q+E + 
Sbjct  236   LGEYVRQSLDHPYHLSLTQYKARHHLAYLQSLPVRDTALERLVAAEFQLNRSLHQKEMQA  295

Query  1086  ILRWWKSLGLKDEL--AKNQQLKWYIWTLALIPDPSMSRERIELTKPIALVYLIDDIIDV  913
             I RWW  LGL  E+   ++Q LKWY+W++  +   S SR R+++TK IALVY++DDI D+
Sbjct  296   IKRWWMELGLVQEIPVVRDQVLKWYMWSMTALQGRSFSRHRVQITKIIALVYVVDDIFDL  355

Query  912   YATFDQTKQFIDAINRWDLSVGEGLPDYMKRCLVVLFDTTNDINNLVFEKYGWNPIDHLK  733
              AT D+   F +A+  W+ +  E LP YM+ C   L+  TN+I +   +++G N ++HL+
Sbjct  356   VATLDELSLFAEAVKMWNSTAAESLPSYMRSCYKALYTVTNEIADTAEKEHGLNHVNHLR  415

Query  732   RAWKCLCSAYITEAKWFATGKSPSANEYLQTGIITTGIPMVLITCFFLLGHGAFAGTTDI  553
             +AW  L   ++ EA+W AT K P+A +YL  G++T+G+P+  +  F +LG      T  +
Sbjct  416   KAWAALFDGFMVEARWLATDKVPTAEDYLTNGVVTSGVPLTFVHIFIMLGCDDDQSTQAL  475

Query  552   EDMITSV----GAILRLLDDLDATQGEKQDGNDASYVEYYVKEHEGLSISDGKQRIMNMV  385
              D + SV      ILRL DD+ + + E Q+G D SY ++Y+ E+   S SD +  + +++
Sbjct  476   VDHMPSVISCPAKILRLWDDMGSAEDEAQEGFDGSYRDFYLMENPRCSRSDAEAHMRSLI  535

Query  384   SEQWKLINKQCLSPTRIPESFSKSCLNIARMVPMMYNYSDTHCLPILQ  241
             + +W+ +N++CL       SF+  CLN ARM+ +MY+Y+    L +L+
Sbjct  536   AREWEELNRECLCKRTFSSSFTHVCLNAARMISVMYSYNKEQRLLVLE  583



>gb|KGN64587.1| hypothetical protein Csa_1G066560 [Cucumis sativus]
Length=426

 Score =   333 bits (854),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 171/419 (41%), Positives = 266/419 (63%), Gaps = 17/419 (4%)
 Frame = -2

Query  1428  EKGEFKEELSKDIRGLMALHEASHLSIEGEDVLDEAAKFS----RESLIANMVHLDECQA  1261
             E+G FK+ L  DI+GLM+L+EAS L + GE+ + EA  FS    RE +I N  ++D+ +A
Sbjct  3     EEGHFKQNLEHDIKGLMSLYEASQLCLPGENRMKEAQNFSSKILREYIITNE-NIDKKEA  61

Query  1260  SMVQNTLQYPYHKSLARFTAKTFIEN-----MRVENEWEATLVNLATMDYSITQSFYQEE  1096
             + V+ TL+ PYH S ++F  K +            N+W      +A +D++I Q+ +Q+E
Sbjct  62    NHVERTLENPYHTSFSKFMVKDYFREGDELLHATNNKWVHAFQKVAKVDFNIAQNMHQQE  121

Query  1095  FRQILRWWKSLGLKDEL--AKNQQLKWYIWTLALIPDPSMSRERIELTKPIALVYLIDDI  922
               Q   WWK  GL   L  A++Q LKWYI +L  + DP  S ERI+L+KP++ +YLIDD+
Sbjct  122   LVQFTLWWKETGLGKTLPFARDQPLKWYICSLVCLIDPCFSDERIQLSKPVSFIYLIDDM  181

Query  921   IDVYATFDQTKQFIDAINRWDLSVGEGLPDYMKRCLVVLFDTTNDINNLVFEKYGWNPID  742
              DVY + DQ   F +A+ RWD+++ E LP+ M+ C   L+D TN+I++ +++K+GWNPI+
Sbjct  182   FDVYGSLDQLTLFTEAVRRWDITMTEALPECMRICFKSLYDMTNEISSKIYKKHGWNPIN  241

Query  741   HLKRAWKCLCSAYITEAKWFATGKSPSANEYLQTGIITTGIPMVLITCFFLLGHGAFAGT  562
              L+++W  LC A++ E +WF  G+SPSA+EYL+ G++++G+ +VL+  FFLLG      T
Sbjct  242   SLQKSWAKLCDAFLVEGRWFDCGESPSADEYLKNGVVSSGVHVVLVHAFFLLGQSITNQT  301

Query  561   TDIED----MITSVGAILRLLDDLDATQGEKQDGNDASYVEYYVKEHEGLSISDGKQRIM  394
               + D    +I+S   ILRL DDL + + E Q+G D SYV YY+  ++ +SI   ++ + 
Sbjct  302   VHLLDNDPLIISSPATILRLHDDLGSAKDENQEGYDGSYVNYYMIHNQDVSIDTTRKHMA  361

Query  393   NMVSEQWKLINKQCLS-PTRIPESFSKSCLNIARMVPMMYNYSDTHCLPILQKQIMSMF  220
             N++S  WK +NK+CLS     P +F ++ L+IAR VP++Y Y     LP L+K + SM 
Sbjct  362   NLISNSWKNLNKECLSFNNPFPAAFIQASLSIARFVPILYGYDQNQKLPTLEKIVKSML  420



>gb|EAY84259.1| hypothetical protein OsI_05639 [Oryza sativa Indica Group]
 gb|EAZ21543.1| hypothetical protein OsJ_05170 [Oryza sativa Japonica Group]
Length=527

 Score =   336 bits (862),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 168/479 (35%), Positives = 279/479 (58%), Gaps = 19/479 (4%)
 Frame = -2

Query  1635  LNVIDAIQHLGIDHHFHDQIGAILQRQYQKVKIDDFQKINGLYDISLSFRLLRQEGYNVS  1456
             +  +D ++ L +DH+F D++   +        +++      L D +L+FRL+R+ G++VS
Sbjct  44    IATVDHLRRLCMDHYFQDEVDDAMD----ACLLEELAHGGDLLDATLAFRLMREAGHHVS  99

Query  1455  SD-VFTKFTSEKGEFKEELSKDIRGLMALHEASHLSIEGEDVLDEAAKFSRESLIANMVH  1279
             +D V  +FT + GEF+ +  KDIRGL++L + SH++I  E  L +A +FS  +L + + +
Sbjct  100   ADEVLGRFTDDNGEFRLDYRKDIRGLLSLQDISHMNIGQEASLCKAKEFSTRNLESAINY  159

Query  1278  LDECQASMVQNTLQYPYHKSLARFTAKTFIENMRVENEWEATLVNLATMDYSITQSFYQE  1099
             L+   A  V+ +L +PYH SL ++ A+  +  ++        +  LA  D+ + +  +Q 
Sbjct  160   LEPNLARYVRQSLDHPYHVSLNQYKARHHLSYLQTLPIRCTAMEELALADFQLNKLLHQM  219

Query  1098  EFRQILRWWKSLGLKDEL--AKNQQLKWYIWTLALIPDPSMSRERIELTKPIALVYLIDD  925
             E ++I RWW  LGL  E+  A++Q  KW++W +  I   S+SR RIELTK ++ VY++DD
Sbjct  220   EMQEIKRWWMDLGLAQEIPVARDQVQKWFVWMMTAIQGASLSRCRIELTKIVSFVYIVDD  279

Query  924   IIDVYATFDQTKQFIDAINRWDLSVGEGLPDYMKRCLVVLFDTTNDINNLVFEKYGWNPI  745
             I D+  T ++   F  AI  WDL+  + LP  M+ C   L   TNDI ++V  ++G NPI
Sbjct  280   IFDLVGTREELSCFTQAIRMWDLAAADSLPSCMRSCFRALHTVTNDIADMVEREHGVNPI  339

Query  744   DHLKRAWKCLCSAYITEAKWFATGKSPSANEYLQTGIITTGIPMVLITCFFLLGHGAFAG  565
             +HLK+AW  L   ++TE KW + G+ P + EYL+ G++T+G+P+V +   F+LGH     
Sbjct  340   NHLKKAWAMLFDGFMTETKWLSAGQVPDSEEYLRNGVVTSGVPLVFVHLLFMLGHDVSQN  399

Query  564   TTDIEDMITSV----GAILRLLDDLDATQGEKQDGNDASYVEYYVKEHEGLSISDGKQRI  397
               +  D I  V      ILRL DDL + + E Q+G D SY E Y+KE+ GL+  + ++ +
Sbjct  400   AAEFVDHIPPVISCPAKILRLWDDLGSAKDEAQEGLDGSYKELYLKENPGLAAGEAEEHV  459

Query  396   MNMVSEQWKLINKQCL--------SPTRIPESFSKSCLNIARMVPMMYNYSDTHCLPIL  244
               +++ +W+ +N++C           T  P  F+++ LN ARMV +MY Y     LP+L
Sbjct  460   RRLIAGEWEELNRECFSASPSRSSPATTFPAGFTQAALNAARMVGVMYGYDGERRLPVL  518



>gb|AGB05613.1| sesquiterpene synthase 4 [Valeriana officinalis]
Length=545

 Score =   337 bits (863),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 178/502 (35%), Positives = 291/502 (58%), Gaps = 18/502 (4%)
 Frame = -2

Query  1686  EWQRGLLYQFQEDDLQVLNVIDAIQHLGIDHHFHDQIGAILQ---RQYQKVKIDDFQKIN  1516
             E  R  L     D  + + +ID++Q LG++HHF   I  +LQ    +++    D      
Sbjct  48    EATRRTLRNESSDSTEKMRLIDSLQRLGLNHHFEQDIKEMLQDFANEHKNTNQD------  101

Query  1515  GLYDISLSFRLLRQEGYNVSSDVFTKFTSEKGEFKEELSKDIRGLMALHEASHLSIEGED  1336
              L+  SL FRLLR  G+NV+ DVF KFT E G+FKE L +D  G+++L+EAS+L  +GE+
Sbjct  102   -LFTTSLRFRLLRHNGFNVTPDVFNKFTEENGKFKESLGEDTIGILSLYEASYLGGKGEE  160

Query  1335  VLDEAAKFSRESLIANMVHLDECQASMVQNTLQYPYHKSLARFTAKTFIE-NMRVENEWE  1159
             +L EA KFS   L  +  H+       +  +L+ P H  +AR  ++ +IE +   E   +
Sbjct  161   ILSEAMKFSESKLRESSGHVAPHIRRQIFQSLELPRHLRMARLESRRYIEEDYSNEIGAD  220

Query  1158  ATLVNLATMDYSITQSFYQEEFRQILRWWKSLGLKDEL--AKNQQLKWYIWTLALIPDPS  985
             ++L+ LA +D++  Q+ +Q E  +I RWWK LGL D+L  A+++ L+ ++WT+ L+P+P 
Sbjct  221   SSLLELAKLDFNSVQALHQMELTEISRWWKQLGLSDKLPFARDRPLECFLWTVGLLPEPK  280

Query  984   MSRERIELTKPIALVYLIDDIIDVYATFDQTKQFIDAINRWDLSVGEGLPDYMKRCLVVL  805
              S  RIEL K IA++ +IDDI D Y ++DQ   F +AI RWDL   + LP+YMK C + L
Sbjct  281   YSGCRIELAKTIAVLLVIDDIFDTYGSYDQLILFTNAIRRWDLDAMDELPEYMKICYMAL  340

Query  804   FDTTNDINNLVFEKYGWNPIDHLKRAWKCLCSAYITEAKWFATGKSPSANEYLQTGIITT  625
             ++TTN+I   V ++ GW+ + +LKR W  +   ++ EAKW  +G+ P+   Y++ G+ T 
Sbjct  341   YNTTNEICYKVLKENGWSVLPYLKRTWIDMVEGFMLEAKWLNSGEQPNLEAYIENGVTTA  400

Query  624   GIPMVLITCFFLLGHGAFAGTTDI-----EDMITSVGAILRLLDDLDATQGEKQDGNDAS  460
             G  M L+  FFL+G G       +       + +S G ILRL DDL   + E++ G+ +S
Sbjct  401   GSYMALVHLFFLIGDGVNDENVKLLLDPYPKLFSSAGRILRLWDDLGTAKEEQERGDVSS  460

Query  459   YVEYYVKEHEGLSISDGKQRIMNMVSEQWKLINKQCLSPTRIPESFSKSCLNIARMVPMM  280
              ++ Y+KE    S S+G+Q I+ ++   WK +N + +    +P++  ++  N+AR   ++
Sbjct  461   SIQLYMKEKNVRSESEGRQGIVEIIYNLWKDMNGELIGSNALPQAIIETSFNMARTSQVV  520

Query  279   YNYSDTHCLPILQKQIMSMFST  214
             Y + D      +   + S+F T
Sbjct  521   YQHEDDTYFSSVDNYVQSLFFT  542



>ref|NP_001268099.1| R-linalool synthase, chloroplastic-like [Vitis vinifera]
 gb|ADR66822.1| geraniol synthase [Vitis vinifera]
Length=593

 Score =   338 bits (867),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 173/473 (37%), Positives = 272/473 (58%), Gaps = 17/473 (4%)
 Frame = -2

Query  1650  DDLQVLNVIDAIQHLGIDHHFHDQIGAILQRQYQKVKIDDFQKINGLYDISLSFRLLRQE  1471
             D    + ++D ++ LG+ +HF D+I A+LQR        D+     L+  +L FRLLRQ 
Sbjct  97    DSRAAMEMVDTVERLGLSYHFEDEINALLQR------FCDWNASEDLFTTALRFRLLRQN  150

Query  1470  GYNVSSDVFTKFTSEKGEFKEELSKDIRGLMALHEASHLSIEGEDVLDEAAKFSRESLIA  1291
             G+   SDVF KF  + G+FKE L++DI G+++LHEASHL  + E+VL EA +F+R  LI 
Sbjct  151   GFPTHSDVFGKFMDKNGKFKESLTEDIWGMLSLHEASHLGAKNEEVLAEAKEFTRIHLIQ  210

Query  1290  NMVHLDECQASMVQNTLQYPYHKSLARFTAKTFIENMRVENEWEATLVNLATMDYSITQS  1111
             +M H++   +S V   L+ P H  + R  A+ +I     E+      + LA +D+ + QS
Sbjct  211   SMPHMEPHFSSHVGRALELPRHLRMVRLEARNYIGEYSRESNPNLAFLELAKLDFDMVQS  270

Query  1110  FYQEEFRQILRWWKSLGLKDEL--AKNQQLKWYIWTLALIPDPSMSRERIELTKPIALVY  937
              +Q+E  +I+RWWK LGL D+L  A+++ ++ ++WT+ + PDP  S  RIELTK IA++ 
Sbjct  271   LHQKELAEIVRWWKQLGLVDKLDFARDRPMECFLWTVGIFPDPRHSSCRIELTKAIAILL  330

Query  936   LIDDIIDVYATFDQTKQFIDAINRWDLSVGEGLPDYMKRCLVVLFDTTNDINNLVFEKYG  757
             + DD+ D Y + D+   F DA+ RWDL   + LP+YMK C + L++TTNDI   + +++G
Sbjct  331   VXDDVYDSYGSLDELALFTDAVKRWDLGAMDQLPEYMKICYMALYNTTNDIAYRILKEHG  390

Query  756   WNPIDHLKRAWKCLCSAYITEAKWFATGKSPSANEYLQTGIITTGIPMVLITCFFLLGHG  577
             W+ I+ LKR W  +  A++ EA  F  G  PS  EYL   + T G  M L+  FFL   G
Sbjct  391   WSVIEDLKRTWMDIFGAFLAEAHCFKGGHVPSLEEYLNNAVTTGGTYMALVHAFFLTRQG  450

Query  576   A----FAGTTDIEDMITSVGAILRLLDDLDATQGEKQDGNDASYVEYYVKEHEG-----L  424
                   A      ++ +  G ILRL DDL   + E++ G++AS +E Y +E E      L
Sbjct  451   VTRENMAMLKPYPNIFSCSGKILRLWDDLGTAREEQERGDNASSIECYKREREREMDTVL  510

Query  423   SISDGKQRIMNMVSEQWKLINKQCLSPTRIPESFSKSCLNIARMVPMMYNYSD  265
                  ++ I  M+   W  +N + ++ + +P S  K+  N++R   ++Y + D
Sbjct  511   DDEACRKHIRQMIQSLWVELNGELVASSALPLSIIKAAFNLSRTAQVIYQHGD  563



>gb|AGB05612.1| sesquiterpene synthase 3 [Valeriana officinalis]
Length=591

 Score =   337 bits (865),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 178/499 (36%), Positives = 290/499 (58%), Gaps = 12/499 (2%)
 Frame = -2

Query  1686  EWQRGLLYQFQEDDLQVLNVIDAIQHLGIDHHFHDQIGAILQRQYQKVKIDDFQKINGLY  1507
             E  R  L     D  + + +ID++Q LG++HHF   I  +LQ    + K  +      L+
Sbjct  94    EATRRTLRNESSDSTEKMRLIDSLQRLGLNHHFEQDIKEMLQDFANEHKNTN----QDLF  149

Query  1506  DISLSFRLLRQEGYNVSSDVFTKFTSEKGEFKEELSKDIRGLMALHEASHLSIEGEDVLD  1327
               SL FRLLR  G+NV+ DVF KFT E G+FKE L +D  G+++L+EAS+L  +GE++L 
Sbjct  150   TTSLRFRLLRHNGFNVTPDVFNKFTEENGKFKESLGEDTIGILSLYEASYLGGKGEEILS  209

Query  1326  EAAKFSRESLIANMVHLDECQASMVQNTLQYPYHKSLARFTAKTFIE-NMRVENEWEATL  1150
             EA KFS   L  +  H+       +  +L+ P H  +AR  ++ +IE +   E   +++L
Sbjct  210   EAMKFSESKLRESSGHVAPHIRRQIFQSLELPRHLRMARLESRRYIEEDYSNEIGADSSL  269

Query  1149  VNLATMDYSITQSFYQEEFRQILRWWKSLGLKDEL--AKNQQLKWYIWTLALIPDPSMSR  976
             + LA +D++  Q+ +Q E  +I RWWK LGL D+L  A+++ L+ ++WT+ L+P+P  S 
Sbjct  270   LELAKLDFNSVQALHQMELTEISRWWKQLGLSDKLPFARDRPLECFLWTVGLLPEPKYSG  329

Query  975   ERIELTKPIALVYLIDDIIDVYATFDQTKQFIDAINRWDLSVGEGLPDYMKRCLVVLFDT  796
              RIEL K IA++ +IDDI D Y ++DQ   F +AI RWDL   + LP+YMK C + L++T
Sbjct  330   CRIELAKTIAVLLVIDDIFDTYGSYDQLILFTNAIRRWDLDAMDELPEYMKICYMALYNT  389

Query  795   TNDINNLVFEKYGWNPIDHLKRAWKCLCSAYITEAKWFATGKSPSANEYLQTGIITTGIP  616
             TN+I   V ++ GW+ + +LKR W  +   ++ EAKW  +G+ P+   Y++ G+ T G  
Sbjct  390   TNEICYKVLKENGWSVLPYLKRTWIDMVEGFMLEAKWLNSGEQPNLEAYIENGVTTAGSY  449

Query  615   MVLITCFFLLGHGAFAGTTDI-----EDMITSVGAILRLLDDLDATQGEKQDGNDASYVE  451
             M L+  FFL+G G       +       + +S G ILRL DDL   + E++ G+ +S ++
Sbjct  450   MALVHLFFLIGDGVNDENVKLLLDPYPKLFSSAGRILRLWDDLGTAKEEQERGDVSSSIQ  509

Query  450   YYVKEHEGLSISDGKQRIMNMVSEQWKLINKQCLSPTRIPESFSKSCLNIARMVPMMYNY  271
              Y+KE    S S+G+Q I+ ++   WK +N + +    +P++  ++  N+AR   ++Y +
Sbjct  510   LYMKEKNVRSESEGRQGIVEIIYNLWKDMNGELIGSNALPQAIIETSFNMARTSQVVYQH  569

Query  270   SDTHCLPILQKQIMSMFST  214
              D      +   + S+F T
Sbjct  570   EDDTYFSSVDNYVQSLFFT  588



>emb|CBI40948.3| unnamed protein product [Vitis vinifera]
Length=432

 Score =   332 bits (850),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 163/334 (49%), Positives = 230/334 (69%), Gaps = 5/334 (1%)
 Frame = -2

Query  1719  DEFLLKSEGKREWQRGLLYQFQEDDLQVLNVIDAIQHLGIDHHFHDQIGAILQRQYQKVK  1540
             +EF ++   K E  R  L +  ED L+ L +IDAIQ LGID+HFH +I  +LQR + K  
Sbjct  91    NEFYMEHAQKLEEVRRALKEVGEDTLEALLMIDAIQRLGIDYHFHGEIEVVLQRLHTKFN  150

Query  1539  -IDDFQKINGLYDISLSFRLLRQEGYNVSSDVFTKFTSEKGEFKEELSKDIRGLMALHEA  1363
              + D    N LY+++L FRLLRQEGY VS+DVF      +G+ +E+LS+DI+GLM L+EA
Sbjct  151   TVSDCH--NNLYELALGFRLLRQEGYYVSADVFNNLKDTEGKLQEKLSEDIKGLMGLYEA  208

Query  1362  SHLSIEGEDVLDEAAKFSRESLIANMVHLDECQASMVQNTLQYPYHKSLARFTAKTFIEN  1183
             S L I+GED+L+E   FS + L A   H D  QA +V+NTL +P+HKSLARF AK+F+ +
Sbjct  209   SQLCIKGEDILEEIGNFSSQLLNAWNTHNDHSQARIVRNTLGHPHHKSLARFMAKSFLSD  268

Query  1182  MRVENEWEATLVNLATMDYSITQSFYQEEFRQILRWWKSLGLKDEL--AKNQQLKWYIWT  1009
              +  + W      LA MD+++ +S +Q+E  Q+ +WWK LGL  EL  A+NQ LKWY+W 
Sbjct  269   FQGTDGWVNVFRELAKMDFNVVKSIHQKEMLQVSKWWKDLGLAKELKFARNQPLKWYMWP  328

Query  1008  LALIPDPSMSRERIELTKPIALVYLIDDIIDVYATFDQTKQFIDAINRWDLSVGEGLPDY  829
             LA++PDPS+S +R+ELTKPI+LVY+IDDI DV+ T D+   F +A+NRW+ +  E LPDY
Sbjct  329   LAVLPDPSLSEQRVELTKPISLVYIIDDIFDVHGTLDELTLFTEAVNRWEYAAVEQLPDY  388

Query  828   MKRCLVVLFDTTNDINNLVFEKYGWNPIDHLKRA  727
             MK C   L   TN+I++ V+  +GWNP++ L++A
Sbjct  389   MKICFNALNGITNEISSKVYNDHGWNPMESLRKA  422



>ref|XP_010686917.1| PREDICTED: (3S,6E)-nerolidol synthase 1-like isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=581

 Score =   336 bits (861),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 178/478 (37%), Positives = 285/478 (60%), Gaps = 24/478 (5%)
 Frame = -2

Query  1647  DLQVLNVIDAIQHLGIDHHFHDQIGAILQRQYQKVKIDDFQKING-LYDISLSFRLLRQE  1471
             +L+ L ++D IQ LG++ +F + + A L++   + K+   +  +G  Y+++L FRLLRQ 
Sbjct  89    ELEELIMVDIIQRLGLEDYFREDMHAALEKL--RAKLCTMKDGDGKFYEVALCFRLLRQN  146

Query  1470  GYNVSSDVFTKFTSEKGEFKEELSKDIRGLMALHEASHLSIEGEDVLDEAAKFSRESL--  1297
             GY+V +DVF KF    G+FK EL KD++ L++L E+S LS  GED+L EA  FSR+ L  
Sbjct  147   GYHVPADVFYKFKDNDGKFKHELYKDVKALLSLFESSQLSTTGEDILGEACDFSRQYLED  206

Query  1296  -IANMVHLDECQASMVQNTLQYPYHKSLARFTAKTFIENMRVE----------NEWEATL  1150
              + ++V  ++ +A ++ NTL++PYHKSLAR  AK F+ +  V            EW   +
Sbjct  207   ALKDIVS-EQPKARIIVNTLRFPYHKSLARLLAKNFLLDFDVSLKILHDLSTVKEWMNEV  265

Query  1149  VNLATMDYSITQSFYQEEFRQILRWWKSLGLKD-ELAKNQQLKWYIWTLALIPDPSMSRE  973
               LA +D+ + Q  Y+ E  +I +W K+L L +   A+ +  KW +W+  + P PSMS E
Sbjct  266   QELALIDFEMAQMTYKNEVEEISKWGKTLNLDNLTFARIEPFKWCMWSFGIFPGPSMSEE  325

Query  972   RIELTKPIALVYLIDDIIDVYATFDQTKQFIDAINRWDLSVGEGLPD-YMKRCLVVLFDT  796
             R+EL K ++  Y+IDDI D    +D+   F  AINRW+ +  +GLP+ YMK C   L +T
Sbjct  326   RLELAKAVSFAYIIDDIFDSCGRYDELYLFTKAINRWEYADIKGLPNNYMKVCFKALLET  385

Query  795   TNDINNLVFEKYGWNPIDHLKRAWKCLCSAYITEAKWFATGKSPSANEYLQTGIITTGIP  616
             T+D +  +  K+GWNP++ L+  W   C+A + E+KW     SP+A+EYL  GI+T+G  
Sbjct  386   TDDFSYKIQTKHGWNPLELLRNLWAEHCNACLLESKWSVARYSPTADEYLNNGIVTSGTH  445

Query  615   MVLITCFFLLGHG----AFAGTTDIEDMITSVGAILRLLDDLDATQGEKQDGNDASYVEY  448
             +VL   FFL+G G    +      +  +I+S   ILRL +D      +  +G D SYV+ 
Sbjct  446   VVLAHAFFLIGQGINKRSLEELKTLPSIISSAATILRLWNDAGIHTDKTPNGYDGSYVDI  505

Query  447   YVKEHEGLSISDGKQRIMNMVSEQWKLINKQCLSP-TRIPESFSKSCLNIARMVPMMY  277
             ++KE +  S    ++ +  M+S+ WK +N++ +SP +   + F  +C+N+ R+VP MY
Sbjct  506   FMKEQKCSSSDCARRHVRQMISDAWKCLNEEYVSPISPFSKDFKVACVNLTRVVPFMY  563



>ref|NP_001045720.1| Os02g0121700 [Oryza sativa Japonica Group]
 dbj|BAD07605.1| putative linalool synthase [Oryza sativa Japonica Group]
 dbj|BAF07634.1| Os02g0121700 [Oryza sativa Japonica Group]
 gb|ACF05530.1| linalool synthase [Oryza sativa Japonica Group]
 dbj|BAG99084.1| unnamed protein product [Oryza sativa Japonica Group]
Length=595

 Score =   336 bits (862),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 168/479 (35%), Positives = 279/479 (58%), Gaps = 19/479 (4%)
 Frame = -2

Query  1635  LNVIDAIQHLGIDHHFHDQIGAILQRQYQKVKIDDFQKINGLYDISLSFRLLRQEGYNVS  1456
             +  +D ++ L +DH+F D++   +        +++      L D +L+FRL+R+ G++VS
Sbjct  112   IATVDHLRRLCMDHYFQDEVDDAMD----ACLLEELAHGGDLLDATLAFRLMREAGHHVS  167

Query  1455  SD-VFTKFTSEKGEFKEELSKDIRGLMALHEASHLSIEGEDVLDEAAKFSRESLIANMVH  1279
             +D V  +FT + GEF+ +  KDIRGL++L + SH++I  E  L +A +FS  +L + + +
Sbjct  168   ADEVLGRFTDDNGEFRLDYRKDIRGLLSLQDISHMNIGQEASLCKAKEFSTRNLESAINY  227

Query  1278  LDECQASMVQNTLQYPYHKSLARFTAKTFIENMRVENEWEATLVNLATMDYSITQSFYQE  1099
             L+   A  V+ +L +PYH SL ++ A+  +  ++        +  LA  D+ + +  +Q 
Sbjct  228   LEPNLARYVRQSLDHPYHVSLNQYKARHHLSYLQTLPIRCTAMEELALADFQLNKLLHQM  287

Query  1098  EFRQILRWWKSLGLKDEL--AKNQQLKWYIWTLALIPDPSMSRERIELTKPIALVYLIDD  925
             E ++I RWW  LGL  E+  A++Q  KW++W +  I   S+SR RIELTK ++ VY++DD
Sbjct  288   EMQEIKRWWMDLGLAQEIPVARDQVQKWFVWMMTAIQGASLSRCRIELTKIVSFVYIVDD  347

Query  924   IIDVYATFDQTKQFIDAINRWDLSVGEGLPDYMKRCLVVLFDTTNDINNLVFEKYGWNPI  745
             I D+  T ++   F  AI  WDL+  + LP  M+ C   L   TNDI ++V  ++G NPI
Sbjct  348   IFDLVGTREELSCFTQAIRMWDLAAADSLPSCMRSCFRALHTVTNDIADMVEREHGVNPI  407

Query  744   DHLKRAWKCLCSAYITEAKWFATGKSPSANEYLQTGIITTGIPMVLITCFFLLGHGAFAG  565
             +HLK+AW  L   ++TE KW + G+ P + EYL+ G++T+G+P+V +   F+LGH     
Sbjct  408   NHLKKAWAMLFDGFMTETKWLSAGQVPDSEEYLRNGVVTSGVPLVFVHLLFMLGHDVSQN  467

Query  564   TTDIEDMITSV----GAILRLLDDLDATQGEKQDGNDASYVEYYVKEHEGLSISDGKQRI  397
               +  D I  V      ILRL DDL + + E Q+G D SY E Y+KE+ GL+  + ++ +
Sbjct  468   AAEFVDHIPPVISCPAKILRLWDDLGSAKDEAQEGLDGSYKELYLKENPGLAAGEAEEHV  527

Query  396   MNMVSEQWKLINKQCL--------SPTRIPESFSKSCLNIARMVPMMYNYSDTHCLPIL  244
               +++ +W+ +N++C           T  P  F+++ LN ARMV +MY Y     LP+L
Sbjct  528   RRLIAGEWEELNRECFSASPSRSSPATTFPAGFTQAALNAARMVGVMYGYDGERRLPVL  586



>ref|XP_006851178.1| hypothetical protein AMTR_s00043p00177130 [Amborella trichopoda]
 gb|ERN12759.1| hypothetical protein AMTR_s00043p00177130 [Amborella trichopoda]
Length=483

 Score =   332 bits (851),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 172/459 (37%), Positives = 259/459 (56%), Gaps = 8/459 (2%)
 Frame = -2

Query  1635  LNVIDAIQHLGIDHHFHDQIGAILQRQYQKVKIDDFQKINGLYDISLSFRLLRQEGYNVS  1456
             + +ID IQ L + +HF  +I A L   Y+          + L    L FRLLRQ GYNVS
Sbjct  1     MALIDHIQRLSVAYHFEMEIEAALGGIYRGFSTHGSD--DNLLVAYLKFRLLRQHGYNVS  58

Query  1455  SDVFTKFTSEKGEFKEELSKDIRGLMALHEASHLSIEGEDVLDEAAKFSRESLIANMVHL  1276
             S+VF KF    G FK  LS+D  G++ L+EASHL I+GED++DEA  F  E L  +M  +
Sbjct  59    SNVFNKFKDGNGNFKPSLSEDFIGMLNLYEASHLRIQGEDIMDEALGFCVEHLSTSMHRI  118

Query  1275  DECQASMVQNTLQYPYHKSLARFTAKTFIENMRVENEWEATLVNLATMDYSITQSFYQEE  1096
             +     +V++ L+ P H    R   + +IE  + + +    L+  A  D+++ QS Y+ E
Sbjct  119   EPNIVKIVKHALKLPLHFRTPRLETRHYIEVYKEDPQRNQDLLEFAQRDFNMVQSLYRGE  178

Query  1095  FRQILRWWKSLGLKDELA--KNQQLKWYIWTLALIPDPSMSRERIELTKPIALVYLIDDI  922
              +++ RWW  L +  ELA   +Q   W++W +A++P+P  S  R+++TK I+ +YLIDDI
Sbjct  179   LKEVSRWWLELDMAKELAFAPDQIHHWFMWPVAIVPEPKYSECRVDMTKVISFIYLIDDI  238

Query  921   IDVYATFDQTKQFIDAINRWDLSVGEGLPDYMKRCLVVLFDTTNDINNLVFEKYGWNPID  742
              DVY + D+ + F  AI RWDLS   G P YM  C + L   T DI   + + +G++  D
Sbjct  239   YDVYGSMDELELFTQAITRWDLSEIHGFPKYMNVCYLALHGVTRDIARKIHKNHGFDITD  298

Query  741   HLKRAWKCLCSAYITEAKWFATGKSPSANEYLQTGIITTGIPMVLITCFFLLGHGAFAGT  562
             +L++AW  LC   + +AKWF +G+ P A EYL+  + +TG+ +VLI  +FL+GH     T
Sbjct  299   YLRQAWTSLCEPDLVQAKWFRSGQVPRAKEYLKNAVTSTGVHVVLIHTYFLMGHKVTRET  358

Query  561   TDI----EDMITSVGAILRLLDDLDATQGEKQDGNDASYVEYYVKEHEGLSISDGKQRIM  394
               +       I     I RL DDL  +  E+  G+DASY+E Y+KEHE  S    ++   
Sbjct  359   ARLISNDPQFIRCPATIQRLWDDLSTSMEERDGGDDASYIESYMKEHEDESEESAREHTT  418

Query  393   NMVSEQWKLINKQCLSPTRIPESFSKSCLNIARMVPMMY  277
             N++   WK    + L P     SF+ S LNI+R+  ++Y
Sbjct  419   NLIITMWKRRIHESLKPNPFQHSFTISVLNISRIAQVVY  457



>gb|AHE41084.1| geraniol synthase [Valeriana officinalis]
Length=594

 Score =   334 bits (857),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 176/499 (35%), Positives = 290/499 (58%), Gaps = 12/499 (2%)
 Frame = -2

Query  1686  EWQRGLLYQFQEDDLQVLNVIDAIQHLGIDHHFHDQIGAILQRQYQKVKIDDFQKINGLY  1507
             E  R  L     D  + + +ID++Q LG++HHF   I  +LQ    + K  +      L+
Sbjct  94    EATRRTLRNESSDSTEKMRLIDSLQRLGLNHHFEQDIKEMLQDFANEHKNTN----QDLF  149

Query  1506  DISLSFRLLRQEGYNVSSDVFTKFTSEKGEFKEELSKDIRGLMALHEASHLSIEGEDVLD  1327
               SL FRLLR  G+NV+ DVF KFT E G+FKE L +D  G+++L+EAS+L  +GE++L 
Sbjct  150   TTSLRFRLLRHNGFNVTPDVFNKFTEENGKFKESLGEDTIGILSLYEASYLGGKGEEILS  209

Query  1326  EAAKFSRESLIANMVHLDECQASMVQNTLQYPYHKSLARFTAKTFIE-NMRVENEWEATL  1150
             EA KFS   L  +  H+       +  +L+ P H  +AR  ++ +IE +   E   +++L
Sbjct  210   EAMKFSESKLRESSGHVAXHIRRQIFQSLELPRHLRMARLESRRYIEEDYSNEIGADSSL  269

Query  1149  VNLATMDYSITQSFYQEEFRQILRWWKSLGLKDEL--AKNQQLKWYIWTLALIPDPSMSR  976
             + LA +D++  Q+ +Q E  +I RWWK LGL D+L  A+++ L+ ++WT+ L+P+P  S 
Sbjct  270   LELAKLDFNSVQALHQMELTEISRWWKQLGLSDKLPFARDRPLECFLWTVGLLPEPKYSG  329

Query  975   ERIELTKPIALVYLIDDIIDVYATFDQTKQFIDAINRWDLSVGEGLPDYMKRCLVVLFDT  796
              RIEL K IA++ +IDDI D Y ++DQ   F +AI RWDL   + LP+YMK C + L++T
Sbjct  330   CRIELAKTIAVLLVIDDIFDTYGSYDQLILFTNAIRRWDLDAMDELPEYMKICYMALYNT  389

Query  795   TNDINNLVFEKYGWNPIDHLKRAWKCLCSAYITEAKWFATGKSPSANEYLQTGIITTGIP  616
             TN+I   V ++ GW+ + +L+R W  +   ++ EAKW  +G+ P+   Y++ G+ T G  
Sbjct  390   TNEICYKVLKENGWSVLPYLERTWIDMVEGFMLEAKWLNSGEQPNLEAYIENGVTTAGSY  449

Query  615   MVLITCFFLLGHGAFAGTTDI-----EDMITSVGAILRLLDDLDATQGEKQDGNDASYVE  451
             M L+  FFL+G G       +       + +S G ILRL DDL   + E++ G+ +S ++
Sbjct  450   MALVHLFFLIGDGVNDENVKLLLDPYPKLFSSAGRILRLWDDLGTAKEEQERGDVSSSIQ  509

Query  450   YYVKEHEGLSISDGKQRIMNMVSEQWKLINKQCLSPTRIPESFSKSCLNIARMVPMMYNY  271
              Y+KE    S S+G++ I+ ++   WK +N + +    +P++  ++  N+AR   ++Y +
Sbjct  510   LYMKEKNVRSESEGREGIVEIIYNLWKDMNGELIGSNALPQAIIETSFNMARTSQVVYQH  569

Query  270   SDTHCLPILQKQIMSMFST  214
              D      +   + S+F T
Sbjct  570   EDDTYFSSVDNYVQSLFFT  588



>ref|XP_009386568.1| PREDICTED: (3S,6E)-nerolidol synthase 1-like [Musa acuminata 
subsp. malaccensis]
Length=408

 Score =   328 bits (840),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 158/398 (40%), Positives = 259/398 (65%), Gaps = 8/398 (2%)
 Frame = -2

Query  1404  LSKDIRGLMALHEASHLSIEGEDVLDEAAKFSRESLIANMVHLDECQASMVQNTLQYPYH  1225
             L++ I G+++L EAS+L+  GE++L +A  F+ + L ++M +++      +Q TL +PYH
Sbjct  4     LTEKIDGMISLFEASNLNT-GENILHKANIFATDYLKSSMTYMEPDSVKCIQQTLDHPYH  62

Query  1224  KSLARFTAKTFIENMRVENEWEATLVNLATMDYSITQSFYQEEFRQILRWWKSLGLKDEL  1045
              SL R+ A+ ++ + R E   +  +  LA  D+ + QS +++E  +I  WWK+LGL  EL
Sbjct  63    MSLQRYKARQYLNHQRGEEGRKGVIQELARTDFVLIQSLHRKELNEITCWWKNLGLAQEL  122

Query  1044  --AKNQQLKWYIWTLALIPDPSMSRERIELTKPIALVYLIDDIIDVYATFDQTKQFIDAI  871
               A++Q LKWY W++ ++P+P  S+ RI LTK I+ +YL+DDI DV+ + D+   F  AI
Sbjct  123   RFARDQSLKWYTWSMTILPNPKFSKYRIALTKVISFIYLLDDIYDVHGSLDELHLFTKAI  182

Query  870   NRWDLSVGEGLPDYMKRCLVVLFDTTNDINNLVFEKYGWNPIDHLKRAWKCLCSAYITEA  691
             + W++S  + LP YM+ C + L++TT++I  +VF+++GWNPI+ L ++W  LC+A++ EA
Sbjct  183   DEWEISAIDSLPFYMRICYMALYNTTDEITQMVFKEHGWNPINSLTKSWIALCNAFMVEA  242

Query  690   KWFATGKSPSANEYLQTGIITTGIPMVLITCFFLLGHGAFAGTTDI----EDMITSVGAI  523
             KWFA  + P A++Y++ G I+ G+P+VLI  FFLLG G      ++      +I+S   I
Sbjct  243   KWFAHSRVPMADDYMRNGTISCGVPVVLIHIFFLLGQGLTHDNVNLIESYPKLISSPAKI  302

Query  522   LRLLDDLDATQGEKQDGNDASYVEYYVKEHEGLSISDGKQRIMNMVSEQWKLINKQC-LS  346
             LRL DDL + + E QDG D SY+E ++KE+   S    +  +M M+S+ W+ +NK+C  S
Sbjct  303   LRLWDDLGSAKDENQDGFDGSYLECFMKENPYCSGQGARDHVMLMISKAWEELNKECFFS  362

Query  345   PTRIPESFSKSCLNIARMVPMMYNYSDTHCLPILQKQI  232
              +   + F  +CLN+ARMV +MY+Y D   LP+L++ I
Sbjct  363   SSSFSQDFVMACLNMARMVKVMYSYDDEQKLPLLEEYI  400



>gb|ADK62524.1| geraniol synthase [Phyla dulcis]
Length=584

 Score =   332 bits (852),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 178/484 (37%), Positives = 275/484 (57%), Gaps = 21/484 (4%)
 Frame = -2

Query  1635  LNVIDAIQHLGIDHHFHDQIGAILQRQYQKVKIDDFQKINGLYDISLSFRLLRQEGYNVS  1456
             L  ID IQ LGI  +F D+I  ILQ +      D  Q  +GL+  +L FRLLR  GY ++
Sbjct  109   LKFIDTIQRLGISCYFEDEINGILQAELS----DTDQLEDGLFTTALRFRLLRHYGYQIA  164

Query  1455  SDVFTKFTSEKGEFKEELSKDIRGLMALHEASHLSIEGEDVLDEAAKFSRESLIANMVHL  1276
              DVF KFT + G+FKE L+ D +GL++L+EAS++   GE++L+EA KF++        HL
Sbjct  165   PDVFLKFTDQNGKFKESLADDTQGLVSLYEASYMGANGENILEEAMKFTK-------THL  217

Query  1275  DECQASM--VQNTLQYPYHKSLARFTAKTFIENMRVENEWEATLVNLATMDYSITQSFYQ  1102
                Q +M  V   L+ P H  +AR  A+ +IE        +  L+ L  +DY+  Q+ +Q
Sbjct  218   QGRQHAMREVAEALELPRHLRMARLEARRYIEQYGTMIGHDKDLLELVILDYNNVQAQHQ  277

Query  1101  EEFRQILRWWKSLGLKDEL--AKNQQLKWYIWTLALIPDPSMSRERIELTKPIALVYLID  928
              E  +I RWWK LGL D+L  A+++ L+ ++WT+ L+P+P  S  RIEL K IA++ +ID
Sbjct  278   AELAEIARWWKELGLVDKLTFARDRPLECFLWTVGLLPEPKYSACRIELAKTIAILLVID  337

Query  927   DIIDVYATFDQTKQFIDAINRWDLSVGEGLPDYMKRCLVVLFDTTNDINNLVFEKYGWNP  748
             DI D Y   ++   F +AI RWDL   E LP+YMK C + L++TTN+I   V +K GW+ 
Sbjct  338   DIFDTYGKMEELALFTEAIRRWDLEAMETLPEYMKICYMALYNTTNEICYKVLKKNGWSV  397

Query  747   IDHLKRAWKCLCSAYITEAKWFATGKSPSANEYLQTGIITTGIPMVLITCFFLLGHGAFA  568
             + +L+  W  +   ++ EAKWF  G +P+  EY++ G+ T G  M L+  FFL+G G  A
Sbjct  398   LPYLRYTWMDMIEGFMVEAKWFNGGSAPNLEEYIENGVSTAGAYMALVHLFFLIGEGVSA  457

Query  567   GTTDI------EDMITSVGAILRLLDDLDATQGEKQDGNDASYVEYYVKEHEGLSISDGK  406
                 I        + ++ G ILRL DDL   + E+  G+ AS +  ++KE    +  +G+
Sbjct  458   QNAQILLKKPYPKLFSAAGRILRLWDDLGTAKEEEGRGDLASSIRLFMKEKNLTTEEEGR  517

Query  405   QRIMNMVSEQWKLINKQCLSPTRIPESFSKSCLNIARMVPMMYNYSDTHCLPILQKQIMS  226
               I   +   WK +N + +S  R+P +  K  LN+AR   ++Y + +      +   + +
Sbjct  518   NGIQEEIYSLWKDLNGELISKGRMPLAIIKVALNMARASQVVYKHDEDSYFSCVDNYVEA  577

Query  225   MFST  214
             +F T
Sbjct  578   LFFT  581



>ref|XP_010419443.1| PREDICTED: S-(+)-linalool synthase, chloroplastic [Camelina sativa]
Length=510

 Score =   329 bits (844),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 175/490 (36%), Positives = 288/490 (59%), Gaps = 17/490 (3%)
 Frame = -2

Query  1656  QEDDLQVLNVIDAIQHLGIDHHFHDQIGAILQRQYQKVKIDDFQKINGLYDISLSFRLLR  1477
             ++D  + L + +A Q LGI  HF  +I   L   Y++     F   + +++++L FR+LR
Sbjct  25    RDDPFESLEMTNANQGLGIVLHFRLEIDQNLHIIYKECT--HFYACD-IHELALCFRVLR  81

Query  1476  QEGYNVSSDVFTKFTSEKGEFKEELSKDIRGLMALHEASHLSIEGEDVLDEAAKFSRESL  1297
             Q+G+ V   +F    ++KG  +++   D++ L  L+EA  + +E E+  D   +F  + L
Sbjct  82    QDGHYVQESIFENILNKKGRLEDDPKVDVKVL--LYEAFEIFLEDEETHDGVKEFMFDRL  139

Query  1296  IANMVHLDECQASMVQNTLQYPYHKSLARFTAKTFIENMRV---EN-EWEATLVNLATMD  1129
                       Q  ++ +TL  P HK+L R T+  FI  +++   EN EW  +++ +A + 
Sbjct  140   NELCSCRKSHQERVMMSTLAQPRHKTLRRLTSNRFISMIKIAGQENKEWFQSILGVAEIK  199

Query  1128  YSITQSFYQEEFRQILRWWKSLGLKDELAK--NQQLKWYIWTLALIPDPSMSRERIELTK  955
               + +S   EE  QI +WW+ LGL+ EL K  NQ LKWY W+  ++ DP+++ +R++LTK
Sbjct  200   SILLKSLVHEEMSQISKWWRELGLEKELRKIRNQPLKWYTWSREILQDPTLTEQRLDLTK  259

Query  954   PIALVYLIDDIIDVYATFDQTKQFIDAINRWDLSVGEGLPDYMKRCLVVLFDTTNDINNL  775
             PI+LVY+ DDI DVY   ++   F   + RWD    E LP YMK C   L   T +I+  
Sbjct  260   PISLVYVKDDIFDVYGKLEELIIFTQVVERWDHKGLEKLPRYMKVCFEALDMITMEISMK  319

Query  774   VFEKYGWNPIDHLKRAWKCLCSAYITEAKWFATGKSPSANEYLQTGIITTGIPMVLITCF  595
             + + +GWNP D L+++W  LC A++ EAKWF +G  P+  EY++ G++++G+ +V++  +
Sbjct  320   ICKSHGWNPTDSLRKSWASLCKAFLIEAKWFNSGYLPNTEEYMKNGVVSSGVHLVMLHVY  379

Query  594   FLLGHGAFAGTTDIED----MITSVGAILRLLDDLDATQGEKQDGNDASYVEYYVKEHEG  427
             FLLG        ++ +    +++S   ILRL DDL + + E QDG D SY+E Y+ E+EG
Sbjct  380   FLLGEELTREKVELIESNPRIVSSAATILRLWDDLGSAKDENQDGADGSYIECYMNEYEG  439

Query  426   LSISDGKQRIMNMVSEQWKLINKQCLSPTRIPESFSKSCLNIARMVPMM--YNYSDTHCL  253
              ++ + +  + + +S+ WK +N +CL+P+    SFSK+CLNIAR VP+M  YNY D   L
Sbjct  440   STVDEARTHVFHKISKAWKCLNMECLNPSPFSRSFSKACLNIARTVPLMYKYNYDDDQRL  499

Query  252   PILQKQIMSM  223
               L K + S+
Sbjct  500   LGLDKYLKSL  509



>gb|EMS50987.1| (3S,6E)-nerolidol synthase 1, chloroplastic [Triticum urartu]
Length=551

 Score =   329 bits (843),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 184/489 (38%), Positives = 299/489 (61%), Gaps = 23/489 (5%)
 Frame = -2

Query  1677  RGLLYQFQEDDLQVLNVIDAIQHLGIDHHFHDQIGAILQRQYQKVKIDDFQKINGLYDIS  1498
             + LL+Q  +    +L  +D ++ L IDH+F D+I  ++      V  DD      L D +
Sbjct  68    QALLHQHPKSRRAMLTTVDHLKRLCIDHYFQDEIDNVMDACVDLVHSDD------LLDAT  121

Query  1497  LSFRLLRQEGYNVSSD-VFTKFTSEKGEFKEELSKDIRGLMALHEASHLSIEGEDVLDEA  1321
             LS RL+R+ GY VS+D V  KFT++ G+F   L+KDIRG+++L + S+L++ GE  L +A
Sbjct  122   LSLRLMREAGYYVSADDVLRKFTNDNGDFNHGLTKDIRGMLSLQDMSYLNM-GESSLYKA  180

Query  1320  AKFSRESLIANMVHLDECQASMVQNTLQYPYHKSLARFTAK---TFIENMRVENEWEATL  1150
              +FS + L   + +L+   A  V+ +L +PYH SL ++ A+   ++++N+   N    ++
Sbjct  181   NEFSAKHLRLAIKYLEPSLARYVRRSLDHPYHVSLMQYKARHHLSYLQNLPTRN---TSI  237

Query  1149  VNLATMDYSITQSFYQEEFRQILRWWKSLGLKDEL--AKNQQLKWYIWTLALIPDPSMSR  976
              NLA  ++ I +  +Q E +++ RWW  LGL  E+  A++Q LKWY+W +A++   S SR
Sbjct  238   ENLALAEFQIKKLQHQREIKEVKRWWMDLGLAKEIPGARDQVLKWYMWPMAVLEGLSFSR  297

Query  975   ERIELTKPIALVYLIDDIIDVYATFDQTKQFIDAINRWDLSVG-EGLPDYMKRCLVVLFD  799
              RIE+TK I++VY++DDI D+ AT ++   F +AI  WD +   + LP YM  C   L+ 
Sbjct  298   YRIEITKIISMVYIVDDIFDLVATQNELSLFNEAIKMWDPAAAVDSLPSYMISCYKALYT  357

Query  798   TTNDINNLVFEKYGWNPIDHLKRAWKCLCSAYITEAKWFATGKSPSANEYLQTGIITTGI  619
              TNDI  +V +++G NPI HLK+AW  L   ++ E KW  T ++P++ +YL+ GI+T+G 
Sbjct  358   VTNDIAAMVRKEHGLNPITHLKQAWAALFDGFMIEGKWLYTNQAPTSEDYLRNGIVTSGA  417

Query  618   PMVLITCFFLLGHGAFAGTTD-IEDMITSVGAILRLLDDLDATQGEKQDGNDASYVEYYV  442
             P+V +  FFLLGH    G  D I  +I+    I+RL DD+ + + E Q G D SY E Y 
Sbjct  418   PLVFLHLFFLLGHDFTEGNNDRILRIISCTAKIMRLWDDMGSAKDESQAGLDGSYKELYH  477

Query  441   KEHEGLSISDGKQRIMNMVSEQWKLINKQCLSPT--RIPESFSKSCLNIARMVPMMYNYS  268
             +E+      D ++ +++M++ +W+ +N++C S T   +  +F ++ LN ARMV +MY+Y 
Sbjct  478   RENPH---GDAEKHMLDMIASEWQDLNRECFSGTTSTLSHTFIRASLNFARMVRVMYSYD  534

Query  267   DTHCLPILQ  241
             D   LPIL+
Sbjct  535   DEQRLPILE  543



>emb|CDP20228.1| unnamed protein product [Coffea canephora]
Length=480

 Score =   327 bits (837),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 167/481 (35%), Positives = 277/481 (58%), Gaps = 12/481 (2%)
 Frame = -2

Query  1635  LNVIDAIQHLGIDHHFHDQIGAILQRQYQKVKIDDFQKINGLYDISLSFRLLRQEGYNVS  1456
             +N+ID +Q LG+ +HF D + AIL +     + D       L   +L FRLLR  G+ +S
Sbjct  1     MNLIDTLQRLGLAYHFEDDMNAILSQLSSSGQSD-----GDLLTTALRFRLLRHNGHKIS  55

Query  1455  SDVFTKFTSEKGEFKEELSKDIRGLMALHEASHLSIEGEDVLDEAAKFSRESLIANMVHL  1276
             SD+F KF  + G+FK+ L +D  GL++L+EASHL+  GED+L EA + +   L  ++  L
Sbjct  56    SDIFQKFMDKNGKFKDSLKEDTMGLLSLYEASHLAANGEDILLEAMELTEAHLKQSLPSL  115

Query  1275  DECQASMVQNTLQYPYHKSLARFTAKTFIENMRVENEWEATLVNLATMDYSITQSFYQEE  1096
                 A  V + L+ P H+ +AR  A+ +I+    E   +  L+ LA +DY+  QS +Q E
Sbjct  116   PTQLARKVSSALELPRHRRMARLEARRYIQEYSEEIGHDPNLLELAKLDYNKVQSLHQME  175

Query  1095  FRQILRWWKSLGLKDEL--AKNQQLKWYIWTLALIPDPSMSRERIELTKPIALVYLIDDI  922
                I RWWK LGL D+L  A+++ L+ ++WT+ ++P+P  S  RIEL K IA++ +IDDI
Sbjct  176   LTDISRWWKQLGLVDKLTFARDRPLECFLWTVGILPEPKYSNCRIELAKTIAILLVIDDI  235

Query  921   IDVYATFDQTKQFIDAINRWDLSVGEGLPDYMKRCLVVLFDTTNDINNLVFEKYGWNPID  742
              D + T D+   F +AI RWDL   EGLP+YM+ C + L++TTN+I   + ++ GW+ + 
Sbjct  236   FDTHGTIDELVLFTNAIRRWDLEAMEGLPEYMRICYMALYNTTNEICYKILKENGWSVLP  295

Query  741   HLKRAWKCLCSAYITEAKWFATGKSPSANEYLQTGIITTGIPMVLITCFFLLGHGAFAGT  562
             +LK  W  +   ++ EA W++ G+ P+  EY+  G+ T G  M ++  FFL+G G     
Sbjct  296   YLKATWIDMIEGFMLEASWYSNGQEPNMEEYVANGVTTAGTYMAMVHLFFLIGQGVTEEN  355

Query  561   TDI-----EDMITSVGAILRLLDDLDATQGEKQDGNDASYVEYYVKEHEGLSISDGKQRI  397
               +       + +  G ILRL DDL   + E++ G+ AS ++ +++E+      +G++RI
Sbjct  356   VKLLMKPYPKLFSCSGRILRLWDDLGTAKEEQERGDLASSIQLFMRENNITCDEEGRKRI  415

Query  396   MNMVSEQWKLINKQCLSPTRIPESFSKSCLNIARMVPMMYNYSDTHCLPILQKQIMSMFS  217
             + ++   WK +N   +S   +P +  K+  N+AR   ++Y + +      +   + S+F 
Sbjct  416   LQLIDNLWKDLNWGLVSRNAMPLAIIKAAFNMARSSQVVYQHEEESYFSSVDNYVESLFF  475

Query  216   T  214
             T
Sbjct  476   T  476



>ref|XP_006858763.1| hypothetical protein AMTR_s00066p00144770 [Amborella trichopoda]
 gb|ERN20230.1| hypothetical protein AMTR_s00066p00144770 [Amborella trichopoda]
Length=565

 Score =   328 bits (842),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 179/483 (37%), Positives = 278/483 (58%), Gaps = 11/483 (2%)
 Frame = -2

Query  1641  QVLNVIDAIQHLGIDHHFHDQIGAILQRQYQKVKIDDFQKINGLYDISLSFRLLRQEGYN  1462
             ++LN++D +QHLG+ H+F  +I   L   YQ+         + L  +SL FRLLRQEGYN
Sbjct  10    RILNLMDLLQHLGLAHNFEREIEHALDLIYQRN-----DGYDDLSSVSLRFRLLRQEGYN  64

Query  1461  VSSDVFTKFTSEKGEFKEELSKDIRGLMALHEASHLSIEGEDVLDEAAKFSRESLIANMV  1282
             VSSD F KFT ++G+F   L +D+RG++ L+EASHL    ED+L+EA  F+ + L   M 
Sbjct  65    VSSDNFKKFTLKEGKFNPCLIEDVRGMLCLYEASHLGTPREDILNEALDFTSKHLKGVME  124

Query  1281  HLDECQASMVQNTLQYPYHKSLARFTAKTFIENMRVENEWEATLVNLATMDYSITQSFYQ  1102
              L+   A  +++ L+ P H+ + R   K  I       +    L+ LA +D+++ Q  YQ
Sbjct  125   DLEPNLAREIRSALELPLHRRVNRLMVKDNIMAYERCKDNNKVLLELAKLDFNMVQLLYQ  184

Query  1101  EEFRQILRWWKSLGLKDEL--AKNQQLKWYIWTLALIPDPSMSRERIELTKPIALVYLID  928
              E   ILRWW+ LGL  +L  A+++ L+ Y WT+ +  +PS S+ R+ELTK IAL+ +ID
Sbjct  185   REINDILRWWRELGLTKQLTFARDRPLECYFWTVGIFSEPSFSKCRMELTKTIALLSVID  244

Query  927   DIIDVYATFDQTKQFIDAINRWDLSVGEGLPDYMKRCLVVLFDTTNDINNLVFEKYGWNP  748
             DI D+Y + ++ + F +A+ RWDLS  E LP+YMK C + L++T N +   +   YG N 
Sbjct  245   DIYDIYGSLEELEIFTNAVQRWDLSAMEELPEYMKICYLALYNTINQMAIEILNDYGRNV  304

Query  747   IDHLKRAWKCLCSAYITEAKWFATGKSPSANEYLQTGIITTGIPMVLITCFFLLGHGAFA  568
             + HLK+ W  LC AY+ EA+W   G  P+ +EYL+T  IT G  M L     L+G     
Sbjct  305   VMHLKKRWSDLCHAYLVEAQWVRRGYVPTLDEYLRTSAITGGTYMALFHSLCLMGDKVTR  364

Query  567   GTTDIEDMITSV----GAILRLLDDLDATQGEKQDGNDASYVEYYVKEHEGLSISDGKQR  400
              + +  D   ++      ILRL DDL  ++ EK+ G+ +S +EYY++ +   +    ++ 
Sbjct  365   ESNETIDQNPNIVWCSAVILRLWDDLGTSKDEKERGDVSSSIEYYMRNNGKCTDDQAREN  424

Query  399   IMNMVSEQWKLINKQCLSPTRIPESFSKSCLNIARMVPMMYNYSDTHCLPILQKQIMSMF  220
             I + +S+ WK +N      +   +SFSK+ LN++RM  ++Y + D    P +   I S  
Sbjct  425   IRSCISDTWKELNCHYFQSSPFSKSFSKAALNLSRMAQVIYQHGDNPSFPAIDDHIKSFM  484

Query  219   STI  211
               I
Sbjct  485   DPI  487



>emb|CDP20227.1| unnamed protein product [Coffea canephora]
Length=584

 Score =   328 bits (841),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 167/486 (34%), Positives = 282/486 (58%), Gaps = 12/486 (2%)
 Frame = -2

Query  1650  DDLQVLNVIDAIQHLGIDHHFHDQIGAILQRQYQKVKIDDFQKINGLYDISLSFRLLRQE  1471
             + L+ +N+ID +Q LG+ +HF D + AIL +     + D       L   +L FRLLR  
Sbjct  100   EPLKAMNLIDTLQRLGLAYHFEDDMNAILSQLSSSGQSD-----GDLLTTALRFRLLRHN  154

Query  1470  GYNVSSDVFTKFTSEKGEFKEELSKDIRGLMALHEASHLSIEGEDVLDEAAKFSRESLIA  1291
             G+ +SSD+F KF  + G+FK+ L +D  GL++L+EASH+   G+D+L EA +F+   L  
Sbjct  155   GHKISSDIFQKFMDKNGKFKDSLKEDTMGLLSLYEASHVGANGDDLLLEAMEFTEAHLKQ  214

Query  1290  NMVHLDECQASMVQNTLQYPYHKSLARFTAKTFIENMRVENEWEATLVNLATMDYSITQS  1111
             ++  L    A  V + L+ P H+ +AR  A+ +I+    E   +  L+ LA +DY+  QS
Sbjct  215   SLPSLPTQLARKVSSALELPRHRRMARLEARRYIQEYSEEIGHDPNLLELAKLDYNKVQS  274

Query  1110  FYQEEFRQILRWWKSLGLKDEL--AKNQQLKWYIWTLALIPDPSMSRERIELTKPIALVY  937
              +Q E  +I RWWK LGL D+L  A+++ L+ ++WT+ ++P+P  S  RIEL K IA++ 
Sbjct  275   LHQMELTEISRWWKQLGLVDKLTFARDRPLECFLWTVGILPEPKYSNCRIELAKTIAILL  334

Query  936   LIDDIIDVYATFDQTKQFIDAINRWDLSVGEGLPDYMKRCLVVLFDTTNDINNLVFEKYG  757
             +IDDI D + T D+   F +AI RWDL   EGLP+YM+ C + L++TTN+I   + ++ G
Sbjct  335   VIDDIFDTHGTIDELVLFTNAIRRWDLEAMEGLPEYMRICYMALYNTTNEICYKILKENG  394

Query  756   WNPIDHLKRAWKCLCSAYITEAKWFATGKSPSANEYLQTGIITTGIPMVLITCFFLLGHG  577
             W+ + +LK  W  +   ++ EA W+  G+ P+  EY++ G+ T G  M ++  FFL+G G
Sbjct  395   WSVLPYLKATWIDMIEGFMLEASWYNNGQVPNMEEYVENGVTTAGAYMAMVHLFFLIGQG  454

Query  576   AFAGTTDI-----EDMITSVGAILRLLDDLDATQGEKQDGNDASYVEYYVKEHEGLSISD  412
                    +       + +  G ILRL DDL   + E++ G+ AS ++ +++E+      +
Sbjct  455   VTEENVKLLMKPYPKLFSCSGRILRLWDDLGTAKEEQERGDLASSIQLFMRENNITCDEE  514

Query  411   GKQRIMNMVSEQWKLINKQCLSPTRIPESFSKSCLNIARMVPMMYNYSDTHCLPILQKQI  232
             G++RI+ ++   WK +N + +S   +P +  K+  N+AR   ++Y + +      +   +
Sbjct  515   GRKRILQLIDNLWKDLNWELVSRDAMPLAIIKAAFNMARSSQVVYQHEEESYFSSVDNYV  574

Query  231   MSMFST  214
              S+F T
Sbjct  575   ESLFFT  580



>ref|XP_010059420.1| PREDICTED: (3S,6E)-nerolidol synthase 1-like, partial [Eucalyptus 
grandis]
Length=709

 Score =   329 bits (844),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 170/394 (43%), Positives = 251/394 (64%), Gaps = 5/394 (1%)
 Frame = -2

Query  1725  SKDEFLLKSEGKREWQRGLLYQFQEDDLQVLNVIDAIQHLGIDHHFHDQIGAILQRQYQK  1546
             ++D+  +K + K +     L +   + ++ L ++D IQ LG++  F +QI AIL+ QY  
Sbjct  309   AQDDSGIKHDEKTKSLIDFLNKVVNEPVESLIIVDMIQRLGVESLFREQIKAILKWQYTH  368

Query  1545  VKIDDFQKINGLYDISLSFRLLRQEGYNVSSDVFTKFTSEKGEFKEELSKDIRGLMALHE  1366
                 +  K + +Y+I+L FRLLRQEGY V +DVF  F  +   F  +L  +I+G+M L++
Sbjct  369   FSSLNHGK-DDVYEIALWFRLLRQEGYRVPADVFEYFNDKGKGFVMKLEGNIKGMMELYK  427

Query  1365  ASHLSIEGEDVLDEAAKFSRESLIANMV-HLDECQASMVQNTLQYPYHKSLARFTA-KTF  1192
             AS +S E ED+LDEA  FS + L A +   LD  QA M+++TLQYPY KS AR  A ++F
Sbjct  428   ASQMSTEEEDILDEAECFSSKCLNALLTCDLDHEQARMIESTLQYPYRKSFARLLAPQSF  487

Query  1191  IENMRVENEWEATLVNLATMDYSITQSFYQEEFRQILRWWKSLGLKDEL--AKNQQLKWY  1018
             + +M   N W   L+ +A     I Q  +Q+E  QI +WWK LGL +++  A++Q LKWY
Sbjct  488   VNDMPGANSWMEDLLEVANKKRRIDQFVHQKEIHQINKWWKELGLGEKMKCARDQPLKWY  547

Query  1017  IWTLALIPDPSMSRERIELTKPIALVYLIDDIIDVYATFDQTKQFIDAINRWDLSVGEGL  838
             +W++A++ DPS+S  R+EL KPI+LVY+IDDI DV+ T D    F +AI RWD++  E L
Sbjct  548   MWSMAILTDPSLSELRVELIKPISLVYIIDDIFDVHGTVDGLILFTEAIKRWDIACAEQL  607

Query  837   PDYMKRCLVVLFDTTNDINNLVFEKYGWNPIDHLKRAWKCLCSAYITEAKWFATGKSPSA  658
             P+YMK+C  VL D  ND   ++FEK+ WNP   LK  W  LC+A++ E +W A+GK P A
Sbjct  608   PEYMKKCFKVLNDIANDFGKIIFEKHRWNPTRFLKHMWANLCNAFLVEFQWNASGKLPKA  667

Query  657   NEYLQTGIITTGIPMVLITCFFLLGHGAFAGTTD  556
             ++YL+  IIT+G+P+VL   FFL+G      + D
Sbjct  668   DDYLKNAIITSGVPLVLTHLFFLMGQNIANQSMD  701


 Score =   210 bits (535),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 112/259 (43%), Positives = 155/259 (60%), Gaps = 18/259 (7%)
 Frame = -2

Query  1080  RWWKSLGLKDEL--AKNQQLKWYIWTLALIPDPSMSRERIELTKPIALVYLIDDIIDVYA  907
             +WWK  GL +E+  A++Q LKWY+W++A++ DP +S  R+EL KPI+LVY+IDDI DVY 
Sbjct  105   KWWKESGLGEEMKFARDQPLKWYLWSIAILTDPGLSELRVELVKPISLVYIIDDIFDVYG  164

Query  906   TFDQTKQFIDAINRWDLSVGEGLPDYMKRCLVVLFDTTNDINNLVFEKYGWNPIDHLKRA  727
               D+   F   I RWD +  E LP+YMK+C  VL D TND  N++FEK+GWNP   LK+ 
Sbjct  165   KVDELILFTGVIKRWDDACAEQLPEYMKKCFKVLSDITNDFGNIIFEKHGWNPTRFLKQM  224

Query  726   WKCLCSAYITEAKWFATGKSPSANEYLQTGIITTGIPMVLITCFFLLGHGAFAGTTD---  556
             W  LC+A++ E +W A+G  P A++YL+ GIIT+G+P+VL   FF +G      + D   
Sbjct  225   WANLCNAFLVEFQWNASGTLPKADDYLKNGIITSGVPLVLAHLFFQMGQNIANQSMDSKK  284

Query  555   ----IEDMITSVGAILRLLDDLDATQ---GEKQDGNDASYVEYYVK----EHEGLSISDG  409
                 + + I  V  ILRL DDL   Q   G K D    S +++  K      E L I D 
Sbjct  285   EEVPLPNTIFLVAEILRLWDDLGCAQDDSGIKHDEKTKSLIDFLNKVVNEPVESLIIVDM  344

Query  408   KQR--IMNMVSEQWKLINK  358
              QR  + ++  EQ K I K
Sbjct  345   IQRLGVESLFREQIKAILK  363


 Score = 61.2 bits (147),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 47/70 (67%), Gaps = 0/70 (0%)
 Frame = -2

Query  1518  NGLYDISLSFRLLRQEGYNVSSDVFTKFTSEKGEFKEELSKDIRGLMALHEASHLSIEGE  1339
             + +Y+I+L FRLL ++     +DVF  F  +   F  ++  +++G+M L+EAS +SIEG+
Sbjct  34    DNVYEIALRFRLLGKKVMMCPADVFEYFKDKGKGFIMKVEGNVKGMMELYEASQMSIEGD  93

Query  1338  DVLDEAAKFS  1309
             D+LDEA  FS
Sbjct  94    DILDEAKCFS  103



>ref|XP_002513266.1| 1,8-cineole synthase, chloroplast precursor, putative [Ricinus 
communis]
 sp|B9RHP7.1|TPS11_RICCO RecName: Full=Probable terpene synthase 11; Short=RcSeTPS11 [Ricinus 
communis]
 gb|EEF49134.1| 1,8-cineole synthase, chloroplast precursor, putative [Ricinus 
communis]
Length=572

 Score =   325 bits (832),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 181/526 (34%), Positives = 292/526 (56%), Gaps = 24/526 (5%)
 Frame = -2

Query  1794  PVVFRCQSVNSSSLRSEKMTVTLS-------KDEFLLKSEGKREWQRGLLYQF--QEDDL  1642
             P  +R  S  S S+RS  +T ++S       K+    K E   E   G   +       +
Sbjct  25    PSSYRTNS--SLSVRSPTLTCSISTISQPTRKEPATTKPEIMEELHEGTRKELLTSSSPI  82

Query  1641  QVLNVIDAIQHLGIDHHFHDQIGAILQRQYQKVKIDDFQKINGLYDISLSFRLLRQEGYN  1462
               + +ID+IQ LG+ ++F ++I  +L R        D +    L   +L FRLLR   + 
Sbjct  83    ATMKLIDSIQRLGVGYYFEEEINTLLDR------FLDLETTEDLLATALRFRLLRDNCFP  136

Query  1461  VSSDVFTKFTSEKGEFKEELSKDIRGLMALHEASHLSIEGEDVLDEAAKFSRESLIANMV  1282
               SDVF KF ++ G+FKE L KD+ GL++L+EAS+L  + E  L EA +F++  L    +
Sbjct  137   AHSDVFGKFMNKDGKFKESLRKDVWGLLSLYEASYLGTKDEVELVEAMEFTKTCLEEQSI  196

Query  1281  HLDECQASM-VQNTLQYPYHKSLARFTAKTFIENMRVENEWEATLVNLATMDYSITQSFY  1105
              L   + S  V   L  P H  + R  A+ +I    +E+     L+ LA ++++  QS +
Sbjct  197   PLMAHKLSRHVSQALDLPRHLRMPRLEARNYIHEYSLESNNSPPLLELAKLEFNAVQSLH  256

Query  1104  QEEFRQILRWWKSLGLKDEL--AKNQQLKWYIWTLALIPDPSMSRERIELTKPIALVYLI  931
             Q+E  +I+RWWK LGL D+L  A+++ L+ Y+WT+ + P+P  S  RIELTK IA++ +I
Sbjct  257   QKELIEIVRWWKQLGLVDKLGFARDRPLECYLWTVGIFPEPYNSTCRIELTKTIAILLVI  316

Query  930   DDIIDVYATFDQTKQFIDAINRWDLSVGEGLPDYMKRCLVVLFDTTNDINNLVFEKYGWN  751
             DDI D Y +      F +A+ RWDL+  E LP+YMK C + L++TTNDI  ++ +++G +
Sbjct  317   DDIFDTYGSLPDLILFTEAVRRWDLNAMESLPEYMKICYMALYNTTNDIGFMILKRHGLS  376

Query  750   PIDHLKRAWKCLCSAYITEAKWFATGKSPSANEYLQTGIITTGIPMVLITCFFLLGHGAF  571
              + HLKR W  +  A++TEAKWF +G  P+  EYL  G+ T G  M L+  FFL+G G  
Sbjct  377   IVPHLKRTWIDMFEAFLTEAKWFNSGYVPTLEEYLDNGVTTGGTYMALVHSFFLMGQGVN  436

Query  570   AGTTDI----EDMITSVGAILRLLDDLDATQGEKQDGNDASYVEYYVKEHEGLSISDGKQ  403
               T  +     D+ +  G ILRL DDL   + E++ G+ A  +E  ++E       +G++
Sbjct  437   KETVTMMEPYPDLFSLSGRILRLWDDLGTAREEQERGDVACSIECLMREKRISCDDEGRK  496

Query  402   RIMNMVSEQWKLINKQCLSPTRIPESFSKSCLNIARMVPMMYNYSD  265
             ++  ++   W  +N + ++P+ +P S   + LN+AR   ++Y + D
Sbjct  497   QVRQLIRSLWTELNGELIAPSAMPLSIINASLNLARTAQVVYQHGD  542



>ref|XP_003619712.1| Linalool synthase [Medicago truncatula]
 gb|AES75930.1| (3S)-linalool/(E)-nerolidol/(E,E)-geranyl linalool synthase [Medicago 
truncatula]
Length=402

 Score =   319 bits (817),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 171/402 (43%), Positives = 248/402 (62%), Gaps = 12/402 (3%)
 Frame = -2

Query  1416  FKEELSKDIRGLMALHEASHLSIEGEDVLDEAAKFSRESLIANMVHLDE-CQASMVQNTL  1240
             F+E+  +D++GL+AL+EAS LSIEGED L++      E L A +    E  +A  V N L
Sbjct  2     FEEKHGEDVKGLIALYEASQLSIEGEDHLNDVGYLCWELLHAWLSRNQEHNEALYVANAL  61

Query  1239  QYPYHKSLARFTAKT-FIENMRVENEWEATLVNLATMDYSITQSFYQEEFRQILRWWKSL  1063
             Q P H  L+RF  +  FI N++ E +    L  LA ++ SI +   Q E  ++ +WWK L
Sbjct  62    QNPLHYGLSRFMDRNIFIHNLKAEKDL-ICLKELANINSSIVRFMNQNETTEVSKWWKEL  120

Query  1062  GLKDEL--AKNQQLKWYIWTLALIPDPSMSRERIELTKPIALVYLIDDIIDVYATFDQTK  889
             GL  E+  ++ Q LKWY W +A   DP+ S +RIELTKPI+L+Y+IDDI DV+ T DQ  
Sbjct  121   GLAKEVKFSEYQPLKWYTWPMACFTDPNFSEQRIELTKPISLIYVIDDIFDVHGTLDQLT  180

Query  888   QFIDAINRWDLSVGEGLPDYMKRCLVVLFDTTNDINNLVFEKYGWNPIDHLKRAWKCLCS  709
              F DAINRW+++  E LP++MK  L  L+D TN+    V++K+G+NPID LK+ W  L +
Sbjct  181   IFTDAINRWEITGTEQLPNFMKISLNALYDITNNFAEKVYKKHGFNPIDTLKKWWIRLLN  240

Query  708   AYITEAKWFATGKSPSANEYLQTGIITTGIPMVLITCFFLLGH--GAFAGTTDIED----  547
             A++ EA+W  +   P A +YL  GI++TG+ +VL+  FFLL H  G    T DI D    
Sbjct  241   AFMEEARWLNSSHLPRAEDYLNNGIVSTGVHVVLVHAFFLLDHVNGITKETVDILDENFP  300

Query  546   -MITSVGAILRLLDDLDATQGEKQDGNDASYVEYYVKEHEGLSISDGKQRIMNMVSEQWK  370
              +I SV  ILRL DDL+  +   Q+G D SY++ ++ EH+ +S  D ++ +  M+S +WK
Sbjct  301   NVIYSVAKILRLSDDLEGAKSGDQNGLDGSYLDCFMSEHQDISGEDVQRHVARMISNEWK  360

Query  369   LINKQCLSPTRIPESFSKSCLNIARMVPMMYNYSDTHCLPIL  244
              +N++ L   +   SFS  C+N ARMVP+MY+Y     L  L
Sbjct  361   CLNQEILVANKFSSSFSNFCINAARMVPLMYHYKSNPSLSNL  402



>ref|XP_004487383.1| PREDICTED: geraniol synthase, chloroplastic-like [Cicer arietinum]
Length=580

 Score =   325 bits (832),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 176/491 (36%), Positives = 277/491 (56%), Gaps = 16/491 (3%)
 Frame = -2

Query  1650  DDLQVLNVIDAIQHLGIDHHFHDQIGAILQRQYQKVKIDDFQKINGLYDISLSFRLLRQE  1471
             D +  L +ID+IQ LGI HHF D+I   L R      I ++     ++  SL FRLLR  
Sbjct  84    DPILTLKMIDSIQGLGISHHFEDEINIQLGR------ICNWDTSQDIFATSLQFRLLRHN  137

Query  1470  GYNVSSDVFTKFTSEKGEFKEELSKDIRGLMALHEASHLSIEGEDVLDEAAKFSRESLIA  1291
             GY  +SDVF KF  + G FKE  +KDI G+++L+EASHL  E E+VL +A +FS+  L  
Sbjct  138   GYPTTSDVFRKFLDKSGNFKESFTKDIWGMLSLYEASHLGTEDEEVLKKAMEFSKTHLNE  197

Query  1290  NMVHLDECQASMVQNTLQYPYHKSLARFTAKTFIENMRVENEWEATLVNLATMDYSITQS  1111
              + +L     S +   L  P H  + R  A+ ++E  R   +  +  + LA +D  I QS
Sbjct  198   LIPNLAPEVGSHIARALTIPKHLRMVRLEARNYMEEYRQATDQISVFLELAKLDSQIIQS  257

Query  1110  FYQEEFRQILRWWKSLGLKDELA--KNQQLKWYIWTLALIPDPSMSRERIELTKPIALVY  937
              +Q E  +I RWWK LG+ D +   +++  + ++WT+ + P+P  +  RIELTK I ++ 
Sbjct  258   LHQRELAEISRWWKELGVVDRIGFGRDRPTECFLWTVGIFPEPYYTNCRIELTKTICILL  317

Query  936   LIDDIIDVYATFDQTKQFIDAINRWDLSVGEGLPDYMKRCLVVLFDTTNDINNLVFEKYG  757
             ++DDI D Y TF +   F +AI RWDL   E LP+YMK C + L++TTN+I   + +++G
Sbjct  318   VMDDIFDTYGTFHELVLFTNAIKRWDLDAMEQLPEYMKICYMALYNTTNEIAYRIQKEHG  377

Query  756   WNPIDHLKRAWKCLCSAYITEAKWFATGKSPSANEYLQTGIITTGIPMVLITCFFLLG--  583
              N + HLKR W  +  A++ EAKWF +G  PS   YL  G+I+ G  M L+   FL+G  
Sbjct  378   LNVVSHLKRTWIDIFDAFLEEAKWFNSGYVPSFKTYLDNGVISAGSCMALVHATFLIGNH  437

Query  582   -HG----AFAGTTDIEDMITSVGAILRLLDDLDATQGEKQDGNDASYVEYYVKEHEGLSI  418
              HG     F+ T     + +  G ILRL DDL  +  E++ G++AS ++  ++E+     
Sbjct  438   VHGLSKETFSTTKPYPRLFSCSGEILRLWDDLGTSTEEQERGDNASSIQCLMRENNISDE  497

Query  417   SDGKQRIMNMVSEQWKLINKQCLSPTRIPESFSKSCLNIARMVPMMYNYSDTHCLPILQK  238
             ++G++ I  ++ + W+ +N   ++ T IP S  K+ LN+AR   ++Y + D      +  
Sbjct  498   NEGRKHIRLLIGKLWRELNGLVMTKT-IPFSIVKASLNMARTSQLIYQHGDDKTTFTVDD  556

Query  237   QIMSMFSTING  205
              + ++  T  G
Sbjct  557   YVQTLIFTSRG  567



>gb|EMT00022.1| Linalool synthase, chloroplastic [Aegilops tauschii]
Length=471

 Score =   321 bits (822),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 180/476 (38%), Positives = 290/476 (61%), Gaps = 23/476 (5%)
 Frame = -2

Query  1638  VLNVIDAIQHLGIDHHFHDQIGAILQRQYQKVKIDDFQKINGLYDISLSFRLLRQEGYNV  1459
             +L  +D ++ L IDH+F D+I  ++      V  DD      L D +LS RL+R+ GY V
Sbjct  1     MLTTVDHLKRLCIDHYFQDEIDNVMDACVDLVHSDD------LLDATLSLRLMREAGYYV  54

Query  1458  SSD-VFTKFTSEKGEFKEELSKDIRGLMALHEASHLSIEGEDVLDEAAKFSRESLIANMV  1282
             S+D V  KFT++ G+F   L KDIRG+++L E S+L++ GE  L +A +FS + L   + 
Sbjct  55    SADDVLRKFTNDNGDFNHGLIKDIRGMLSLQEMSYLNM-GESSLYKANEFSAKHLRLAIK  113

Query  1281  HLDECQASMVQNTLQYPYHKSLARFTAK---TFIENMRVENEWEATLVNLATMDYSITQS  1111
             +L+   A  V+ +L +PYH SL ++ A+   ++++N+   N    ++ NLA  ++ I + 
Sbjct  114   YLEPSLARYVRRSLDHPYHVSLMQYKARHHLSYLQNLPTRN---TSIENLALAEFQIKKL  170

Query  1110  FYQEEFRQILRWWKSLGLKDEL--AKNQQLKWYIWTLALIPDPSMSRERIELTKPIALVY  937
              +Q E +++ RWW  LGL  E+  A++Q LKWY+W + ++   S SR RIE+TK +++VY
Sbjct  171   QHQREIKEVKRWWMDLGLAKEIPAARDQVLKWYMWPMTVLEGLSFSRYRIEITKIVSMVY  230

Query  936   LIDDIIDVYATFDQTKQFIDAINRWDLSVG-EGLPDYMKRCLVVLFDTTNDINNLVFEKY  760
             ++DDI D+ AT ++   F +AI  WD +   + LP YM  C   L+  TNDI  +V +++
Sbjct  231   IVDDIFDLVATQNELSLFNEAIKMWDPAAAVDSLPSYMISCYKALYTVTNDIAAMVRKEH  290

Query  759   GWNPIDHLKRAWKCLCSAYITEAKWFATGKSPSANEYLQTGIITTGIPMVLITCFFLLGH  580
             G NPI HLK+AW  L   ++ E KW  T ++P+ ++YL+ GI+T+G P+V +  FFLLGH
Sbjct  291   GLNPITHLKQAWAALFDGFMIERKWLYTNQAPTPDDYLRNGIVTSGAPLVFLHLFFLLGH  350

Query  579   GAFAGTTD-IEDMITSVGAILRLLDDLDATQGEKQDGNDASYVEYYVKEHEGLSISDGKQ  403
                 G  D +  +I+    I+RL DDL + + E Q+G D SY E Y +E+      D ++
Sbjct  351   DLTEGNNDHMLRIISCAAKIMRLWDDLGSAKDESQEGLDGSYKELYHRENPH---GDVEK  407

Query  402   RIMNMVSEQWKLINKQCLSPTR--IPESFSKSCLNIARMVPMMYNYSDTHCLPILQ  241
              ++ M++ +W+ +N++C S T+  +  +F  + LN ARMV +MY Y D   LPIL+
Sbjct  408   HVLEMIAGEWQDLNRECFSGTKSTLSHTFIGASLNFARMVRVMYGYDDEQRLPILE  463



>gb|AFD64744.1| plastid geraniol synthase [Catharanthus roseus]
 gb|AHA82032.1| geraniol synthase [Catharanthus roseus]
Length=589

 Score =   324 bits (831),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 169/487 (35%), Positives = 277/487 (57%), Gaps = 11/487 (2%)
 Frame = -2

Query  1653  EDDLQVLNVIDAIQHLGIDHHFHDQIGAILQRQYQKVKIDDFQKINGLYDISLSFRLLRQ  1474
             E  L+ L +ID IQ LG+ +HF D I +IL   +  +     Q    L   SL FRLLR 
Sbjct  104   EKPLEALKMIDIIQRLGLSYHFEDDINSILT-GFSNISS---QTHEDLLTASLCFRLLRH  159

Query  1473  EGYNVSSDVFTKFTSEKGEFKEELSKDIRGLMALHEASHLSIEGEDVLDEAAKFSRESLI  1294
              G+ ++ D+F KF    G+FK+ L  D  G+++L+EAS+L   GE++L EA +F++  L 
Sbjct  160   NGHKINPDIFQKFMDNNGKFKDSLKDDTLGMLSLYEASYLGANGEEILMEAQEFTKTHLK  219

Query  1293  ANMVHLDECQASMVQNTLQYPYHKSLARFTAKTFIENMRVENEWEATLVNLATMDYSITQ  1114
              ++  +    +  V   L+ P H+ + R  A+ FIE    EN+    L+ LA +DY+  Q
Sbjct  220   NSLPAMAPSLSKKVSQALEQPRHRRMLRLEARRFIEEYGAENDHNPDLLELAKLDYNKVQ  279

Query  1113  SFYQEEFRQILRWWKSLGLKDEL--AKNQQLKWYIWTLALIPDPSMSRERIELTKPIALV  940
             S +Q E  +I RWWK LGL D+L  A+++ L+ ++WT+ L+P+P  S  RIEL K IA++
Sbjct  280   SLHQMELSEITRWWKQLGLVDKLTFARDRPLECFLWTVGLLPEPKYSGCRIELAKTIAIL  339

Query  939   YLIDDIIDVYATFDQTKQFIDAINRWDLSVGEGLPDYMKRCLVVLFDTTNDINNLVFEKY  760
              +IDDI D + T D+   F +AI RWDL   E LP+YM+ C + L++TTN+I   V ++ 
Sbjct  340   LVIDDIFDTHGTLDELLLFTNAIKRWDLEAMEDLPEYMRICYMALYNTTNEICYKVLKEN  399

Query  759   GWNPIDHLKRAWKCLCSAYITEAKWFATGKSPSANEYLQTGIITTGIPMVLITCFFLLGH  580
             GW+ + +LK  W  +   ++ EA+WF +   P+  EY++ G+ T G  M L+  FFL+G 
Sbjct  400   GWSVLPYLKATWIDMIEGFMVEAEWFNSDYVPNMEEYVENGVRTAGSYMALVHLFFLIGQ  459

Query  579   GAFAGTTDI-----EDMITSVGAILRLLDDLDATQGEKQDGNDASYVEYYVKEHEGLSIS  415
             G       +       + +S G ILRL DDL   + E++ G+ AS ++ +++E E  S  
Sbjct  460   GVTEDNVKLLIKPYPKLFSSSGRILRLWDDLGTAKEEQERGDLASSIQLFMREKEIKSEE  519

Query  414   DGKQRIMNMVSEQWKLINKQCLSPTRIPESFSKSCLNIARMVPMMYNYSDTHCLPILQKQ  235
             +G++ I+ ++   WK +N + +    +P +  K+  N+AR   ++Y + +      +   
Sbjct  520   EGRKGILEIIENLWKELNGELVYREEMPLAIIKTAFNMARASQVVYQHEEDTYFSSVDNY  579

Query  234   IMSMFST  214
             + ++F T
Sbjct  580   VKALFFT  586



>ref|NP_001105854.1| terpene synthase 2 [Zea mays]
 gb|AAX99149.1| terpene synthase 2 [Zea mays]
 gb|AFW69883.1| terpene synthase 2 [Zea mays]
Length=581

 Score =   324 bits (830),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 165/482 (34%), Positives = 285/482 (59%), Gaps = 20/482 (4%)
 Frame = -2

Query  1641  QVLNVIDAIQHLGIDHHFHDQI-GAILQRQYQKVKIDDFQKINGLYDISLSFRLLRQEGY  1465
             ++L  ID ++ L IDH+F ++I GA+      ++   D      L+D +L+FRLLR+ G+
Sbjct  96    EMLVTIDNLKRLCIDHYFEEEIEGAMATGACTRLLHSD-----DLFDATLAFRLLREAGH  150

Query  1464  NVSS--DVFTKFT-SEKGEFKEELSKDIRGLMALHEASHLSIEGEDVLDEAAK-FSRESL  1297
             +VS+  DV  +F     G+FK  LS D+RGL++LH+ SHL + GE  L   AK FS   L
Sbjct  151   DVSAKDDVLRRFIDGASGDFKLSLSNDVRGLLSLHDMSHLDVGGEAALLHRAKEFSSRHL  210

Query  1296  IANMVHLDECQ-ASMVQNTLQYPYHKSLARFTAKTFIENMRVENEWEATLVNLATMDYSI  1120
              + + +LD+   A  V+ +L +PYH SL ++ A+  +  ++     +A +  LA  ++ +
Sbjct  211   ASAVRYLDDPSLAEYVRQSLDHPYHLSLTQYKARHHLRYLQSLPSRDAAVERLAVAEFQL  270

Query  1119  TQSFYQEEFRQILRWWKSLGLKDEL--AKNQQLKWYIWTLALIPDPSMSRERIELTKPIA  946
              +S +Q E R+I RWW  LGL +E+   ++Q +KWY+W++A +   S SR R+E+TK I+
Sbjct  271   NKSLHQGEMREIKRWWMDLGLAEEIPVVRDQVMKWYMWSMAALQGSSFSRYRVEITKIIS  330

Query  945   LVYLIDDIIDVYATFDQTKQFIDAINRWDLSVGEGLPDYMKRCLVVLFDTTNDINNLVFE  766
             LVY++DDI D+  T ++   F +A+  WD    + LP  M+ C   L   TN+I  +  +
Sbjct  331   LVYVVDDIFDLVGTLEELSAFTEAVKMWDTVAADSLPSCMRSCYKALHTVTNEIAEIAQK  390

Query  765   KYGWNPIDHLKRAWKCLCSAYITEAKWFATGKSPSANEYLQTGIITTGIPMVLITCFFLL  586
             ++G N ++ L++AW  L   ++ EA+W AT + P+A +YL+ G+IT+G+P+  +  F +L
Sbjct  391   EHGSNHVNRLRKAWAVLFDGFMVEARWLATDQVPTAEDYLRNGVITSGVPLTFMHIFSML  450

Query  585   GHGAFAGTTDIE-------DMITSVGAILRLLDDLDATQGEKQDGNDASYVEYYVKEHEG  427
             G+   +   + E        +I+    ILRL DD+ + + E Q+G D SY ++Y+ E+  
Sbjct  451   GYDDPSTEEEEEAIIDHMPSIISCPAKILRLWDDMGSAEDEAQEGFDGSYRDFYLMENPS  510

Query  426   LSISDGKQRIMNMVSEQWKLINKQCLSPTRIPESFSKSCLNIARMVPMMYNYSDTHCLPI  247
              S  + +  +  +++ +W+++N++C      P +  + CLN ARMV +MY+Y+    LP+
Sbjct  511   RSPGEAEAHMRGLIAREWEVLNRECFCRRTFPSNLVQVCLNTARMVSVMYSYNKEQRLPV  570

Query  246   LQ  241
             L+
Sbjct  571   LE  572



>ref|XP_010686918.1| PREDICTED: (3S,6E)-nerolidol synthase 1-like isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=567

 Score =   323 bits (829),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 174/478 (36%), Positives = 279/478 (58%), Gaps = 36/478 (8%)
 Frame = -2

Query  1647  DLQVLNVIDAIQHLGIDHHFHDQIGAILQRQYQKVKIDDFQKING-LYDISLSFRLLRQE  1471
             +L+ L ++D IQ LG++ +F + + A L++   + K+   +  +G  Y+++L FRLLRQ 
Sbjct  89    ELEELIMVDIIQRLGLEDYFREDMHAALEKL--RAKLCTMKDGDGKFYEVALCFRLLRQN  146

Query  1470  GYNVSSDVFTKFTSEKGEFKEELSKDIRGLMALHEASHLSIEGEDVLDEAAKFSRESL--  1297
             GY+V +DVF KF    G+FK EL KD++ L++L E+S LS  GED+L EA  FSR+ L  
Sbjct  147   GYHVPADVFYKFKDNDGKFKHELYKDVKALLSLFESSQLSTTGEDILGEACDFSRQYLED  206

Query  1296  -IANMVHLDECQASMVQNTLQYPYHKSLARFTAKTFIENMRVE----------NEWEATL  1150
              + ++V  ++ +A ++ NTL++PYHKSLAR  AK F+ +  V            EW   +
Sbjct  207   ALKDIVS-EQPKARIIVNTLRFPYHKSLARLLAKNFLLDFDVSLKILHDLSTVKEWMNEV  265

Query  1149  VNLATMDYSITQSFYQEEFRQILRWWKSLGLKDELAKNQQLKWYIWTLALIPDPSMSRER  970
               LA +D+ + Q  Y+ E              +E++K +  KW +W+  + P PSMS ER
Sbjct  266   QELALIDFEMAQMTYKNEV-------------EEISKIEPFKWCMWSFGIFPGPSMSEER  312

Query  969   IELTKPIALVYLIDDIIDVYATFDQTKQFIDAINRWDLSVGEGLPD-YMKRCLVVLFDTT  793
             +EL K ++  Y+IDDI D    +D+   F  AINRW+ +  +GLP+ YMK C   L +TT
Sbjct  313   LELAKAVSFAYIIDDIFDSCGRYDELYLFTKAINRWEYADIKGLPNNYMKVCFKALLETT  372

Query  792   NDINNLVFEKYGWNPIDHLKRAWKCLCSAYITEAKWFATGKSPSANEYLQTGIITTGIPM  613
             +D +  +  K+GWNP++ L+  W   C+A + E+KW     SP+A+EYL  GI+T+G  +
Sbjct  373   DDFSYKIQTKHGWNPLELLRNLWAEHCNACLLESKWSVARYSPTADEYLNNGIVTSGTHV  432

Query  612   VLITCFFLLGHG----AFAGTTDIEDMITSVGAILRLLDDLDATQGEKQDGNDASYVEYY  445
             VL   FFL+G G    +      +  +I+S   ILRL +D      +  +G D SYV+ +
Sbjct  433   VLAHAFFLIGQGINKRSLEELKTLPSIISSAATILRLWNDAGIHTDKTPNGYDGSYVDIF  492

Query  444   VKEHEGLSISDGKQRIMNMVSEQWKLINKQCLSP-TRIPESFSKSCLNIARMVPMMYN  274
             +KE +  S    ++ +  M+S+ WK +N++ +SP +   + F  +C+N+ R+VP MY 
Sbjct  493   MKEQKCSSSDCARRHVRQMISDAWKCLNEEYVSPISPFSKDFKVACVNLTRVVPFMYT  550



>ref|NP_001147300.1| terpene synthase 2 [Zea mays]
 gb|ACG26662.1| terpene synthase 2 [Zea mays]
Length=583

 Score =   323 bits (828),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 174/525 (33%), Positives = 300/525 (57%), Gaps = 25/525 (5%)
 Frame = -2

Query  1758  SLRSEKMTVTLSKDEFLLKSEGKREWQRGLLYQFQEDDLQVLNVIDAIQHLGIDHHFHDQ  1579
             +L +   + TL + +F L+ EG     + +L Q      ++L  ID ++ L IDH+F ++
Sbjct  56    TLAASSSSNTLLRSDFDLQ-EGLTTDVKRMLRQRSGGGREMLVTIDNLKRLCIDHYFEEE  114

Query  1578  I-GAILQRQYQKVKIDDFQKINGLYDISLSFRLLRQEGYNVSS--DVFTKFTSE-KGEFK  1411
             I GA+                + L+D +L+FRLLR+ G++VS+  DV  +F     G+FK
Sbjct  115   IEGAM-----ATAACTGLLHSDDLFDATLAFRLLREAGHDVSAKDDVLRRFIDGVSGDFK  169

Query  1410  EELSKDIRGLMALHEASHLSIEGEDVLDEAAK-FSRESLIANMVHLDECQ-ASMVQNTLQ  1237
               LS D+RGL++LH+ SHL + GE  L   AK FS   L + + +LD+   A  V+ +L 
Sbjct  170   ISLSNDVRGLLSLHDMSHLDVGGEAALLHRAKEFSSRHLASAVRYLDDPSLAEYVRQSLD  229

Query  1236  YPYHKSLARFTAK---TFIENMRVENEWEATLVNLATMDYSITQSFYQEEFRQILRWWKS  1066
             +PYH SL ++ A+    +++++      +A +  LA  ++ + +S +Q E R+I RWW  
Sbjct  230   HPYHLSLTQYKARHHLRYLQSLPCSCRVDAAVERLAVAEFQLNKSLHQREMREIKRWWMD  289

Query  1065  LGLKDEL--AKNQQLKWYIWTLALIPDPSMSRERIELTKPIALVYLIDDIIDVYATFDQT  892
             LGL +E+   ++Q +KWY+W++A +   S SR R+E+TK I+LVY++DDI D+  T ++ 
Sbjct  290   LGLAEEIPVVRDQVMKWYMWSMAALQGSSFSRYRVEITKIISLVYVVDDIFDLVGTLEEL  349

Query  891   KQFIDAINRWDLSVGEGLPDYMKRCLVVLFDTTNDINNLVFEKYGWNPIDHLKRAWKCLC  712
               F +A+  WD    + LP  M+ C   L   TN+I  +  +++G +PI+ L++AW  L 
Sbjct  350   SAFTEAVKMWDTVAADSLPSCMRSCYKALHTVTNEIAEIAHKEHGSDPINRLRKAWAVLF  409

Query  711   SAYITEAKWFATGKSPSANEYLQTGIITTGIPMVLITCFFLLGHGAFAGTTDIED-----  547
               ++ EA+W AT + P A +YL+ G+IT+G+P+  +  F +LG+     T + E+     
Sbjct  410   DGFMVEARWLATDQVPMAEDYLRNGVITSGVPLTFLHIFSMLGYDDDRSTEEEEEAIIDH  469

Query  546   ---MITSVGAILRLLDDLDATQGEKQDGNDASYVEYYVKEHEGLSISDGKQRIMNMVSEQ  376
                +I+    ILRL DD+ + + E Q+G D SY ++Y+ E+   S  + +  + +++  +
Sbjct  470   MPSIISCPAKILRLWDDMGSAEDEAQEGFDGSYRDFYLMENPSRSPGEAEAHMRSLIMRE  529

Query  375   WKLINKQCLSPTRIPESFSKSCLNIARMVPMMYNYSDTHCLPILQ  241
             W  +N++C      P   ++ CLN  RMV +MY+Y+    LP+L+
Sbjct  530   WVELNRECFCRRTFPSDIAQVCLNTVRMVSVMYSYNKEQRLPVLE  574



>ref|XP_011080637.1| PREDICTED: geraniol synthase, chloroplastic-like [Sesamum indicum]
Length=593

 Score =   322 bits (825),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 169/494 (34%), Positives = 280/494 (57%), Gaps = 11/494 (2%)
 Frame = -2

Query  1674  GLLYQFQEDDLQVLNVIDAIQHLGIDHHFHDQIGAILQRQYQKVKIDDFQKINGLYDISL  1495
             G+  Q     ++ L +ID IQ LGI ++  D I AILQ ++      D    + L+  +L
Sbjct  97    GMQLQSAAAAVEKLKLIDTIQRLGIAYYLEDGINAILQAEFSNALSTD----DDLFTTAL  152

Query  1494  SFRLLRQEGYNVSSDVFTKFTSEKGEFKEELSKDIRGLMALHEASHLSIEGEDVLDEAAK  1315
              FRLLR  G+ +S DVF KF  + G+FKE L+ D  GL++L+EAS+L   GE++L++A +
Sbjct  153   RFRLLRHNGFQISPDVFLKFMDKNGQFKESLTDDKLGLLSLYEASYLGSNGEEILEKAME  212

Query  1314  FSRESLIANMVHLDECQASMVQNTLQYPYHKSLARFTAKTFIENMRVENEWEATLVNLAT  1135
              ++  L  ++  L       V   L+ P H  +AR  A+ +I+    +++ +  L+ LA 
Sbjct  213   LTKTHLQRSLPQLPPQLQGQVAQALELPRHLRMARLEARRYIDQYAAQSDCDQELLELAI  272

Query  1134  MDYSITQSFYQEEFRQILRWWKSLGLKDEL--AKNQQLKWYIWTLALIPDPSMSRERIEL  961
             +DY+  Q+ +Q E  +I RWW  LGL D+L  A+++ L+ ++W++ L+P+P  S  RIEL
Sbjct  273   LDYNKVQAQHQMELAEITRWWTQLGLVDKLTFARDRPLECFLWSVGLLPEPKYSTCRIEL  332

Query  960   TKPIALVYLIDDIIDVYATFDQTKQFIDAINRWDLSVGEGLPDYMKRCLVVLFDTTNDIN  781
              K IA++ +IDDI D Y   D+   F DAI RWDL   E LP+YMK C + L++TTN+I 
Sbjct  333   AKTIAILLVIDDIFDTYGKMDELLLFTDAIRRWDLEAMETLPEYMKICYMALYNTTNEIC  392

Query  780   NLVFEKYGWNPIDHLKRAWKCLCSAYITEAKWFATGKSPSANEYLQTGIITTGIPMVLIT  601
               V ++ GW+ + +LK  W  +   ++ EAKWF  G +P+  EY++ G+ T G  M L+ 
Sbjct  393   YKVLKENGWSVLPYLKSTWIDMIEGFMVEAKWFNGGSAPNLEEYIENGVSTAGAYMALVH  452

Query  600   CFFLLGHGAFAGTTDI-----EDMITSVGAILRLLDDLDATQGEKQDGNDASYVEYYVKE  436
              FFL+G G       +       + ++ G ILRL DDL   + E++ G+ AS +   ++E
Sbjct  453   LFFLIGEGVTDHNARLLFKPYPKLFSAAGRILRLWDDLGTAKEEEERGDLASSIHLLMRE  512

Query  435   HEGLSISDGKQRIMNMVSEQWKLINKQCLSPTRIPESFSKSCLNIARMVPMMYNYSDTHC  256
              +  +  +G+ RI+  +   WK +N + ++   +P +  K  LN+AR   ++Y + +   
Sbjct  513   KKLATEEEGRSRILEDIYGLWKDLNGELIAKNGMPLAIIKVALNMARASQVVYKHDEDTY  572

Query  255   LPILQKQIMSMFST  214
                +   + ++F T
Sbjct  573   FSSVDNYVEALFFT  586



>ref|XP_004952082.1| PREDICTED: probable terpene synthase 13-like isoform X1 [Setaria 
italica]
Length=565

 Score =   320 bits (821),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 170/514 (33%), Positives = 297/514 (58%), Gaps = 25/514 (5%)
 Frame = -2

Query  1728  LSKDEFLLKSEGKREWQRGLLYQFQEDDLQVLNVIDAIQHLGIDHHFHDQIGAILQRQYQ  1549
             L   +F L+ EG    Q+ +L Q +    +++  ID ++ L IDH+F ++I + +     
Sbjct  51    LPISDFDLQQEGLTSIQK-ILQQRRSSAREMITTIDNLKRLCIDHYFEEEIESAMGACMD  109

Query  1548  KVKIDDFQKINGLYDISLSFRLLRQEGYNVSSD-VFTKFTSEKGEFKEELSKDIRGLMAL  1372
              +  DD      L+D +L+ RL+R+ G++VS+D V  +FT + GEFK  LS DIRGL++L
Sbjct  110   LIHSDD------LFDATLALRLMREAGHDVSADDVLRRFTDDTGEFKIALSNDIRGLLSL  163

Query  1371  HEASHLSIEGEDVLDEAAKFSRESLIANMVHLDECQASMVQNTLQYPYHKSLARFTAKTF  1192
             H+ SHL +  E  L++A +F+R+ L + + +L+   A  V+ +L +PYH SL ++ A+  
Sbjct  164   HDMSHLDMGDEASLNKAKEFTRKHLASAIRYLEPGLACYVRQSLDHPYHLSLMQYKARHH  223

Query  1191  IENMRVENEWEATLVNLATMDYSITQSFYQEEFRQILRWWKSLGLKDEL--AKNQQLKWY  1018
             +  ++     +  +  LA  ++ + +  +Q+E +++  WW  LGL  E+   ++Q LKWY
Sbjct  224   LSYLQTLPTRDTAMEELAISEFQLNKRLHQKEMQEVKGWWMDLGLFHEIPVVRDQVLKWY  283

Query  1017  IWTLALI-----------PDPSMSRERIELTKPIALVYLIDDIIDVYATFDQTKQFIDAI  871
             +WT A                S+SR RIE TK IAL+Y++DDI D+  T  +   F +AI
Sbjct  284   MWTTATFQGYSLSSFQKRKGSSLSRYRIETTKIIALIYVVDDIFDLVGTPQELSLFTEAI  343

Query  870   NRWDLSVGEGLPDYMKRCLVVLFDTTNDINNLVFEKYGWNPIDHLKRAWKCLCSAYITEA  691
               W+    + LP  ++ C   ++ +TN+I N+V E++G+NP++HLK +W  L   ++ EA
Sbjct  344   KIWNTEAADLLPSGIRSCYKTIYTSTNEIANMVEEEHGFNPVNHLKNSWAVLFDGFMIEA  403

Query  690   KWFATGKSPSANEYLQTGIITTGIPMVLITCFFLLGHGAFAGTTDIEDMITSV----GAI  523
             +W AT + P+A +YL+ G +T+G+P+ L   F +LG+       ++ D I S+      I
Sbjct  404   RWLATDQVPTAEDYLRNGAVTSGVPLTLAHIFAMLGYDQSNEAAELADHIPSIISCPAKI  463

Query  522   LRLLDDLDATQGEKQDGNDASYVEYYVKEHEGLSISDGKQRIMNMVSEQWKLINKQCLSP  343
             LRL DDL + + E Q+G D SY ++Y+ E+   + +D ++ +  +++ +W+ +N++  S 
Sbjct  464   LRLWDDLGSAEDEAQEGLDGSYRDFYMMENLSCTQADAEEHMRGLIAREWEELNREGFSR  523

Query  342   TRIPESFSKSCLNIARMVPMMYNYSDTHCLPILQ  241
                   F++  LN ARMV +MY+Y     L +L+
Sbjct  524   RTFASRFTQVSLNAARMVGVMYSYDKDGRLLVLE  557



>gb|KCW74862.1| hypothetical protein EUGRSUZ_E03598 [Eucalyptus grandis]
Length=341

 Score =   313 bits (801),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 151/340 (44%), Positives = 218/340 (64%), Gaps = 11/340 (3%)
 Frame = -2

Query  1182  MRVENEWEATLVNLATMDYSITQSFYQEEFRQILRWWKSLGLKDEL--AKNQQLKWYIWT  1009
             M V N W   L+ +A  +  I QS +++E  QI  WWK LGL +E+   ++Q LKWY+W+
Sbjct  1     MLVANSWMEDLLEVANRERRIIQSLHRKEIHQINMWWKELGLGEEMEFVRDQPLKWYMWS  60

Query  1008  LALIPDPSMSRERIELTKPIALVYLIDDIIDVYATFDQTKQFIDAINRWDLSVGEGLPDY  829
             +A++ DPS+S  R+EL KPI+LVY+IDDI DVY   D+   F + I RWD +  E LP Y
Sbjct  61    MAILTDPSLSELRVELIKPISLVYIIDDIFDVYGKADELILFTEVIERWDNACAEQLPQY  120

Query  828   MKRCLVVLFDTTNDINNLVFEKYGWNPIDHLKRAWKCLCSAYITEAKWFATGKSPSANEY  649
             MK+C  VL D TND+ N++FEK+G NP   LK+ W  LC+A++ E +W A+GK P A++Y
Sbjct  121   MKKCFKVLSDITNDLGNIIFEKHGRNPTRFLKQMWANLCNAFLVEFQWNASGKMPKADDY  180

Query  648   LQTGIITTGIPMVLITCFFLLGHGAFAGTTD-------IEDMITSVGAILRLLDDLDATQ  490
             L+  IIT+G+P+VL   FFL+G      + D       + + I  V  ILRL DDL   Q
Sbjct  181   LKNAIITSGVPLVLAHLFFLMGQNIANQSMDSKKEEVPLPNTIFLVAEILRLWDDLGCAQ  240

Query  489   GEKQDGNDASYVEYYVKEHEGLSISDGKQRIMNMVSEQWKLINKQCLSPTRIPESFSKSC  310
              E Q+G D SYVE Y++E++G S    ++ +M ++S+ WKL+NK+CLSP      F ++C
Sbjct  241   DENQNGYDGSYVECYLRENQGSSYQSARKHVMELISKSWKLLNKECLSPCPFSAPFLEAC  300

Query  309   LNIARMVPMMYNYSDTHCLPILQKQIMSMFSTINGESIRL  190
             +N A+MV +MYNY D H L +LQ  + S+  T + E++ L
Sbjct  301   VNAAKMVSLMYNYEDKHGLGLLQDHMKSL--TCDHETLLL  338



>gb|AFW66581.1| hypothetical protein ZEAMMB73_828091 [Zea mays]
Length=1851

 Score =   338 bits (866),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 181/527 (34%), Positives = 306/527 (58%), Gaps = 20/527 (4%)
 Frame = -2

Query  1782  RCQSVNSSSLRSEKMTVTLSKDEFLLKSEGKREWQRGLLYQFQEDDLQ---VLNVIDAIQ  1612
             R  S+ + S  +      L  D+F L+ EG  +  R +L Q Q+       ++  +D ++
Sbjct  1324  RGDSIVTRSSAAANTLPLLRNDDFDLR-EGLTDV-RNVLRQRQKSGCSSRDMMVTVDNLK  1381

Query  1611  HLGIDHHFHDQIGAILQRQYQKVKIDDFQKINGLYDISLSFRLLRQEGYNVSSD-VFTKF  1435
              L IDH+F ++I   +      +   D      L+D +L+FRLLR+ G+ VS+D V  +F
Sbjct  1382  RLCIDHYFQEEIERAMGACCMGLIHSD-----DLFDATLAFRLLREAGHGVSADDVLRRF  1436

Query  1434  TSEK---GEFKEELSKDIRGLMALHEASHLSIEGEDVLDEAAKFSRESLIANMVHLDECQ  1264
             T +    GEF+ +LSKDIRGL++LH+ SHL + GE++L +A  FSR  L + + +L+   
Sbjct  1437  TDDDDSGGEFRLDLSKDIRGLLSLHDMSHLDMGGEELLCKARVFSRHHLASAVRYLEPSL  1496

Query  1263  ASMVQNTLQYPYHKSLARFTAKTFIENMRVENEWEATLVNLATMDYSITQSFYQEEFRQI  1084
                V+ +L +PYH SL ++ A+  +  ++     +  L  L   ++ + +S +Q+E + I
Sbjct  1497  GEYVRQSLDHPYHLSLTQYKARHHLAYLQSLPVRDTALERLVAAEFQLNRSLHQKEMQAI  1556

Query  1083  LRWWKSLGLKDEL--AKNQQLKWYIWTLALIPDPSMSRERIELTKPIALVYLIDDIIDVY  910
              RWW  LGL  E+   ++Q LKWY+W++  +   S SR R+++TK IALVY++DDI D+ 
Sbjct  1557  KRWWMELGLVQEIPVVRDQVLKWYMWSMTALQGRSFSRHRVQITKIIALVYVVDDIFDLV  1616

Query  909   ATFDQTKQFIDAINRWDLSVGEGLPDYMKRCLVVLFDTTNDINNLVFEKYGWNPIDHLKR  730
             AT D+   F +A+  W+ +  E LP YM+ C   L+  TN+I +   +++G N ++HL++
Sbjct  1617  ATLDELSLFAEAVKMWNSTAAESLPSYMRSCYKALYTVTNEIADTAEKEHGLNHVNHLRK  1676

Query  729   AWKCLCSAYITEAKWFATGKSPSANEYLQTGIITTGIPMVLITCFFLLGHGAFAGTTDIE  550
             AW  L   ++ EA+W AT K P+A +YL  G++T+G+P+  +  F +LG      T  + 
Sbjct  1677  AWAALFDGFMVEARWLATDKVPTAEDYLTNGVVTSGVPLTFVHIFIMLGCDDDQSTQALV  1736

Query  549   DMITSV----GAILRLLDDLDATQGEKQDGNDASYVEYYVKEHEGLSISDGKQRIMNMVS  382
             D + SV      ILRL DD+ + + E Q+G D SY ++Y+ E+   S SD +  + ++++
Sbjct  1737  DHMPSVISCPAKILRLWDDMGSAEDEAQEGFDGSYRDFYLMENPRCSRSDAEAHMRSLIA  1796

Query  381   EQWKLINKQCLSPTRIPESFSKSCLNIARMVPMMYNYSDTHCLPILQ  241
              +W+ +N++CL       SF+  CLN ARM+ +MY+Y+    L +L+
Sbjct  1797  REWEELNRECLCKRTFSSSFTHVCLNAARMISVMYSYNKEQRLLVLE  1843



>ref|XP_004952083.1| PREDICTED: probable terpene synthase 13-like isoform X2 [Setaria 
italica]
Length=561

 Score =   320 bits (819),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 170/514 (33%), Positives = 295/514 (57%), Gaps = 29/514 (6%)
 Frame = -2

Query  1728  LSKDEFLLKSEGKREWQRGLLYQFQEDDLQVLNVIDAIQHLGIDHHFHDQIGAILQRQYQ  1549
             L   +F L+ EG    Q+ +L Q +    +++  ID ++ L IDH+F ++I + +     
Sbjct  51    LPISDFDLQQEGLTSIQK-ILQQRRSSAREMITTIDNLKRLCIDHYFEEEIESAMGACMD  109

Query  1548  KVKIDDFQKINGLYDISLSFRLLRQEGYNVSSD-VFTKFTSEKGEFKEELSKDIRGLMAL  1372
              +  DD      L+D +L+ RL+R+ G++VS+D V  +FT + GEFK  LS DIRGL++L
Sbjct  110   LIHSDD------LFDATLALRLMREAGHDVSADDVLRRFTDDTGEFKIALSNDIRGLLSL  163

Query  1371  HEASHLSIEGEDVLDEAAKFSRESLIANMVHLDECQASMVQNTLQYPYHKSLARFTAKTF  1192
             H+ SHL +  E  L++A +F+R+ L + + +L+   A  V+ +L +PYH SL ++ A+  
Sbjct  164   HDMSHLDMGDEASLNKAKEFTRKHLASAIRYLEPGLACYVRQSLDHPYHLSLMQYKARHH  223

Query  1191  IENMRVENEWEATLVNLATMDYSITQSFYQEEFRQILRWWKSLGLKDEL--AKNQQLKWY  1018
             +  ++     +  +  LA  ++ + +  +Q+E +++  WW  LGL  E+   ++Q LKWY
Sbjct  224   LSYLQTLPTRDTAMEELAISEFQLNKRLHQKEMQEVKGWWMDLGLFHEIPVVRDQVLKWY  283

Query  1017  IWTLALI-----------PDPSMSRERIELTKPIALVYLIDDIIDVYATFDQTKQFIDAI  871
             +WT A                S+SR RIE TK IAL+Y++DDI D+  T  +   F +AI
Sbjct  284   MWTTATFQGYSLSSFQKRKGSSLSRYRIETTKIIALIYVVDDIFDLVGTPQELSLFTEAI  343

Query  870   NRWDLSVGEGLPDYMKRCLVVLFDTTNDINNLVFEKYGWNPIDHLKRAWKCLCSAYITEA  691
               W+    + LP  ++ C   ++ TTN+I ++V E+ G+NP++HL+ AW  L   ++ EA
Sbjct  344   KMWNTVAADSLPSGIRSCYKAIYATTNEIADMVEEERGFNPVNHLRHAWAVLFDGFMVEA  403

Query  690   KWFATGKSPSANEYLQTGIITTGIPMVLITCFFLLGHGAFAGTTDIEDMITSV----GAI  523
             +W AT + P+A +YL+ G +T+G+P+ L   F +LG+       ++ D I S+      I
Sbjct  404   RWLATDQVPTAEDYLRNGAVTSGVPLTLAHIFAMLGYDQSNEAAELADHIPSIISCPAKI  463

Query  522   LRLLDDLDATQGEKQDGNDASYVEYYVKEHEGLSISDGKQRIMNMVSEQWKLINKQCLSP  343
             LRL DDL    G  ++G D SY ++Y+ E+   + +D ++ +  +++ +W+ +N++C S 
Sbjct  464   LRLWDDL----GSAEEGLDGSYRDFYLMENPSCTQADAEEHMRGLIAREWEELNRECFSR  519

Query  342   TRIPESFSKSCLNIARMVPMMYNYSDTHCLPILQ  241
                   F++  LN ARMV +MY+Y     L +L+
Sbjct  520   RTFASRFTQVSLNAARMVGIMYSYDKDGRLLVLE  553



>ref|XP_010109572.1| R-linalool synthase [Morus notabilis]
 gb|EXC23176.1| R-linalool synthase [Morus notabilis]
Length=583

 Score =   320 bits (821),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 170/480 (35%), Positives = 279/480 (58%), Gaps = 12/480 (3%)
 Frame = -2

Query  1635  LNVIDAIQHLGIDHHFHDQIGAILQRQYQKVKIDDFQKINGLYDISLSFRLLRQEGYNVS  1456
             + ++D IQ LG+ HHF  +I  +L+         D+    GLYD +L FRLLR  G   S
Sbjct  107   MKLVDVIQRLGVGHHFEKEIRLLLE------GFLDYNSNEGLYDAALRFRLLRHNGLPTS  160

Query  1455  SDVFTKFTSEKGEFKEELSKDIRGLMALHEASHLSIEGEDVLDEAAKFSRESLIANMVHL  1276
             SDVF KF + KG+FKE L +DI G+++L+EAS+L  +GED L +A +F+R  L  ++  L
Sbjct  161   SDVFDKFMNNKGDFKESLRQDIWGMLSLYEASYLGAKGEDKLLKAMEFTRSHLKQSLPSL  220

Query  1275  DECQASMVQNTLQYPYHKSLARFTAKTFIENMRVENEWEATLVNLATMDYSITQSFYQEE  1096
                  + +  +L+ P H  +A   A+ +I+    E+     L+ LA +++S  QS +++E
Sbjct  221   PPQLQTQIAKSLELPRHLRMATLEARNYIDEYSQESNHSLALLELAELEFSELQSLHRKE  280

Query  1095  FRQILRWWKSLGLKDEL--AKNQQLKWYIWTLALIPDPSMSRERIELTKPIALVYLIDDI  922
               +I+ WWK LGL ++L  A+++  + ++WT+ + P+ S S  RIEL K + ++ ++DDI
Sbjct  281   LAEIIIWWKQLGLVEKLGFARDRPFECFLWTVGVFPEASYSNIRIELAKTVCILLVLDDI  340

Query  921   IDVYATFDQTKQFIDAINRWDLSVGEGLPDYMKRCLVVLFDTTNDINNLVFEKYGWNPID  742
              D Y + D+   F DAI RW+LS  E LP YMK C + L++TTN+I   V +++GW    
Sbjct  341   YDTYGSLDELILFNDAIKRWELSAMEQLPAYMKICYMALYNTTNEIAYRVLKEHGWCISA  400

Query  741   HLKRAWKCLCSAYITEAKWFATGKSPSANEYLQTGIITTGIPMVLITCFFLLGHGAFAGT  562
             HLKR W  +  A++TEA+W     +P+  +YL  G+ + G  M L+  FFL+GH     T
Sbjct  401   HLKRTWIDIFEAFLTEAEWCNRRYTPTLEQYLTNGVTSGGSYMALVHSFFLIGHDVTDET  460

Query  561   TDI----EDMITSVGAILRLLDDLDATQGEKQDGNDASYVEYYVKEHEGLSISDGKQRIM  394
               +     ++ +  G ILRL DDL   + E++ G+ AS +E Y+KE+      + ++ I 
Sbjct  461   VSMMEPYPELFSCSGKILRLWDDLGTAKEEQERGDVASSMECYMKENNVELEDEARKHIK  520

Query  393   NMVSEQWKLINKQCLSPTRIPESFSKSCLNIARMVPMMYNYSDTHCLPILQKQIMSMFST  214
              M+   W  +N+  ++P+ +P S +K+C N+AR   ++Y + D      ++  + S+F T
Sbjct  521   KMIGNLWMELNEHLMAPSALPRSITKACFNLARTAQIIYQHGDDETFFSVEDHVQSLFFT  580



>ref|XP_006469778.1| PREDICTED: probable terpene synthase 11-like [Citrus sinensis]
Length=647

 Score =   322 bits (825),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 169/496 (34%), Positives = 276/496 (56%), Gaps = 10/496 (2%)
 Frame = -2

Query  1689  REWQRGLLYQFQEDDLQVLNVIDAIQHLGIDHHFHDQIGAILQRQYQKVKIDDFQKINGL  1510
             +E  R  L +   D    + +ID IQ LGI +HF D+I   L+R        D      L
Sbjct  151   QERTRKALRKSSNDPTATMKLIDTIQRLGIGYHFEDEIMERLER----FSDGDAAGEENL  206

Query  1509  YDISLSFRLLRQEGYNVSSDVFTKFTSEKGEFKEELSKDIRGLMALHEASHLSIEGEDVL  1330
             ++ +L FRLLR  G    +D+F KF +++G+ KE +SKD RG+++L+EAS+L+ + +D+L
Sbjct  207   FENALRFRLLRHNGLPACTDIFKKFINKEGKLKESVSKDTRGMLSLYEASYLATQDKDIL  266

Query  1329  DEAAKFSRESLIANMVHLDECQASMVQNTLQYPYHKSLARFTAKTFIENMRVENEWEATL  1150
              EA +F++  L  ++  +D   +  V   L  P H  ++R  A  +I         + TL
Sbjct  267   FEAMEFTKTELTQSVSLMDSQSSRHVVQALALPRHLRMSRSEAGNYINEYSQSWNHDQTL  326

Query  1149  VNLATMDYSITQSFYQEEFRQILRWWKSLGLKDELA--KNQQLKWYIWTLALIPDPSMSR  976
             + LA  D+++ QS +Q E  +I RWWK LGL D+L   +++ L+ ++WT+ + P+P  S 
Sbjct  327   LQLAKSDFNMVQSLHQRELAEIKRWWKQLGLVDKLGFGRDRPLECFLWTVGIFPEPYYSN  386

Query  975   ERIELTKPIALVYLIDDIIDVYATFDQTKQFIDAINRWDLSVGEGLPDYMKRCLVVLFDT  796
              RIEL K IAL+ +IDDI D Y +      F +AI RWDL   E +P+YMK C + L++T
Sbjct  387   CRIELAKTIALLLVIDDIFDTYGSLSDLVLFTEAIQRWDLGAMEHIPEYMKICYMALYNT  446

Query  795   TNDINNLVFEKYGWNPIDHLKRAWKCLCSAYITEAKWFATGKSPSANEYLQTGIITTGIP  616
             TN+I+  + + +GWN +  LKR W  +  A ++EAKWF+ G  P+  +YL+ G+ T G  
Sbjct  447   TNEISYRILKDHGWNVVPQLKRTWIDIFEAQLSEAKWFSEGYVPTQEQYLRNGVTTGGTY  506

Query  615   MVLITCFFLLGHGAFAGTTDI----EDMITSVGAILRLLDDLDATQGEKQDGNDASYVEY  448
             M L+  F L+G      T  +     ++ +  G ILRL DDL   + E++ G+ AS +E 
Sbjct  507   MALVHAFCLMGQDVTKETLAMMEPYPNLFSCSGKILRLWDDLGTAREEQERGDVASSIEC  566

Query  447   YVKEHEGLSISDGKQRIMNMVSEQWKLINKQCLSPTRIPESFSKSCLNIARMVPMMYNYS  268
             Y++E       + ++ I  ++   W  +N   ++P  +P S   + LN+AR   ++Y + 
Sbjct  567   YMREKTISCEEEARKHIRQLIRSLWVELNGMLVAPAALPASIVNASLNLARTAQVVYQHG  626

Query  267   DTHCLPILQKQIMSMF  220
             D + +  +   I  +F
Sbjct  627   DDNTVTSVNGHIERLF  642



>gb|EYU46035.1| hypothetical protein MIMGU_mgv1a019488mg, partial [Erythranthe 
guttata]
Length=488

 Score =   317 bits (812),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 167/485 (34%), Positives = 277/485 (57%), Gaps = 15/485 (3%)
 Frame = -2

Query  1635  LNVIDAIQHLGIDHHFHDQIGAILQRQYQKVKIDDFQKINGLYDISLSFRLLRQEGYNVS  1456
             L +ID IQ LGI ++F + I AIL  ++    I +    + L+  +L FRLLR  G+ ++
Sbjct  2     LKLIDTIQRLGIGYYFEEDINAILLVEFSNALITE----DNLFTTALRFRLLRHNGFQIT  57

Query  1455  SDVFTKFTSEKGEFKEELSKDIRGLMALHEASHLSIEGEDVLDEAAKFSRESLIANMVHL  1276
             SDVF KF  E  +F+E L+ D  GL++L+EAS++   GE++L+EA KF++  L  ++  L
Sbjct  58    SDVFLKFMDENRKFEESLADDTLGLLSLYEASYMGANGEEILEEATKFTKAYLQLSIRQL  117

Query  1275  DECQA--SMVQNTLQYPYHKSLARFTAKTFIENMRVENEWEATLVNLATMDYSITQSFYQ  1102
                     +V   L+ P H  +AR   + +IE    +++ +A L+ LAT+DY+  Q+ +Q
Sbjct  118   SPPHHHDQLVIEALKLPRHMRMARLETRQYIEKYGAQSDCDAALLELATLDYNKVQTQHQ  177

Query  1101  EEFRQILRWWKSLGLKDEL--AKNQQLKWYIWTLALIPDPSMSRERIELTKPIALVYLID  928
              E  +I RWW+ LGL  +L  A+++ L+ ++WT+ L+P+P  S  RIEL K IA++ +ID
Sbjct  178   IELAEITRWWRQLGLVKKLTFARDRPLECFLWTVGLLPEPKYSTCRIELAKTIAILLVID  237

Query  927   DIIDVYATFDQTKQFIDAINRWDLSVGEGLPDYMKRCLVVLFDTTNDINNLVFEKYGWNP  748
             DI D Y   D+   F DAI RWDL   E LP YMK C + L++TTN+I   V ++ GW  
Sbjct  238   DIFDTYGKMDELVIFTDAIRRWDLEAIETLPKYMKICYLALYNTTNEICYNVLKENGWTV  297

Query  747   IDHLKRAWKCLCSAYITEAKWFATGKSPSANEYLQTGIITTGIPMVLITCFFLLGHGAFA  568
             + +LK  W  +   ++ EA WF  G  P+  EY++ G+ T G  M  +  FFL+G G   
Sbjct  298   LPYLKSTWIDMIEGFMVEATWFNGGSEPNLEEYIENGVSTAGAYMAFVHLFFLIGEGVTR  357

Query  567   GTTDI------EDMITSVGAILRLLDDLDATQGEKQDGNDASYVEYYVKEHEGLSISDGK  406
               +++       ++ +  G ILRL DDL  ++ E++ G+ AS +  +++E       +G+
Sbjct  358   ENSELLLNKPYPNIFSFAGRILRLWDDLGTSKEEEERGDMASSIRLFMREKNIEREEEGR  417

Query  405   QRIMNMVSEQWKLINKQCLSPTRI-PESFSKSCLNIARMVPMMYNYSDTHCLPILQKQIM  229
             +R++  +   WK +N + +   R+ P +     LN+AR   ++YN+ +      +   + 
Sbjct  418   KRVLEEIYGLWKDLNGEMMCENRVMPLAIIDVALNMARASQVVYNHEEDSYFSNVDNYVE  477

Query  228   SMFST  214
             ++F T
Sbjct  478   ALFFT  482



>sp|Q5SBP3.1|LLOS_OCIBA RecName: Full=R-linalool synthase, chloroplastic; Flags: Precursor 
[Ocimum basilicum]
 gb|AAV63789.1| R-linalool synthase [Ocimum basilicum]
Length=574

 Score =   318 bits (815),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 179/512 (35%), Positives = 284/512 (55%), Gaps = 24/512 (5%)
 Frame = -2

Query  1722  KDEFLLKSEGKREWQRGLLYQFQEDDLQVLNVIDAIQHLGIDHHFHDQIGAILQRQYQKV  1543
             + E+LL+ E  R+ QR        + ++ L +ID IQ LGI ++F D I A+L+  +   
Sbjct  73    RREYLLE-ETARKLQRN-----DTESVEKLKLIDNIQRLGIGYYFEDAIDAVLRSPFSAE  126

Query  1542  KIDDFQKINGLYDISLSFRLLRQEGYNVSSDVFTKFTSEKGEFKEELSKDIRGLMALHEA  1363
             + +D      L+  +L FRLLR  G  V+ ++F KF  E+GEF E    D  GL++L+EA
Sbjct  127   EEED------LFTAALRFRLLRHNGIQVTPEIFLKFKDERGEFDE---SDTLGLLSLYEA  177

Query  1362  SHLSIEGEDVLDEAAKFSRESLIANMVHLDECQASMVQNTLQYPYHKSLARFTAKTFIEN  1183
             S+L + GE++L+EA +F+   L  ++  L     S V   L  P H  +AR  A+ FIE 
Sbjct  178   SNLGVTGEEILEEAMEFAEPRLRRSLSELAAPLRSEVAQALDVPRHLRMARLEARRFIEQ  237

Query  1182  MRVENEWEATLVNLATMDYSITQSFYQEEFRQILRWWKSLGLKDELA--KNQQLKWYIWT  1009
                +++ +  L+ LA +DY+  Q+ +Q E  +I RWWK LGL ++L   +++ L+ ++WT
Sbjct  238   YGKQSDHDGDLLELAILDYNQVQAQHQSELTEITRWWKQLGLVEKLGFGRDRALECFMWT  297

Query  1008  LALIPDPSMSRERIELTKPIALVYLIDDIIDVYATFDQTKQFIDAINRWDLSVGEGLPDY  829
             + ++P P  S  RIE  K  AL+Y+IDDI D Y   D+   F DAI RWDL   EGLP+Y
Sbjct  298   MGILPHPKYSSSRIESAKAAALLYVIDDIFDTYGKMDELILFTDAIRRWDLEAMEGLPEY  357

Query  828   MKRCLVVLFDTTNDINNLVFEKYGWNPIDHLKRAWKCLCSAYITEAKWFATGKSPSANEY  649
             MK C + L++TTN+I   V +  G   + +LK  W     AY+ E KWF+ G +P   EY
Sbjct  358   MKICYMALYNTTNEICYRVLKDTGRIALPYLKSVWIETIEAYMVEVKWFSGGSAPKLEEY  417

Query  648   LQTGIITTGIPMVLITCFFLLGHG------AFAGTTDIEDMITSVGAILRLLDDLDATQG  487
             ++ G  T G  MVL+  FFL+G G       F          ++ G I RL DDL  +Q 
Sbjct  418   IENGASTVGAYMVLVHLFFLIGEGLTHQNVLFFKQKPYHKPFSAAGRIFRLWDDLGTSQE  477

Query  486   EKQDGNDASYVEYYVKEHEGLSISDGKQRIMNMVSEQWKLINKQCLS-PTRIPESFSKSC  310
             E++ G+ AS +  ++KE++  ++ + +  ++  +S  WK +N+  +S    +P +  K  
Sbjct  478   EEERGDMASSIRLFMKEYKLSTVEEARSCVLEEISRLWKDLNEGLISIKDALPLTIVKVA  537

Query  309   LNIARMVPMMYNYSDTHCLPILQKQIMSMFST  214
             LNIAR   ++Y +     +  +   + ++F T
Sbjct  538   LNIARTSQVVYKHEQHTYMLSVDNYVEALFFT  569



>ref|XP_002451415.1| hypothetical protein SORBIDRAFT_04g001770 [Sorghum bicolor]
 gb|EES04391.1| hypothetical protein SORBIDRAFT_04g001770 [Sorghum bicolor]
Length=417

 Score =   311 bits (796),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 152/404 (38%), Positives = 247/404 (61%), Gaps = 13/404 (3%)
 Frame = -2

Query  1422  GEFKEELSKDIRGLMALHEASHLSIEGEDVLDEAAKFSRESLIANMVHLDECQASMVQNT  1243
             G+F   LSKD  GL++LH+ SHL I  E  L EA +FSR+ L + + +++   A  V+ +
Sbjct  9     GKFSLALSKDTMGLLSLHDMSHLDIGEEPALHEAKEFSRKHLASAISNMEPGLARYVRQS  68

Query  1242  LQYPYHKSLARFTAKTFIENMR-VENEWEATLVNLATMDYSITQSFYQEEFRQILRWWKS  1066
             L +PYH SL ++ A+  +  ++ + N     +  LA  ++ + +  +Q E ++I RWW +
Sbjct  69    LDHPYHLSLMQYKARHHLSYLQSLPNRSTTAMEELAVAEFQLNKMLHQMEMKEIKRWWMN  128

Query  1065  LGLKDEL--AKNQQLKWYIWTLALIPDPSMSRERIELTKPIALVYLIDDIIDVYATFDQT  892
             LGL  E+  A++Q LKWY W++ ++   S S+ R+E+TK I++ Y++DDI D+  T ++ 
Sbjct  129   LGLAQEVPVARDQVLKWYTWSMTILQGSSFSKYRVEITKIISIAYVVDDIFDLVGTLEEL  188

Query  891   KQFIDAINRWDLSVGEGLPDYMKRCLVVLFDTTNDINNLVFEKYGWNPIDHLKRAWKCLC  712
               F +AI  WDL   + LP YM+ C  VL+  TN++ ++  +++G NP+DHL++AW  L 
Sbjct  189   SLFTEAIKMWDLEAADSLPCYMRSCYRVLYTATNEMADMAEKEHGLNPVDHLRKAWAVLF  248

Query  711   SAYITEAKWFATGKSPSANEYLQTGIITTGIPMVLITCFFLLG-HGAFAG-----TTDIE  550
               ++ EAKW AT + PSA+EYL+ G+IT+G+P+  +   FLLG H A +G     T  I 
Sbjct  249   DGFMVEAKWLATDQVPSADEYLRNGVITSGVPLAFVHILFLLGHHHAVSGNAAELTNSIP  308

Query  549   DMITSVGAILRLLDDLDATQGEKQDGNDASYVEYYVKEHEGLSISDGKQRIMNMVSEQWK  370
               ITS   ILRL DD+ + + E Q+G D SY E Y+ EH      D ++ +  +++++W+
Sbjct  309   PAITSASKILRLWDDMGSAKDEAQEGLDGSYRELYLLEHPA---GDVEEHMRRLIAKEWQ  365

Query  369   LINKQCLSPTRIPESFSKSCLNIA-RMVPMMYNYSDTHCLPILQ  241
              +N++C S       F+++CLN A RMV +MY Y     LP+L+
Sbjct  366   ELNRECFSRRTFSSCFAQACLNAARRMVSVMYMYDKEQKLPVLE  409



>gb|KHN25759.1| R-linalool synthase, chloroplastic [Glycine soja]
Length=563

 Score =   315 bits (808),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 181/543 (33%), Positives = 293/543 (54%), Gaps = 26/543 (5%)
 Frame = -2

Query  1857  SSHASIPC------FSIGTALHCRRRTPVVFRCQSVNSSSLRSEKMTVTLSKDEFLLKSE  1696
             SS AS P        S+ T+        +  +C + N + + S+   + L  + F    +
Sbjct  13    SSLASCPSIYQPWNLSLQTSKRGTIHNNLSIKCVAFNDNKVPSQ---IDLRTNNF---EQ  66

Query  1695  GKREWQRGLLYQFQEDDLQVLNVIDAIQHLGIDHHFHDQIGAILQRQYQKVKIDDFQKIN  1516
              KR  Q  LL     D +++L +ID IQ LGI+HHF ++I        Q  K+ D+    
Sbjct  67    VKRNSQMALLNS--SDPIKILKMIDTIQRLGIEHHFKEEINV------QLGKVGDWDVTQ  118

Query  1515  GLYDISLSFRLLRQEGYNVSSDVFTKFTSEKGEFKEELSKDIRGLMALHEASHLSIEGED  1336
              L+  +L FRL R  G+   SDVF KF  + G FKE ++ DI G+++L+EAS+L  +GE+
Sbjct  119   DLFGTALQFRLQRHNGWPSCSDVFKKFLDKSGTFKESITNDIWGMLSLYEASYLGAKGEE  178

Query  1335  VLDEAAKFSRESLIANMVHLDECQASMVQNTLQYPYHKSLARFTAKTFIENMRVENEWEA  1156
             VL +A  FS+  L  ++ HL      +V   L  P H  + R  A+ ++E          
Sbjct  179   VLQQAMDFSKAHLHQSLPHLSPELRKLVAKALTLPRHLRMGRLEARNYMEKYSQATNQIP  238

Query  1155  TLVNLATMDYSITQSFYQEEFRQILRWWKSLGLKDEL--AKNQQLKWYIWTLALIPDPSM  982
              L+ LA +D+++ QS +Q+E  +I RWWK+LGL + L  A+++  + ++WT+   P+P  
Sbjct  239   ALMELAKLDFAMVQSMHQKELAEISRWWKNLGLVERLGFARDRPAECFLWTVGTFPEPRY  298

Query  981   SRERIELTKPIALVYLIDDIIDVYATFDQTKQFIDAINRWDLSVGEGLPDYMKRCLVVLF  802
             S  RIELTK I ++ ++DDI D Y T ++   F +AI RWDL   E LP+YMK C + LF
Sbjct  299   SNCRIELTKTICILLVMDDIFDTYGTLEELVLFTEAIKRWDLDAMEQLPEYMKICYMALF  358

Query  801   DTTNDINNLVFEKYGWNPIDHLKRAWKCLCSAYITEAKWFATGKSPSANEYLQTGIITTG  622
             +TT++I   + +++G   +  LKR W  +  A++ EAKWF  G  P+  EYL  G+I++G
Sbjct  359   NTTHEIAYKIQKEHGQTVVACLKRTWIDIFEAFLKEAKWFNNGYIPTFKEYLDNGVISSG  418

Query  621   IPMVLITCFFLLGHGAFAGTTDI----EDMITSVGAILRLLDDLDATQGEKQDGNDASYV  454
               M L+   FL+G      T  I      + +  G ILRL DDL  ++ E++ G++A  +
Sbjct  419   SYMALVHATFLIGDSLSKETISIMKPYPRLFSCSGEILRLWDDLGTSREEQERGDNACSI  478

Query  453   EYYVKEHEGLSISDGKQRIMNMVSEQWKLINKQCLSPTRIPESFSKSCLNIARMVPMMYN  274
             +  + E+     +  ++ I  ++   W  +N   ++ T +P S  K+ LN+AR   ++Y 
Sbjct  479   QCLMTENNLSDENVARKHIRQLIQNLWPELNGLAMTTTALPSSVMKASLNMARTAQVIYQ  538

Query  273   YSD  265
             + D
Sbjct  539   HGD  541



>ref|XP_007149937.1| hypothetical protein PHAVU_005G111700g [Phaseolus vulgaris]
 gb|ESW21931.1| hypothetical protein PHAVU_005G111700g [Phaseolus vulgaris]
Length=569

 Score =   315 bits (808),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 183/526 (35%), Positives = 294/526 (56%), Gaps = 23/526 (4%)
 Frame = -2

Query  1815  LHCRRRTPVVFRCQSVNSSSLRSEKMTVTLSKDEFLLKSEGKREWQRGLLYQFQEDDLQV  1636
             L C+  TP + +  S+NS  L ++K+   +      ++ + KR  Q  LL     D ++ 
Sbjct  36    LSCKTSTPTIMQL-SINSLPL-TQKVPSLIDLGTKRME-QVKRRSQETLLNS--SDPIKT  90

Query  1635  LNVIDAIQHLGIDHHFHDQIGAILQRQYQKVKIDDFQKINGLYDISLSFRLLRQEGYNVS  1456
             L +ID IQ LGI HHF ++I   L       K+ D+     L+  +L FRLLR  G+  S
Sbjct  91    LKIIDTIQRLGIGHHFEEEINVKLG------KLRDWDFSEDLFSTTLQFRLLRNNGWPTS  144

Query  1455  SDVFTKFTSEKGEFKEELSKDIRGLMALHEASHLSIEGEDVLDEAAKFSRESLIANMVHL  1276
             SDVF KF  + G FKE ++ DI G+++++EAS+L  +GE+VL++A  FS   L  ++ HL
Sbjct  145   SDVFKKFLDKSGNFKESITNDIWGMLSMYEASYLGAKGEEVLEKAMDFSTAHLHQSLQHL  204

Query  1275  DECQASMVQNTLQYPYHKSLARFTAKTFIENMRVENEWEATLVNLATMDYSITQSFYQEE  1096
                  ++V   L  P H  ++R  A+ +I+     +     L+ +A +DY++ QS +Q+E
Sbjct  205   SPDVGNLVARALTLPRHLRMSRLEARNYIKEYSQVSSHMPYLLEMAKIDYAMLQSMHQKE  264

Query  1095  FRQILRWWKSLGLKDEL--AKNQQLKWYIWTLALIPDPSMSRERIELTKPIALVYLIDDI  922
             F +I RWW  LGL + L  A+++  + ++WT+ + P+P  S  RIELTK I ++ ++DDI
Sbjct  265   FAEISRWWNKLGLAERLGFARDKPAECFLWTMGIFPEPCYSNCRIELTKTICILLVMDDI  324

Query  921   IDVYATFDQTKQFIDAINRWDLSVGEGLPDYMKRCLVVLFDTTNDINNLVFEKYGWNPID  742
              D Y T D+   F  AI RWDL   E LP+YMK   + L++TT++I   +  ++G N I 
Sbjct  325   FDTYGTLDELILFTKAIKRWDLDAMEQLPEYMKISYLALYNTTHEIAYKIQMEHGQNVIS  384

Query  741   HLKRAWKCLCSAYITEAKWFATGKSPSANEYLQTGIITTGIPMVLITCFFLLGHGAFAGT  562
              LKR W  +  A++ EAKWF     P+  EYL  G+I++G  M L+   FL+G G    T
Sbjct  385   SLKRTWIDIFEAFLKEAKWFNNKYVPTFQEYLDNGVISSGSYMALVHATFLIGDGLSKET  444

Query  561   TDIED----MITSVGAILRLLDDLDATQGEKQDGNDASYVEYYVKEHEGLSISD---GKQ  403
               + +    + +  G ILRL DDL  ++ E++ G++A  ++  + E+   +ISD    ++
Sbjct  445   ISMMNPYPRLFSCSGEILRLWDDLGTSKEEQERGDNACSIQCLMIEN---NISDENVARK  501

Query  402   RIMNMVSEQWKLINKQCLSPTRIPESFSKSCLNIARMVPMMYNYSD  265
              I   +   W  +N   L+ T +P S  K+ LN+AR   ++Y + D
Sbjct  502   HIRRFIRNLWPELNSLVLTTTSLPFSIMKASLNMARTAQVIYQHGD  547



>emb|CCM43930.1| putative monoterpene synthase [Coffea arabica]
Length=580

 Score =   315 bits (807),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 164/486 (34%), Positives = 277/486 (57%), Gaps = 16/486 (3%)
 Frame = -2

Query  1650  DDLQVLNVIDAIQHLGIDHHFHDQIGAILQRQYQKVKIDDFQKINGLYDISLSFRLLRQE  1471
             + L+ +N+ID +Q LG+ +HF D + AIL +     + D       L   +L FRLLR  
Sbjct  100   EPLKAMNLIDTLQRLGLAYHFEDDMNAILSQLSSSGQSD-----GDLLTTALRFRLLRHN  154

Query  1470  GYNVSSDVFTKFTSEKGEFKEELSKDIRGLMALHEASHLSIEGEDVLDEAAKFSRESLIA  1291
             G+ +      KF  + G+FK+ L +D  GL++L+EASHL+  GED+L EA + +   L  
Sbjct  155   GHKI----VQKFMDKNGKFKDSLKEDTMGLLSLYEASHLAANGEDILLEAMELTEAHLKQ  210

Query  1290  NMVHLDECQASMVQNTLQYPYHKSLARFTAKTFIENMRVENEWEATLVNLATMDYSITQS  1111
             ++  L    A  V + L+ P H+ +AR  A+ +I+    E   +  L+ LA +DY+  QS
Sbjct  211   SLPSLPTQLARKVSSALELPRHRRMARLEARRYIQEYSEEIGHDPNLLELAKLDYNKVQS  270

Query  1110  FYQEEFRQILRWWKSLGLKDEL--AKNQQLKWYIWTLALIPDPSMSRERIELTKPIALVY  937
              +Q E  +I RWWK LGL D+L  A+++ L+ ++WT+ ++P+P  S  RIEL K IA++ 
Sbjct  271   LHQMELTEISRWWKQLGLVDKLTFARDRPLECFLWTVGILPEPKYSNCRIELAKTIAILL  330

Query  936   LIDDIIDVYATFDQTKQFIDAINRWDLSVGEGLPDYMKRCLVVLFDTTNDINNLVFEKYG  757
             +IDDI D + T D+   F +AI RWDL   EGLP+YM+ C + L++TTN+I   + ++ G
Sbjct  331   VIDDIFDTHGTIDELVLFTNAIRRWDLEAMEGLPEYMRICYMALYNTTNEICYKILKENG  390

Query  756   WNPIDHLKRAWKCLCSAYITEAKWFATGKSPSANEYLQTGIITTGIPMVLITCFFLLGHG  577
             W+ + +LK  W  +   ++ EA W+  G+ P+  EY++ G+ T G  M ++  FFL+G G
Sbjct  391   WSVLPYLKATWIDMIEGFMLEASWYNNGQVPNMEEYVENGVTTAGAYMAMVHLFFLIGQG  450

Query  576   AFAGTTDI-----EDMITSVGAILRLLDDLDATQGEKQDGNDASYVEYYVKEHEGLSISD  412
                    +       + +  G ILRL DDL   + E++ G+ AS ++ +++E+      +
Sbjct  451   VTEENVKLLMKPYPKLFSCSGRILRLWDDLGTAKEEQERGDLASSIQLFMRENNITCDEE  510

Query  411   GKQRIMNMVSEQWKLINKQCLSPTRIPESFSKSCLNIARMVPMMYNYSDTHCLPILQKQI  232
             G++RI+ ++   WK +N + +S   +P +  K+  N+AR   ++Y + +      +   +
Sbjct  511   GRKRILQLIDNLWKDLNWELVSRDAMPLAIIKAAFNMARSSQVVYQHEEESYFSSVDNYV  570

Query  231   MSMFST  214
              S+F T
Sbjct  571   ESLFFT  576



>ref|XP_003540326.1| PREDICTED: probable terpene synthase 11 [Glycine max]
Length=568

 Score =   315 bits (806),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 181/543 (33%), Positives = 293/543 (54%), Gaps = 26/543 (5%)
 Frame = -2

Query  1857  SSHASIPC------FSIGTALHCRRRTPVVFRCQSVNSSSLRSEKMTVTLSKDEFLLKSE  1696
             SS AS P        S+ T+        +  +C + N + + S+   + L  + F    +
Sbjct  18    SSLASCPSIYQPWNLSLQTSKRGTIHNNLSIKCVAFNDNKVPSQ---IDLRTNNF---EQ  71

Query  1695  GKREWQRGLLYQFQEDDLQVLNVIDAIQHLGIDHHFHDQIGAILQRQYQKVKIDDFQKIN  1516
              KR  Q  LL     D +++L +ID IQ LGI+HHF ++I        Q  K+ D+    
Sbjct  72    VKRNSQMALLNS--SDPIKILKMIDTIQRLGIEHHFKEEINV------QLGKLGDWDVTQ  123

Query  1515  GLYDISLSFRLLRQEGYNVSSDVFTKFTSEKGEFKEELSKDIRGLMALHEASHLSIEGED  1336
              L+  +L FRL R  G+   SDVF KF  + G FKE ++ DI G+++L+EAS+L  +GE+
Sbjct  124   DLFGTALQFRLQRHNGWPSCSDVFKKFLDKSGTFKESITNDIWGMLSLYEASYLGAKGEE  183

Query  1335  VLDEAAKFSRESLIANMVHLDECQASMVQNTLQYPYHKSLARFTAKTFIENMRVENEWEA  1156
             VL +A  FS+  L  ++ HL      +V   L  P H  + R  A+ ++E          
Sbjct  184   VLQQAMDFSKAHLHQSLPHLSPELRKLVAKALTLPRHLRMGRLEARNYMEKYSQATNQIP  243

Query  1155  TLVNLATMDYSITQSFYQEEFRQILRWWKSLGLKDEL--AKNQQLKWYIWTLALIPDPSM  982
              L+ LA +D+++ QS +Q+E  +I RWWK+LGL + L  A+++  + ++WT+   P+P  
Sbjct  244   ALMELAKLDFAMVQSMHQKELAEISRWWKNLGLVERLGFARDRPAECFLWTVGTFPEPRY  303

Query  981   SRERIELTKPIALVYLIDDIIDVYATFDQTKQFIDAINRWDLSVGEGLPDYMKRCLVVLF  802
             S  RIELTK I ++ ++DDI D Y T ++   F +AI RWDL   E LP+YMK C + LF
Sbjct  304   SNCRIELTKTICILLVMDDIFDTYGTLEELVLFTEAIKRWDLDAMEQLPEYMKICYMALF  363

Query  801   DTTNDINNLVFEKYGWNPIDHLKRAWKCLCSAYITEAKWFATGKSPSANEYLQTGIITTG  622
             +TT++I   + +++G   +  LKR W  +  A++ EAKWF  G  P+  EYL  G+I++G
Sbjct  364   NTTHEIAYKIQKEHGQTVVACLKRTWIDIFEAFLKEAKWFNNGYIPTFKEYLDNGVISSG  423

Query  621   IPMVLITCFFLLGHGAFAGTTDI----EDMITSVGAILRLLDDLDATQGEKQDGNDASYV  454
               M L+   FL+G      T  I      + +  G ILRL DDL  ++ E++ G++A  +
Sbjct  424   SYMALVHATFLIGDSLSKETISIMKPYPRLFSCSGEILRLWDDLGTSREEQERGDNACSI  483

Query  453   EYYVKEHEGLSISDGKQRIMNMVSEQWKLINKQCLSPTRIPESFSKSCLNIARMVPMMYN  274
             +  + E+     +  ++ I  ++   W  +N   ++ T +P S  K+ LN+AR   ++Y 
Sbjct  484   QCLMTENNLSDENVARKHIRQLIQNLWPELNGLAMTTTALPSSVMKASLNMARTAQVIYQ  543

Query  273   YSD  265
             + D
Sbjct  544   HGD  546



>ref|NP_001064918.2| Os10g0489500 [Oryza sativa Japonica Group]
 gb|AAL31055.1|AC090120_1 putative monoterpene synthase [Oryza sativa Japonica Group]
 gb|ABB47812.2| Terpene synthase family, metal binding domain containing protein, 
expressed [Oryza sativa Japonica Group]
 gb|EAZ16503.1| hypothetical protein OsJ_31975 [Oryza sativa Japonica Group]
 dbj|BAF26832.2| Os10g0489500 [Oryza sativa Japonica Group]
Length=468

 Score =   311 bits (797),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 160/469 (34%), Positives = 274/469 (58%), Gaps = 13/469 (3%)
 Frame = -2

Query  1635  LNVIDAIQHLGIDHHFHDQIGAILQRQYQKVKIDDFQKINGLYDISLSFRLLRQEGYNVS  1456
             +  +D ++ L IDH+F D++   +        +++      L D +L+FRL+R+ G++VS
Sbjct  1     MATVDHLKRLCIDHYFQDEVDGAMD-----AHLEELAHGGDLLDATLAFRLMREAGHHVS  55

Query  1455  SD-VFTKFTSEKGEFKEELSKDIRGLMALHEASHLSIEGEDVLDEAAKFSRESLIANMVH  1279
              D V  +FT   G+F    SKDIRGL++L + SH++I  E  L +A +F+  +L + + +
Sbjct  56    PDEVLGRFTDGNGDFSMAYSKDIRGLLSLQDISHMNIGAEASLYKAKEFTSRNLQSAIDY  115

Query  1278  LDECQASMVQNTLQYPYHKSLARFTAKTFIENMRVENEWEATLVNLATMDYSITQSFYQE  1099
             L+   A  V+ +L++PYH SL ++ A+  +  ++        +  LA  ++ + +  +Q 
Sbjct  116   LEPGLARYVRQSLEHPYHVSLMQYKARHHLSYLQTLPTRCTAMEELALANFKLNKLLHQM  175

Query  1098  EFRQILRWWKSLGLKDEL--AKNQQLKWYIWTLALIPDPSMSRERIELTKPIALVYLIDD  925
             E ++I RWW +LGL  E+  A++Q  KWY+W +      S SR RIELTK  + VY++DD
Sbjct  176   EMQEIKRWWMNLGLAQEIPVARDQVQKWYVWIMTAFQGASFSRYRIELTKIASFVYIMDD  235

Query  924   IIDVYATFDQTKQFIDAINRWDLSVGEGLPDYMKRCLVVLFDTTNDINNLVFEKYGWNPI  745
             I D+ +T ++   F  AI  WD +  + LP  M+ C   ++  TNDI ++V  ++G NPI
Sbjct  236   IFDLVSTQEERSCFTQAIKMWDFAAADSLPSCMRSCYRAIYTVTNDIADMVEREHGVNPI  295

Query  744   DHLKRAWKCLCSAYITEAKWFATGKSPSANEYLQTGIITTGIPMVLITCFFLLGHGAFAG  565
             +HLK+AW  L    +TEAKW      PS+ +YL+ G+IT+G+P++ +   F+LGH A   
Sbjct  296   NHLKKAWAVLFDGLMTEAKWLTDSHVPSSEDYLRNGVITSGVPLMFLHLLFMLGHDAAEL  355

Query  564   TTDIEDMITSVGAILRLLDDLDATQGEKQDGNDASYVEYYVKEHEGLSISDGKQRIMNMV  385
               +I  +I+    I RL DD+    G  ++G D SY E Y++E+ GL+ S+ ++ +  M+
Sbjct  356   IDNIPPVISCPAKIFRLWDDI----GNAKEGLDGSYKELYLRENPGLAASEAEEHMRGMI  411

Query  384   SEQWKLINKQCLSPTR-IPESFSKSCLNIARMVPMMYNYSDTHCLPILQ  241
             + +W+ +N++     R  P  F+++ LN ARMV +M+ +     LP+L+
Sbjct  412   AREWEKLNRESFFSGRAFPAGFTQAALNAARMVGVMHGHDGEQRLPVLE  460



>gb|AAR87368.1| putative terpene synthase [Oryza sativa Japonica Group]
Length=505

 Score =   312 bits (799),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 160/469 (34%), Positives = 274/469 (58%), Gaps = 13/469 (3%)
 Frame = -2

Query  1635  LNVIDAIQHLGIDHHFHDQIGAILQRQYQKVKIDDFQKINGLYDISLSFRLLRQEGYNVS  1456
             +  +D ++ L IDH+F D++   +        +++      L D +L+FRL+R+ G++VS
Sbjct  38    MATVDHLKRLCIDHYFQDEVDGAMD-----AHLEELAHGGDLLDATLAFRLMREAGHHVS  92

Query  1455  SD-VFTKFTSEKGEFKEELSKDIRGLMALHEASHLSIEGEDVLDEAAKFSRESLIANMVH  1279
              D V  +FT   G+F    SKDIRGL++L + SH++I  E  L +A +F+  +L + + +
Sbjct  93    PDEVLGRFTDGNGDFSMAYSKDIRGLLSLQDISHMNIGAEASLYKAKEFTSRNLQSAIDY  152

Query  1278  LDECQASMVQNTLQYPYHKSLARFTAKTFIENMRVENEWEATLVNLATMDYSITQSFYQE  1099
             L+   A  V+ +L++PYH SL ++ A+  +  ++        +  LA  ++ + +  +Q 
Sbjct  153   LEPGLARYVRQSLEHPYHVSLMQYKARHHLSYLQTLPTRCTAMEELALANFKLNKLLHQM  212

Query  1098  EFRQILRWWKSLGLKDEL--AKNQQLKWYIWTLALIPDPSMSRERIELTKPIALVYLIDD  925
             E ++I RWW +LGL  E+  A++Q  KWY+W +      S SR RIELTK  + VY++DD
Sbjct  213   EMQEIKRWWMNLGLAQEIPVARDQVQKWYVWIMTAFQGASFSRYRIELTKIASFVYIMDD  272

Query  924   IIDVYATFDQTKQFIDAINRWDLSVGEGLPDYMKRCLVVLFDTTNDINNLVFEKYGWNPI  745
             I D+ +T ++   F  AI  WD +  + LP  M+ C   ++  TNDI ++V  ++G NPI
Sbjct  273   IFDLVSTQEERSCFTQAIKMWDFAAADSLPSCMRSCYRAIYTVTNDIADMVEREHGVNPI  332

Query  744   DHLKRAWKCLCSAYITEAKWFATGKSPSANEYLQTGIITTGIPMVLITCFFLLGHGAFAG  565
             +HLK+AW  L    +TEAKW      PS+ +YL+ G+IT+G+P++ +   F+LGH A   
Sbjct  333   NHLKKAWAVLFDGLMTEAKWLTDSHVPSSEDYLRNGVITSGVPLMFLHLLFMLGHDAAEL  392

Query  564   TTDIEDMITSVGAILRLLDDLDATQGEKQDGNDASYVEYYVKEHEGLSISDGKQRIMNMV  385
               +I  +I+    I RL DD+    G  ++G D SY E Y++E+ GL+ S+ ++ +  M+
Sbjct  393   IDNIPPVISCPAKIFRLWDDI----GNAKEGLDGSYKELYLRENPGLAASEAEEHMRGMI  448

Query  384   SEQWKLINKQCLSPTR-IPESFSKSCLNIARMVPMMYNYSDTHCLPILQ  241
             + +W+ +N++     R  P  F+++ LN ARMV +M+ +     LP+L+
Sbjct  449   AREWEKLNRESFFSGRAFPAGFTQAALNAARMVGVMHGHDGEQRLPVLE  497



>ref|XP_003597053.1| Myrcene synthase [Medicago truncatula]
 gb|ABB01626.1| terpene synthase [Medicago truncatula]
 gb|AES67304.1| sesquiterpene synthase [Medicago truncatula]
Length=567

 Score =   313 bits (803),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 180/510 (35%), Positives = 283/510 (55%), Gaps = 17/510 (3%)
 Frame = -2

Query  1773  SVNSSSLRSEKMTVTLSKDEFLLKSEGKREWQRGLLYQFQEDDLQVLNVIDAIQHLGIDH  1594
             S+ S +L +EK++   ++D+     + KR  +  L+     D +  L +ID+IQ LGI H
Sbjct  45    SIKSIAL-NEKLSPLQTEDKTKSLGQVKRRSREALVNS--NDPIVTLKMIDSIQRLGIGH  101

Query  1593  HFHDQIGAILQRQYQKVKIDDFQKINGLYDISLSFRLLRQEGYNVSSDVFTKFTSEKGEF  1414
             H  D+I   L R      I D+     L+  SL FRLLR  G+   SDVF KF  + G F
Sbjct  102   HLEDEINIQLGR------ICDWDLSQDLFATSLQFRLLRHNGWTTCSDVFRKFLDKSGNF  155

Query  1413  KEELSKDIRGLMALHEASHLSIEGEDVLDEAAKFSRESLIANMVHLDECQASMVQNTLQY  1234
              E L+KD+ G+++L+EAS+L  E E++L +A +FSR  L   + HL       +  +L  
Sbjct  156   NESLTKDVWGMLSLYEASYLGTEDEEILKKAMEFSRARLSELIPHLSPEVGRNIAKSLTL  215

Query  1233  PYHKSLARFTAKTFIENMRVENEWEATLVNLATMDYSITQSFYQEEFRQILRWWKSLGLK  1054
             P H  +AR  A+ ++E     +     L+ LA +D  + QS +Q E  +I RWWK LGL 
Sbjct  216   PKHLRMARLEARNYMEEYSKGSNQIPALLELAKLDSDMVQSLHQRELAEICRWWKELGLV  275

Query  1053  DEL--AKNQQLKWYIWTLALIPDPSMSRERIELTKPIALVYLIDDIIDVYATFDQTKQFI  880
             ++L  A+++  + ++WT+ + P+P  S  RIELTK I ++ ++DDI D Y T D+   F 
Sbjct  276   EKLGFARDRPTECFLWTVGIFPEPCHSNCRIELTKTICILLVMDDIFDTYGTLDELVLFT  335

Query  879   DAINRWDLSVGEGLPDYMKRCLVVLFDTTNDINNLVFEKYGWNPIDHLKRAWKCLCSAYI  700
              AI RWDL   + LP+YMK C + L++TTN+I   + +++G   + +LKR W  +  A++
Sbjct  336   KAIKRWDLDAMDQLPEYMKICYMALYNTTNEIAYKIQKEHGLTVVSYLKRTWIDIFEAFL  395

Query  699   TEAKWFATGKSPSANEYLQTGIITTGIPMVLITCFFLLGHGAFAGTTDI-----EDMITS  535
              EAKWF  G  P+   YL  G+I+ G  M L+   FL+G G    T  I       + T 
Sbjct  396   EEAKWFNNGCVPNFKTYLDNGVISAGSCMALVHATFLIGDGLSKETMSIMMKSYPRLFTC  455

Query  534   VGAILRLLDDLDATQGEKQDGNDASYVEYYVKEHEGLSISDGKQRIMNMVSEQWKLINKQ  355
              G ILRL DDL  +  E++ G++AS ++  ++E+     ++G+  I  ++   W+ +N  
Sbjct  456   SGEILRLWDDLGTSTEEQERGDNASSIQCMMRENNISDENEGRIHIRMLLGNLWRELNGL  515

Query  354   CLSPTRIPESFSKSCLNIARMVPMMYNYSD  265
               + T IP S  K+ LN+AR   ++Y + D
Sbjct  516   ATTKT-IPLSVVKASLNMARTAQVIYQHGD  544



>gb|EAY79010.1| hypothetical protein OsI_34119 [Oryza sativa Indica Group]
Length=575

 Score =   312 bits (800),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 161/469 (34%), Positives = 275/469 (59%), Gaps = 13/469 (3%)
 Frame = -2

Query  1635  LNVIDAIQHLGIDHHFHDQIGAILQRQYQKVKIDDFQKINGLYDISLSFRLLRQEGYNVS  1456
             +  +D ++ L IDH+F D++   +        +++      L D +L+FRL+R+ G++VS
Sbjct  108   MATVDHLKRLCIDHYFQDEVDGAMD-----AHLEELAHGGDLLDATLAFRLMREAGHHVS  162

Query  1455  SD-VFTKFTSEKGEFKEELSKDIRGLMALHEASHLSIEGEDVLDEAAKFSRESLIANMVH  1279
              D V  +FT   G+F    SKDIRGL++L + SH++I  E  L +A +F+  +L + + +
Sbjct  163   PDEVLGRFTDGNGDFSMAYSKDIRGLLSLQDISHMNIGAEASLYKAKEFTSRNLQSAIDY  222

Query  1278  LDECQASMVQNTLQYPYHKSLARFTAKTFIENMRVENEWEATLVNLATMDYSITQSFYQE  1099
             L+   A  V+ +L++PYH SL ++ A+  +  ++        +  LA  D+ + +  +Q 
Sbjct  223   LEPGLARYVRQSLEHPYHVSLMQYKARHHLSYLQTLPTRCTAMEELALADFKLNKLLHQM  282

Query  1098  EFRQILRWWKSLGLKDEL--AKNQQLKWYIWTLALIPDPSMSRERIELTKPIALVYLIDD  925
             E ++I RWW +LGL  E+  A++Q  KWY+W +      S SR RIELTK  + VY++DD
Sbjct  283   EMQEIKRWWMNLGLAQEIPVARDQVQKWYVWIMTAFQGASFSRYRIELTKIASFVYIMDD  342

Query  924   IIDVYATFDQTKQFIDAINRWDLSVGEGLPDYMKRCLVVLFDTTNDINNLVFEKYGWNPI  745
             I D+ +T ++   F  AI  WD +  + LP  M+ C   ++  TNDI ++V  ++G NPI
Sbjct  343   IFDLVSTQEERSCFTQAIKMWDFAAADSLPSCMRSCYRAIYTVTNDIADMVEREHGVNPI  402

Query  744   DHLKRAWKCLCSAYITEAKWFATGKSPSANEYLQTGIITTGIPMVLITCFFLLGHGAFAG  565
             +HLK+AW  L    +TEAKW      PS+ +YL+ G+IT+G+P++ +   F+LGH A   
Sbjct  403   NHLKKAWAVLFDGLMTEAKWLTYSHVPSSEDYLRNGVITSGVPLMFLHLLFMLGHDAAEL  462

Query  564   TTDIEDMITSVGAILRLLDDLDATQGEKQDGNDASYVEYYVKEHEGLSISDGKQRIMNMV  385
               +I  +I+    I RL DD+    G  ++G D SY E Y++E+ GL+ S+ ++ +  ++
Sbjct  463   IDNIPPVISCPAKIFRLWDDI----GNAKEGLDGSYKELYLRENPGLAASEAEEHMRGLI  518

Query  384   SEQWKLINKQC-LSPTRIPESFSKSCLNIARMVPMMYNYSDTHCLPILQ  241
             + +W+ +N++   S    P SF+++ LN ARMV +M+ +     LP+L+
Sbjct  519   TREWEKLNRESFFSGKAFPASFTQAALNAARMVGVMHGHDGEQRLPVLE  567



>gb|EMT16520.1| Linalool synthase, chloroplastic [Aegilops tauschii]
Length=554

 Score =   310 bits (794),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 166/484 (34%), Positives = 285/484 (59%), Gaps = 21/484 (4%)
 Frame = -2

Query  1677  RGLLYQFQEDDLQVLNVIDAIQHLGIDHHFHDQIGAILQRQYQKVKIDDFQKINGLYDIS  1498
             + L  Q  +    ++ ++D ++HL ID +F D+IG ++      ++ D+      L D++
Sbjct  79    QALFLQHPKSSRGMMTIVDHLKHLCIDQYFQDEIGNVVDSCMDLIRSDN------LLDVT  132

Query  1497  LSFRLLRQEGYNVSSDVFTKFTSEKGEFKEELSKDIRGLMALHEASHLSIEGEDVLDEAA  1318
             LS RL+R++G      V  KF +  G+F    S+DIRGL++LH+ S L++ GE  L +A 
Sbjct  133   LSMRLMREDG------VLQKFANGNGDFSLAHSQDIRGLLSLHDVSQLNM-GEASLYKAK  185

Query  1317  KFSRESLIANMVHLDECQASMVQNTLQYPYHKSLARFTAKTFIENMRVENEWEATLVNLA  1138
             ++SR+ L + + +L+   A  V+ +L +PYH SL +F A+  +  ++        +  LA
Sbjct  186   EYSRKHLRSTLNYLEPNLARYVKQSLDHPYHVSLMQFKARHHLSYLQSLPTRNTAIEKLA  245

Query  1137  TMDYSITQSFYQEEFRQILRWWKSLGLKDEL--AKNQQLKWYIWTLALIPDPSMSRERIE  964
               ++ I +  +Q E +++ RWW  LGL  E+  A++Q +KWY+W + ++   S S+ RI 
Sbjct  246   VAEFQINKLQHQREMQEVNRWWMDLGLAKEIPAARDQVVKWYMWPMTILEGYSFSKYRIA  305

Query  963   LTKPIALVYLIDDIIDVYATFDQTKQFIDAINRWDLSVGEGLPDYMKRCLVVLFDTTNDI  784
             +TK I++VY++DDI D+ AT ++   F +AI  W+L   + LP YM  C   L++ TNDI
Sbjct  306   ITKIISMVYIVDDIFDLVATQEELSLFNEAIIMWNLEAVDSLPSYMISCYKALYNITNDI  365

Query  783   NNLVFEKYGWNPIDHLKRAWKCLCSAYITEAKWFATGKSPSANEYLQTGIITTGIPMVLI  604
              ++  +++G N I+HLK+AW  L   ++ EAKW +    P+  +YL+ GIIT+G P++ +
Sbjct  366   ADMSMKEHGLNSINHLKKAWATLFDGFMIEAKWLSGNHVPAREDYLRNGIITSGAPLLFM  425

Query  603   TCFFLLGHGAFAGTTD-IEDMITSVGAILRLLDDLDATQGEKQDGNDASYVEYYVKEHEG  427
                F+LGH       D +  +I+    I+RL DD+ + + E Q+G D SY E Y+KE   
Sbjct  426   HLLFMLGHDITEENNDHMSRIISCPAKIMRLWDDMGSAKDEAQEGLDGSYKELYLKESPH  485

Query  426   LSISDGKQRIMNMVSEQWKLINKQCLSPTR--IPESFSKSCLNIARMVPMMYNYSDTHCL  253
                 D ++ ++ M++ +W+ +N++C S TR  +  +F ++ LN ARMV +MY Y   H L
Sbjct  486   ---GDAEEHMLEMIAGEWEGLNRECFSRTRSSLSPTFIRASLNFARMVSVMYGYDHEHRL  542

Query  252   PILQ  241
             P+L+
Sbjct  543   PVLE  546



>ref|XP_003597054.1| Myrcene synthase [Medicago truncatula]
 gb|AES67305.1| sesquiterpene synthase [Medicago truncatula]
Length=565

 Score =   307 bits (787),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 187/536 (35%), Positives = 287/536 (54%), Gaps = 22/536 (4%)
 Frame = -2

Query  1836  CFSIGTALHCR------RRTPVVFRCQSVNSSSLRSEKMTVTLSKDEFLLKSEGKREWQR  1675
             C S  +  H R       +   + R  S+NS++L ++K+    + D      + KR+ Q 
Sbjct  18    CNSRSSTYHSRILLLQKSKPGFMHRKLSINSTAL-NDKVAPLQTDDSTKSLEQVKRKSQE  76

Query  1674  GLLYQFQEDDLQVLNVIDAIQHLGIDHHFHDQIGAILQRQYQKVKIDDFQKINGLYDISL  1495
              LL     D +  L +ID+IQ LGI HH  D+I   L R      I D+     L+  SL
Sbjct  77    ALLNS--SDPMVALKMIDSIQGLGIGHHLEDEINIQLGR------ICDWDLSLDLFGTSL  128

Query  1494  SFRLLRQEGYNVSSDVFTKFTSEKGEFKEELSKDIRGLMALHEASHLSIEGEDVLDEAAK  1315
              FRLLR  G+   SDVF K+  + G FKE L+KDI G+++L+EASHL  E E++L  A K
Sbjct  129   QFRLLRHNGWPTCSDVFKKYLDKSGNFKESLTKDIWGMLSLYEASHLGTEDEEILKRAMK  188

Query  1314  FSRESLIANMVHLDECQASMVQNTLQYPYHKSLARFTAKTFIENMRVENEWEATLVNLAT  1135
             FS   L   + HL       +  +L  P H  +AR  A+ ++E     +     L+ LA 
Sbjct  189   FSSAHLNELIPHLSPEIGRNIAKSLTLPKHLRMARLEARNYMEEYSKGSNQIPALLELAK  248

Query  1134  MDYSITQSFYQEEFRQILRWWKSLGLKDEL--AKNQQLKWYIWTLALIPDPSMSRERIEL  961
             +D  + QS +Q E  +I RW K LGL + L  A+++  + ++WT+ + P+P  S  RIEL
Sbjct  249   LDSDMVQSLHQRELTEICRWSKELGLIERLSFARDRPTECFLWTVGIFPEPCYSNCRIEL  308

Query  960   TKPIALVYLIDDIIDVYATFDQTKQFIDAINRWDLSVGEGLPDYMKRCLVVLFDTTNDIN  781
             TK I ++ +IDDI D Y T +    F  AI RWDL   E LP+YMK C + L++TTN+I 
Sbjct  309   TKTICILDVIDDIFDNYGTLEDLVLFTKAIKRWDLDGMEQLPEYMKICYMALYNTTNEIA  368

Query  780   NLVFEKYGWNPIDHLKRAWKCLCSAYITEAKWFATGKSPSANEYLQTGIITTGIPMVLIT  601
               + +++G   +  LK+ W  +  AY+ EAKWF +G  PS   YL  G+I+ G  M L+ 
Sbjct  369   YRIQKEHGLTVVSCLKKTWMDMFDAYLEEAKWFNSGYVPSFKTYLDNGVISVGSCMALVH  428

Query  600   CFFLLGHGAFAGTTDI----EDMITSVGAILRLLDDLDATQGEKQDGNDASYVEYYVKEH  433
               FL+G G    T  +      + +  G ILRL DDL  +  E++ G++A  ++  +KE+
Sbjct  429   STFLIGDGLSKETISMMKQYPRLFSCSGEILRLWDDLGTSTEEQERGDNACSIQCLMKEN  488

Query  432   EGLSISDGKQRIMNMVSEQWKLINKQCLSPTRIPESFSKSCLNIARMVPMMYNYSD  265
                  ++ ++ +  ++   W+ +N   +S T IP S  K+ LN+AR   ++Y + D
Sbjct  489   NISDENEARKHLRLLIGNLWRELNGLAMSKT-IPLSVVKASLNMARTAQVIYQHGD  543



>gb|KHN25758.1| R-linalool synthase, chloroplastic [Glycine soja]
Length=582

 Score =   307 bits (787),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 177/504 (35%), Positives = 278/504 (55%), Gaps = 23/504 (5%)
 Frame = -2

Query  1692  KREWQRGLLYQFQEDDLQVLNVIDAIQHLGIDHHFHDQIGAILQRQYQKVKIDDFQKING  1513
             KR+ Q  LL     D L+ L +ID IQ LGI+HHF  +I   L R      I D+     
Sbjct  76    KRKSQEALLNS--SDSLRTLEIIDTIQRLGIEHHFEKEINLQLGR------IGDWNAAED  127

Query  1512  LYDISLSFRLLRQEGYNVSSDVFTKFTSEKGEFKEELSKDIRGLMALHEASHLSIEGEDV  1333
             L+  SL FRLLR  G+   SDVF KF  + G FKE +++DI G+++L+EAS+L  +GE+V
Sbjct  128   LFATSLQFRLLRHYGWPTCSDVFNKFLDQSGNFKESVTRDIWGMLSLYEASYLGAKGEEV  187

Query  1332  LDEAAKFSRESLIANMVHLDECQASMVQNTLQYPYHKSLARFTAKTF-IENMRVENEWEA  1156
             L +A  +SR  L  ++  L     S+V   L+ P H  + R  AK F +E  +  N+  A
Sbjct  188   LQQAMDYSRAHLCQSLSDLSPKVGSIVVEALKLPRHLRMGRLEAKNFMVEYSQASNQIPA  247

Query  1155  TLVNLATMDYSITQSFYQEEFRQILRWWKSLGLKDEL--AKNQQLKWYIWTLALIPDPSM  982
              L+ LA +DY + QS +Q+E  +I RWWK LGL + L   ++   + ++W L + P+P  
Sbjct  248   -LLELARLDYDMIQSMHQKELAEISRWWKELGLIERLGFGRDGPRECFLWVLGIFPEPRY  306

Query  981   SRERIELTKPIALVYLIDDIIDVYATFDQTKQFIDAINRWDLSVGEGLPDYMKRCLVVLF  802
             S  RIEL K I ++ ++DD+ D Y T D+   F  AI RWDL V E LP+YMK C + L+
Sbjct  307   SNCRIELAKAICILQVLDDMFDTYGTLDELILFTKAIKRWDLDVMEQLPEYMKICYMALY  366

Query  801   DTTNDINNLVFEKYGWNPIDHLKRAWKCLCSAYITEAKWFATGKSPSANEYLQTGIITTG  622
             +TT++I   + + +G   +  LKR W  L  AY+ EAKWF     P+  +YL  G+I++G
Sbjct  367   NTTHEIAYKIQKDHGQTVVACLKRTWIDLIEAYLKEAKWFNNKYVPTFQQYLDNGVISSG  426

Query  621   IPMVLITCFFLLGHGAFAGTTDIED-----MITSVGAILRLLDDLDATQGEKQDGNDASY  457
               + L+   FL+G      T  + +     + +  G ILRL DDL  ++ E++ G++A  
Sbjct  427   SYLALVHASFLIGDDFSKETISMMNPPYPRLFSCSGEILRLWDDLGTSRDEQERGDNACS  486

Query  456   VEYYVKEHEGLSISD---GKQRIMNMVSEQWKLINKQCLSPTRIPESFSKSCLNIARMVP  286
             ++  + E+   +ISD    ++ I  ++   W  +N   +  T +P S  ++ LN+AR   
Sbjct  487   IQCLMTEN---NISDENVARRHIRKLIKNLWPELNGLTMITTTLPLSVMRASLNMARTSQ  543

Query  285   MMYNYSDTHCLPILQKQIMSMFST  214
             ++Y + D   +  +   + ++  T
Sbjct  544   VIYQHGDYQSMLTVDDHVQALLLT  567



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 6138706414592