BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c24331_g1_i2 len=1608 path=[10157:0-86 7806:87-218 @7938@!:219-619
12754:620-684 8339:685-1419 9074:1420-1490 9145:1491-1536
9074:1537-1607]

Length=1608
                                                                      Score     E

ref|XP_007027659.1|  Pleiotropic drug resistance 11 isoform 1           294   2e-154   
ref|XP_010658730.1|  PREDICTED: pleiotropic drug resistance prote...    314   4e-154   
ref|XP_010049726.1|  PREDICTED: pleiotropic drug resistance prote...    297   5e-154   
emb|CBI40238.3|  unnamed protein product                                314   8e-154   
ref|XP_002534113.1|  ATP-binding cassette transporter, putative         310   9e-153   Ricinus communis
ref|XP_004303014.1|  PREDICTED: pleiotropic drug resistance prote...    297   4e-151   
ref|XP_004303015.1|  PREDICTED: pleiotropic drug resistance prote...    297   5e-151   
ref|XP_010067156.1|  PREDICTED: pleiotropic drug resistance prote...    307   2e-150   
gb|KCW65223.1|  hypothetical protein EUGRSUZ_G02707                     307   3e-150   
ref|XP_010036716.1|  PREDICTED: pleiotropic drug resistance prote...    311   4e-150   
gb|KCW48349.1|  hypothetical protein EUGRSUZ_K02065                     311   4e-150   
ref|XP_010242632.1|  PREDICTED: pleiotropic drug resistance prote...    316   6e-150   
ref|XP_010036718.1|  PREDICTED: pleiotropic drug resistance prote...    311   8e-150   
ref|XP_010036717.1|  PREDICTED: pleiotropic drug resistance prote...    310   8e-150   
gb|KCW48350.1|  hypothetical protein EUGRSUZ_K02065                     310   8e-150   
emb|CBI40241.3|  unnamed protein product                                307   1e-149   
ref|XP_008227291.1|  PREDICTED: pleiotropic drug resistance prote...    310   5e-149   
ref|XP_007207810.1|  hypothetical protein PRUPE_ppa024119mg             310   5e-149   
ref|XP_008227295.1|  PREDICTED: pleiotropic drug resistance prote...    310   5e-149   
ref|XP_008227287.1|  PREDICTED: pleiotropic drug resistance prote...    310   5e-149   
ref|XP_007010271.1|  Pleiotropic drug resistance 6                      301   6e-149   
ref|XP_007023609.1|  Pleiotropic drug resistance 11                     296   6e-149   
ref|XP_010089393.1|  Pleiotropic drug resistance protein 2              293   8e-149   
ref|XP_008241277.1|  PREDICTED: pleiotropic drug resistance prote...    286   1e-148   
ref|XP_007203982.1|  hypothetical protein PRUPE_ppa000212mg             286   2e-148   
ref|XP_010654053.1|  PREDICTED: pleiotropic drug resistance prote...    303   2e-148   
emb|CBI30263.3|  unnamed protein product                                303   2e-148   
ref|XP_006604625.1|  PREDICTED: ABC transporter G family member 3...    289   2e-148   
ref|XP_006604626.1|  PREDICTED: ABC transporter G family member 3...    289   3e-148   
ref|XP_009365366.1|  PREDICTED: pleiotropic drug resistance prote...    290   5e-148   
ref|XP_009365370.1|  PREDICTED: pleiotropic drug resistance prote...    290   5e-148   
emb|CBI40240.3|  unnamed protein product                                293   5e-148   
emb|CAN77838.1|  hypothetical protein VITISV_025837                     302   6e-148   Vitis vinifera
gb|KDP42709.1|  hypothetical protein JCGZ_23649                         293   1e-147   
ref|XP_009352981.1|  PREDICTED: ABC transporter G family member 3...    286   2e-147   
ref|XP_010658729.1|  PREDICTED: pleiotropic drug resistance prote...    292   3e-147   
ref|XP_010244003.1|  PREDICTED: pleiotropic drug resistance prote...    316   3e-147   
ref|XP_008356632.1|  PREDICTED: pleiotropic drug resistance prote...    284   3e-147   
ref|XP_006381302.1|  ABC transporter family protein                     290   5e-147   
ref|XP_010244015.1|  PREDICTED: pleiotropic drug resistance prote...    316   6e-147   
ref|XP_011018900.1|  PREDICTED: pleiotropic drug resistance prote...    290   2e-146   
gb|KDP45005.1|  hypothetical protein JCGZ_01505                         293   2e-146   
emb|CDP06962.1|  unnamed protein product                                311   4e-146   
ref|XP_009352982.1|  PREDICTED: pleiotropic drug resistance prote...    286   7e-146   
ref|XP_008349787.1|  PREDICTED: pleiotropic drug resistance prote...    305   8e-146   
ref|XP_009374757.1|  PREDICTED: pleiotropic drug resistance prote...    281   1e-145   
gb|KHG04563.1|  Pleiotropic drug resistance 2                           298   1e-145   
ref|XP_008231976.1|  PREDICTED: pleiotropic drug resistance prote...    293   1e-145   
ref|XP_004291545.1|  PREDICTED: pleiotropic drug resistance prote...    302   3e-145   
ref|XP_009356106.1|  PREDICTED: pleiotropic drug resistance prote...    299   3e-145   
ref|XP_007162869.1|  hypothetical protein PHAVU_001G187900g             286   6e-145   
gb|KHG09700.1|  Pleiotropic drug resistance 2                           296   7e-145   
ref|XP_007221392.1|  hypothetical protein PRUPE_ppa000185mg             291   8e-145   
ref|XP_008391811.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...    282   1e-144   
ref|XP_007208416.1|  hypothetical protein PRUPE_ppa000235mg             312   2e-144   
ref|XP_008360438.1|  PREDICTED: pleiotropic drug resistance prote...    310   3e-144   
ref|XP_009364873.1|  PREDICTED: pleiotropic drug resistance prote...    310   9e-144   
gb|KCW50780.1|  hypothetical protein EUGRSUZ_J00451                     295   2e-143   
ref|XP_008345629.1|  PREDICTED: pleiotropic drug resistance prote...    298   2e-143   
ref|XP_010031471.1|  PREDICTED: pleiotropic drug resistance prote...    295   2e-143   
ref|XP_009365364.1|  PREDICTED: pleiotropic drug resistance prote...    281   9e-143   
ref|XP_011032821.1|  PREDICTED: pleiotropic drug resistance prote...    293   2e-142   
ref|XP_011088856.1|  PREDICTED: pleiotropic drug resistance prote...    314   2e-142   
ref|XP_011090010.1|  PREDICTED: LOW QUALITY PROTEIN: pleiotropic ...    318   2e-142   
gb|KHG28039.1|  ABC transporter G family member 41                      282   2e-142   
ref|XP_008370068.1|  PREDICTED: pleiotropic drug resistance prote...    309   3e-142   
gb|EYU38080.1|  hypothetical protein MIMGU_mgv1a025570mg                280   4e-142   
ref|XP_008227362.1|  PREDICTED: pleiotropic drug resistance prote...    301   6e-142   
ref|XP_008227349.1|  PREDICTED: pleiotropic drug resistance prote...    301   6e-142   
ref|XP_009628764.1|  PREDICTED: pleiotropic drug resistance prote...    293   8e-142   
ref|XP_008227358.1|  PREDICTED: pleiotropic drug resistance prote...    301   8e-142   
gb|EYU38621.1|  hypothetical protein MIMGU_mgv1a025382mg                299   2e-141   
gb|KDO46933.1|  hypothetical protein CISIN_1g045902mg                   288   2e-141   
ref|XP_006436657.1|  hypothetical protein CICLE_v10033294mg             288   2e-141   
ref|XP_002311035.2|  hypothetical protein POPTR_0008s02480g             289   3e-141   Populus trichocarpa [western balsam poplar]
ref|XP_009763866.1|  PREDICTED: pleiotropic drug resistance prote...    291   3e-141   
ref|XP_007208417.1|  hypothetical protein PRUPE_ppa000239mg             300   3e-141   
gb|KDP34703.1|  hypothetical protein JCGZ_10908                         297   3e-141   
ref|XP_010031472.1|  PREDICTED: pleiotropic drug resistance prote...    289   3e-141   
ref|XP_010031473.1|  PREDICTED: pleiotropic drug resistance prote...    292   4e-141   
ref|XP_002529080.1|  ATP-binding cassette transporter, putative         306   5e-141   Ricinus communis
gb|KCW50781.1|  hypothetical protein EUGRSUZ_J00454                     292   5e-141   
ref|XP_004496191.1|  PREDICTED: pleiotropic drug resistance prote...    293   6e-141   
ref|XP_011076911.1|  PREDICTED: pleiotropic drug resistance prote...    277   7e-141   
ref|XP_009141587.1|  PREDICTED: ABC transporter G family member 39      275   1e-140   
emb|CDY43723.1|  BnaAnng07380D                                          275   1e-140   
ref|XP_006361443.1|  PREDICTED: pleiotropic drug resistance prote...    290   2e-140   
ref|XP_006361444.1|  PREDICTED: pleiotropic drug resistance prote...    289   3e-140   
ref|XP_009364871.1|  PREDICTED: pleiotropic drug resistance prote...    297   5e-140   
ref|XP_002529079.1|  ATP-binding cassette transporter, putative         304   7e-140   Ricinus communis
ref|XP_009348120.1|  PREDICTED: pleiotropic drug resistance prote...    298   1e-139   
emb|CDO99881.1|  unnamed protein product                                280   1e-139   
ref|XP_002887089.1|  ATPDR11/PDR11                                      280   1e-139   
ref|XP_009351140.1|  PREDICTED: pleiotropic drug resistance prote...    302   2e-139   
ref|XP_011076913.1|  PREDICTED: pleiotropic drug resistance prote...    297   4e-139   
ref|XP_009348121.1|  PREDICTED: pleiotropic drug resistance prote...    294   4e-139   
gb|EYU40701.1|  hypothetical protein MIMGU_mgv1a022939mg                308   5e-139   
ref|XP_008349786.1|  PREDICTED: pleiotropic drug resistance prote...    303   7e-139   
ref|XP_010552832.1|  PREDICTED: ABC transporter G family member 3...    294   7e-139   
ref|XP_010312551.1|  PREDICTED: pleiotropic drug resistance prote...    286   8e-139   
ref|XP_004249988.1|  PREDICTED: pleiotropic drug resistance prote...    286   1e-138   
ref|XP_010312553.1|  PREDICTED: pleiotropic drug resistance prote...    286   1e-138   
ref|XP_010312550.1|  PREDICTED: pleiotropic drug resistance prote...    286   1e-138   
ref|XP_010312552.1|  PREDICTED: pleiotropic drug resistance prote...    286   1e-138   
ref|XP_004291542.1|  PREDICTED: pleiotropic drug resistance prote...    294   1e-138   
ref|NP_176867.2|  ABC transporter G family member 39                    276   2e-138   Arabidopsis thaliana [mouse-ear cress]
gb|AAF98206.1|AC007152_2  Putative ABC transporter                      276   2e-138   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008359761.1|  PREDICTED: pleiotropic drug resistance prote...    292   2e-138   
ref|XP_010496113.1|  PREDICTED: ABC transporter G family member 39      278   2e-138   
gb|AAG50592.1|AC083891_6  ABC transporter, putative                     276   2e-138   Arabidopsis thaliana [mouse-ear cress]
gb|AES81993.2|  drug resistance transporter-like ABC domain protein     273   2e-138   
ref|XP_003625775.1|  Pleiotropic drug resistance ABC transporter ...    273   2e-138   
ref|XP_007145541.1|  hypothetical protein PHAVU_007G247200g             285   2e-138   
emb|CDO99882.1|  unnamed protein product                                280   3e-138   
gb|KHN37838.1|  Pleiotropic drug resistance protein 2                   280   3e-138   
emb|CBI17066.3|  unnamed protein product                                307   4e-138   
emb|CAN83834.1|  hypothetical protein VITISV_006821                     307   4e-138   Vitis vinifera
ref|XP_010651721.1|  PREDICTED: pleiotropic drug resistance prote...    307   5e-138   
ref|XP_006590192.1|  PREDICTED: pleiotropic drug resistance prote...    279   5e-138   
ref|XP_009763865.1|  PREDICTED: pleiotropic drug resistance prote...    292   5e-138   
ref|XP_009763864.1|  PREDICTED: pleiotropic drug resistance prote...    292   5e-138   
ref|XP_006300648.1|  hypothetical protein CARUB_v10019658mg             280   6e-138   
ref|XP_010683847.1|  PREDICTED: ABC transporter G family member 3...    284   1e-137   
ref|XP_006410815.1|  hypothetical protein EUTSA_v10016140mg             270   1e-137   
ref|XP_002879608.1|  ATPDR6/PDR6                                        272   2e-137   
gb|EYU36972.1|  hypothetical protein MIMGU_mgv1a0189871mg               304   2e-137   
gb|KHN00911.1|  Pleiotropic drug resistance protein 2                   277   2e-137   
ref|XP_006606280.1|  PREDICTED: pleiotropic drug resistance prote...    277   3e-137   
ref|XP_006606281.1|  PREDICTED: pleiotropic drug resistance prote...    277   3e-137   
gb|KGN59109.1|  hypothetical protein Csa_3G774730                       278   4e-137   
ref|XP_010651917.1|  PREDICTED: pleiotropic drug resistance prote...    300   7e-137   
ref|XP_004143306.1|  PREDICTED: ABC transporter G family member 3...    278   9e-137   
ref|XP_004164072.1|  PREDICTED: ABC transporter G family member 3...    278   9e-137   
ref|XP_004151527.1|  PREDICTED: LOW QUALITY PROTEIN: pleiotropic ...    276   1e-136   
ref|XP_010415239.1|  PREDICTED: ABC transporter G family member 3...    273   2e-136   
ref|XP_010415237.1|  PREDICTED: ABC transporter G family member 3...    273   2e-136   
gb|KFK36344.1|  hypothetical protein AALP_AA4G110300                    272   2e-136   
ref|XP_006575132.1|  PREDICTED: pleiotropic drug resistance prote...    281   2e-136   
ref|XP_009628856.1|  PREDICTED: pleiotropic drug resistance prote...    287   3e-136   
ref|XP_010511609.1|  PREDICTED: ABC transporter G family member 3...    271   4e-136   
ref|XP_008227338.1|  PREDICTED: pleiotropic drug resistance prote...    301   4e-136   
gb|KEH43440.1|  drug resistance transporter-like ABC domain protein     286   4e-136   
ref|XP_006345999.1|  PREDICTED: pleiotropic drug resistance prote...    287   4e-136   
ref|XP_004250479.1|  PREDICTED: pleiotropic drug resistance prote...    293   4e-136   
ref|XP_006577062.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...    282   4e-136   
ref|XP_004171668.1|  PREDICTED: pleiotropic drug resistance prote...    276   5e-136   
ref|XP_007162867.1|  hypothetical protein PHAVU_001G187700g             283   5e-136   
gb|KHN18743.1|  ABC transporter G family member 39                      282   6e-136   
ref|XP_008462545.1|  PREDICTED: ABC transporter G family member 3...    279   6e-136   
ref|NP_181179.2|  ABC transporter G family member 34                    268   7e-136   Arabidopsis thaliana [mouse-ear cress]
gb|KHN25179.1|  Pleiotropic drug resistance protein 2                   280   8e-136   
gb|AAD24623.1|  putative ABC transporter                                268   8e-136   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004291541.1|  PREDICTED: pleiotropic drug resistance prote...    303   8e-136   
emb|CDX84561.1|  BnaA03g16690D                                          267   9e-136   
ref|XP_002267191.2|  PREDICTED: pleiotropic drug resistance prote...    299   1e-135   Vitis vinifera
ref|XP_010553380.1|  PREDICTED: ABC transporter G family member 3...    285   1e-135   
emb|CBI17067.3|  unnamed protein product                                299   1e-135   
ref|XP_010509478.1|  PREDICTED: ABC transporter G family member 3...    273   1e-135   
ref|XP_010553378.1|  PREDICTED: ABC transporter G family member 3...    285   1e-135   
ref|XP_007208393.1|  hypothetical protein PRUPE_ppa000233mg             301   2e-135   
ref|XP_006349092.1|  PREDICTED: pleiotropic drug resistance prote...    290   2e-135   
ref|XP_009626402.1|  PREDICTED: pleiotropic drug resistance prote...    299   2e-135   
sp|Q2PCF1.1|PDR2_NICPL  RecName: Full=Pleiotropic drug resistance...    297   2e-135   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
ref|XP_003625773.1|  ABC transporter G family member                    271   3e-135   
gb|AES81991.2|  drug resistance transporter-like ABC domain protein     271   3e-135   
ref|XP_003625777.1|  Pleiotropic drug resistance protein                266   3e-135   
ref|XP_010516859.1|  PREDICTED: ABC transporter G family member 3...    273   4e-135   
gb|AES81995.2|  drug resistance transporter-like ABC domain protein     266   5e-135   
emb|CAN80610.1|  hypothetical protein VITISV_042903                     296   7e-135   Vitis vinifera
ref|XP_010505184.1|  PREDICTED: ABC transporter G family member 34      274   7e-135   
ref|XP_009133080.1|  PREDICTED: ABC transporter G family member 3...    268   7e-135   
ref|XP_009133078.1|  PREDICTED: ABC transporter G family member 3...    268   8e-135   
ref|XP_006361492.1|  PREDICTED: pleiotropic drug resistance prote...    293   8e-135   
ref|XP_010926683.1|  PREDICTED: pleiotropic drug resistance prote...    289   1e-134   
emb|CDX79673.1|  BnaC03g20090D                                          265   1e-134   
gb|KCW50779.1|  hypothetical protein EUGRSUZ_J00450                     283   1e-134   
ref|XP_010034201.1|  PREDICTED: pleiotropic drug resistance prote...    283   1e-134   
ref|XP_007208139.1|  hypothetical protein PRUPE_ppa000232mg             298   1e-134   
ref|XP_010553381.1|  PREDICTED: ABC transporter G family member 3...    280   2e-134   
ref|XP_004251027.1|  PREDICTED: pleiotropic drug resistance prote...    290   3e-134   
gb|KEH41422.1|  drug resistance transporter-like ABC domain protein     283   3e-134   
ref|XP_010516857.1|  PREDICTED: ABC transporter G family member 3...    273   4e-134   
ref|XP_003590279.1|  ABC transporter G family member                    281   6e-134   
ref|XP_010093208.1|  Pleiotropic drug resistance protein 2              292   7e-134   
ref|XP_004494909.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...    255   8e-134   
ref|XP_009798514.1|  PREDICTED: pleiotropic drug resistance prote...    294   8e-134   
ref|XP_007015918.1|  Pleiotropic drug resistance 6                      302   1e-133   
ref|XP_011044671.1|  PREDICTED: pleiotropic drug resistance prote...    272   3e-133   
gb|EYU19792.1|  hypothetical protein MIMGU_mgv1a000194mg                269   6e-133   
ref|XP_010089395.1|  Pleiotropic drug resistance protein 2              283   6e-133   
ref|XP_008442813.1|  PREDICTED: pleiotropic drug resistance prote...    277   9e-133   
ref|XP_010509477.1|  PREDICTED: ABC transporter G family member 3...    269   1e-132   
ref|XP_010505181.1|  PREDICTED: ABC transporter G family member 3...    271   1e-132   
ref|XP_010505182.1|  PREDICTED: ABC transporter G family member 3...    271   1e-132   
emb|CDP15381.1|  unnamed protein product                                273   1e-132   
ref|XP_006361493.1|  PREDICTED: pleiotropic drug resistance prote...    286   3e-132   
ref|XP_006296271.1|  hypothetical protein CARUB_v10025439mg             272   6e-132   
ref|XP_006430269.1|  hypothetical protein CICLE_v10010903mg             268   1e-131   
ref|XP_006481825.1|  PREDICTED: ABC transporter G family member 3...    267   5e-131   
gb|ADE77370.1|  unknown                                                 280   7e-131   
ref|XP_002313659.2|  hypothetical protein POPTR_0009s14940g             267   7e-131   Populus trichocarpa [western balsam poplar]
gb|KHN18744.1|  ABC transporter G family member 39                      271   9e-131   
ref|XP_010519283.1|  PREDICTED: ABC transporter G family member 3...    288   3e-130   
ref|XP_006345864.1|  PREDICTED: pleiotropic drug resistance prote...    278   7e-130   
ref|XP_006430268.1|  hypothetical protein CICLE_v10010902mg             279   1e-129   
ref|XP_006851555.1|  hypothetical protein AMTR_s00040p00185210          289   1e-129   
ref|XP_008442814.1|  PREDICTED: ABC transporter G family member 3...    258   3e-129   
ref|XP_010312549.1|  PREDICTED: pleiotropic drug resistance prote...    280   3e-129   
ref|XP_008458615.1|  PREDICTED: LOW QUALITY PROTEIN: pleiotropic ...    271   3e-129   
ref|XP_006481824.1|  PREDICTED: ABC transporter G family member 3...    278   6e-129   
gb|KDO61074.1|  hypothetical protein CISIN_1g0005062mg                  277   8e-129   
ref|XP_004170354.1|  PREDICTED: LOW QUALITY PROTEIN: pleiotropic ...    268   8e-129   
ref|XP_004145784.1|  PREDICTED: pleiotropic drug resistance prote...    268   8e-129   
ref|XP_007143816.1|  hypothetical protein PHAVU_007G104000g             269   1e-128   
emb|CBI28361.3|  unnamed protein product                                300   3e-128   
ref|XP_004515482.1|  PREDICTED: pleiotropic drug resistance prote...    271   4e-128   
ref|XP_010683848.1|  PREDICTED: ABC transporter G family member 3...    261   5e-127   
ref|XP_010683849.1|  PREDICTED: ABC transporter G family member 3...    261   8e-127   
gb|EPS65201.1|  hypothetical protein M569_09576                         254   2e-126   
ref|XP_006430270.1|  hypothetical protein CICLE_v10010901mg             278   2e-126   
ref|XP_006481826.1|  PREDICTED: ABC transporter G family member 3...    278   3e-126   
ref|XP_004239721.1|  PREDICTED: pleiotropic drug resistance prote...    273   3e-126   
ref|XP_002532015.1|  ATP-binding cassette transporter, putative         288   1e-125   Ricinus communis
ref|XP_008339080.1|  PREDICTED: pleiotropic drug resistance prote...    248   1e-125   
ref|XP_009411967.1|  PREDICTED: pleiotropic drug resistance prote...    279   4e-125   
ref|XP_009411968.1|  PREDICTED: pleiotropic drug resistance prote...    279   4e-125   
ref|XP_010683850.1|  PREDICTED: ABC transporter G family member 3...    247   3e-122   
ref|XP_007162868.1|  hypothetical protein PHAVU_001G187800g             248   6e-122   
ref|XP_004515487.1|  PREDICTED: ABC transporter G family member 3...    257   7e-122   
ref|XP_003625772.1|  ABC transporter G family member                    253   9e-122   
gb|AES81990.2|  drug resistance transporter-like ABC domain protein     253   1e-121   
gb|AEG76903.1|  putative ATP-binding cassette transporter               234   6e-120   
emb|CDP04695.1|  unnamed protein product                                246   2e-118   
ref|XP_002297807.2|  hypothetical protein POPTR_0001s14660g             261   2e-116   Populus trichocarpa [western balsam poplar]
ref|XP_010249929.1|  PREDICTED: pleiotropic drug resistance prote...    265   2e-116   
ref|XP_008392128.1|  PREDICTED: pleiotropic drug resistance prote...    266   2e-115   
ref|XP_008392127.1|  PREDICTED: pleiotropic drug resistance prote...    265   2e-115   
ref|XP_010249930.1|  PREDICTED: pleiotropic drug resistance prote...    261   2e-115   
ref|XP_007227084.1|  hypothetical protein PRUPE_ppa000234mg             259   3e-115   
ref|XP_010227927.1|  PREDICTED: pleiotropic drug resistance prote...    255   3e-115   
ref|XP_011094543.1|  PREDICTED: pleiotropic drug resistance prote...    263   4e-115   
ref|XP_009334795.1|  PREDICTED: pleiotropic drug resistance prote...    258   5e-115   
ref|XP_008394025.1|  PREDICTED: pleiotropic drug resistance prote...    258   5e-115   
ref|XP_004161244.1|  PREDICTED: LOW QUALITY PROTEIN: pleiotropic ...    243   7e-115   
ref|XP_002324840.1|  hypothetical protein POPTR_0018s01240g             265   7e-115   Populus trichocarpa [western balsam poplar]
ref|XP_008442815.1|  PREDICTED: ABC transporter G family member 3...    240   9e-115   
ref|XP_008361068.1|  PREDICTED: pleiotropic drug resistance prote...    253   1e-114   
ref|XP_008361067.1|  PREDICTED: pleiotropic drug resistance prote...    253   1e-114   
gb|ABA94465.2|  ABC transporter, putative, expressed                    258   1e-114   Oryza sativa Japonica Group [Japonica rice]
gb|EMS54450.1|  Pleiotropic drug resistance protein 5                   251   1e-114   
emb|CAD59574.1|  PDR-like ABC transporter                               258   1e-114   Oryza sativa Japonica Group [Japonica rice]
gb|EEE52395.1|  hypothetical protein OsJ_34498                          258   1e-114   Oryza sativa Japonica Group [Japonica rice]
gb|EEC68477.1|  hypothetical protein OsI_36727                          258   2e-114   Oryza sativa Indica Group [Indian rice]
gb|KDP33642.1|  hypothetical protein JCGZ_07213                         262   7e-114   
ref|XP_003553514.1|  PREDICTED: pleiotropic drug resistance prote...    253   1e-113   
ref|XP_004156752.1|  PREDICTED: LOW QUALITY PROTEIN: pleiotropic ...    248   1e-113   
ref|XP_003569331.1|  PREDICTED: pleiotropic drug resistance prote...    259   1e-113   
gb|ACU82515.1|  pleiotropic drug resistance protein                     248   1e-113   Cucumis sativus [cucumbers]
ref|XP_004148099.1|  PREDICTED: pleiotropic drug resistance prote...    248   1e-113   
emb|CAN80954.1|  hypothetical protein VITISV_032205                     263   2e-113   Vitis vinifera
ref|XP_011020655.1|  PREDICTED: pleiotropic drug resistance prote...    250   2e-113   
ref|XP_009589545.1|  PREDICTED: pleiotropic drug resistance prote...    265   2e-113   
gb|KHN02456.1|  Pleiotropic drug resistance protein 1                   253   2e-113   
ref|XP_008459146.1|  PREDICTED: pleiotropic drug resistance prote...    247   3e-113   
ref|XP_006427144.1|  hypothetical protein CICLE_v10024707mg             251   3e-113   
gb|KDO58232.1|  hypothetical protein CISIN_1g047682mg                   251   3e-113   
ref|XP_006465412.1|  PREDICTED: pleiotropic drug resistance prote...    251   3e-113   
ref|XP_002297805.2|  hypothetical protein POPTR_0001s14630g             253   3e-113   Populus trichocarpa [western balsam poplar]
gb|KGN59075.1|  hypothetical protein Csa_3G751990                       239   3e-113   
ref|XP_006663558.1|  PREDICTED: pleiotropic drug resistance prote...    246   3e-113   
gb|EMS46441.1|  Pleiotropic drug resistance protein 5                   251   3e-113   
ref|XP_006368914.1|  hypothetical protein POPTR_0001s14650g             258   4e-113   
ref|XP_011034492.1|  PREDICTED: pleiotropic drug resistance prote...    263   5e-113   
ref|XP_010648604.1|  PREDICTED: pleiotropic drug resistance prote...    261   5e-113   
ref|XP_010648603.1|  PREDICTED: pleiotropic drug resistance prote...    261   5e-113   
ref|XP_002304713.2|  hypothetical protein POPTR_0003s17740g             251   6e-113   Populus trichocarpa [western balsam poplar]
ref|XP_010023520.1|  PREDICTED: pleiotropic drug resistance prote...    256   8e-113   
ref|XP_010023519.1|  PREDICTED: pleiotropic drug resistance prote...    256   8e-113   
ref|XP_002514349.1|  ATP-binding cassette transporter, putative         262   8e-113   Ricinus communis
ref|XP_010254256.1|  PREDICTED: pleiotropic drug resistance prote...    257   8e-113   
ref|XP_010654715.1|  PREDICTED: pleiotropic drug resistance prote...    256   8e-113   
ref|NP_001068174.2|  Os11g0587600                                       252   9e-113   
ref|XP_006366078.1|  PREDICTED: pleiotropic drug resistance prote...    258   9e-113   
ref|XP_004247841.1|  PREDICTED: pleiotropic drug resistance prote...    244   1e-112   
emb|CBI36229.3|  unnamed protein product                                255   1e-112   
ref|XP_002304711.2|  hypothetical protein POPTR_0003s17730g             249   1e-112   
emb|CAN77690.1|  hypothetical protein VITISV_022715                     255   2e-112   
ref|XP_002304712.2|  hypothetical protein POPTR_0003s17730g             249   2e-112   
ref|XP_009334794.1|  PREDICTED: pleiotropic drug resistance prote...    251   2e-112   
gb|ACP19711.1|  PDR-type ABC transporter                                250   3e-112   
gb|ACL80650.1|  PDR-type ABC transporter                                250   3e-112   
emb|CDO98092.1|  unnamed protein product                                248   3e-112   
ref|XP_009407444.1|  PREDICTED: pleiotropic drug resistance prote...    254   3e-112   
ref|XP_009775073.1|  PREDICTED: pleiotropic drug resistance prote...    261   4e-112   
ref|XP_007226604.1|  hypothetical protein PRUPE_ppa023430mg             259   4e-112   
ref|XP_008775870.1|  PREDICTED: pleiotropic drug resistance prote...    248   5e-112   
ref|XP_008775869.1|  PREDICTED: pleiotropic drug resistance prote...    248   5e-112   
ref|XP_010049001.1|  PREDICTED: pleiotropic drug resistance prote...    253   9e-112   
ref|XP_010537955.1|  PREDICTED: ABC transporter G family member 4...    253   1e-111   
emb|CDY36570.1|  BnaA06g10230D                                          252   1e-111   
ref|XP_003563012.1|  PREDICTED: pleiotropic drug resistance prote...    243   2e-111   
ref|NP_173005.1|  ABC transporter G family member 40                    253   2e-111   
emb|CAN83563.1|  hypothetical protein VITISV_025401                     254   2e-111   
ref|XP_002983747.1|  ATP-binding cassette transporter                   241   2e-111   
ref|XP_006366077.1|  PREDICTED: pleiotropic drug resistance prote...    255   2e-111   
ref|XP_002990511.1|  hypothetical protein SELMODRAFT_131727             241   2e-111   
ref|XP_009148948.1|  PREDICTED: ABC transporter G family member 40      251   2e-111   
ref|XP_010249928.1|  PREDICTED: putative pleiotropic drug resista...    259   3e-111   
emb|CDO98093.1|  unnamed protein product                                248   3e-111   
gb|AFA43816.1|  ABCG/PDR subfamily ABC protein                          255   3e-111   
ref|XP_010916538.1|  PREDICTED: pleiotropic drug resistance prote...    253   3e-111   
ref|XP_002309596.1|  hypothetical protein POPTR_0006s26460g             258   3e-111   
gb|AFA43815.1|  ABCG/PDR subfamily ABC transporter                      255   3e-111   
gb|EMS45664.1|  Pleiotropic drug resistance protein 5                   248   3e-111   
ref|XP_011081908.1|  PREDICTED: pleiotropic drug resistance prote...    254   4e-111   
gb|AES81585.2|  drug resistance transporter-like ABC domain protein     253   4e-111   
gb|AES81619.2|  drug resistance transporter-like ABC domain protein     254   4e-111   
ref|XP_003625401.1|  Pleiotropic drug resistance protein                254   4e-111   
ref|XP_008445146.1|  PREDICTED: pleiotropic drug resistance prote...    250   5e-111   
ref|XP_006360347.1|  PREDICTED: pleiotropic drug resistance prote...    245   5e-111   
ref|XP_010914973.1|  PREDICTED: pleiotropic drug resistance prote...    254   5e-111   
emb|CDY39660.1|  BnaC05g11890D                                          251   5e-111   
ref|XP_010914974.1|  PREDICTED: pleiotropic drug resistance prote...    254   6e-111   
emb|CDP04826.1|  unnamed protein product                                264   6e-111   
ref|XP_004291476.1|  PREDICTED: pleiotropic drug resistance prote...    256   7e-111   
ref|XP_003625367.1|  Pleiotropic drug resistance protein                252   9e-111   
ref|XP_009347962.1|  PREDICTED: pleiotropic drug resistance prote...    255   1e-110   
dbj|BAJ97635.1|  predicted protein                                      249   1e-110   
gb|AGT28055.1|  pleiotropic drug resistance transporter 3               245   1e-110   
ref|XP_006416897.1|  hypothetical protein EUTSA_v10006564mg             252   1e-110   
emb|CBI36227.3|  unnamed protein product                                251   1e-110   
dbj|BAJ97406.1|  predicted protein                                      245   1e-110   
gb|EMT06883.1|  Pleiotropic drug resistance protein 4                   251   2e-110   
ref|XP_009780354.1|  PREDICTED: LOW QUALITY PROTEIN: pleiotropic ...    242   2e-110   
ref|XP_010654718.1|  PREDICTED: pleiotropic drug resistance prote...    249   2e-110   
ref|XP_010654716.1|  PREDICTED: pleiotropic drug resistance prote...    251   2e-110   
ref|XP_010033905.1|  PREDICTED: ABC transporter G family member 4...    251   2e-110   
dbj|BAJ96653.1|  predicted protein                                      249   2e-110   
ref|XP_010023518.1|  PREDICTED: pleiotropic drug resistance prote...    247   2e-110   
gb|KDP33643.1|  hypothetical protein JCGZ_07214                         252   2e-110   
ref|XP_010459091.1|  PREDICTED: ABC transporter G family member 4...    248   2e-110   
ref|XP_010023517.1|  PREDICTED: pleiotropic drug resistance prote...    247   2e-110   
gb|KCW53771.1|  hypothetical protein EUGRSUZ_J030242                    250   2e-110   
ref|XP_003625398.1|  Pleiotropic drug resistance protein                246   3e-110   
ref|XP_010497221.1|  PREDICTED: ABC transporter G family member 4...    248   3e-110   
gb|KHG05121.1|  ABC transporter G family member 40                      256   3e-110   
ref|XP_010476642.1|  PREDICTED: ABC transporter G family member 4...    248   3e-110   
ref|XP_007162609.1|  hypothetical protein PHAVU_001G165800g             250   3e-110   
ref|XP_010459089.1|  PREDICTED: ABC transporter G family member 4...    248   3e-110   
gb|AES81616.2|  drug resistance transporter-like ABC domain protein     246   3e-110   
ref|XP_002514350.1|  ATP-binding cassette transporter, putative         250   3e-110   
ref|XP_004245225.1|  PREDICTED: pleiotropic drug resistance prote...    254   5e-110   
ref|XP_004138011.1|  PREDICTED: ABC transporter G family member 3...    230   5e-110   
ref|XP_011012297.1|  PREDICTED: pleiotropic drug resistance prote...    261   5e-110   
ref|XP_010110325.1|  Pleiotropic drug resistance protein 1              237   5e-110   
gb|KEH28743.1|  drug resistance transporter-like ABC domain protein     253   6e-110   
ref|XP_010459090.1|  PREDICTED: ABC transporter G family member 4...    247   6e-110   
ref|XP_010654717.1|  PREDICTED: pleiotropic drug resistance prote...    254   6e-110   
emb|CBI36226.3|  unnamed protein product                                254   7e-110   
ref|XP_011019747.1|  PREDICTED: pleiotropic drug resistance prote...    253   7e-110   
ref|XP_004239864.1|  PREDICTED: pleiotropic drug resistance prote...    243   7e-110   
gb|KDO58233.1|  hypothetical protein CISIN_1g000541mg                   246   7e-110   
ref|XP_006465411.1|  PREDICTED: pleiotropic drug resistance prote...    246   8e-110   
gb|EMT25793.1|  hypothetical protein F775_52343                         250   9e-110   
ref|NP_001237697.1|  PDR-like ABC-transporter                           256   9e-110   
gb|EEE67291.1|  hypothetical protein OsJ_24490                          239   1e-109   
sp|Q8GU86.2|PDR5_ORYSJ  RecName: Full=Pleiotropic drug resistance...    240   1e-109   
gb|EEC82164.1|  hypothetical protein OsI_26239                          239   1e-109   
ref|XP_002527329.1|  ATP-binding cassette transporter, putative         249   1e-109   
ref|XP_010532149.1|  PREDICTED: ABC transporter G family member 4...    248   1e-109   
ref|XP_006576269.1|  PREDICTED: PDR-like ABC-transporter isoform X1     256   1e-109   
gb|KHG04772.1|  ABC transporter G family member 40                      257   1e-109   
gb|KHN09389.1|  Pleiotropic drug resistance protein 1                   256   1e-109   
ref|XP_006427145.1|  hypothetical protein CICLE_v10024697mg             245   1e-109   
emb|CAD59572.1|  PDR-like ABC transporter                               239   1e-109   
ref|XP_002991414.1|  ATP-binding cassette transporter                   253   2e-109   
ref|NP_001059813.1|  Os07g0522500                                       238   2e-109   
tpg|DAA58928.1|  TPA: hypothetical protein ZEAMMB73_427923              248   2e-109   
ref|XP_008675479.1|  PREDICTED: pleiotropic drug resistance prote...    248   2e-109   
emb|CDM83417.1|  unnamed protein product                                249   2e-109   
ref|XP_007200339.1|  hypothetical protein PRUPE_ppa000227mg             251   2e-109   
ref|XP_004138743.1|  PREDICTED: pleiotropic drug resistance prote...    246   2e-109   
ref|XP_008675480.1|  PREDICTED: pleiotropic drug resistance prote...    247   2e-109   
ref|XP_002892871.1|  ATPDR12/PDR12                                      248   3e-109   
ref|XP_010654719.1|  PREDICTED: pleiotropic drug resistance prote...    247   3e-109   
emb|CBI36213.3|  unnamed protein product                                247   4e-109   
ref|XP_008655816.1|  PREDICTED: pleiotropic drug resistance prote...    238   4e-109   
sp|Q8GU89.1|PDR4_ORYSJ  RecName: Full=Pleiotropic drug resistance...    256   4e-109   
gb|EAY74922.1|  hypothetical protein OsI_02816                          256   4e-109   
ref|XP_010934582.1|  PREDICTED: ABC transporter G family member 3...    234   5e-109   
ref|XP_004245224.1|  PREDICTED: pleiotropic drug resistance prote...    247   5e-109   
ref|NP_001043541.1|  Os01g0609900                                       256   5e-109   
gb|EAZ12650.1|  hypothetical protein OsJ_02565                          256   5e-109   
gb|KCW59811.1|  hypothetical protein EUGRSUZ_H02558                     241   5e-109   
ref|XP_010023521.1|  PREDICTED: ABC transporter G family member 4...    241   5e-109   
ref|XP_002514348.1|  ATP-binding cassette transporter, putative         243   6e-109   
ref|XP_007161247.1|  hypothetical protein PHAVU_001G054400g             251   6e-109   
dbj|BAD52527.1|  putative PDR-type ABC transporter 2                    256   6e-109   
ref|XP_006644354.1|  PREDICTED: pleiotropic drug resistance prote...    256   6e-109   
ref|XP_010023528.1|  PREDICTED: ABC transporter G family member 4...    255   6e-109   
ref|XP_002466050.1|  hypothetical protein SORBIDRAFT_01g000220          242   6e-109   
ref|XP_010023529.1|  PREDICTED: ABC transporter G family member 4...    255   6e-109   
ref|XP_010023527.1|  PREDICTED: ABC transporter G family member 4...    255   7e-109   
gb|KCW59819.1|  hypothetical protein EUGRSUZ_H02564                     255   7e-109   
gb|KEH28744.1|  drug resistance transporter-like ABC domain protein     253   8e-109   
gb|EPS69014.1|  hypothetical protein M569_05753                         243   8e-109   
ref|XP_006648597.1|  PREDICTED: pleiotropic drug resistance prote...    244   1e-108   
ref|XP_002458140.1|  hypothetical protein SORBIDRAFT_03g027520          245   1e-108   
ref|XP_010023530.1|  PREDICTED: ABC transporter G family member 4...    251   2e-108   
ref|XP_010023531.1|  PREDICTED: ABC transporter G family member 4...    251   2e-108   
ref|XP_008656641.1|  PREDICTED: pleiotropic drug resistance prote...    240   3e-108   
tpg|DAA52621.1|  TPA: hypothetical protein ZEAMMB73_590710              234   3e-108   
gb|KCW59818.1|  hypothetical protein EUGRSUZ_H02563                     251   3e-108   
gb|AFW83220.1|  hypothetical protein ZEAMMB73_049092                    240   3e-108   
ref|XP_008675093.1|  PREDICTED: pleiotropic drug resistance prote...    231   3e-108   
tpg|DAA57809.1|  TPA: hypothetical protein ZEAMMB73_345927              231   4e-108   
ref|XP_003597819.1|  Pleiotropic drug resistance protein                258   4e-108   
gb|KCW59823.1|  hypothetical protein EUGRSUZ_H02569                     255   4e-108   
ref|XP_008675094.1|  PREDICTED: pleiotropic drug resistance prote...    231   4e-108   
ref|XP_009416092.1|  PREDICTED: pleiotropic drug resistance prote...    248   4e-108   
tpg|DAA57810.1|  TPA: hypothetical protein ZEAMMB73_345927              231   5e-108   
ref|XP_010023532.1|  PREDICTED: ABC transporter G family member 4...    255   5e-108   
ref|XP_002298123.2|  ABC transporter family protein                     257   5e-108   
ref|XP_009596530.1|  PREDICTED: pleiotropic drug resistance prote...    248   5e-108   
ref|XP_009370616.1|  PREDICTED: pleiotropic drug resistance prote...    248   6e-108   
ref|XP_003597818.1|  Pleiotropic drug resistance protein                258   6e-108   
ref|XP_007023982.1|  Pleiotropic drug resistance 12                     252   7e-108   
ref|XP_002993849.1|  hypothetical protein SELMODRAFT_137645             248   7e-108   
ref|XP_002987677.1|  ATP-binding cassette transporter                   248   7e-108   
ref|XP_003545503.1|  PREDICTED: pleiotropic drug resistance prote...    248   7e-108   
gb|KGN44420.1|  ATP-binding cassette transporter                        223   7e-108   
ref|XP_006596115.1|  PREDICTED: pleiotropic drug resistance prote...    248   8e-108   
ref|XP_009799503.1|  PREDICTED: pleiotropic drug resistance prote...    248   8e-108   
ref|XP_006596116.1|  PREDICTED: pleiotropic drug resistance prote...    248   8e-108   
ref|XP_003625399.1|  Pleiotropic drug resistance protein                243   8e-108   
gb|KHN12917.1|  Pleiotropic drug resistance protein 1                   248   8e-108   
ref|XP_006596117.1|  PREDICTED: pleiotropic drug resistance prote...    248   9e-108   
ref|XP_006596118.1|  PREDICTED: pleiotropic drug resistance prote...    248   9e-108   
ref|XP_003569329.1|  PREDICTED: pleiotropic drug resistance prote...    255   9e-108   
ref|XP_008235577.1|  PREDICTED: pleiotropic drug resistance prote...    243   9e-108   
gb|KDP36996.1|  hypothetical protein JCGZ_06052                         252   9e-108   
dbj|BAB92011.1|  pleiotropic drug resistance like protein               248   9e-108   
dbj|BAD07484.1|  PDR-type ABC transporter 2                             248   1e-107   
ref|XP_006369160.1|  hypothetical protein POPTR_0001s17570g             256   1e-107   
gb|AES81617.2|  drug resistance transporter-like ABC domain protein     243   1e-107   
ref|XP_009401798.1|  PREDICTED: pleiotropic drug resistance prote...    262   1e-107   
ref|XP_006658621.1|  PREDICTED: pleiotropic drug resistance prote...    233   1e-107   
ref|XP_009401806.1|  PREDICTED: pleiotropic drug resistance prote...    262   1e-107   
ref|XP_009401814.1|  PREDICTED: pleiotropic drug resistance prote...    262   1e-107   
ref|XP_008663062.1|  PREDICTED: pleiotropic drug resistance prote...    238   1e-107   
ref|XP_006476214.1|  PREDICTED: pleiotropic drug resistance prote...    256   1e-107   
ref|XP_006476213.1|  PREDICTED: pleiotropic drug resistance prote...    256   1e-107   
gb|AES81618.2|  drug resistance transporter-like ABC domain protein     243   2e-107   
ref|XP_006476215.1|  PREDICTED: pleiotropic drug resistance prote...    256   2e-107   
ref|XP_006450535.1|  hypothetical protein CICLE_v10010431mg             256   2e-107   
ref|XP_008663061.1|  PREDICTED: pleiotropic drug resistance prote...    238   2e-107   
ref|XP_006476216.1|  PREDICTED: pleiotropic drug resistance prote...    256   2e-107   
ref|XP_002977481.1|  hypothetical protein SELMODRAFT_443490             238   2e-107   
ref|XP_006601131.1|  PREDICTED: putative pleiotropic drug resista...    250   2e-107   
gb|KDO79586.1|  hypothetical protein CISIN_1g046196mg                   256   2e-107   
ref|XP_007162610.1|  hypothetical protein PHAVU_001G1659001g            244   2e-107   
ref|XP_006658622.1|  PREDICTED: pleiotropic drug resistance prote...    233   2e-107   
ref|XP_002527332.1|  ATP-binding cassette transporter, putative         248   2e-107   
ref|XP_009415904.1|  PREDICTED: pleiotropic drug resistance prote...    249   2e-107   
ref|XP_002512728.1|  ATP-binding cassette transporter, putative         263   2e-107   
ref|XP_009415905.1|  PREDICTED: pleiotropic drug resistance prote...    249   2e-107   
gb|EMS67829.1|  Pleiotropic drug resistance protein 4                   241   2e-107   
ref|XP_007013791.1|  Pleiotropic drug resistance 12                     251   2e-107   
ref|XP_004486707.1|  PREDICTED: pleiotropic drug resistance prote...    253   3e-107   
ref|XP_004289998.1|  PREDICTED: pleiotropic drug resistance prote...    250   3e-107   
gb|EYU21929.1|  hypothetical protein MIMGU_mgv1a023987mg                247   3e-107   
ref|XP_008360420.1|  PREDICTED: pleiotropic drug resistance prote...    299   3e-107   
ref|XP_008775868.1|  PREDICTED: pleiotropic drug resistance prote...    243   3e-107   
gb|EYU29215.1|  hypothetical protein MIMGU_mgv1a018488mg                248   3e-107   
ref|XP_008775867.1|  PREDICTED: pleiotropic drug resistance prote...    243   3e-107   
ref|XP_008775866.1|  PREDICTED: pleiotropic drug resistance prote...    243   3e-107   
ref|XP_010254261.1|  PREDICTED: pleiotropic drug resistance prote...    245   3e-107   
ref|XP_004506879.1|  PREDICTED: pleiotropic drug resistance prote...    253   4e-107   
gb|KHN45207.1|  Pleiotropic drug resistance protein 1                   250   4e-107   
ref|XP_010254262.1|  PREDICTED: pleiotropic drug resistance prote...    244   4e-107   
ref|XP_004239866.1|  PREDICTED: pleiotropic drug resistance prote...    243   4e-107   
ref|XP_004957881.1|  PREDICTED: pleiotropic drug resistance prote...    240   5e-107   
ref|NP_001043539.1|  Os01g0609300                                       257   6e-107   
sp|A2WSH0.1|PDR3_ORYSI  RecName: Full=Pleiotropic drug resistance...    257   6e-107   
ref|XP_002527331.1|  ATP-binding cassette transporter, putative         245   7e-107   
dbj|BAD52520.1|  putative ABC1 protein                                  256   7e-107   
gb|EAZ12646.1|  hypothetical protein OsJ_02561                          256   7e-107   
gb|KDP37162.1|  hypothetical protein JCGZ_06218                         239   8e-107   
ref|XP_006644353.1|  PREDICTED: probable pleiotropic drug resista...    255   8e-107   
ref|XP_008346192.1|  PREDICTED: pleiotropic drug resistance prote...    243   8e-107   
ref|XP_011082498.1|  PREDICTED: pleiotropic drug resistance prote...    246   9e-107   
ref|XP_008228659.1|  PREDICTED: pleiotropic drug resistance prote...    238   9e-107   
ref|XP_007162608.1|  hypothetical protein PHAVU_001G165700g             248   1e-106   
ref|XP_006646084.1|  PREDICTED: pleiotropic drug resistance prote...    254   1e-106   
gb|KDO58223.1|  hypothetical protein CISIN_1g000524mg                   241   1e-106   
gb|KDO58222.1|  hypothetical protein CISIN_1g000524mg                   241   1e-106   
ref|XP_008228658.1|  PREDICTED: pleiotropic drug resistance prote...    238   1e-106   
ref|XP_006427136.1|  hypothetical protein CICLE_v10024709mg             241   1e-106   
ref|XP_008775871.1|  PREDICTED: pleiotropic drug resistance prote...    248   1e-106   
ref|XP_004986111.1|  PREDICTED: pleiotropic drug resistance prote...    236   1e-106   



>ref|XP_007027659.1| Pleiotropic drug resistance 11 isoform 1 [Theobroma cacao]
 gb|EOY08161.1| Pleiotropic drug resistance 11 isoform 1 [Theobroma cacao]
Length=1460

 Score =   294 bits (752),  Expect(2) = 2e-154, Method: Compositional matrix adjust.
 Identities = 130/181 (72%), Positives = 158/181 (87%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              +AV GV KI++G+NPATWMLE+S   +EAQ  VDFA+IYANS L++RNQELIKELS P 
Sbjct  1107  FEAVQGVQKIRDGHNPATWMLEVSAPPVEAQLNVDFADIYANSSLYRRNQELIKELSAPA  1166

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             PGS+DL+FPTKYSQ F+ QCKACFWKQHWSYWRNPQYNA+RFF+TI +G++FG+IFW KG
Sbjct  1167  PGSKDLFFPTKYSQPFLTQCKACFWKQHWSYWRNPQYNAIRFFLTIFIGILFGLIFWNKG  1226

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
             ++   QQDL+NLLGA+Y+AV+FLG+ N S+VQ+ VA+ERTVFYRERAAGMYS LPYA AQ
Sbjct  1227  EQTTKQQDLMNLLGAMYSAVLFLGATNASAVQSVVAIERTVFYRERAAGMYSELPYAFAQ  1286

Query  624   V  626
             V
Sbjct  1287  V  1287


 Score =   281 bits (719),  Expect(2) = 2e-154, Method: Compositional matrix adjust.
 Identities = 126/175 (72%), Positives = 151/175 (86%), Gaps = 0/175 (0%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  IE IY A+QTI Y+LLLY MIGFEWK+GKFLWFYY++ T F+YFTLYGMM+VALTPG
Sbjct  1286  QVAIETIYTAIQTIIYTLLLYSMIGFEWKVGKFLWFYYYILTCFVYFTLYGMMVVALTPG  1345

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
              Q AAI M+F L+FWNLF+GF++PR Q+PVWWRWYYWASP  W+LYGL+TSQ+GDK + V
Sbjct  1346  HQIAAIVMSFFLSFWNLFSGFLIPRTQIPVWWRWYYWASPVAWTLYGLVTSQVGDKNALV  1405

Query  1046  QVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
             +VPG+GD+++K FLK   G++Y FLPAVAAAH+GW LLFFFVFAYGI FLNFQRR
Sbjct  1406  EVPGQGDISVKDFLKGTLGFEYDFLPAVAAAHIGWCLLFFFVFAYGIKFLNFQRR  1460



>ref|XP_010658730.1| PREDICTED: pleiotropic drug resistance protein 2-like [Vitis 
vinifera]
Length=1479

 Score =   314 bits (805),  Expect(2) = 4e-154, Method: Compositional matrix adjust.
 Identities = 140/181 (77%), Positives = 163/181 (90%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              +AVPGVPK+++G NPATWMLEIS+A +EAQ GVDFAEIYA S L+QRNQELIKELSTP 
Sbjct  1126  FEAVPGVPKVRDGQNPATWMLEISSAAVEAQLGVDFAEIYAKSELYQRNQELIKELSTPS  1185

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             PGS+DLYFPTKYSQSF+ QCKACFWKQHWSYWRNP YNA+RFF+TI++GV+FGVIFW KG
Sbjct  1186  PGSKDLYFPTKYSQSFISQCKACFWKQHWSYWRNPPYNAIRFFLTIIIGVLFGVIFWNKG  1245

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
             ++   +QDL+NLLGA+++AV FLG+ NTSSVQ  VA+ERTVFYRERAAGMYSALPYA AQ
Sbjct  1246  EKTDKEQDLINLLGAMFSAVFFLGATNTSSVQPVVAIERTVFYRERAAGMYSALPYAFAQ  1305

Query  624   V  626
             V
Sbjct  1306  V  1306


 Score =   260 bits (664),  Expect(2) = 4e-154, Method: Compositional matrix adjust.
 Identities = 119/175 (68%), Positives = 144/175 (82%), Gaps = 0/175 (0%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  IEAIYVA+QT+ YSLLLY M+GF W++ KFLWFYY++   FIYFTLYGMM+VALTP 
Sbjct  1305  QVAIEAIYVAIQTLVYSLLLYSMMGFYWRVDKFLWFYYYLLMCFIYFTLYGMMIVALTPN  1364

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
              Q AAI M+F L+FWNLFAGF++PR Q+P+WWRWYYWASP  W++YGL+TSQ+GDKE  V
Sbjct  1365  HQIAAIVMSFFLSFWNLFAGFLIPRMQIPIWWRWYYWASPVSWTIYGLVTSQVGDKEDPV  1424

Query  1046  QVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
             QVPG G  ++K +LK+  G++Y FL AVA AH+GW LLF FVFAYGI FLNFQRR
Sbjct  1425  QVPGAGVKSVKLYLKEALGFEYDFLGAVALAHIGWVLLFLFVFAYGIKFLNFQRR  1479



>ref|XP_010049726.1| PREDICTED: pleiotropic drug resistance protein 2-like [Eucalyptus 
grandis]
 gb|KCW89229.1| hypothetical protein EUGRSUZ_A01530 [Eucalyptus grandis]
Length=1459

 Score =   297 bits (761),  Expect(2) = 5e-154, Method: Compositional matrix adjust.
 Identities = 131/181 (72%), Positives = 159/181 (88%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              +AVPGVPKI++G+NPATWMLE+S   +EAQ  VDFA+IY NS L++RNQ+LIKELSTP 
Sbjct  1106  FEAVPGVPKIRDGHNPATWMLEVSAPAVEAQLEVDFADIYPNSDLYKRNQDLIKELSTPA  1165

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             PGS+DL+FPT+YSQ F+ QCKACFWKQHWSYWRNPQYNA+RFF+TIV+ ++FG+IFW KG
Sbjct  1166  PGSKDLHFPTEYSQPFLTQCKACFWKQHWSYWRNPQYNAIRFFMTIVIAILFGLIFWDKG  1225

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
              +   QQDL+NLLGA+YAAV+FLG+ N S+VQ+ VA+ERTVFYRERAAGMYS LPYA AQ
Sbjct  1226  QQTTKQQDLMNLLGAMYAAVLFLGATNASAVQSIVAIERTVFYRERAAGMYSPLPYAFAQ  1285

Query  624   V  626
             V
Sbjct  1286  V  1286


 Score =   276 bits (707),  Expect(2) = 5e-154, Method: Compositional matrix adjust.
 Identities = 125/175 (71%), Positives = 148/175 (85%), Gaps = 0/175 (0%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  IE IYVA+QT+ YSLLLY MIGFEWK+GKFLWFYY++   FIYFT+YGMM+VALTPG
Sbjct  1285  QVAIETIYVAIQTLVYSLLLYSMIGFEWKVGKFLWFYYYILMCFIYFTMYGMMVVALTPG  1344

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
              Q AAI M+F L+FWNLF+GF++PR Q+PVWWRWYYWASP  W+LYGL+TSQ+GDK   +
Sbjct  1345  HQIAAIVMSFFLSFWNLFSGFLIPRPQIPVWWRWYYWASPVAWTLYGLVTSQVGDKNGNL  1404

Query  1046  QVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
             ++PG G+M +KQFLK   G+DY FLPAVA AH+GW LLFFFVFAYGI FLNFQRR
Sbjct  1405  EIPGAGNMPLKQFLKVELGFDYSFLPAVAVAHIGWVLLFFFVFAYGIKFLNFQRR  1459



>emb|CBI40238.3| unnamed protein product [Vitis vinifera]
Length=1450

 Score =   314 bits (804),  Expect(2) = 8e-154, Method: Compositional matrix adjust.
 Identities = 140/181 (77%), Positives = 163/181 (90%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              +AVPGVPK+++G NPATWMLEIS+A +EAQ GVDFAEIYA S L+QRNQELIKELSTP 
Sbjct  1097  FEAVPGVPKVRDGQNPATWMLEISSAAVEAQLGVDFAEIYAKSELYQRNQELIKELSTPS  1156

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             PGS+DLYFPTKYSQSF+ QCKACFWKQHWSYWRNP YNA+RFF+TI++GV+FGVIFW KG
Sbjct  1157  PGSKDLYFPTKYSQSFISQCKACFWKQHWSYWRNPPYNAIRFFLTIIIGVLFGVIFWNKG  1216

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
             ++   +QDL+NLLGA+++AV FLG+ NTSSVQ  VA+ERTVFYRERAAGMYSALPYA AQ
Sbjct  1217  EKTDKEQDLINLLGAMFSAVFFLGATNTSSVQPVVAIERTVFYRERAAGMYSALPYAFAQ  1276

Query  624   V  626
             V
Sbjct  1277  V  1277


 Score =   259 bits (662),  Expect(2) = 8e-154, Method: Compositional matrix adjust.
 Identities = 119/175 (68%), Positives = 144/175 (82%), Gaps = 0/175 (0%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  IEAIYVA+QT+ YSLLLY M+GF W++ KFLWFYY++   FIYFTLYGMM+VALTP 
Sbjct  1276  QVAIEAIYVAIQTLVYSLLLYSMMGFYWRVDKFLWFYYYLLMCFIYFTLYGMMIVALTPN  1335

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
              Q AAI M+F L+FWNLFAGF++PR Q+P+WWRWYYWASP  W++YGL+TSQ+GDKE  V
Sbjct  1336  HQIAAIVMSFFLSFWNLFAGFLIPRMQIPIWWRWYYWASPVSWTIYGLVTSQVGDKEDPV  1395

Query  1046  QVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
             QVPG G  ++K +LK+  G++Y FL AVA AH+GW LLF FVFAYGI FLNFQRR
Sbjct  1396  QVPGAGVKSVKLYLKEALGFEYDFLGAVALAHIGWVLLFLFVFAYGIKFLNFQRR  1450



>ref|XP_002534113.1| ATP-binding cassette transporter, putative [Ricinus communis]
 gb|EEF28273.1| ATP-binding cassette transporter, putative [Ricinus communis]
Length=1437

 Score =   310 bits (793),  Expect(2) = 9e-153, Method: Compositional matrix adjust.
 Identities = 138/181 (76%), Positives = 159/181 (88%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              +A+PGVPKIK+GYNPATWML+IST+ +E Q  VDFAEIY NS L+QRNQELIKELS PP
Sbjct  1084  FEAIPGVPKIKDGYNPATWMLDISTSSMETQLNVDFAEIYVNSSLYQRNQELIKELSIPP  1143

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
              GS+DLY PTKYSQSF+ QCKACFWK HWSYWRNPQYNA+RFF+T+++G +FG+IFW KG
Sbjct  1144  SGSKDLYLPTKYSQSFLVQCKACFWKHHWSYWRNPQYNAIRFFLTVIIGTLFGLIFWNKG  1203

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
              +I  QQDL+NLLGAIY+AV FLG+ NTSSVQ  VA+ERTVFYRERAAGMYSALPYA AQ
Sbjct  1204  QKIGKQQDLMNLLGAIYSAVFFLGACNTSSVQPVVAIERTVFYRERAAGMYSALPYAFAQ  1263

Query  624   V  626
             V
Sbjct  1264  V  1264


 Score =   260 bits (664),  Expect(2) = 9e-153, Method: Compositional matrix adjust.
 Identities = 113/175 (65%), Positives = 145/175 (83%), Gaps = 0/175 (0%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  IE IY+A+QT+ Y+L+L+ MIGFEWK+GKFLWF+YF+F SF+YFTLYGMM+VALTP 
Sbjct  1263  QVAIEVIYIAIQTVVYTLILFSMIGFEWKVGKFLWFFYFLFMSFVYFTLYGMMVVALTPN  1322

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
              Q AAI M+F ++ WN+F GFI+PR  +P+WWRWYYWASP  W+ YGL+TSQ+GDK + V
Sbjct  1323  HQIAAIVMSFFISLWNMFTGFIIPRMLIPIWWRWYYWASPVAWTTYGLVTSQVGDKNALV  1382

Query  1046  QVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
             ++PG G+M +K FLK+  GYDY FLPAVAAAH+GW ++FF VFAYGI + NFQ+R
Sbjct  1383  EIPGAGNMPVKVFLKETLGYDYDFLPAVAAAHLGWIIIFFLVFAYGIKYFNFQKR  1437



>ref|XP_004303014.1| PREDICTED: pleiotropic drug resistance protein 2-like isoform 
1 [Fragaria vesca subsp. vesca]
Length=1460

 Score =   297 bits (760),  Expect(2) = 4e-151, Method: Compositional matrix adjust.
 Identities = 133/181 (73%), Positives = 156/181 (86%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              +A+PGV KI++GYNPATWMLE++   +E Q  VDFA+IYANS L+QRNQELIKELSTP 
Sbjct  1107  FEAIPGVTKIRDGYNPATWMLEVTAPSVETQLDVDFADIYANSSLYQRNQELIKELSTPV  1166

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             PGS+DLYFPTKYSQ F  QCKACFWK HWSYWRNPQYNA+RFF+TIV+G +FG+IFW KG
Sbjct  1167  PGSKDLYFPTKYSQPFSVQCKACFWKMHWSYWRNPQYNAIRFFMTIVIGGLFGLIFWNKG  1226

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
              +   QQDL+NLLGA+YAAV+FLG+ N S+VQ+ VA+ERTVFYRERAAGMYS LPYA AQ
Sbjct  1227  QQTTQQQDLMNLLGAMYAAVLFLGATNASAVQSVVAIERTVFYRERAAGMYSELPYAFAQ  1286

Query  624   V  626
             V
Sbjct  1287  V  1287


 Score =   267 bits (682),  Expect(2) = 4e-151, Method: Compositional matrix adjust.
 Identities = 121/175 (69%), Positives = 146/175 (83%), Gaps = 0/175 (0%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  IE IYVA+QTI Y+++LY MIGFEWK+ KFLWFYY++   FIYFT+YGMM+VALTPG
Sbjct  1286  QVAIETIYVAIQTIIYTMILYSMIGFEWKIAKFLWFYYYILLCFIYFTMYGMMVVALTPG  1345

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
              Q AAI M+F L+FWNLF+GF++PR Q+P+WWRWYYWASP  W+LYGL+TSQ+GDK + +
Sbjct  1346  HQIAAIVMSFFLSFWNLFSGFLIPRPQIPIWWRWYYWASPVAWTLYGLVTSQVGDKNADL  1405

Query  1046  QVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
              +PG G   +K FLKD  G+DY FLPAVAAAHVGW LLFFFVFAYGI +LNFQRR
Sbjct  1406  VLPGYGTTPLKSFLKDQLGFDYDFLPAVAAAHVGWVLLFFFVFAYGIKYLNFQRR  1460



>ref|XP_004303015.1| PREDICTED: pleiotropic drug resistance protein 2-like isoform 
2 [Fragaria vesca subsp. vesca]
Length=1449

 Score =   297 bits (760),  Expect(2) = 5e-151, Method: Compositional matrix adjust.
 Identities = 133/181 (73%), Positives = 156/181 (86%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              +A+PGV KI++GYNPATWMLE++   +E Q  VDFA+IYANS L+QRNQELIKELSTP 
Sbjct  1096  FEAIPGVTKIRDGYNPATWMLEVTAPSVETQLDVDFADIYANSSLYQRNQELIKELSTPV  1155

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             PGS+DLYFPTKYSQ F  QCKACFWK HWSYWRNPQYNA+RFF+TIV+G +FG+IFW KG
Sbjct  1156  PGSKDLYFPTKYSQPFSVQCKACFWKMHWSYWRNPQYNAIRFFMTIVIGGLFGLIFWNKG  1215

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
              +   QQDL+NLLGA+YAAV+FLG+ N S+VQ+ VA+ERTVFYRERAAGMYS LPYA AQ
Sbjct  1216  QQTTQQQDLMNLLGAMYAAVLFLGATNASAVQSVVAIERTVFYRERAAGMYSELPYAFAQ  1275

Query  624   V  626
             V
Sbjct  1276  V  1276


 Score =   267 bits (682),  Expect(2) = 5e-151, Method: Compositional matrix adjust.
 Identities = 121/175 (69%), Positives = 146/175 (83%), Gaps = 0/175 (0%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  IE IYVA+QTI Y+++LY MIGFEWK+ KFLWFYY++   FIYFT+YGMM+VALTPG
Sbjct  1275  QVAIETIYVAIQTIIYTMILYSMIGFEWKIAKFLWFYYYILLCFIYFTMYGMMVVALTPG  1334

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
              Q AAI M+F L+FWNLF+GF++PR Q+P+WWRWYYWASP  W+LYGL+TSQ+GDK + +
Sbjct  1335  HQIAAIVMSFFLSFWNLFSGFLIPRPQIPIWWRWYYWASPVAWTLYGLVTSQVGDKNADL  1394

Query  1046  QVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
              +PG G   +K FLKD  G+DY FLPAVAAAHVGW LLFFFVFAYGI +LNFQRR
Sbjct  1395  VLPGYGTTPLKSFLKDQLGFDYDFLPAVAAAHVGWVLLFFFVFAYGIKYLNFQRR  1449



>ref|XP_010067156.1| PREDICTED: pleiotropic drug resistance protein 2-like [Eucalyptus 
grandis]
Length=1465

 Score =   307 bits (787),  Expect(2) = 2e-150, Method: Compositional matrix adjust.
 Identities = 139/181 (77%), Positives = 162/181 (90%), Gaps = 1/181 (1%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              +A+PGVP+IKNGYNPATWML++S+   EAQ GVDFAEIYANS L++ NQ+LIK+LSTP 
Sbjct  1113  FEAIPGVPRIKNGYNPATWMLDVSSTAAEAQLGVDFAEIYANSELYKNNQQLIKQLSTPE  1172

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             PGS DLYFPTKYSQ+FV QCKACFWKQHWSYWRNPQY A+R+F+T V+GVMFG+IFW KG
Sbjct  1173  PGSTDLYFPTKYSQTFVTQCKACFWKQHWSYWRNPQY-AIRYFMTTVVGVMFGLIFWNKG  1231

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
              +IH +QDLLNLLGA+Y+AV+FLG+ NTSSVQ  VA+ERTVFYRERAAGMYSALPYA AQ
Sbjct  1232  GQIHKEQDLLNLLGAMYSAVLFLGATNTSSVQPVVAIERTVFYRERAAGMYSALPYAFAQ  1291

Query  624   V  626
             V
Sbjct  1292  V  1292


 Score =   254 bits (649),  Expect(2) = 2e-150, Method: Compositional matrix adjust.
 Identities = 118/175 (67%), Positives = 141/175 (81%), Gaps = 0/175 (0%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  IEAIYVA+QT+ YSLLLY MIGF W++ KFLWFYY++   FIYFTLYGMM VALTP 
Sbjct  1291  QVAIEAIYVAIQTLVYSLLLYSMIGFHWRVDKFLWFYYYILMCFIYFTLYGMMTVALTPS  1350

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
              Q AAI M+F L+FWNLF+GF++PR  +PVWWRWYYWASP  W++YGL+TSQ+GDKE+ V
Sbjct  1351  HQIAAIVMSFFLSFWNLFSGFLIPRMLIPVWWRWYYWASPVAWTIYGLVTSQIGDKENEV  1410

Query  1046  QVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
              VP EG + +K +LK   G+DY FL  VA AH+GW LLFFFVFAYGI +LNFQRR
Sbjct  1411  FVPEEGFIKVKDYLKQKKGFDYDFLGVVAVAHIGWVLLFFFVFAYGIRYLNFQRR  1465



>gb|KCW65223.1| hypothetical protein EUGRSUZ_G02707 [Eucalyptus grandis]
Length=1488

 Score =   307 bits (786),  Expect(2) = 3e-150, Method: Compositional matrix adjust.
 Identities = 139/181 (77%), Positives = 162/181 (90%), Gaps = 1/181 (1%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              +A+PGVP+IKNGYNPATWML++S+   EAQ GVDFAEIYANS L++ NQ+LIK+LSTP 
Sbjct  1136  FEAIPGVPRIKNGYNPATWMLDVSSTAAEAQLGVDFAEIYANSELYKNNQQLIKQLSTPE  1195

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             PGS DLYFPTKYSQ+FV QCKACFWKQHWSYWRNPQY A+R+F+T V+GVMFG+IFW KG
Sbjct  1196  PGSTDLYFPTKYSQTFVTQCKACFWKQHWSYWRNPQY-AIRYFMTTVVGVMFGLIFWNKG  1254

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
              +IH +QDLLNLLGA+Y+AV+FLG+ NTSSVQ  VA+ERTVFYRERAAGMYSALPYA AQ
Sbjct  1255  GQIHKEQDLLNLLGAMYSAVLFLGATNTSSVQPVVAIERTVFYRERAAGMYSALPYAFAQ  1314

Query  624   V  626
             V
Sbjct  1315  V  1315


 Score =   254 bits (649),  Expect(2) = 3e-150, Method: Compositional matrix adjust.
 Identities = 118/175 (67%), Positives = 141/175 (81%), Gaps = 0/175 (0%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  IEAIYVA+QT+ YSLLLY MIGF W++ KFLWFYY++   FIYFTLYGMM VALTP 
Sbjct  1314  QVAIEAIYVAIQTLVYSLLLYSMIGFHWRVDKFLWFYYYILMCFIYFTLYGMMTVALTPS  1373

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
              Q AAI M+F L+FWNLF+GF++PR  +PVWWRWYYWASP  W++YGL+TSQ+GDKE+ V
Sbjct  1374  HQIAAIVMSFFLSFWNLFSGFLIPRMLIPVWWRWYYWASPVAWTIYGLVTSQIGDKENEV  1433

Query  1046  QVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
              VP EG + +K +LK   G+DY FL  VA AH+GW LLFFFVFAYGI +LNFQRR
Sbjct  1434  FVPEEGFIKVKDYLKQKKGFDYDFLGVVAVAHIGWVLLFFFVFAYGIRYLNFQRR  1488



>ref|XP_010036716.1| PREDICTED: pleiotropic drug resistance protein 2-like isoform 
X1 [Eucalyptus grandis]
Length=1458

 Score =   311 bits (798),  Expect(2) = 4e-150, Method: Compositional matrix adjust.
 Identities = 141/180 (78%), Positives = 160/180 (89%), Gaps = 0/180 (0%)
 Frame = +3

Query  87    QAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPPP  266
             QAVPGVPKI++GYNPATWMLEI+   IE Q GVDFAEIYANS L+QRNQELIKEL TP P
Sbjct  1106  QAVPGVPKIRDGYNPATWMLEITAPQIEVQLGVDFAEIYANSSLYQRNQELIKELRTPVP  1165

Query  267   GSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKGD  446
             GS+DLYFPTKYSQSF+ QCKACFWKQHWSYWRNPQYNA+RFF+TIV+G +FG+IFW KG 
Sbjct  1166  GSKDLYFPTKYSQSFLTQCKACFWKQHWSYWRNPQYNAIRFFMTIVIGALFGLIFWNKGQ  1225

Query  447   EIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQV  626
             +   QQDL+NLLGA+YAAV+FLG+ N S+VQ+ VA+ERTVFYRERAAGMYS LPYA AQV
Sbjct  1226  QTTQQQDLMNLLGAMYAAVLFLGATNASAVQSVVAIERTVFYRERAAGMYSELPYAFAQV  1285


 Score =   249 bits (636),  Expect(2) = 4e-150, Method: Compositional matrix adjust.
 Identities = 119/175 (68%), Positives = 145/175 (83%), Gaps = 0/175 (0%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  IE IYVA+QTI Y+LLLY MIGF+W  GKFLWFYY++   F+YFT+YGMM+VALTPG
Sbjct  1284  QVAIETIYVAIQTIVYTLLLYSMIGFKWTAGKFLWFYYYILMCFVYFTMYGMMVVALTPG  1343

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
              Q AAI M+F L+FWNLF+GF++PR Q+PVWWRWYYWASP  W++YGL+TSQ+GDK+S++
Sbjct  1344  HQIAAIVMSFFLSFWNLFSGFLIPRPQIPVWWRWYYWASPVAWTIYGLVTSQVGDKDSQL  1403

Query  1046  QVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
              +PG  D+ +K FLK+  G+DY FLP VA AHV W LLFFFVFAYGI FLNFQRR
Sbjct  1404  VIPGAEDVALKAFLKEELGFDYNFLPVVAVAHVVWVLLFFFVFAYGIKFLNFQRR  1458



>gb|KCW48349.1| hypothetical protein EUGRSUZ_K02065 [Eucalyptus grandis]
Length=1384

 Score =   311 bits (798),  Expect(2) = 4e-150, Method: Compositional matrix adjust.
 Identities = 141/180 (78%), Positives = 160/180 (89%), Gaps = 0/180 (0%)
 Frame = +3

Query  87    QAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPPP  266
             QAVPGVPKI++GYNPATWMLEI+   IE Q GVDFAEIYANS L+QRNQELIKEL TP P
Sbjct  1032  QAVPGVPKIRDGYNPATWMLEITAPQIEVQLGVDFAEIYANSSLYQRNQELIKELRTPVP  1091

Query  267   GSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKGD  446
             GS+DLYFPTKYSQSF+ QCKACFWKQHWSYWRNPQYNA+RFF+TIV+G +FG+IFW KG 
Sbjct  1092  GSKDLYFPTKYSQSFLTQCKACFWKQHWSYWRNPQYNAIRFFMTIVIGALFGLIFWNKGQ  1151

Query  447   EIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQV  626
             +   QQDL+NLLGA+YAAV+FLG+ N S+VQ+ VA+ERTVFYRERAAGMYS LPYA AQV
Sbjct  1152  QTTQQQDLMNLLGAMYAAVLFLGATNASAVQSVVAIERTVFYRERAAGMYSELPYAFAQV  1211


 Score =   249 bits (636),  Expect(2) = 4e-150, Method: Compositional matrix adjust.
 Identities = 119/175 (68%), Positives = 145/175 (83%), Gaps = 0/175 (0%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  IE IYVA+QTI Y+LLLY MIGF+W  GKFLWFYY++   F+YFT+YGMM+VALTPG
Sbjct  1210  QVAIETIYVAIQTIVYTLLLYSMIGFKWTAGKFLWFYYYILMCFVYFTMYGMMVVALTPG  1269

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
              Q AAI M+F L+FWNLF+GF++PR Q+PVWWRWYYWASP  W++YGL+TSQ+GDK+S++
Sbjct  1270  HQIAAIVMSFFLSFWNLFSGFLIPRPQIPVWWRWYYWASPVAWTIYGLVTSQVGDKDSQL  1329

Query  1046  QVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
              +PG  D+ +K FLK+  G+DY FLP VA AHV W LLFFFVFAYGI FLNFQRR
Sbjct  1330  VIPGAEDVALKAFLKEELGFDYNFLPVVAVAHVVWVLLFFFVFAYGIKFLNFQRR  1384



>ref|XP_010242632.1| PREDICTED: pleiotropic drug resistance protein 2-like [Nelumbo 
nucifera]
Length=1453

 Score =   316 bits (809),  Expect(2) = 6e-150, Method: Compositional matrix adjust.
 Identities = 142/181 (78%), Positives = 162/181 (90%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              +AVPGVPKIK+GYNPATWMLE++T   EAQ  VDFAE+YANS L+QRNQELIKELSTP 
Sbjct  1100  FEAVPGVPKIKDGYNPATWMLEVTTTSFEAQLNVDFAEVYANSALYQRNQELIKELSTPA  1159

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             PGS+DL+FPTKYSQ+F  QCKACFWKQ+WSYWRNPQYNA+RFF+TIV+GVMFGVIFW KG
Sbjct  1160  PGSKDLHFPTKYSQTFATQCKACFWKQYWSYWRNPQYNAIRFFMTIVIGVMFGVIFWNKG  1219

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
             D+   QQDLLNLLGA+YAAV+FLG+ N S+VQ+ VA+ERTVFYRERAAGMYS LPYA AQ
Sbjct  1220  DKTDKQQDLLNLLGAMYAAVLFLGATNASAVQSVVAIERTVFYRERAAGMYSELPYAFAQ  1279

Query  624   V  626
             V
Sbjct  1280  V  1280


 Score =   244 bits (623),  Expect(2) = 6e-150, Method: Compositional matrix adjust.
 Identities = 118/175 (67%), Positives = 144/175 (82%), Gaps = 0/175 (0%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  +E IYVA+QT  YSLLLY MIGF+W L KFL FYYF+   FIYF +YGMM+VALTPG
Sbjct  1279  QVAVETIYVAIQTFIYSLLLYSMIGFQWHLDKFLLFYYFILMCFIYFAMYGMMVVALTPG  1338

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
              Q AAI M+F L+FWNLF+GF++PR Q+P+WWRWYYWASP  W+LYGL+ SQ+GDK+SR+
Sbjct  1339  HQIAAIVMSFFLSFWNLFSGFLIPRPQIPIWWRWYYWASPIAWTLYGLVVSQVGDKDSRI  1398

Query  1046  QVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
             +VPGEG  T+K FLK + G+++ FL AV AAH+G+ LLFFFVFAYGI FLNFQRR
Sbjct  1399  EVPGEGFTTVKAFLKSYLGFEHDFLGAVVAAHIGFVLLFFFVFAYGIKFLNFQRR  1453



>ref|XP_010036718.1| PREDICTED: pleiotropic drug resistance protein 2-like isoform 
X3 [Eucalyptus grandis]
Length=1260

 Score =   311 bits (797),  Expect(2) = 8e-150, Method: Compositional matrix adjust.
 Identities = 141/180 (78%), Positives = 160/180 (89%), Gaps = 0/180 (0%)
 Frame = +3

Query  87    QAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPPP  266
             QAVPGVPKI++GYNPATWMLEI+   IE Q GVDFAEIYANS L+QRNQELIKEL TP P
Sbjct  908   QAVPGVPKIRDGYNPATWMLEITAPQIEVQLGVDFAEIYANSSLYQRNQELIKELRTPVP  967

Query  267   GSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKGD  446
             GS+DLYFPTKYSQSF+ QCKACFWKQHWSYWRNPQYNA+RFF+TIV+G +FG+IFW KG 
Sbjct  968   GSKDLYFPTKYSQSFLTQCKACFWKQHWSYWRNPQYNAIRFFMTIVIGALFGLIFWNKGQ  1027

Query  447   EIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQV  626
             +   QQDL+NLLGA+YAAV+FLG+ N S+VQ+ VA+ERTVFYRERAAGMYS LPYA AQV
Sbjct  1028  QTTQQQDLMNLLGAMYAAVLFLGATNASAVQSVVAIERTVFYRERAAGMYSELPYAFAQV  1087


 Score =   249 bits (635),  Expect(2) = 8e-150, Method: Compositional matrix adjust.
 Identities = 119/175 (68%), Positives = 145/175 (83%), Gaps = 0/175 (0%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  IE IYVA+QTI Y+LLLY MIGF+W  GKFLWFYY++   F+YFT+YGMM+VALTPG
Sbjct  1086  QVAIETIYVAIQTIVYTLLLYSMIGFKWTAGKFLWFYYYILMCFVYFTMYGMMVVALTPG  1145

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
              Q AAI M+F L+FWNLF+GF++PR Q+PVWWRWYYWASP  W++YGL+TSQ+GDK+S++
Sbjct  1146  HQIAAIVMSFFLSFWNLFSGFLIPRPQIPVWWRWYYWASPVAWTIYGLVTSQVGDKDSQL  1205

Query  1046  QVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
              +PG  D+ +K FLK+  G+DY FLP VA AHV W LLFFFVFAYGI FLNFQRR
Sbjct  1206  VIPGAEDVALKAFLKEELGFDYNFLPVVAVAHVVWVLLFFFVFAYGIKFLNFQRR  1260



>ref|XP_010036717.1| PREDICTED: pleiotropic drug resistance protein 2-like isoform 
X2 [Eucalyptus grandis]
Length=1457

 Score =   310 bits (795),  Expect(2) = 8e-150, Method: Compositional matrix adjust.
 Identities = 140/181 (77%), Positives = 160/181 (88%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              +AVPGVPKI++GYNPATWMLEI+   IE Q GVDFAEIYANS L+QRNQELIKEL TP 
Sbjct  1104  FEAVPGVPKIRDGYNPATWMLEITAPQIEVQLGVDFAEIYANSSLYQRNQELIKELRTPV  1163

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             PGS+DLYFPTKYSQSF+ QCKACFWKQHWSYWRNPQYNA+RFF+TIV+G +FG+IFW KG
Sbjct  1164  PGSKDLYFPTKYSQSFLTQCKACFWKQHWSYWRNPQYNAIRFFMTIVIGALFGLIFWNKG  1223

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
              +   QQDL+NLLGA+YAAV+FLG+ N S+VQ+ VA+ERTVFYRERAAGMYS LPYA AQ
Sbjct  1224  QQTTQQQDLMNLLGAMYAAVLFLGATNASAVQSVVAIERTVFYRERAAGMYSELPYAFAQ  1283

Query  624   V  626
             V
Sbjct  1284  V  1284


 Score =   249 bits (636),  Expect(2) = 8e-150, Method: Compositional matrix adjust.
 Identities = 119/175 (68%), Positives = 145/175 (83%), Gaps = 0/175 (0%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  IE IYVA+QTI Y+LLLY MIGF+W  GKFLWFYY++   F+YFT+YGMM+VALTPG
Sbjct  1283  QVAIETIYVAIQTIVYTLLLYSMIGFKWTAGKFLWFYYYILMCFVYFTMYGMMVVALTPG  1342

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
              Q AAI M+F L+FWNLF+GF++PR Q+PVWWRWYYWASP  W++YGL+TSQ+GDK+S++
Sbjct  1343  HQIAAIVMSFFLSFWNLFSGFLIPRPQIPVWWRWYYWASPVAWTIYGLVTSQVGDKDSQL  1402

Query  1046  QVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
              +PG  D+ +K FLK+  G+DY FLP VA AHV W LLFFFVFAYGI FLNFQRR
Sbjct  1403  VIPGAEDVALKAFLKEELGFDYNFLPVVAVAHVVWVLLFFFVFAYGIKFLNFQRR  1457



>gb|KCW48350.1| hypothetical protein EUGRSUZ_K02065 [Eucalyptus grandis]
Length=1383

 Score =   310 bits (795),  Expect(2) = 8e-150, Method: Compositional matrix adjust.
 Identities = 140/181 (77%), Positives = 160/181 (88%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              +AVPGVPKI++GYNPATWMLEI+   IE Q GVDFAEIYANS L+QRNQELIKEL TP 
Sbjct  1030  FEAVPGVPKIRDGYNPATWMLEITAPQIEVQLGVDFAEIYANSSLYQRNQELIKELRTPV  1089

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             PGS+DLYFPTKYSQSF+ QCKACFWKQHWSYWRNPQYNA+RFF+TIV+G +FG+IFW KG
Sbjct  1090  PGSKDLYFPTKYSQSFLTQCKACFWKQHWSYWRNPQYNAIRFFMTIVIGALFGLIFWNKG  1149

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
              +   QQDL+NLLGA+YAAV+FLG+ N S+VQ+ VA+ERTVFYRERAAGMYS LPYA AQ
Sbjct  1150  QQTTQQQDLMNLLGAMYAAVLFLGATNASAVQSVVAIERTVFYRERAAGMYSELPYAFAQ  1209

Query  624   V  626
             V
Sbjct  1210  V  1210


 Score =   249 bits (636),  Expect(2) = 8e-150, Method: Compositional matrix adjust.
 Identities = 119/175 (68%), Positives = 145/175 (83%), Gaps = 0/175 (0%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  IE IYVA+QTI Y+LLLY MIGF+W  GKFLWFYY++   F+YFT+YGMM+VALTPG
Sbjct  1209  QVAIETIYVAIQTIVYTLLLYSMIGFKWTAGKFLWFYYYILMCFVYFTMYGMMVVALTPG  1268

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
              Q AAI M+F L+FWNLF+GF++PR Q+PVWWRWYYWASP  W++YGL+TSQ+GDK+S++
Sbjct  1269  HQIAAIVMSFFLSFWNLFSGFLIPRPQIPVWWRWYYWASPVAWTIYGLVTSQVGDKDSQL  1328

Query  1046  QVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
              +PG  D+ +K FLK+  G+DY FLP VA AHV W LLFFFVFAYGI FLNFQRR
Sbjct  1329  VIPGAEDVALKAFLKEELGFDYNFLPVVAVAHVVWVLLFFFVFAYGIKFLNFQRR  1383



>emb|CBI40241.3| unnamed protein product [Vitis vinifera]
Length=1444

 Score =   307 bits (787),  Expect(2) = 1e-149, Method: Compositional matrix adjust.
 Identities = 137/182 (75%), Positives = 163/182 (90%), Gaps = 0/182 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              +AVPGVPK+++G NPATWMLE+++A  EAQ GVDFAEIYA S L+QRNQELIKELSTP 
Sbjct  1091  FEAVPGVPKVRDGQNPATWMLEVTSAAYEAQLGVDFAEIYAKSELYQRNQELIKELSTPS  1150

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             PGS++LYFPTKYSQSF  QCKACFWKQHWSYWRNP YNA+RFF+TI++GV+FGVIFW KG
Sbjct  1151  PGSKNLYFPTKYSQSFFTQCKACFWKQHWSYWRNPPYNAIRFFLTIIIGVLFGVIFWNKG  1210

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
             ++I  +QDLLNLLGA+++AV FLG+ NT++VQ  VA+ERTVFYRERAAGMYSALPYA AQ
Sbjct  1211  EQIDKEQDLLNLLGAMFSAVFFLGATNTAAVQPVVAIERTVFYRERAAGMYSALPYAFAQ  1270

Query  624   VI  629
             V+
Sbjct  1271  VV  1272


 Score =   252 bits (643),  Expect(2) = 1e-149, Method: Compositional matrix adjust.
 Identities = 116/175 (66%), Positives = 143/175 (82%), Gaps = 0/175 (0%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  IE IYVA+QT+ YSLLLY M+GF W++ KFLWFYY++   FIYFTLYGMM+VALTP 
Sbjct  1270  QVVIETIYVAIQTLVYSLLLYSMMGFYWRVDKFLWFYYYLLMCFIYFTLYGMMIVALTPS  1329

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
              Q AAI M+F L+FWNLF+GF++PR Q+P+WWRWYYWASP  W++YGL+TSQ+G+KE  V
Sbjct  1330  HQIAAIVMSFFLSFWNLFSGFLIPRMQIPIWWRWYYWASPVAWTIYGLVTSQVGNKEDPV  1389

Query  1046  QVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
             QVPG G  ++K +LK+  G++Y FL AVA AH+GW LLF FVFAYGI FLNFQRR
Sbjct  1390  QVPGAGVKSVKLYLKEASGFEYDFLGAVALAHIGWVLLFLFVFAYGIKFLNFQRR  1444



>ref|XP_008227291.1| PREDICTED: pleiotropic drug resistance protein 2-like isoform 
X2 [Prunus mume]
Length=1444

 Score =   310 bits (794),  Expect(2) = 5e-149, Method: Compositional matrix adjust.
 Identities = 136/181 (75%), Positives = 162/181 (90%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              +A+PGV KIK GYNPATWMLEIS+  +EAQ  +DFA++YANS L++RNQELIKELSTP 
Sbjct  1091  FEAIPGVQKIKEGYNPATWMLEISSTAVEAQLKIDFAQVYANSDLYRRNQELIKELSTPQ  1150

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             PGS+DLYF T+YSQSF+ QCKACFWKQHWSYWRN +YNA+RFF+TIV+G++FG+IFWGKG
Sbjct  1151  PGSKDLYFATRYSQSFITQCKACFWKQHWSYWRNSRYNAIRFFMTIVIGILFGIIFWGKG  1210

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
             D+IH QQDL+NLLGA YAAV+FLG+ N S+VQ+ VA+ERTVFYRERAAGMYS LPYA AQ
Sbjct  1211  DQIHKQQDLINLLGATYAAVLFLGASNASAVQSVVAIERTVFYRERAAGMYSELPYAFAQ  1270

Query  624   V  626
             V
Sbjct  1271  V  1271


 Score =   247 bits (631),  Expect(2) = 5e-149, Method: Compositional matrix adjust.
 Identities = 112/175 (64%), Positives = 140/175 (80%), Gaps = 0/175 (0%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  IE IYVA+QT  Y+LLLY MIG++WK+ KFL+FYYF+F  F YF++YGMM+VALTPG
Sbjct  1270  QVAIETIYVAIQTFIYALLLYSMIGYDWKVEKFLYFYYFIFMCFTYFSMYGMMVVALTPG  1329

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
              Q AAI M+F L+FWNLF+GF++PR  +P+WWRWYYWASP  W++YG+ TSQ+GDK++ +
Sbjct  1330  HQIAAIVMSFFLSFWNLFSGFLIPRPLIPIWWRWYYWASPVAWTIYGIFTSQVGDKKTLL  1389

Query  1046  QVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
             ++PG     +  FLK+F GYDY FL  V  AHVGW LLFFFVFAYGI FLNFQRR
Sbjct  1390  EIPGSAPKPVDAFLKEFLGYDYDFLVPVVLAHVGWVLLFFFVFAYGIKFLNFQRR  1444



>ref|XP_007207810.1| hypothetical protein PRUPE_ppa024119mg [Prunus persica]
 gb|EMJ09009.1| hypothetical protein PRUPE_ppa024119mg [Prunus persica]
Length=1423

 Score =   310 bits (794),  Expect(2) = 5e-149, Method: Compositional matrix adjust.
 Identities = 137/181 (76%), Positives = 161/181 (89%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              +A+PGV KIK GYNPATWMLEIS+  +EAQ  +DFA++YANS L++RNQELIKELSTP 
Sbjct  1070  FEAIPGVQKIKEGYNPATWMLEISSTAVEAQLKIDFAQVYANSDLYRRNQELIKELSTPQ  1129

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             PGS DLYF T+YSQSF+ QCKACFWKQHWSYWRN +YNA+RFF+TIV+G++FGVIFWGKG
Sbjct  1130  PGSNDLYFATRYSQSFITQCKACFWKQHWSYWRNSRYNAIRFFMTIVIGILFGVIFWGKG  1189

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
             D+IH QQDL+NLLGA YAAV+FLG+ N S+VQ+ VA+ERTVFYRERAAGMYS LPYA AQ
Sbjct  1190  DQIHKQQDLINLLGATYAAVLFLGASNASAVQSVVAIERTVFYRERAAGMYSELPYAFAQ  1249

Query  624   V  626
             V
Sbjct  1250  V  1250


 Score =   247 bits (631),  Expect(2) = 5e-149, Method: Compositional matrix adjust.
 Identities = 112/175 (64%), Positives = 140/175 (80%), Gaps = 0/175 (0%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  IE IYVA+QT  Y+LLLY MIG++WK+ KFL+FYYF+F  F YF++YGMM+VALTPG
Sbjct  1249  QVAIETIYVAIQTFIYALLLYSMIGYDWKVEKFLYFYYFIFMCFTYFSMYGMMVVALTPG  1308

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
              Q AAI M+F L+FWNLF+GF++PR  +P+WWRWYYWASP  W++YG+ TSQ+GDK++ +
Sbjct  1309  HQIAAIVMSFFLSFWNLFSGFLIPRPLIPIWWRWYYWASPVAWTIYGIFTSQVGDKKTLL  1368

Query  1046  QVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
             ++PG     +  FLK+F GYDY FL  V  AHVGW LLFFFVFAYGI FLNFQRR
Sbjct  1369  EIPGSAPKPVDAFLKEFLGYDYDFLVPVVLAHVGWVLLFFFVFAYGIRFLNFQRR  1423



>ref|XP_008227295.1| PREDICTED: pleiotropic drug resistance protein 2-like isoform 
X3 [Prunus mume]
Length=1449

 Score =   310 bits (794),  Expect(2) = 5e-149, Method: Compositional matrix adjust.
 Identities = 136/181 (75%), Positives = 162/181 (90%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              +A+PGV KIK GYNPATWMLEIS+  +EAQ  +DFA++YANS L++RNQELIKELSTP 
Sbjct  1096  FEAIPGVQKIKEGYNPATWMLEISSTAVEAQLKIDFAQVYANSDLYRRNQELIKELSTPQ  1155

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             PGS+DLYF T+YSQSF+ QCKACFWKQHWSYWRN +YNA+RFF+TIV+G++FG+IFWGKG
Sbjct  1156  PGSKDLYFATRYSQSFITQCKACFWKQHWSYWRNSRYNAIRFFMTIVIGILFGIIFWGKG  1215

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
             D+IH QQDL+NLLGA YAAV+FLG+ N S+VQ+ VA+ERTVFYRERAAGMYS LPYA AQ
Sbjct  1216  DQIHKQQDLINLLGATYAAVLFLGASNASAVQSVVAIERTVFYRERAAGMYSELPYAFAQ  1275

Query  624   V  626
             V
Sbjct  1276  V  1276


 Score =   247 bits (631),  Expect(2) = 5e-149, Method: Compositional matrix adjust.
 Identities = 112/175 (64%), Positives = 140/175 (80%), Gaps = 0/175 (0%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  IE IYVA+QT  Y+LLLY MIG++WK+ KFL+FYYF+F  F YF++YGMM+VALTPG
Sbjct  1275  QVAIETIYVAIQTFIYALLLYSMIGYDWKVEKFLYFYYFIFMCFTYFSMYGMMVVALTPG  1334

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
              Q AAI M+F L+FWNLF+GF++PR  +P+WWRWYYWASP  W++YG+ TSQ+GDK++ +
Sbjct  1335  HQIAAIVMSFFLSFWNLFSGFLIPRPLIPIWWRWYYWASPVAWTIYGIFTSQVGDKKTLL  1394

Query  1046  QVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
             ++PG     +  FLK+F GYDY FL  V  AHVGW LLFFFVFAYGI FLNFQRR
Sbjct  1395  EIPGSAPKPVDAFLKEFLGYDYDFLVPVVLAHVGWVLLFFFVFAYGIKFLNFQRR  1449



>ref|XP_008227287.1| PREDICTED: pleiotropic drug resistance protein 2-like isoform 
X1 [Prunus mume]
Length=1455

 Score =   310 bits (794),  Expect(2) = 5e-149, Method: Compositional matrix adjust.
 Identities = 136/181 (75%), Positives = 162/181 (90%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              +A+PGV KIK GYNPATWMLEIS+  +EAQ  +DFA++YANS L++RNQELIKELSTP 
Sbjct  1102  FEAIPGVQKIKEGYNPATWMLEISSTAVEAQLKIDFAQVYANSDLYRRNQELIKELSTPQ  1161

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             PGS+DLYF T+YSQSF+ QCKACFWKQHWSYWRN +YNA+RFF+TIV+G++FG+IFWGKG
Sbjct  1162  PGSKDLYFATRYSQSFITQCKACFWKQHWSYWRNSRYNAIRFFMTIVIGILFGIIFWGKG  1221

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
             D+IH QQDL+NLLGA YAAV+FLG+ N S+VQ+ VA+ERTVFYRERAAGMYS LPYA AQ
Sbjct  1222  DQIHKQQDLINLLGATYAAVLFLGASNASAVQSVVAIERTVFYRERAAGMYSELPYAFAQ  1281

Query  624   V  626
             V
Sbjct  1282  V  1282


 Score =   247 bits (631),  Expect(2) = 5e-149, Method: Compositional matrix adjust.
 Identities = 112/175 (64%), Positives = 140/175 (80%), Gaps = 0/175 (0%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  IE IYVA+QT  Y+LLLY MIG++WK+ KFL+FYYF+F  F YF++YGMM+VALTPG
Sbjct  1281  QVAIETIYVAIQTFIYALLLYSMIGYDWKVEKFLYFYYFIFMCFTYFSMYGMMVVALTPG  1340

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
              Q AAI M+F L+FWNLF+GF++PR  +P+WWRWYYWASP  W++YG+ TSQ+GDK++ +
Sbjct  1341  HQIAAIVMSFFLSFWNLFSGFLIPRPLIPIWWRWYYWASPVAWTIYGIFTSQVGDKKTLL  1400

Query  1046  QVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
             ++PG     +  FLK+F GYDY FL  V  AHVGW LLFFFVFAYGI FLNFQRR
Sbjct  1401  EIPGSAPKPVDAFLKEFLGYDYDFLVPVVLAHVGWVLLFFFVFAYGIKFLNFQRR  1455



>ref|XP_007010271.1| Pleiotropic drug resistance 6 [Theobroma cacao]
 gb|EOY19081.1| Pleiotropic drug resistance 6 [Theobroma cacao]
Length=1503

 Score =   301 bits (771),  Expect(2) = 6e-149, Method: Compositional matrix adjust.
 Identities = 129/181 (71%), Positives = 162/181 (90%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              +AVPGVPKIK GYNPATWMLEIS+  +EAQ  VDF+EIYA S L+++N++LI++LSTP 
Sbjct  1150  FEAVPGVPKIKEGYNPATWMLEISSTAVEAQLDVDFSEIYAKSELYRKNEKLIQDLSTPV  1209

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             PG++DL+F TKYSQ F  QC+ACFWKQHWSYWRNPQYNA+RFF+T+++G++FG+IFW KG
Sbjct  1210  PGTKDLHFSTKYSQDFFTQCRACFWKQHWSYWRNPQYNAIRFFMTVIVGIIFGMIFWDKG  1269

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
             D+IH QQDL+NLLGA+Y+AV+FLG+ NTS+VQ+ VA+ERTVFYRERAAGMYS LPYA +Q
Sbjct  1270  DKIHKQQDLMNLLGAMYSAVLFLGATNTSAVQSVVAIERTVFYRERAAGMYSPLPYAFSQ  1329

Query  624   V  626
             V
Sbjct  1330  V  1330


 Score =   256 bits (653),  Expect(2) = 6e-149, Method: Compositional matrix adjust.
 Identities = 116/175 (66%), Positives = 143/175 (82%), Gaps = 0/175 (0%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  IEAIYV++QT+ YSLLLY MIGF   +GKFL FYYF+   F+YFTLYGMMLVALTP 
Sbjct  1329  QVAIEAIYVSIQTLVYSLLLYSMIGFHVDVGKFLLFYYFILMCFMYFTLYGMMLVALTPN  1388

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
              QFAAI M+F L+FWNLF+GF++PR ++P+WWRWYYWASP  W++YGL+TSQ+GD+ + V
Sbjct  1389  HQFAAIVMSFFLSFWNLFSGFLIPRTEIPIWWRWYYWASPVAWTIYGLVTSQVGDQLALV  1448

Query  1046  QVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
              +PGE  +T+K +L+   G+DY FLPAV AAH+GW LLF FVFAYGI FLNFQRR
Sbjct  1449  DIPGELPLTVKDYLEAHLGFDYSFLPAVVAAHIGWVLLFLFVFAYGIKFLNFQRR  1503



>ref|XP_007023609.1| Pleiotropic drug resistance 11 [Theobroma cacao]
 gb|EOY26231.1| Pleiotropic drug resistance 11 [Theobroma cacao]
Length=1452

 Score =   296 bits (758),  Expect(2) = 6e-149, Method: Compositional matrix adjust.
 Identities = 135/181 (75%), Positives = 153/181 (85%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              +AVPGVPKIK+GYNPATWMLEIST  +E Q  VDFAEIYA S L+QRNQE IKELSTP 
Sbjct  1099  FEAVPGVPKIKDGYNPATWMLEISTPAVEGQLDVDFAEIYAKSSLYQRNQERIKELSTPA  1158

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             PGS DLYFPTKY+Q F+ QCK CF KQHWSY RNPQYNA+RFF+T VLG++FG+IFW KG
Sbjct  1159  PGSNDLYFPTKYAQPFLSQCKVCFLKQHWSYLRNPQYNAIRFFITFVLGILFGLIFWNKG  1218

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
              +I  QQD+LN  GA+Y+AV FLG++N SSVQA VA+ERTVFYRERAAGMYS LPYA AQ
Sbjct  1219  QQIAKQQDVLNFFGAMYSAVFFLGAVNASSVQAIVAIERTVFYRERAAGMYSPLPYAFAQ  1278

Query  624   V  626
             V
Sbjct  1279  V  1279


 Score =   260 bits (665),  Expect(2) = 6e-149, Method: Compositional matrix adjust.
 Identities = 114/175 (65%), Positives = 147/175 (84%), Gaps = 0/175 (0%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  IE IY ++QT+ Y LLLY MIG+EWK GKFLWFYY++ +S++YFTLYGMM+VALTPG
Sbjct  1278  QVAIETIYTSIQTLIYVLLLYLMIGYEWKAGKFLWFYYYITSSYVYFTLYGMMVVALTPG  1337

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
              Q AAI M+F L+FWN+F+GF++PR Q+P+WWRWYYWA+P  W+LYGLITSQ+GDK++ +
Sbjct  1338  HQIAAIVMSFFLSFWNMFSGFLIPRPQIPIWWRWYYWATPVAWTLYGLITSQVGDKDTFL  1397

Query  1046  QVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
             +VPG  D+ +K ++K+ FG++Y FLP VA AH+ W LLFFFVFAYGI FLNFQRR
Sbjct  1398  EVPGSADIPLKTYIKEMFGFEYDFLPVVAVAHICWCLLFFFVFAYGIKFLNFQRR  1452



>ref|XP_010089393.1| Pleiotropic drug resistance protein 2 [Morus notabilis]
 gb|EXB37746.1| Pleiotropic drug resistance protein 2 [Morus notabilis]
Length=1477

 Score =   293 bits (751),  Expect(2) = 8e-149, Method: Compositional matrix adjust.
 Identities = 132/181 (73%), Positives = 157/181 (87%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              +A+PGVPKI++GYNPATWMLE++T  + AQ  VDFAE+YANS L+ RNQELI+ELSTP 
Sbjct  1123  FEAIPGVPKIRDGYNPATWMLEVTTPQVGAQLDVDFAELYANSSLYLRNQELIEELSTPA  1182

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             PGS+DL+FPTKYSQ F  QC AC WKQ+WSYWRNPQYNA+RFF+TIV+GV+FG+IFW KG
Sbjct  1183  PGSKDLFFPTKYSQPFYVQCNACVWKQYWSYWRNPQYNAIRFFMTIVIGVLFGLIFWNKG  1242

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
              +   QQDL NLLGA+YAAV+FLG+ N S+VQ+ VA+ERTVFYRERAAGMYSALPYA AQ
Sbjct  1243  QQTTKQQDLTNLLGAMYAAVLFLGACNASAVQSIVAIERTVFYRERAAGMYSALPYAFAQ  1302

Query  624   V  626
             V
Sbjct  1303  V  1303


 Score =   263 bits (672),  Expect(2) = 8e-149, Method: Compositional matrix adjust.
 Identities = 120/176 (68%), Positives = 145/176 (82%), Gaps = 1/176 (1%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  +E +Y A+QT  Y+LLLY MIGFEWK GKFLWFYY+M   F+YFT+YGMM+VALTPG
Sbjct  1302  QVAVETMYTAIQTFIYTLLLYSMIGFEWKAGKFLWFYYYMTMCFVYFTMYGMMVVALTPG  1361

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
              Q AAI MAF L+FWNLF+GF+LPR Q+P+WWRWYYWASP  W+LYGL+TSQ+GDK++ +
Sbjct  1362  HQIAAIVMAFFLSFWNLFSGFLLPRMQIPIWWRWYYWASPVAWTLYGLVTSQVGDKDADL  1421

Query  1046  QVPGEG-DMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
             ++PG G  + +K FLKD  G+DY FLP VA AHVGW LLFFFVFAYGI FLN+QRR
Sbjct  1422  EIPGLGTSIPLKVFLKDNLGFDYNFLPTVAVAHVGWVLLFFFVFAYGIKFLNYQRR  1477



>ref|XP_008241277.1| PREDICTED: pleiotropic drug resistance protein 2-like [Prunus 
mume]
Length=1443

 Score =   286 bits (733),  Expect(2) = 1e-148, Method: Compositional matrix adjust.
 Identities = 133/181 (73%), Positives = 155/181 (86%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              +AVPGV KIK+GYNPATWMLE++   +EAQ  VDFA+IYANS L+QRNQELIK+LST  
Sbjct  1090  FEAVPGVTKIKDGYNPATWMLEVTAPAVEAQLDVDFADIYANSSLYQRNQELIKDLSTAA  1149

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             PGS+DLYFPTKYSQ F  QCKA FWK HWSYWRNPQYNA+RFF+TIV+G +FG+IFW KG
Sbjct  1150  PGSKDLYFPTKYSQPFSVQCKASFWKMHWSYWRNPQYNAIRFFMTIVIGCLFGLIFWQKG  1209

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
              +   QQDL+NLLGA+YAAV+FLG+ N S+VQ+ VA+ERTVFYRERAAGMYS LPYA AQ
Sbjct  1210  QQTTQQQDLMNLLGAMYAAVLFLGATNASAVQSVVAIERTVFYRERAAGMYSELPYAFAQ  1269

Query  624   V  626
             V
Sbjct  1270  V  1270


 Score =   269 bits (687),  Expect(2) = 1e-148, Method: Compositional matrix adjust.
 Identities = 122/175 (70%), Positives = 148/175 (85%), Gaps = 0/175 (0%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  IE IYVA+QT  Y+LLLY MIGFEWK+GKFLWFYY++   F+YFT+YGMM+VALTPG
Sbjct  1269  QVAIETIYVAIQTFIYTLLLYSMIGFEWKVGKFLWFYYYILMCFVYFTMYGMMVVALTPG  1328

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
              Q AAI M+F L+FWNLF+GF++PR Q+P+WWRWYYWASP  W+LYGL+TSQ+GDK + +
Sbjct  1329  HQIAAIVMSFFLSFWNLFSGFLIPRPQIPIWWRWYYWASPVAWTLYGLVTSQVGDKNADL  1388

Query  1046  QVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
              +PG G M +K+FLKD  G+++ FLPAVAAAHVGW LLFFFVFAYGI FLNFQRR
Sbjct  1389  VLPGYGTMPLKKFLKDDLGFEHDFLPAVAAAHVGWVLLFFFVFAYGIKFLNFQRR  1443



>ref|XP_007203982.1| hypothetical protein PRUPE_ppa000212mg [Prunus persica]
 gb|EMJ05181.1| hypothetical protein PRUPE_ppa000212mg [Prunus persica]
Length=1454

 Score =   286 bits (733),  Expect(2) = 2e-148, Method: Compositional matrix adjust.
 Identities = 133/181 (73%), Positives = 155/181 (86%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              +AVPGV KIK+GYNPATWMLE++   +EAQ  VDFA+IYANS L+QRNQELIK+LST  
Sbjct  1101  FEAVPGVTKIKDGYNPATWMLEVTAPAVEAQLDVDFADIYANSSLYQRNQELIKDLSTAA  1160

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             PGS+DLYFPTKYSQ F  QCKA FWK HWSYWRNPQYNA+RFF+TIV+G +FG+IFW KG
Sbjct  1161  PGSKDLYFPTKYSQPFSVQCKASFWKMHWSYWRNPQYNAIRFFMTIVIGCLFGLIFWQKG  1220

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
              +   QQDL+NLLGA+YAAV+FLG+ N S+VQ+ VA+ERTVFYRERAAGMYS LPYA AQ
Sbjct  1221  QQTTQQQDLMNLLGAMYAAVLFLGATNASAVQSVVAIERTVFYRERAAGMYSELPYAFAQ  1280

Query  624   V  626
             V
Sbjct  1281  V  1281


 Score =   269 bits (687),  Expect(2) = 2e-148, Method: Compositional matrix adjust.
 Identities = 122/175 (70%), Positives = 148/175 (85%), Gaps = 0/175 (0%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  IE IYVA+QT  Y+LLLY MIGFEWK+GKFLWFYY++   F+YFT+YGMM+VALTPG
Sbjct  1280  QVAIETIYVAIQTFIYTLLLYSMIGFEWKVGKFLWFYYYILMCFVYFTMYGMMVVALTPG  1339

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
              Q AAI M+F L+FWNLF+GF++PR Q+P+WWRWYYWASP  W+LYGL+TSQ+GDK + +
Sbjct  1340  HQIAAIVMSFFLSFWNLFSGFLIPRPQIPIWWRWYYWASPVAWTLYGLVTSQVGDKNADL  1399

Query  1046  QVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
              +PG G M +K+FLKD  G+++ FLPAVAAAHVGW LLFFFVFAYGI FLNFQRR
Sbjct  1400  VLPGYGTMPLKKFLKDDLGFEHDFLPAVAAAHVGWVLLFFFVFAYGIKFLNFQRR  1454



>ref|XP_010654053.1| PREDICTED: pleiotropic drug resistance protein 2 [Vitis vinifera]
Length=1451

 Score =   303 bits (776),  Expect(2) = 2e-148, Method: Compositional matrix adjust.
 Identities = 136/181 (75%), Positives = 158/181 (87%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              +A+PGVPKIK G NPATWML +S + +EAQ  VDFAEIYANS L+QRNQELIKELSTPP
Sbjct  1098  FEAIPGVPKIKEGSNPATWMLVVSASSVEAQMEVDFAEIYANSSLYQRNQELIKELSTPP  1157

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             P S+DLYFPT++SQ F  QCKACFWKQHWSYWRNPQYNA+RFF+TIV+G +FGVIFW KG
Sbjct  1158  PASKDLYFPTEFSQPFSTQCKACFWKQHWSYWRNPQYNAIRFFMTIVIGALFGVIFWNKG  1217

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
             ++   QQDL+NLLGA+YAAV+FLG+ N S+VQ+ VA+ERTVFYRERAAGMYS LPYA AQ
Sbjct  1218  EQTTKQQDLMNLLGAMYAAVLFLGATNASAVQSIVAIERTVFYRERAAGMYSPLPYAFAQ  1277

Query  624   V  626
             V
Sbjct  1278  V  1278


 Score =   252 bits (643),  Expect(2) = 2e-148, Method: Compositional matrix adjust.
 Identities = 122/175 (70%), Positives = 148/175 (85%), Gaps = 0/175 (0%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  IEAIYVA+QTI Y+LLLY MIGF+WK+GKFLWFYY++   FIYFT+YGMM+VALTPG
Sbjct  1277  QVSIEAIYVAIQTIVYTLLLYSMIGFDWKVGKFLWFYYYILMCFIYFTMYGMMVVALTPG  1336

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
              Q AAI M+F L+FWNLF+GF++PR Q+PVWWRWYYWASP  W+LYGL+TSQ+GDK + +
Sbjct  1337  HQIAAIVMSFFLSFWNLFSGFLIPRPQIPVWWRWYYWASPVAWTLYGLVTSQVGDKNALL  1396

Query  1046  QVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
             +VPG G++ +K FLK+  G++Y FLPAVA AHV W  LFFFVFAYGI FLNFQRR
Sbjct  1397  EVPGSGNVPLKLFLKESLGFEYDFLPAVAVAHVVWVALFFFVFAYGIRFLNFQRR  1451



>emb|CBI30263.3| unnamed protein product [Vitis vinifera]
Length=1357

 Score =   303 bits (776),  Expect(2) = 2e-148, Method: Compositional matrix adjust.
 Identities = 136/181 (75%), Positives = 158/181 (87%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              +A+PGVPKIK G NPATWML +S + +EAQ  VDFAEIYANS L+QRNQELIKELSTPP
Sbjct  1004  FEAIPGVPKIKEGSNPATWMLVVSASSVEAQMEVDFAEIYANSSLYQRNQELIKELSTPP  1063

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             P S+DLYFPT++SQ F  QCKACFWKQHWSYWRNPQYNA+RFF+TIV+G +FGVIFW KG
Sbjct  1064  PASKDLYFPTEFSQPFSTQCKACFWKQHWSYWRNPQYNAIRFFMTIVIGALFGVIFWNKG  1123

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
             ++   QQDL+NLLGA+YAAV+FLG+ N S+VQ+ VA+ERTVFYRERAAGMYS LPYA AQ
Sbjct  1124  EQTTKQQDLMNLLGAMYAAVLFLGATNASAVQSIVAIERTVFYRERAAGMYSPLPYAFAQ  1183

Query  624   V  626
             V
Sbjct  1184  V  1184


 Score =   252 bits (643),  Expect(2) = 2e-148, Method: Compositional matrix adjust.
 Identities = 122/175 (70%), Positives = 148/175 (85%), Gaps = 0/175 (0%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  IEAIYVA+QTI Y+LLLY MIGF+WK+GKFLWFYY++   FIYFT+YGMM+VALTPG
Sbjct  1183  QVSIEAIYVAIQTIVYTLLLYSMIGFDWKVGKFLWFYYYILMCFIYFTMYGMMVVALTPG  1242

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
              Q AAI M+F L+FWNLF+GF++PR Q+PVWWRWYYWASP  W+LYGL+TSQ+GDK + +
Sbjct  1243  HQIAAIVMSFFLSFWNLFSGFLIPRPQIPVWWRWYYWASPVAWTLYGLVTSQVGDKNALL  1302

Query  1046  QVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
             +VPG G++ +K FLK+  G++Y FLPAVA AHV W  LFFFVFAYGI FLNFQRR
Sbjct  1303  EVPGSGNVPLKLFLKESLGFEYDFLPAVAVAHVVWVALFFFVFAYGIRFLNFQRR  1357



>ref|XP_006604625.1| PREDICTED: ABC transporter G family member 39-like isoform X1 
[Glycine max]
Length=1454

 Score =   289 bits (740),  Expect(2) = 2e-148, Method: Compositional matrix adjust.
 Identities = 131/181 (72%), Positives = 155/181 (86%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              + +PGVPKIK+GYNPA+WML+IS+  +EA   VDFAEIYA S L++RNQELI+ELSTP 
Sbjct  1101  FEGIPGVPKIKDGYNPASWMLDISSTTMEANLEVDFAEIYAKSTLYRRNQELIEELSTPV  1160

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             P S+DL+FPTKYSQSF  QCKA FWKQ+WSYWR PQYNAVRFF+TIV+GVMFGVIFW K 
Sbjct  1161  PDSKDLHFPTKYSQSFFVQCKANFWKQYWSYWRYPQYNAVRFFMTIVVGVMFGVIFWNKA  1220

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
              + H QQDL+NLLG +YAA++FLG++N SSVQ  VA+ERT+FYRERAAGMYSALPYA  Q
Sbjct  1221  KKTHKQQDLMNLLGGMYAAMLFLGAMNASSVQPVVAIERTIFYRERAAGMYSALPYAFGQ  1280

Query  624   V  626
             V
Sbjct  1281  V  1281


 Score =   266 bits (679),  Expect(2) = 2e-148, Method: Compositional matrix adjust.
 Identities = 121/175 (69%), Positives = 142/175 (81%), Gaps = 0/175 (0%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  IEAIY A+QT  YSL+LY MIGF+WK   F WFYY++   F+YFTLYGMM+VALTPG
Sbjct  1280  QVAIEAIYNAIQTAVYSLILYSMIGFDWKATSFFWFYYYILMCFMYFTLYGMMIVALTPG  1339

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
              Q AAI M+F L+FWNLF+GFI+PR Q+PVWWRWYYWASP  W+LYGLITSQLGDK + +
Sbjct  1340  HQVAAICMSFFLSFWNLFSGFIIPRTQIPVWWRWYYWASPVSWTLYGLITSQLGDKNAEL  1399

Query  1046  QVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
             ++PG G M +K+FLK   G+DY FLP VAAAHVGW +LF FVFAYGI FLNFQRR
Sbjct  1400  EIPGAGSMGLKEFLKQNLGFDYDFLPVVAAAHVGWVILFMFVFAYGIKFLNFQRR  1454



>ref|XP_006604626.1| PREDICTED: ABC transporter G family member 39-like isoform X2 
[Glycine max]
 gb|KHN02247.1| ABC transporter G family member 39 [Glycine soja]
Length=1453

 Score =   289 bits (740),  Expect(2) = 3e-148, Method: Compositional matrix adjust.
 Identities = 131/181 (72%), Positives = 155/181 (86%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              + +PGVPKIK+GYNPA+WML+IS+  +EA   VDFAEIYA S L++RNQELI+ELSTP 
Sbjct  1100  FEGIPGVPKIKDGYNPASWMLDISSTTMEANLEVDFAEIYAKSTLYRRNQELIEELSTPV  1159

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             P S+DL+FPTKYSQSF  QCKA FWKQ+WSYWR PQYNAVRFF+TIV+GVMFGVIFW K 
Sbjct  1160  PDSKDLHFPTKYSQSFFVQCKANFWKQYWSYWRYPQYNAVRFFMTIVVGVMFGVIFWNKA  1219

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
              + H QQDL+NLLG +YAA++FLG++N SSVQ  VA+ERT+FYRERAAGMYSALPYA  Q
Sbjct  1220  KKTHKQQDLMNLLGGMYAAMLFLGAMNASSVQPVVAIERTIFYRERAAGMYSALPYAFGQ  1279

Query  624   V  626
             V
Sbjct  1280  V  1280


 Score =   265 bits (678),  Expect(2) = 3e-148, Method: Compositional matrix adjust.
 Identities = 121/175 (69%), Positives = 142/175 (81%), Gaps = 0/175 (0%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  IEAIY A+QT  YSL+LY MIGF+WK   F WFYY++   F+YFTLYGMM+VALTPG
Sbjct  1279  QVAIEAIYNAIQTAVYSLILYSMIGFDWKATSFFWFYYYILMCFMYFTLYGMMIVALTPG  1338

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
              Q AAI M+F L+FWNLF+GFI+PR Q+PVWWRWYYWASP  W+LYGLITSQLGDK + +
Sbjct  1339  HQVAAICMSFFLSFWNLFSGFIIPRTQIPVWWRWYYWASPVSWTLYGLITSQLGDKNAEL  1398

Query  1046  QVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
             ++PG G M +K+FLK   G+DY FLP VAAAHVGW +LF FVFAYGI FLNFQRR
Sbjct  1399  EIPGAGSMGLKEFLKQNLGFDYDFLPVVAAAHVGWVILFMFVFAYGIKFLNFQRR  1453



>ref|XP_009365366.1| PREDICTED: pleiotropic drug resistance protein 2-like [Pyrus 
x bretschneideri]
Length=1452

 Score =   290 bits (741),  Expect(2) = 5e-148, Method: Compositional matrix adjust.
 Identities = 130/181 (72%), Positives = 155/181 (86%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              +A+PGV KIK+G NPATWML+++   +EAQ  VDFA+IYANS  ++RNQELIKELSTP 
Sbjct  1099  FEAIPGVTKIKDGCNPATWMLDVTAPAVEAQLDVDFADIYANSLPYKRNQELIKELSTPA  1158

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             PGS+DLYFPTKYSQ F  QCKACFWK +WSYWRNPQYNA+RFF+TIV+GV+FG+IFW KG
Sbjct  1159  PGSKDLYFPTKYSQPFSIQCKACFWKMYWSYWRNPQYNAIRFFITIVIGVLFGIIFWQKG  1218

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
                  QQDL+NLLGA++AAV+FLGS N S+VQ+ VA+ERTVFYRERAAGMYS LPYA +Q
Sbjct  1219  QHTAQQQDLMNLLGALFAAVLFLGSTNASAVQSVVAIERTVFYRERAAGMYSELPYAFSQ  1278

Query  624   V  626
             V
Sbjct  1279  V  1279


 Score =   264 bits (675),  Expect(2) = 5e-148, Method: Compositional matrix adjust.
 Identities = 123/175 (70%), Positives = 143/175 (82%), Gaps = 0/175 (0%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  IE IYVA+QT  Y+LLLY MIGFEWK+GKFLWFYY++   FIYFT+YGMM+VALTPG
Sbjct  1278  QVAIEIIYVAIQTFIYTLLLYSMIGFEWKIGKFLWFYYYILMCFIYFTMYGMMVVALTPG  1337

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
              Q AAI M+F L  WNLF+GF++PR Q+P+WWRWYYWASP  W+LYGL+ SQLGDK   +
Sbjct  1338  HQIAAIVMSFFLIIWNLFSGFLIPRPQIPIWWRWYYWASPVAWTLYGLVMSQLGDKNVDI  1397

Query  1046  QVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
              +PG G M +K FLKD FG++Y FLPAVAAAHVGW LLF FVFAYGI FLNFQRR
Sbjct  1398  VLPGYGTMPLKMFLKDAFGFEYDFLPAVAAAHVGWVLLFCFVFAYGIKFLNFQRR  1452



>ref|XP_009365370.1| PREDICTED: pleiotropic drug resistance protein 2-like [Pyrus 
x bretschneideri]
Length=1452

 Score =   290 bits (741),  Expect(2) = 5e-148, Method: Compositional matrix adjust.
 Identities = 130/181 (72%), Positives = 155/181 (86%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              +A+PGV KIK+G NPATWML+++   +EAQ  VDFA+IYANS  ++RNQELIKELSTP 
Sbjct  1099  FEAIPGVTKIKDGCNPATWMLDVTAPAVEAQLDVDFADIYANSLPYKRNQELIKELSTPA  1158

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             PGS+DLYFPTKYSQ F  QCKACFWK +WSYWRNPQYNA+RFF+TIV+GV+FG+IFW KG
Sbjct  1159  PGSKDLYFPTKYSQPFSIQCKACFWKMYWSYWRNPQYNAIRFFITIVIGVLFGIIFWQKG  1218

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
                  QQDL+NLLGA++AAV+FLGS N S+VQ+ VA+ERTVFYRERAAGMYS LPYA +Q
Sbjct  1219  QHTAQQQDLMNLLGALFAAVLFLGSTNASAVQSVVAIERTVFYRERAAGMYSELPYAFSQ  1278

Query  624   V  626
             V
Sbjct  1279  V  1279


 Score =   264 bits (675),  Expect(2) = 5e-148, Method: Compositional matrix adjust.
 Identities = 123/175 (70%), Positives = 143/175 (82%), Gaps = 0/175 (0%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  IE IYVA+QT  Y+LLLY MIGFEWK+GKFLWFYY++   FIYFT+YGMM+VALTPG
Sbjct  1278  QVAIEIIYVAIQTFIYTLLLYSMIGFEWKIGKFLWFYYYILMCFIYFTMYGMMVVALTPG  1337

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
              Q AAI M+F L  WNLF+GF++PR Q+P+WWRWYYWASP  W+LYGL+ SQLGDK   +
Sbjct  1338  HQIAAIVMSFFLIIWNLFSGFLIPRPQIPIWWRWYYWASPVAWTLYGLVMSQLGDKNVDI  1397

Query  1046  QVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
              +PG G M +K FLKD FG++Y FLPAVAAAHVGW LLF FVFAYGI FLNFQRR
Sbjct  1398  VLPGYGTMPLKMFLKDAFGFEYDFLPAVAAAHVGWVLLFCFVFAYGIKFLNFQRR  1452



>emb|CBI40240.3| unnamed protein product [Vitis vinifera]
Length=2196

 Score =   293 bits (750),  Expect(2) = 5e-148, Method: Compositional matrix adjust.
 Identities = 130/181 (72%), Positives = 157/181 (87%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              +AVPGVPK+++G NPATWMLE+S+A +EAQ GVDFAEIYA S L+QRNQELIK +STP 
Sbjct  1843  FEAVPGVPKVRDGQNPATWMLEVSSAAVEAQLGVDFAEIYAKSELYQRNQELIKVISTPS  1902

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             PGS++LYFPTKYSQSF+ QCKACFWKQHWSYWRNP YNA+R F+TI++GV+FG IF  KG
Sbjct  1903  PGSKNLYFPTKYSQSFITQCKACFWKQHWSYWRNPPYNAIRLFLTIIIGVLFGAIFRNKG  1962

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
              +   +QDL+NLLGA+++AV FLG+ NT++VQ  VA+ERTVFYRERAAGMYSAL YA AQ
Sbjct  1963  KQTDKEQDLINLLGAMFSAVFFLGTTNTAAVQPVVAIERTVFYRERAAGMYSALSYAFAQ  2022

Query  624   V  626
             V
Sbjct  2023  V  2023


 Score =   261 bits (666),  Expect(2) = 5e-148, Method: Compositional matrix adjust.
 Identities = 118/175 (67%), Positives = 144/175 (82%), Gaps = 0/175 (0%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  IEAIYVA+QT  YS LLY M+GF W++ KFLWFYY++F  FIYFTLYGMM+VALTP 
Sbjct  2022  QVAIEAIYVAIQTCLYSFLLYSMMGFYWRVDKFLWFYYYLFMCFIYFTLYGMMIVALTPS  2081

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
              Q AAI M+F L+FWNLF+GF++ R Q+P+WWRWYYWASP  W++YGL+TSQ+GDKE  V
Sbjct  2082  HQIAAIVMSFFLSFWNLFSGFLIHRMQIPIWWRWYYWASPVAWTIYGLVTSQVGDKEDPV  2141

Query  1046  QVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
             QVPG  DM++KQ+LK+  G++Y FL AVA AH+GW LLF FVFAYGI FL+FQRR
Sbjct  2142  QVPGADDMSVKQYLKEALGFEYDFLGAVALAHIGWVLLFLFVFAYGIKFLDFQRR  2196



>emb|CAN77838.1| hypothetical protein VITISV_025837 [Vitis vinifera]
Length=1456

 Score =   302 bits (774),  Expect(2) = 6e-148, Method: Compositional matrix adjust.
 Identities = 136/181 (75%), Positives = 158/181 (87%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              +A+PGVPKIK G NPATWML +S + +EAQ  VDFAEIYANS L+QRNQELIKELSTPP
Sbjct  1103  FEAIPGVPKIKEGSNPATWMLVVSASSVEAQMEVDFAEIYANSSLYQRNQELIKELSTPP  1162

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             P S+DLYFPT++SQ F  QCKACFWKQHWSYWRNPQYNA+RFF+TIV+G +FGVIFW KG
Sbjct  1163  PXSKDLYFPTEFSQPFSTQCKACFWKQHWSYWRNPQYNAIRFFMTIVIGALFGVIFWNKG  1222

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
             ++   QQDL+NLLGA+YAAV+FLG+ N S+VQ+ VA+ERTVFYRERAAGMYS LPYA AQ
Sbjct  1223  EQTTKQQDLMNLLGAMYAAVLFLGATNASAVQSIVAIERTVFYRERAAGMYSPLPYAFAQ  1282

Query  624   V  626
             V
Sbjct  1283  V  1283


 Score =   251 bits (642),  Expect(2) = 6e-148, Method: Compositional matrix adjust.
 Identities = 122/175 (70%), Positives = 148/175 (85%), Gaps = 0/175 (0%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  IEAIYVA+QTI Y+LLLY MIGF+WK+GKFLWFYY++   FIYFT+YGMM+VALTPG
Sbjct  1282  QVSIEAIYVAIQTIVYTLLLYSMIGFDWKVGKFLWFYYYILMCFIYFTMYGMMVVALTPG  1341

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
              Q AAI M+F L+FWNLF+GF++PR Q+PVWWRWYYWASP  W+LYGL+TSQ+GDK + +
Sbjct  1342  HQIAAIVMSFFLSFWNLFSGFLIPRPQIPVWWRWYYWASPVAWTLYGLVTSQVGDKNALL  1401

Query  1046  QVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
             +VPG G++ +K FLK+  G++Y FLPAVA AHV W  LFFFVFAYGI FLNFQRR
Sbjct  1402  EVPGSGNVPLKLFLKESLGFEYDFLPAVAVAHVVWVALFFFVFAYGIRFLNFQRR  1456



>gb|KDP42709.1| hypothetical protein JCGZ_23649 [Jatropha curcas]
Length=611

 Score =   293 bits (751),  Expect(2) = 1e-147, Method: Compositional matrix adjust.
 Identities = 133/181 (73%), Positives = 158/181 (87%), Gaps = 0/181 (0%)
 Frame = +3

Query  84   LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
             +AVPGVPKIK+GYNPATWML+IST+ +EAQ  VDFA+IY NS L+QRNQELIKELSTP 
Sbjct  258  FEAVPGVPKIKDGYNPATWMLDISTSSMEAQLNVDFAQIYMNSSLYQRNQELIKELSTPA  317

Query  264  PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             G++DLYFP+KYSQSF+ QCKACFWKQ  SYWRNPQYNA+RFF+T+++GV+FG+IFW  G
Sbjct  318  AGTKDLYFPSKYSQSFLVQCKACFWKQQRSYWRNPQYNAIRFFLTLIIGVLFGLIFWNTG  377

Query  444  DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
             +   QQDLLNLLGA+Y+A+ FLG+ NTSSVQ  VA+ERTVFYRE+AAGMYS LPYA AQ
Sbjct  378  QKTGKQQDLLNLLGAMYSAIFFLGATNTSSVQPIVAIERTVFYREKAAGMYSPLPYAFAQ  437

Query  624  V  626
            V
Sbjct  438  V  438


 Score =   259 bits (663),  Expect(2) = 1e-147, Method: Compositional matrix adjust.
 Identities = 118/175 (67%), Positives = 141/175 (81%), Gaps = 0/175 (0%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  IEAIYV VQ+I Y+L+LY MIGFEW  GKFLWF YF+ TSFIYFTLYGMMLVALTPG
Sbjct  437   QVAIEAIYVTVQSICYTLVLYSMIGFEWDTGKFLWFLYFIITSFIYFTLYGMMLVALTPG  496

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
              Q AAI M+F L+FWNLF+GF++PR Q+P+WWRWYYW SP  W++YGL+ SQ+GDK   +
Sbjct  497   HQIAAIVMSFFLSFWNLFSGFLVPRSQIPIWWRWYYWLSPVAWTIYGLVASQVGDKNVDL  556

Query  1046  QVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
             QVPG G + +K FLK+  G+D+ FLP VA AH+ W  +FFFVFAYGI FLNFQRR
Sbjct  557   QVPGVGKVPLKMFLKENMGFDHNFLPVVAVAHLAWVFIFFFVFAYGIRFLNFQRR  611



>ref|XP_009352981.1| PREDICTED: ABC transporter G family member 34-like [Pyrus x bretschneideri]
Length=1451

 Score =   286 bits (733),  Expect(2) = 2e-147, Method: Compositional matrix adjust.
 Identities = 132/181 (73%), Positives = 156/181 (86%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              +A+PGVPKIK+GYNPATWMLE++   +E Q  VDFA+IY NS L+++NQELIKELSTP 
Sbjct  1098  FEAIPGVPKIKDGYNPATWMLEVTAPAVETQLDVDFADIYQNSSLYEKNQELIKELSTPA  1157

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             PGS+DLYFPTKYSQ F  QCKACFWK HWSYWRNPQYNA+RFF+TIV+GV+FG+IFW KG
Sbjct  1158  PGSKDLYFPTKYSQPFPVQCKACFWKMHWSYWRNPQYNAIRFFMTIVIGVLFGLIFWQKG  1217

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
              +   QQDL+N LGA+YAAV+FLG+ N S+VQ+ VA+ERTVFYRERAAGMYS LPYA AQ
Sbjct  1218  QQTAQQQDLMNFLGAMYAAVLFLGATNASAVQSVVAIERTVFYRERAAGMYSELPYAFAQ  1277

Query  624   V  626
             V
Sbjct  1278  V  1278


 Score =   265 bits (678),  Expect(2) = 2e-147, Method: Compositional matrix adjust.
 Identities = 121/175 (69%), Positives = 147/175 (84%), Gaps = 0/175 (0%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  IE IYVA+QT  Y+LLLY MIGF+WK+ KFLWFYY++   FIYFT+YGMM+VALTPG
Sbjct  1277  QVAIETIYVAIQTFIYTLLLYSMIGFKWKVEKFLWFYYYILMCFIYFTMYGMMVVALTPG  1336

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
              Q AAI M+F L+FWNLF+GF++PR Q+P+WWRWYYWASP  W+LYGL+TSQ+GDK + +
Sbjct  1337  HQIAAIVMSFFLSFWNLFSGFLIPRPQIPIWWRWYYWASPVAWTLYGLVTSQVGDKNADL  1396

Query  1046  QVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
              +PG G M +K+FLKD FG++Y FLP VAAAHVGW L+FFFVFAYGI FLNFQRR
Sbjct  1397  ILPGYGTMPLKKFLKDDFGFEYDFLPVVAAAHVGWVLIFFFVFAYGIKFLNFQRR  1451



>ref|XP_010658729.1| PREDICTED: pleiotropic drug resistance protein 2-like [Vitis 
vinifera]
Length=1456

 Score =   292 bits (747),  Expect(2) = 3e-147, Method: Compositional matrix adjust.
 Identities = 130/181 (72%), Positives = 157/181 (87%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              +AVPGVPK+++G NPATWMLE+S+A +EAQ GVDFAEIYA S L+QRNQELIK +STP 
Sbjct  1103  FEAVPGVPKVRDGQNPATWMLEVSSAAVEAQLGVDFAEIYAKSELYQRNQELIKVISTPS  1162

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             PGS++LYFPTKYSQSF+ QCKACFWKQHWSYWRNP YNA+R F+TI++GV+FG IF  KG
Sbjct  1163  PGSKNLYFPTKYSQSFITQCKACFWKQHWSYWRNPPYNAIRLFLTIIIGVLFGAIFRNKG  1222

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
              +   +QDL+NLLGA+++AV FLG+ NT++VQ  VA+ERTVFYRERAAGMYSAL YA AQ
Sbjct  1223  KQTDKEQDLINLLGAMFSAVFFLGTTNTAAVQPVVAIERTVFYRERAAGMYSALSYAFAQ  1282

Query  624   V  626
             V
Sbjct  1283  V  1283


 Score =   259 bits (662),  Expect(2) = 3e-147, Method: Compositional matrix adjust.
 Identities = 118/175 (67%), Positives = 144/175 (82%), Gaps = 0/175 (0%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  IEAIYVA+QT  YS LLY M+GF W++ KFLWFYY++F  FIYFTLYGMM+VALTP 
Sbjct  1282  QVAIEAIYVAIQTCLYSFLLYSMMGFYWRVDKFLWFYYYLFMCFIYFTLYGMMIVALTPS  1341

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
              Q AAI M+F L+FWNLF+GF++ R Q+P+WWRWYYWASP  W++YGL+TSQ+GDKE  V
Sbjct  1342  HQIAAIVMSFFLSFWNLFSGFLIHRMQIPIWWRWYYWASPVAWTIYGLVTSQVGDKEDPV  1401

Query  1046  QVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
             QVPG  DM++KQ+LK+  G++Y FL AVA AH+GW LLF FVFAYGI FL+FQRR
Sbjct  1402  QVPGADDMSVKQYLKEALGFEYDFLGAVALAHIGWVLLFLFVFAYGIKFLDFQRR  1456



>ref|XP_010244003.1| PREDICTED: pleiotropic drug resistance protein 2-like isoform 
X1 [Nelumbo nucifera]
Length=1459

 Score =   316 bits (810),  Expect(2) = 3e-147, Method: Compositional matrix adjust.
 Identities = 140/181 (77%), Positives = 163/181 (90%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              +AVPGVPKIK+GYNPATWMLE++T  +E Q G+DFAE+YANS L+QRNQELIKELSTP 
Sbjct  1106  FEAVPGVPKIKDGYNPATWMLEVTTTSVENQFGLDFAEVYANSSLYQRNQELIKELSTPA  1165

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             PGS+DL+FPTKYSQSF  QCKACFWKQHWSYWRNPQYNA+RFF+TIV+G +FG+IFW KG
Sbjct  1166  PGSKDLHFPTKYSQSFATQCKACFWKQHWSYWRNPQYNAIRFFLTIVIGALFGIIFWNKG  1225

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
             D+   QQDLLNLLGA+YAAV+FLG+ NTS+VQ+ VA+ERTVFYRERAAGMYS +PYA AQ
Sbjct  1226  DKTSKQQDLLNLLGAMYAAVLFLGATNTSAVQSVVAIERTVFYRERAAGMYSEMPYAFAQ  1285

Query  624   V  626
             V
Sbjct  1286  V  1286


 Score =   234 bits (598),  Expect(2) = 3e-147, Method: Compositional matrix adjust.
 Identities = 112/175 (64%), Positives = 141/175 (81%), Gaps = 0/175 (0%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  IE IYVA+QT+ Y+LLLY MIGF+W+  KF  FYYF+   FIYFT+YGMMLVALTPG
Sbjct  1285  QVAIETIYVAIQTLIYTLLLYSMIGFQWQADKFFLFYYFILMCFIYFTMYGMMLVALTPG  1344

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
              Q AAI M+F L+ WNLF+GF++PR Q+P+WWRWYYWASP  W+LYGL+ SQ+GDK++ +
Sbjct  1345  HQIAAIVMSFFLSLWNLFSGFLIPRPQIPIWWRWYYWASPVAWTLYGLVVSQVGDKDTPI  1404

Query  1046  QVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
             +VPG+G  T+K FLK + G+++ FL  V  AH+G+ LLFFFVFAYGI FLNFQRR
Sbjct  1405  EVPGQGTTTVKLFLKSYLGFEHDFLGPVVVAHIGFVLLFFFVFAYGIKFLNFQRR  1459



>ref|XP_008356632.1| PREDICTED: pleiotropic drug resistance protein 2-like [Malus 
domestica]
Length=1150

 Score =   284 bits (726),  Expect(2) = 3e-147, Method: Compositional matrix adjust.
 Identities = 132/181 (73%), Positives = 155/181 (86%), Gaps = 0/181 (0%)
 Frame = +3

Query  84   LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
             +A+PGVPKIK+GYNPATWMLE++   +E Q  VDFA+ Y NS L+Q NQELIKELSTP 
Sbjct  797  FEAIPGVPKIKDGYNPATWMLEVTAPAVETQLDVDFADXYQNSSLYQXNQELIKELSTPA  856

Query  264  PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
            PGS+DLYFPTK+SQ F  QCKACFWK HWSYWRNPQYNA+RFF+TIV+GV+FG+IFW KG
Sbjct  857  PGSKDLYFPTKFSQPFPVQCKACFWKMHWSYWRNPQYNAIRFFMTIVIGVLFGLIFWQKG  916

Query  444  DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
             +   QQDL+NLLGA+YAAV+FLG+ N S+VQ+ VA+ERTVFYRERAAGMYS LPYA AQ
Sbjct  917  QQTAQQQDLMNLLGAMYAAVLFLGATNASAVQSVVAIERTVFYRERAAGMYSELPYAFAQ  976

Query  624  V  626
            V
Sbjct  977  V  977


 Score =   267 bits (683),  Expect(2) = 3e-147, Method: Compositional matrix adjust.
 Identities = 123/175 (70%), Positives = 147/175 (84%), Gaps = 0/175 (0%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  IE IYVA+QT  Y+LLLY MIGFEWK+ KFLWFYY++   FIYFT+YGMM+VALTPG
Sbjct  976   QVAIETIYVAIQTFIYTLLLYSMIGFEWKVEKFLWFYYYILMCFIYFTMYGMMVVALTPG  1035

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
              Q AAI M+F L+FWNLF+GF++PR Q+P+WWRWYYWASP  W+LYGL+TSQ+GDK + +
Sbjct  1036  HQIAAIVMSFFLSFWNLFSGFLIPRPQIPIWWRWYYWASPVAWTLYGLVTSQVGDKNADL  1095

Query  1046  QVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
              +PG G M +K+FLKD  G++Y FLPAVAAAHVGW LLFFFVFAYGI FLNFQRR
Sbjct  1096  ILPGYGTMPLKKFLKDDLGFEYDFLPAVAAAHVGWVLLFFFVFAYGIKFLNFQRR  1150



>ref|XP_006381302.1| ABC transporter family protein [Populus trichocarpa]
 gb|ERP59099.1| ABC transporter family protein [Populus trichocarpa]
Length=1463

 Score =   290 bits (743),  Expect(2) = 5e-147, Method: Compositional matrix adjust.
 Identities = 128/181 (71%), Positives = 156/181 (86%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              +AVPGVPKI++ YNPATWMLEIS   +EAQ  VDFAE YANS L+QRNQE+IKELSTP 
Sbjct  1109  FEAVPGVPKIRDAYNPATWMLEISAPSMEAQLDVDFAEQYANSSLYQRNQEIIKELSTPA  1168

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             PGS+DLYF T+YSQ+F+ QCKACFWKQHWSYWRNP+YNA+R F+T+ +G++FG+IFW KG
Sbjct  1169  PGSKDLYFRTQYSQTFLTQCKACFWKQHWSYWRNPRYNAIRLFMTLAIGIIFGLIFWDKG  1228

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
              +  +QQDLLN+ GA+YAAV+FLG+ N + VQ+ +A+ERTVFYRERAAGMYS LPYA AQ
Sbjct  1229  QKTFSQQDLLNVFGAMYAAVLFLGATNAAGVQSIIAIERTVFYRERAAGMYSPLPYAFAQ  1288

Query  624   V  626
             V
Sbjct  1289  V  1289


 Score =   260 bits (664),  Expect(2) = 5e-147, Method: Compositional matrix adjust.
 Identities = 118/176 (67%), Positives = 146/176 (83%), Gaps = 1/176 (1%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  IEAIYVAVQTI YS+LL+ M+GFEW   KFLWFYYF+F  F+YFTL+GMM+VALTP 
Sbjct  1288  QVAIEAIYVAVQTIVYSILLFSMMGFEWTAAKFLWFYYFIFMCFVYFTLFGMMVVALTPA  1347

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
              Q AAI M+F  +FWNLF+GF+LPR Q+P+WWRWYYW SP  W+LYGL+TSQ+GDK + +
Sbjct  1348  PQIAAICMSFFTSFWNLFSGFLLPRPQIPIWWRWYYWCSPVAWTLYGLVTSQVGDKTNTI  1407

Query  1046  QVPGEG-DMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
              VPGE  D+ IK+FLK + G++Y FLPAVAAAH+GW +LFFF+F+YGI FLNFQ+R
Sbjct  1408  SVPGESEDVPIKEFLKGYLGFEYDFLPAVAAAHLGWVVLFFFLFSYGIKFLNFQKR  1463



>ref|XP_010244015.1| PREDICTED: pleiotropic drug resistance protein 2-like isoform 
X3 [Nelumbo nucifera]
Length=1269

 Score =   316 bits (809),  Expect(2) = 6e-147, Method: Compositional matrix adjust.
 Identities = 140/181 (77%), Positives = 163/181 (90%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              +AVPGVPKIK+GYNPATWMLE++T  +E Q G+DFAE+YANS L+QRNQELIKELSTP 
Sbjct  916   FEAVPGVPKIKDGYNPATWMLEVTTTSVENQFGLDFAEVYANSSLYQRNQELIKELSTPA  975

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             PGS+DL+FPTKYSQSF  QCKACFWKQHWSYWRNPQYNA+RFF+TIV+G +FG+IFW KG
Sbjct  976   PGSKDLHFPTKYSQSFATQCKACFWKQHWSYWRNPQYNAIRFFLTIVIGALFGIIFWNKG  1035

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
             D+   QQDLLNLLGA+YAAV+FLG+ NTS+VQ+ VA+ERTVFYRERAAGMYS +PYA AQ
Sbjct  1036  DKTSKQQDLLNLLGAMYAAVLFLGATNTSAVQSVVAIERTVFYRERAAGMYSEMPYAFAQ  1095

Query  624   V  626
             V
Sbjct  1096  V  1096


 Score =   234 bits (597),  Expect(2) = 6e-147, Method: Compositional matrix adjust.
 Identities = 112/175 (64%), Positives = 141/175 (81%), Gaps = 0/175 (0%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  IE IYVA+QT+ Y+LLLY MIGF+W+  KF  FYYF+   FIYFT+YGMMLVALTPG
Sbjct  1095  QVAIETIYVAIQTLIYTLLLYSMIGFQWQADKFFLFYYFILMCFIYFTMYGMMLVALTPG  1154

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
              Q AAI M+F L+ WNLF+GF++PR Q+P+WWRWYYWASP  W+LYGL+ SQ+GDK++ +
Sbjct  1155  HQIAAIVMSFFLSLWNLFSGFLIPRPQIPIWWRWYYWASPVAWTLYGLVVSQVGDKDTPI  1214

Query  1046  QVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
             +VPG+G  T+K FLK + G+++ FL  V  AH+G+ LLFFFVFAYGI FLNFQRR
Sbjct  1215  EVPGQGTTTVKLFLKSYLGFEHDFLGPVVVAHIGFVLLFFFVFAYGIKFLNFQRR  1269



>ref|XP_011018900.1| PREDICTED: pleiotropic drug resistance protein 2-like [Populus 
euphratica]
Length=1462

 Score =   290 bits (742),  Expect(2) = 2e-146, Method: Compositional matrix adjust.
 Identities = 127/181 (70%), Positives = 156/181 (86%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              +A+PGVPKIK+ YNPATWMLEIS   +EAQ  VDFAE YANS L+QRNQE+IKELSTP 
Sbjct  1108  FEAIPGVPKIKDAYNPATWMLEISAPSMEAQLDVDFAEQYANSSLYQRNQEIIKELSTPA  1167

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             PGS+DLYF T+YSQ+F+ QCKACFWKQHWSYWRNP+YNA+R F+T+ +G++FG+IFW KG
Sbjct  1168  PGSKDLYFQTQYSQTFLTQCKACFWKQHWSYWRNPRYNAIRLFMTLAIGIIFGLIFWDKG  1227

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
              +  +QQDLLN+ GA+YAAV+FLG+ N + VQ+ +A+ERTVFYRERAAGMYS +PYA AQ
Sbjct  1228  QKTFSQQDLLNVFGAMYAAVLFLGATNAAGVQSIIAIERTVFYRERAAGMYSPMPYAFAQ  1287

Query  624   V  626
             V
Sbjct  1288  V  1288


 Score =   259 bits (661),  Expect(2) = 2e-146, Method: Compositional matrix adjust.
 Identities = 117/176 (66%), Positives = 146/176 (83%), Gaps = 1/176 (1%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  IEAIYVAVQTI YS++L+ M+GFEW   KFLWFYYF+F  F+YFTL+GMM+VALTP 
Sbjct  1287  QVAIEAIYVAVQTIVYSIILFSMMGFEWTAAKFLWFYYFIFMCFVYFTLFGMMVVALTPA  1346

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
              Q AAI M+F  +FWNLF+GF+LPR Q+P+WWRWYYW SP  W+LYGL+TSQ+G+K + +
Sbjct  1347  PQIAAICMSFFTSFWNLFSGFLLPRPQIPIWWRWYYWCSPVAWTLYGLVTSQVGEKTNEI  1406

Query  1046  QVPGEG-DMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
              VPGE  D+ IKQFLK + G++Y FLPAVAAAH+GW +LFFF+F+YGI FLNFQ+R
Sbjct  1407  SVPGESEDVPIKQFLKGYLGFEYDFLPAVAAAHLGWVVLFFFLFSYGIKFLNFQKR  1462



>gb|KDP45005.1| hypothetical protein JCGZ_01505 [Jatropha curcas]
Length=1471

 Score =   293 bits (751),  Expect(2) = 2e-146, Method: Compositional matrix adjust.
 Identities = 131/181 (72%), Positives = 156/181 (86%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              +AVPGVPKIKNGYNPATWMLEIS+  +E Q  VDFAE+YANS L+Q+NQELI+ELSTP 
Sbjct  1118  FEAVPGVPKIKNGYNPATWMLEISSNAVETQLNVDFAEVYANSELYQKNQELIEELSTPA  1177

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             PGS+DLYFPT+YSQ F  QCKACF KQHWSYW+NP+YNA+R F+T+ +GV+FG+IFW KG
Sbjct  1178  PGSKDLYFPTQYSQDFFTQCKACFLKQHWSYWKNPRYNAIRLFMTVTVGVIFGLIFWDKG  1237

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
              +   QQDL NLLGA+Y+AV+FLG+ NTSSV + V+VERTVFYRE+AAGMYS LPYA AQ
Sbjct  1238  QKTQKQQDLFNLLGAMYSAVMFLGATNTSSVLSIVSVERTVFYREKAAGMYSELPYACAQ  1297

Query  624   V  626
             V
Sbjct  1298  V  1298


 Score =   255 bits (652),  Expect(2) = 2e-146, Method: Compositional matrix adjust.
 Identities = 117/175 (67%), Positives = 144/175 (82%), Gaps = 0/175 (0%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  IEAIYVA+QT+ YSLLLY MIGF+W+   FLWFY+F+F  F+YFTLYGMMLVALTPG
Sbjct  1297  QVAIEAIYVAIQTLIYSLLLYSMIGFQWRADNFLWFYFFIFMCFMYFTLYGMMLVALTPG  1356

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
              Q AAI M+F L+FWNLF+GF++PR Q+P+WWRWYYWASP  W++YGLITSQ+G     V
Sbjct  1357  HQIAAIVMSFFLSFWNLFSGFLIPRTQIPIWWRWYYWASPTAWTIYGLITSQVGKISENV  1416

Query  1046  QVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
             +VPG G M++K +LK++ G++Y FL AV AAH+G+ LLF FVFAYGI FLNFQRR
Sbjct  1417  EVPGVGFMSVKDYLKEYLGFEYDFLGAVIAAHIGFVLLFLFVFAYGIKFLNFQRR  1471



>emb|CDP06962.1| unnamed protein product [Coffea canephora]
Length=1385

 Score =   311 bits (796),  Expect(2) = 4e-146, Method: Compositional matrix adjust.
 Identities = 140/181 (77%), Positives = 162/181 (90%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              +AVPGVPKIK GYNPATWML++ST+ +EAQ  VDFAEIYANS L++RNQELIKELS P 
Sbjct  1031  FEAVPGVPKIKEGYNPATWMLDVSTSAMEAQLEVDFAEIYANSDLYRRNQELIKELSAPE  1090

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             PGS+DLYFPT+YSQSF+ QCKACFWKQHWSYWRN QYNA+RFF+T+V+G+MFGVIFW KG
Sbjct  1091  PGSRDLYFPTQYSQSFLVQCKACFWKQHWSYWRNSQYNAIRFFMTVVIGIMFGVIFWDKG  1150

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
              +I  QQDLLN+LGAIYAAV+FLG+ N S+VQ+ VA+ERTVFYRERAAGMYS LPYA AQ
Sbjct  1151  TKIFRQQDLLNILGAIYAAVLFLGATNASAVQSVVAIERTVFYRERAAGMYSELPYAFAQ  1210

Query  624   V  626
             V
Sbjct  1211  V  1211


 Score =   236 bits (603),  Expect(2) = 4e-146, Method: Compositional matrix adjust.
 Identities = 109/176 (62%), Positives = 137/176 (78%), Gaps = 1/176 (1%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  IE IYVA+QT+ Y+LLLY MIGF+W   KFL+FYYF+F  + YF++YGMM+VALTPG
Sbjct  1210  QVAIETIYVAIQTLVYTLLLYSMIGFDWTAEKFLYFYYFIFMCYAYFSMYGMMVVALTPG  1269

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
              Q AAI M+F L+FWNLF+GF++PR  +PVWWRWYYW SP  WS+YG+  SQ+ D+ + +
Sbjct  1270  HQIAAIVMSFFLSFWNLFSGFLIPRPLIPVWWRWYYWCSPVAWSIYGIFASQIADRTTGI  1329

Query  1046  QVPG-EGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
             +VPG +  + I QFLK++ GYD+ FL  V  AHVGW L FFFVFAYGI FLNFQRR
Sbjct  1330  EVPGSDTKVPINQFLKEYLGYDHDFLIPVVFAHVGWVLCFFFVFAYGIKFLNFQRR  1385



>ref|XP_009352982.1| PREDICTED: pleiotropic drug resistance protein 2-like [Pyrus 
x bretschneideri]
Length=1451

 Score =   286 bits (733),  Expect(2) = 7e-146, Method: Compositional matrix adjust.
 Identities = 134/181 (74%), Positives = 155/181 (86%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              +A+PGVPKIK+GYNPATWMLE++   +E Q  VDFA+IY NS L+QRNQELIKELSTP 
Sbjct  1098  FEAIPGVPKIKDGYNPATWMLEVTAPAVETQLDVDFADIYQNSSLYQRNQELIKELSTPA  1157

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             PGS+DLYFPTKYSQ F  QCKACFWK HWSYWRNPQYNA+RFF+TIV+GV+FG+IFW KG
Sbjct  1158  PGSKDLYFPTKYSQPFPVQCKACFWKMHWSYWRNPQYNAIRFFMTIVIGVLFGLIFWQKG  1217

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
              +   QQDL+NLLGA+YAAV+FLG+ N S V+  VA+ERTVFYRERAAGMYS LPYA AQ
Sbjct  1218  QQTAQQQDLMNLLGAMYAAVLFLGTTNASVVRFVVAIERTVFYRERAAGMYSELPYAFAQ  1277

Query  624   V  626
             V
Sbjct  1278  V  1278


 Score =   260 bits (665),  Expect(2) = 7e-146, Method: Compositional matrix adjust.
 Identities = 118/175 (67%), Positives = 146/175 (83%), Gaps = 0/175 (0%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  IE +YVA+QT  Y+LLL+ MIGF+WK+ KF+WFYY++   FIYFT+YGMM+VALTPG
Sbjct  1277  QVAIETVYVAIQTFIYTLLLFSMIGFKWKVEKFIWFYYYILMCFIYFTMYGMMVVALTPG  1336

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
              Q AAI M+F L FWNLF+GF++PR Q+P+WWRWYYWASP  W++YGL+TSQ+GDK + +
Sbjct  1337  HQIAAIVMSFFLGFWNLFSGFLIPRPQIPIWWRWYYWASPVAWTVYGLVTSQVGDKNADL  1396

Query  1046  QVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
              +PG G M +K+FLKD FG++Y FLP VAAAHVGW LLFFFVFAYGI FLNFQRR
Sbjct  1397  ILPGYGTMPLKKFLKDDFGFEYDFLPVVAAAHVGWVLLFFFVFAYGIKFLNFQRR  1451



>ref|XP_008349787.1| PREDICTED: pleiotropic drug resistance protein 2-like [Malus 
domestica]
Length=1437

 Score =   305 bits (781),  Expect(2) = 8e-146, Method: Compositional matrix adjust.
 Identities = 136/181 (75%), Positives = 159/181 (88%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              +A+ GV KIK GYNPATWMLEIS+  +EAQ  +DF+E+YANS L+QRNQELIKELSTP 
Sbjct  1084  FEAIEGVQKIKEGYNPATWMLEISSTAVEAQLNLDFSEVYANSDLYQRNQELIKELSTPQ  1143

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             PGS+DL+FPTKYSQSF+ QCKACFWKQ WSYWRN QYNA+RFF+TIV+G++FGVIFWGKG
Sbjct  1144  PGSKDLHFPTKYSQSFITQCKACFWKQQWSYWRNSQYNAIRFFMTIVIGILFGVIFWGKG  1203

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
              +IH QQDL+NLLGA Y+AV+FLG+ N SSVQ  VA+ERTVFYRERAAGMYS LPYA +Q
Sbjct  1204  SQIHKQQDLINLLGATYSAVLFLGASNASSVQTVVAIERTVFYRERAAGMYSELPYAFSQ  1263

Query  624   V  626
             V
Sbjct  1264  V  1264


 Score =   241 bits (616),  Expect(2) = 8e-146, Method: Compositional matrix adjust.
 Identities = 107/175 (61%), Positives = 139/175 (79%), Gaps = 0/175 (0%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  IE IYVA+QT  YSLLLY MIG+ WK+ KFL+FYYF+F  F YF++YGMM+VALTPG
Sbjct  1263  QVAIETIYVAIQTFIYSLLLYSMIGYHWKVEKFLYFYYFIFMCFTYFSMYGMMVVALTPG  1322

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
              Q AA+ M+F ++FWNLF+GF++PR  +P+WWRWYYW SP  W++YG+ TSQ+GDK++ +
Sbjct  1323  SQIAAVVMSFFISFWNLFSGFLIPRPLIPIWWRWYYWCSPVAWTIYGVFTSQVGDKKTLL  1382

Query  1046  QVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
             ++PG     +  FLK++ GYDY FL AV  AH+GW LLFFF+FAYGI FLNFQ+R
Sbjct  1383  EIPGSAPKPVDAFLKEYLGYDYDFLVAVVFAHLGWVLLFFFIFAYGIRFLNFQKR  1437



>ref|XP_009374757.1| PREDICTED: pleiotropic drug resistance protein 2-like [Pyrus 
x bretschneideri]
Length=1452

 Score =   281 bits (719),  Expect(2) = 1e-145, Method: Compositional matrix adjust.
 Identities = 130/181 (72%), Positives = 157/181 (87%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              +A+PGV KIK+G NPATWML+++   +EAQ  VDFA+IYANS L++RNQELIKELSTP 
Sbjct  1099  FKAIPGVTKIKDGCNPATWMLDVTAPAVEAQLDVDFADIYANSLLYKRNQELIKELSTPA  1158

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             PGS+DLYFPTKYSQ F  QCKACFWK +WSYWRNPQYNA+RFF+TIV+GV+FG+IFW KG
Sbjct  1159  PGSKDLYFPTKYSQPFSIQCKACFWKMYWSYWRNPQYNAIRFFITIVIGVLFGIIFWQKG  1218

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
              +   QQDL+NLLGA++AAV+FLG+ N S+VQ+ VA+ERTVFYRERAAGMYS LPYA +Q
Sbjct  1219  QQTAQQQDLMNLLGALFAAVLFLGATNASAVQSVVAIERTVFYRERAAGMYSELPYAFSQ  1278

Query  624   V  626
             V
Sbjct  1279  V  1279


 Score =   265 bits (677),  Expect(2) = 1e-145, Method: Compositional matrix adjust.
 Identities = 123/175 (70%), Positives = 143/175 (82%), Gaps = 0/175 (0%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  IE IYVA+QT  Y+LLLY MIGFEWK+GKFLWFYY++   FIYFT+YGMM+VALTPG
Sbjct  1278  QVAIETIYVAIQTFIYTLLLYSMIGFEWKIGKFLWFYYYILMCFIYFTMYGMMVVALTPG  1337

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
              Q AAI M+F L  WNLF+GF++PR Q+P+WWRWYYWASP  W+LYGL+ SQLGDK   +
Sbjct  1338  YQIAAIVMSFFLIIWNLFSGFLIPRPQIPIWWRWYYWASPVAWTLYGLVMSQLGDKNVDI  1397

Query  1046  QVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
              +PG G M +K FLKD FG++Y FLPAVAAAHVGW LLF FVFAYGI FLNFQRR
Sbjct  1398  VLPGYGTMPLKMFLKDAFGFEYDFLPAVAAAHVGWVLLFCFVFAYGIKFLNFQRR  1452



>gb|KHG04563.1| Pleiotropic drug resistance 2 [Gossypium arboreum]
Length=752

 Score =   298 bits (762),  Expect(2) = 1e-145, Method: Compositional matrix adjust.
 Identities = 132/181 (73%), Positives = 159/181 (88%), Gaps = 0/181 (0%)
 Frame = +3

Query  84   LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
             +A+PGVPKIK GYNPATWMLEIS+  +EAQ  VDF+EIYA S L+++N+ELIK+LSTP 
Sbjct  399  FEAIPGVPKIKEGYNPATWMLEISSTAVEAQLDVDFSEIYAKSELYRKNEELIKDLSTPV  458

Query  264  PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
            PG +DL+FPT YSQ F  QCKACFWKQH SYWRNPQYNA+RFF+T  +G++FG+IFWGKG
Sbjct  459  PGIKDLHFPTTYSQGFFTQCKACFWKQHNSYWRNPQYNAIRFFMTFFVGIIFGMIFWGKG  518

Query  444  DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
            D+IH QQDL+NLLGA+Y+AV+FLG+ NTS+VQ+ VA+ERTVFYRERAAGMYS LPYA AQ
Sbjct  519  DKIHKQQDLMNLLGAMYSAVLFLGATNTSAVQSVVAIERTVFYRERAAGMYSPLPYAFAQ  578

Query  624  V  626
            V
Sbjct  579  V  579


 Score =   248 bits (633),  Expect(2) = 1e-145, Method: Compositional matrix adjust.
 Identities = 113/175 (65%), Positives = 139/175 (79%), Gaps = 0/175 (0%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  IEAIYV++QT+ YS+LLY MIGF   +GKF  FYYF+   F+YFTLYGMMLVALTP 
Sbjct  578   QVAIEAIYVSIQTLVYSILLYSMIGFHMDVGKFFLFYYFILMCFMYFTLYGMMLVALTPN  637

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
              QFAAI M+F L+FWNLF+GF++PR ++P+WWRWYYWASP  W++ GL+TSQ+GDK+  V
Sbjct  638   HQFAAIVMSFFLSFWNLFSGFLIPRTEIPIWWRWYYWASPVAWTINGLVTSQVGDKDDPV  697

Query  1046  QVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
              +PGE  MT+K +L+   G+ Y FLP V AAH+GW LLF FVFAYGI FLNFQRR
Sbjct  698   VIPGELPMTVKAYLETHLGFRYDFLPVVVAAHIGWVLLFLFVFAYGIKFLNFQRR  752



>ref|XP_008231976.1| PREDICTED: pleiotropic drug resistance protein 2-like [Prunus 
mume]
Length=1465

 Score =   293 bits (751),  Expect(2) = 1e-145, Method: Compositional matrix adjust.
 Identities = 127/181 (70%), Positives = 159/181 (88%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              +A+PG+ KI++GYNPATWMLEIS+  +E Q  VDFA+IY  S L+++NQELI+ELSTP 
Sbjct  1112  FEAIPGITKIRDGYNPATWMLEISSPTVETQLNVDFADIYQKSELYKKNQELIEELSTPV  1171

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             PGS+DL+FPTKYSQSF+ QCKACFWKQHWSYWRNP YNA+R F+++V+G +FG+IFW KG
Sbjct  1172  PGSKDLHFPTKYSQSFLTQCKACFWKQHWSYWRNPPYNAIRLFLSMVVGTIFGLIFWNKG  1231

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
             ++ H +QDLLNL+GA+Y+A+IFLG+ NT+SVQ  VA+ERTVFYRERAAGMYSALPYA AQ
Sbjct  1232  EKTHKEQDLLNLMGAMYSAIIFLGATNTASVQPVVAIERTVFYRERAAGMYSALPYAFAQ  1291

Query  624   V  626
             V
Sbjct  1292  V  1292


 Score =   252 bits (644),  Expect(2) = 1e-145, Method: Compositional matrix adjust.
 Identities = 114/175 (65%), Positives = 141/175 (81%), Gaps = 0/175 (0%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  IE IYVAVQT+ YSL+LY MIGF W++ KF WFYYF+   FIYFTLYGMMLVALTPG
Sbjct  1291  QVAIETIYVAVQTLVYSLILYSMIGFPWRVDKFFWFYYFILMCFIYFTLYGMMLVALTPG  1350

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
              Q AAI M+F L+FWNLF+GF++PR Q+P+WWRWYYW SP  W++YGL+TSQ+GDK S V
Sbjct  1351  HQIAAIVMSFFLSFWNLFSGFLIPRTQIPIWWRWYYWGSPVAWTIYGLVTSQVGDKTSLV  1410

Query  1046  QVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
             +VPG+  M+++ +LK   G++Y FL AV  AH+G+ LLF FVFAYGI +LNFQRR
Sbjct  1411  EVPGQARMSVQTYLKTRLGFEYDFLGAVVVAHIGFVLLFLFVFAYGIKYLNFQRR  1465



>ref|XP_004291545.1| PREDICTED: pleiotropic drug resistance protein 2-like [Fragaria 
vesca subsp. vesca]
Length=1421

 Score =   302 bits (774),  Expect(2) = 3e-145, Method: Compositional matrix adjust.
 Identities = 133/181 (73%), Positives = 160/181 (88%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              +++ GV KI++GYNPATWMLEIS+  +E Q  +DFAE+YANS L++RNQELIKELSTP 
Sbjct  1068  FESIQGVQKIRDGYNPATWMLEISSTAVETQLHIDFAEVYANSNLYRRNQELIKELSTPQ  1127

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
              GS+DLYFPT+YSQSF+ QCKACFWKQHWSYWRN  YNA+RFF+T+V+G++FGVIFWGKG
Sbjct  1128  LGSKDLYFPTRYSQSFLTQCKACFWKQHWSYWRNSHYNAIRFFMTVVIGILFGVIFWGKG  1187

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
             D+IH QQDL+NLLGA YAAV+FLG+ N S+VQ+ VA+ERTVFYRERAAGMYS LPYA AQ
Sbjct  1188  DKIHKQQDLINLLGATYAAVLFLGASNASAVQSVVAIERTVFYRERAAGMYSELPYAFAQ  1247

Query  624   V  626
             V
Sbjct  1248  V  1248


 Score =   243 bits (619),  Expect(2) = 3e-145, Method: Compositional matrix adjust.
 Identities = 110/175 (63%), Positives = 137/175 (78%), Gaps = 0/175 (0%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  IE IYVA+QT  Y+LLLY MIG++WK+ KFL+FYYF+F  F YF++YGMM+VALTPG
Sbjct  1247  QVAIETIYVAIQTFIYALLLYSMIGYQWKVAKFLYFYYFIFMCFTYFSMYGMMVVALTPG  1306

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
              Q AAI M+F L+FWNLF+GF++PR  +P+WWRWYYW SP  W++YG+ TSQ+GD +S +
Sbjct  1307  HQIAAIVMSFFLSFWNLFSGFLIPRPLIPIWWRWYYWCSPVAWTIYGIFTSQVGDNKSLL  1366

Query  1046  QVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
              +PG     +  FLK++ GYDY FL  V  AHVGW LLFFFVFAYGI FLNFQRR
Sbjct  1367  DIPGATPKAVDAFLKEYLGYDYDFLVPVVLAHVGWVLLFFFVFAYGIKFLNFQRR  1421



>ref|XP_009356106.1| PREDICTED: pleiotropic drug resistance protein 2-like [Pyrus 
x bretschneideri]
Length=1472

 Score =   299 bits (766),  Expect(2) = 3e-145, Method: Compositional matrix adjust.
 Identities = 130/181 (72%), Positives = 162/181 (90%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              +A+PG+ KI++GYNPATWMLEI++  +E++  VDFA+IYANS L+++NQELI ELSTP 
Sbjct  1119  FEAIPGITKIRDGYNPATWMLEITSPAVESRLNVDFADIYANSELYRKNQELITELSTPV  1178

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             PGS+DLYFPTKYSQSF+ QCKACFWKQHWSYWRNP YNA+R F+T+V+G++FG+IFW KG
Sbjct  1179  PGSKDLYFPTKYSQSFLTQCKACFWKQHWSYWRNPPYNAIRLFLTVVVGIIFGLIFWNKG  1238

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
             D+ + +QDLLNL+GA+Y+AV+FLG+ NT+SVQ  VAVERTVFYRERAAGMYSALPYA AQ
Sbjct  1239  DQTYKEQDLLNLVGAMYSAVLFLGATNTASVQPIVAVERTVFYRERAAGMYSALPYAFAQ  1298

Query  624   V  626
             V
Sbjct  1299  V  1299


 Score =   245 bits (626),  Expect(2) = 3e-145, Method: Compositional matrix adjust.
 Identities = 111/175 (63%), Positives = 139/175 (79%), Gaps = 0/175 (0%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  IE IYVA+QT++YSL+L+ M+GF W + KF WFYYF+   FIYFTLYGMMLVALTPG
Sbjct  1298  QVAIETIYVAIQTLAYSLILFSMMGFTWHVDKFFWFYYFILMCFIYFTLYGMMLVALTPG  1357

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
              Q AAI M+F L+FWNLF+GF+LPR Q+P+WWRWYYW SP  W++YGL+TSQ+GD+ S V
Sbjct  1358  HQIAAIVMSFFLSFWNLFSGFLLPRMQIPIWWRWYYWGSPVAWTIYGLVTSQVGDRTSLV  1417

Query  1046  QVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
             +VPGE  M+++ +LK   G++Y FL AV  AH+G+ LLF FVFAYGI  LNFQ R
Sbjct  1418  EVPGEARMSVQMYLKTRLGFEYDFLGAVVVAHIGFVLLFLFVFAYGIKCLNFQTR  1472



>ref|XP_007162869.1| hypothetical protein PHAVU_001G187900g [Phaseolus vulgaris]
 gb|ESW34863.1| hypothetical protein PHAVU_001G187900g [Phaseolus vulgaris]
Length=1452

 Score =   286 bits (731),  Expect(2) = 6e-145, Method: Compositional matrix adjust.
 Identities = 132/181 (73%), Positives = 151/181 (83%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              +AVPGVPKIKNGYNPATWML+IS+  +EA   VDFAEIYA S L++RN+ELI+ELSTP 
Sbjct  1099  FEAVPGVPKIKNGYNPATWMLDISSTLVEANLEVDFAEIYAKSTLYRRNEELIQELSTPS  1158

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             P S+DLYFPTKYSQSF  QCKA FWKQ+WSYWR PQYN VRF +TIV G+MFG IFW K 
Sbjct  1159  PDSKDLYFPTKYSQSFFVQCKANFWKQYWSYWRYPQYNVVRFLMTIVEGIMFGAIFWNKA  1218

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
              + H QQDL NLLGA+YAAV F+G++N SSVQ  VA+ERT+FYRERAAGMYSALPYA  Q
Sbjct  1219  HKTHKQQDLGNLLGAMYAAVFFMGAMNASSVQPVVAIERTIFYRERAAGMYSALPYAFGQ  1278

Query  624   V  626
             V
Sbjct  1279  V  1279


 Score =   258 bits (658),  Expect(2) = 6e-145, Method: Compositional matrix adjust.
 Identities = 116/175 (66%), Positives = 142/175 (81%), Gaps = 0/175 (0%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  IEAIY A+QT  Y+L+L+  IGF+WK   F WFYY++F SF+YFTLYGMM+VALTPG
Sbjct  1278  QVAIEAIYNAIQTAIYALMLFSTIGFDWKATSFFWFYYYIFMSFMYFTLYGMMIVALTPG  1337

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
              Q AAI M+F L+FWNLF+GFI+PR Q+P+WWRWYYWASP  W+LYGLITSQLGD+   +
Sbjct  1338  HQVAAICMSFFLSFWNLFSGFIIPRMQIPIWWRWYYWASPVSWTLYGLITSQLGDRNVEL  1397

Query  1046  QVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
             ++PG G M +K+FLK  FG++Y FLP VAA HVGW +LF FVFAYGI FLNFQ+R
Sbjct  1398  EIPGNGTMQLKEFLKQNFGFEYDFLPVVAAVHVGWVILFLFVFAYGIKFLNFQKR  1452



>gb|KHG09700.1| Pleiotropic drug resistance 2 [Gossypium arboreum]
Length=1115

 Score =   296 bits (757),  Expect(2) = 7e-145, Method: Compositional matrix adjust.
 Identities = 131/181 (72%), Positives = 159/181 (88%), Gaps = 0/181 (0%)
 Frame = +3

Query  84   LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
             +AVPGVPKI+ GYNPATWMLEIS+  +EAQ  VDFAEIYANS L+++N+ELIK+L TP 
Sbjct  762  FEAVPGVPKIQGGYNPATWMLEISSTAVEAQLDVDFAEIYANSELYRKNEELIKDLCTPV  821

Query  264  PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
            PG++DL+FPT YSQ F  QCKACFWKQ+ SYWRNPQYNA+RFF+T  +G++FGVIFW KG
Sbjct  822  PGTRDLHFPTTYSQDFFTQCKACFWKQYHSYWRNPQYNAIRFFMTFFVGIIFGVIFWDKG  881

Query  444  DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
            ++IH QQDL+NLLGA+Y+AV+FLG+ NTS+VQ+ VA+ERTVFYRERAAGMYS LPYA AQ
Sbjct  882  NKIHKQQDLMNLLGAMYSAVLFLGATNTSAVQSVVAIERTVFYRERAAGMYSPLPYAFAQ  941

Query  624  V  626
            V
Sbjct  942  V  942


 Score =   248 bits (632),  Expect(2) = 7e-145, Method: Compositional matrix adjust.
 Identities = 113/175 (65%), Positives = 140/175 (80%), Gaps = 0/175 (0%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  IEAIYV++QT+ YS+LLY MIGF+ ++G+F  FY+F+   F+YFTLYGMMLVALTP 
Sbjct  941   QVAIEAIYVSIQTLVYSILLYTMIGFQMEVGRFFMFYFFILMCFMYFTLYGMMLVALTPN  1000

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
              QFAAI M+F L+FWNLF+GF++PR ++P+WWRWYYWASP  W++YGL+TSQ+GDK   V
Sbjct  1001  HQFAAIIMSFFLSFWNLFSGFLIPRTEIPIWWRWYYWASPVAWTIYGLVTSQVGDKSDMV  1060

Query  1046  QVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
                GE  + IK FL+   G+DY FLPAV AAH+GW LLF FVFAYGI FLNFQRR
Sbjct  1061  VTTGEIPIAIKDFLEKSLGFDYSFLPAVVAAHIGWVLLFLFVFAYGIKFLNFQRR  1115



>ref|XP_007221392.1| hypothetical protein PRUPE_ppa000185mg [Prunus persica]
 gb|EMJ22591.1| hypothetical protein PRUPE_ppa000185mg [Prunus persica]
Length=1499

 Score =   291 bits (745),  Expect(2) = 8e-145, Method: Compositional matrix adjust.
 Identities = 126/181 (70%), Positives = 158/181 (87%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              +A+PG+ +I++GYNPATWMLEIS+  +E Q  VDFA+IY  S L+++N ELI+ELSTP 
Sbjct  1146  FEAIPGITEIRDGYNPATWMLEISSPTVETQLNVDFADIYQKSELYKKNHELIEELSTPV  1205

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             PGS+DL+FPTKYSQSF+ QCKACFWKQHWSYWRNP YNA+R F++IV+G +FG+IFW KG
Sbjct  1206  PGSKDLHFPTKYSQSFLTQCKACFWKQHWSYWRNPPYNAIRLFLSIVVGTIFGLIFWNKG  1265

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
             ++ H +QDLLNL+GA+Y+A+IFLG+ NT+SVQ  VA+ERTVFYRERAAGMYSALPYA AQ
Sbjct  1266  EKTHKEQDLLNLMGAMYSAIIFLGATNTASVQPVVAIERTVFYRERAAGMYSALPYAFAQ  1325

Query  624   V  626
             V
Sbjct  1326  V  1326


 Score =   252 bits (644),  Expect(2) = 8e-145, Method: Compositional matrix adjust.
 Identities = 114/175 (65%), Positives = 141/175 (81%), Gaps = 0/175 (0%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  IE IYVAVQT+ YSL+LY MIGF W++ KF WFYYF+   FIYFTLYGMMLVALTPG
Sbjct  1325  QVAIETIYVAVQTLMYSLILYSMIGFPWRVDKFFWFYYFILMCFIYFTLYGMMLVALTPG  1384

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
              Q AAI M+F L+FWNLF+GF++PR Q+P+WWRWYYW SP  W++YGL+TSQ+GDK S V
Sbjct  1385  HQIAAIVMSFFLSFWNLFSGFLIPRTQIPIWWRWYYWGSPVAWTIYGLVTSQVGDKTSLV  1444

Query  1046  QVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
             +VPG+  M+++ +LK   G++Y FL AV  AH+G+ LLF FVFAYGI +LNFQRR
Sbjct  1445  EVPGQARMSVQTYLKRRLGFEYDFLGAVVVAHIGFVLLFLFVFAYGIKYLNFQRR  1499



>ref|XP_008391811.1| PREDICTED: LOW QUALITY PROTEIN: ABC transporter G family member 
34-like [Malus domestica]
Length=1451

 Score =   282 bits (722),  Expect(2) = 1e-144, Method: Compositional matrix adjust.
 Identities = 132/181 (73%), Positives = 153/181 (85%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              +A+PGVPKIK+GYNPATWMLE++   +E Q  VDFA+ Y NS L+QRNQELIKELSTP 
Sbjct  1098  FEAIPGVPKIKDGYNPATWMLEVTAPAVETQLDVDFADXYQNSSLYQRNQELIKELSTPA  1157

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             PGS+DLYFPTKYSQ F  QCKACFWK HWSYWRNPQYNA+RFF+TIV+GV+FG+IFW KG
Sbjct  1158  PGSKDLYFPTKYSQPFPVQCKACFWKMHWSYWRNPQYNAIRFFMTIVIGVLFGLIFWQKG  1217

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
              +   QQDL+NLLGA+YAAV+ LG+ N S V+  VA+ERTVFYRERAAGMYS LPYA AQ
Sbjct  1218  QQTAQQQDLMNLLGAMYAAVLXLGTTNASVVRFVVAIERTVFYRERAAGMYSELPYAFAQ  1277

Query  624   V  626
             V
Sbjct  1278  V  1278


 Score =   260 bits (665),  Expect(2) = 1e-144, Method: Compositional matrix adjust.
 Identities = 119/175 (68%), Positives = 143/175 (82%), Gaps = 0/175 (0%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  IE  YVA+QT  Y+LLL+ MIGF WK+ KF WFYY++   FIYFT+YGMM+VALTPG
Sbjct  1277  QVAIETXYVAIQTFIYTLLLFSMIGFXWKVEKFJWFYYYILMCFIYFTMYGMMVVALTPG  1336

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
              Q A I M F L+FWNLF+GF++PR Q+P+WWRWYYWASP  W+LYGL+TSQ+GDK + +
Sbjct  1337  HQIAVIVMPFFLSFWNLFSGFLIPRPQIPIWWRWYYWASPVAWTLYGLVTSQVGDKNADL  1396

Query  1046  QVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
              +PG G M +K+FLKD FG++Y FLPAVAAAHVGW LLFFFVFAYGI FLNFQRR
Sbjct  1397  ILPGYGTMPLKKFLKDDFGFEYDFLPAVAAAHVGWVLLFFFVFAYGIKFLNFQRR  1451



>ref|XP_007208416.1| hypothetical protein PRUPE_ppa000235mg [Prunus persica]
 gb|EMJ09615.1| hypothetical protein PRUPE_ppa000235mg [Prunus persica]
Length=1420

 Score =   312 bits (799),  Expect(2) = 2e-144, Method: Compositional matrix adjust.
 Identities = 138/181 (76%), Positives = 162/181 (90%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              +A+PGV KIK GYNPATWMLE+S+A IEAQ  VDFAEI+ANS L++RNQELIKELS P 
Sbjct  1067  FEAIPGVSKIKEGYNPATWMLEVSSASIEAQNDVDFAEIFANSDLYRRNQELIKELSVPE  1126

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             PGS+DLYFPT+YSQSF+ QCKACFWKQHWSYWRN +YNA+RFF+TI +GV+FG+IFWGKG
Sbjct  1127  PGSKDLYFPTQYSQSFLTQCKACFWKQHWSYWRNSRYNAIRFFMTICIGVLFGIIFWGKG  1186

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
             D+IH QQDL+NLLGA Y+A++FLG+ N S+VQ+ VAVERTVFYRERAAGMYS LPYA AQ
Sbjct  1187  DDIHKQQDLINLLGATYSAILFLGASNASAVQSVVAVERTVFYRERAAGMYSELPYAFAQ  1246

Query  624   V  626
             V
Sbjct  1247  V  1247


 Score =   230 bits (586),  Expect(2) = 2e-144, Method: Compositional matrix adjust.
 Identities = 106/175 (61%), Positives = 135/175 (77%), Gaps = 0/175 (0%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  IE IYVA+QT+ YS LL+ MIG+ +K+ KFL+FYYF+F  F YF++YGMM+VALTPG
Sbjct  1246  QVAIETIYVAIQTLVYSCLLFFMIGYNFKVEKFLYFYYFIFMCFTYFSMYGMMVVALTPG  1305

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
              Q AAI M+F L+FWNLF+GF++PR  +P+WWRWYYW SP  W++YG+ TSQ+GD ++ +
Sbjct  1306  HQIAAITMSFFLSFWNLFSGFLIPRPLIPIWWRWYYWGSPVAWTIYGIFTSQVGDIKTEI  1365

Query  1046  QVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
              V  +    +  FLK+F G+DY FL  V  AHVGW LLFFFVFAYGI FLNFQRR
Sbjct  1366  TVNIDEKKAVDVFLKEFLGFDYDFLIPVVVAHVGWVLLFFFVFAYGIKFLNFQRR  1420



>ref|XP_008360438.1| PREDICTED: pleiotropic drug resistance protein 2-like [Malus 
domestica]
Length=1448

 Score =   310 bits (795),  Expect(2) = 3e-144, Method: Compositional matrix adjust.
 Identities = 139/181 (77%), Positives = 160/181 (88%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              +A+PGV KIK GYNPATWMLE+S+A IEAQ  VDFAEI+ANS L++RNQELIKELS P 
Sbjct  1095  FEAIPGVAKIKEGYNPATWMLEVSSAAIEAQNDVDFAEIFANSDLYKRNQELIKELSIPE  1154

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             PGS DLYFPT+YSQSF  QCKACFWKQHWSYWRN +YNA+RFF+TI +GV+FGVIFWGKG
Sbjct  1155  PGSSDLYFPTQYSQSFATQCKACFWKQHWSYWRNSRYNAIRFFMTICIGVLFGVIFWGKG  1214

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
             D+IH QQDL+NLLGA Y+A++FLG+ N S+VQ+ VAVERTVFYRERAAGMYS LPYA AQ
Sbjct  1215  DKIHKQQDLINLLGATYSAILFLGASNASAVQSVVAVERTVFYRERAAGMYSELPYAFAQ  1274

Query  624   V  626
             V
Sbjct  1275  V  1275


 Score =   231 bits (588),  Expect(2) = 3e-144, Method: Compositional matrix adjust.
 Identities = 105/175 (60%), Positives = 136/175 (78%), Gaps = 0/175 (0%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  IE IYVA+QT  YS LL+ MIG+ +K+ KFL+FYYF+F  F YF++YGMM+VALTPG
Sbjct  1274  QVAIETIYVAIQTFVYSCLLFFMIGYNFKVEKFLYFYYFIFMCFTYFSMYGMMVVALTPG  1333

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
              Q AAI M+F L+FWNLF+GF++PR  +P+WWRWYYW SP  W++YG+ TSQ+GD ++ +
Sbjct  1334  HQIAAIVMSFFLSFWNLFSGFLIPRPLIPIWWRWYYWGSPVAWTIYGIFTSQVGDMKTNI  1393

Query  1046  QVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
              +P +G   I  FLK++ G+DY FL  V  AH+GW LLFFFVFAYGI +LNFQRR
Sbjct  1394  DIPIQGPQKIDVFLKNYLGFDYDFLIPVVIAHLGWVLLFFFVFAYGIKYLNFQRR  1448



>ref|XP_009364873.1| PREDICTED: pleiotropic drug resistance protein 2-like [Pyrus 
x bretschneideri]
Length=1448

 Score =   310 bits (794),  Expect(2) = 9e-144, Method: Compositional matrix adjust.
 Identities = 138/181 (76%), Positives = 160/181 (88%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              +A+PGV KIK GYNPATWMLE+S+A IEAQ  VDFAEI+ANS L++RNQELIKELS P 
Sbjct  1095  FEAIPGVAKIKEGYNPATWMLEVSSAAIEAQNDVDFAEIFANSDLYRRNQELIKELSVPE  1154

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             PGS DLYFPT+YSQSF  QCKACFWKQHWSYWRN +YNA+RFF+TI +G++FGVIFWGKG
Sbjct  1155  PGSSDLYFPTQYSQSFATQCKACFWKQHWSYWRNSRYNAIRFFMTISIGILFGVIFWGKG  1214

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
             D+IH QQDL+NLLGA Y+A++FLG+ N S+VQ+ VAVERTVFYRERAAGMYS LPYA AQ
Sbjct  1215  DKIHKQQDLINLLGATYSAILFLGASNASAVQSVVAVERTVFYRERAAGMYSELPYAFAQ  1274

Query  624   V  626
             V
Sbjct  1275  V  1275


 Score =   229 bits (585),  Expect(2) = 9e-144, Method: Compositional matrix adjust.
 Identities = 103/175 (59%), Positives = 137/175 (78%), Gaps = 0/175 (0%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  IE IYVA+QT  YS LL+ MIG+++K+ KFL+FYYF+F  F YF++YGMM+V+LTPG
Sbjct  1274  QVAIETIYVAIQTFVYSCLLFFMIGYKFKVEKFLYFYYFIFMCFTYFSMYGMMVVSLTPG  1333

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
              Q AAI M+F L+FWNLF+GF++PR  +P+WWRWYYW SP  W++YG+ TSQ+GD ++ +
Sbjct  1334  HQIAAIVMSFFLSFWNLFSGFLIPRPLIPIWWRWYYWGSPVAWTIYGIFTSQVGDIKTEI  1393

Query  1046  QVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
              +P +G   +  FLK++ G+DY FL  V  AH+GW LLFFFVFAYGI +LNFQRR
Sbjct  1394  DIPIQGRQRVDLFLKNYLGFDYDFLIPVVVAHLGWVLLFFFVFAYGIKYLNFQRR  1448



>gb|KCW50780.1| hypothetical protein EUGRSUZ_J00451 [Eucalyptus grandis]
Length=1419

 Score =   295 bits (755),  Expect(2) = 2e-143, Method: Compositional matrix adjust.
 Identities = 131/181 (72%), Positives = 159/181 (88%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              +AVPGVPKIK GYNPATWML++S   +EAQ  VDFA+IYANS L++RNQELIKELS+P 
Sbjct  1066  FEAVPGVPKIKEGYNPATWMLDVSATSVEAQLDVDFADIYANSDLYRRNQELIKELSSPQ  1125

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             PGS+DLYFPT+YSQ F+ QC ACF KQ+WSYWRN ++NA+RFF+T+V+G+MFG+IFW KG
Sbjct  1126  PGSKDLYFPTQYSQGFLTQCHACFCKQNWSYWRNSRFNAIRFFMTVVIGLMFGLIFWNKG  1185

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
             D+I+ QQDL+NLLGA YAAV+FLG+ N S+VQ+ VA+ERTVFYRERAAGMYS LPYA AQ
Sbjct  1186  DKIYKQQDLINLLGATYAAVLFLGATNASAVQSVVAIERTVFYRERAAGMYSELPYAFAQ  1245

Query  624   V  626
             V
Sbjct  1246  V  1246


 Score =   243 bits (621),  Expect(2) = 2e-143, Method: Compositional matrix adjust.
 Identities = 111/175 (63%), Positives = 137/175 (78%), Gaps = 0/175 (0%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  IE IYVA+QT+ YSL+LY MIGFEWKLGK L+FYYF+F  + YF++YGMM+VALTPG
Sbjct  1245  QVAIETIYVAIQTVIYSLILYSMIGFEWKLGKVLYFYYFIFMCYTYFSMYGMMVVALTPG  1304

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
              Q AAI M+F L FWNLF+GF++PR  +PVWWRWYYW SP  W++YG+ TSQ+GDK+  +
Sbjct  1305  HQIAAITMSFFLNFWNLFSGFLIPRPLIPVWWRWYYWCSPVAWTIYGIFTSQVGDKKDPI  1364

Query  1046  QVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
             ++ G     I +FLK   G+DY FL  VA AH+GW L+FFFVFAYGI FLNFQRR
Sbjct  1365  EIDGGLKPQIDEFLKSSLGFDYDFLVPVALAHIGWVLVFFFVFAYGIKFLNFQRR  1419



>ref|XP_008345629.1| PREDICTED: pleiotropic drug resistance protein 2-like [Malus 
domestica]
Length=1464

 Score =   298 bits (763),  Expect(2) = 2e-143, Method: Compositional matrix adjust.
 Identities = 129/181 (71%), Positives = 161/181 (89%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              +A+PG+ KI++GYNPATWMLEI++  +E++  VDF +IYANS L+++NQELI ELSTP 
Sbjct  1111  FEAIPGITKIRDGYNPATWMLEITSPAVESRLNVDFGDIYANSELYRKNQELITELSTPV  1170

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             PGS+DLYFPTKYSQSF+ QCKACFWKQHWSYWRNP YNA+R F+TI++G++FG+IFW KG
Sbjct  1171  PGSKDLYFPTKYSQSFLTQCKACFWKQHWSYWRNPPYNAIRLFLTIIVGIIFGLIFWNKG  1230

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
             D+ + +QDLLNL+GA+Y+AV+FLG+ NT+SVQ  VAVERTVFYRERAAGMYSALPYA AQ
Sbjct  1231  DQTYKEQDLLNLVGAMYSAVLFLGATNTASVQPIVAVERTVFYRERAAGMYSALPYAFAQ  1290

Query  624   V  626
             V
Sbjct  1291  V  1291


 Score =   240 bits (613),  Expect(2) = 2e-143, Method: Compositional matrix adjust.
 Identities = 110/175 (63%), Positives = 137/175 (78%), Gaps = 0/175 (0%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  IE IYVA+QT++YSL+L+ M+GF W + KF  FYYF+   FIYFTLYGMMLVALTPG
Sbjct  1290  QVAIETIYVAIQTLAYSLILFSMMGFTWHVDKFFLFYYFILMCFIYFTLYGMMLVALTPG  1349

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
              Q AAI M+F L+FWNLF+GF+LPR Q+P+WWRWYYW SP  W++YGL+TSQ+GD  S V
Sbjct  1350  HQIAAIVMSFFLSFWNLFSGFLLPRMQIPIWWRWYYWGSPVAWTIYGLVTSQVGDXTSLV  1409

Query  1046  QVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
             +VPGE  M+++ +LK   G++Y FL AV  AH+G+ LLF FVFAYGI  LNFQ R
Sbjct  1410  EVPGEAHMSVQMYLKTRLGFEYDFLGAVVVAHIGFVLLFLFVFAYGIKCLNFQTR  1464



>ref|XP_010031471.1| PREDICTED: pleiotropic drug resistance protein 2-like [Eucalyptus 
grandis]
Length=1448

 Score =   295 bits (756),  Expect(2) = 2e-143, Method: Compositional matrix adjust.
 Identities = 131/181 (72%), Positives = 159/181 (88%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              +AVPGVPKIK GYNPATWML++S   +EAQ  VDFA+IYANS L++RNQELIKELS+P 
Sbjct  1095  FEAVPGVPKIKEGYNPATWMLDVSATSVEAQLDVDFADIYANSDLYRRNQELIKELSSPQ  1154

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             PGS+DLYFPT+YSQ F+ QC ACF KQ+WSYWRN ++NA+RFF+T+V+G+MFG+IFW KG
Sbjct  1155  PGSKDLYFPTQYSQGFLTQCHACFCKQNWSYWRNSRFNAIRFFMTVVIGLMFGLIFWNKG  1214

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
             D+I+ QQDL+NLLGA YAAV+FLG+ N S+VQ+ VA+ERTVFYRERAAGMYS LPYA AQ
Sbjct  1215  DKIYKQQDLINLLGATYAAVLFLGATNASAVQSVVAIERTVFYRERAAGMYSELPYAFAQ  1274

Query  624   V  626
             V
Sbjct  1275  V  1275


 Score =   243 bits (621),  Expect(2) = 2e-143, Method: Compositional matrix adjust.
 Identities = 111/175 (63%), Positives = 137/175 (78%), Gaps = 0/175 (0%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  IE IYVA+QT+ YSL+LY MIGFEWKLGK L+FYYF+F  + YF++YGMM+VALTPG
Sbjct  1274  QVAIETIYVAIQTVIYSLILYSMIGFEWKLGKVLYFYYFIFMCYTYFSMYGMMVVALTPG  1333

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
              Q AAI M+F L FWNLF+GF++PR  +PVWWRWYYW SP  W++YG+ TSQ+GDK+  +
Sbjct  1334  HQIAAITMSFFLNFWNLFSGFLIPRPLIPVWWRWYYWCSPVAWTIYGIFTSQVGDKKDPI  1393

Query  1046  QVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
             ++ G     I +FLK   G+DY FL  VA AH+GW L+FFFVFAYGI FLNFQRR
Sbjct  1394  EIDGGLKPQIDEFLKSSLGFDYDFLVPVALAHIGWVLVFFFVFAYGIKFLNFQRR  1448



>ref|XP_009365364.1| PREDICTED: pleiotropic drug resistance protein 2-like [Pyrus 
x bretschneideri]
Length=1452

 Score =   281 bits (720),  Expect(2) = 9e-143, Method: Compositional matrix adjust.
 Identities = 129/181 (71%), Positives = 156/181 (86%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              +A+PGV KIK+GYNPATWMLE++   +EAQ  VDFA+IY NS L++RNQELIKELSTP 
Sbjct  1099  FEAIPGVTKIKDGYNPATWMLEVTAPAVEAQLDVDFADIYTNSLLYKRNQELIKELSTPA  1158

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             PGS+DLYFPTKYSQ F  QCKACFWK +WSYWRNPQYNA+RFF+TIV+GV+FG+IFW KG
Sbjct  1159  PGSKDLYFPTKYSQPFSIQCKACFWKMYWSYWRNPQYNAIRFFITIVIGVLFGIIFWQKG  1218

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
              +   QQDL+NLLGA+++AV+FLG+ N + VQ+ VA+ERTVFYRERAAGMYS LPYA +Q
Sbjct  1219  QQTAQQQDLMNLLGALFSAVLFLGATNATGVQSVVAIERTVFYRERAAGMYSELPYAFSQ  1278

Query  624   V  626
             V
Sbjct  1279  V  1279


 Score =   254 bits (650),  Expect(2) = 9e-143, Method: Compositional matrix adjust.
 Identities = 118/175 (67%), Positives = 140/175 (80%), Gaps = 0/175 (0%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  IE IY A+Q+  Y++LLY MIGFEWK+GKFLWFYY++   F YFT+YGMM+VALTPG
Sbjct  1278  QVAIETIYSAIQSFIYTILLYSMIGFEWKIGKFLWFYYYILMCFTYFTMYGMMVVALTPG  1337

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
              Q AAI M+F L FWNLFAGF++PR Q+P+WWRWYYWASP  W+LYGL+ SQLGDK + +
Sbjct  1338  HQIAAIVMSFFLIFWNLFAGFLIPRPQIPIWWRWYYWASPVAWTLYGLVISQLGDKNADI  1397

Query  1046  QVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
              +PG G M +K FLK  F ++Y FLPAVAAAHVGW LLF FVFAY I FLNFQRR
Sbjct  1398  VIPGYGTMPLKMFLKYAFAFEYDFLPAVAAAHVGWVLLFCFVFAYSIKFLNFQRR  1452



>ref|XP_011032821.1| PREDICTED: pleiotropic drug resistance protein 2 [Populus euphratica]
Length=1464

 Score =   293 bits (749),  Expect(2) = 2e-142, Method: Compositional matrix adjust.
 Identities = 131/181 (72%), Positives = 157/181 (87%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              +AVPGVPKIK+GYNPATWMLEIS+  +EAQ  VDFAEIYANS L+Q NQELI+ELS P 
Sbjct  1111  FEAVPGVPKIKDGYNPATWMLEISSTAVEAQLKVDFAEIYANSELYQSNQELIEELSKPE  1170

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             PGS+DLYFPT+YSQ FV QCKACF KQ WSYW+NP+YNA+R F+T+ +G++FG+IFW +G
Sbjct  1171  PGSKDLYFPTQYSQDFVTQCKACFLKQKWSYWKNPRYNAMRLFMTVAIGLIFGLIFWNQG  1230

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
              +I+ QQDL NLLGA+Y+AVIFLG+ NTSSV + V++ERTVFYRERAAGMYS LPYA AQ
Sbjct  1231  QKINKQQDLFNLLGAMYSAVIFLGATNTSSVMSIVSIERTVFYRERAAGMYSELPYAFAQ  1290

Query  624   V  626
             V
Sbjct  1291  V  1291


 Score =   243 bits (619),  Expect(2) = 2e-142, Method: Compositional matrix adjust.
 Identities = 109/175 (62%), Positives = 142/175 (81%), Gaps = 0/175 (0%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  IE IYVA+QT+ YS+LLY MIGF W+   FLWFY+F+FT+F+YFTLYGMMLV+LTPG
Sbjct  1290  QVAIEGIYVAIQTMVYSILLYVMIGFSWEFTNFLWFYFFIFTAFMYFTLYGMMLVSLTPG  1349

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
              Q AAI M+F ++FWNLF+GF++PR Q+P+WWRWYYWASP  W++YGLITSQ+G+ +  +
Sbjct  1350  HQIAAIVMSFFMSFWNLFSGFLVPRTQIPLWWRWYYWASPVSWTIYGLITSQVGNLKKMI  1409

Query  1046  QVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
             ++P  G + +K FLK   G++Y FL AVAAAH+G+ +LF F FAYGI +LNFQRR
Sbjct  1410  EIPEVGPVAVKDFLKARLGFEYDFLGAVAAAHIGFVVLFLFCFAYGIKYLNFQRR  1464



>ref|XP_011088856.1| PREDICTED: pleiotropic drug resistance protein 2-like [Sesamum 
indicum]
Length=1455

 Score =   314 bits (804),  Expect(2) = 2e-142, Method: Compositional matrix adjust.
 Identities = 143/181 (79%), Positives = 161/181 (89%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              +AVPGV KIK GYNPATWMLE+S++  EAQ  VDFA+IYANS L+QRNQ+LIKELSTP 
Sbjct  1101  FEAVPGVAKIKEGYNPATWMLEVSSSAAEAQLDVDFADIYANSSLYQRNQQLIKELSTPV  1160

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             PGSQDLYFPT+YSQSF+ QCKACFWKQHWSYWRN QYNA+RFF TIV+GV+FGVIFW KG
Sbjct  1161  PGSQDLYFPTQYSQSFLTQCKACFWKQHWSYWRNSQYNAIRFFTTIVIGVLFGVIFWQKG  1220

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
             D+IH QQDLLNLLGA YAAV+FLG+ N S+VQ+ VA+ERTVFYRERAAGMYS LPYA AQ
Sbjct  1221  DQIHRQQDLLNLLGATYAAVLFLGATNASAVQSVVAIERTVFYRERAAGMYSELPYAFAQ  1280

Query  624   V  626
             V
Sbjct  1281  V  1281


 Score =   221 bits (564),  Expect(2) = 2e-142, Method: Compositional matrix adjust.
 Identities = 111/176 (63%), Positives = 136/176 (77%), Gaps = 1/176 (1%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  IE IYVA+QTI YSLLLY MIG+ W   KF +FYYF+F  F YF++YGMM+VALTPG
Sbjct  1280  QVAIETIYVAIQTIVYSLLLYSMIGYHWTGEKFFYFYYFIFMCFTYFSMYGMMVVALTPG  1339

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
              Q AAI M+F L+FWNLF+GF++PR  +P+WWRWYYWASP  W++YG+  SQ+GD+ S +
Sbjct  1340  YQIAAIVMSFFLSFWNLFSGFLIPRPLIPIWWRWYYWASPVAWTIYGIFASQIGDQTSDL  1399

Query  1046  QVPGEGD-MTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
             ++ G    M +  FLKD+ GYD+ FL AV  AHVGW LLFFFVFAYGI FLNFQRR
Sbjct  1400  ELTGNTQTMRVNDFLKDYLGYDHDFLIAVVFAHVGWVLLFFFVFAYGIKFLNFQRR  1455



>ref|XP_011090010.1| PREDICTED: LOW QUALITY PROTEIN: pleiotropic drug resistance protein 
2-like [Sesamum indicum]
Length=1433

 Score =   318 bits (815),  Expect(2) = 2e-142, Method: Compositional matrix adjust.
 Identities = 144/181 (80%), Positives = 162/181 (90%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              +AVPGV KIK GYNPATWMLE++++ +EAQ  VDFAEIYANS L++RNQELIKELSTPP
Sbjct  1079  FEAVPGVQKIKEGYNPATWMLEVTSSAVEAQLDVDFAEIYANSDLYRRNQELIKELSTPP  1138

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             PGSQDLYFPT+YSQSF+ QCKACFWKQHWSYWRN QYNA+R F TIV+GVMFGVIFW KG
Sbjct  1139  PGSQDLYFPTQYSQSFLTQCKACFWKQHWSYWRNSQYNAIRLFTTIVIGVMFGVIFWQKG  1198

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
             D+IH QQDLLNLLGA YAAV+FLG+ N S+VQ+ VA+ERTVFYRERAAGMYS LPYA AQ
Sbjct  1199  DQIHRQQDLLNLLGATYAAVLFLGATNASAVQSVVAIERTVFYRERAAGMYSELPYAFAQ  1258

Query  624   V  626
             V
Sbjct  1259  V  1259


 Score =   217 bits (552),  Expect(2) = 2e-142, Method: Compositional matrix adjust.
 Identities = 109/176 (62%), Positives = 135/176 (77%), Gaps = 1/176 (1%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  IE IYVAVQT+ YSLLLY MIG+ W   KF +FYYF+F  F YF++YGMM+VALTPG
Sbjct  1258  QVAIETIYVAVQTLVYSLLLYSMIGYHWTGEKFFYFYYFIFMCFTYFSMYGMMVVALTPG  1317

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
              Q AAI M+F L+FWNLF+GF++PR  +P+WWRWYYWASP  W++YG+  SQ+GD  + +
Sbjct  1318  YQIAAIVMSFFLSFWNLFSGFLIPRPLIPIWWRWYYWASPVAWTIYGIFASQVGDITTEL  1377

Query  1046  QVPGE-GDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
             ++ G  G + +  FLKD+ GYD+ FL  V  AHVGW LLFFFVFAYGI FLNFQRR
Sbjct  1378  ELTGNTGRIRVNDFLKDYLGYDHDFLIPVVFAHVGWVLLFFFVFAYGIKFLNFQRR  1433



>gb|KHG28039.1| ABC transporter G family member 41 [Gossypium arboreum]
Length=1383

 Score =   282 bits (721),  Expect(2) = 2e-142, Method: Compositional matrix adjust.
 Identities = 126/181 (70%), Positives = 150/181 (83%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              +A+PGVPKIK GYNPATWMLEI+   +E Q   DFAEIYA S L+QRNQELI+ELS P 
Sbjct  1030  FEAIPGVPKIKEGYNPATWMLEITAPAVENQLNADFAEIYAESSLYQRNQELIEELSHPV  1089

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             PGS+DL+FPTKYS  F+ QCK CF KQHWSY RNP+YNA+RFF TIV+G++FG+IFW KG
Sbjct  1090  PGSEDLHFPTKYSLPFLSQCKVCFLKQHWSYKRNPRYNAIRFFTTIVVGILFGLIFWNKG  1149

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
              +I  QQD+LN  GA+Y+AV FLG++N ++VQ  VA+ERTVFYRERAAGMYS LPYALAQ
Sbjct  1150  QQIAKQQDVLNFFGAMYSAVFFLGAVNATTVQGVVAIERTVFYRERAAGMYSELPYALAQ  1209

Query  624   V  626
             V
Sbjct  1210  V  1210


 Score =   253 bits (646),  Expect(2) = 2e-142, Method: Compositional matrix adjust.
 Identities = 112/175 (64%), Positives = 139/175 (79%), Gaps = 0/175 (0%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  IE IY A+QT  Y  LLY MIG+EWK   FLWFYYF+  SF+YFTLYGMM++ALTPG
Sbjct  1209  QVAIEIIYTAIQTAIYVALLYSMIGYEWKASNFLWFYYFITASFVYFTLYGMMVIALTPG  1268

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
              Q AAI M+F L+ WN+F+GF++PR ++PVWWRWYYW +P  W+LYGLITSQLGD+ S +
Sbjct  1269  AQVAAIVMSFFLSLWNIFSGFLIPRPRIPVWWRWYYWVTPVAWTLYGLITSQLGDRNSDL  1328

Query  1046  QVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
             +VPG  D+ +K+F+K+ FG++Y FLP VA  H+GW LLFF VFAYGI FLNFQRR
Sbjct  1329  EVPGFPDIPVKRFIKEMFGFEYEFLPVVAVVHIGWCLLFFLVFAYGIKFLNFQRR  1383



>ref|XP_008370068.1| PREDICTED: pleiotropic drug resistance protein 2-like [Malus 
domestica]
Length=1449

 Score =   309 bits (792),  Expect(2) = 3e-142, Method: Compositional matrix adjust.
 Identities = 139/181 (77%), Positives = 160/181 (88%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              +A+PGV KIK GYNPATWMLE+S+A +EAQ  VDFAEI+ANS  ++RNQELIKELS P 
Sbjct  1096  FEAIPGVAKIKEGYNPATWMLEVSSAAVEAQNDVDFAEIFANSHQYRRNQELIKELSMPE  1155

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             PGS DLYFPT+YSQSFV QCKACFWKQHWSYWRN +YNA+RFF+TI +GV+FGVIFWGKG
Sbjct  1156  PGSNDLYFPTQYSQSFVTQCKACFWKQHWSYWRNSRYNAIRFFMTICIGVLFGVIFWGKG  1215

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
             D+IH QQDL+NLLGA Y+AV+FLG+ N S+VQ+ VAVERTVFYRERAAGMYS LPYA AQ
Sbjct  1216  DKIHKQQDLINLLGATYSAVLFLGASNASAVQSVVAVERTVFYRERAAGMYSELPYAFAQ  1275

Query  624   V  626
             V
Sbjct  1276  V  1276


 Score =   225 bits (574),  Expect(2) = 3e-142, Method: Compositional matrix adjust.
 Identities = 105/175 (60%), Positives = 133/175 (76%), Gaps = 0/175 (0%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  IE IYVA+QT  YS LL+ MIG+ +K+ KFL+FYYF+F  F YF++YGMM+VALTPG
Sbjct  1275  QVAIETIYVAIQTFIYSCLLFFMIGYTFKVEKFLYFYYFIFMCFTYFSMYGMMVVALTPG  1334

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
              Q AAI M+F L+FWNLF+GF++PR  +P+WWRWYYW SP  W++YG+ TSQ+GD ++ V
Sbjct  1335  HQIAAIVMSFFLSFWNLFSGFLIPRPLIPIWWRWYYWGSPVAWTIYGIFTSQVGDMKTEV  1394

Query  1046  QVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
               P +    I  FLK + G+DY FL  V  AH+GW LLFFFVFAYGI +LNFQRR
Sbjct  1395  SSPIQEQQRIDVFLKSYLGFDYDFLIPVVIAHLGWVLLFFFVFAYGIKYLNFQRR  1449



>gb|EYU38080.1| hypothetical protein MIMGU_mgv1a025570mg [Erythranthe guttata]
Length=1420

 Score =   280 bits (717),  Expect(2) = 4e-142, Method: Compositional matrix adjust.
 Identities = 125/181 (69%), Positives = 151/181 (83%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              +++PGV KI  GYNPATWMLE+S++ +E Q G+DFAE Y+NS LH +N EL K+LS P 
Sbjct  1067  FESIPGVLKITYGYNPATWMLEVSSSAVETQLGIDFAEAYSNSSLHSKNLELNKKLSIPE  1126

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
              GS DLYFPTKYSQ F+ Q  ACFWKQHWSYWRNPQYN +RFF+T V+G++FGVIFW KG
Sbjct  1127  QGSHDLYFPTKYSQPFLVQFNACFWKQHWSYWRNPQYNVIRFFMTTVIGIIFGVIFWDKG  1186

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
             D+I  +QDL NL+GA+YAAV+FLG  NTS+VQ+ VA+ERTVFYRERAAGM+SALPYA AQ
Sbjct  1187  DKILKEQDLSNLMGAMYAAVLFLGGTNTSAVQSVVAIERTVFYRERAAGMFSALPYAFAQ  1246

Query  624   V  626
             V
Sbjct  1247  V  1247


 Score =   254 bits (648),  Expect(2) = 4e-142, Method: Compositional matrix adjust.
 Identities = 117/175 (67%), Positives = 137/175 (78%), Gaps = 0/175 (0%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  +E IYVA+QT  YSLLLY MIGFEW   KFLWFYY++F  F+YFTLYGMMLVALTP 
Sbjct  1246  QVSVETIYVAIQTFVYSLLLYSMIGFEWGATKFLWFYYYVFMCFVYFTLYGMMLVALTPS  1305

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
              Q AAI M+F L+FWNLF+GF++PR ++P+WWRWYYW SP  W++YGL+TSQ+GDK   V
Sbjct  1306  YQIAAIVMSFFLSFWNLFSGFLIPRMEIPIWWRWYYWGSPVAWTIYGLVTSQVGDKMDNV  1365

Query  1046  QVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
              VP  GDM IK +LK F GY+  FL  VA AHVGW+LLFFFVF YGI  LNFQRR
Sbjct  1366  HVPEHGDMPIKDYLKQFLGYESDFLGYVALAHVGWALLFFFVFVYGIKVLNFQRR  1420



>ref|XP_008227362.1| PREDICTED: pleiotropic drug resistance protein 2-like isoform 
X3 [Prunus mume]
Length=1434

 Score =   301 bits (772),  Expect(2) = 6e-142, Method: Compositional matrix adjust.
 Identities = 134/181 (74%), Positives = 157/181 (87%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              +A+PGV KIK GYNPATWMLE+S++ +E +   DFAE+YANS L++RNQELI ELSTP 
Sbjct  1081  FEAIPGVSKIKEGYNPATWMLEVSSSAVEVRLETDFAEVYANSELYRRNQELINELSTPL  1140

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             PGS+DLYFPT+YSQSF  QCKACFWKQHWSYWRN +YNA+RFF+TI +GV+FGVIFW KG
Sbjct  1141  PGSKDLYFPTRYSQSFGTQCKACFWKQHWSYWRNSRYNAIRFFMTICIGVLFGVIFWSKG  1200

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
             D+IH QQDL+NLLGA Y+A++FLGS N  SVQ+ VAVERTVFYRERAAGMYS LPYA AQ
Sbjct  1201  DQIHKQQDLINLLGATYSAILFLGSSNAFSVQSVVAVERTVFYRERAAGMYSELPYAFAQ  1260

Query  624   V  626
             V
Sbjct  1261  V  1261


 Score =   232 bits (592),  Expect(2) = 6e-142, Method: Compositional matrix adjust.
 Identities = 106/175 (61%), Positives = 135/175 (77%), Gaps = 0/175 (0%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  IE IYVA+QT  YS LL+ MIG+ +K+ KFL+FYYF+F SF YF++YGMM VALTPG
Sbjct  1260  QVSIETIYVAIQTFVYSCLLFFMIGYNFKVEKFLYFYYFIFMSFTYFSMYGMMAVALTPG  1319

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
              Q AAI M+F ++FWNLF+GF++PR  +P+WWRWYYW SP  W++YG+ TSQ+GD ++ +
Sbjct  1320  HQIAAIVMSFFMSFWNLFSGFLIPRPLIPIWWRWYYWGSPVAWTIYGVFTSQVGDVKTFI  1379

Query  1046  QVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
              +P +    +  F+KD+ GYDY FL  V  AHVGW LLFFFVFAYGI FLNFQRR
Sbjct  1380  DIPSQEPQRVDLFIKDYLGYDYDFLIPVVVAHVGWVLLFFFVFAYGIKFLNFQRR  1434



>ref|XP_008227349.1| PREDICTED: pleiotropic drug resistance protein 2-like isoform 
X1 [Prunus mume]
Length=1444

 Score =   301 bits (772),  Expect(2) = 6e-142, Method: Compositional matrix adjust.
 Identities = 134/181 (74%), Positives = 157/181 (87%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              +A+PGV KIK GYNPATWMLE+S++ +E +   DFAE+YANS L++RNQELI ELSTP 
Sbjct  1091  FEAIPGVSKIKEGYNPATWMLEVSSSAVEVRLETDFAEVYANSELYRRNQELINELSTPL  1150

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             PGS+DLYFPT+YSQSF  QCKACFWKQHWSYWRN +YNA+RFF+TI +GV+FGVIFW KG
Sbjct  1151  PGSKDLYFPTRYSQSFGTQCKACFWKQHWSYWRNSRYNAIRFFMTICIGVLFGVIFWSKG  1210

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
             D+IH QQDL+NLLGA Y+A++FLGS N  SVQ+ VAVERTVFYRERAAGMYS LPYA AQ
Sbjct  1211  DQIHKQQDLINLLGATYSAILFLGSSNAFSVQSVVAVERTVFYRERAAGMYSELPYAFAQ  1270

Query  624   V  626
             V
Sbjct  1271  V  1271


 Score =   232 bits (591),  Expect(2) = 6e-142, Method: Compositional matrix adjust.
 Identities = 106/175 (61%), Positives = 135/175 (77%), Gaps = 0/175 (0%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  IE IYVA+QT  YS LL+ MIG+ +K+ KFL+FYYF+F SF YF++YGMM VALTPG
Sbjct  1270  QVSIETIYVAIQTFVYSCLLFFMIGYNFKVEKFLYFYYFIFMSFTYFSMYGMMAVALTPG  1329

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
              Q AAI M+F ++FWNLF+GF++PR  +P+WWRWYYW SP  W++YG+ TSQ+GD ++ +
Sbjct  1330  HQIAAIVMSFFMSFWNLFSGFLIPRPLIPIWWRWYYWGSPVAWTIYGVFTSQVGDVKTFI  1389

Query  1046  QVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
              +P +    +  F+KD+ GYDY FL  V  AHVGW LLFFFVFAYGI FLNFQRR
Sbjct  1390  DIPSQEPQRVDLFIKDYLGYDYDFLIPVVVAHVGWVLLFFFVFAYGIKFLNFQRR  1444



>ref|XP_009628764.1| PREDICTED: pleiotropic drug resistance protein 2-like [Nicotiana 
tomentosiformis]
Length=1462

 Score =   293 bits (750),  Expect(2) = 8e-142, Method: Compositional matrix adjust.
 Identities = 131/181 (72%), Positives = 156/181 (86%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              ++VPGV KIK+GYNPATWMLE+S A +E+Q GVDFAEI  NS L++RN+ELIK+LST  
Sbjct  1105  FESVPGVNKIKDGYNPATWMLEVSAASVESQLGVDFAEILTNSDLYRRNEELIKQLSTSA  1164

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             PGS+DLYFPTKYSQ  + Q KACFWKQHWSYWRNPQYN +RFF+T V+G++FGVIFWGKG
Sbjct  1165  PGSKDLYFPTKYSQPLLTQFKACFWKQHWSYWRNPQYNVIRFFMTTVIGIIFGVIFWGKG  1224

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
              +   QQDL NL+GA+YAAV+FLG  NTS+VQ+ VA+ERTVFYRERAAGM+SALPYA AQ
Sbjct  1225  GKFEKQQDLSNLMGAMYAAVLFLGGTNTSAVQSVVAIERTVFYRERAAGMFSALPYAFAQ  1284

Query  624   V  626
             V
Sbjct  1285  V  1285


 Score =   240 bits (613),  Expect(2) = 8e-142, Method: Compositional matrix adjust.
 Identities = 111/179 (62%), Positives = 136/179 (76%), Gaps = 4/179 (2%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  +E IYV +QT  YSL+LY MIGFEW+  KF WFYY++F  F+YFTLYGMMLVALTP 
Sbjct  1284  QVTVETIYVGIQTFLYSLILYSMIGFEWQADKFFWFYYYVFMCFVYFTLYGMMLVALTPN  1343

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
              Q AAI M+F L+FWNLF+GF++PR Q+P+WWRWYYW SP  W++YGLITSQLGDK   V
Sbjct  1344  YQIAAIVMSFFLSFWNLFSGFLIPRMQIPIWWRWYYWGSPVAWTIYGLITSQLGDKTELV  1403

Query  1046  QVPGEGD----MTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
              VP   +    + +K +LK++ GYD+ FL AVAAAH+GW LLFF VF Y I  LNFQ+R
Sbjct  1404  HVPSHDNAPTYLPLKDYLKEYLGYDFDFLGAVAAAHLGWVLLFFTVFVYAIRVLNFQKR  1462



>ref|XP_008227358.1| PREDICTED: pleiotropic drug resistance protein 2-like isoform 
X2 [Prunus mume]
Length=1441

 Score =   301 bits (771),  Expect(2) = 8e-142, Method: Compositional matrix adjust.
 Identities = 134/181 (74%), Positives = 157/181 (87%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              +A+PGV KIK GYNPATWMLE+S++ +E +   DFAE+YANS L++RNQELI ELSTP 
Sbjct  1088  FEAIPGVSKIKEGYNPATWMLEVSSSAVEVRLETDFAEVYANSELYRRNQELINELSTPL  1147

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             PGS+DLYFPT+YSQSF  QCKACFWKQHWSYWRN +YNA+RFF+TI +GV+FGVIFW KG
Sbjct  1148  PGSKDLYFPTRYSQSFGTQCKACFWKQHWSYWRNSRYNAIRFFMTICIGVLFGVIFWSKG  1207

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
             D+IH QQDL+NLLGA Y+A++FLGS N  SVQ+ VAVERTVFYRERAAGMYS LPYA AQ
Sbjct  1208  DQIHKQQDLINLLGATYSAILFLGSSNAFSVQSVVAVERTVFYRERAAGMYSELPYAFAQ  1267

Query  624   V  626
             V
Sbjct  1268  V  1268


 Score =   232 bits (591),  Expect(2) = 8e-142, Method: Compositional matrix adjust.
 Identities = 106/175 (61%), Positives = 135/175 (77%), Gaps = 0/175 (0%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  IE IYVA+QT  YS LL+ MIG+ +K+ KFL+FYYF+F SF YF++YGMM VALTPG
Sbjct  1267  QVSIETIYVAIQTFVYSCLLFFMIGYNFKVEKFLYFYYFIFMSFTYFSMYGMMAVALTPG  1326

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
              Q AAI M+F ++FWNLF+GF++PR  +P+WWRWYYW SP  W++YG+ TSQ+GD ++ +
Sbjct  1327  HQIAAIVMSFFMSFWNLFSGFLIPRPLIPIWWRWYYWGSPVAWTIYGVFTSQVGDVKTFI  1386

Query  1046  QVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
              +P +    +  F+KD+ GYDY FL  V  AHVGW LLFFFVFAYGI FLNFQRR
Sbjct  1387  DIPSQEPQRVDLFIKDYLGYDYDFLIPVVVAHVGWVLLFFFVFAYGIKFLNFQRR  1441



>gb|EYU38621.1| hypothetical protein MIMGU_mgv1a025382mg [Erythranthe guttata]
Length=1432

 Score =   299 bits (765),  Expect(2) = 2e-141, Method: Compositional matrix adjust.
 Identities = 135/181 (75%), Positives = 155/181 (86%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              + +PGVPKI +GYNPATWML++ST   E+Q GVDFA+IYANS L+QRNQELI ELSTPP
Sbjct  1079  FEDIPGVPKIDHGYNPATWMLDVSTPSAESQLGVDFADIYANSSLYQRNQELINELSTPP  1138

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             PGS DL+F TKYSQ F  QCKAC WKQ WSYWRNPQYNA+RFF+TI +GV+FGVIFW KG
Sbjct  1139  PGSSDLHFSTKYSQPFFNQCKACLWKQFWSYWRNPQYNAIRFFITIAIGVIFGVIFWNKG  1198

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
              +I  QQDL NLLGAIYAAVIFLG+ N++SVQ  VA+ERTVFYRE+AAGMYSALPYA +Q
Sbjct  1199  QKIEKQQDLQNLLGAIYAAVIFLGATNSTSVQGVVAIERTVFYREKAAGMYSALPYAFSQ  1258

Query  624   V  626
             V
Sbjct  1259  V  1259


 Score =   233 bits (594),  Expect(2) = 2e-141, Method: Compositional matrix adjust.
 Identities = 101/175 (58%), Positives = 138/175 (79%), Gaps = 0/175 (0%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  +E +Y+A QT+ Y+L+LY MIGFEW++GKFLWFYYF+FT F+Y TLYGMML+ALTPG
Sbjct  1258  QVAVETLYIAAQTVIYALILYSMIGFEWRIGKFLWFYYFIFTCFVYLTLYGMMLIALTPG  1317

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
             VQ  AI  +F L+ WNLF+GF++PR Q+P+WWRWYYW +P  W++YG++ SQ+G+  S+V
Sbjct  1318  VQVGAIMASFFLSLWNLFSGFLIPRTQIPIWWRWYYWGTPVAWTIYGMVVSQIGELTSQV  1377

Query  1046  QVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
             +VPG G MT+K +LK+  G+++ FLP +   H+ + LLF  VFA GI +LNFQRR
Sbjct  1378  EVPGVGFMTVKSYLKENLGFEHHFLPIIGIMHLVFILLFGTVFALGIRYLNFQRR  1432



>gb|KDO46933.1| hypothetical protein CISIN_1g045902mg [Citrus sinensis]
Length=1472

 Score =   288 bits (736),  Expect(2) = 2e-141, Method: Compositional matrix adjust.
 Identities = 125/181 (69%), Positives = 156/181 (86%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              +AVPGVPKI++GYNPATW+LE+S+  +E Q  VDFA IYA+S L++RNQ+LIKELS+P 
Sbjct  1119  FEAVPGVPKIRDGYNPATWVLEVSSNAVETQLNVDFAAIYADSDLYRRNQQLIKELSSPA  1178

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             PGS+DLYF TKYSQ F+ QCK CFWKQHWSYWRNP+YNA+RFF+T V+G +FG+IFW KG
Sbjct  1179  PGSKDLYFTTKYSQDFITQCKTCFWKQHWSYWRNPKYNAIRFFLTTVIGALFGMIFWDKG  1238

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
             ++   +QDL+NLLGA+Y+AV+FLG+ N SSV + VA+ERTVFYRERAAGMYS+L YA AQ
Sbjct  1239  EKTSKEQDLINLLGAMYSAVLFLGASNASSVTSVVAIERTVFYRERAAGMYSSLTYAFAQ  1298

Query  624   V  626
             V
Sbjct  1299  V  1299


 Score =   244 bits (623),  Expect(2) = 2e-141, Method: Compositional matrix adjust.
 Identities = 118/175 (67%), Positives = 144/175 (82%), Gaps = 0/175 (0%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  IEAIYV++QTI YSLLLY MIGF W++ KFLWFY+FM   F+YFTLYGMMLVALTP 
Sbjct  1298  QVSIEAIYVSIQTIVYSLLLYSMIGFHWEVTKFLWFYFFMLMCFMYFTLYGMMLVALTPN  1357

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
              Q A I M+F L+FWNLF+GF++PR Q+P+WWRWYYWASP  W++YGL+TSQ+GDK S V
Sbjct  1358  QQIATILMSFFLSFWNLFSGFMVPRTQIPIWWRWYYWASPVAWTIYGLVTSQIGDKVSEV  1417

Query  1046  QVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
             +V GE  +T+K++L   +GYDY FL AVAAAH+G+ +LFFFVF YGI FLNFQRR
Sbjct  1418  EVAGESGITVKEYLYKHYGYDYDFLGAVAAAHIGFVVLFFFVFVYGIKFLNFQRR  1472



>ref|XP_006436657.1| hypothetical protein CICLE_v10033294mg [Citrus clementina]
 gb|ESR49897.1| hypothetical protein CICLE_v10033294mg [Citrus clementina]
Length=1456

 Score =   288 bits (736),  Expect(2) = 2e-141, Method: Compositional matrix adjust.
 Identities = 125/181 (69%), Positives = 156/181 (86%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              +AVPGVPKI++GYNPATW+LE+S+  +E Q  VDFA IYA+S L++RNQ+LIKELS+P 
Sbjct  1103  FEAVPGVPKIRDGYNPATWVLEVSSNAVETQLNVDFAAIYADSDLYRRNQQLIKELSSPA  1162

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             PGS+DLYF TKYSQ F+ QCK CFWKQHWSYWRNP+YNA+RFF+T V+G +FG+IFW KG
Sbjct  1163  PGSKDLYFTTKYSQDFITQCKTCFWKQHWSYWRNPKYNAIRFFLTTVIGALFGMIFWDKG  1222

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
             ++   +QDL+NLLGA+Y+AV+FLG+ N SSV + VA+ERTVFYRERAAGMYS+L YA AQ
Sbjct  1223  EKTSKEQDLINLLGAMYSAVLFLGASNASSVTSVVAIERTVFYRERAAGMYSSLTYAFAQ  1282

Query  624   V  626
             V
Sbjct  1283  V  1283


 Score =   244 bits (623),  Expect(2) = 2e-141, Method: Compositional matrix adjust.
 Identities = 118/175 (67%), Positives = 144/175 (82%), Gaps = 0/175 (0%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  IEAIYV++QTI YSLLLY MIGF W++ KFLWFY+FM   F+YFTLYGMMLVALTP 
Sbjct  1282  QVSIEAIYVSIQTIVYSLLLYSMIGFHWEVTKFLWFYFFMLMCFMYFTLYGMMLVALTPN  1341

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
              Q A I M+F L+FWNLF+GF++PR Q+P+WWRWYYWASP  W++YGL+TSQ+GDK S V
Sbjct  1342  QQIATILMSFFLSFWNLFSGFMVPRTQIPIWWRWYYWASPVAWTIYGLVTSQIGDKVSEV  1401

Query  1046  QVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
             +V GE  +T+K++L   +GYDY FL AVAAAH+G+ +LFFFVF YGI FLNFQRR
Sbjct  1402  EVAGESGITVKEYLYKHYGYDYDFLGAVAAAHIGFVVLFFFVFVYGIKFLNFQRR  1456



>ref|XP_002311035.2| hypothetical protein POPTR_0008s02480g [Populus trichocarpa]
 gb|EEE88402.2| hypothetical protein POPTR_0008s02480g [Populus trichocarpa]
Length=1440

 Score =   289 bits (739),  Expect(2) = 3e-141, Method: Compositional matrix adjust.
 Identities = 129/181 (71%), Positives = 155/181 (86%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              +AVPGVPKIK+GYNPATWMLEIS+  +EAQ  VDFAEIYA S L+Q NQELI+ELS P 
Sbjct  1087  FEAVPGVPKIKDGYNPATWMLEISSTAVEAQLKVDFAEIYAQSELYQSNQELIEELSKPE  1146

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             PGS+DLYFPT+YSQ F  QCKACF KQ WSYW+NP+YN +RFF+T+ +G++FG+IFW +G
Sbjct  1147  PGSKDLYFPTQYSQDFFTQCKACFLKQKWSYWKNPRYNTMRFFMTLTIGLIFGLIFWNQG  1206

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
              +I+ QQDL NLLGA+Y+AVIFLG+ NTSSV + V++ERTVFYRERAAGMYS LPYA AQ
Sbjct  1207  QKINKQQDLFNLLGAMYSAVIFLGATNTSSVMSIVSIERTVFYRERAAGMYSELPYAFAQ  1266

Query  624   V  626
             V
Sbjct  1267  V  1267


 Score =   243 bits (619),  Expect(2) = 3e-141, Method: Compositional matrix adjust.
 Identities = 110/175 (63%), Positives = 142/175 (81%), Gaps = 0/175 (0%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  IE IYVA+QT+ YS+LLY MIGF W+   FLWFY+F+FT+F+YFTLYGMMLV+LTPG
Sbjct  1266  QVAIEGIYVAIQTMVYSILLYVMIGFSWEFTNFLWFYFFIFTAFMYFTLYGMMLVSLTPG  1325

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
              Q AAI M+F L+FWNLF+GF++PR Q+P+WWRWYYWASP  W++YGLITSQ+G+ +  +
Sbjct  1326  HQIAAIVMSFFLSFWNLFSGFLVPRTQIPLWWRWYYWASPVSWTIYGLITSQVGNLKKMI  1385

Query  1046  QVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
             ++P  G + +K FLK   G++Y FL AVAAAH+G+ +LF F FAYGI +LNFQRR
Sbjct  1386  EIPEVGPVAVKDFLKARLGFEYDFLGAVAAAHIGFVVLFLFSFAYGIKYLNFQRR  1440



>ref|XP_009763866.1| PREDICTED: pleiotropic drug resistance protein 2-like [Nicotiana 
sylvestris]
Length=1462

 Score =   291 bits (744),  Expect(2) = 3e-141, Method: Compositional matrix adjust.
 Identities = 130/184 (71%), Positives = 156/184 (85%), Gaps = 0/184 (0%)
 Frame = +3

Query  75    RPLLQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELS  254
             R   ++VPGV KIK+GYNPATWMLE+S A +E Q GV+FAEI  NS L++RN+ELIK+LS
Sbjct  1102  REYFESVPGVNKIKDGYNPATWMLEVSAASVETQLGVNFAEILTNSDLYRRNEELIKQLS  1161

Query  255   TPPPGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFW  434
             T  PGS+DLYFPTKYSQ  + Q KACFWKQHWSYWRNPQYN +RFF+T V+G++FGV+FW
Sbjct  1162  TSAPGSKDLYFPTKYSQPLLTQFKACFWKQHWSYWRNPQYNVIRFFMTTVIGIIFGVVFW  1221

Query  435   GKGDEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYA  614
             GKG +   QQDL NL+GA+YAAV+FLG  NTS+VQ+ VA+ERTVFYRERAAGM+SALPYA
Sbjct  1222  GKGGKFEKQQDLSNLMGAMYAAVLFLGGTNTSAVQSVVAIERTVFYRERAAGMFSALPYA  1281

Query  615   LAQV  626
              AQV
Sbjct  1282  FAQV  1285


 Score =   240 bits (613),  Expect(2) = 3e-141, Method: Compositional matrix adjust.
 Identities = 111/179 (62%), Positives = 136/179 (76%), Gaps = 4/179 (2%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  +E IYV +QT  YSL+LY MIGFEW+  KF WFYY++F  F+YFTLYGMMLVALTP 
Sbjct  1284  QVTVETIYVGIQTFLYSLILYSMIGFEWQADKFFWFYYYVFMCFVYFTLYGMMLVALTPN  1343

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
              Q AAI M+F L+FWNLF+GF++PR Q+P+WWRWYYW SP  W++YGLITSQLGDK   V
Sbjct  1344  YQIAAIVMSFFLSFWNLFSGFLIPRMQIPIWWRWYYWGSPVAWTIYGLITSQLGDKTEPV  1403

Query  1046  QVPGEGD----MTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
              VP   +    + +K +LK++ GYD+ FL AVAAAH+GW LLFF VF Y I  LNFQ+R
Sbjct  1404  HVPSHDNAPSYLPLKDYLKEYLGYDFDFLGAVAAAHLGWVLLFFTVFVYAIRVLNFQKR  1462



>ref|XP_007208417.1| hypothetical protein PRUPE_ppa000239mg [Prunus persica]
 gb|EMJ09616.1| hypothetical protein PRUPE_ppa000239mg [Prunus persica]
Length=1416

 Score =   300 bits (767),  Expect(2) = 3e-141, Method: Compositional matrix adjust.
 Identities = 134/181 (74%), Positives = 156/181 (86%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              +A+PGV KIK GYNPATWMLE+S++ +E +   DFAE+YANS L++RNQELI ELSTP 
Sbjct  1063  FEAIPGVSKIKEGYNPATWMLEVSSSAVEVRLETDFAEVYANSELYRRNQELINELSTPL  1122

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             PGS+DLYFPT+YSQ F  QCKACFWKQHWSYWRN +YNA+RFF+TI  GV+FGVIFWGKG
Sbjct  1123  PGSKDLYFPTQYSQGFGTQCKACFWKQHWSYWRNSRYNAIRFFMTICTGVLFGVIFWGKG  1182

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
             D+IH QQDL+NLLGA Y+A++FLGS N  SVQ+ VAVERTVFYRERAAGMYS LPYA AQ
Sbjct  1183  DQIHKQQDLINLLGATYSAILFLGSNNAFSVQSVVAVERTVFYRERAAGMYSELPYAFAQ  1242

Query  624   V  626
             V
Sbjct  1243  V  1243


 Score =   231 bits (590),  Expect(2) = 3e-141, Method: Compositional matrix adjust.
 Identities = 106/175 (61%), Positives = 135/175 (77%), Gaps = 0/175 (0%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  IE IYVA+QT  YS LL+ MIG+ +K+ KFL+FYYF+F SF YF++YGMM VALTPG
Sbjct  1242  QVSIETIYVAIQTFIYSCLLFFMIGYNFKVEKFLYFYYFIFMSFTYFSMYGMMAVALTPG  1301

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
              Q AAI M+F ++FWNLF+GF++PR  +P+WWRWYYW SP  W++YG+ TSQ+GD ++ +
Sbjct  1302  HQIAAIVMSFFMSFWNLFSGFLIPRPLIPIWWRWYYWGSPIAWTIYGVFTSQVGDVKTFI  1361

Query  1046  QVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
              +P +    +  F+KD+ GYDY FL  V  AHVGW LLFFFVFAYGI FLNFQRR
Sbjct  1362  DIPSQEPQRVDLFIKDYLGYDYDFLIPVVVAHVGWVLLFFFVFAYGIKFLNFQRR  1416



>gb|KDP34703.1| hypothetical protein JCGZ_10908 [Jatropha curcas]
Length=1445

 Score =   297 bits (760),  Expect(2) = 3e-141, Method: Compositional matrix adjust.
 Identities = 134/181 (74%), Positives = 155/181 (86%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              + VPGVPKIK+GYNPATWMLE+S+  +EAQ  VDFAEIY  S L++RNQELIKELSTP 
Sbjct  1092  FEVVPGVPKIKDGYNPATWMLEVSSTAVEAQLDVDFAEIYVTSDLYRRNQELIKELSTPQ  1151

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             PGS DLYFPT+YSQSF+ QCKACFWKQH SYWRN +YNA+RFF+TI++G+MFGVIFW KG
Sbjct  1152  PGSSDLYFPTQYSQSFITQCKACFWKQHLSYWRNSRYNAIRFFMTIMIGIMFGVIFWNKG  1211

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
               I  QQ+L NLLGA YAA++FLG+ N S+VQ+ VAVERTVFYRERAAGMYS LPYA AQ
Sbjct  1212  GHIETQQELTNLLGATYAAILFLGASNASAVQSVVAVERTVFYRERAAGMYSELPYAFAQ  1271

Query  624   V  626
             V
Sbjct  1272  V  1272


 Score =   234 bits (596),  Expect(2) = 3e-141, Method: Compositional matrix adjust.
 Identities = 108/175 (62%), Positives = 133/175 (76%), Gaps = 0/175 (0%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  IE IYVA+QT  YSLLLY MIG+EW+L KFL+FYYF+   F YF++YGMM+VALTPG
Sbjct  1271  QVAIETIYVAIQTFIYSLLLYSMIGYEWELDKFLYFYYFILMCFTYFSMYGMMVVALTPG  1330

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
              Q AAI M+F L+FWNLF+GF++PR  +PVWWRWYYW SP  W++YG+  SQ GDK++ +
Sbjct  1331  HQIAAIVMSFFLSFWNLFSGFLIPRPLIPVWWRWYYWGSPVAWTIYGIFASQFGDKKALL  1390

Query  1046  QVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
              +P    + +  FLK+  GYD+ FL  V  AHVGW LLFF VFAYGI FLNFQRR
Sbjct  1391  SIPETPPVAVDVFLKNSLGYDHDFLVPVVLAHVGWVLLFFLVFAYGIKFLNFQRR  1445



>ref|XP_010031472.1| PREDICTED: pleiotropic drug resistance protein 2-like [Eucalyptus 
grandis]
 gb|KCW50778.1| hypothetical protein EUGRSUZ_J00449 [Eucalyptus grandis]
Length=1447

 Score =   289 bits (740),  Expect(2) = 3e-141, Method: Compositional matrix adjust.
 Identities = 130/181 (72%), Positives = 154/181 (85%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              +AVPGVPKI  GYNPATWML+++   +EAQ  VDFAEIYANS L++RNQELIKELS+P 
Sbjct  1094  FEAVPGVPKIHEGYNPATWMLDVTATSVEAQLDVDFAEIYANSDLYRRNQELIKELSSPQ  1153

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             PGS+DLYFPT+YSQ F+ QC ACFWKQ+WSYWRN ++NA+RF  TIV+G+MFG IFW KG
Sbjct  1154  PGSKDLYFPTQYSQGFLTQCHACFWKQNWSYWRNSRFNAIRFVSTIVIGLMFGFIFWNKG  1213

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
              +I  QQDL+NLLGA YAAV+FLG+ N S+VQ+ VA+ERTVFYRERAAGMYS LPYA AQ
Sbjct  1214  GKIFKQQDLINLLGATYAAVLFLGATNASAVQSVVAIERTVFYRERAAGMYSELPYAFAQ  1273

Query  624   V  626
             V
Sbjct  1274  V  1274


 Score =   242 bits (617),  Expect(2) = 3e-141, Method: Compositional matrix adjust.
 Identities = 110/175 (63%), Positives = 137/175 (78%), Gaps = 0/175 (0%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  IE IYVA+QT+ YSL+LY MIGFEWKLGK L+FYYF+F  + YF++YGMM+VALTPG
Sbjct  1273  QVAIETIYVAIQTVIYSLILYSMIGFEWKLGKVLYFYYFIFMCYTYFSMYGMMVVALTPG  1332

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
              Q A+I M+F L FWNLF+GF++PR  +PVWWRWYYW SP  W++YG+ TSQ+GDK+  +
Sbjct  1333  HQIASIVMSFFLNFWNLFSGFLIPRPLIPVWWRWYYWCSPVAWTIYGIFTSQVGDKKDGI  1392

Query  1046  QVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
             ++ G G   I  FLK+  G+DY FL  VA AH+GW L FFF+FAYGI FLNFQRR
Sbjct  1393  ELDGGGKPAIDAFLKENLGFDYDFLVPVALAHIGWVLGFFFIFAYGIKFLNFQRR  1447



>ref|XP_010031473.1| PREDICTED: pleiotropic drug resistance protein 2-like [Eucalyptus 
grandis]
Length=1447

 Score =   292 bits (748),  Expect(2) = 4e-141, Method: Compositional matrix adjust.
 Identities = 131/181 (72%), Positives = 157/181 (87%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              +AVPGVPKIK GYNPATWML++S   +EAQ  VDFAEIYANS L++RNQELIKELS+P 
Sbjct  1094  FEAVPGVPKIKEGYNPATWMLDVSATSVEAQLEVDFAEIYANSDLYRRNQELIKELSSPQ  1153

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             PGS+DLYFPT+YSQ F+ QC ACF KQ+WSYWRN ++NA+RFF+T+V+G+MFG IFW KG
Sbjct  1154  PGSKDLYFPTQYSQGFLTQCHACFCKQNWSYWRNSRFNAIRFFMTVVIGLMFGFIFWNKG  1213

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
              +I+ QQDL+NLLGA YAAV+FLG+ N +SVQ+ VA+ERTVFYRERAAGMYS LPYA AQ
Sbjct  1214  GKIYKQQDLINLLGATYAAVLFLGATNAASVQSVVAIERTVFYRERAAGMYSELPYAFAQ  1273

Query  624   V  626
             V
Sbjct  1274  V  1274


 Score =   239 bits (609),  Expect(2) = 4e-141, Method: Compositional matrix adjust.
 Identities = 110/175 (63%), Positives = 136/175 (78%), Gaps = 0/175 (0%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  IE IYVA+QT+ YSL+LY MIGFEWKLGK L+FYYF+F  + YF++YGMM+VALTPG
Sbjct  1273  QVAIETIYVAIQTVIYSLILYSMIGFEWKLGKVLYFYYFIFMCYTYFSMYGMMVVALTPG  1332

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
              Q AAI M+F L FWNLF+GF++PR  +PVWWRWYYW SP  W++YG+ TSQ+GDK+  +
Sbjct  1333  HQIAAIVMSFFLNFWNLFSGFLIPRPLIPVWWRWYYWCSPVAWTIYGIFTSQVGDKKDGI  1392

Query  1046  QVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
             ++   G   I  FLK+  G+DY FL  VA AH+GW L FFF+FAYGI FLNFQRR
Sbjct  1393  ELDVGGTPAIDVFLKESLGFDYDFLVPVALAHIGWVLGFFFIFAYGIKFLNFQRR  1447



>ref|XP_002529080.1| ATP-binding cassette transporter, putative [Ricinus communis]
 gb|EEF33324.1| ATP-binding cassette transporter, putative [Ricinus communis]
Length=1444

 Score =   306 bits (784),  Expect(2) = 5e-141, Method: Compositional matrix adjust.
 Identities = 134/181 (74%), Positives = 160/181 (88%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              +AVPGVPKIK+GYNPATWMLEIS+  +E+Q GVDFA+IYANS L+QRNQELIKELSTPP
Sbjct  1091  FEAVPGVPKIKDGYNPATWMLEISSIAVESQLGVDFADIYANSDLYQRNQELIKELSTPP  1150

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             PGS+DLYFPTKYSQ+FV QCKACFWKQ+WSYWRN Q+N +RF +TI++G++FG +FW KG
Sbjct  1151  PGSKDLYFPTKYSQNFVTQCKACFWKQYWSYWRNTQFNTIRFIMTIIIGILFGAVFWSKG  1210

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
             D+   QQDL+NLLGA YAA++FLG+IN  +V + VA+ERTVFYRERAAGMYS LPYA AQ
Sbjct  1211  DQFQKQQDLMNLLGATYAALLFLGAINALAVTSVVAIERTVFYRERAAGMYSELPYAFAQ  1270

Query  624   V  626
             V
Sbjct  1271  V  1271


 Score =   224 bits (571),  Expect(2) = 5e-141, Method: Compositional matrix adjust.
 Identities = 101/175 (58%), Positives = 133/175 (76%), Gaps = 0/175 (0%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  IE IYVA+QTI Y++++Y M+GF+WK  KFL+F YF+F  FIY++LYGMM VALTPG
Sbjct  1270  QVAIETIYVAIQTIFYAVIIYSMMGFDWKADKFLYFSYFIFMCFIYYSLYGMMAVALTPG  1329

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
              Q AAI M+F L  WNLF+GF LPR  +PVWWRWYYWASP  W++YG+  SQ+ ++++ +
Sbjct  1330  QQIAAIVMSFFLNLWNLFSGFFLPRPLIPVWWRWYYWASPVAWTIYGVFASQIANEKTLL  1389

Query  1046  QVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
             ++P    + +  +LK+ FGYD+ FL  V  AHVGW LLFFFVFAY I +LNFQ+R
Sbjct  1390  EIPESKPVAVNVYLKEVFGYDHDFLIPVVLAHVGWVLLFFFVFAYSIRYLNFQKR  1444



>gb|KCW50781.1| hypothetical protein EUGRSUZ_J00454 [Eucalyptus grandis]
Length=1424

 Score =   292 bits (747),  Expect(2) = 5e-141, Method: Compositional matrix adjust.
 Identities = 131/181 (72%), Positives = 157/181 (87%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              +AVPGVPKIK GYNPATWML++S   +EAQ  VDFAEIYANS L++RNQELIKELS+P 
Sbjct  1071  FEAVPGVPKIKEGYNPATWMLDVSATSVEAQLEVDFAEIYANSDLYRRNQELIKELSSPQ  1130

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             PGS+DLYFPT+YSQ F+ QC ACF KQ+WSYWRN ++NA+RFF+T+V+G+MFG IFW KG
Sbjct  1131  PGSKDLYFPTQYSQGFLTQCHACFCKQNWSYWRNSRFNAIRFFMTVVIGLMFGFIFWNKG  1190

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
              +I+ QQDL+NLLGA YAAV+FLG+ N +SVQ+ VA+ERTVFYRERAAGMYS LPYA AQ
Sbjct  1191  GKIYKQQDLINLLGATYAAVLFLGATNAASVQSVVAIERTVFYRERAAGMYSELPYAFAQ  1250

Query  624   V  626
             V
Sbjct  1251  V  1251


 Score =   238 bits (608),  Expect(2) = 5e-141, Method: Compositional matrix adjust.
 Identities = 110/175 (63%), Positives = 136/175 (78%), Gaps = 0/175 (0%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  IE IYVA+QT+ YSL+LY MIGFEWKLGK L+FYYF+F  + YF++YGMM+VALTPG
Sbjct  1250  QVAIETIYVAIQTVIYSLILYSMIGFEWKLGKVLYFYYFIFMCYTYFSMYGMMVVALTPG  1309

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
              Q AAI M+F L FWNLF+GF++PR  +PVWWRWYYW SP  W++YG+ TSQ+GDK+  +
Sbjct  1310  HQIAAIVMSFFLNFWNLFSGFLIPRPLIPVWWRWYYWCSPVAWTIYGIFTSQVGDKKDGI  1369

Query  1046  QVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
             ++   G   I  FLK+  G+DY FL  VA AH+GW L FFF+FAYGI FLNFQRR
Sbjct  1370  ELDVGGTPAIDVFLKESLGFDYDFLVPVALAHIGWVLGFFFIFAYGIKFLNFQRR  1424



>ref|XP_004496191.1| PREDICTED: pleiotropic drug resistance protein 2-like [Cicer 
arietinum]
Length=1460

 Score =   293 bits (749),  Expect(2) = 6e-141, Method: Compositional matrix adjust.
 Identities = 128/181 (71%), Positives = 159/181 (88%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              +A+ G+P+I +G+NPATWMLEI++  +E+Q  VDFAE+Y  S L+Q+NQELIKELSTP 
Sbjct  1107  FEAIQGIPRIIDGFNPATWMLEITSPTVESQLSVDFAELYIKSELYQKNQELIKELSTPL  1166

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             PG++DL F TK+SQSF+ QCKACFWKQHWSYWRNPQYNA+RFF++I +GV+FG+IFW KG
Sbjct  1167  PGTKDLNFATKHSQSFITQCKACFWKQHWSYWRNPQYNAIRFFLSISVGVIFGLIFWKKG  1226

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
             D+IH +QDL+NL GA+Y+A++FLG+ NTSSVQ  VAVERTVFYRERAAGMYSALPYA AQ
Sbjct  1227  DKIHKEQDLMNLAGAMYSAILFLGATNTSSVQPVVAVERTVFYRERAAGMYSALPYAFAQ  1286

Query  624   V  626
             V
Sbjct  1287  V  1287


 Score =   237 bits (605),  Expect(2) = 6e-141, Method: Compositional matrix adjust.
 Identities = 102/175 (58%), Positives = 136/175 (78%), Gaps = 0/175 (0%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  IE +YVA+QT +Y+L+LY M+GF W+  KF+WFYYF+F SF+YFTLYGMM VALTP 
Sbjct  1286  QVAIECVYVAIQTFAYTLILYTMMGFPWQTEKFIWFYYFIFMSFVYFTLYGMMTVALTPN  1345

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
              Q AAI M+F L FWN+F+GF++P+ Q+P+WWRWYYW  P  W++YGL+TSQLGD  + +
Sbjct  1346  HQIAAIVMSFFLVFWNIFSGFVIPKSQIPIWWRWYYWVCPTAWTVYGLVTSQLGDNNTPI  1405

Query  1046  QVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
             +VPG G +++K +LK   GY+Y FL  VAAAH+ + ++F FVFAY I  LNFQ+R
Sbjct  1406  EVPGAGTISVKAYLKKQMGYEYDFLGVVAAAHIAFVIVFLFVFAYSIKVLNFQKR  1460



>ref|XP_011076911.1| PREDICTED: pleiotropic drug resistance protein 2-like [Sesamum 
indicum]
Length=1446

 Score =   277 bits (709),  Expect(2) = 7e-141, Method: Compositional matrix adjust.
 Identities = 131/181 (72%), Positives = 159/181 (88%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              +++ GVPKIK+GYNPATWMLE+S++ +E Q G+DFAEIY+NS L +RNQE+ KELSTP 
Sbjct  1093  FESIRGVPKIKDGYNPATWMLEVSSSTVETQLGLDFAEIYSNSDLQRRNQEVNKELSTPT  1152

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             P SQDLYFPTKYSQ F+ Q KACFWKQHWSYWRNPQYN +RFF+T ++G++FGVIFW KG
Sbjct  1153  PESQDLYFPTKYSQPFLVQFKACFWKQHWSYWRNPQYNVIRFFMTTIIGIIFGVIFWDKG  1212

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
             D++H QQDL NL+GA+YAAV+FLG  NTS+VQ+ VA+ERTVFYRERAAGM+SALPYA AQ
Sbjct  1213  DKMHKQQDLSNLMGAMYAAVLFLGGTNTSAVQSVVAIERTVFYRERAAGMFSALPYAFAQ  1272

Query  624   V  626
             V
Sbjct  1273  V  1273


 Score =   253 bits (645),  Expect(2) = 7e-141, Method: Compositional matrix adjust.
 Identities = 117/175 (67%), Positives = 138/175 (79%), Gaps = 0/175 (0%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q G+E IYVA+QT  YSLLLY MIGFEW   KFLWFYY++F  F+YFTLYGMMLVALTP 
Sbjct  1272  QVGVETIYVAIQTFVYSLLLYSMIGFEWGATKFLWFYYYVFMCFVYFTLYGMMLVALTPS  1331

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
              Q AAI M+F L+FWNLF+GF++PR Q+P+WWRWYYW SP  W++YGLITSQ+GDK   V
Sbjct  1332  YQIAAIVMSFFLSFWNLFSGFLIPRMQIPIWWRWYYWGSPVAWTIYGLITSQVGDKMDNV  1391

Query  1046  QVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
              VP  GD+ +K +LK + GY+  FL  VA AHVGW+LLFFFVF YGI  LNFQRR
Sbjct  1392  HVPEHGDIPVKYYLKQYLGYESEFLGYVALAHVGWALLFFFVFVYGIKLLNFQRR  1446



>ref|XP_009141587.1| PREDICTED: ABC transporter G family member 39 [Brassica rapa]
Length=1453

 Score =   275 bits (704),  Expect(2) = 1e-140, Method: Compositional matrix adjust.
 Identities = 121/181 (67%), Positives = 154/181 (85%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              +AV GVPKIK+GYNPATWML+++T  +E+Q  +DFA+++ANS L++RNQELIK+LSTPP
Sbjct  1100  FEAVEGVPKIKDGYNPATWMLDVTTPSMESQMSLDFAQLFANSSLYRRNQELIKQLSTPP  1159

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             PGS DLYFPTKYSQ F  Q KACFWKQ+WS WR PQYNA+RF +TIV+GVMFG+IFW  G
Sbjct  1160  PGSNDLYFPTKYSQPFWTQTKACFWKQYWSNWRYPQYNAIRFLMTIVIGVMFGLIFWQTG  1219

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
              +I  +QDL N  GA+YAA++FLG+ N ++VQ  +A+ERTVFYRE+AAGMYSA+PYA++Q
Sbjct  1220  TKIEKEQDLNNFFGAMYAAILFLGATNAATVQPAIAIERTVFYREKAAGMYSAIPYAISQ  1279

Query  624   V  626
             V
Sbjct  1280  V  1280


 Score =   254 bits (648),  Expect(2) = 1e-140, Method: Compositional matrix adjust.
 Identities = 112/177 (63%), Positives = 143/177 (81%), Gaps = 0/177 (0%)
 Frame = +2

Query  680   ILQAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALT  859
             I Q  +E +Y  +QT  Y+L+LY MIG++W + KFLWFYY+M TSFIYFTLYGMMLVALT
Sbjct  1277  ISQVAVEIMYNTIQTAVYTLILYSMIGYDWTVAKFLWFYYYMLTSFIYFTLYGMMLVALT  1336

Query  860   PGVQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKES  1039
             P  Q A I M+F L+ WNLF+GF++PR Q+P+WWRWYYWA+P  W+LYG+ITSQ+GD++S
Sbjct  1337  PNYQIAGICMSFFLSLWNLFSGFLIPRPQIPIWWRWYYWATPVAWTLYGIITSQVGDQDS  1396

Query  1040  RVQVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
              VQ+ G G+M++K  +KD FG+++ FLP VAA H+GW LLF FVFAYGI FLNFQRR
Sbjct  1397  IVQIAGVGNMSLKTLMKDGFGFEHDFLPVVAAVHIGWILLFVFVFAYGIKFLNFQRR  1453



>emb|CDY43723.1| BnaAnng07380D [Brassica napus]
Length=1453

 Score =   275 bits (704),  Expect(2) = 1e-140, Method: Compositional matrix adjust.
 Identities = 121/181 (67%), Positives = 154/181 (85%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              +AV GVPKIK+GYNPATWML+++T  +E+Q  +DFA+++ANS L++RNQELIK+LSTPP
Sbjct  1100  FEAVEGVPKIKDGYNPATWMLDVTTPSMESQMSLDFAQLFANSSLYRRNQELIKQLSTPP  1159

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             PGS DLYFPTKYSQ F  Q KACFWKQ+WS WR PQYNA+RF +TIV+GVMFG+IFW  G
Sbjct  1160  PGSNDLYFPTKYSQPFWTQTKACFWKQYWSNWRYPQYNAIRFLMTIVIGVMFGLIFWQTG  1219

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
              +I  +QDL N  GA+YAA++FLG+ N ++VQ  +A+ERTVFYRE+AAGMYSA+PYA++Q
Sbjct  1220  TKIEKEQDLNNFFGAMYAAILFLGATNAATVQPAIAIERTVFYREKAAGMYSAIPYAISQ  1279

Query  624   V  626
             V
Sbjct  1280  V  1280


 Score =   254 bits (648),  Expect(2) = 1e-140, Method: Compositional matrix adjust.
 Identities = 112/177 (63%), Positives = 143/177 (81%), Gaps = 0/177 (0%)
 Frame = +2

Query  680   ILQAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALT  859
             I Q  +E +Y  +QT  Y+L+LY MIG++W + KFLWFYY+M TSFIYFTLYGMMLVALT
Sbjct  1277  ISQVAVEIMYNTIQTAVYTLILYSMIGYDWTVAKFLWFYYYMLTSFIYFTLYGMMLVALT  1336

Query  860   PGVQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKES  1039
             P  Q A I M+F L+ WNLF+GF++PR Q+P+WWRWYYWA+P  W+LYG+ITSQ+GD++S
Sbjct  1337  PNYQIAGICMSFFLSLWNLFSGFLIPRPQIPIWWRWYYWATPVAWTLYGIITSQVGDQDS  1396

Query  1040  RVQVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
              VQ+ G G+M++K  +KD FG+++ FLP VAA H+GW LLF FVFAYGI FLNFQRR
Sbjct  1397  IVQIAGVGNMSLKTLMKDGFGFEHDFLPVVAAVHIGWILLFVFVFAYGIKFLNFQRR  1453



>ref|XP_006361443.1| PREDICTED: pleiotropic drug resistance protein 2-like isoform 
X1 [Solanum tuberosum]
Length=1464

 Score =   290 bits (741),  Expect(2) = 2e-140, Method: Compositional matrix adjust.
 Identities = 130/181 (72%), Positives = 155/181 (86%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              ++VPGV KIK+GYNPATWMLE+S A +E Q GV+FAE Y NS L++RN+EL KELSTP 
Sbjct  1107  FESVPGVNKIKDGYNPATWMLEVSAASVETQFGVNFAEYYTNSDLYRRNEELNKELSTPA  1166

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             PGS+DLYFPTKYSQ  + Q KACFWKQHWSYWRNPQYN +RFF+T V+G++FGVIFW KG
Sbjct  1167  PGSKDLYFPTKYSQPLLTQFKACFWKQHWSYWRNPQYNVIRFFMTTVIGIIFGVIFWDKG  1226

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
              ++  QQDL NL+GA+YAAV+FLG  NTS+VQ+ VA+ERTVFYRERAAGM+SALPYA AQ
Sbjct  1227  GKLEKQQDLSNLMGAMYAAVLFLGGTNTSAVQSVVAIERTVFYRERAAGMFSALPYAFAQ  1286

Query  624   V  626
             V
Sbjct  1287  V  1287


 Score =   239 bits (609),  Expect(2) = 2e-140, Method: Compositional matrix adjust.
 Identities = 113/179 (63%), Positives = 136/179 (76%), Gaps = 4/179 (2%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  +E IYV +QT  YSL+LY MIGFEW+  KF WFYY++F  F+YFTLYGMMLVALTP 
Sbjct  1286  QVTVETIYVGIQTFLYSLILYSMIGFEWQADKFFWFYYYVFMCFVYFTLYGMMLVALTPN  1345

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
              Q AAI M+F L+FWNLF+GF++PR Q+P+WWRWYYW SP  W++YGLITSQLGDK   V
Sbjct  1346  YQIAAIVMSFFLSFWNLFSGFLIPRMQIPIWWRWYYWGSPVAWTIYGLITSQLGDKTELV  1405

Query  1046  QVPG-EGDMT---IKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
              +P  +G  T   +K +LK + GYDY FL AVAAAH+ W LLFFFVF Y I  LNFQ+R
Sbjct  1406  HIPSHDGTPTYIQLKDYLKQYLGYDYDFLGAVAAAHLAWVLLFFFVFVYAIRVLNFQKR  1464



>ref|XP_006361444.1| PREDICTED: pleiotropic drug resistance protein 2-like isoform 
X2 [Solanum tuberosum]
Length=1451

 Score =   289 bits (740),  Expect(2) = 3e-140, Method: Compositional matrix adjust.
 Identities = 130/181 (72%), Positives = 155/181 (86%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              ++VPGV KIK+GYNPATWMLE+S A +E Q GV+FAE Y NS L++RN+EL KELSTP 
Sbjct  1094  FESVPGVNKIKDGYNPATWMLEVSAASVETQFGVNFAEYYTNSDLYRRNEELNKELSTPA  1153

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             PGS+DLYFPTKYSQ  + Q KACFWKQHWSYWRNPQYN +RFF+T V+G++FGVIFW KG
Sbjct  1154  PGSKDLYFPTKYSQPLLTQFKACFWKQHWSYWRNPQYNVIRFFMTTVIGIIFGVIFWDKG  1213

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
              ++  QQDL NL+GA+YAAV+FLG  NTS+VQ+ VA+ERTVFYRERAAGM+SALPYA AQ
Sbjct  1214  GKLEKQQDLSNLMGAMYAAVLFLGGTNTSAVQSVVAIERTVFYRERAAGMFSALPYAFAQ  1273

Query  624   V  626
             V
Sbjct  1274  V  1274


 Score =   239 bits (609),  Expect(2) = 3e-140, Method: Compositional matrix adjust.
 Identities = 113/179 (63%), Positives = 136/179 (76%), Gaps = 4/179 (2%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  +E IYV +QT  YSL+LY MIGFEW+  KF WFYY++F  F+YFTLYGMMLVALTP 
Sbjct  1273  QVTVETIYVGIQTFLYSLILYSMIGFEWQADKFFWFYYYVFMCFVYFTLYGMMLVALTPN  1332

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
              Q AAI M+F L+FWNLF+GF++PR Q+P+WWRWYYW SP  W++YGLITSQLGDK   V
Sbjct  1333  YQIAAIVMSFFLSFWNLFSGFLIPRMQIPIWWRWYYWGSPVAWTIYGLITSQLGDKTELV  1392

Query  1046  QVPG-EGDMT---IKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
              +P  +G  T   +K +LK + GYDY FL AVAAAH+ W LLFFFVF Y I  LNFQ+R
Sbjct  1393  HIPSHDGTPTYIQLKDYLKQYLGYDYDFLGAVAAAHLAWVLLFFFVFVYAIRVLNFQKR  1451



>ref|XP_009364871.1| PREDICTED: pleiotropic drug resistance protein 2-like [Pyrus 
x bretschneideri]
Length=1439

 Score =   297 bits (761),  Expect(2) = 5e-140, Method: Compositional matrix adjust.
 Identities = 132/181 (73%), Positives = 160/181 (88%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              +A+PGVPKIK GYNPATWML++S+A +EAQ  VDFAEI+ANS L++RNQELIKELS P 
Sbjct  1086  FEAIPGVPKIKEGYNPATWMLDVSSAAVEAQNDVDFAEIFANSDLYRRNQELIKELSMPQ  1145

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             PGS+DL+FPT++SQSF+ QCKACFWKQHWSYWRN QYNA+RFF+TI +GV+FG+IFW KG
Sbjct  1146  PGSKDLHFPTQFSQSFLTQCKACFWKQHWSYWRNSQYNAIRFFMTISVGVIFGIIFWNKG  1205

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
              ++  QQD++NLLGA YAAV+FLG+ N S+VQ+ VAVERTVFYRERAAGMYS LPYA +Q
Sbjct  1206  KKMDTQQDIMNLLGAGYAAVLFLGAGNASAVQSVVAVERTVFYRERAAGMYSELPYAFSQ  1265

Query  624   V  626
             V
Sbjct  1266  V  1266


 Score =   230 bits (586),  Expect(2) = 5e-140, Method: Compositional matrix adjust.
 Identities = 102/175 (58%), Positives = 133/175 (76%), Gaps = 0/175 (0%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  IE +YV +QT +YS++LY MIGF+WK+ KFL+FYYF+F  F YF++YGMM VALTPG
Sbjct  1265  QVAIETLYVLIQTFAYSVILYGMIGFDWKVDKFLYFYYFIFMCFTYFSMYGMMAVALTPG  1324

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
              Q AAI M F ++FWNLF+GF++PR  +P+WWRWYYW SP  W++YG+  SQ+GD +  +
Sbjct  1325  PQIAAIVMGFFMSFWNLFSGFLVPRTLIPIWWRWYYWGSPVAWTIYGIFASQMGDIKKDI  1384

Query  1046  QVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
              +PGE    + QFLKD+ GY+  F+  V   HVGW LLFFF+FAYGI +LNFQRR
Sbjct  1385  IIPGEESKPVNQFLKDYLGYEEDFVIPVVFGHVGWVLLFFFMFAYGIKYLNFQRR  1439



>ref|XP_002529079.1| ATP-binding cassette transporter, putative [Ricinus communis]
 gb|EEF33323.1| ATP-binding cassette transporter, putative [Ricinus communis]
Length=1446

 Score =   304 bits (778),  Expect(2) = 7e-140, Method: Compositional matrix adjust.
 Identities = 138/181 (76%), Positives = 159/181 (88%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              ++VPGV KIK GYNPATWMLE++T  +EAQ  VDFAEIYANS L++RNQELIKELSTP 
Sbjct  1093  FESVPGVAKIKEGYNPATWMLEVTTTTVEAQLDVDFAEIYANSALYRRNQELIKELSTPQ  1152

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             PGSQDLYFPT+YSQSF+ QCKACF+KQ+WSYWRN +YNA+RFF+TIV+GVMFG+IFWGKG
Sbjct  1153  PGSQDLYFPTRYSQSFITQCKACFYKQNWSYWRNSRYNAIRFFMTIVIGVMFGIIFWGKG  1212

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
             D+I  QQ L NLLGA YAA++FLG  N S+VQ+ VAVERTVFYRERAAGMYS LPYA AQ
Sbjct  1213  DQIETQQQLTNLLGATYAAILFLGGSNASAVQSVVAVERTVFYRERAAGMYSELPYAFAQ  1272

Query  624   V  626
             V
Sbjct  1273  V  1273


 Score =   223 bits (568),  Expect(2) = 7e-140, Method: Compositional matrix adjust.
 Identities = 109/175 (62%), Positives = 137/175 (78%), Gaps = 0/175 (0%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  IE +YVA+QTI Y+L+LY MIG+EW +GKF +FYYF+F  F YF++YGMM+VALTPG
Sbjct  1272  QVAIETLYVAIQTIIYTLILYSMIGYEWDVGKFFYFYYFIFMCFTYFSMYGMMVVALTPG  1331

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
              Q AAI MAF L+FWNLF+GF++PR  +PVWWRWYYW SP  W++YG++ SQ GDK S +
Sbjct  1332  HQIAAIVMAFFLSFWNLFSGFLVPRPLIPVWWRWYYWGSPVAWTIYGILASQFGDKTSPI  1391

Query  1046  QVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
             Q+P    + +  FLK+ +G+D+ FL  V  AHVGW LLFFFVFAYGI FLNFQRR
Sbjct  1392  QIPETPSVPVNVFLKEGWGFDHDFLVPVVIAHVGWVLLFFFVFAYGIKFLNFQRR  1446



>ref|XP_009348120.1| PREDICTED: pleiotropic drug resistance protein 2-like [Pyrus 
x bretschneideri]
Length=1439

 Score =   298 bits (762),  Expect(2) = 1e-139, Method: Compositional matrix adjust.
 Identities = 130/181 (72%), Positives = 161/181 (89%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              +A+PGVPKIK GYNPATWML++S+A +EAQ  VDFAEI+ANS L++RNQELIKELSTP 
Sbjct  1086  FEALPGVPKIKEGYNPATWMLDVSSAAVEAQNDVDFAEIFANSDLYRRNQELIKELSTPQ  1145

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             PGS+DLYFPT++SQSF+ QCKACFWKQHWSYWRN QYNA+RFF+T+ +G++FG+IFW KG
Sbjct  1146  PGSKDLYFPTQFSQSFLTQCKACFWKQHWSYWRNSQYNAIRFFMTVSVGIIFGIIFWNKG  1205

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
              +++ QQD++NLLGA Y AV+FLG+ N S+VQ+ +AVERTVFYRERAAGMYS LPYA +Q
Sbjct  1206  KKMNTQQDIMNLLGAGYGAVLFLGAGNASAVQSVIAVERTVFYRERAAGMYSELPYAFSQ  1265

Query  624   V  626
             V
Sbjct  1266  V  1266


 Score =   228 bits (582),  Expect(2) = 1e-139, Method: Compositional matrix adjust.
 Identities = 103/175 (59%), Positives = 132/175 (75%), Gaps = 0/175 (0%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  IE  YV +QT +YSL+LY MIGF WK  KFL+FYYF+F  F YF++YGMM VALTPG
Sbjct  1265  QVAIETFYVLIQTFAYSLILYGMIGFNWKADKFLYFYYFIFMCFTYFSMYGMMAVALTPG  1324

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
              Q AAI + F ++FWNLF+GF++PR  +P+WWRWYYW SP  W++YGL   Q+GD ++ V
Sbjct  1325  PQIAAIVIGFFMSFWNLFSGFLVPRTLIPIWWRWYYWGSPIAWTIYGLFACQMGDVKTLV  1384

Query  1046  QVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
             ++PGE    + QFLKD+ G++  F+  V  AHVGW LLFFF+FAYGI +LNFQRR
Sbjct  1385  EIPGEKSKPVDQFLKDYLGFEEDFVIPVVFAHVGWVLLFFFLFAYGIKYLNFQRR  1439



>emb|CDO99881.1| unnamed protein product [Coffea canephora]
Length=1461

 Score =   280 bits (717),  Expect(2) = 1e-139, Method: Compositional matrix adjust.
 Identities = 126/181 (70%), Positives = 153/181 (85%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              ++VPGV KI++G+NPATWMLE+S+  IE Q GVDFAEIY+ S LH+ N+ELIKELS P 
Sbjct  1108  FESVPGVTKIRDGFNPATWMLEVSSNAIENQLGVDFAEIYSTSDLHRTNEELIKELSNPA  1167

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             P S+DL FPTKYSQ  + Q KACFWKQ+WSYWRNPQYN +RFF+T V+G++FGVIFW KG
Sbjct  1168  PESKDLNFPTKYSQPSITQFKACFWKQYWSYWRNPQYNVIRFFMTTVIGIIFGVIFWDKG  1227

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
              ++  QQDL NLLGA+YAAV+FLG  NTS+VQ+ VA+ERTVFYRE+AAGM+SALPYA AQ
Sbjct  1228  GQMRKQQDLSNLLGAMYAAVLFLGGTNTSAVQSVVAIERTVFYREKAAGMFSALPYAFAQ  1287

Query  624   V  626
             V
Sbjct  1288  V  1288


 Score =   246 bits (627),  Expect(2) = 1e-139, Method: Compositional matrix adjust.
 Identities = 112/175 (64%), Positives = 138/175 (79%), Gaps = 0/175 (0%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  +E +YV VQT  YSLLLY MIGF+W++ KF WFYY++F  F+YFTLYGMMLVALTP 
Sbjct  1287  QVAVETMYVGVQTFVYSLLLYSMIGFQWEVAKFFWFYYYVFMCFVYFTLYGMMLVALTPS  1346

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
              + AAI M+F L+FWNLF+GF++PR  +PVWWRWYYW SP  W++YGLITSQLGD    V
Sbjct  1347  YEIAAILMSFFLSFWNLFSGFLIPRMAIPVWWRWYYWGSPVAWTIYGLITSQLGDVADPV  1406

Query  1046  QVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
              VP  GD+ +K +LK++ GY++ FL AVAAAH+GW LLFFFVF YGI  LNFQ+R
Sbjct  1407  HVPDHGDLPVKVYLKEYLGYEHDFLGAVAAAHLGWVLLFFFVFVYGIRALNFQKR  1461



>ref|XP_002887089.1| ATPDR11/PDR11 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH63348.1| ATPDR11/PDR11 [Arabidopsis lyrata subsp. lyrata]
Length=1450

 Score =   280 bits (717),  Expect(2) = 1e-139, Method: Compositional matrix adjust.
 Identities = 122/182 (67%), Positives = 157/182 (86%), Gaps = 0/182 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              +AV GVPKIK+GYNPATWML+++T  IE+Q  +DFA+I+ANS L+QRNQELI ELSTPP
Sbjct  1097  FEAVEGVPKIKDGYNPATWMLDVTTPSIESQMSLDFAQIFANSSLYQRNQELITELSTPP  1156

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             PGS+D+YF  KY+QSF  Q KACFWKQ+WSYWR+PQYNA+RF +T+V+GV+FG+IFW  G
Sbjct  1157  PGSKDVYFRNKYAQSFSTQTKACFWKQYWSYWRHPQYNAIRFLMTVVIGVLFGLIFWQIG  1216

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
              +I N+QDL N  GA+YAAV+FLG+ N ++VQ  +A+ERTVFYRE+AAGMYSA+PYA++Q
Sbjct  1217  TKIENEQDLNNFFGAMYAAVLFLGATNAATVQPAIAIERTVFYREKAAGMYSAIPYAISQ  1276

Query  624   VI  629
             V+
Sbjct  1277  VV  1278


 Score =   245 bits (626),  Expect(2) = 1e-139, Method: Compositional matrix adjust.
 Identities = 110/177 (62%), Positives = 138/177 (78%), Gaps = 0/177 (0%)
 Frame = +2

Query  680   ILQAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALT  859
             I Q  +E +Y  +QT  Y+L+LY MIG +W + KFLWFYY+M TSFIYFTLYGMML+ALT
Sbjct  1274  ISQVVVEIMYNTIQTGVYTLILYSMIGCDWTVAKFLWFYYYMLTSFIYFTLYGMMLMALT  1333

Query  860   PGVQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKES  1039
             P  Q A I M+F L+ WNLF+GF++PR Q+P+WWRWYYWA+P  W+LYGLITSQ+GDK+S
Sbjct  1334  PNYQIAGICMSFFLSLWNLFSGFLIPRPQIPIWWRWYYWATPVAWTLYGLITSQVGDKDS  1393

Query  1040  RVQVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
              V + G GD+ +K  LK+ FG+++ FLP VA  H+ W LLF FVFAYGI FLNFQRR
Sbjct  1394  MVHISGIGDIDLKTLLKEGFGFEHDFLPVVAVVHIAWILLFLFVFAYGIKFLNFQRR  1450



>ref|XP_009351140.1| PREDICTED: pleiotropic drug resistance protein 2-like [Pyrus 
x bretschneideri]
Length=1451

 Score =   302 bits (774),  Expect(2) = 2e-139, Method: Compositional matrix adjust.
 Identities = 133/181 (73%), Positives = 160/181 (88%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              +A+PGVPKIK GYNPATWMLE+S+A +EAQ  VDFA+I+ANS L+++NQELI+ELSTP 
Sbjct  1099  FEAIPGVPKIKEGYNPATWMLEVSSAAVEAQNNVDFADIFANSDLYRQNQELIEELSTPQ  1158

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             PGS DLYFPT+YSQSF+ QC ACFWKQHWSYWRN +YNA+RFF+T  +G++FGVIFWGKG
Sbjct  1159  PGSSDLYFPTQYSQSFITQCHACFWKQHWSYWRNSRYNAIRFFMTAGIGILFGVIFWGKG  1218

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
             D IH QQDL+NLLGA Y+AV+FLG+ N ++VQ+ VA+ERTVFYRERAAGMYS LPYA AQ
Sbjct  1219  DSIHKQQDLINLLGATYSAVLFLGASNANAVQSVVAIERTVFYRERAAGMYSELPYAFAQ  1278

Query  624   V  626
             V
Sbjct  1279  V  1279


 Score =   223 bits (568),  Expect(2) = 2e-139, Method: Compositional matrix adjust.
 Identities = 104/175 (59%), Positives = 130/175 (74%), Gaps = 1/175 (1%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  IE IYVA+QT  YS LLY MIG+ W + KFL+FYYF+F  F Y ++YGMM+VALTPG
Sbjct  1278  QVAIETIYVAIQTFMYSCLLYSMIGYVWTVEKFLYFYYFIFMCFTYMSMYGMMMVALTPG  1337

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
              Q AAI  +F  +FWNLF+GF++ R  +PVWWRWYYW SP  WS+YG+  SQ+GD +  +
Sbjct  1338  HQIAAIVSSFFTSFWNLFSGFLISRPLIPVWWRWYYWGSPIAWSIYGIFASQVGDNKDPI  1397

Query  1046  QVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
             +   +GD+ +  F+KD FGYDY FL  V  AH+GW LLFFFVFAYGI +LNFQRR
Sbjct  1398  ET-SQGDVPVDVFIKDNFGYDYDFLIPVVFAHIGWVLLFFFVFAYGIKYLNFQRR  1451



>ref|XP_011076913.1| PREDICTED: pleiotropic drug resistance protein 2-like [Sesamum 
indicum]
Length=1478

 Score =   297 bits (761),  Expect(2) = 4e-139, Method: Compositional matrix adjust.
 Identities = 132/181 (73%), Positives = 160/181 (88%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              Q+VPGVP+IK GYNPATWMLE+ST  +EAQ  VDFAEIYANS  ++RN+ELIK+LSTP 
Sbjct  1125  FQSVPGVPEIKEGYNPATWMLEVSTPAMEAQLNVDFAEIYANSDRYRRNEELIKQLSTPA  1184

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             PGSQDLYFPT+Y+QSF+ QC+ACFWKQH SYWR+PQYNA+RFF+T ++GV+FGVIFW KG
Sbjct  1185  PGSQDLYFPTEYAQSFLSQCRACFWKQHLSYWRHPQYNAIRFFMTTIIGVIFGVIFWDKG  1244

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
              ++  QQDL+NL+GA+Y+AV+FLG  NTS+VQ+ VAVERTVFYRE+AAGMYS LPYA AQ
Sbjct  1245  QQMSKQQDLMNLVGAMYSAVMFLGGTNTSAVQSVVAVERTVFYREKAAGMYSPLPYAFAQ  1304

Query  624   V  626
             V
Sbjct  1305  V  1305


 Score =   226 bits (577),  Expect(2) = 4e-139, Method: Compositional matrix adjust.
 Identities = 110/175 (63%), Positives = 137/175 (78%), Gaps = 0/175 (0%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  IE IYVA+QT  YSL+LY MIGF W    F WFY+F+F  F+YFT YGMMLVALTP 
Sbjct  1304  QVAIETIYVAIQTFIYSLILYSMIGFHWGADTFFWFYFFVFMCFVYFTAYGMMLVALTPN  1363

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
              Q AAI M+F L+FWNLF+GF++ R ++P+WWRWYYWASP  W++YGL+TSQ+GD+   V
Sbjct  1364  YQIAAIVMSFFLSFWNLFSGFLIARTEIPIWWRWYYWASPVAWTIYGLVTSQVGDRNEPV  1423

Query  1046  QVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
             +VPG  D+++KQ+L  F G+ Y FL AVAAAHVGW++LF  VFAYGI +LNFQRR
Sbjct  1424  EVPGFPDISVKQYLDRFLGFKYDFLGAVAAAHVGWAILFCLVFAYGIKYLNFQRR  1478



>ref|XP_009348121.1| PREDICTED: pleiotropic drug resistance protein 2-like [Pyrus 
x bretschneideri]
Length=427

 Score =   294 bits (752),  Expect(2) = 4e-139, Method: Compositional matrix adjust.
 Identities = 129/181 (71%), Positives = 161/181 (89%), Gaps = 0/181 (0%)
 Frame = +3

Query  84   LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
             +A+PGVPKIK GYNPATWML++S+A +EAQ  VDFAEI+ANS L++RNQELIKELSTP 
Sbjct  74   FEAIPGVPKIKEGYNPATWMLDVSSAAVEAQNDVDFAEIFANSDLYRRNQELIKELSTPQ  133

Query  264  PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
            PGS+D+YFPT++SQSF+ QCKACFWKQHWSYWRN QYNA+RFF+T+ +G++FG+IFW KG
Sbjct  134  PGSKDVYFPTQFSQSFLTQCKACFWKQHWSYWRNSQYNAIRFFMTVSVGIIFGIIFWNKG  193

Query  444  DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
             +++ QQD++NLLGA Y AV+FLG+ N S+VQ+ +AVERTVFYRERAAGMYS LPYA +Q
Sbjct  194  KKMNTQQDIMNLLGAGYGAVLFLGAGNASAVQSVIAVERTVFYRERAAGMYSELPYAFSQ  253

Query  624  V  626
            V
Sbjct  254  V  254


 Score =   230 bits (586),  Expect(2) = 4e-139, Method: Compositional matrix adjust.
 Identities = 104/175 (59%), Positives = 134/175 (77%), Gaps = 0/175 (0%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  IE +YV +QT +YS +LY MIGF WK+ KFL+FYYF+F  F YF++YGMM VALTPG
Sbjct  253   QVAIETLYVLIQTFAYSFILYGMIGFNWKVDKFLYFYYFIFMCFTYFSMYGMMAVALTPG  312

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
              Q AAI M F ++FWNLF+GF++PR  +P+WWRWYYW SP  W++YGL  SQ+GD ++ V
Sbjct  313   PQIAAIVMGFFMSFWNLFSGFLIPRTLIPIWWRWYYWGSPIAWTIYGLFASQMGDVKTLV  372

Query  1046  QVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
             ++PGE    + QFLKD+ G++  F+  V  AHVGW LLFFF+FAYGI +LNFQRR
Sbjct  373   EIPGEKSKPVDQFLKDYLGFEEDFVIPVVFAHVGWVLLFFFLFAYGIKYLNFQRR  427



>gb|EYU40701.1| hypothetical protein MIMGU_mgv1a022939mg, partial [Erythranthe 
guttata]
Length=1031

 Score =   308 bits (789),  Expect(2) = 5e-139, Method: Compositional matrix adjust.
 Identities = 139/181 (77%), Positives = 159/181 (88%), Gaps = 0/181 (0%)
 Frame = +3

Query  84   LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
             +AVPGV KIK GYNPATWML+++++  E Q  VDFAE+YANS L++RNQELIKELS PP
Sbjct  677  FEAVPGVAKIKEGYNPATWMLDVTSSAAEGQLDVDFAEVYANSALYRRNQELIKELSNPP  736

Query  264  PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
            PGS DLYFPT+YSQSF+ QCKACFWKQHWSYWRN QYNA+RFF T+V+GVMFGVIFW KG
Sbjct  737  PGSSDLYFPTQYSQSFLTQCKACFWKQHWSYWRNSQYNAIRFFTTVVIGVMFGVIFWQKG  796

Query  444  DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
            D+IH QQDLLNLLGA Y+AV+FLG+ N S+VQ+ VAVERTVFYRERAAGMYS LPYA AQ
Sbjct  797  DQIHRQQDLLNLLGATYSAVLFLGASNASAVQSVVAVERTVFYRERAAGMYSELPYAFAQ  856

Query  624  V  626
            V
Sbjct  857  V  857


 Score =   216 bits (549),  Expect(2) = 5e-139, Method: Compositional matrix adjust.
 Identities = 108/176 (61%), Positives = 135/176 (77%), Gaps = 1/176 (1%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  IE IYVA+QT+ YSLLLY MIG++W   KF +FYYF+F  F YF++YGMM+VALTPG
Sbjct  856   QVAIETIYVAIQTLVYSLLLYSMIGYQWTGEKFFYFYYFIFMCFTYFSMYGMMVVALTPG  915

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
              Q AAI M+F L+FWNLF+GF++PR  +P+WWRWYYWASP  W++YG+ TSQ+GD+   +
Sbjct  916   YQIAAIVMSFFLSFWNLFSGFLIPRPLIPIWWRWYYWASPVAWTIYGIFTSQIGDQTGDL  975

Query  1046  QVPGE-GDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
             ++ G    M + QFLK+  GYD+ FL  V  AHVGW LLFF VFAYGI FLNFQRR
Sbjct  976   ELTGNIATMKVNQFLKEELGYDHDFLIPVVFAHVGWVLLFFLVFAYGIKFLNFQRR  1031



>ref|XP_008349786.1| PREDICTED: pleiotropic drug resistance protein 2-like [Malus 
domestica]
Length=1451

 Score =   303 bits (776),  Expect(2) = 7e-139, Method: Compositional matrix adjust.
 Identities = 134/181 (74%), Positives = 159/181 (88%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              +A+PGVPKIK GYNPATWMLE+S+A +EAQ  VDFAEI+ANS L+++NQELIKELSTP 
Sbjct  1099  FEAIPGVPKIKEGYNPATWMLEVSSASVEAQNNVDFAEIFANSELYRQNQELIKELSTPQ  1158

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             PGS DLYFPT+YSQSF+ QC ACFWKQHWSYWRN +YNA+R F+T  +G++FGVIFWGKG
Sbjct  1159  PGSSDLYFPTQYSQSFITQCHACFWKQHWSYWRNSRYNAIRLFMTAGIGILFGVIFWGKG  1218

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
             D IH QQDL+NLLGA Y+AV+FLG+ N ++VQ+ VA+ERTVFYRERAAGMYS LPYA AQ
Sbjct  1219  DSIHKQQDLINLLGATYSAVLFLGASNANAVQSVVAIERTVFYRERAAGMYSELPYAFAQ  1278

Query  624   V  626
             V
Sbjct  1279  V  1279


 Score =   220 bits (561),  Expect(2) = 7e-139, Method: Compositional matrix adjust.
 Identities = 103/175 (59%), Positives = 130/175 (74%), Gaps = 1/175 (1%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  IE IYVA+QT  YS +LY MIG+ W + KFL+FYYF+F  F Y ++YGMM+VALTPG
Sbjct  1278  QVAIETIYVAIQTFMYSCILYSMIGYVWTVEKFLYFYYFIFMCFTYMSMYGMMMVALTPG  1337

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
              Q AAI  +F  +FWNLF+GF++ R  +PVWWRWYYW SP  WS+YG+  SQ+GD +  +
Sbjct  1338  HQIAAIVSSFFTSFWNLFSGFLISRPLIPVWWRWYYWGSPIAWSIYGIFASQVGDNKDLI  1397

Query  1046  QVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
              V  +G++ +  F+KD FGYDY FL  V  AH+GW LLFFFVFAYGI +LNFQRR
Sbjct  1398  -VTSQGEVRVDVFIKDNFGYDYDFLIPVVFAHIGWVLLFFFVFAYGIKYLNFQRR  1451



>ref|XP_010552832.1| PREDICTED: ABC transporter G family member 39-like [Tarenaya 
hassleriana]
Length=1442

 Score =   294 bits (753),  Expect(2) = 7e-139, Method: Compositional matrix adjust.
 Identities = 132/182 (73%), Positives = 158/182 (87%), Gaps = 0/182 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              +AV GVPKIK+GYNPATWML+IST  +E Q G+DFAEIYANS L+QRNQELI+ELSTPP
Sbjct  1089  FEAVSGVPKIKDGYNPATWMLDISTPSMETQLGIDFAEIYANSSLYQRNQELIEELSTPP  1148

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             PGS+DLYFPTKYSQSF  QCKACFWKQ+ SYWR+PQYNA+RF +T+++GV+FG+I+W KG
Sbjct  1149  PGSEDLYFPTKYSQSFATQCKACFWKQYNSYWRHPQYNAIRFLMTLLIGVLFGLIYWQKG  1208

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
              +I  QQDL N  GA+YAAV+FLG  N ++VQ  VA+ERTVFYRERAAGMYSA+PYA AQ
Sbjct  1209  SKIEKQQDLNNFFGAMYAAVMFLGPTNAATVQPVVAIERTVFYRERAAGMYSAIPYAFAQ  1268

Query  624   VI  629
             V+
Sbjct  1269  VV  1270


 Score =   229 bits (583),  Expect(2) = 7e-139, Method: Compositional matrix adjust.
 Identities = 101/175 (58%), Positives = 131/175 (75%), Gaps = 0/175 (0%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  +E +Y   QT+ Y+L+LY MIG++W + KF WF+Y++ T FIYFTLYGMMLVALTP 
Sbjct  1268  QVVVEIVYNVAQTMVYTLILYSMIGYDWTIVKFFWFFYYVVTCFIYFTLYGMMLVALTPN  1327

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
                A+I M+F L  WNLF+GF++PR Q+P+WWRWYYWASP  W+LYG+ITSQ+GD E  V
Sbjct  1328  YHIASICMSFFLGLWNLFSGFLIPRPQIPIWWRWYYWASPVAWTLYGIITSQVGDSEMSV  1387

Query  1046  QVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
             Q+PG GD+ +K  +K+  G+D+ FLP VA  HV W L+F  VF YGI + NFQRR
Sbjct  1388  QIPGLGDINLKALMKEGLGFDHEFLPTVAILHVVWILVFLVVFTYGIKYFNFQRR  1442



>ref|XP_010312551.1| PREDICTED: pleiotropic drug resistance protein 2-like isoform 
X3 [Solanum lycopersicum]
Length=1450

 Score =   286 bits (732),  Expect(2) = 8e-139, Method: Compositional matrix adjust.
 Identities = 128/181 (71%), Positives = 153/181 (85%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              ++VPGV KIK+GYNPATWMLE+S A +E Q  ++FAEIY NS L++RN+EL KELSTP 
Sbjct  1093  FESVPGVNKIKDGYNPATWMLEVSAASVETQFSINFAEIYTNSDLYRRNEELNKELSTPA  1152

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             PGS+DLYFPTKYSQ  + Q KAC WKQHWSYWRNPQYN +RFF+T V+G++FGVIFW KG
Sbjct  1153  PGSKDLYFPTKYSQPLLTQFKACLWKQHWSYWRNPQYNVIRFFMTTVIGIIFGVIFWDKG  1212

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
              +   QQDL NL+GA+YAAV+FLG  NTS+VQ+ VA+ERTVFYRERAAGM+SALPYA AQ
Sbjct  1213  GKFEKQQDLSNLMGAMYAAVLFLGGTNTSAVQSVVAIERTVFYRERAAGMFSALPYAFAQ  1272

Query  624   V  626
             V
Sbjct  1273  V  1273


 Score =   237 bits (604),  Expect(2) = 8e-139, Method: Compositional matrix adjust.
 Identities = 112/179 (63%), Positives = 135/179 (75%), Gaps = 4/179 (2%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  +E IYV +QT  YSL+LY MIGFEW+  KF WFYY++F  F+YFTLYGMMLVALTP 
Sbjct  1272  QVTVETIYVGIQTFLYSLILYSMIGFEWQADKFFWFYYYVFMCFVYFTLYGMMLVALTPN  1331

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
              Q AAI M+F L+FWNLF+GF++PR Q+P+WWRWYYW SP  W++YGLITSQLGDK   V
Sbjct  1332  YQIAAIVMSFFLSFWNLFSGFLIPRMQIPIWWRWYYWGSPVAWTIYGLITSQLGDKTELV  1391

Query  1046  QVPG-EGDMT---IKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
              +P  +G  T   +K +LK +  YDY FL AVAAAH+ W LLFFFVF Y I  LNFQ+R
Sbjct  1392  HIPSHDGTPTYIQLKDYLKQYLDYDYDFLGAVAAAHLAWVLLFFFVFVYAIRVLNFQKR  1450



>ref|XP_004249988.1| PREDICTED: pleiotropic drug resistance protein 2-like isoform 
X1 [Solanum lycopersicum]
Length=1464

 Score =   286 bits (732),  Expect(2) = 1e-138, Method: Compositional matrix adjust.
 Identities = 128/181 (71%), Positives = 153/181 (85%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              ++VPGV KIK+GYNPATWMLE+S A +E Q  ++FAEIY NS L++RN+EL KELSTP 
Sbjct  1107  FESVPGVNKIKDGYNPATWMLEVSAASVETQFSINFAEIYTNSDLYRRNEELNKELSTPA  1166

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             PGS+DLYFPTKYSQ  + Q KAC WKQHWSYWRNPQYN +RFF+T V+G++FGVIFW KG
Sbjct  1167  PGSKDLYFPTKYSQPLLTQFKACLWKQHWSYWRNPQYNVIRFFMTTVIGIIFGVIFWDKG  1226

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
              +   QQDL NL+GA+YAAV+FLG  NTS+VQ+ VA+ERTVFYRERAAGM+SALPYA AQ
Sbjct  1227  GKFEKQQDLSNLMGAMYAAVLFLGGTNTSAVQSVVAIERTVFYRERAAGMFSALPYAFAQ  1286

Query  624   V  626
             V
Sbjct  1287  V  1287


 Score =   237 bits (604),  Expect(2) = 1e-138, Method: Compositional matrix adjust.
 Identities = 112/179 (63%), Positives = 135/179 (75%), Gaps = 4/179 (2%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  +E IYV +QT  YSL+LY MIGFEW+  KF WFYY++F  F+YFTLYGMMLVALTP 
Sbjct  1286  QVTVETIYVGIQTFLYSLILYSMIGFEWQADKFFWFYYYVFMCFVYFTLYGMMLVALTPN  1345

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
              Q AAI M+F L+FWNLF+GF++PR Q+P+WWRWYYW SP  W++YGLITSQLGDK   V
Sbjct  1346  YQIAAIVMSFFLSFWNLFSGFLIPRMQIPIWWRWYYWGSPVAWTIYGLITSQLGDKTELV  1405

Query  1046  QVPG-EGDMT---IKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
              +P  +G  T   +K +LK +  YDY FL AVAAAH+ W LLFFFVF Y I  LNFQ+R
Sbjct  1406  HIPSHDGTPTYIQLKDYLKQYLDYDYDFLGAVAAAHLAWVLLFFFVFVYAIRVLNFQKR  1464



>ref|XP_010312553.1| PREDICTED: pleiotropic drug resistance protein 2-like isoform 
X5 [Solanum lycopersicum]
Length=1432

 Score =   286 bits (732),  Expect(2) = 1e-138, Method: Compositional matrix adjust.
 Identities = 128/181 (71%), Positives = 153/181 (85%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              ++VPGV KIK+GYNPATWMLE+S A +E Q  ++FAEIY NS L++RN+EL KELSTP 
Sbjct  1075  FESVPGVNKIKDGYNPATWMLEVSAASVETQFSINFAEIYTNSDLYRRNEELNKELSTPA  1134

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             PGS+DLYFPTKYSQ  + Q KAC WKQHWSYWRNPQYN +RFF+T V+G++FGVIFW KG
Sbjct  1135  PGSKDLYFPTKYSQPLLTQFKACLWKQHWSYWRNPQYNVIRFFMTTVIGIIFGVIFWDKG  1194

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
              +   QQDL NL+GA+YAAV+FLG  NTS+VQ+ VA+ERTVFYRERAAGM+SALPYA AQ
Sbjct  1195  GKFEKQQDLSNLMGAMYAAVLFLGGTNTSAVQSVVAIERTVFYRERAAGMFSALPYAFAQ  1254

Query  624   V  626
             V
Sbjct  1255  V  1255


 Score =   236 bits (603),  Expect(2) = 1e-138, Method: Compositional matrix adjust.
 Identities = 112/179 (63%), Positives = 135/179 (75%), Gaps = 4/179 (2%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  +E IYV +QT  YSL+LY MIGFEW+  KF WFYY++F  F+YFTLYGMMLVALTP 
Sbjct  1254  QVTVETIYVGIQTFLYSLILYSMIGFEWQADKFFWFYYYVFMCFVYFTLYGMMLVALTPN  1313

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
              Q AAI M+F L+FWNLF+GF++PR Q+P+WWRWYYW SP  W++YGLITSQLGDK   V
Sbjct  1314  YQIAAIVMSFFLSFWNLFSGFLIPRMQIPIWWRWYYWGSPVAWTIYGLITSQLGDKTELV  1373

Query  1046  QVPG-EGDMT---IKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
              +P  +G  T   +K +LK +  YDY FL AVAAAH+ W LLFFFVF Y I  LNFQ+R
Sbjct  1374  HIPSHDGTPTYIQLKDYLKQYLDYDYDFLGAVAAAHLAWVLLFFFVFVYAIRVLNFQKR  1432



>ref|XP_010312550.1| PREDICTED: pleiotropic drug resistance protein 2-like isoform 
X2 [Solanum lycopersicum]
Length=1452

 Score =   286 bits (732),  Expect(2) = 1e-138, Method: Compositional matrix adjust.
 Identities = 128/181 (71%), Positives = 153/181 (85%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              ++VPGV KIK+GYNPATWMLE+S A +E Q  ++FAEIY NS L++RN+EL KELSTP 
Sbjct  1095  FESVPGVNKIKDGYNPATWMLEVSAASVETQFSINFAEIYTNSDLYRRNEELNKELSTPA  1154

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             PGS+DLYFPTKYSQ  + Q KAC WKQHWSYWRNPQYN +RFF+T V+G++FGVIFW KG
Sbjct  1155  PGSKDLYFPTKYSQPLLTQFKACLWKQHWSYWRNPQYNVIRFFMTTVIGIIFGVIFWDKG  1214

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
              +   QQDL NL+GA+YAAV+FLG  NTS+VQ+ VA+ERTVFYRERAAGM+SALPYA AQ
Sbjct  1215  GKFEKQQDLSNLMGAMYAAVLFLGGTNTSAVQSVVAIERTVFYRERAAGMFSALPYAFAQ  1274

Query  624   V  626
             V
Sbjct  1275  V  1275


 Score =   236 bits (603),  Expect(2) = 1e-138, Method: Compositional matrix adjust.
 Identities = 112/179 (63%), Positives = 135/179 (75%), Gaps = 4/179 (2%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  +E IYV +QT  YSL+LY MIGFEW+  KF WFYY++F  F+YFTLYGMMLVALTP 
Sbjct  1274  QVTVETIYVGIQTFLYSLILYSMIGFEWQADKFFWFYYYVFMCFVYFTLYGMMLVALTPN  1333

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
              Q AAI M+F L+FWNLF+GF++PR Q+P+WWRWYYW SP  W++YGLITSQLGDK   V
Sbjct  1334  YQIAAIVMSFFLSFWNLFSGFLIPRMQIPIWWRWYYWGSPVAWTIYGLITSQLGDKTELV  1393

Query  1046  QVPG-EGDMT---IKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
              +P  +G  T   +K +LK +  YDY FL AVAAAH+ W LLFFFVF Y I  LNFQ+R
Sbjct  1394  HIPSHDGTPTYIQLKDYLKQYLDYDYDFLGAVAAAHLAWVLLFFFVFVYAIRVLNFQKR  1452



>ref|XP_010312552.1| PREDICTED: pleiotropic drug resistance protein 2-like isoform 
X4 [Solanum lycopersicum]
Length=1448

 Score =   286 bits (732),  Expect(2) = 1e-138, Method: Compositional matrix adjust.
 Identities = 128/181 (71%), Positives = 153/181 (85%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              ++VPGV KIK+GYNPATWMLE+S A +E Q  ++FAEIY NS L++RN+EL KELSTP 
Sbjct  1091  FESVPGVNKIKDGYNPATWMLEVSAASVETQFSINFAEIYTNSDLYRRNEELNKELSTPA  1150

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             PGS+DLYFPTKYSQ  + Q KAC WKQHWSYWRNPQYN +RFF+T V+G++FGVIFW KG
Sbjct  1151  PGSKDLYFPTKYSQPLLTQFKACLWKQHWSYWRNPQYNVIRFFMTTVIGIIFGVIFWDKG  1210

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
              +   QQDL NL+GA+YAAV+FLG  NTS+VQ+ VA+ERTVFYRERAAGM+SALPYA AQ
Sbjct  1211  GKFEKQQDLSNLMGAMYAAVLFLGGTNTSAVQSVVAIERTVFYRERAAGMFSALPYAFAQ  1270

Query  624   V  626
             V
Sbjct  1271  V  1271


 Score =   236 bits (603),  Expect(2) = 1e-138, Method: Compositional matrix adjust.
 Identities = 112/179 (63%), Positives = 135/179 (75%), Gaps = 4/179 (2%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  +E IYV +QT  YSL+LY MIGFEW+  KF WFYY++F  F+YFTLYGMMLVALTP 
Sbjct  1270  QVTVETIYVGIQTFLYSLILYSMIGFEWQADKFFWFYYYVFMCFVYFTLYGMMLVALTPN  1329

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
              Q AAI M+F L+FWNLF+GF++PR Q+P+WWRWYYW SP  W++YGLITSQLGDK   V
Sbjct  1330  YQIAAIVMSFFLSFWNLFSGFLIPRMQIPIWWRWYYWGSPVAWTIYGLITSQLGDKTELV  1389

Query  1046  QVPG-EGDMT---IKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
              +P  +G  T   +K +LK +  YDY FL AVAAAH+ W LLFFFVF Y I  LNFQ+R
Sbjct  1390  HIPSHDGTPTYIQLKDYLKQYLDYDYDFLGAVAAAHLAWVLLFFFVFVYAIRVLNFQKR  1448



>ref|XP_004291542.1| PREDICTED: pleiotropic drug resistance protein 2-like [Fragaria 
vesca subsp. vesca]
Length=1441

 Score =   294 bits (752),  Expect(2) = 1e-138, Method: Compositional matrix adjust.
 Identities = 129/181 (71%), Positives = 156/181 (86%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              +A+PGVPKIK+G+NPATWML++S+A +EA   +DFAE+YANS L++  QELIKELSTP 
Sbjct  1088  FEAIPGVPKIKDGFNPATWMLDVSSAAVEAHNNIDFAEVYANSELYRSVQELIKELSTPL  1147

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             PGS+DLYFPTKYSQSF  QCKACFWKQHWSYWRN QYNA+RFF TIV+G +FG+IFW KG
Sbjct  1148  PGSKDLYFPTKYSQSFPTQCKACFWKQHWSYWRNSQYNAIRFFTTIVIGALFGIIFWNKG  1207

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
             D +  +QD++NL+GA YAAV+FLG+ N  SVQ+ V++ERTVFYRERAAGMYS LPYA AQ
Sbjct  1208  DVLEKEQDIINLMGATYAAVLFLGAGNGHSVQSVVSIERTVFYRERAAGMYSELPYAFAQ  1267

Query  624   V  626
             V
Sbjct  1268  V  1268


 Score =   229 bits (583),  Expect(2) = 1e-138, Method: Compositional matrix adjust.
 Identities = 103/175 (59%), Positives = 135/175 (77%), Gaps = 0/175 (0%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  IE IYVA+Q+  Y LLL+ MIG+++K+ KFL+FYYF    F YF++YGMM+VALTPG
Sbjct  1267  QVAIETIYVAIQSFIYCLLLFFMIGYKFKIEKFLYFYYFTCMCFTYFSMYGMMVVALTPG  1326

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
              Q A+I M+F ++FWNLF+GF++PR  +P+WWRWYYW SP  W++YG+I SQ GD+  R 
Sbjct  1327  HQIASIVMSFFMSFWNLFSGFLIPRPLIPIWWRWYYWGSPVAWTIYGIIGSQFGDRSDRS  1386

Query  1046  QVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
                 EG +T+ ++LK+ +GYD+ FL  V AAHVGW LLFFFVFAYGI +LNFQRR
Sbjct  1387  ITTAEGSVTVDEYLKEAYGYDHDFLIPVVAAHVGWVLLFFFVFAYGIKYLNFQRR  1441



>ref|NP_176867.2| ABC transporter G family member 39 [Arabidopsis thaliana]
 sp|Q7PC84.1|AB39G_ARATH RecName: Full=ABC transporter G family member 39; Short=ABC transporter 
ABCG.39; Short=AtABCG39; AltName: Full=Probable pleiotropic 
drug resistance protein 11 [Arabidopsis thaliana]
 tpg|DAA00879.1| TPA_exp: PDR11 ABC transporter [Arabidopsis thaliana]
 gb|AEE34577.1| ABC transporter G family member 39 [Arabidopsis thaliana]
Length=1454

 Score =   276 bits (706),  Expect(2) = 2e-138, Method: Compositional matrix adjust.
 Identities = 118/181 (65%), Positives = 157/181 (87%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              +AV GVPKI +GYNPATWML+++T  +E+Q  +DFA+I++NS L++RNQELIK+LSTPP
Sbjct  1101  FEAVEGVPKINDGYNPATWMLDVTTPSMESQMSLDFAQIFSNSSLYRRNQELIKDLSTPP  1160

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             PGS+D+YF TKY+QSF  Q KACFWKQ+WSYWR+PQYNA+RF +T+V+GV+FG+IFW  G
Sbjct  1161  PGSKDVYFKTKYAQSFSTQTKACFWKQYWSYWRHPQYNAIRFLMTVVIGVLFGLIFWQIG  1220

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
              +  N+QDL N  GA+YAAV+FLG++N ++VQ  +A+ERTVFYRE+AAGMYSA+PYA++Q
Sbjct  1221  TKTENEQDLNNFFGAMYAAVLFLGALNAATVQPAIAIERTVFYREKAAGMYSAIPYAISQ  1280

Query  624   V  626
             V
Sbjct  1281  V  1281


 Score =   246 bits (628),  Expect(2) = 2e-138, Method: Compositional matrix adjust.
 Identities = 110/177 (62%), Positives = 137/177 (77%), Gaps = 0/177 (0%)
 Frame = +2

Query  680   ILQAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALT  859
             I Q  +E +Y  +QT  Y+L+LY MIG  W + KFLWFYY+M TSFIYFTLYGMML+ALT
Sbjct  1278  ISQVAVEIMYNTIQTGVYTLILYSMIGCNWTMAKFLWFYYYMLTSFIYFTLYGMMLMALT  1337

Query  860   PGVQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKES  1039
             P  Q A I M+F L+ WNLF+GF++PR Q+P+WWRWYYWA+P  W+LYGLITSQ+GDK+S
Sbjct  1338  PNYQIAGICMSFFLSLWNLFSGFLIPRPQIPIWWRWYYWATPVAWTLYGLITSQVGDKDS  1397

Query  1040  RVQVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
              V + G GD+ +K  LK+ FG+++ FLP VA  H+ W LLF FVFAYGI FLNFQRR
Sbjct  1398  MVHISGIGDIDLKTLLKEGFGFEHDFLPVVAVVHIAWILLFLFVFAYGIKFLNFQRR  1454



>gb|AAF98206.1|AC007152_2 Putative ABC transporter [Arabidopsis thaliana]
Length=1435

 Score =   276 bits (706),  Expect(2) = 2e-138, Method: Compositional matrix adjust.
 Identities = 118/181 (65%), Positives = 157/181 (87%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              +AV GVPKI +GYNPATWML+++T  +E+Q  +DFA+I++NS L++RNQELIK+LSTPP
Sbjct  1082  FEAVEGVPKINDGYNPATWMLDVTTPSMESQMSLDFAQIFSNSSLYRRNQELIKDLSTPP  1141

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             PGS+D+YF TKY+QSF  Q KACFWKQ+WSYWR+PQYNA+RF +T+V+GV+FG+IFW  G
Sbjct  1142  PGSKDVYFKTKYAQSFSTQTKACFWKQYWSYWRHPQYNAIRFLMTVVIGVLFGLIFWQIG  1201

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
              +  N+QDL N  GA+YAAV+FLG++N ++VQ  +A+ERTVFYRE+AAGMYSA+PYA++Q
Sbjct  1202  TKTENEQDLNNFFGAMYAAVLFLGALNAATVQPAIAIERTVFYREKAAGMYSAIPYAISQ  1261

Query  624   V  626
             V
Sbjct  1262  V  1262


 Score =   246 bits (628),  Expect(2) = 2e-138, Method: Compositional matrix adjust.
 Identities = 110/177 (62%), Positives = 137/177 (77%), Gaps = 0/177 (0%)
 Frame = +2

Query  680   ILQAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALT  859
             I Q  +E +Y  +QT  Y+L+LY MIG  W + KFLWFYY+M TSFIYFTLYGMML+ALT
Sbjct  1259  ISQVAVEIMYNTIQTGVYTLILYSMIGCNWTMAKFLWFYYYMLTSFIYFTLYGMMLMALT  1318

Query  860   PGVQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKES  1039
             P  Q A I M+F L+ WNLF+GF++PR Q+P+WWRWYYWA+P  W+LYGLITSQ+GDK+S
Sbjct  1319  PNYQIAGICMSFFLSLWNLFSGFLIPRPQIPIWWRWYYWATPVAWTLYGLITSQVGDKDS  1378

Query  1040  RVQVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
              V + G GD+ +K  LK+ FG+++ FLP VA  H+ W LLF FVFAYGI FLNFQRR
Sbjct  1379  MVHISGIGDIDLKTLLKEGFGFEHDFLPVVAVVHIAWILLFLFVFAYGIKFLNFQRR  1435



>ref|XP_008359761.1| PREDICTED: pleiotropic drug resistance protein 2-like [Malus 
domestica]
Length=1164

 Score =   292 bits (748),  Expect(2) = 2e-138, Method: Compositional matrix adjust.
 Identities = 128/181 (71%), Positives = 159/181 (88%), Gaps = 0/181 (0%)
 Frame = +3

Query  84   LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
             +A+PGVPKIK GYNPATWML++S+A IEAQ  +DFAEI+ANS L++RNQELIKELS P 
Sbjct  811  FEAIPGVPKIKEGYNPATWMLDVSSAAIEAQNDIDFAEIFANSDLYRRNQELIKELSMPQ  870

Query  264  PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             GS+DLYFPT++SQSF+ QCKACFWKQHWSYWRN QYNA+RFF+T+ +G++FG+IFW KG
Sbjct  871  QGSKDLYFPTQFSQSFLTQCKACFWKQHWSYWRNSQYNAIRFFMTVSVGIIFGIIFWNKG  930

Query  444  DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
             +++ QQD++NLLGA Y AV+FLG+ N S+VQ+ +AVERTVFYRERAAGMYS LPYA +Q
Sbjct  931  KKMNTQQDIMNLLGAGYGAVLFLGAGNASAVQSVIAVERTVFYRERAAGMYSELPYAFSQ  990

Query  624  V  626
            V
Sbjct  991  V  991


 Score =   230 bits (586),  Expect(2) = 2e-138, Method: Compositional matrix adjust.
 Identities = 104/175 (59%), Positives = 134/175 (77%), Gaps = 0/175 (0%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  IE +YV +QT +YSL+LY MIGF WK+ KFL+FYYF+F  F YF++YGMM VALTPG
Sbjct  990   QVAIETLYVLIQTFAYSLILYGMIGFNWKVDKFLYFYYFIFMCFTYFSMYGMMAVALTPG  1049

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
              Q AAI M F ++FWNLF+GF++PR  +P+WWRWYYW SP  W++YGL  SQ+GD ++ V
Sbjct  1050  PQIAAIVMGFFMSFWNLFSGFLVPRTLIPIWWRWYYWGSPIAWTIYGLFASQMGDVKTLV  1109

Query  1046  QVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
             ++ GE    + QFLKD+ G++  F+  V  AHVGW LLFFF+FAYGI +LNFQRR
Sbjct  1110  EIXGEKSKPVNQFLKDYLGFEEDFVIPVVFAHVGWVLLFFFLFAYGIKYLNFQRR  1164



>ref|XP_010496113.1| PREDICTED: ABC transporter G family member 39 [Camelina sativa]
Length=1448

 Score =   278 bits (712),  Expect(2) = 2e-138, Method: Compositional matrix adjust.
 Identities = 121/181 (67%), Positives = 156/181 (86%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              + V GVPKIK+GYNPATWML+++T  IE+Q  +DF++I+ANS L++RNQELIKELSTPP
Sbjct  1095  FEGVEGVPKIKDGYNPATWMLDVTTPSIESQMSLDFSQIFANSSLYRRNQELIKELSTPP  1154

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             PGS+DLYF TKY+Q F  Q KACFWKQ+WSYWR+PQYNA+RF +T+V+GV+FG+IFW  G
Sbjct  1155  PGSKDLYFRTKYAQPFSTQTKACFWKQYWSYWRHPQYNAIRFLMTVVIGVLFGLIFWQIG  1214

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
              +I N+QDL N  GA+YAAV+FLG+ N ++VQ  +A+ERTVFYRE+AAGMYSA+PYA++Q
Sbjct  1215  TKIENEQDLNNFFGAMYAAVLFLGATNAATVQPAIAIERTVFYREKAAGMYSAIPYAISQ  1274

Query  624   V  626
             V
Sbjct  1275  V  1275


 Score =   243 bits (621),  Expect(2) = 2e-138, Method: Compositional matrix adjust.
 Identities = 110/177 (62%), Positives = 138/177 (78%), Gaps = 0/177 (0%)
 Frame = +2

Query  680   ILQAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALT  859
             I Q  +E +Y  +QT  Y+L+LY MIG +W + KFLWFYY+M TSFIYFTLYGMML+ALT
Sbjct  1272  ISQVAVEIMYNTIQTGVYTLILYSMIGCDWTVTKFLWFYYYMLTSFIYFTLYGMMLMALT  1331

Query  860   PGVQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKES  1039
             P  Q A I M+F L+ WNLF+GF++PR Q+P+WWRWYYWA+P  W+LYGLITSQ+GDK+S
Sbjct  1332  PNYQIAGICMSFFLSLWNLFSGFLIPRPQIPLWWRWYYWATPVAWTLYGLITSQVGDKDS  1391

Query  1040  RVQVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
              V + G GD+ +K  LK+ FG+++ FLP VA  H+ W LLF FVFAYGI FLNFQRR
Sbjct  1392  VVHITGIGDIDLKILLKEGFGFEHDFLPVVAVVHIAWILLFVFVFAYGIKFLNFQRR  1448



>gb|AAG50592.1|AC083891_6 ABC transporter, putative [Arabidopsis thaliana]
Length=1434

 Score =   276 bits (706),  Expect(2) = 2e-138, Method: Compositional matrix adjust.
 Identities = 118/181 (65%), Positives = 157/181 (87%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              +AV GVPKI +GYNPATWML+++T  +E+Q  +DFA+I++NS L++RNQELIK+LSTPP
Sbjct  1081  FEAVEGVPKINDGYNPATWMLDVTTPSMESQMSLDFAQIFSNSSLYRRNQELIKDLSTPP  1140

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             PGS+D+YF TKY+QSF  Q KACFWKQ+WSYWR+PQYNA+RF +T+V+GV+FG+IFW  G
Sbjct  1141  PGSKDVYFKTKYAQSFSTQTKACFWKQYWSYWRHPQYNAIRFLMTVVIGVLFGLIFWQIG  1200

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
              +  N+QDL N  GA+YAAV+FLG++N ++VQ  +A+ERTVFYRE+AAGMYSA+PYA++Q
Sbjct  1201  TKTENEQDLNNFFGAMYAAVLFLGALNAATVQPAIAIERTVFYREKAAGMYSAIPYAISQ  1260

Query  624   V  626
             V
Sbjct  1261  V  1261


 Score =   246 bits (627),  Expect(2) = 2e-138, Method: Compositional matrix adjust.
 Identities = 110/177 (62%), Positives = 137/177 (77%), Gaps = 0/177 (0%)
 Frame = +2

Query  680   ILQAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALT  859
             I Q  +E +Y  +QT  Y+L+LY MIG  W + KFLWFYY+M TSFIYFTLYGMML+ALT
Sbjct  1258  ISQVAVEIMYNTIQTGVYTLILYSMIGCNWTMAKFLWFYYYMLTSFIYFTLYGMMLMALT  1317

Query  860   PGVQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKES  1039
             P  Q A I M+F L+ WNLF+GF++PR Q+P+WWRWYYWA+P  W+LYGLITSQ+GDK+S
Sbjct  1318  PNYQIAGICMSFFLSLWNLFSGFLIPRPQIPIWWRWYYWATPVAWTLYGLITSQVGDKDS  1377

Query  1040  RVQVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
              V + G GD+ +K  LK+ FG+++ FLP VA  H+ W LLF FVFAYGI FLNFQRR
Sbjct  1378  MVHISGIGDIDLKTLLKEGFGFEHDFLPVVAVVHIAWILLFLFVFAYGIKFLNFQRR  1434



>gb|AES81993.2| drug resistance transporter-like ABC domain protein [Medicago 
truncatula]
Length=1457

 Score =   273 bits (698),  Expect(2) = 2e-138, Method: Compositional matrix adjust.
 Identities = 126/181 (70%), Positives = 151/181 (83%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              +A+ GV KIK GYNPATWMLE+S+A IEAQ  VDFAEIY NS L+QRNQELIKELSTP 
Sbjct  1104  FEAISGVQKIKEGYNPATWMLEVSSATIEAQLEVDFAEIYNNSTLYQRNQELIKELSTPA  1163

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             P S DLYFPTKYSQSF  QCKA FWKQ+ SYWR+ QYNAVRF +TI++G++FG+IFW + 
Sbjct  1164  PDSNDLYFPTKYSQSFFVQCKANFWKQNLSYWRHSQYNAVRFLMTIIIGLLFGLIFWKQA  1223

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
              +   QQDLLNLLGA+Y+AV+FLG+ N+++VQ  V++ RT+FYRERAAGMYSALPYA  Q
Sbjct  1224  KKTKTQQDLLNLLGAMYSAVLFLGATNSATVQPVVSIARTIFYRERAAGMYSALPYAFGQ  1283

Query  624   V  626
             V
Sbjct  1284  V  1284


 Score =   248 bits (634),  Expect(2) = 2e-138, Method: Compositional matrix adjust.
 Identities = 111/175 (63%), Positives = 138/175 (79%), Gaps = 0/175 (0%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  +E +Y A+QT  Y+L+LY MIGFEWK+  F+WF+Y++   FIYFT YGMMLVALTP 
Sbjct  1283  QVAVETVYNAIQTAIYTLILYSMIGFEWKVANFIWFFYYILMCFIYFTFYGMMLVALTPD  1342

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
                A I+MAF L+FWNLF+GF++PR Q+P+WWRWYYWASP  W+LYGLITSQLGDK + +
Sbjct  1343  HVVAGISMAFFLSFWNLFSGFVIPRMQIPIWWRWYYWASPVAWTLYGLITSQLGDKNTEL  1402

Query  1046  QVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
              +PG G M +K+FLK  +GYD+ FLP VA AH+GW LLF FVFA+GI F NFQRR
Sbjct  1403  VIPGAGSMELKEFLKQNWGYDHDFLPQVAVAHLGWVLLFAFVFAFGIKFFNFQRR  1457



>ref|XP_003625775.1| Pleiotropic drug resistance ABC transporter family protein [Medicago 
truncatula]
Length=1461

 Score =   273 bits (698),  Expect(2) = 2e-138, Method: Compositional matrix adjust.
 Identities = 126/181 (70%), Positives = 151/181 (83%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              +A+ GV KIK GYNPATWMLE+S+A IEAQ  VDFAEIY NS L+QRNQELIKELSTP 
Sbjct  1108  FEAISGVQKIKEGYNPATWMLEVSSATIEAQLEVDFAEIYNNSTLYQRNQELIKELSTPA  1167

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             P S DLYFPTKYSQSF  QCKA FWKQ+ SYWR+ QYNAVRF +TI++G++FG+IFW + 
Sbjct  1168  PDSNDLYFPTKYSQSFFVQCKANFWKQNLSYWRHSQYNAVRFLMTIIIGLLFGLIFWKQA  1227

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
              +   QQDLLNLLGA+Y+AV+FLG+ N+++VQ  V++ RT+FYRERAAGMYSALPYA  Q
Sbjct  1228  KKTKTQQDLLNLLGAMYSAVLFLGATNSATVQPVVSIARTIFYRERAAGMYSALPYAFGQ  1287

Query  624   V  626
             V
Sbjct  1288  V  1288


 Score =   248 bits (634),  Expect(2) = 2e-138, Method: Compositional matrix adjust.
 Identities = 111/175 (63%), Positives = 138/175 (79%), Gaps = 0/175 (0%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  +E +Y A+QT  Y+L+LY MIGFEWK+  F+WF+Y++   FIYFT YGMMLVALTP 
Sbjct  1287  QVAVETVYNAIQTAIYTLILYSMIGFEWKVANFIWFFYYILMCFIYFTFYGMMLVALTPD  1346

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
                A I+MAF L+FWNLF+GF++PR Q+P+WWRWYYWASP  W+LYGLITSQLGDK + +
Sbjct  1347  HVVAGISMAFFLSFWNLFSGFVIPRMQIPIWWRWYYWASPVAWTLYGLITSQLGDKNTEL  1406

Query  1046  QVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
              +PG G M +K+FLK  +GYD+ FLP VA AH+GW LLF FVFA+GI F NFQRR
Sbjct  1407  VIPGAGSMELKEFLKQNWGYDHDFLPQVAVAHLGWVLLFAFVFAFGIKFFNFQRR  1461



>ref|XP_007145541.1| hypothetical protein PHAVU_007G247200g [Phaseolus vulgaris]
 gb|ESW17535.1| hypothetical protein PHAVU_007G247200g [Phaseolus vulgaris]
Length=1502

 Score =   285 bits (728),  Expect(2) = 2e-138, Method: Compositional matrix adjust.
 Identities = 126/181 (70%), Positives = 155/181 (86%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              + + GVP+IK+GYNPATWMLEI++  +E+Q GVDF E+Y  S L+Q+NQELIKE+ TP 
Sbjct  1149  FEGITGVPEIKDGYNPATWMLEITSPIVESQLGVDFGELYTKSDLYQKNQELIKEICTPV  1208

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             PG++DLYFPTKYSQSFV QCKACFWKQ+ SYWRNPQYNAVRFF+TIV+G++FG+I+W KG
Sbjct  1209  PGTKDLYFPTKYSQSFVTQCKACFWKQNCSYWRNPQYNAVRFFITIVIGLIFGLIYWDKG  1268

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
              +   +QDLLNLLGA+YA+V FLG+ NT+SVQ  VA+ERTV YRERAAGMYS LPYA+ Q
Sbjct  1269  KKTEKEQDLLNLLGAMYASVFFLGASNTNSVQPVVAIERTVLYRERAAGMYSELPYAIGQ  1328

Query  624   V  626
             V
Sbjct  1329  V  1329


 Score =   237 bits (604),  Expect(2) = 2e-138, Method: Compositional matrix adjust.
 Identities = 110/177 (62%), Positives = 137/177 (77%), Gaps = 0/177 (0%)
 Frame = +2

Query  680   ILQAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALT  859
             I Q  IE IYVA Q+++YS++LY MIGFE +   FLWFYYF+F SF+YFTLYGMM VALT
Sbjct  1326  IGQVAIEVIYVATQSLAYSIILYWMIGFEPRFENFLWFYYFIFMSFMYFTLYGMMTVALT  1385

Query  860   PGVQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKES  1039
             P  Q AAI M+F + FWNLF+GF++PR Q+P+WWRWYYW SP  W++YGL+TSQ+GDK S
Sbjct  1386  PNYQIAAIVMSFFINFWNLFSGFLIPRTQIPIWWRWYYWGSPVAWTIYGLVTSQVGDKNS  1445

Query  1040  RVQVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
              ++VPG G MT+KQ+L   FG+ + FL  VA  HV + LLF  VFAYGI FLNFQ+R
Sbjct  1446  PIEVPGFGLMTVKQYLDRQFGFQHDFLGVVALTHVAFCLLFLLVFAYGIKFLNFQKR  1502



>emb|CDO99882.1| unnamed protein product [Coffea canephora]
Length=1478

 Score =   280 bits (716),  Expect(2) = 3e-138, Method: Compositional matrix adjust.
 Identities = 135/181 (75%), Positives = 160/181 (88%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              ++VPGV KI+ GYNPATWML+IST  +EAQ  VDFAEIYANS +++RNQELIK+LSTPP
Sbjct  1125  FESVPGVTKIREGYNPATWMLDISTPSVEAQLNVDFAEIYANSDVYRRNQELIKQLSTPP  1184

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             PGSQDLYFPTKYSQSF  QCKACFWK   SYWRNP+YNA+RFF+T ++G++FGVIFW KG
Sbjct  1185  PGSQDLYFPTKYSQSFFNQCKACFWKHQLSYWRNPKYNAIRFFMTTIIGIIFGVIFWRKG  1244

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
              +++ QQDLLNL+GA+YAAV+FLG  NTS+VQ+ VAVERTVFYRE+AAGMYSALPYA AQ
Sbjct  1245  HKMYKQQDLLNLVGAMYAAVMFLGGTNTSAVQSVVAVERTVFYREKAAGMYSALPYAFAQ  1304

Query  624   V  626
             V
Sbjct  1305  V  1305


 Score =   241 bits (615),  Expect(2) = 3e-138, Method: Compositional matrix adjust.
 Identities = 109/175 (62%), Positives = 134/175 (77%), Gaps = 0/175 (0%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q   E IYVA+QT  YSLLLY MIGF W++ KFLWFYYF+F  F+YF LYGMMLVALTP 
Sbjct  1304  QVATEVIYVALQTFIYSLLLYSMIGFHWQVDKFLWFYYFVFMCFVYFGLYGMMLVALTPN  1363

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
              Q AAI M+F L FWNLF+GF++PR Q+PVWWRWYYW SP  W++YGL+TSQ+GD    V
Sbjct  1364  YQIAAIGMSFFLNFWNLFSGFMIPRTQIPVWWRWYYWGSPVAWTIYGLVTSQVGDMTEPV  1423

Query  1046  QVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
              +PG G++ +K++LK + GY + FL  VA  H+GW +LF FVFAY I FLNFQ+R
Sbjct  1424  SIPGSGELPMKEYLKQYLGYKHDFLGVVAVVHLGWVVLFCFVFAYAIKFLNFQKR  1478



>gb|KHN37838.1| Pleiotropic drug resistance protein 2 [Glycine soja]
Length=1468

 Score =   280 bits (716),  Expect(2) = 3e-138, Method: Compositional matrix adjust.
 Identities = 124/181 (69%), Positives = 152/181 (84%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              + +PGVP+IK+GYNPATW+LEI+T  +E+Q  VDFAE Y  S L+QRNQELI+ELSTP 
Sbjct  1115  FETIPGVPRIKDGYNPATWVLEITTPAVESQLRVDFAEFYTKSELYQRNQELIEELSTPL  1174

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
              G++DL FPTKYS SF+ QC ACFWKQH SYWRNPQYN +R F+ +++GV+FG+IFW KG
Sbjct  1175  EGTKDLDFPTKYSLSFITQCIACFWKQHLSYWRNPQYNGIRLFMAVIIGVIFGLIFWKKG  1234

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
             ++   +QDL+NL+GAI+AAV FLG  NTSSVQ  VA+ERTVFYRERAAGMYSALPYA+AQ
Sbjct  1235  NQTDTEQDLMNLMGAIFAAVFFLGGSNTSSVQPIVAIERTVFYRERAAGMYSALPYAIAQ  1294

Query  624   V  626
             V
Sbjct  1295  V  1295


 Score =   241 bits (615),  Expect(2) = 3e-138, Method: Compositional matrix adjust.
 Identities = 109/177 (62%), Positives = 137/177 (77%), Gaps = 0/177 (0%)
 Frame = +2

Query  680   ILQAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALT  859
             I Q  IE IYVA+QT S+SL+L+ M+GF W++ KFLWFY+FMF SF+YFTLYGMM  ALT
Sbjct  1292  IAQVAIECIYVAIQTFSFSLILFSMMGFLWRVDKFLWFYFFMFISFVYFTLYGMMTAALT  1351

Query  860   PGVQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKES  1039
             P  Q AAI MAF L FWN+F+GFI+P+ Q+P+WWRW+YW  P  WSLYGL+TSQ+GDK++
Sbjct  1352  PNPQIAAIVMAFFLVFWNIFSGFIIPKSQIPIWWRWFYWVCPTAWSLYGLVTSQVGDKDT  1411

Query  1040  RVQVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
              + VPG   MT+K FL++ FGY+YGFL  VA AH+ +  LF FVFAY I   NFQ+R
Sbjct  1412  PILVPGTESMTVKAFLEEEFGYEYGFLGVVAVAHIAFVALFLFVFAYSIKVFNFQKR  1468



>emb|CBI17066.3| unnamed protein product [Vitis vinifera]
Length=1388

 Score =   307 bits (786),  Expect(2) = 4e-138, Method: Compositional matrix adjust.
 Identities = 137/181 (76%), Positives = 162/181 (90%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              ++VPGV KIK GYNPATWMLEIS++ +EAQ  +DFAE+YA+S L++RNQ LIKELSTP 
Sbjct  1035  FESVPGVTKIKEGYNPATWMLEISSSAVEAQLDIDFAEVYASSDLYRRNQNLIKELSTPE  1094

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             PGS+DLYFPT+YSQSF+ QCKACFWKQH+SYWRN +YNA+RFF+TIV+GV+FGVIFW KG
Sbjct  1095  PGSKDLYFPTQYSQSFITQCKACFWKQHYSYWRNSEYNAIRFFMTIVIGVLFGVIFWSKG  1154

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
             D+IH QQDL+NLLGA YAAV+FLG+ N +SVQ+ VAVERTVFYRERAAGMYS LPYA AQ
Sbjct  1155  DQIHKQQDLINLLGATYAAVLFLGATNATSVQSVVAVERTVFYRERAAGMYSELPYAFAQ  1214

Query  624   V  626
             V
Sbjct  1215  V  1215


 Score =   214 bits (545),  Expect(2) = 4e-138, Method: Compositional matrix adjust.
 Identities = 103/175 (59%), Positives = 133/175 (76%), Gaps = 0/175 (0%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  IE IYVA+QT+ Y+LLLY MIGF WK+ KF +FYYF+F  F YF++YGMM+VALTPG
Sbjct  1214  QVAIETIYVAIQTLVYALLLYSMIGFHWKVDKFFYFYYFIFMCFTYFSMYGMMVVALTPG  1273

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
              Q AAI  +F L+FWNLF+GF++PR  +P+WWRWYYW SP  W++YG+  SQ+GD  + +
Sbjct  1274  HQIAAIVSSFFLSFWNLFSGFLIPRPLIPIWWRWYYWGSPVAWTIYGIFASQVGDITTDL  1333

Query  1046  QVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
             ++ G   M + +F+K+  G+D+ FL  V  AHVGW  LFFFVFAYGI FLNFQRR
Sbjct  1334  EITGSSPMPVNEFIKENLGFDHDFLVPVVFAHVGWVFLFFFVFAYGIKFLNFQRR  1388



>emb|CAN83834.1| hypothetical protein VITISV_006821 [Vitis vinifera]
Length=1454

 Score =   307 bits (786),  Expect(2) = 4e-138, Method: Compositional matrix adjust.
 Identities = 137/181 (76%), Positives = 162/181 (90%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              ++VPGV KIK GYNPATWMLEIS++ +EAQ  +DFAE+YA+S L++RNQ LIKELSTP 
Sbjct  1101  FESVPGVTKIKEGYNPATWMLEISSSAVEAQLDIDFAEVYASSDLYRRNQNLIKELSTPE  1160

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             PGS+DLYFPT+YSQSF+ QCKACFWKQH+SYWRN +YNA+RFF+TIV+GV+FGVIFW KG
Sbjct  1161  PGSKDLYFPTQYSQSFITQCKACFWKQHYSYWRNSEYNAIRFFMTIVIGVLFGVIFWSKG  1220

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
             D+IH QQDL+NLLGA YAAV+FLG+ N +SVQ+ VAVERTVFYRERAAGMYS LPYA AQ
Sbjct  1221  DQIHKQQDLINLLGATYAAVLFLGATNATSVQSVVAVERTVFYRERAAGMYSELPYAFAQ  1280

Query  624   V  626
             V
Sbjct  1281  V  1281


 Score =   214 bits (544),  Expect(2) = 4e-138, Method: Compositional matrix adjust.
 Identities = 103/175 (59%), Positives = 133/175 (76%), Gaps = 0/175 (0%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  IE IYVA+QT+ Y+LLLY MIGF WK+ KF +FYYF+F  F YF++YGMM+VALTPG
Sbjct  1280  QVAIETIYVAIQTLVYALLLYSMIGFHWKVDKFFYFYYFIFMCFTYFSMYGMMVVALTPG  1339

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
              Q AAI  +F L+FWNLF+GF++PR  +P+WWRWYYW SP  W++YG+  SQ+GD  + +
Sbjct  1340  HQIAAIVSSFFLSFWNLFSGFLIPRPLIPIWWRWYYWGSPVAWTIYGIFASQVGDITTDL  1399

Query  1046  QVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
             ++ G   M + +F+K+  G+D+ FL  V  AHVGW  LFFFVFAYGI FLNFQRR
Sbjct  1400  EITGSSPMPVNEFIKENLGFDHDFLVPVVFAHVGWVFLFFFVFAYGIKFLNFQRR  1454



>ref|XP_010651721.1| PREDICTED: pleiotropic drug resistance protein 2-like [Vitis 
vinifera]
Length=1454

 Score =   307 bits (786),  Expect(2) = 5e-138, Method: Compositional matrix adjust.
 Identities = 137/181 (76%), Positives = 162/181 (90%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              ++VPGV KIK GYNPATWMLEIS++ +EAQ  +DFAE+YA+S L++RNQ LIKELSTP 
Sbjct  1101  FESVPGVTKIKEGYNPATWMLEISSSAVEAQLDIDFAEVYASSDLYRRNQNLIKELSTPE  1160

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             PGS+DLYFPT+YSQSF+ QCKACFWKQH+SYWRN +YNA+RFF+TIV+GV+FGVIFW KG
Sbjct  1161  PGSKDLYFPTQYSQSFITQCKACFWKQHYSYWRNSEYNAIRFFMTIVIGVLFGVIFWSKG  1220

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
             D+IH QQDL+NLLGA YAAV+FLG+ N +SVQ+ VAVERTVFYRERAAGMYS LPYA AQ
Sbjct  1221  DQIHKQQDLINLLGATYAAVLFLGATNATSVQSVVAVERTVFYRERAAGMYSELPYAFAQ  1280

Query  624   V  626
             V
Sbjct  1281  V  1281


 Score =   214 bits (544),  Expect(2) = 5e-138, Method: Compositional matrix adjust.
 Identities = 103/175 (59%), Positives = 133/175 (76%), Gaps = 0/175 (0%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  IE IYVA+QT+ Y+LLLY MIGF WK+ KF +FYYF+F  F YF++YGMM+VALTPG
Sbjct  1280  QVAIETIYVAIQTLVYALLLYSMIGFHWKVDKFFYFYYFIFMCFTYFSMYGMMVVALTPG  1339

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
              Q AAI  +F L+FWNLF+GF++PR  +P+WWRWYYW SP  W++YG+  SQ+GD  + +
Sbjct  1340  HQIAAIVSSFFLSFWNLFSGFLIPRPLIPIWWRWYYWGSPVAWTIYGIFASQVGDITTDL  1399

Query  1046  QVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
             ++ G   M + +F+K+  G+D+ FL  V  AHVGW  LFFFVFAYGI FLNFQRR
Sbjct  1400  EITGSSPMPVNEFIKENLGFDHDFLVPVVFAHVGWVFLFFFVFAYGIKFLNFQRR  1454



>ref|XP_006590192.1| PREDICTED: pleiotropic drug resistance protein 2-like [Glycine 
max]
Length=1302

 Score =   279 bits (714),  Expect(2) = 5e-138, Method: Compositional matrix adjust.
 Identities = 124/181 (69%), Positives = 152/181 (84%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              + +PGVP+IK+GYNPATW+LEI+T  +E+Q  VDFAE Y  S L+QRNQELI+ELSTP 
Sbjct  949   FETIPGVPRIKDGYNPATWVLEITTPAVESQLRVDFAEFYTKSELYQRNQELIEELSTPL  1008

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
              G++DL FPTKYS SF+ QC ACFWKQH SYWRNPQYN +R F+ +++GV+FG+IFW KG
Sbjct  1009  EGTKDLDFPTKYSLSFITQCIACFWKQHLSYWRNPQYNGIRLFMAVIIGVIFGLIFWKKG  1068

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
             ++   +QDL+NL+GAI+AAV FLG  NTSSVQ  VA+ERTVFYRERAAGMYSALPYA+AQ
Sbjct  1069  NQTDTEQDLMNLMGAIFAAVFFLGGSNTSSVQPIVAIERTVFYRERAAGMYSALPYAIAQ  1128

Query  624   V  626
             V
Sbjct  1129  V  1129


 Score =   241 bits (615),  Expect(2) = 5e-138, Method: Compositional matrix adjust.
 Identities = 109/177 (62%), Positives = 137/177 (77%), Gaps = 0/177 (0%)
 Frame = +2

Query  680   ILQAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALT  859
             I Q  IE IYVA+QT S+SL+L+ M+GF W++ KFLWFY+FMF SF+YFTLYGMM  ALT
Sbjct  1126  IAQVAIECIYVAIQTFSFSLILFSMMGFLWRVDKFLWFYFFMFISFVYFTLYGMMTAALT  1185

Query  860   PGVQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKES  1039
             P  Q AAI MAF L FWN+F+GFI+P+ Q+P+WWRW+YW  P  WSLYGL+TSQ+GDK++
Sbjct  1186  PNPQIAAIVMAFFLVFWNIFSGFIIPKSQIPIWWRWFYWVCPTAWSLYGLVTSQVGDKDT  1245

Query  1040  RVQVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
              + VPG   MT+K FL++ FGY+YGFL  VA AH+ +  LF FVFAY I   NFQ+R
Sbjct  1246  PILVPGTESMTVKAFLEEEFGYEYGFLGVVAVAHIAFVALFLFVFAYSIKVFNFQKR  1302



>ref|XP_009763865.1| PREDICTED: pleiotropic drug resistance protein 2-like isoform 
X2 [Nicotiana sylvestris]
Length=1473

 Score =   292 bits (748),  Expect(2) = 5e-138, Method: Compositional matrix adjust.
 Identities = 132/181 (73%), Positives = 158/181 (87%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              Q+VPGVP +K GYNPATWML+IS   +EAQ  VDFA+IYANS L++RNQELIKELS P 
Sbjct  1120  FQSVPGVPGVKEGYNPATWMLDISAPAVEAQLQVDFADIYANSELYRRNQELIKELSIPA  1179

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             PGSQDL+FPT+Y+Q F+EQCKACFWKQH SYWR+PQYNA+RF +T ++GV+FG+IFW KG
Sbjct  1180  PGSQDLHFPTEYAQPFLEQCKACFWKQHLSYWRHPQYNAIRFAMTAMVGVIFGIIFWNKG  1239

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
             D++   QDLLNL+GA+YAAV+FLG  NTS+VQ+ VAVERTVFYRE+AAGMYSALPYA AQ
Sbjct  1240  DKVSKLQDLLNLVGAMYAAVMFLGGTNTSAVQSIVAVERTVFYREKAAGMYSALPYAFAQ  1299

Query  624   V  626
             V
Sbjct  1300  V  1300


 Score =   228 bits (581),  Expect(2) = 5e-138, Method: Compositional matrix adjust.
 Identities = 108/175 (62%), Positives = 139/175 (79%), Gaps = 0/175 (0%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  IE IY+A+QT+ YSL+LY MIGF W  GKF  FY+F+F  F+YFT+YGMMLVALTP 
Sbjct  1299  QVAIETIYIAIQTLIYSLILYAMIGFHWTAGKFFLFYFFVFMCFVYFTMYGMMLVALTPN  1358

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
                AAI M+F L+FWNLF+GF++PR Q+P+WWRWYYWASP  W++YGL+TSQ+GDK + V
Sbjct  1359  YHIAAIVMSFFLSFWNLFSGFLIPRTQIPIWWRWYYWASPVAWTIYGLVTSQVGDKNNLV  1418

Query  1046  QVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
             ++PG G++ +K +LK+ FG++Y FL  VAA HV W++ F FVFAY I FLNFQRR
Sbjct  1419  EIPGGGEVPLKLYLKENFGFEYDFLGVVAAMHVVWAVFFCFVFAYAIKFLNFQRR  1473



>ref|XP_009763864.1| PREDICTED: pleiotropic drug resistance protein 2-like isoform 
X1 [Nicotiana sylvestris]
Length=1473

 Score =   292 bits (748),  Expect(2) = 5e-138, Method: Compositional matrix adjust.
 Identities = 132/181 (73%), Positives = 158/181 (87%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              Q+VPGVP +K GYNPATWML+IS   +EAQ  VDFA+IYANS L++RNQELIKELS P 
Sbjct  1120  FQSVPGVPGVKEGYNPATWMLDISAPAVEAQLQVDFADIYANSELYRRNQELIKELSIPA  1179

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             PGSQDL+FPT+Y+Q F+EQCKACFWKQH SYWR+PQYNA+RF +T ++GV+FG+IFW KG
Sbjct  1180  PGSQDLHFPTEYAQPFLEQCKACFWKQHLSYWRHPQYNAIRFAMTAMVGVIFGIIFWNKG  1239

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
             D++   QDLLNL+GA+YAAV+FLG  NTS+VQ+ VAVERTVFYRE+AAGMYSALPYA AQ
Sbjct  1240  DKVSKLQDLLNLVGAMYAAVMFLGGTNTSAVQSIVAVERTVFYREKAAGMYSALPYAFAQ  1299

Query  624   V  626
             V
Sbjct  1300  V  1300


 Score =   228 bits (581),  Expect(2) = 5e-138, Method: Compositional matrix adjust.
 Identities = 108/175 (62%), Positives = 139/175 (79%), Gaps = 0/175 (0%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  IE IY+A+QT+ YSL+LY MIGF W  GKF  FY+F+F  F+YFT+YGMMLVALTP 
Sbjct  1299  QVAIETIYIAIQTLIYSLILYAMIGFHWTAGKFFLFYFFVFMCFVYFTMYGMMLVALTPN  1358

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
                AAI M+F L+FWNLF+GF++PR Q+P+WWRWYYWASP  W++YGL+TSQ+GDK + V
Sbjct  1359  YHIAAIVMSFFLSFWNLFSGFLIPRTQIPIWWRWYYWASPVAWTIYGLVTSQVGDKNNLV  1418

Query  1046  QVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
             ++PG G++ +K +LK+ FG++Y FL  VAA HV W++ F FVFAY I FLNFQRR
Sbjct  1419  EIPGGGEVPLKLYLKENFGFEYDFLGVVAAMHVVWAVFFCFVFAYAIKFLNFQRR  1473



>ref|XP_006300648.1| hypothetical protein CARUB_v10019658mg [Capsella rubella]
 gb|EOA33546.1| hypothetical protein CARUB_v10019658mg [Capsella rubella]
Length=1449

 Score =   280 bits (717),  Expect(2) = 6e-138, Method: Compositional matrix adjust.
 Identities = 121/181 (67%), Positives = 156/181 (86%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              +AV GVPKIK+GYNPATWML+++T  +E+Q  +DFA+I+ NS L+QRNQELIKELSTPP
Sbjct  1096  FEAVEGVPKIKDGYNPATWMLDVTTPSMESQMSLDFAQIFTNSSLYQRNQELIKELSTPP  1155

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             PGS+DLYF TKY+Q F  Q KACFWKQ+WSYWR+PQYNA+RF +T+++GVMFG+IFW  G
Sbjct  1156  PGSKDLYFRTKYAQPFFTQTKACFWKQYWSYWRHPQYNAIRFLMTVIIGVMFGLIFWQMG  1215

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
              +I N+QD+ N  GA+YAAV+FLG+ N ++VQ  +A+ERTVFYRE+AAGMYSA+PYA++Q
Sbjct  1216  TKIENEQDVNNFFGAMYAAVLFLGATNAATVQPAIAIERTVFYREKAAGMYSAIPYAISQ  1275

Query  624   V  626
             V
Sbjct  1276  V  1276


 Score =   239 bits (611),  Expect(2) = 6e-138, Method: Compositional matrix adjust.
 Identities = 108/177 (61%), Positives = 136/177 (77%), Gaps = 0/177 (0%)
 Frame = +2

Query  680   ILQAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALT  859
             I Q  +E +Y  +QT  Y+L+LY MIG  W + KFLWFYY+M TSFIYFTLYGMML+ALT
Sbjct  1273  ISQVAVEIMYNTIQTGVYTLILYSMIGCNWTVTKFLWFYYYMLTSFIYFTLYGMMLMALT  1332

Query  860   PGVQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKES  1039
             P    A I ++F L+ WNLF+GF++PR Q+P+WWRWYYWA+P  W+LYG+ITSQ+GDK+S
Sbjct  1333  PNYYIAGICLSFFLSLWNLFSGFLIPRPQIPIWWRWYYWATPVAWTLYGIITSQVGDKDS  1392

Query  1040  RVQVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
              V + G GD+ +K  LK+ FG++Y FLP VA  H+ W LLF FVFAYGI FLNFQRR
Sbjct  1393  MVHITGIGDIGLKTLLKEGFGFEYDFLPVVAVVHIAWILLFLFVFAYGIKFLNFQRR  1449



>ref|XP_010683847.1| PREDICTED: ABC transporter G family member 39-like [Beta vulgaris 
subsp. vulgaris]
Length=1457

 Score =   284 bits (727),  Expect(2) = 1e-137, Method: Compositional matrix adjust.
 Identities = 131/179 (73%), Positives = 154/179 (86%), Gaps = 0/179 (0%)
 Frame = +3

Query  90    AVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPPPG  269
             AVPGVPKIK+GYNPATWML+IST+  E+Q  +DFA  YANS L+QRNQ+LIKELST  PG
Sbjct  1106  AVPGVPKIKDGYNPATWMLDISTSQAESQLDIDFAGYYANSSLYQRNQDLIKELSTATPG  1165

Query  270   SQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKGDE  449
             S DL+FPT+YSQ F  Q KACFWKQ+WSYWRNPQYN VRF +TI +GV+FGVIFW KG +
Sbjct  1166  SSDLHFPTRYSQPFFVQFKACFWKQYWSYWRNPQYNVVRFVLTIAIGVIFGVIFWNKGRK  1225

Query  450   IHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQV  626
             I  +QDL+NLLGA+Y+AV+FLG+ N S+VQA VA+ERTVFYRE+AAGMYSA PYALAQV
Sbjct  1226  ISKEQDLMNLLGAMYSAVLFLGATNASAVQAVVAIERTVFYREKAAGMYSAFPYALAQV  1284


 Score =   235 bits (600),  Expect(2) = 1e-137, Method: Compositional matrix adjust.
 Identities = 109/175 (62%), Positives = 139/175 (79%), Gaps = 0/175 (0%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  IEAIY  +QT+ Y+LLLY MIGFEWK+GKF++F+YF+ T FIYF +YGMMLV+LTPG
Sbjct  1283  QVAIEAIYTVIQTLLYTLLLYSMIGFEWKIGKFVYFWYFITTCFIYFAMYGMMLVSLTPG  1342

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
              Q A I M F L+ WNLFAGF++PR Q+P+WWRWYYWASP  W+LYGL+TSQ+GD  S +
Sbjct  1343  HQVAGILMGFFLSLWNLFAGFLIPRPQIPIWWRWYYWASPVSWTLYGLVTSQVGDTSSLL  1402

Query  1046  QVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
              +PG  + ++K +LK+F GYDY FLP +A  H+GW L FF +FAYGI +LNFQ+R
Sbjct  1403  HIPGSSNQSVKVYLKEFLGYDYDFLPVIAVGHLGWVLFFFLIFAYGIKYLNFQKR  1457



>ref|XP_006410815.1| hypothetical protein EUTSA_v10016140mg [Eutrema salsugineum]
 gb|ESQ52268.1| hypothetical protein EUTSA_v10016140mg [Eutrema salsugineum]
Length=1449

 Score =   270 bits (690),  Expect(2) = 1e-137, Method: Compositional matrix adjust.
 Identities = 121/181 (67%), Positives = 150/181 (83%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              +AV GVPKIK G+NPATWML+++T  +E+Q  VDFA+I+ANS L++ NQELIKELSTPP
Sbjct  1096  FEAVEGVPKIKEGFNPATWMLDVTTPSMESQMSVDFAQIFANSSLYRGNQELIKELSTPP  1155

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             PGS DLYF TKYSQ F  Q KACFWKQ+WS WR+PQYNA+RF +T V+GV+FG+IFW  G
Sbjct  1156  PGSSDLYFRTKYSQPFSTQTKACFWKQYWSNWRHPQYNAIRFLMTTVIGVLFGLIFWQTG  1215

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
              +I  +QDL N  GA+YAAV FLG+ N ++VQ  +A+ERTVFYRERAAGMYSA+PYA++Q
Sbjct  1216  TKIEKEQDLNNFFGAMYAAVFFLGATNAATVQPAIAIERTVFYRERAAGMYSAIPYAISQ  1275

Query  624   V  626
             V
Sbjct  1276  V  1276


 Score =   249 bits (635),  Expect(2) = 1e-137, Method: Compositional matrix adjust.
 Identities = 112/177 (63%), Positives = 141/177 (80%), Gaps = 0/177 (0%)
 Frame = +2

Query  680   ILQAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALT  859
             I Q  +E +Y A+QT  Y+L+LY MIG++W + KF WFYY+M TSFIYFTLYGMMLVALT
Sbjct  1273  ISQVAVEIMYNALQTGLYTLILYSMIGYDWTVTKFFWFYYYMLTSFIYFTLYGMMLVALT  1332

Query  860   PGVQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKES  1039
             P  Q A I M+F L+ WNLF+GF++ R Q+P+WWRWYYWA+P  W+LYG+ITSQ+GD++S
Sbjct  1333  PNYQIAGICMSFFLSLWNLFSGFLIARPQIPIWWRWYYWATPVAWTLYGIITSQVGDRDS  1392

Query  1040  RVQVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
              VQ+ G GDM++K  LKD FG+++ FLP VAA H+ W LLF FVFAYGI FLNFQRR
Sbjct  1393  MVQITGVGDMSLKTLLKDGFGFEHDFLPVVAAVHIAWILLFVFVFAYGIKFLNFQRR  1449



>ref|XP_002879608.1| ATPDR6/PDR6 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH55867.1| ATPDR6/PDR6 [Arabidopsis lyrata subsp. lyrata]
Length=1452

 Score =   272 bits (696),  Expect(2) = 2e-137, Method: Compositional matrix adjust.
 Identities = 119/181 (66%), Positives = 152/181 (84%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              +A+ GVPKIK+GYNPATWML+++T  +E+Q  +DFA+I+ANS L+ RNQELIKELSTPP
Sbjct  1099  FEAIEGVPKIKDGYNPATWMLDVTTPSMESQMSMDFAQIFANSSLNLRNQELIKELSTPP  1158

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             PGS DLYFPTKY+Q F  Q KACFWK +WS WR PQYNA+RF +T+V+GV+FG++FW  G
Sbjct  1159  PGSSDLYFPTKYAQPFATQTKACFWKMYWSNWRYPQYNAIRFLMTVVIGVLFGLLFWQTG  1218

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
              +I  +QDL N  GA+YAAV+FLG+ N ++VQ  VA+ERTVFYRE+AAGMYSA+PYA++Q
Sbjct  1219  TKIEKEQDLNNFFGAMYAAVLFLGATNAATVQPAVAIERTVFYREKAAGMYSAIPYAISQ  1278

Query  624   V  626
             V
Sbjct  1279  V  1279


 Score =   246 bits (628),  Expect(2) = 2e-137, Method: Compositional matrix adjust.
 Identities = 111/177 (63%), Positives = 139/177 (79%), Gaps = 0/177 (0%)
 Frame = +2

Query  680   ILQAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALT  859
             I Q  +E +Y  +QT  Y+L+LY MIG++W + KF WFYY+M TSFIYFTLYGMMLVALT
Sbjct  1276  ISQVAVEIMYNIIQTGVYTLILYSMIGYDWTVVKFFWFYYYMLTSFIYFTLYGMMLVALT  1335

Query  860   PGVQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKES  1039
             P  Q A I M+F L+ WNLF+GF++PR Q+P+WWRWYYWASP  W+LYG+ITSQ+GDK+S
Sbjct  1336  PNYQIAGICMSFFLSLWNLFSGFLIPRPQIPIWWRWYYWASPVAWTLYGIITSQVGDKDS  1395

Query  1040  RVQVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
              V + G GDM++K  LK  FG+++ FLP VAA H+ W L+F FVFAYGI FLNFQRR
Sbjct  1396  IVHITGVGDMSLKTLLKTGFGFEHDFLPVVAAVHIAWILVFLFVFAYGIKFLNFQRR  1452



>gb|EYU36972.1| hypothetical protein MIMGU_mgv1a0189871mg, partial [Erythranthe 
guttata]
Length=352

 Score =   304 bits (779),  Expect(2) = 2e-137, Method: Compositional matrix adjust.
 Identities = 138/178 (78%), Positives = 157/178 (88%), Gaps = 0/178 (0%)
 Frame = +3

Query  93   VPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPPPGS  272
            VPGV KIK GYNPATWML+++++  E Q  VDFAE+YANS L++RNQELIKELS PPPGS
Sbjct  1    VPGVAKIKEGYNPATWMLDVTSSAAEGQLDVDFAEVYANSALYRRNQELIKELSNPPPGS  60

Query  273  QDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKGDEI  452
             DLYFPT+YSQSF+ QCKACFWKQHWSYWRN QYNA+RFF T+V+GVMFGVIFW KGD+I
Sbjct  61   SDLYFPTQYSQSFLTQCKACFWKQHWSYWRNSQYNAIRFFTTVVIGVMFGVIFWQKGDQI  120

Query  453  HNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQV  626
            H QQDLLNLLGA Y+AV+FLG+ N S+VQ+ VAVERTVFYRERAAGMYS LPYA AQV
Sbjct  121  HRQQDLLNLLGATYSAVLFLGASNASAVQSVVAVERTVFYRERAAGMYSELPYAFAQV  178


 Score =   214 bits (545),  Expect(2) = 2e-137, Method: Compositional matrix adjust.
 Identities = 108/176 (61%), Positives = 135/176 (77%), Gaps = 1/176 (1%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  IE IYVA+QT+ YSLLLY MIG++W   KF +FYYF+F  F YF++YGMM+VALTPG
Sbjct  177   QVAIETIYVAIQTLVYSLLLYSMIGYQWTGEKFFYFYYFIFMCFTYFSMYGMMVVALTPG  236

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
              Q AAI M+F L+FWNLF+GF++PR  +P+WWRWYYWASP  W++YG+ TSQ+GD+   +
Sbjct  237   YQIAAIVMSFFLSFWNLFSGFLIPRPLIPIWWRWYYWASPVAWTIYGIFTSQIGDQTGDL  296

Query  1046  QVPGE-GDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
             ++ G    M + QFLK+  GYD+ FL  V  AHVGW LLFF VFAYGI FLNFQRR
Sbjct  297   ELTGNIATMKVNQFLKEELGYDHDFLIPVVFAHVGWVLLFFLVFAYGIKFLNFQRR  352



>gb|KHN00911.1| Pleiotropic drug resistance protein 2 [Glycine soja]
Length=1474

 Score =   277 bits (709),  Expect(2) = 2e-137, Method: Compositional matrix adjust.
 Identities = 126/181 (70%), Positives = 150/181 (83%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              +A P VP+IK+GYNPATW+LEIST  +E+Q  VDFAE Y  S L+QRNQELIKELSTP 
Sbjct  1121  FEAFPEVPRIKDGYNPATWVLEISTPAVESQLRVDFAEFYTKSELYQRNQELIKELSTPL  1180

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
              G++DL FPTKYS SF+ QC ACFWKQH SYWRNPQYN +R F+ I +GV+FG+IFW KG
Sbjct  1181  EGTKDLDFPTKYSLSFITQCIACFWKQHLSYWRNPQYNGIRLFMAISIGVIFGLIFWKKG  1240

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
             ++   +QDL+NL+GAI+AAV FLG  NTS+VQ  VA+ERTVFYRERAAGMYSALPYA+AQ
Sbjct  1241  NQTDTEQDLMNLMGAIFAAVFFLGGSNTSTVQPIVAIERTVFYRERAAGMYSALPYAIAQ  1300

Query  624   V  626
             V
Sbjct  1301  V  1301


 Score =   241 bits (614),  Expect(2) = 2e-137, Method: Compositional matrix adjust.
 Identities = 108/177 (61%), Positives = 138/177 (78%), Gaps = 0/177 (0%)
 Frame = +2

Query  680   ILQAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALT  859
             I Q  IE IYVA+QT ++SL+L+ M+GF W++ KFLWFY+FMF SF+YFTLYGMM  ALT
Sbjct  1298  IAQVAIECIYVAIQTFTFSLILFSMMGFLWRVDKFLWFYFFMFISFVYFTLYGMMTAALT  1357

Query  860   PGVQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKES  1039
             P  Q AAI MAF L FWN+F+GFI+P+ Q+P+WWRW+YW  P  WS+YGL+TSQ+GDK++
Sbjct  1358  PNPQIAAIVMAFFLVFWNVFSGFIIPKSQIPIWWRWFYWVCPTAWSVYGLVTSQVGDKDT  1417

Query  1040  RVQVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
              + VPG   MT+K FL++ FGY+YGFL  VA AH+ +  LF FVFAYGI   NFQ+R
Sbjct  1418  PILVPGSEPMTVKAFLEEEFGYEYGFLGVVAVAHIAFVALFLFVFAYGIKVFNFQKR  1474



>ref|XP_006606280.1| PREDICTED: pleiotropic drug resistance protein 2-like isoform 
X1 [Glycine max]
Length=1474

 Score =   277 bits (709),  Expect(2) = 3e-137, Method: Compositional matrix adjust.
 Identities = 126/181 (70%), Positives = 150/181 (83%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              +A P VP+IK+GYNPATW+LEIST  +E+Q  VDFAE Y  S L+QRNQELIKELSTP 
Sbjct  1121  FEAFPEVPRIKDGYNPATWVLEISTPAVESQLRVDFAEFYTKSELYQRNQELIKELSTPL  1180

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
              G++DL FPTKYS SF+ QC ACFWKQH SYWRNPQYN +R F+ I +GV+FG+IFW KG
Sbjct  1181  EGTKDLDFPTKYSLSFITQCIACFWKQHLSYWRNPQYNGIRLFMAISIGVIFGLIFWKKG  1240

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
             ++   +QDL+NL+GAI+AAV FLG  NTS+VQ  VA+ERTVFYRERAAGMYSALPYA+AQ
Sbjct  1241  NQTDTEQDLMNLMGAIFAAVFFLGGSNTSTVQPIVAIERTVFYRERAAGMYSALPYAIAQ  1300

Query  624   V  626
             V
Sbjct  1301  V  1301


 Score =   241 bits (614),  Expect(2) = 3e-137, Method: Compositional matrix adjust.
 Identities = 108/177 (61%), Positives = 138/177 (78%), Gaps = 0/177 (0%)
 Frame = +2

Query  680   ILQAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALT  859
             I Q  IE IYVA+QT ++SL+L+ M+GF W++ KFLWFY+FMF SF+YFTLYGMM  ALT
Sbjct  1298  IAQVAIECIYVAIQTFTFSLILFSMMGFLWRVDKFLWFYFFMFISFVYFTLYGMMTAALT  1357

Query  860   PGVQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKES  1039
             P  Q AAI MAF L FWN+F+GFI+P+ Q+P+WWRW+YW  P  WS+YGL+TSQ+GDK++
Sbjct  1358  PNPQIAAIVMAFFLVFWNVFSGFIIPKSQIPIWWRWFYWVCPTAWSVYGLVTSQVGDKDT  1417

Query  1040  RVQVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
              + VPG   MT+K FL++ FGY+YGFL  VA AH+ +  LF FVFAYGI   NFQ+R
Sbjct  1418  PILVPGSEPMTVKAFLEEEFGYEYGFLGVVAVAHIAFVALFLFVFAYGIKVFNFQKR  1474



>ref|XP_006606281.1| PREDICTED: pleiotropic drug resistance protein 2-like isoform 
X2 [Glycine max]
Length=1472

 Score =   277 bits (709),  Expect(2) = 3e-137, Method: Compositional matrix adjust.
 Identities = 126/181 (70%), Positives = 150/181 (83%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              +A P VP+IK+GYNPATW+LEIST  +E+Q  VDFAE Y  S L+QRNQELIKELSTP 
Sbjct  1119  FEAFPEVPRIKDGYNPATWVLEISTPAVESQLRVDFAEFYTKSELYQRNQELIKELSTPL  1178

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
              G++DL FPTKYS SF+ QC ACFWKQH SYWRNPQYN +R F+ I +GV+FG+IFW KG
Sbjct  1179  EGTKDLDFPTKYSLSFITQCIACFWKQHLSYWRNPQYNGIRLFMAISIGVIFGLIFWKKG  1238

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
             ++   +QDL+NL+GAI+AAV FLG  NTS+VQ  VA+ERTVFYRERAAGMYSALPYA+AQ
Sbjct  1239  NQTDTEQDLMNLMGAIFAAVFFLGGSNTSTVQPIVAIERTVFYRERAAGMYSALPYAIAQ  1298

Query  624   V  626
             V
Sbjct  1299  V  1299


 Score =   241 bits (614),  Expect(2) = 3e-137, Method: Compositional matrix adjust.
 Identities = 108/177 (61%), Positives = 138/177 (78%), Gaps = 0/177 (0%)
 Frame = +2

Query  680   ILQAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALT  859
             I Q  IE IYVA+QT ++SL+L+ M+GF W++ KFLWFY+FMF SF+YFTLYGMM  ALT
Sbjct  1296  IAQVAIECIYVAIQTFTFSLILFSMMGFLWRVDKFLWFYFFMFISFVYFTLYGMMTAALT  1355

Query  860   PGVQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKES  1039
             P  Q AAI MAF L FWN+F+GFI+P+ Q+P+WWRW+YW  P  WS+YGL+TSQ+GDK++
Sbjct  1356  PNPQIAAIVMAFFLVFWNVFSGFIIPKSQIPIWWRWFYWVCPTAWSVYGLVTSQVGDKDT  1415

Query  1040  RVQVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
              + VPG   MT+K FL++ FGY+YGFL  VA AH+ +  LF FVFAYGI   NFQ+R
Sbjct  1416  PILVPGSEPMTVKAFLEEEFGYEYGFLGVVAVAHIAFVALFLFVFAYGIKVFNFQKR  1472



>gb|KGN59109.1| hypothetical protein Csa_3G774730 [Cucumis sativus]
Length=827

 Score =   278 bits (712),  Expect(2) = 4e-137, Method: Compositional matrix adjust.
 Identities = 121/181 (67%), Positives = 155/181 (86%), Gaps = 0/181 (0%)
 Frame = +3

Query  84   LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
             +A+PG+PKI+NG NPATWMLE++   +EAQ  +DFA+ +A SP+++RNQELI ELSTP 
Sbjct  474  FEAIPGIPKIENGKNPATWMLEVTAPPMEAQLDIDFADTFAKSPIYRRNQELIMELSTPA  533

Query  264  PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
            PGS+DL+FPT+YSQSF  QC+ACFWKQH SYWR+ QYNA+RFF TIV+G++FG++FW KG
Sbjct  534  PGSKDLHFPTEYSQSFFFQCRACFWKQHRSYWRHTQYNAIRFFSTIVVGILFGLVFWNKG  593

Query  444  DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
              +  QQD+LN++GAIY+A+IFLG+ N SSVQ+ VA+ERT FYRE+AAGMYSALPYA AQ
Sbjct  594  QILAKQQDVLNVMGAIYSAIIFLGASNASSVQSVVAIERTAFYREKAAGMYSALPYAFAQ  653

Query  624  V  626
            V
Sbjct  654  V  654


 Score =   239 bits (609),  Expect(2) = 4e-137, Method: Compositional matrix adjust.
 Identities = 110/175 (63%), Positives = 136/175 (78%), Gaps = 0/175 (0%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  IE IYV VQ+I YSL++Y MIGFEWKLGKFL F Y +F  F YFTLYGMM+VALTP 
Sbjct  653   QVAIETIYVFVQSIIYSLIIYSMIGFEWKLGKFLLFCYLVFMCFTYFTLYGMMVVALTPN  712

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
                AAI M+F + FWNLF GF++PR  +PVWWRWYYWA+P  W++YG++ SQ+GDK+S V
Sbjct  713   YHIAAIVMSFFVGFWNLFTGFLIPRPAIPVWWRWYYWANPVAWTIYGIVASQVGDKDSLV  772

Query  1046  QVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
             Q+PG G + +K FLK+ FGY++ F+P V AAH  W L+F FVFAYGI +LNFQRR
Sbjct  773   QIPGVGSVRLKLFLKEGFGYEHDFIPIVIAAHFIWVLVFIFVFAYGIKYLNFQRR  827



>ref|XP_010651917.1| PREDICTED: pleiotropic drug resistance protein 2-like [Vitis 
vinifera]
Length=1453

 Score =   300 bits (769),  Expect(2) = 7e-137, Method: Compositional matrix adjust.
 Identities = 134/181 (74%), Positives = 159/181 (88%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              ++VPGV KIK GYNPATWMLE+ST+ +EAQ  +DFAE+YANS L++RNQ+LI ELSTP 
Sbjct  1100  FESVPGVTKIKEGYNPATWMLEVSTSAVEAQLDIDFAEVYANSALYRRNQDLINELSTPA  1159

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             PGS+DLYFPT+YSQSF+ QCKACFWKQH+SYWRN +YNA+RFF+TIV+GV+FGVIFW KG
Sbjct  1160  PGSKDLYFPTQYSQSFITQCKACFWKQHYSYWRNSEYNAIRFFMTIVIGVLFGVIFWSKG  1219

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
             D+IH QQDL+NLLGA Y+A+IFLG+ N  +VQ  VAVERTVFYRERAAGMYS LP A AQ
Sbjct  1220  DQIHKQQDLINLLGATYSAIIFLGASNAFAVQPVVAVERTVFYRERAAGMYSELPNAFAQ  1279

Query  624   V  626
             V
Sbjct  1280  V  1280


 Score =   216 bits (551),  Expect(2) = 7e-137, Method: Compositional matrix adjust.
 Identities = 106/175 (61%), Positives = 130/175 (74%), Gaps = 0/175 (0%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  IE IYVAVQT+ Y+LLLY MIGF WK+ KF +FYYF+F SF YF++YGMM+ ALTPG
Sbjct  1279  QVAIETIYVAVQTLVYALLLYSMIGFHWKVDKFFYFYYFIFMSFTYFSMYGMMVTALTPG  1338

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
              Q AAI  +F L FWNLF+GF++PR  +P+WWRWYYWASP  W++YG+  SQLGD  S V
Sbjct  1339  HQIAAIVSSFFLNFWNLFSGFLIPRPLIPIWWRWYYWASPVAWTIYGIFASQLGDMTSEV  1398

Query  1046  QVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
             ++ G     + +F+KD  G D+ FL  V  AHVGW  LFF VFAYGI F+NFQRR
Sbjct  1399  EITGRSPRPVNEFIKDELGLDHDFLVPVVFAHVGWVFLFFIVFAYGIKFINFQRR  1453



>ref|XP_004143306.1| PREDICTED: ABC transporter G family member 39-like [Cucumis sativus]
 gb|KGN48240.1| hypothetical protein Csa_6G450940 [Cucumis sativus]
Length=1455

 Score =   278 bits (712),  Expect(2) = 9e-137, Method: Compositional matrix adjust.
 Identities = 122/181 (67%), Positives = 155/181 (86%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              ++VPGVPKIK+GYNPATWMLE++ + +E Q  VDFA+IYANS L+QRNQELI ELS PP
Sbjct  1102  FESVPGVPKIKDGYNPATWMLEVTASSVETQLDVDFADIYANSALYQRNQELIAELSQPP  1161

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             PGS+DL+FPTKYSQ+F  Q KACFWK + SYWRNP+YNAVRFF+T+++G++FG+IFW KG
Sbjct  1162  PGSEDLHFPTKYSQTFTVQFKACFWKWYRSYWRNPRYNAVRFFMTVMIGLLFGLIFWNKG  1221

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
             ++   +QDL N LGA+YAA++FLG+ N S++Q  V++ERTVFYRERAAGMYS LPYA +Q
Sbjct  1222  EKTEKEQDLRNFLGAMYAAILFLGASNASAIQPVVSIERTVFYRERAAGMYSPLPYAFSQ  1281

Query  624   V  626
             V
Sbjct  1282  V  1282


 Score =   238 bits (606),  Expect(2) = 9e-137, Method: Compositional matrix adjust.
 Identities = 106/175 (61%), Positives = 137/175 (78%), Gaps = 0/175 (0%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  IE IY A+QTI YSLLL+ M+GF+WK   F WFYYF+   F+YFT++GMM++ALTPG
Sbjct  1281  QVAIEVIYNAIQTIIYSLLLFSMMGFQWKASNFFWFYYFILMCFVYFTMFGMMIIALTPG  1340

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
              Q AAIAM+F L+FWNLF+GF++PR Q+P+WWRWYYW SP  W++ GL+TSQ+G+K   +
Sbjct  1341  PQIAAIAMSFFLSFWNLFSGFMVPRPQIPIWWRWYYWLSPIAWTINGLVTSQVGNKGGNL  1400

Query  1046  QVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
              VPG  D+ +K FLKD FG++Y FLP +A AH GW  L+FFVFAY + FLNFQ+R
Sbjct  1401  HVPGGVDIPVKTFLKDTFGFEYDFLPYIALAHFGWVFLYFFVFAYSMKFLNFQKR  1455



>ref|XP_004164072.1| PREDICTED: ABC transporter G family member 39-like [Cucumis sativus]
Length=1455

 Score =   278 bits (712),  Expect(2) = 9e-137, Method: Compositional matrix adjust.
 Identities = 122/181 (67%), Positives = 155/181 (86%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              ++VPGVPKIK+GYNPATWMLE++ + +E Q  VDFA+IYANS L+QRNQELI ELS PP
Sbjct  1102  FESVPGVPKIKDGYNPATWMLEVTASSVETQLDVDFADIYANSALYQRNQELIAELSQPP  1161

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             PGS+DL+FPTKYSQ+F  Q KACFWK + SYWRNP+YNAVRFF+T+++G++FG+IFW KG
Sbjct  1162  PGSEDLHFPTKYSQTFTVQFKACFWKWYRSYWRNPRYNAVRFFMTVMIGLLFGLIFWNKG  1221

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
             ++   +QDL N LGA+YAA++FLG+ N S++Q  V++ERTVFYRERAAGMYS LPYA +Q
Sbjct  1222  EKTEKEQDLRNFLGAMYAAILFLGASNASAIQPVVSIERTVFYRERAAGMYSPLPYAFSQ  1281

Query  624   V  626
             V
Sbjct  1282  V  1282


 Score =   238 bits (606),  Expect(2) = 9e-137, Method: Compositional matrix adjust.
 Identities = 106/175 (61%), Positives = 137/175 (78%), Gaps = 0/175 (0%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  IE IY A+QTI YSLLL+ M+GF+WK   F WFYYF+   F+YFT++GMM++ALTPG
Sbjct  1281  QVAIEVIYNAIQTIIYSLLLFSMMGFQWKASNFFWFYYFILMCFVYFTMFGMMIIALTPG  1340

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
              Q AAIAM+F L+FWNLF+GF++PR Q+P+WWRWYYW SP  W++ GL+TSQ+G+K   +
Sbjct  1341  PQIAAIAMSFFLSFWNLFSGFMVPRPQIPIWWRWYYWLSPIAWTINGLVTSQVGNKGGNL  1400

Query  1046  QVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
              VPG  D+ +K FLKD FG++Y FLP +A AH GW  L+FFVFAY + FLNFQ+R
Sbjct  1401  HVPGGVDIPVKTFLKDTFGFEYDFLPYIALAHFGWVFLYFFVFAYSMKFLNFQKR  1455



>ref|XP_004151527.1| PREDICTED: LOW QUALITY PROTEIN: pleiotropic drug resistance protein 
2-like [Cucumis sativus]
Length=426

 Score =   276 bits (706),  Expect(2) = 1e-136, Method: Compositional matrix adjust.
 Identities = 122/183 (67%), Positives = 156/183 (85%), Gaps = 0/183 (0%)
 Frame = +3

Query  84   LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
             +A+PG+PKI+NG NPATWMLE++   +EAQ  +DFA+ +A SP+++RNQELI ELSTP 
Sbjct  58   FEAIPGIPKIENGKNPATWMLEVTAPPMEAQLDIDFADTFAKSPIYRRNQELIMELSTPA  117

Query  264  PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
            PGS+DL+FPT+YSQSF  QC+ACFWKQH SYWR+ QYNA+RFF TIV+G++FG++FW KG
Sbjct  118  PGSKDLHFPTEYSQSFFFQCRACFWKQHRSYWRHTQYNAIRFFSTIVVGILFGLVFWNKG  177

Query  444  DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
              +  QQD+LN++GAIY+A+IFLG+ N SSVQ+ VA+ERT FYRE+AAGMYSALPYA AQ
Sbjct  178  QILAKQQDVLNVMGAIYSAIIFLGASNASSVQSVVAIERTAFYREKAAGMYSALPYAFAQ  237

Query  624  VIK  632
            V K
Sbjct  238  VTK  240


 Score =   239 bits (611),  Expect(2) = 1e-136, Method: Compositional matrix adjust.
 Identities = 112/177 (63%), Positives = 138/177 (78%), Gaps = 0/177 (0%)
 Frame = +2

Query  680   ILQAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALT  859
             ILQ  IE IYV VQ+I YSL++Y MIGFEWKLGKFL F Y +F  F YFTLYGMM+VALT
Sbjct  250   ILQVAIETIYVFVQSIIYSLIIYSMIGFEWKLGKFLLFCYLVFMCFTYFTLYGMMVVALT  309

Query  860   PGVQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKES  1039
             P    AAI M+F + FWNLF GF++PR  +PVWWRWYYWA+P  W++YG++ SQ+GDK+S
Sbjct  310   PNYHIAAIVMSFFVGFWNLFTGFLIPRPAIPVWWRWYYWANPVAWTIYGIVASQVGDKDS  369

Query  1040  RVQVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
              VQ+PG G + +K FLK+ FGY++ F+P V AAH  W L+F FVFAYGI +LNFQRR
Sbjct  370   LVQIPGVGSVRLKLFLKEGFGYEHDFIPIVIAAHFIWVLVFIFVFAYGIKYLNFQRR  426



>ref|XP_010415239.1| PREDICTED: ABC transporter G family member 39-like isoform X2 
[Camelina sativa]
Length=1448

 Score =   273 bits (699),  Expect(2) = 2e-136, Method: Compositional matrix adjust.
 Identities = 119/181 (66%), Positives = 155/181 (86%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              +AV GVPKI +G NPATWML+++T  +E+Q  +DF++I+ANS L++RNQELIKELSTPP
Sbjct  1095  FEAVEGVPKIIDGSNPATWMLDVTTPSLESQMSLDFSQIFANSSLYRRNQELIKELSTPP  1154

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             PGS+DLYF TKY+Q F  Q KACFWKQ+WSYWR+PQYNA+RF +T+V+GV+FG+IFW  G
Sbjct  1155  PGSKDLYFRTKYAQPFSTQAKACFWKQYWSYWRHPQYNAIRFLMTVVIGVLFGLIFWQIG  1214

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
              +I N+QDL N  GA+YAAV+FLG+ N ++VQ  +A+ERTVFYRE+AAGMYSA+PYA++Q
Sbjct  1215  TKIENEQDLNNFFGAMYAAVLFLGATNAATVQPAIAIERTVFYREKAAGMYSAIPYAISQ  1274

Query  624   V  626
             V
Sbjct  1275  V  1275


 Score =   242 bits (618),  Expect(2) = 2e-136, Method: Compositional matrix adjust.
 Identities = 110/177 (62%), Positives = 138/177 (78%), Gaps = 0/177 (0%)
 Frame = +2

Query  680   ILQAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALT  859
             I Q  +E +Y  +QT  Y+L+LY MIG +W + KFLWFYY+M TSFIYFTLYGMML+ALT
Sbjct  1272  ISQVAVEIMYNTIQTGVYTLILYSMIGCDWTVTKFLWFYYYMLTSFIYFTLYGMMLMALT  1331

Query  860   PGVQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKES  1039
             P  Q A I M+F L+ WNLF+GF++PR Q+P+WWRWYYWA+P  W+LYGLITSQ+GDK+S
Sbjct  1332  PNYQIAGICMSFFLSLWNLFSGFLIPRSQIPLWWRWYYWATPVAWTLYGLITSQVGDKDS  1391

Query  1040  RVQVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
              V + G GD+ +K  LK+ FG+++ FL  VA  H+ W LLFFFVFAYGI FLNFQRR
Sbjct  1392  VVHITGIGDIDLKILLKEGFGFEHDFLRVVAVVHIAWILLFFFVFAYGIKFLNFQRR  1448



>ref|XP_010415237.1| PREDICTED: ABC transporter G family member 39-like isoform X1 
[Camelina sativa]
Length=1451

 Score =   273 bits (699),  Expect(2) = 2e-136, Method: Compositional matrix adjust.
 Identities = 119/181 (66%), Positives = 155/181 (86%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              +AV GVPKI +G NPATWML+++T  +E+Q  +DF++I+ANS L++RNQELIKELSTPP
Sbjct  1098  FEAVEGVPKIIDGSNPATWMLDVTTPSLESQMSLDFSQIFANSSLYRRNQELIKELSTPP  1157

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             PGS+DLYF TKY+Q F  Q KACFWKQ+WSYWR+PQYNA+RF +T+V+GV+FG+IFW  G
Sbjct  1158  PGSKDLYFRTKYAQPFSTQAKACFWKQYWSYWRHPQYNAIRFLMTVVIGVLFGLIFWQIG  1217

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
              +I N+QDL N  GA+YAAV+FLG+ N ++VQ  +A+ERTVFYRE+AAGMYSA+PYA++Q
Sbjct  1218  TKIENEQDLNNFFGAMYAAVLFLGATNAATVQPAIAIERTVFYREKAAGMYSAIPYAISQ  1277

Query  624   V  626
             V
Sbjct  1278  V  1278


 Score =   242 bits (618),  Expect(2) = 2e-136, Method: Compositional matrix adjust.
 Identities = 110/177 (62%), Positives = 138/177 (78%), Gaps = 0/177 (0%)
 Frame = +2

Query  680   ILQAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALT  859
             I Q  +E +Y  +QT  Y+L+LY MIG +W + KFLWFYY+M TSFIYFTLYGMML+ALT
Sbjct  1275  ISQVAVEIMYNTIQTGVYTLILYSMIGCDWTVTKFLWFYYYMLTSFIYFTLYGMMLMALT  1334

Query  860   PGVQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKES  1039
             P  Q A I M+F L+ WNLF+GF++PR Q+P+WWRWYYWA+P  W+LYGLITSQ+GDK+S
Sbjct  1335  PNYQIAGICMSFFLSLWNLFSGFLIPRSQIPLWWRWYYWATPVAWTLYGLITSQVGDKDS  1394

Query  1040  RVQVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
              V + G GD+ +K  LK+ FG+++ FL  VA  H+ W LLFFFVFAYGI FLNFQRR
Sbjct  1395  VVHITGIGDIDLKILLKEGFGFEHDFLRVVAVVHIAWILLFFFVFAYGIKFLNFQRR  1451



>gb|KFK36344.1| hypothetical protein AALP_AA4G110300 [Arabis alpina]
Length=1441

 Score =   272 bits (695),  Expect(2) = 2e-136, Method: Compositional matrix adjust.
 Identities = 121/181 (67%), Positives = 152/181 (84%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              +A+ GVPKIK+GYNPATWML+++T  +E+Q  +DFA+I+ANS L++RNQEL KELSTPP
Sbjct  1088  FEAIEGVPKIKDGYNPATWMLDVTTPSMESQMNLDFAQIFANSSLYRRNQELNKELSTPP  1147

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             PGS DLYF TKYSQ F+ Q KACFWKQ+WS WR PQYNA+RF +TIV+G +FG+IFW  G
Sbjct  1148  PGSNDLYFKTKYSQPFLTQTKACFWKQYWSNWRYPQYNAIRFIMTIVIGFLFGLIFWQTG  1207

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
              +I  +QDL N  GA+YAAV+FLG+ N ++VQ  +AVERTVFYRE+AAGMYSA+PYA+AQ
Sbjct  1208  TKIEKEQDLNNFFGAMYAAVLFLGATNAATVQPAIAVERTVFYREKAAGMYSAIPYAIAQ  1267

Query  624   V  626
             V
Sbjct  1268  V  1268


 Score =   243 bits (621),  Expect(2) = 2e-136, Method: Compositional matrix adjust.
 Identities = 109/177 (62%), Positives = 138/177 (78%), Gaps = 0/177 (0%)
 Frame = +2

Query  680   ILQAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALT  859
             I Q  +E +Y  +QT  Y+L+LY MIG++W + KF WFYY+M TSFIYFTLYGMMLVALT
Sbjct  1265  IAQVSVEIMYNIIQTGIYTLILYSMIGYDWTVAKFFWFYYYMLTSFIYFTLYGMMLVALT  1324

Query  860   PGVQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKES  1039
             P  Q A I M+F L+ WNLF+GF++PR Q+P+WWRWYYWA P  W+LYG+ITSQ+GD++S
Sbjct  1325  PNYQIAGICMSFFLSLWNLFSGFLIPRPQIPIWWRWYYWACPVAWTLYGIITSQVGDQDS  1384

Query  1040  RVQVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
              V + G GD+T+K  LK+ FG++  FLP VA  H+GW LLF FVFAYGI +LNFQRR
Sbjct  1385  IVHITGIGDVTLKMLLKEGFGFEQDFLPVVAVVHIGWILLFVFVFAYGIKYLNFQRR  1441



>ref|XP_006575132.1| PREDICTED: pleiotropic drug resistance protein 2-like [Glycine 
max]
Length=1480

 Score =   281 bits (718),  Expect(2) = 2e-136, Method: Compositional matrix adjust.
 Identities = 126/181 (70%), Positives = 154/181 (85%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              +A+ GVPKIK+G NPATWMLEIS+  +E+Q  VDFAE+Y  S L+Q+NQE+IKEL TP 
Sbjct  1127  FEAIAGVPKIKDGCNPATWMLEISSPVVESQLNVDFAELYTKSDLYQKNQEVIKELCTPV  1186

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             PG++DL+FP+KYSQSFV QCKACFWKQ+ SYWRNPQYNA+RFF TIV+G++FG+I+W KG
Sbjct  1187  PGTKDLHFPSKYSQSFVTQCKACFWKQNCSYWRNPQYNAIRFFTTIVIGIIFGLIYWDKG  1246

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
              +   +QDLLNLLGA+YAAV FLG+ NT+SVQ  VA+ERTV YRERAAGMYS LPYA+ Q
Sbjct  1247  KKTQKEQDLLNLLGAMYAAVFFLGASNTNSVQPVVAIERTVLYRERAAGMYSELPYAIGQ  1306

Query  624   V  626
             V
Sbjct  1307  V  1307


 Score =   234 bits (598),  Expect(2) = 2e-136, Method: Compositional matrix adjust.
 Identities = 107/177 (60%), Positives = 137/177 (77%), Gaps = 0/177 (0%)
 Frame = +2

Query  680   ILQAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALT  859
             I Q  IE IYVA+Q+++Y++LLY MIGFE ++  FLWFYYF+F  F+YFTLYGMM VALT
Sbjct  1304  IGQVAIEVIYVAIQSLAYTILLYWMIGFEPRVENFLWFYYFIFMCFMYFTLYGMMTVALT  1363

Query  860   PGVQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKES  1039
             P  Q AA+ M+F + FWNLF+GF++PR Q+P+WWRWYYW SP  W++YGL+TSQ+GDK S
Sbjct  1364  PNYQIAALVMSFFINFWNLFSGFVIPRTQIPIWWRWYYWGSPVAWTIYGLVTSQVGDKNS  1423

Query  1040  RVQVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
              ++VPG   MT+K +L+  FG+ + FL  VA  HV + LLF  VFAYGI FLNFQRR
Sbjct  1424  PIEVPGFRTMTVKDYLERQFGFQHEFLGVVALTHVAFCLLFLLVFAYGIKFLNFQRR  1480



>ref|XP_009628856.1| PREDICTED: pleiotropic drug resistance protein 2-like [Nicotiana 
tomentosiformis]
 ref|XP_009628925.1| PREDICTED: pleiotropic drug resistance protein 2-like [Nicotiana 
tomentosiformis]
 ref|XP_009628986.1| PREDICTED: pleiotropic drug resistance protein 2-like [Nicotiana 
tomentosiformis]
 ref|XP_009629046.1| PREDICTED: pleiotropic drug resistance protein 2-like [Nicotiana 
tomentosiformis]
 ref|XP_009629118.1| PREDICTED: pleiotropic drug resistance protein 2-like [Nicotiana 
tomentosiformis]
Length=1473

 Score =   287 bits (735),  Expect(2) = 3e-136, Method: Compositional matrix adjust.
 Identities = 131/181 (72%), Positives = 155/181 (86%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              Q+VPGVP IK GYNPATWML+IS   +EAQ  VDFA+IYANS L++RNQELIKELS P 
Sbjct  1120  FQSVPGVPGIKEGYNPATWMLDISAPAVEAQLQVDFADIYANSELYRRNQELIKELSIPT  1179

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             PGSQDL+FPT Y+Q   EQCKACFWKQH SYWR+P+YNA+RF +T ++GV+FG+IFW KG
Sbjct  1180  PGSQDLHFPTVYAQPVFEQCKACFWKQHLSYWRHPRYNAIRFAMTAMIGVIFGIIFWNKG  1239

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
             D++   QDLLNL+GA+YAAV+FLG  NTS+VQ+ VAVERTVFYRE+AAGMYSALPYA AQ
Sbjct  1240  DKVSKLQDLLNLVGAMYAAVMFLGGTNTSAVQSIVAVERTVFYREKAAGMYSALPYAFAQ  1299

Query  624   V  626
             V
Sbjct  1300  V  1300


 Score =   228 bits (580),  Expect(2) = 3e-136, Method: Compositional matrix adjust.
 Identities = 107/175 (61%), Positives = 139/175 (79%), Gaps = 0/175 (0%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  IE IY+A+QT+ YSL+LY MIGF W  GKF  FY+F+F  F+YFT+YGMMLVALTP 
Sbjct  1299  QVAIETIYIAIQTLIYSLILYAMIGFHWTTGKFFLFYFFVFMCFVYFTMYGMMLVALTPN  1358

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
                AAI M+F L+FWNLF+GF++PR Q+P+WWRWYYWASP  W++YGL+TSQ+GDK + V
Sbjct  1359  YHIAAIVMSFFLSFWNLFSGFLIPRTQIPIWWRWYYWASPVAWTIYGLVTSQVGDKNNLV  1418

Query  1046  QVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
             ++PG G++ +K +LK+ FG++Y FL  VAA HV W++ F F+FAY I FLNFQRR
Sbjct  1419  EIPGGGEVPLKLYLKENFGFEYDFLGVVAAMHVVWAVFFCFIFAYAIKFLNFQRR  1473



>ref|XP_010511609.1| PREDICTED: ABC transporter G family member 39-like [Camelina 
sativa]
Length=1448

 Score =   271 bits (693),  Expect(2) = 4e-136, Method: Compositional matrix adjust.
 Identities = 118/181 (65%), Positives = 154/181 (85%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              +A+ GVPKI+NGYNPATWML+++T  +E+Q  +DF++I+ANS L++RNQELIKELSTPP
Sbjct  1095  FEAIEGVPKIENGYNPATWMLDVTTPSMESQMRLDFSQIFANSSLYRRNQELIKELSTPP  1154

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
              GS+DLYF TKY+Q F  Q KACFWKQ+WSYWR+P YNA+RF +T+V+GV+FG IFW  G
Sbjct  1155  HGSKDLYFRTKYAQPFSTQTKACFWKQYWSYWRHPHYNAIRFLMTVVIGVLFGQIFWQIG  1214

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
              +I N+QDL N  GA+YAAV+FLG+ N ++VQ  +A+ERTVFYRE+AAGMYSA+PYA++Q
Sbjct  1215  TKIENEQDLNNFFGAMYAAVLFLGATNAATVQPAIAIERTVFYREKAAGMYSAIPYAISQ  1274

Query  624   V  626
             V
Sbjct  1275  V  1275


 Score =   243 bits (621),  Expect(2) = 4e-136, Method: Compositional matrix adjust.
 Identities = 110/177 (62%), Positives = 138/177 (78%), Gaps = 0/177 (0%)
 Frame = +2

Query  680   ILQAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALT  859
             I Q  +E +Y  +QT  Y+L+LY MIG +W + KFLWFYY+M TSFIYFTLYGMML+ALT
Sbjct  1272  ISQVAVEIMYNTIQTGVYTLILYSMIGCDWTVTKFLWFYYYMLTSFIYFTLYGMMLMALT  1331

Query  860   PGVQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKES  1039
             P  Q A I M+F L+ WNLF+GF++PR Q+P+WWRWYYWA+P  W+LYGLITSQ+GDK+S
Sbjct  1332  PNYQIAGICMSFFLSLWNLFSGFLIPRPQIPLWWRWYYWATPVAWTLYGLITSQVGDKDS  1391

Query  1040  RVQVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
              V + G GD+ +K  LK+ FG+++ FLP VA  H+ W LLF FVFAYGI FLNFQRR
Sbjct  1392  VVHITGIGDIDLKILLKEGFGFEHDFLPVVAVVHIAWILLFVFVFAYGIKFLNFQRR  1448



>ref|XP_008227338.1| PREDICTED: pleiotropic drug resistance protein 2-like [Prunus 
mume]
Length=1451

 Score =   301 bits (771),  Expect(2) = 4e-136, Method: Compositional matrix adjust.
 Identities = 130/181 (72%), Positives = 160/181 (88%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              +A+PGVPKIK GYNPATWML++S+A +EAQ  +DFAE+YANS L++RN+ELIKELS P 
Sbjct  1099  FEAIPGVPKIKEGYNPATWMLDVSSAAVEAQNNIDFAEVYANSELYRRNEELIKELSIPL  1158

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             PGS DL+FPT++SQSF+ QCKACFWKQHWSYWRN +YNA+RFF+T V+G++FGVIFW KG
Sbjct  1159  PGSNDLHFPTQFSQSFIVQCKACFWKQHWSYWRNSRYNAIRFFMTAVIGIIFGVIFWSKG  1218

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
             D +H QQDL+NLLGA Y+AV+FLG+ N S+VQ+ +A+ERTVFYRERAAGMYS LPYA AQ
Sbjct  1219  DSLHKQQDLINLLGATYSAVLFLGAGNASAVQSVIAIERTVFYRERAAGMYSELPYAFAQ  1278

Query  624   V  626
             V
Sbjct  1279  V  1279


 Score =   213 bits (542),  Expect(2) = 4e-136, Method: Compositional matrix adjust.
 Identities = 99/175 (57%), Positives = 127/175 (73%), Gaps = 1/175 (1%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  IE IYVA+QT  YS +LY MIG+ WK+ KFL+FYYF+F  F YFT+ GMM+VALTP 
Sbjct  1278  QVAIETIYVAIQTFMYSCILYSMIGYTWKVEKFLYFYYFVFMCFTYFTMNGMMMVALTPN  1337

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
              Q AAI  +F   FWNLF+GF++ R  +PVWWRWYYW SP  W++YG++ SQ GD ++ +
Sbjct  1338  HQIAAIVSSFFTNFWNLFSGFLIARPLIPVWWRWYYWGSPIAWTIYGIMASQFGDNKTFI  1397

Query  1046  QVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
               P EG   +  +LK+  GY++ F+  V  AH+GW LLFFFVFAYGI FLNFQ+R
Sbjct  1398  DTP-EGSQRVDLYLKNNLGYEHDFVVPVFFAHIGWVLLFFFVFAYGIKFLNFQKR  1451



>gb|KEH43440.1| drug resistance transporter-like ABC domain protein [Medicago 
truncatula]
Length=1468

 Score =   286 bits (731),  Expect(2) = 4e-136, Method: Compositional matrix adjust.
 Identities = 123/181 (68%), Positives = 157/181 (87%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              +A+PG+P+IK+G+NPATWMLEIS+  +E+Q  VDFA++Y  S L+Q N+ELIKELS P 
Sbjct  1115  FEAIPGIPRIKDGHNPATWMLEISSPIVESQLSVDFADLYIKSELYQTNEELIKELSAPV  1174

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             PG++D+ F TK+S+SF+ QCK CFWKQ WSYWRNPQYNA RFF+++ +GV+FG++FW KG
Sbjct  1175  PGTKDINFATKHSRSFITQCKGCFWKQRWSYWRNPQYNATRFFMSLTVGVIFGLVFWNKG  1234

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
             D+IH +QDLLNL GA+Y+A++FLG+ NTSSVQ  VAVERTVFYRERAAGMYSALPYA+AQ
Sbjct  1235  DKIHKEQDLLNLTGAMYSAILFLGATNTSSVQPVVAVERTVFYRERAAGMYSALPYAIAQ  1294

Query  624   V  626
             V
Sbjct  1295  V  1295


 Score =   228 bits (582),  Expect(2) = 4e-136, Method: Compositional matrix adjust.
 Identities = 107/177 (60%), Positives = 141/177 (80%), Gaps = 0/177 (0%)
 Frame = +2

Query  680   ILQAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALT  859
             I Q  IE IYVA+QT++Y+L+LY M+GF W+  KF+WFYYF+F SF+YFTLYGMM VALT
Sbjct  1292  IAQVAIECIYVAIQTLAYTLILYSMMGFPWQADKFIWFYYFIFMSFVYFTLYGMMTVALT  1351

Query  860   PGVQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKES  1039
             P  Q AAI M+F L FWN+F+GF++P+ Q+P+WWRWYYWA P  W++YGL+TSQLGDKE+
Sbjct  1352  PNYQIAAIVMSFFLMFWNIFSGFVIPKSQIPIWWRWYYWACPTAWTVYGLLTSQLGDKET  1411

Query  1040  RVQVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
              ++VPG G +++K +LK   G++Y FL AVA AHV + ++F FVFAYGI   NFQ+R
Sbjct  1412  LIEVPGAGTISVKAYLKKEMGFEYDFLGAVAVAHVAFVVMFLFVFAYGIKVFNFQKR  1468



>ref|XP_006345999.1| PREDICTED: pleiotropic drug resistance protein 2-like [Solanum 
tuberosum]
Length=1457

 Score =   287 bits (735),  Expect(2) = 4e-136, Method: Compositional matrix adjust.
 Identities = 127/181 (70%), Positives = 154/181 (85%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              Q+VPGVP IK GYNPATWML+I+T  +EAQ  VDF +IYA S L++RNQELIK+LS P 
Sbjct  1104  FQSVPGVPTIKEGYNPATWMLDITTPAVEAQVNVDFTDIYAKSDLYRRNQELIKQLSVPA  1163

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             PGS+DL+FPTKYSQ+F+ QCK CFWKQH SYWR+PQYNA RFF+T  + ++FG+IFW KG
Sbjct  1164  PGSRDLHFPTKYSQTFISQCKVCFWKQHLSYWRHPQYNATRFFMTATIVIIFGIIFWDKG  1223

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
             ++++  QDLLN+LGA+YAAV+FLG  NT +VQ+ VAVERTVFYRERAAGMYSALPYA AQ
Sbjct  1224  NKMYKLQDLLNILGAMYAAVVFLGGANTPAVQSVVAVERTVFYRERAAGMYSALPYAFAQ  1283

Query  624   V  626
             V
Sbjct  1284  V  1284


 Score =   227 bits (578),  Expect(2) = 4e-136, Method: Compositional matrix adjust.
 Identities = 110/175 (63%), Positives = 137/175 (78%), Gaps = 0/175 (0%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  IE IYVA+QT  YSLLLY MIGF W   KF WFY+F+F  F+YFT+YGMMLVALTP 
Sbjct  1283  QVAIETIYVAIQTFIYSLLLYSMIGFHWTAVKFCWFYFFVFMCFVYFTMYGMMLVALTPS  1342

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
                A I M+F L+FWNLF+GF++PR Q+P+WWRWYYW SP  W++YGL+TSQ+GDK+  +
Sbjct  1343  YPIAFIVMSFFLSFWNLFSGFLIPRTQIPIWWRWYYWGSPVAWTIYGLVTSQVGDKDDNI  1402

Query  1046  QVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
             +VPG G++ +K FLK++ G++Y FL  VA AHV W +LF FVFAYGI FLNFQRR
Sbjct  1403  EVPGVGEIPLKLFLKEYLGFEYEFLGVVAVAHVAWVVLFCFVFAYGIKFLNFQRR  1457



>ref|XP_004250479.1| PREDICTED: pleiotropic drug resistance protein 2-like [Solanum 
lycopersicum]
Length=1467

 Score =   293 bits (749),  Expect(2) = 4e-136, Method: Compositional matrix adjust.
 Identities = 130/182 (71%), Positives = 160/182 (88%), Gaps = 0/182 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              Q+VPGVP+IK G NPATWML++S+  +EAQ  VDFA+IYANS L++RNQELIKELS P 
Sbjct  1114  FQSVPGVPEIKEGINPATWMLDVSSPAVEAQLQVDFADIYANSELYRRNQELIKELSIPA  1173

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             PGSQDL+FPTK+SQ F EQCKACFWKQH SYWR+PQYNA+RF +T ++GV+FG+IFW KG
Sbjct  1174  PGSQDLHFPTKFSQPFFEQCKACFWKQHLSYWRHPQYNAIRFAMTAMIGVIFGIIFWNKG  1233

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
             +++  QQDLLN++GAIYAAV+FLG  NTS+VQ+ VA+ERTVFYRE+AAGM+SALPYA AQ
Sbjct  1234  NQLSKQQDLLNIVGAIYAAVMFLGGTNTSTVQSVVAIERTVFYREKAAGMFSALPYAFAQ  1293

Query  624   VI  629
             V+
Sbjct  1294  VV  1295


 Score =   221 bits (564),  Expect(2) = 4e-136, Method: Compositional matrix adjust.
 Identities = 103/175 (59%), Positives = 138/175 (79%), Gaps = 0/175 (0%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  IE IY+A+QT  YSL+L+ MIGF+W +GKF  FY+F+F  F+YFT+YGMMLVALTP 
Sbjct  1293  QVVIETIYIAIQTFIYSLILFTMIGFQWTVGKFFLFYFFVFMCFVYFTMYGMMLVALTPN  1352

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
                AAI M+F L+FWNLF+GF++ R Q+P+WWRWYYW SP  W++YGL+TSQ+GDK + +
Sbjct  1353  YHIAAIVMSFFLSFWNLFSGFVISRTQIPIWWRWYYWGSPVAWTIYGLVTSQVGDKSNLI  1412

Query  1046  QVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
             ++PG G++++K +LK+  G++Y FL  VAA HV W++ F FVFAY I FLNFQRR
Sbjct  1413  EIPGSGEVSLKSYLKESCGFEYDFLGVVAAMHVVWAVFFCFVFAYAIKFLNFQRR  1467



>ref|XP_006577062.1| PREDICTED: LOW QUALITY PROTEIN: ABC transporter G family member 
34-like [Glycine max]
Length=1447

 Score =   282 bits (722),  Expect(2) = 4e-136, Method: Compositional matrix adjust.
 Identities = 129/181 (71%), Positives = 147/181 (81%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              +++ GV KIK+GYNPATWMLE+ST  IEA  G+DFAEIY NS L+QRNQELIKELSTPP
Sbjct  1094  FESIAGVQKIKDGYNPATWMLEVSTPSIEAHLGIDFAEIYTNSTLYQRNQELIKELSTPP  1153

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
              GS DL FPTKYSQSF  QCKACFWKQ+WSYWRNP YNAVR F TI +G+MFG+IFW K 
Sbjct  1154  QGSSDLRFPTKYSQSFFVQCKACFWKQYWSYWRNPSYNAVRLFFTIAIGIMFGLIFWNKA  1213

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
               I  QQDL +LLGA+YAAV+FLG+ NT  VQ  V +ERTV YRERAAGMYS L YA++Q
Sbjct  1214  KNIKKQQDLFDLLGAMYAAVMFLGTSNTMGVQPIVDIERTVLYRERAAGMYSTLTYAISQ  1273

Query  624   V  626
             V
Sbjct  1274  V  1274


 Score =   232 bits (591),  Expect(2) = 4e-136, Method: Compositional matrix adjust.
 Identities = 105/177 (59%), Positives = 131/177 (74%), Gaps = 0/177 (0%)
 Frame = +2

Query  680   ILQAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALT  859
             I Q  IEAIY A QT  +S+++Y M+GFEW   KFL FYYFM    IY+TLYGMM+VA+T
Sbjct  1271  ISQVAIEAIYSATQTTIFSVIIYSMMGFEWTARKFLSFYYFMLMCLIYYTLYGMMIVAVT  1330

Query  860   PGVQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKES  1039
             P  Q AA+  +F LT WN F GF++PR Q+P+WWRWYYW +P  W+LYGL+TSQ GDK +
Sbjct  1331  PSFQIAAVCNSFFLTIWNTFCGFVIPRTQIPIWWRWYYWLAPNAWTLYGLVTSQFGDKIT  1390

Query  1040  RVQVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
             +V++PG  +M +K+ LK  FGYDY FLP V   H+GW LLF FVFAY I FLNFQ+R
Sbjct  1391  QVEIPGAENMGLKELLKKNFGYDYHFLPVVVVVHLGWVLLFLFVFAYSIKFLNFQKR  1447



>ref|XP_004171668.1| PREDICTED: pleiotropic drug resistance protein 2-like, partial 
[Cucumis sativus]
Length=565

 Score =   276 bits (706),  Expect(2) = 5e-136, Method: Compositional matrix adjust.
 Identities = 121/181 (67%), Positives = 155/181 (86%), Gaps = 0/181 (0%)
 Frame = +3

Query  84   LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
             +A+PG+PKI+NG NPATWMLE++   +EAQ  +DFA+ +A SP+++RNQELI ELSTP 
Sbjct  212  FEAIPGIPKIENGKNPATWMLEVTAPPMEAQLDIDFADTFAKSPIYRRNQELIMELSTPA  271

Query  264  PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
            PGS+DL+FPT+YSQSF  QC+ACFWKQH SYWR+ QYNA+RFF TIV+G++FG++FW KG
Sbjct  272  PGSKDLHFPTEYSQSFFFQCRACFWKQHRSYWRHTQYNAIRFFSTIVVGILFGLVFWNKG  331

Query  444  DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
              +  QQD+LN++GAIY+A+IFLG+ N SSVQ+ VA+ERT FYRE+AAGMYSALPYA AQ
Sbjct  332  QILAKQQDVLNVMGAIYSAIIFLGASNASSVQSVVAIERTAFYREKAAGMYSALPYAFAQ  391

Query  624  V  626
            V
Sbjct  392  V  392


 Score =   238 bits (606),  Expect(2) = 5e-136, Method: Compositional matrix adjust.
 Identities = 110/175 (63%), Positives = 136/175 (78%), Gaps = 0/175 (0%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  IE IYV VQ+I YSL++Y MIGFEWKLGKFL F Y +F  F YFTLYGMM+VALTP 
Sbjct  391   QVAIETIYVFVQSIIYSLIIYSMIGFEWKLGKFLLFCYLVFMCFTYFTLYGMMVVALTPN  450

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
                AAI M+F + FWNLF GF++PR  +PVWWRWYYWA+P  W++YG++ SQ+GDK+S V
Sbjct  451   YHIAAIVMSFFVGFWNLFTGFLIPRPAIPVWWRWYYWANPVAWTIYGIVASQVGDKDSLV  510

Query  1046  QVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
             Q+PG G + +K FLK+ FGY++ F+P V AAH  W L+F FVFAYGI +LNFQRR
Sbjct  511   QIPGVGSVRLKLFLKEGFGYEHDFIPIVIAAHFIWVLVFIFVFAYGIKYLNFQRR  565



>ref|XP_007162867.1| hypothetical protein PHAVU_001G187700g [Phaseolus vulgaris]
 gb|ESW34861.1| hypothetical protein PHAVU_001G187700g [Phaseolus vulgaris]
Length=1442

 Score =   283 bits (724),  Expect(2) = 5e-136, Method: Compositional matrix adjust.
 Identities = 128/181 (71%), Positives = 149/181 (82%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              +A+ GV ++K+ YNPATWML+I+T  +EAQ G+DFAEIYANS LH+RNQELIKELS+PP
Sbjct  1089  FEAIVGVQEVKDSYNPATWMLQITTPSVEAQLGIDFAEIYANSTLHRRNQELIKELSSPP  1148

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             PGS DLYFPTKYSQSF  QCKACFWKQ WSYWRNP YNAVRFF TIV+G+++G+IFW K 
Sbjct  1149  PGSNDLYFPTKYSQSFFVQCKACFWKQFWSYWRNPSYNAVRFFFTIVVGIVYGIIFWNKA  1208

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
               +  QQDL +LLGA+YAAVIFLGS N   VQ  V  ER V YRERAAGMYS LPYA++Q
Sbjct  1209  KHVQKQQDLFDLLGAMYAAVIFLGSGNAMGVQPIVDRERNVLYRERAAGMYSTLPYAISQ  1268

Query  624   V  626
             V
Sbjct  1269  V  1269


 Score =   231 bits (588),  Expect(2) = 5e-136, Method: Compositional matrix adjust.
 Identities = 102/177 (58%), Positives = 130/177 (73%), Gaps = 0/177 (0%)
 Frame = +2

Query  680   ILQAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALT  859
             I Q  +EAIY A+Q   YS+ +Y M+GFEWK+ KFLWF+Y M    IY+TLYGMM+VALT
Sbjct  1266  ISQVAVEAIYNAIQATIYSVFIYSMMGFEWKVLKFLWFFYIMLMCLIYYTLYGMMIVALT  1325

Query  860   PGVQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKES  1039
             P  Q A    +F L+ W  F GFI+PR Q+PVWWRWYYW +P  W+LYG++TSQLGD+ +
Sbjct  1326  PSFQIAVTCNSFFLSIWGTFCGFIIPRTQIPVWWRWYYWLTPNAWTLYGIVTSQLGDENA  1385

Query  1040  RVQVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
              V++PG  +M +K+ LK+ FGY+Y FLP VA   +GW LLF FVFAY I FLNFQ+R
Sbjct  1386  EVEIPGAENMVVKEVLKENFGYEYQFLPVVAVVQIGWVLLFLFVFAYSIKFLNFQKR  1442



>gb|KHN18743.1| ABC transporter G family member 39 [Glycine soja]
Length=1450

 Score =   282 bits (721),  Expect(2) = 6e-136, Method: Compositional matrix adjust.
 Identities = 129/181 (71%), Positives = 147/181 (81%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              +++ GV KIK+GYNPATWMLE+ST  IEA  G+DFAEIY NS L+QRNQELIKELSTPP
Sbjct  1097  FESIAGVQKIKDGYNPATWMLEVSTPSIEAHLGIDFAEIYTNSTLYQRNQELIKELSTPP  1156

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
              GS DL FPTKYSQSF  QCKACFWKQ+WSYWRNP YNAVR F TI +G+MFG+IFW K 
Sbjct  1157  QGSSDLRFPTKYSQSFFVQCKACFWKQYWSYWRNPSYNAVRLFFTIAIGIMFGLIFWNKA  1216

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
               I  QQDL +LLGA+YAAV+FLG+ NT  VQ  V +ERTV YRERAAGMYS L YA++Q
Sbjct  1217  KNIKKQQDLFDLLGAMYAAVMFLGTSNTMGVQPIVDIERTVLYRERAAGMYSTLTYAISQ  1276

Query  624   V  626
             V
Sbjct  1277  V  1277


 Score =   231 bits (590),  Expect(2) = 6e-136, Method: Compositional matrix adjust.
 Identities = 105/177 (59%), Positives = 131/177 (74%), Gaps = 0/177 (0%)
 Frame = +2

Query  680   ILQAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALT  859
             I Q  IEAIY A QT  +S+++Y M+GFEW   KFL FYYFM    IY+TLYGMM+VA+T
Sbjct  1274  ISQVAIEAIYSATQTTIFSVIIYSMMGFEWTARKFLSFYYFMLMCLIYYTLYGMMIVAVT  1333

Query  860   PGVQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKES  1039
             P  Q AA+  +F LT WN F GF++PR Q+P+WWRWYYW +P  W+LYGL+TSQ GDK +
Sbjct  1334  PSFQIAAVCNSFFLTIWNTFCGFVIPRTQIPIWWRWYYWLAPNAWTLYGLVTSQFGDKIT  1393

Query  1040  RVQVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
             +V++PG  +M +K+ LK  FGYDY FLP V   H+GW LLF FVFAY I FLNFQ+R
Sbjct  1394  QVEIPGAENMGLKELLKKNFGYDYHFLPVVVVVHLGWVLLFLFVFAYSIKFLNFQKR  1450



>ref|XP_008462545.1| PREDICTED: ABC transporter G family member 39-like [Cucumis melo]
Length=1455

 Score =   279 bits (714),  Expect(2) = 6e-136, Method: Compositional matrix adjust.
 Identities = 123/181 (68%), Positives = 154/181 (85%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              ++VPGVPKIK+GYNPATWMLE++ + +E Q  VDFA+IYANS L+QRNQELI ELS PP
Sbjct  1102  FESVPGVPKIKDGYNPATWMLEVTASSVETQLDVDFADIYANSALYQRNQELIAELSEPP  1161

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             PGSQDL+FPTKYSQ+F  Q KACFWK + SYWRNP+YNAVRFF+T+++G++FG+IFW KG
Sbjct  1162  PGSQDLHFPTKYSQTFTVQFKACFWKWYRSYWRNPRYNAVRFFMTVMIGLLFGLIFWNKG  1221

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
              +   +QDL N LGA+YAA++FLG+ N S++Q  V++ERTVFYRERAAGMYS LPYA +Q
Sbjct  1222  SKTDKEQDLRNFLGAMYAAILFLGASNASAIQPVVSIERTVFYRERAAGMYSPLPYAFSQ  1281

Query  624   V  626
             V
Sbjct  1282  V  1282


 Score =   234 bits (597),  Expect(2) = 6e-136, Method: Compositional matrix adjust.
 Identities = 105/175 (60%), Positives = 136/175 (78%), Gaps = 0/175 (0%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  IE IY A+QTI Y+LLL+ M+GFEWK   F WFYYF+   F+YFT++GMM++ALTPG
Sbjct  1281  QVAIEVIYNAIQTIIYALLLFSMMGFEWKASNFFWFYYFILMCFVYFTMFGMMIIALTPG  1340

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
              Q AAIAM+F L+FWNLF+GF++PR Q+P+WWRWYYW SP  W++ GL+TSQ+G+K   +
Sbjct  1341  PQIAAIAMSFFLSFWNLFSGFMVPRPQIPIWWRWYYWLSPIAWTINGLVTSQVGNKGGNL  1400

Query  1046  QVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
              V G  D+ +K FLKD FG++Y FLP +A AH GW  L+FFVFAY + FLNFQ+R
Sbjct  1401  HVAGGVDIPVKTFLKDTFGFEYDFLPYIALAHFGWVFLYFFVFAYSMKFLNFQKR  1455



>ref|NP_181179.2| ABC transporter G family member 34 [Arabidopsis thaliana]
 sp|Q7PC87.1|AB34G_ARATH RecName: Full=ABC transporter G family member 34; Short=ABC transporter 
ABCG.34; Short=AtABCG34; AltName: Full=Pleiotropic 
drug resistance protein 6 [Arabidopsis thaliana]
 tpg|DAA00874.1| TPA_exp: PDR6 ABC transporter [Arabidopsis thaliana]
 gb|AEC09246.1| ABC transporter G family member 34 [Arabidopsis thaliana]
Length=1453

 Score =   268 bits (684),  Expect(2) = 7e-136, Method: Compositional matrix adjust.
 Identities = 117/181 (65%), Positives = 151/181 (83%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              +A+ GVPKIK+GYNPATWML+++T  +E+Q  VDFA+I+ NS +++RNQELIKELSTPP
Sbjct  1100  FEAIEGVPKIKDGYNPATWMLDVTTPSMESQMSVDFAQIFVNSSVNRRNQELIKELSTPP  1159

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             PGS DLYF TKY+Q F  Q KACFWK +WS WR PQYNA+RF +T+V+GV+FG++FW  G
Sbjct  1160  PGSNDLYFRTKYAQPFSTQTKACFWKMYWSNWRYPQYNAIRFLMTVVIGVLFGLLFWQTG  1219

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
              +I  +QDL N  GA+YAAV+FLG+ N ++VQ  VA+ERTVFYRE+AAGMYSA+PYA++Q
Sbjct  1220  TKIEKEQDLNNFFGAMYAAVLFLGATNAATVQPAVAIERTVFYREKAAGMYSAIPYAISQ  1279

Query  624   V  626
             V
Sbjct  1280  V  1280


 Score =   245 bits (626),  Expect(2) = 7e-136, Method: Compositional matrix adjust.
 Identities = 108/177 (61%), Positives = 138/177 (78%), Gaps = 0/177 (0%)
 Frame = +2

Query  680   ILQAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALT  859
             I Q  +E +Y  +QT  Y+L+LY MIG++W + KF WFYY+M T F+YFTLYGMMLVALT
Sbjct  1277  ISQVAVEIMYNTIQTGVYTLILYSMIGYDWTVVKFFWFYYYMLTCFVYFTLYGMMLVALT  1336

Query  860   PGVQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKES  1039
             P  Q A I ++F L+FWNLF+GF++PR Q+P+WWRWYYWASP  W+LYG+ITSQ+GD++S
Sbjct  1337  PNYQIAGICLSFFLSFWNLFSGFLIPRPQIPIWWRWYYWASPVAWTLYGIITSQVGDRDS  1396

Query  1040  RVQVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
              V + G GDM++K  LK+ FG+DY FLP VA  H+ W L+F F FAYGI FLNFQRR
Sbjct  1397  IVHITGVGDMSLKTLLKNGFGFDYDFLPVVAVVHIAWILIFLFAFAYGIKFLNFQRR  1453



>gb|KHN25179.1| Pleiotropic drug resistance protein 2 [Glycine soja]
Length=1329

 Score =   280 bits (715),  Expect(2) = 8e-136, Method: Compositional matrix adjust.
 Identities = 126/181 (70%), Positives = 154/181 (85%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              +A+ GVPKIK+G NPATWMLEIS+  +E+Q  VDFAE+Y  S L+Q+NQE+IKEL TP 
Sbjct  976   FEAIAGVPKIKDGCNPATWMLEISSPVVESQLNVDFAELYTKSDLYQKNQEVIKELCTPV  1035

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             PG++DL+FP+KYSQSFV QCKACFWKQ+ SYWRNPQYNA+RFF TIV+G++FG+I+W KG
Sbjct  1036  PGTKDLHFPSKYSQSFVTQCKACFWKQNCSYWRNPQYNAIRFFTTIVIGIIFGLIYWDKG  1095

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
              +   +QDLLNLLGA+YAAV FLG+ NT+SVQ  VA+ERTV YRERAAGMYS LPYA+ Q
Sbjct  1096  KKTQKEQDLLNLLGAMYAAVFFLGASNTNSVQPVVAIERTVLYRERAAGMYSELPYAIGQ  1155

Query  624   V  626
             V
Sbjct  1156  V  1156


 Score =   234 bits (596),  Expect(2) = 8e-136, Method: Compositional matrix adjust.
 Identities = 107/177 (60%), Positives = 137/177 (77%), Gaps = 0/177 (0%)
 Frame = +2

Query  680   ILQAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALT  859
             I Q  IE IYVA+Q+++Y++LLY MIGFE ++  FLWFYYF+F  F+YFTLYGMM VALT
Sbjct  1153  IGQVAIEVIYVAIQSLAYTILLYWMIGFEPRVENFLWFYYFIFMCFMYFTLYGMMTVALT  1212

Query  860   PGVQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKES  1039
             P  Q AA+ M+F + FWNLF+GF++PR Q+P+WWRWYYW SP  W++YGL+TSQ+GDK S
Sbjct  1213  PNYQIAALVMSFFINFWNLFSGFVIPRTQIPIWWRWYYWGSPVAWTIYGLVTSQVGDKNS  1272

Query  1040  RVQVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
              ++VPG   MT+K +L+  FG+ + FL  VA  HV + LLF  VFAYGI FLNFQRR
Sbjct  1273  PIEVPGFRTMTVKDYLERQFGFQHEFLGVVALTHVAFCLLFLLVFAYGIKFLNFQRR  1329



>gb|AAD24623.1| putative ABC transporter [Arabidopsis thaliana]
 gb|AAM15320.1| putative ABC transporter [Arabidopsis thaliana]
Length=1450

 Score =   268 bits (684),  Expect(2) = 8e-136, Method: Compositional matrix adjust.
 Identities = 117/181 (65%), Positives = 151/181 (83%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              +A+ GVPKIK+GYNPATWML+++T  +E+Q  VDFA+I+ NS +++RNQELIKELSTPP
Sbjct  1097  FEAIEGVPKIKDGYNPATWMLDVTTPSMESQMSVDFAQIFVNSSVNRRNQELIKELSTPP  1156

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             PGS DLYF TKY+Q F  Q KACFWK +WS WR PQYNA+RF +T+V+GV+FG++FW  G
Sbjct  1157  PGSNDLYFRTKYAQPFSTQTKACFWKMYWSNWRYPQYNAIRFLMTVVIGVLFGLLFWQTG  1216

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
              +I  +QDL N  GA+YAAV+FLG+ N ++VQ  VA+ERTVFYRE+AAGMYSA+PYA++Q
Sbjct  1217  TKIEKEQDLNNFFGAMYAAVLFLGATNAATVQPAVAIERTVFYREKAAGMYSAIPYAISQ  1276

Query  624   V  626
             V
Sbjct  1277  V  1277


 Score =   245 bits (626),  Expect(2) = 8e-136, Method: Compositional matrix adjust.
 Identities = 108/177 (61%), Positives = 138/177 (78%), Gaps = 0/177 (0%)
 Frame = +2

Query  680   ILQAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALT  859
             I Q  +E +Y  +QT  Y+L+LY MIG++W + KF WFYY+M T F+YFTLYGMMLVALT
Sbjct  1274  ISQVAVEIMYNTIQTGVYTLILYSMIGYDWTVVKFFWFYYYMLTCFVYFTLYGMMLVALT  1333

Query  860   PGVQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKES  1039
             P  Q A I ++F L+FWNLF+GF++PR Q+P+WWRWYYWASP  W+LYG+ITSQ+GD++S
Sbjct  1334  PNYQIAGICLSFFLSFWNLFSGFLIPRPQIPIWWRWYYWASPVAWTLYGIITSQVGDRDS  1393

Query  1040  RVQVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
              V + G GDM++K  LK+ FG+DY FLP VA  H+ W L+F F FAYGI FLNFQRR
Sbjct  1394  IVHITGVGDMSLKTLLKNGFGFDYDFLPVVAVVHIAWILIFLFAFAYGIKFLNFQRR  1450



>ref|XP_004291541.1| PREDICTED: pleiotropic drug resistance protein 2-like [Fragaria 
vesca subsp. vesca]
Length=1441

 Score =   303 bits (775),  Expect(2) = 8e-136, Method: Compositional matrix adjust.
 Identities = 134/181 (74%), Positives = 160/181 (88%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              +A+PGVPKI  GYNPATWML+IS++ +EAQ  +DFAE+YANS L++R QELIKELSTP 
Sbjct  1088  FEAIPGVPKIIEGYNPATWMLDISSSAMEAQLDIDFAEVYANSDLYRRTQELIKELSTPE  1147

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             PGS+DLYFPT+YSQS++ QCKACFWKQHWSYWRN +YNA+RFF+TI +G +FGVIFW KG
Sbjct  1148  PGSKDLYFPTQYSQSYLTQCKACFWKQHWSYWRNSRYNAIRFFMTICIGGLFGVIFWSKG  1207

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
             D+IH QQDL+NLLGA Y+AV+FLG+ N S+VQ+ VAVERTVFYRERAAGMYS LPYA AQ
Sbjct  1208  DQIHKQQDLINLLGATYSAVLFLGASNASAVQSVVAVERTVFYRERAAGMYSELPYAFAQ  1267

Query  624   V  626
             V
Sbjct  1268  V  1268


 Score =   211 bits (536),  Expect(2) = 8e-136, Method: Compositional matrix adjust.
 Identities = 104/175 (59%), Positives = 131/175 (75%), Gaps = 0/175 (0%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  IE IYVA+QT  YS +LY MIG+ WK+ KF +FYYF+F  F YF++YGMM+VALTPG
Sbjct  1267  QVAIETIYVAIQTFIYSCILYSMIGYTWKVEKFFYFYYFIFMCFTYFSMYGMMVVALTPG  1326

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
              Q AAI M+F L+FWNLF+GF++ R  +PVWWRWYYW SP  W++YG+  SQ+GD  + +
Sbjct  1327  HQIAAIVMSFFLSFWNLFSGFLIARPLIPVWWRWYYWGSPVAWTIYGIFGSQVGDMTAEI  1386

Query  1046  QVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
              +     + I +F+KD+ G+DY FL  V  AHVGW LLFFFVFAYGI FLNFQRR
Sbjct  1387  DMADGDKVAINKFVKDYLGFDYDFLIPVVIAHVGWVLLFFFVFAYGIKFLNFQRR  1441



>emb|CDX84561.1| BnaA03g16690D [Brassica napus]
Length=1631

 Score =   267 bits (683),  Expect(2) = 9e-136, Method: Compositional matrix adjust.
 Identities = 118/181 (65%), Positives = 149/181 (82%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              +AV GVPKIK+GYNPATWML+++T  +E+Q  +DFA+I+ NS L+ RNQELIKELSTPP
Sbjct  1278  FEAVEGVPKIKDGYNPATWMLDVTTPSMESQMSLDFAQIFTNSSLYGRNQELIKELSTPP  1337

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             PGS DLYFPTKYSQ F  Q KAC WKQ+WS WR PQYN++RF +TI  GV+FG+IFW  G
Sbjct  1338  PGSNDLYFPTKYSQPFWTQTKACLWKQYWSNWRFPQYNSIRFLMTIAFGVLFGLIFWQTG  1397

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
              +I  +QDL N  GA+YAAV+FLG+ N ++VQ  +A+ERTVFYRE+AAGMYSA+PYA+++
Sbjct  1398  TKIEKEQDLNNFFGAMYAAVLFLGATNAAAVQPVIAIERTVFYREKAAGMYSAIPYAISK  1457

Query  624   V  626
             V
Sbjct  1458  V  1458


 Score =   246 bits (627),  Expect(2) = 9e-136, Method: Compositional matrix adjust.
 Identities = 109/177 (62%), Positives = 140/177 (79%), Gaps = 0/177 (0%)
 Frame = +2

Query  680   ILQAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALT  859
             I +  +E +Y  +QT  Y+L+LY MIG++W + KF WFYY+M TSFIYFTLYGMML+ALT
Sbjct  1455  ISKVAVEIMYNTIQTGVYTLILYSMIGYDWTVTKFFWFYYYMLTSFIYFTLYGMMLMALT  1514

Query  860   PGVQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKES  1039
             P  Q A I M+F +  WNLF+GF++PR Q+P+WWRWYYWA+P  W+LYG+ITSQ+GDK+S
Sbjct  1515  PNPQIAGICMSFFVVLWNLFSGFLIPRPQIPIWWRWYYWATPVAWTLYGIITSQVGDKDS  1574

Query  1040  RVQVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
              VQ+ G GDM++K  LK+ FG+++ FLP VAA H+ W LLF FVFAYGI FLNFQRR
Sbjct  1575  IVQITGVGDMSLKTLLKNGFGFEHDFLPVVAAVHIAWILLFAFVFAYGIKFLNFQRR  1631



>ref|XP_002267191.2| PREDICTED: pleiotropic drug resistance protein 2-like [Vitis 
vinifera]
Length=1453

 Score =   299 bits (766),  Expect(2) = 1e-135, Method: Compositional matrix adjust.
 Identities = 133/181 (73%), Positives = 160/181 (88%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              ++VPGV KIK GYNPATWMLE+ST+ +EAQ  +DFAE++ANS L++RNQ+LI ELSTP 
Sbjct  1100  FESVPGVTKIKEGYNPATWMLEVSTSAVEAQLDIDFAEVFANSALYRRNQDLINELSTPA  1159

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             PGS+DLYFPT+YSQSFV QCKACFWKQ +SYWRN +YNA+RFF+TIV+GV+FGVIFW KG
Sbjct  1160  PGSKDLYFPTQYSQSFVTQCKACFWKQRYSYWRNSEYNAIRFFMTIVIGVLFGVIFWSKG  1219

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
             D+IH QQ+L+NLLGA YAA++FLG+ N ++VQ  VAVERTVFYRERAAGMYS LPYA AQ
Sbjct  1220  DQIHKQQELINLLGATYAAILFLGASNATAVQPVVAVERTVFYRERAAGMYSELPYAFAQ  1279

Query  624   V  626
             V
Sbjct  1280  V  1280


 Score =   213 bits (543),  Expect(2) = 1e-135, Method: Compositional matrix adjust.
 Identities = 104/175 (59%), Positives = 132/175 (75%), Gaps = 0/175 (0%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  IE IYVA+QT+ Y LLLY MIGF+WK+ KF +FYYF+F  F YF+LYGMM+VALTPG
Sbjct  1279  QVAIETIYVAIQTLVYVLLLYSMIGFQWKVDKFFYFYYFIFMCFTYFSLYGMMVVALTPG  1338

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
              Q AAI  +F   FWNLF+GF++PR  +P+WWRWYYWASP  W++YG+  SQ+GD  + +
Sbjct  1339  HQIAAIVSSFFFNFWNLFSGFLIPRPLIPIWWRWYYWASPVAWTIYGIFASQVGDITTDL  1398

Query  1046  QVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
             ++ G   M + +F+K+  G+D+ FL  V  AHVGW  LFFFVFAYGI FLNFQRR
Sbjct  1399  EITGSSPMPVNEFIKENLGFDHDFLVPVVFAHVGWVFLFFFVFAYGIKFLNFQRR  1453



>ref|XP_010553380.1| PREDICTED: ABC transporter G family member 39-like isoform X2 
[Tarenaya hassleriana]
Length=1462

 Score =   285 bits (729),  Expect(2) = 1e-135, Method: Compositional matrix adjust.
 Identities = 128/181 (71%), Positives = 154/181 (85%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              ++V GVPKI + YNPATWMLE+ST  +E Q GVDFAEIYANS L+QRNQELI+ELSTPP
Sbjct  1109  FESVHGVPKIIDSYNPATWMLEVSTPSMETQLGVDFAEIYANSTLYQRNQELIRELSTPP  1168

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             P S +LYFPTKYSQSF  QC+ACFWKQ+ SYWR+PQYNA+RF +T+V+G+MFG+IFW KG
Sbjct  1169  PSSNNLYFPTKYSQSFSTQCRACFWKQYKSYWRHPQYNAIRFLMTVVIGIMFGLIFWQKG  1228

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
              +I  QQDL N  GA+YAA++FLG+ N ++VQ  VA+ERTVFYRERAAGMYSA+PYA AQ
Sbjct  1229  TKIEKQQDLNNFFGAMYAALLFLGATNAATVQPVVAIERTVFYRERAAGMYSAIPYAFAQ  1288

Query  624   V  626
             V
Sbjct  1289  V  1289


 Score =   228 bits (580),  Expect(2) = 1e-135, Method: Compositional matrix adjust.
 Identities = 106/175 (61%), Positives = 136/175 (78%), Gaps = 0/175 (0%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  +E IY   QT+ YSL+LY MIG++W +GKF WF+Y++   FIYFTLYGMMLVA+TP 
Sbjct  1288  QVAVEMIYNFAQTVVYSLILYTMIGYDWTVGKFFWFFYYILACFIYFTLYGMMLVAMTPN  1347

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
                A I+M+F L+ WNLF+GF++PR Q+P+WWRWYYWASP  W+LYG++TSQ+GDKES V
Sbjct  1348  YHIAGISMSFFLSLWNLFSGFLIPRPQLPIWWRWYYWASPVAWTLYGILTSQVGDKESLV  1407

Query  1046  QVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
             Q+PG GD+++K  LKD FG+D+ FLP VA  HV W  +F  VFAY I FLNFQ+R
Sbjct  1408  QIPGIGDVSLKVLLKDGFGFDHDFLPVVAVVHVVWIAVFLLVFAYSIKFLNFQKR  1462



>emb|CBI17067.3| unnamed protein product [Vitis vinifera]
Length=1460

 Score =   299 bits (765),  Expect(2) = 1e-135, Method: Compositional matrix adjust.
 Identities = 133/181 (73%), Positives = 160/181 (88%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              ++VPGV KIK GYNPATWMLE+ST+ +EAQ  +DFAE++ANS L++RNQ+LI ELSTP 
Sbjct  1107  FESVPGVTKIKEGYNPATWMLEVSTSAVEAQLDIDFAEVFANSALYRRNQDLINELSTPA  1166

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             PGS+DLYFPT+YSQSFV QCKACFWKQ +SYWRN +YNA+RFF+TIV+GV+FGVIFW KG
Sbjct  1167  PGSKDLYFPTQYSQSFVTQCKACFWKQRYSYWRNSEYNAIRFFMTIVIGVLFGVIFWSKG  1226

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
             D+IH QQ+L+NLLGA YAA++FLG+ N ++VQ  VAVERTVFYRERAAGMYS LPYA AQ
Sbjct  1227  DQIHKQQELINLLGATYAAILFLGASNATAVQPVVAVERTVFYRERAAGMYSELPYAFAQ  1286

Query  624   V  626
             V
Sbjct  1287  V  1287


 Score =   214 bits (544),  Expect(2) = 1e-135, Method: Compositional matrix adjust.
 Identities = 104/175 (59%), Positives = 132/175 (75%), Gaps = 0/175 (0%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  IE IYVA+QT+ Y LLLY MIGF+WK+ KF +FYYF+F  F YF+LYGMM+VALTPG
Sbjct  1286  QVAIETIYVAIQTLVYVLLLYSMIGFQWKVDKFFYFYYFIFMCFTYFSLYGMMVVALTPG  1345

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
              Q AAI  +F   FWNLF+GF++PR  +P+WWRWYYWASP  W++YG+  SQ+GD  + +
Sbjct  1346  HQIAAIVSSFFFNFWNLFSGFLIPRPLIPIWWRWYYWASPVAWTIYGIFASQVGDITTDL  1405

Query  1046  QVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
             ++ G   M + +F+K+  G+D+ FL  V  AHVGW  LFFFVFAYGI FLNFQRR
Sbjct  1406  EITGSSPMPVNEFIKENLGFDHDFLVPVVFAHVGWVFLFFFVFAYGIKFLNFQRR  1460



>ref|XP_010509478.1| PREDICTED: ABC transporter G family member 34-like [Camelina 
sativa]
Length=1450

 Score =   273 bits (698),  Expect(2) = 1e-135, Method: Compositional matrix adjust.
 Identities = 121/181 (67%), Positives = 152/181 (84%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              + + GVPKIK+GYNPATWML++ST  +E+Q  VDFA+I+ANS ++QRNQELIKELSTPP
Sbjct  1097  FEGIEGVPKIKDGYNPATWMLDVSTPSMESQMSVDFAQIFANSSINQRNQELIKELSTPP  1156

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             PGS DLYF TKY+Q F  Q KACFWKQ+WS WR PQYNA+RF +TIV+GV+FG+IFW  G
Sbjct  1157  PGSNDLYFQTKYAQPFGTQMKACFWKQYWSNWRYPQYNAIRFLMTIVIGVLFGLIFWQTG  1216

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
              ++  +QDL N  GA+YAAV+FLG+ N ++VQ  +AVERTVFYRE+AAGMYSA+PYA++Q
Sbjct  1217  TKLKKEQDLNNFFGAMYAAVLFLGATNAATVQPAIAVERTVFYREKAAGMYSAIPYAISQ  1276

Query  624   V  626
             V
Sbjct  1277  V  1277


 Score =   239 bits (611),  Expect(2) = 1e-135, Method: Compositional matrix adjust.
 Identities = 108/177 (61%), Positives = 136/177 (77%), Gaps = 0/177 (0%)
 Frame = +2

Query  680   ILQAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALT  859
             I Q  +E +Y   QT  Y+L+LY MIG++W + KF WFYY+M TSFIYFTLYGMMLVALT
Sbjct  1274  ISQVAVEIMYNTAQTALYTLILYSMIGYDWTVVKFFWFYYYMLTSFIYFTLYGMMLVALT  1333

Query  860   PGVQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKES  1039
             P  Q A I M+F L+FWNLF+GF++ R  +P+WWRWYYWASP  W+LYG+ITSQ+GD +S
Sbjct  1334  PNYQIAGICMSFFLSFWNLFSGFLIARPLIPIWWRWYYWASPVAWTLYGIITSQVGDTDS  1393

Query  1040  RVQVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
              V + G GD ++K  LKD FG+++ FLP VA  H+GW L+F FVFAYGI FLNFQ+R
Sbjct  1394  IVHITGVGDTSLKTLLKDGFGFEHDFLPVVAVVHIGWILVFLFVFAYGIKFLNFQKR  1450



>ref|XP_010553378.1| PREDICTED: ABC transporter G family member 39-like isoform X1 
[Tarenaya hassleriana]
Length=1462

 Score =   285 bits (728),  Expect(2) = 1e-135, Method: Compositional matrix adjust.
 Identities = 128/181 (71%), Positives = 154/181 (85%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              ++V GVPKI + YNPATWMLE+ST  +E Q GVDFAEIYANS L+QRNQELI+ELSTPP
Sbjct  1109  FESVHGVPKIIDSYNPATWMLEVSTPSMETQLGVDFAEIYANSTLYQRNQELIRELSTPP  1168

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             P S +LYFPTKYSQSF  QC+ACFWKQ+ SYWR+PQYNA+RF +T+V+G+MFG+IFW KG
Sbjct  1169  PSSNNLYFPTKYSQSFSTQCRACFWKQYKSYWRHPQYNAIRFLMTVVIGIMFGLIFWQKG  1228

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
              +I  QQDL N  GA+YAA++FLG+ N S+VQ  VA+ERTVFYRE+AAGMYSA+PYA AQ
Sbjct  1229  TKIEKQQDLNNFFGAMYAALLFLGATNASAVQPVVAIERTVFYREKAAGMYSAIPYAFAQ  1288

Query  624   V  626
             V
Sbjct  1289  V  1289


 Score =   228 bits (580),  Expect(2) = 1e-135, Method: Compositional matrix adjust.
 Identities = 106/175 (61%), Positives = 136/175 (78%), Gaps = 0/175 (0%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  +E IY   QT+ YSL+LY MIG++W +GKF WF+Y++   FIYFTLYGMMLVA+TP 
Sbjct  1288  QVAVEMIYNFAQTVVYSLILYTMIGYDWTVGKFFWFFYYILACFIYFTLYGMMLVAMTPN  1347

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
                A I+M+F L+ WNLF+GF++PR Q+P+WWRWYYWASP  W+LYG++TSQ+GDKES V
Sbjct  1348  YHIAGISMSFFLSLWNLFSGFLIPRPQLPIWWRWYYWASPVAWTLYGILTSQVGDKESLV  1407

Query  1046  QVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
             Q+PG GD+++K  LKD FG+D+ FLP VA  HV W  +F  VFAY I FLNFQ+R
Sbjct  1408  QIPGIGDVSLKVLLKDGFGFDHDFLPVVAVVHVVWIAVFLLVFAYSIKFLNFQKR  1462



>ref|XP_007208393.1| hypothetical protein PRUPE_ppa000233mg [Prunus persica]
 gb|EMJ09592.1| hypothetical protein PRUPE_ppa000233mg [Prunus persica]
Length=1425

 Score =   301 bits (772),  Expect(2) = 2e-135, Method: Compositional matrix adjust.
 Identities = 131/181 (72%), Positives = 160/181 (88%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              +A+PGVPKIK GYNPATWML++S+A +EAQ  +DFAEIYANS L++RN+ELIKELS P 
Sbjct  1073  FEAIPGVPKIKEGYNPATWMLDVSSAAVEAQNNIDFAEIYANSELYRRNEELIKELSIPL  1132

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             PGS DL+FPT++SQSF+ QCKACFWKQHWSYWRN +YNA+RFF+T V+G++FGVIFW KG
Sbjct  1133  PGSNDLHFPTQFSQSFIVQCKACFWKQHWSYWRNSRYNAIRFFMTAVIGIIFGVIFWSKG  1192

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
             D +H QQDL+NLLGA Y+AV+FLG+ N S+VQ+ +A+ERTVFYRERAAGMYS LPYA AQ
Sbjct  1193  DSLHKQQDLINLLGATYSAVLFLGAGNASAVQSVIAIERTVFYRERAAGMYSELPYAFAQ  1252

Query  624   V  626
             V
Sbjct  1253  V  1253


 Score =   211 bits (536),  Expect(2) = 2e-135, Method: Compositional matrix adjust.
 Identities = 99/175 (57%), Positives = 126/175 (72%), Gaps = 1/175 (1%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  IE IYVA+QT  YS +LY MIG+ WK+ KFL+FYYF+F  F YFT+ GMM+VALTP 
Sbjct  1252  QVAIETIYVAIQTFMYSCILYSMIGYTWKVEKFLYFYYFVFMCFTYFTMNGMMMVALTPN  1311

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
              Q AAI  +F   FWNLF+GF++ R  +PVWWRWYYW SP  W++YG++ SQ GD ++ +
Sbjct  1312  HQIAAIVSSFFTNFWNLFSGFLIARPLIPVWWRWYYWGSPIAWTIYGIMASQFGDIKTFI  1371

Query  1046  QVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
               P EG   +  +LK   GY++ F+  V  AH+GW LLFFFVFAYGI FLNFQ+R
Sbjct  1372  DTP-EGSQRVDLYLKKNLGYEHDFVVPVFFAHIGWVLLFFFVFAYGIKFLNFQKR  1425



>ref|XP_006349092.1| PREDICTED: pleiotropic drug resistance protein 2-like [Solanum 
tuberosum]
Length=1463

 Score =   290 bits (742),  Expect(2) = 2e-135, Method: Compositional matrix adjust.
 Identities = 129/181 (71%), Positives = 157/181 (87%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              +A+ GV KI+   NPATWML+++++ +EA+  VDFAE+YA S L+QRNQ LIKELSTP 
Sbjct  1109  FEAIRGVTKIRECDNPATWMLDVTSSSMEAKLDVDFAEVYAKSDLYQRNQLLIKELSTPA  1168

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             P S+DLYFPT+YSQSF+ QCKACFWKQHWSYWRN QYNA+RFF+T+++G+MFGVIFW KG
Sbjct  1169  PRSEDLYFPTQYSQSFITQCKACFWKQHWSYWRNSQYNAIRFFMTVIIGIMFGVIFWDKG  1228

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
             ++I+ QQDLLNLLGA YAAV+FLG+ N S+VQ+ VAVERTVFYRERAAGMYS LPYA AQ
Sbjct  1229  NKIYRQQDLLNLLGATYAAVMFLGATNASAVQSVVAVERTVFYRERAAGMYSELPYAFAQ  1288

Query  624   V  626
             V
Sbjct  1289  V  1289


 Score =   222 bits (566),  Expect(2) = 2e-135, Method: Compositional matrix adjust.
 Identities = 110/176 (63%), Positives = 136/176 (77%), Gaps = 1/176 (1%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  IE IYVAVQT  YSLLL+ MIG+EW   KF +FYYF+F  F YF++YGMM+VALTPG
Sbjct  1288  QVAIETIYVAVQTFIYSLLLFSMIGYEWTPAKFFYFYYFIFMCFTYFSMYGMMVVALTPG  1347

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
              Q AAI M+F L+FWNLF+GF++PR  +PVWWRWYYW SP  W++YG+  SQ+GD+   +
Sbjct  1348  YQIAAIVMSFFLSFWNLFSGFLVPRPLIPVWWRWYYWGSPVAWTIYGIFASQVGDRTDEL  1407

Query  1046  QVPGEG-DMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
             ++PGE   M + QFLK++ GYD+ FL AV  AHVGW LLFFFVFAYGI FLN Q+R
Sbjct  1408  EIPGETVKMQVNQFLKEYLGYDHDFLVAVVFAHVGWVLLFFFVFAYGIKFLNHQKR  1463



>ref|XP_009626402.1| PREDICTED: pleiotropic drug resistance protein 2 [Nicotiana tomentosiformis]
Length=1460

 Score =   299 bits (766),  Expect(2) = 2e-135, Method: Compositional matrix adjust.
 Identities = 132/181 (73%), Positives = 159/181 (88%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              +A+PGVPKI+   NPATWML++S++ +EAQ  VDFAE+YANS LHQRNQ LIKELSTP 
Sbjct  1106  FEAIPGVPKIRESDNPATWMLDVSSSSMEAQLVVDFAEVYANSNLHQRNQLLIKELSTPA  1165

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
               S+DLYFPT+YSQSF+ QCKACFWKQHWSYWRN QYNA+RFF+T+++G++FGVIFW +G
Sbjct  1166  TCSKDLYFPTQYSQSFITQCKACFWKQHWSYWRNSQYNAIRFFMTVIIGILFGVIFWNQG  1225

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
             ++IH QQDLLNLLGA YAAV+FLG+ N S+VQ+ VA+ERTVFYRERAAGMYS LPYA AQ
Sbjct  1226  NQIHRQQDLLNLLGATYAAVMFLGATNASAVQSVVAIERTVFYRERAAGMYSELPYAFAQ  1285

Query  624   V  626
             V
Sbjct  1286  V  1286


 Score =   213 bits (541),  Expect(2) = 2e-135, Method: Compositional matrix adjust.
 Identities = 105/176 (60%), Positives = 135/176 (77%), Gaps = 1/176 (1%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  IE +YVA+QT  YSLLL+ MIG++    KF +FYYF+F  F YF++YGMM+VALTPG
Sbjct  1285  QVAIETVYVAIQTFIYSLLLFSMIGYQRTAEKFFYFYYFIFMCFTYFSMYGMMVVALTPG  1344

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
              Q AAI M+F L+FWNLF+GF++PR  +PVWWRWYYWASP  W++YG+  SQ+GD+   +
Sbjct  1345  YQIAAIVMSFFLSFWNLFSGFLIPRPLIPVWWRWYYWASPVAWTIYGIFASQVGDRTDEL  1404

Query  1046  QVPGEGD-MTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
             ++ GE + M + QFLK++ GYD+ FL  V  AHVGW LLFFFVFAYGI FLN Q+R
Sbjct  1405  ELTGETEKMQVNQFLKEYLGYDHDFLVVVVFAHVGWVLLFFFVFAYGIKFLNHQKR  1460



>sp|Q2PCF1.1|PDR2_NICPL RecName: Full=Pleiotropic drug resistance protein 2; AltName: 
Full=NpPDR2 [Nicotiana plumbaginifolia]
 emb|CAH40786.1| PDR-like ABC transporter [Nicotiana plumbaginifolia]
Length=1461

 Score =   297 bits (760),  Expect(2) = 2e-135, Method: Compositional matrix adjust.
 Identities = 131/181 (72%), Positives = 158/181 (87%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              + +PGVPKI+   NPATWML++S++ +EAQ  VDFAE+YANS L+QRNQ LIKELSTP 
Sbjct  1107  FETIPGVPKIRESDNPATWMLDVSSSSMEAQLVVDFAEVYANSNLYQRNQLLIKELSTPA  1166

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
               S+DLYFPT+YSQSF+ QCKACFWKQHWSYWRN QYNA+RFF+T+++G++FGVIFW KG
Sbjct  1167  TCSKDLYFPTQYSQSFITQCKACFWKQHWSYWRNSQYNAIRFFMTVIIGILFGVIFWNKG  1226

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
             ++IH QQDLLNLLGA YAAV+FLG+ N S+VQ+ VA+ERTVFYRERAAGMYS LPYA AQ
Sbjct  1227  NQIHRQQDLLNLLGATYAAVMFLGATNASAVQSVVAIERTVFYRERAAGMYSELPYAFAQ  1286

Query  624   V  626
             V
Sbjct  1287  V  1287


 Score =   214 bits (546),  Expect(2) = 2e-135, Method: Compositional matrix adjust.
 Identities = 105/176 (60%), Positives = 137/176 (78%), Gaps = 1/176 (1%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  IE IYVA+QT  YSLLL+ MIG++W   KF +FYYF+F  F YF++YGMM+VALTPG
Sbjct  1286  QVAIETIYVAIQTFVYSLLLFSMIGYQWTAVKFFYFYYFIFMCFTYFSMYGMMVVALTPG  1345

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
              Q AAI M+F L+FWNLF+GF++PR  +PVWWRWYYWASP  W++YG+  SQ+GD+   +
Sbjct  1346  YQIAAIVMSFFLSFWNLFSGFLIPRPLIPVWWRWYYWASPVAWTIYGIFASQVGDRTDEL  1405

Query  1046  QVPGEGD-MTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
             ++ GE + + + +FLK++ GYD+ FL  V  AHVGW LLFFFVFAYGI FLN+Q+R
Sbjct  1406  ELTGETEKIQVNEFLKEYLGYDHDFLLVVVFAHVGWVLLFFFVFAYGIKFLNYQKR  1461



>ref|XP_003625773.1| ABC transporter G family member [Medicago truncatula]
Length=1455

 Score =   271 bits (692),  Expect(2) = 3e-135, Method: Compositional matrix adjust.
 Identities = 123/181 (68%), Positives = 147/181 (81%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              + +PGV KIK+GYNPATWMLE+S+A IEAQ  VDFAEIY  S L+QRNQELI EL+TP 
Sbjct  1102  FEVIPGVQKIKDGYNPATWMLEVSSASIEAQLEVDFAEIYKTSTLYQRNQELINELNTPA  1161

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             P S DLYFPTKYSQSF  QCKA FWKQH SYWR+ QYNAVRF +TI++GV+FG+IFW + 
Sbjct  1162  PDSNDLYFPTKYSQSFFVQCKANFWKQHLSYWRHSQYNAVRFLMTIIIGVLFGLIFWKQA  1221

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
              +   QQDLLNLLGA+Y+ V FLG+ N+ +VQ  V++ RT+FYRERAAGMYSALPYA  Q
Sbjct  1222  KKTKTQQDLLNLLGAMYSTVFFLGTTNSMTVQPVVSIARTIFYRERAAGMYSALPYAFGQ  1281

Query  624   V  626
             +
Sbjct  1282  M  1282


 Score =   241 bits (614),  Expect(2) = 3e-135, Method: Compositional matrix adjust.
 Identities = 107/175 (61%), Positives = 136/175 (78%), Gaps = 0/175 (0%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  +E IY A+QT  Y+L++Y MIGFEWK   FLWF+Y++  SFIYFT YGMM+V+LTP 
Sbjct  1281  QMAVETIYNAIQTTIYALIVYSMIGFEWKAANFLWFFYYILMSFIYFTFYGMMVVSLTPD  1340

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
                A I M F L+FWNLF+GF++PR ++P+WWRWYYWASP  W+LYGLITSQLGDK + +
Sbjct  1341  DVIAGICMFFFLSFWNLFSGFVIPRMEIPIWWRWYYWASPVAWTLYGLITSQLGDKNTEI  1400

Query  1046  QVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
              +PG G M +K+FLK  +GYD+ FLP V  AH+GW LLF FVFA+GI F+NFQ+R
Sbjct  1401  VIPGVGSMELKEFLKQNWGYDHDFLPLVVVAHLGWVLLFAFVFAFGIKFINFQKR  1455



>gb|AES81991.2| drug resistance transporter-like ABC domain protein [Medicago 
truncatula]
Length=1449

 Score =   271 bits (692),  Expect(2) = 3e-135, Method: Compositional matrix adjust.
 Identities = 123/181 (68%), Positives = 147/181 (81%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              + +PGV KIK+GYNPATWMLE+S+A IEAQ  VDFAEIY  S L+QRNQELI EL+TP 
Sbjct  1096  FEVIPGVQKIKDGYNPATWMLEVSSASIEAQLEVDFAEIYKTSTLYQRNQELINELNTPA  1155

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             P S DLYFPTKYSQSF  QCKA FWKQH SYWR+ QYNAVRF +TI++GV+FG+IFW + 
Sbjct  1156  PDSNDLYFPTKYSQSFFVQCKANFWKQHLSYWRHSQYNAVRFLMTIIIGVLFGLIFWKQA  1215

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
              +   QQDLLNLLGA+Y+ V FLG+ N+ +VQ  V++ RT+FYRERAAGMYSALPYA  Q
Sbjct  1216  KKTKTQQDLLNLLGAMYSTVFFLGTTNSMTVQPVVSIARTIFYRERAAGMYSALPYAFGQ  1275

Query  624   V  626
             +
Sbjct  1276  M  1276


 Score =   241 bits (614),  Expect(2) = 3e-135, Method: Compositional matrix adjust.
 Identities = 107/175 (61%), Positives = 136/175 (78%), Gaps = 0/175 (0%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  +E IY A+QT  Y+L++Y MIGFEWK   FLWF+Y++  SFIYFT YGMM+V+LTP 
Sbjct  1275  QMAVETIYNAIQTTIYALIVYSMIGFEWKAANFLWFFYYILMSFIYFTFYGMMVVSLTPD  1334

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
                A I M F L+FWNLF+GF++PR ++P+WWRWYYWASP  W+LYGLITSQLGDK + +
Sbjct  1335  DVIAGICMFFFLSFWNLFSGFVIPRMEIPIWWRWYYWASPVAWTLYGLITSQLGDKNTEI  1394

Query  1046  QVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
              +PG G M +K+FLK  +GYD+ FLP V  AH+GW LLF FVFA+GI F+NFQ+R
Sbjct  1395  VIPGVGSMELKEFLKQNWGYDHDFLPLVVVAHLGWVLLFAFVFAFGIKFINFQKR  1449



>ref|XP_003625777.1| Pleiotropic drug resistance protein [Medicago truncatula]
Length=1699

 Score =   266 bits (679),  Expect(2) = 3e-135, Method: Compositional matrix adjust.
 Identities = 124/181 (69%), Positives = 150/181 (83%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              +A+ GV KIK+GYNPATWMLE+S+A +EAQ  +DFAEIYANS L+QRNQELIKELSTP 
Sbjct  1346  FEAIAGVQKIKDGYNPATWMLEVSSASVEAQLDIDFAEIYANSNLYQRNQELIKELSTPA  1405

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             P S++LYFPTKYSQSF  Q KA FWKQ+ SYWR+ QYNAVRF +T+V+GV FG+IFW +G
Sbjct  1406  PNSKELYFPTKYSQSFFVQYKANFWKQNLSYWRHSQYNAVRFLMTLVIGVSFGLIFWQQG  1465

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
                  QQDLLNLLGA+Y AV++LG +N+S+VQ  V++ RTVFYRERAAGMYSAL YA  Q
Sbjct  1466  KNTKKQQDLLNLLGAMYCAVLYLGFMNSSTVQPVVSIARTVFYRERAAGMYSALSYAFGQ  1525

Query  624   V  626
             +
Sbjct  1526  M  1526


 Score =   245 bits (626),  Expect(2) = 3e-135, Method: Compositional matrix adjust.
 Identities = 107/175 (61%), Positives = 136/175 (78%), Gaps = 0/175 (0%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  +E IY AVQT  Y+L+LY MIGFEWK   FLWFYY++F SF+YF L+GMM  ALTP 
Sbjct  1525  QMAVETIYNAVQTTIYTLILYSMIGFEWKAANFLWFYYYIFMSFMYFKLFGMMFAALTPS  1584

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
             ++ AAI+  F +T WNLF+GF++P+ Q+P+WWRWYYWASP  W+LYG+ITSQLGDK + +
Sbjct  1585  LEVAAISTTFFMTLWNLFSGFLIPKTQIPIWWRWYYWASPIAWTLYGIITSQLGDKNTEI  1644

Query  1046  QVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
              +PG G M +K+FLK   GY++ FLP VA AH+GW LLF FVFA+ I FLNFQ+R
Sbjct  1645  VIPGAGSMELKEFLKQNLGYNHNFLPQVAVAHLGWVLLFAFVFAFSIKFLNFQKR  1699



>ref|XP_010516859.1| PREDICTED: ABC transporter G family member 34-like [Camelina 
sativa]
Length=1450

 Score =   273 bits (699),  Expect(2) = 4e-135, Method: Compositional matrix adjust.
 Identities = 121/181 (67%), Positives = 152/181 (84%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              + + GVPKIK+GYNPATWML++ST  +E+Q  VDFA+I+ANS L+QRNQELIKELSTPP
Sbjct  1097  FEGIEGVPKIKDGYNPATWMLDVSTPSMESQMNVDFAQIFANSSLNQRNQELIKELSTPP  1156

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             PGS DLYF TKY+Q F  Q KACFWKQ+WS WR PQYNA+RF +TIV+GV+FG+IFW  G
Sbjct  1157  PGSNDLYFQTKYAQPFGTQMKACFWKQYWSNWRYPQYNAIRFLMTIVIGVLFGLIFWQTG  1216

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
              ++  +QDL N  GA+YAAV+FLG+ N ++VQ  +A+ERTVFYRE+AAGMYSA+PYA++Q
Sbjct  1217  TKLEKEQDLNNFFGAMYAAVLFLGATNAATVQPAIAIERTVFYREKAAGMYSAIPYAISQ  1276

Query  624   V  626
             V
Sbjct  1277  V  1277


 Score =   237 bits (605),  Expect(2) = 4e-135, Method: Compositional matrix adjust.
 Identities = 107/177 (60%), Positives = 136/177 (77%), Gaps = 0/177 (0%)
 Frame = +2

Query  680   ILQAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALT  859
             I Q  +E +Y  VQT  Y+L+LY MIG++W + KF WFYY+M TSFIYFTLYGMMLVALT
Sbjct  1274  ISQVAVEIMYNTVQTALYTLILYSMIGYDWTVVKFFWFYYYMLTSFIYFTLYGMMLVALT  1333

Query  860   PGVQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKES  1039
             P  Q A I M+F L+FWNLF+GF++ R  +P+WWRWYYWASP  W+LYG+ITSQ+GD +S
Sbjct  1334  PNYQIAGICMSFFLSFWNLFSGFLIARPLIPIWWRWYYWASPVAWTLYGIITSQVGDTDS  1393

Query  1040  RVQVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
              V + G GD ++K  LKD FG+++ FLP VA  H+ W L+F F+FAYGI FLNFQ+R
Sbjct  1394  IVHITGVGDTSLKTLLKDGFGFEHDFLPVVAVVHIAWILVFLFLFAYGIKFLNFQKR  1450



>gb|AES81995.2| drug resistance transporter-like ABC domain protein [Medicago 
truncatula]
Length=1457

 Score =   266 bits (679),  Expect(2) = 5e-135, Method: Compositional matrix adjust.
 Identities = 124/181 (69%), Positives = 150/181 (83%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              +A+ GV KIK+GYNPATWMLE+S+A +EAQ  +DFAEIYANS L+QRNQELIKELSTP 
Sbjct  1104  FEAIAGVQKIKDGYNPATWMLEVSSASVEAQLDIDFAEIYANSNLYQRNQELIKELSTPA  1163

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             P S++LYFPTKYSQSF  Q KA FWKQ+ SYWR+ QYNAVRF +T+V+GV FG+IFW +G
Sbjct  1164  PNSKELYFPTKYSQSFFVQYKANFWKQNLSYWRHSQYNAVRFLMTLVIGVSFGLIFWQQG  1223

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
                  QQDLLNLLGA+Y AV++LG +N+S+VQ  V++ RTVFYRERAAGMYSAL YA  Q
Sbjct  1224  KNTKKQQDLLNLLGAMYCAVLYLGFMNSSTVQPVVSIARTVFYRERAAGMYSALSYAFGQ  1283

Query  624   V  626
             +
Sbjct  1284  M  1284


 Score =   244 bits (624),  Expect(2) = 5e-135, Method: Compositional matrix adjust.
 Identities = 107/175 (61%), Positives = 136/175 (78%), Gaps = 0/175 (0%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  +E IY AVQT  Y+L+LY MIGFEWK   FLWFYY++F SF+YF L+GMM  ALTP 
Sbjct  1283  QMAVETIYNAVQTTIYTLILYSMIGFEWKAANFLWFYYYIFMSFMYFKLFGMMFAALTPS  1342

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
             ++ AAI+  F +T WNLF+GF++P+ Q+P+WWRWYYWASP  W+LYG+ITSQLGDK + +
Sbjct  1343  LEVAAISTTFFMTLWNLFSGFLIPKTQIPIWWRWYYWASPIAWTLYGIITSQLGDKNTEI  1402

Query  1046  QVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
              +PG G M +K+FLK   GY++ FLP VA AH+GW LLF FVFA+ I FLNFQ+R
Sbjct  1403  VIPGAGSMELKEFLKQNLGYNHNFLPQVAVAHLGWVLLFAFVFAFSIKFLNFQKR  1457



>emb|CAN80610.1| hypothetical protein VITISV_042903 [Vitis vinifera]
Length=1357

 Score =   296 bits (759),  Expect(2) = 7e-135, Method: Compositional matrix adjust.
 Identities = 132/181 (73%), Positives = 159/181 (88%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              ++VPGV KIK GYNPATWMLE+ST+ +EAQ  +DFAE++ANS L++RNQ+LI ELSTP 
Sbjct  1004  FESVPGVTKIKEGYNPATWMLEVSTSAVEAQLDIDFAEVFANSALYRRNQDLINELSTPA  1063

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             PGS+DLYFPT+YSQSFV QC ACFWKQ +SYWRN +YNA+RFF+TIV+GV+FGVIFW KG
Sbjct  1064  PGSKDLYFPTQYSQSFVTQCXACFWKQRYSYWRNSEYNAIRFFMTIVIGVLFGVIFWSKG  1123

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
             D+IH QQ+L+NLLGA YAA++FLG+ N ++VQ  VAVERTVFYRERAAGMYS LPYA AQ
Sbjct  1124  DQIHKQQELINLLGATYAAILFLGASNATAVQPVVAVERTVFYRERAAGMYSELPYAFAQ  1183

Query  624   V  626
             V
Sbjct  1184  V  1184


 Score =   214 bits (544),  Expect(2) = 7e-135, Method: Compositional matrix adjust.
 Identities = 104/175 (59%), Positives = 132/175 (75%), Gaps = 0/175 (0%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  IE IYVA+QT+ Y LLLY MIGF+WK+ KF +FYYF+F  F YF+LYGMM+VALTPG
Sbjct  1183  QVAIETIYVAIQTLVYVLLLYSMIGFQWKVDKFFYFYYFIFMCFTYFSLYGMMVVALTPG  1242

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
              Q AAI  +F   FWNLF+GF++PR  +P+WWRWYYWASP  W++YG+  SQ+GD  + +
Sbjct  1243  HQIAAIVSSFFFNFWNLFSGFLIPRPLIPIWWRWYYWASPVAWTIYGIFASQVGDITTDL  1302

Query  1046  QVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
             ++ G   M + +F+K+  G+D+ FL  V  AHVGW  LFFFVFAYGI FLNFQRR
Sbjct  1303  EITGSSPMPVNEFIKENLGFDHDFLVPVVFAHVGWVFLFFFVFAYGIKFLNFQRR  1357



>ref|XP_010505184.1| PREDICTED: ABC transporter G family member 34 [Camelina sativa]
Length=1450

 Score =   274 bits (701),  Expect(2) = 7e-135, Method: Compositional matrix adjust.
 Identities = 122/181 (67%), Positives = 152/181 (84%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              + + GVPKIK+GYNPATWML++ST  +E+Q  VDFA+I+ANS L+QRNQELIKELSTPP
Sbjct  1097  FEGIEGVPKIKDGYNPATWMLDVSTPSMESQMSVDFAQIFANSSLNQRNQELIKELSTPP  1156

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             PGS DLYF TKY+Q F  Q KACFWKQ+WS WR PQYNA+RF +TIV+GV+FG+IFW  G
Sbjct  1157  PGSNDLYFQTKYAQPFGTQVKACFWKQYWSNWRYPQYNAIRFLMTIVIGVLFGLIFWQTG  1216

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
              ++  +QDL N  GA+YAAV+FLG+ N ++VQ  +AVERTVFYRE+AAGMYSA+PYA++Q
Sbjct  1217  TKLKKEQDLNNFFGAMYAAVLFLGATNAATVQPAIAVERTVFYREKAAGMYSAIPYAISQ  1276

Query  624   V  626
             V
Sbjct  1277  V  1277


 Score =   236 bits (601),  Expect(2) = 7e-135, Method: Compositional matrix adjust.
 Identities = 107/177 (60%), Positives = 136/177 (77%), Gaps = 0/177 (0%)
 Frame = +2

Query  680   ILQAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALT  859
             I Q  +E +Y  VQT  YSL+LY MIG++W + KF WF+Y+M TSFIYFTLYGMMLVALT
Sbjct  1274  ISQVAVEIMYNTVQTGLYSLILYSMIGYDWTVVKFFWFFYYMLTSFIYFTLYGMMLVALT  1333

Query  860   PGVQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKES  1039
             P  Q A I M+F L+FWNLF+GF++ R  +P+WWRWYYWASP  W+LYG+ITSQ+GD +S
Sbjct  1334  PNYQIAGICMSFFLSFWNLFSGFLIARPLIPIWWRWYYWASPVAWTLYGIITSQVGDSDS  1393

Query  1040  RVQVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
              V + G GD ++K  LKD FG+++ FLP VA  H+ W L+F F+FAYGI FLNFQ+R
Sbjct  1394  IVHITGVGDTSLKTLLKDGFGFEHDFLPVVAVVHIAWILVFLFLFAYGIKFLNFQKR  1450



>ref|XP_009133080.1| PREDICTED: ABC transporter G family member 34-like isoform X2 
[Brassica rapa]
Length=1426

 Score =   268 bits (686),  Expect(2) = 7e-135, Method: Compositional matrix adjust.
 Identities = 118/181 (65%), Positives = 150/181 (83%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              +AV GVPKIK+GYNPATWML+++T  +E+Q  +DFA+I+ NS L++RNQELIKELSTPP
Sbjct  1073  FEAVEGVPKIKDGYNPATWMLDVTTPSMESQMSLDFAQIFTNSSLYRRNQELIKELSTPP  1132

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             PGS DLYFPTKYSQ F  Q KAC WKQ+WS WR PQYN++RF +TI  GV+FG+IFW  G
Sbjct  1133  PGSNDLYFPTKYSQPFWTQTKACLWKQYWSNWRFPQYNSIRFLMTIAFGVLFGLIFWQTG  1192

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
              +I  +QDL N  GA+YAAV+FLG+ N ++VQ  +A+ERTVFYRE+AAGMYSA+PYA+++
Sbjct  1193  TKIEKEQDLNNFFGAMYAAVLFLGATNAAAVQPVIAIERTVFYREKAAGMYSAIPYAISK  1252

Query  624   V  626
             V
Sbjct  1253  V  1253


 Score =   241 bits (616),  Expect(2) = 7e-135, Method: Compositional matrix adjust.
 Identities = 107/177 (60%), Positives = 139/177 (79%), Gaps = 0/177 (0%)
 Frame = +2

Query  680   ILQAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALT  859
             I +  +E +Y  +QT  Y+L+LY MIG++W + KF WFYY+M TSFIYFTLYGMML+ALT
Sbjct  1250  ISKVAVEIMYNTIQTGVYTLILYSMIGYDWTVTKFFWFYYYMLTSFIYFTLYGMMLMALT  1309

Query  860   PGVQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKES  1039
                Q A I M+F +  WNLF+GF++PR Q+P+WWRWYYWA+P  W+LYG+ITSQ+GDK+S
Sbjct  1310  TNPQIAGICMSFFVVLWNLFSGFLIPRPQIPIWWRWYYWATPVAWTLYGIITSQVGDKDS  1369

Query  1040  RVQVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
              VQ+ G GDM++K  LK+ FG+++ FLP VAA H+ W LLF FVFAYGI F+NFQRR
Sbjct  1370  IVQITGVGDMSLKTLLKNGFGFEHDFLPVVAAVHIAWILLFAFVFAYGIKFINFQRR  1426



>ref|XP_009133078.1| PREDICTED: ABC transporter G family member 34-like isoform X1 
[Brassica rapa]
Length=1449

 Score =   268 bits (686),  Expect(2) = 8e-135, Method: Compositional matrix adjust.
 Identities = 118/181 (65%), Positives = 150/181 (83%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              +AV GVPKIK+GYNPATWML+++T  +E+Q  +DFA+I+ NS L++RNQELIKELSTPP
Sbjct  1096  FEAVEGVPKIKDGYNPATWMLDVTTPSMESQMSLDFAQIFTNSSLYRRNQELIKELSTPP  1155

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             PGS DLYFPTKYSQ F  Q KAC WKQ+WS WR PQYN++RF +TI  GV+FG+IFW  G
Sbjct  1156  PGSNDLYFPTKYSQPFWTQTKACLWKQYWSNWRFPQYNSIRFLMTIAFGVLFGLIFWQTG  1215

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
              +I  +QDL N  GA+YAAV+FLG+ N ++VQ  +A+ERTVFYRE+AAGMYSA+PYA+++
Sbjct  1216  TKIEKEQDLNNFFGAMYAAVLFLGATNAAAVQPVIAIERTVFYREKAAGMYSAIPYAISK  1275

Query  624   V  626
             V
Sbjct  1276  V  1276


 Score =   241 bits (616),  Expect(2) = 8e-135, Method: Compositional matrix adjust.
 Identities = 107/177 (60%), Positives = 139/177 (79%), Gaps = 0/177 (0%)
 Frame = +2

Query  680   ILQAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALT  859
             I +  +E +Y  +QT  Y+L+LY MIG++W + KF WFYY+M TSFIYFTLYGMML+ALT
Sbjct  1273  ISKVAVEIMYNTIQTGVYTLILYSMIGYDWTVTKFFWFYYYMLTSFIYFTLYGMMLMALT  1332

Query  860   PGVQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKES  1039
                Q A I M+F +  WNLF+GF++PR Q+P+WWRWYYWA+P  W+LYG+ITSQ+GDK+S
Sbjct  1333  TNPQIAGICMSFFVVLWNLFSGFLIPRPQIPIWWRWYYWATPVAWTLYGIITSQVGDKDS  1392

Query  1040  RVQVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
              VQ+ G GDM++K  LK+ FG+++ FLP VAA H+ W LLF FVFAYGI F+NFQRR
Sbjct  1393  IVQITGVGDMSLKTLLKNGFGFEHDFLPVVAAVHIAWILLFAFVFAYGIKFINFQRR  1449



>ref|XP_006361492.1| PREDICTED: pleiotropic drug resistance protein 2-like [Solanum 
tuberosum]
Length=1452

 Score =   293 bits (751),  Expect(2) = 8e-135, Method: Compositional matrix adjust.
 Identities = 130/182 (71%), Positives = 159/182 (87%), Gaps = 0/182 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              Q+VPGVP+IK G NPATWML++S   +EAQ  VDFA+IYANS L++RNQELIKELS P 
Sbjct  1099  FQSVPGVPEIKEGINPATWMLDVSATAVEAQLQVDFADIYANSELYRRNQELIKELSVPT  1158

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             PGSQDL+FPTK+SQ F EQCKACFWKQH SYWR+PQYNA+RF +T ++GV+FG+IFW KG
Sbjct  1159  PGSQDLHFPTKFSQPFFEQCKACFWKQHLSYWRHPQYNAIRFAMTTMIGVIFGIIFWDKG  1218

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
             +++  QQDLLN++GAIYAAV+FLG  NTS+VQ+ VA+ERTVFYRE+AAGM+SALPYA AQ
Sbjct  1219  NQLSKQQDLLNIIGAIYAAVMFLGGTNTSAVQSVVAIERTVFYREKAAGMFSALPYAFAQ  1278

Query  624   VI  629
             V+
Sbjct  1279  VV  1280


 Score =   216 bits (551),  Expect(2) = 8e-135, Method: Compositional matrix adjust.
 Identities = 103/175 (59%), Positives = 138/175 (79%), Gaps = 0/175 (0%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  IE IY+A+QT  YSL+L+ MIGF++  GKF  FY+F+F  F+YFT+YGMMLVALTP 
Sbjct  1278  QVVIETIYIAIQTFIYSLILFAMIGFQFTAGKFFLFYFFVFMCFVYFTMYGMMLVALTPN  1337

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
                AAI M+F L+FWNLF+GFI+ R Q+P+WWRWYYW SP  W++YGL+TSQ+GDK + +
Sbjct  1338  YHIAAIVMSFFLSFWNLFSGFIISRTQIPIWWRWYYWGSPVAWTIYGLVTSQVGDKSNLI  1397

Query  1046  QVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
             ++PG G++++K +LK+ +G++Y FL  VAA HV W++ F FVFAY I FLNFQRR
Sbjct  1398  EIPGGGEVSLKLYLKESYGFEYDFLGVVAAMHVVWAVFFCFVFAYAIKFLNFQRR  1452



>ref|XP_010926683.1| PREDICTED: pleiotropic drug resistance protein 2-like [Elaeis 
guineensis]
Length=1471

 Score =   289 bits (740),  Expect(2) = 1e-134, Method: Compositional matrix adjust.
 Identities = 131/181 (72%), Positives = 150/181 (83%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              +A+PGVPKI  GYNPATWMLE+S   +EA+  VDFAEIY+ S L+QRNQELIKELS P 
Sbjct  1118  FEAIPGVPKITEGYNPATWMLEVSAPSVEARMNVDFAEIYSRSSLYQRNQELIKELSIPA  1177

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             P S DL FPTKYSQSF+ QC ACFWKQHWSYWRNPQYNA+RFF+T+++G++FG IFW KG
Sbjct  1178  PSSMDLSFPTKYSQSFITQCMACFWKQHWSYWRNPQYNAIRFFMTLIIGLLFGTIFWKKG  1237

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
              +  NQQDLLNLLGAIYAAV FLG+   ++VQ  VAVERTVFYRERAAGMYS L YA AQ
Sbjct  1238  KKTSNQQDLLNLLGAIYAAVFFLGASVATTVQPVVAVERTVFYRERAAGMYSPLSYAFAQ  1297

Query  624   V  626
             V
Sbjct  1298  V  1298


 Score =   220 bits (561),  Expect(2) = 1e-134, Method: Compositional matrix adjust.
 Identities = 100/175 (57%), Positives = 128/175 (73%), Gaps = 0/175 (0%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  IE +Y+A Q++ Y+LLL+ MIGF W+   F WF YF+F  FIYF LYGMM+VALTP 
Sbjct  1297  QVSIEIVYIAAQSLMYTLLLFSMIGFTWRADNFFWFLYFVFMCFIYFVLYGMMIVALTPN  1356

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
              + A I  +F +TFWNLFAGF++ R  +PVWWRWYYWASP  W++YG++ SQLGDKE+ V
Sbjct  1357  HKIAGIVTSFFITFWNLFAGFLIFRPLIPVWWRWYYWASPVAWTIYGVVASQLGDKENLV  1416

Query  1046  QVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
             ++PGE   T+K +L D  GY + FL  VA AH G+ L+FF VF Y I FLNFQ+R
Sbjct  1417  EIPGEASSTVKAYLNDKLGYKHSFLGYVALAHAGFVLVFFLVFGYSIKFLNFQKR  1471



>emb|CDX79673.1| BnaC03g20090D [Brassica napus]
Length=1221

 Score =   265 bits (676),  Expect(2) = 1e-134, Method: Compositional matrix adjust.
 Identities = 117/181 (65%), Positives = 148/181 (82%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              +AV GVPKI +GYNPATWML+++T  +E+Q  +DFA+I+ NS L+ RNQELIKELSTPP
Sbjct  868   FEAVEGVPKINDGYNPATWMLDVTTPSMESQMSLDFAQIFTNSSLYPRNQELIKELSTPP  927

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             PGS DLYFPTKYSQ F  Q KAC WKQ+WS WR PQYN++RF +TI  GV+FG+IFW  G
Sbjct  928   PGSNDLYFPTKYSQPFWTQTKACLWKQYWSNWRFPQYNSIRFLMTIAFGVLFGLIFWQTG  987

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
              +I  +QDL N  GA+YAAV+FLG+ N ++VQ  +A+ERTVFYRE+AAGMYSA+PYA+++
Sbjct  988   TKIEKEQDLNNFFGAMYAAVLFLGATNAAAVQPVIAIERTVFYREKAAGMYSAIPYAISK  1047

Query  624   V  626
             V
Sbjct  1048  V  1048


 Score =   244 bits (624),  Expect(2) = 1e-134, Method: Compositional matrix adjust.
 Identities = 109/177 (62%), Positives = 140/177 (79%), Gaps = 0/177 (0%)
 Frame = +2

Query  680   ILQAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALT  859
             I +  +E +Y  +QT  Y+L+LY MIG++W + KF WFYY+M TSFIYFTLYGMML+ALT
Sbjct  1045  ISKVAVEIMYNTIQTGVYTLILYSMIGYDWTVTKFFWFYYYMLTSFIYFTLYGMMLMALT  1104

Query  860   PGVQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKES  1039
             P  Q A I M+F +  WNLF+GF++PR Q+P+WWRWYYWA+P  W+LYG+ITSQ+GDK+S
Sbjct  1105  PNPQIAGICMSFFVVLWNLFSGFLIPRPQIPIWWRWYYWATPVAWTLYGIITSQVGDKDS  1164

Query  1040  RVQVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
              VQ+ G GDM++K  LK+ FG+++ FLP VAA H+ W LLF FVFAYGI FLNFQRR
Sbjct  1165  IVQITGVGDMSLKTLLKNGFGFEHDFLPVVAAVHIAWILLFAFVFAYGIKFLNFQRR  1221



>gb|KCW50779.1| hypothetical protein EUGRSUZ_J00450 [Eucalyptus grandis]
Length=1448

 Score =   283 bits (725),  Expect(2) = 1e-134, Method: Compositional matrix adjust.
 Identities = 125/181 (69%), Positives = 153/181 (85%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              +AVPGVPKI  GYNPATWML+++   +EA+  VDFAEIYANS L++RNQELIKELS+P 
Sbjct  1071  FEAVPGVPKIHEGYNPATWMLDVTATSVEAKLDVDFAEIYANSDLYRRNQELIKELSSPQ  1130

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             PGS+DLYFPT+Y Q F  QC+ACFWKQ+WSYWRN QYNA+RF +TIV+G+MFG IFW KG
Sbjct  1131  PGSKDLYFPTQYCQGFQTQCRACFWKQNWSYWRNSQYNAIRFVMTIVIGLMFGFIFWSKG  1190

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
             D+I  Q+DL+NLLGA Y+AV+FLG+ N ++VQ+ VA+ERTV YRERAAGMYS + YA AQ
Sbjct  1191  DKIKKQEDLINLLGATYSAVVFLGATNATAVQSVVAIERTVSYRERAAGMYSGMAYAFAQ  1250

Query  624   V  626
             V
Sbjct  1251  V  1251


 Score =   225 bits (574),  Expect(2) = 1e-134, Method: Compositional matrix adjust.
 Identities = 106/188 (56%), Positives = 137/188 (73%), Gaps = 2/188 (1%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  IE IYVA+QT+ YS++LY MIGFEWKL K L+FYYF+F  + YF+++GMM+ ALTPG
Sbjct  1250  QVAIETIYVAIQTVIYSVILYSMIGFEWKLSKVLYFYYFIFMCYTYFSMFGMMVAALTPG  1309

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
              Q AAI M+F L FWNLF+GF++PR  +PVWWRW YW SP  W++YG+ TSQ GDK + +
Sbjct  1310  HQIAAIVMSFFLNFWNLFSGFLIPRPLIPVWWRWNYWCSPVAWTIYGIFTSQFGDKNAPL  1369

Query  1046  QVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR*GWDA  1225
             ++ GE  + I  FLKD  G+DY FL  VA AH+GW L FF++FAYG+  LN  R+   DA
Sbjct  1370  EIYGENLLPINYFLKDSLGFDYDFLVPVACAHIGWVLGFFYIFAYGVKALN--RQGVVDA  1427

Query  1226  NLSLIPGF  1249
               S +P F
Sbjct  1428  GKSCLPDF  1435



>ref|XP_010034201.1| PREDICTED: pleiotropic drug resistance protein 2-like [Eucalyptus 
grandis]
Length=1471

 Score =   283 bits (725),  Expect(2) = 1e-134, Method: Compositional matrix adjust.
 Identities = 125/181 (69%), Positives = 153/181 (85%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              +AVPGVPKI  GYNPATWML+++   +EA+  VDFAEIYANS L++RNQELIKELS+P 
Sbjct  1094  FEAVPGVPKIHEGYNPATWMLDVTATSVEAKLDVDFAEIYANSDLYRRNQELIKELSSPQ  1153

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             PGS+DLYFPT+Y Q F  QC+ACFWKQ+WSYWRN QYNA+RF +TIV+G+MFG IFW KG
Sbjct  1154  PGSKDLYFPTQYCQGFQTQCRACFWKQNWSYWRNSQYNAIRFVMTIVIGLMFGFIFWSKG  1213

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
             D+I  Q+DL+NLLGA Y+AV+FLG+ N ++VQ+ VA+ERTV YRERAAGMYS + YA AQ
Sbjct  1214  DKIKKQEDLINLLGATYSAVVFLGATNATAVQSVVAIERTVSYRERAAGMYSGMAYAFAQ  1273

Query  624   V  626
             V
Sbjct  1274  V  1274


 Score =   225 bits (574),  Expect(2) = 1e-134, Method: Compositional matrix adjust.
 Identities = 106/188 (56%), Positives = 137/188 (73%), Gaps = 2/188 (1%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  IE IYVA+QT+ YS++LY MIGFEWKL K L+FYYF+F  + YF+++GMM+ ALTPG
Sbjct  1273  QVAIETIYVAIQTVIYSVILYSMIGFEWKLSKVLYFYYFIFMCYTYFSMFGMMVAALTPG  1332

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
              Q AAI M+F L FWNLF+GF++PR  +PVWWRW YW SP  W++YG+ TSQ GDK + +
Sbjct  1333  HQIAAIVMSFFLNFWNLFSGFLIPRPLIPVWWRWNYWCSPVAWTIYGIFTSQFGDKNAPL  1392

Query  1046  QVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR*GWDA  1225
             ++ GE  + I  FLKD  G+DY FL  VA AH+GW L FF++FAYG+  LN  R+   DA
Sbjct  1393  EIYGENLLPINYFLKDSLGFDYDFLVPVACAHIGWVLGFFYIFAYGVKALN--RQGVVDA  1450

Query  1226  NLSLIPGF  1249
               S +P F
Sbjct  1451  GKSCLPDF  1458



>ref|XP_007208139.1| hypothetical protein PRUPE_ppa000232mg [Prunus persica]
 gb|EMJ09338.1| hypothetical protein PRUPE_ppa000232mg [Prunus persica]
Length=1425

 Score =   298 bits (763),  Expect(2) = 1e-134, Method: Compositional matrix adjust.
 Identities = 129/181 (71%), Positives = 159/181 (88%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              +A+PGVPKIK GYNPATWML++S+A +EAQ  +DFAE+YANS L++RN+ELIK LS P 
Sbjct  1073  FEAIPGVPKIKEGYNPATWMLDVSSAAVEAQNNIDFAEVYANSELYRRNEELIKGLSIPL  1132

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             PGS DL+FPT++SQSF+ QCKACFWKQHWSYWRN +YNA+RFF+T V+G++FGVIFW KG
Sbjct  1133  PGSNDLHFPTQFSQSFIVQCKACFWKQHWSYWRNSRYNAIRFFMTAVIGIIFGVIFWSKG  1192

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
             D +H QQDL+NLLGA Y+AV+FLG+ N S+VQ+ +A+ERTVFYRERAAGMYS LPYA AQ
Sbjct  1193  DSLHKQQDLINLLGATYSAVLFLGAGNASAVQSVIAIERTVFYRERAAGMYSELPYAFAQ  1252

Query  624   V  626
             V
Sbjct  1253  V  1253


 Score =   211 bits (537),  Expect(2) = 1e-134, Method: Compositional matrix adjust.
 Identities = 99/175 (57%), Positives = 126/175 (72%), Gaps = 1/175 (1%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  IE IYVA+QT  YS +LY MIG+ WK+ KFL+FYYF+F  F YFT+ GMM+VALTP 
Sbjct  1252  QVAIETIYVAIQTFMYSCILYSMIGYTWKVEKFLYFYYFVFMCFTYFTMNGMMMVALTPN  1311

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
              Q AAI  +F   FWNLF+GF++ R  +PVWWRWYYW SP  W++YG++ SQ GD ++ +
Sbjct  1312  SQIAAIVSSFFTNFWNLFSGFLIARPLIPVWWRWYYWGSPIAWTIYGIMASQFGDVKTFI  1371

Query  1046  QVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
               P EG   +  +LK   GY++ F+  V  AH+GW LLFFFVFAYGI FLNFQ+R
Sbjct  1372  DTP-EGSQRVDLYLKKNLGYEHDFVVPVFFAHIGWVLLFFFVFAYGIKFLNFQKR  1425



>ref|XP_010553381.1| PREDICTED: ABC transporter G family member 39-like isoform X3 
[Tarenaya hassleriana]
Length=1465

 Score =   280 bits (717),  Expect(2) = 2e-134, Method: Compositional matrix adjust.
 Identities = 129/184 (70%), Positives = 154/184 (84%), Gaps = 3/184 (2%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              ++V GVPKI + YNPATWMLE+ST  +E Q GVDFAEIYANS L+QRNQELI+ELSTPP
Sbjct  1109  FESVHGVPKIIDSYNPATWMLEVSTPSMETQLGVDFAEIYANSTLYQRNQELIRELSTPP  1168

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             P S +LYFPTKYSQSF  QC+ACFWKQ+ SYWR+PQYNA+RF +T+V+G+MFG+IFW KG
Sbjct  1169  PSSNNLYFPTKYSQSFSTQCRACFWKQYKSYWRHPQYNAIRFLMTVVIGIMFGLIFWQKG  1228

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTV---FYRERAAGMYSALPYA  614
              +I  QQDL N  GA+YAA++FLG+ N S+VQ  VA+ERTV   FYRERAAGMYSA+PYA
Sbjct  1229  TKIEKQQDLNNFFGAMYAALLFLGATNASAVQPVVAIERTVFYLFYRERAAGMYSAIPYA  1288

Query  615   LAQV  626
              AQV
Sbjct  1289  FAQV  1292


 Score =   228 bits (580),  Expect(2) = 2e-134, Method: Compositional matrix adjust.
 Identities = 106/175 (61%), Positives = 136/175 (78%), Gaps = 0/175 (0%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  +E IY   QT+ YSL+LY MIG++W +GKF WF+Y++   FIYFTLYGMMLVA+TP 
Sbjct  1291  QVAVEMIYNFAQTVVYSLILYTMIGYDWTVGKFFWFFYYILACFIYFTLYGMMLVAMTPN  1350

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
                A I+M+F L+ WNLF+GF++PR Q+P+WWRWYYWASP  W+LYG++TSQ+GDKES V
Sbjct  1351  YHIAGISMSFFLSLWNLFSGFLIPRPQLPIWWRWYYWASPVAWTLYGILTSQVGDKESLV  1410

Query  1046  QVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
             Q+PG GD+++K  LKD FG+D+ FLP VA  HV W  +F  VFAY I FLNFQ+R
Sbjct  1411  QIPGIGDVSLKVLLKDGFGFDHDFLPVVAVVHVVWIAVFLLVFAYSIKFLNFQKR  1465



>ref|XP_004251027.1| PREDICTED: pleiotropic drug resistance protein 2 [Solanum lycopersicum]
Length=1464

 Score =   290 bits (742),  Expect(2) = 3e-134, Method: Compositional matrix adjust.
 Identities = 130/181 (72%), Positives = 158/181 (87%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              +A+ GVPKI+   NPATWML++S++ +EA+  VDFAE+YA S L+QRNQ LIKELSTP 
Sbjct  1110  FEAIRGVPKIRECDNPATWMLDVSSSSMEAKLDVDFAEVYAKSDLYQRNQLLIKELSTPA  1169

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             P S+DLYFPT+YSQSF+ QCKACFWKQ+WSYWRN QYNA+RFF+T+++G+MFGVIFW KG
Sbjct  1170  PRSEDLYFPTQYSQSFLTQCKACFWKQNWSYWRNSQYNAIRFFMTVIIGIMFGVIFWDKG  1229

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
             ++I+ QQDLLNLLGA YAAV+FLG+ N S+VQ+ VAVERTVFYRERAAGMYS LPYA AQ
Sbjct  1230  NKIYRQQDLLNLLGATYAAVMFLGATNASAVQSVVAVERTVFYRERAAGMYSELPYAFAQ  1289

Query  624   V  626
             V
Sbjct  1290  V  1290


 Score =   218 bits (554),  Expect(2) = 3e-134, Method: Compositional matrix adjust.
 Identities = 108/176 (61%), Positives = 135/176 (77%), Gaps = 1/176 (1%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  IE IYVAVQT  YSLLL+ MIG+EW   KF +FYYF+F  F YF++YGMM+VALTPG
Sbjct  1289  QVAIETIYVAVQTFIYSLLLFSMIGYEWTAAKFFYFYYFIFMCFTYFSMYGMMVVALTPG  1348

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
              Q AAI M+F L+FWNLF+GF++PR  +PVWWRWYYW SP  W++YG+  SQ+GD+   +
Sbjct  1349  YQIAAIVMSFFLSFWNLFSGFLVPRPLIPVWWRWYYWGSPVAWTIYGIFASQVGDRIDEL  1408

Query  1046  QVPG-EGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
             ++PG    M + QF+K++ GYD+ FL AV  AHVGW LLFFFVFAYGI FLN Q+R
Sbjct  1409  EIPGVTVKMQVNQFMKEYLGYDHDFLVAVVFAHVGWVLLFFFVFAYGIKFLNHQKR  1464



>gb|KEH41422.1| drug resistance transporter-like ABC domain protein [Medicago 
truncatula]
Length=1468

 Score =   283 bits (724),  Expect(2) = 3e-134, Method: Compositional matrix adjust.
 Identities = 124/181 (69%), Positives = 156/181 (86%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              +A+ G+PKI++GYNPATWMLEIS+  +E+Q  +DFAE+Y  S L+QRNQELIKELS P 
Sbjct  1115  FEAITGIPKIEDGYNPATWMLEISSPVVESQLDIDFAELYNKSSLYQRNQELIKELSIPA  1174

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             PG++DLY+P+KYSQSFV QC ACFWKQ+ SYWRNPQYNA+RFF+TIV+G+MFG+I+W KG
Sbjct  1175  PGTKDLYYPSKYSQSFVTQCSACFWKQYRSYWRNPQYNAIRFFITIVIGLMFGLIYWKKG  1234

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
             +++  +QDLLNL GA+Y++VIFLG+ NTSSVQ  VA+ERTV YRERAAGMYS L YA+ Q
Sbjct  1235  EKMQREQDLLNLFGAMYSSVIFLGASNTSSVQPIVAIERTVLYRERAAGMYSELTYAIGQ  1294

Query  624   V  626
             V
Sbjct  1295  V  1295


 Score =   225 bits (573),  Expect(2) = 3e-134, Method: Compositional matrix adjust.
 Identities = 103/177 (58%), Positives = 137/177 (77%), Gaps = 0/177 (0%)
 Frame = +2

Query  680   ILQAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALT  859
             I Q  IE IYVA+Q++ YS +LY M+GF  ++  F WFY+ +F SF+YFTLYG+M VALT
Sbjct  1292  IGQVAIEVIYVAIQSLIYSNILYWMLGFPPQVENFFWFYFLIFMSFLYFTLYGLMTVALT  1351

Query  860   PGVQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKES  1039
             P  Q AAI M+F ++FWNLF+GF++PR Q+P+WWRWYYWASP  W++YGL+TSQ+GDK S
Sbjct  1352  PNHQIAAIVMSFFISFWNLFSGFLIPRTQIPIWWRWYYWASPVAWTIYGLVTSQVGDKNS  1411

Query  1040  RVQVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
              ++VPG   MT+K +L+   G+++ FL  VA AH+ + LLF FVFAYGI FLNFQ+R
Sbjct  1412  PIEVPGYRLMTVKDYLERRLGFEHDFLGYVALAHIAFCLLFLFVFAYGIKFLNFQKR  1468



>ref|XP_010516857.1| PREDICTED: ABC transporter G family member 34-like [Camelina 
sativa]
Length=1450

 Score =   273 bits (697),  Expect(2) = 4e-134, Method: Compositional matrix adjust.
 Identities = 121/181 (67%), Positives = 149/181 (82%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              +A+ GVPKI +GYNPATWML++++  +E Q  VDFA+I+ANS L+QRNQELIKELSTPP
Sbjct  1097  FEAIEGVPKITDGYNPATWMLDVTSPSMETQLSVDFAQIFANSSLYQRNQELIKELSTPP  1156

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             PGS DLYF TKY+Q F  Q KACFWKQ+WS WR PQYNA+RF +TIV+G MFG+IFW  G
Sbjct  1157  PGSNDLYFQTKYAQPFATQMKACFWKQYWSSWRYPQYNAIRFLMTIVIGFMFGLIFWQTG  1216

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
              +I  +QDL N  GA+YAAV+FLG  N S+VQ  +A+ERTVFYRE+AAGMYSA+PYA++Q
Sbjct  1217  TKIEKEQDLNNFFGAMYAAVMFLGGTNASTVQPAIAIERTVFYREKAAGMYSAIPYAISQ  1276

Query  624   V  626
             V
Sbjct  1277  V  1277


 Score =   235 bits (599),  Expect(2) = 4e-134, Method: Compositional matrix adjust.
 Identities = 104/177 (59%), Positives = 136/177 (77%), Gaps = 0/177 (0%)
 Frame = +2

Query  680   ILQAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALT  859
             I Q  +E +Y  +QT  Y+L+LY MIG++W   KF WFYY+M TSF+YFTLYGMMLVALT
Sbjct  1274  ISQVAVEIMYNIIQTGLYTLILYSMIGYDWTAVKFFWFYYYMLTSFVYFTLYGMMLVALT  1333

Query  860   PGVQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKES  1039
             P  Q A I M+F ++ WNLF+GF++P+  +P+WWRWYYWASP  W+LYG+ITSQ+GD +S
Sbjct  1334  PNYQIAGICMSFFMSLWNLFSGFLIPKPLIPIWWRWYYWASPVAWTLYGIITSQVGDTDS  1393

Query  1040  RVQVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
              V++ G GD ++K  LKD FG+++ FLP VA  H+ W L+F FVFAYGI FLNFQ+R
Sbjct  1394  IVRISGVGDTSLKTLLKDGFGFEHDFLPVVAVVHIAWILVFLFVFAYGIKFLNFQKR  1450



>ref|XP_003590279.1| ABC transporter G family member [Medicago truncatula]
Length=426

 Score =   281 bits (718),  Expect(2) = 6e-134, Method: Compositional matrix adjust.
 Identities = 125/187 (67%), Positives = 160/187 (86%), Gaps = 0/187 (0%)
 Frame = +3

Query  84   LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
             +A+ G+PKI++GYNPATWMLEIS+  +E+Q  +DFAE+Y  S L+QRNQELIKELS P 
Sbjct  58   FEAITGIPKIEDGYNPATWMLEISSPVVESQLDIDFAELYNKSSLYQRNQELIKELSIPA  117

Query  264  PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
            PG++DLY+P+KYSQSFV QC ACFWKQ+ SYWRNPQYNA+RFF+TIV+G+MFG+I+W KG
Sbjct  118  PGTKDLYYPSKYSQSFVTQCSACFWKQYRSYWRNPQYNAIRFFITIVIGLMFGLIYWKKG  177

Query  444  DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
            +++  +QDLLNL+GA+Y++VIFLG+ NTSSVQ  VA+ERTV YRERAAGMYS L YA+ Q
Sbjct  178  EKMQREQDLLNLVGAMYSSVIFLGASNTSSVQPIVAIERTVLYRERAAGMYSELTYAIGQ  237

Query  624  VIKRRKF  644
            + K  +F
Sbjct  238  ISKIIQF  244


 Score =   226 bits (576),  Expect(2) = 6e-134, Method: Compositional matrix adjust.
 Identities = 104/177 (59%), Positives = 138/177 (78%), Gaps = 0/177 (0%)
 Frame = +2

Query  680   ILQAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALT  859
             ILQ  IE IYVA+Q++ YS +LY M+GF  ++  F WFY+ +F SF+YFTLYG+M VALT
Sbjct  250   ILQVAIEVIYVAIQSLIYSNILYWMLGFPPQVENFFWFYFLIFMSFLYFTLYGLMTVALT  309

Query  860   PGVQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKES  1039
             P  Q AAI M+F ++FWNLF+GF++PR Q+P+WWRWYYWASP  W++YGL+TSQ+GDK S
Sbjct  310   PNHQIAAIVMSFFISFWNLFSGFLIPRTQIPIWWRWYYWASPVAWTIYGLVTSQVGDKNS  369

Query  1040  RVQVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
              ++VPG   MT+K +L+   G+++ FL  VA AH+ + LLF FVFAYGI FLNFQ+R
Sbjct  370   PIEVPGYRLMTVKDYLERRLGFEHDFLGYVALAHIAFCLLFLFVFAYGIKFLNFQKR  426



>ref|XP_010093208.1| Pleiotropic drug resistance protein 2 [Morus notabilis]
 gb|EXB53706.1| Pleiotropic drug resistance protein 2 [Morus notabilis]
Length=1538

 Score =   292 bits (748),  Expect(2) = 7e-134, Method: Compositional matrix adjust.
 Identities = 130/181 (72%), Positives = 156/181 (86%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              +A+PGVPKIK GYNPATWMLE+S+  +E+Q  VDFAEIYANS L++RNQ LIKELSTP 
Sbjct  1185  FEAIPGVPKIKEGYNPATWMLEVSSTAVESQLNVDFAEIYANSDLYKRNQNLIKELSTPQ  1244

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
              GS+DLYFPT+YS SF  QCKACFWKQHWSYWRN ++NA+RFF T+++GV+FGVIFW KG
Sbjct  1245  LGSKDLYFPTQYSTSFFTQCKACFWKQHWSYWRNSKFNAIRFFTTVMIGVLFGVIFWDKG  1304

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
              ++ +Q+DLLNLLGA YAAV+FLG+ N S+VQ  V++ERTVFYRERAAGMYS LPYA AQ
Sbjct  1305  GQLGSQKDLLNLLGATYAAVLFLGASNASAVQPVVSIERTVFYRERAAGMYSELPYAFAQ  1364

Query  624   V  626
             V
Sbjct  1365  V  1365


 Score =   214 bits (546),  Expect(2) = 7e-134, Method: Compositional matrix adjust.
 Identities = 107/175 (61%), Positives = 132/175 (75%), Gaps = 0/175 (0%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  IE IYV +QT  YS++LY MIG+EW   KF +FYYF+F  F YF++YGMM+VALTPG
Sbjct  1364  QVAIETIYVLIQTFVYSMILYSMIGYEWTGEKFFYFYYFIFMCFTYFSMYGMMVVALTPG  1423

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
              Q AAI M+F L+FWNLF+GF++PR  +PVWWRWYYW SP  W++YGL  SQ+GD +S +
Sbjct  1424  HQIAAIVMSFFLSFWNLFSGFMIPRPLIPVWWRWYYWGSPVSWTIYGLFASQIGDVKSEL  1483

Query  1046  QVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
             ++ G   M + +FLKD  GYD+ FL  V  AHV W LLFFFVFAYGI FLNFQRR
Sbjct  1484  ELSGGETMAVNKFLKDNLGYDHDFLFPVVLAHVAWVLLFFFVFAYGIKFLNFQRR  1538



>ref|XP_004494909.1| PREDICTED: LOW QUALITY PROTEIN: ABC transporter G family member 
34-like [Cicer arietinum]
Length=1442

 Score =   255 bits (652),  Expect(2) = 8e-134, Method: Compositional matrix adjust.
 Identities = 123/181 (68%), Positives = 145/181 (80%), Gaps = 1/181 (1%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              +A+ GV KIK+GYNPATWMLEIS++  E Q  VDFAEIYANS L+QRNQ+LIKEL+TP 
Sbjct  1090  FEAIQGVQKIKDGYNPATWMLEISSSSNETQLDVDFAEIYANSTLYQRNQKLIKELNTPA  1149

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             P S+DLYFPTKYSQSF  QCKA FWKQ+ SYWR+ QYN VRF +TIV+GV+FG+IFW +G
Sbjct  1150  PNSKDLYFPTKYSQSFFGQCKANFWKQYLSYWRHSQYNIVRFSMTIVIGVLFGLIFWKQG  1209

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
                  QQ+LLNLLGAIY+ V+FLG+ N S+VQ  VA+ R     ERAAGMYSALPYA AQ
Sbjct  1210  KNTQTQQELLNLLGAIYSTVLFLGATNASAVQPVVAIARXX-XXERAAGMYSALPYAFAQ  1268

Query  624   V  626
             V
Sbjct  1269  V  1269


 Score =   251 bits (641),  Expect(2) = 8e-134, Method: Compositional matrix adjust.
 Identities = 109/175 (62%), Positives = 139/175 (79%), Gaps = 0/175 (0%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  +E +Y A+QT+ Y+L++Y MIGFEWK  KF WFYY++   F+YFT YGMMLVALTPG
Sbjct  1268  QVAVETVYNAIQTMIYTLIIYSMIGFEWKAEKFFWFYYYLLLCFMYFTFYGMMLVALTPG  1327

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
                AAI ++F ++FWNLF+GF++PR Q+P+WWRWYYWASP  W+LYG+ITSQ GDK   +
Sbjct  1328  QDVAAICISFFMSFWNLFSGFVIPRMQIPIWWRWYYWASPVAWTLYGIITSQFGDKNGEI  1387

Query  1046  QVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
             ++PG G M +K+FLK  +GY+  FLPAVA AH+GW LLF FVFAYGI FLNFQ+R
Sbjct  1388  EIPGAGSMELKEFLKQNWGYNRDFLPAVAVAHIGWVLLFAFVFAYGIKFLNFQKR  1442



>ref|XP_009798514.1| PREDICTED: pleiotropic drug resistance protein 2 [Nicotiana sylvestris]
Length=1461

 Score =   294 bits (752),  Expect(2) = 8e-134, Method: Compositional matrix adjust.
 Identities = 130/181 (72%), Positives = 158/181 (87%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              + +PGVPKI+   NPATWML++S++ +EAQ  VDFAE+YANS L+QRNQ LIKELSTP 
Sbjct  1107  FETIPGVPKIRESDNPATWMLDVSSSSMEAQLLVDFAEVYANSNLYQRNQLLIKELSTPA  1166

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
               S+DLYFPT+YSQSF+ QCKACFWKQHWSYWRN QYNA+RFF+T+++G++FGVIFW KG
Sbjct  1167  TCSKDLYFPTQYSQSFITQCKACFWKQHWSYWRNSQYNAIRFFMTVIIGILFGVIFWNKG  1226

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
             ++I+ QQDLLNLLGA YAAV+FLG+ N S+VQ+ VA+ERTVFYRERAAGMYS LPYA AQ
Sbjct  1227  NQIYRQQDLLNLLGATYAAVMFLGATNASAVQSVVAIERTVFYRERAAGMYSELPYAFAQ  1286

Query  624   V  626
             V
Sbjct  1287  V  1287


 Score =   213 bits (541),  Expect(2) = 8e-134, Method: Compositional matrix adjust.
 Identities = 105/176 (60%), Positives = 135/176 (77%), Gaps = 1/176 (1%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  IE IYVA+QT  YSLLL+ MIG++W   KF +FYYF+F  F YF++YGMM+VALTPG
Sbjct  1286  QVAIETIYVAIQTFIYSLLLFSMIGYQWTAEKFFYFYYFIFMCFTYFSMYGMMVVALTPG  1345

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
              Q AAI M+F L+FWNLF+GF++PR  +PVWWRWYYWASP  W++YG+  SQ+GD+   +
Sbjct  1346  YQIAAIVMSFFLSFWNLFSGFLVPRPLIPVWWRWYYWASPVAWTIYGIFASQVGDRTDEL  1405

Query  1046  QVPGE-GDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
             ++ GE   + + +FLK++ GYD+ FL  V  AHVGW LLFFFVFAYGI FLN Q+R
Sbjct  1406  ELTGEIEKIQVNKFLKEYLGYDHDFLVVVVFAHVGWVLLFFFVFAYGIKFLNHQKR  1461



>ref|XP_007015918.1| Pleiotropic drug resistance 6 [Theobroma cacao]
 gb|EOY33537.1| Pleiotropic drug resistance 6 [Theobroma cacao]
Length=1452

 Score =   302 bits (773),  Expect(2) = 1e-133, Method: Compositional matrix adjust.
 Identities = 134/181 (74%), Positives = 157/181 (87%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              +AVPGVPKIK GYNPATWMLE+S+  +E Q  VDFA+IYANS L+QRNQELI ELSTP 
Sbjct  1099  FEAVPGVPKIKEGYNPATWMLEVSSTAVETQLNVDFADIYANSDLYQRNQELINELSTPQ  1158

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             PGS+DLYFPTKYSQ FV QCKACFWKQ+WSYWRN +YNAVRFF+T ++G++FGVIFW KG
Sbjct  1159  PGSKDLYFPTKYSQDFVTQCKACFWKQYWSYWRNSEYNAVRFFMTTMIGILFGVIFWNKG  1218

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
             +++  QQDL+NLLGA YAAV+FLG+ N +SVQ  V++ERTVFYRERAAGMYS LPYA AQ
Sbjct  1219  EKLQQQQDLMNLLGATYAAVLFLGATNATSVQPVVSIERTVFYRERAAGMYSELPYAFAQ  1278

Query  624   V  626
             V
Sbjct  1279  V  1279


 Score =   204 bits (519),  Expect(2) = 1e-133, Method: Compositional matrix adjust.
 Identities = 99/175 (57%), Positives = 129/175 (74%), Gaps = 0/175 (0%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  +E IYVA QTI Y+LLL+ MIGFEW+  KF +FYYF+F  F Y ++YGMM+VA+TPG
Sbjct  1278  QVAVETIYVAFQTIIYALLLFSMIGFEWQADKFFYFYYFIFMCFTYMSMYGMMVVAITPG  1337

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
              Q AAI  +FLL+FWNLF+GF++PR  +PVWWRWYYW SP  W++YGL TSQ+GDK++ +
Sbjct  1338  HQIAAIVSSFLLSFWNLFSGFLIPRPLIPVWWRWYYWGSPIAWTIYGLFTSQIGDKDTPL  1397

Query  1046  QVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
             Q+  +  M + +FLKD  G++  FL  +   H  W L+FFFVFAY I   NFQRR
Sbjct  1398  QLSNDATMPVNKFLKDNLGFEEDFLKYIVLGHFAWVLVFFFVFAYAIKCFNFQRR  1452



>ref|XP_011044671.1| PREDICTED: pleiotropic drug resistance protein 2-like [Populus 
euphratica]
Length=1382

 Score =   272 bits (695),  Expect(2) = 3e-133, Method: Compositional matrix adjust.
 Identities = 119/181 (66%), Positives = 149/181 (82%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              + VPGVP+I+ G NPATWMLEIS+  IE Q  VDFAE+YANS L+++NQELIK+LSTP 
Sbjct  1029  FEVVPGVPRIEQGSNPATWMLEISSEAIETQLQVDFAEVYANSELYRKNQELIKKLSTPR  1088

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             PGS+DL FP++YSQSF+ QC ACFWKQH SYWRN ++N  RF V I++G++FG++FW +G
Sbjct  1089  PGSKDLSFPSQYSQSFITQCAACFWKQHKSYWRNSEFNYTRFVVAIIIGILFGLVFWSRG  1148

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
             D I+ + DL+NLLGA YAAV+FLG+ N S+VQ+ +A ERTVFYRERAAGMYS LPYA A 
Sbjct  1149  DRIYKRNDLINLLGATYAAVLFLGATNASAVQSVIATERTVFYRERAAGMYSELPYAFAH  1208

Query  624   V  626
             V
Sbjct  1209  V  1209


 Score =   232 bits (592),  Expect(2) = 3e-133, Method: Compositional matrix adjust.
 Identities = 104/175 (59%), Positives = 137/175 (78%), Gaps = 0/175 (0%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
                IE IYV++QT  YSLLLY MIGFEW + KFL FYYF+FTSF YF++YGMM+++LTPG
Sbjct  1208  HVAIEIIYVSIQTFLYSLLLYSMIGFEWNVAKFLCFYYFIFTSFTYFSMYGMMIISLTPG  1267

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
              + AA+ M+F ++FWNLF+G+++ R  +PVWWRWYYWASP  W++YG+ TSQ+ DK + +
Sbjct  1268  PEIAAVVMSFFISFWNLFSGYLIARPLIPVWWRWYYWASPVAWTIYGIFTSQVVDKNTLL  1327

Query  1046  QVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
             ++PG   + +K F++ + GYD+ FL  V  AHVGW LLFFFVFAYGI FLNFQRR
Sbjct  1328  EIPGSEPVPLKAFVEKYLGYDHEFLLPVVLAHVGWVLLFFFVFAYGIKFLNFQRR  1382



>gb|EYU19792.1| hypothetical protein MIMGU_mgv1a000194mg [Erythranthe guttata]
Length=1451

 Score =   269 bits (687),  Expect(2) = 6e-133, Method: Compositional matrix adjust.
 Identities = 128/181 (71%), Positives = 155/181 (86%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              Q+VPG+P+IK GYNPATWML+++T  IEAQ  VDFAEIY NS LH+RN+ELIK+LS P 
Sbjct  1097  FQSVPGLPEIKEGYNPATWMLDVTTPAIEAQLNVDFAEIYTNSELHKRNEELIKQLSVPA  1156

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             PGSQDL+FP KY+QSF  QC ACFWKQH SYWR+ QYN+ RFF+T ++G++FGVIFW KG
Sbjct  1157  PGSQDLHFPNKYAQSFSSQCNACFWKQHLSYWRHTQYNSSRFFMTTIIGIIFGVIFWNKG  1216

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
              ++  QQDL+NLLGA+Y+AV+FLG  NTS+VQ+ VAVERTVFYRE+AAGMYSALPYA AQ
Sbjct  1217  TQLSKQQDLMNLLGAMYSAVMFLGGTNTSAVQSVVAVERTVFYREKAAGMYSALPYAFAQ  1276

Query  624   V  626
             V
Sbjct  1277  V  1277


 Score =   234 bits (598),  Expect(2) = 6e-133, Method: Compositional matrix adjust.
 Identities = 115/176 (65%), Positives = 141/176 (80%), Gaps = 1/176 (1%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  IE IYVA+QT  YSL+LY MIGFEWK+ KF WFY+F+F  FIYFT YGMMLVALTP 
Sbjct  1276  QVAIETIYVAIQTFVYSLVLYSMIGFEWKVEKFFWFYFFVFMCFIYFTAYGMMLVALTPN  1335

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
                AAI M+F L+FWNLF+GF++PR ++P+WWRWYYWASP  W++YGL+TSQ+GDK   +
Sbjct  1336  YAIAAIVMSFFLSFWNLFSGFLIPRTEIPIWWRWYYWASPVSWTIYGLVTSQVGDKSDLI  1395

Query  1046  QVPG-EGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
             QVPG  GD+ +K++L+ F GY Y FL AVA AHVGW++ F FVFAYGI +LNFQRR
Sbjct  1396  QVPGLVGDIPVKEYLERFLGYKYDFLGAVAGAHVGWAIFFCFVFAYGIKYLNFQRR  1451



>ref|XP_010089395.1| Pleiotropic drug resistance protein 2 [Morus notabilis]
 gb|EXB37748.1| Pleiotropic drug resistance protein 2 [Morus notabilis]
Length=1469

 Score =   283 bits (723),  Expect(2) = 6e-133, Method: Compositional matrix adjust.
 Identities = 125/181 (69%), Positives = 151/181 (83%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
             L+ +PGVPKIK+GYNPATWMLE++   +EAQ GVDFAEIY  S L+Q+NQELIKELSTP 
Sbjct  1115  LEGIPGVPKIKDGYNPATWMLEVTAPSVEAQLGVDFAEIYTKSSLYQKNQELIKELSTPA  1174

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             P + DL+FPTKYSQ F+ QCKACFWKQHWSYWRNP+YN VRFF+TI++ V+FG+I+W KG
Sbjct  1175  PETTDLFFPTKYSQPFLVQCKACFWKQHWSYWRNPKYNGVRFFITIIIAVLFGLIYWNKG  1234

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
              +    ++L+NLLGAI+ AV FLG+ N S+VQ  V +ERTVFYRERAAGMYS LPYA AQ
Sbjct  1235  QKTGTVRELMNLLGAIFTAVFFLGASNGSAVQPIVDIERTVFYRERAAGMYSTLPYACAQ  1294

Query  624   V  626
             V
Sbjct  1295  V  1295


 Score =   221 bits (563),  Expect(2) = 6e-133, Method: Compositional matrix adjust.
 Identities = 99/176 (56%), Positives = 128/176 (73%), Gaps = 1/176 (1%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  IE +Y A Q + Y+++LY MIGFEW +GK  WFYY++    +YFT YGMM VALTPG
Sbjct  1294  QVAIEIVYSATQCLVYTIILYSMIGFEWNIGKIFWFYYYVLMCLVYFTAYGMMGVALTPG  1353

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
              Q  AI M F   FW LF GFILPR+Q+P+WWRWYYWASP  W+++G++ SQLGDK + V
Sbjct  1354  HQIGAIFMYFFCCFWVLFCGFILPREQIPIWWRWYYWASPVSWTIHGVVASQLGDKHTNV  1413

Query  1046  QVPGEG-DMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
             ++PG G  + + +F+K+   +DY FLP VA  ++GW LLF FVFAYGI F NFQ+R
Sbjct  1414  EIPGLGTSIPLNKFIKEQLNFDYDFLPIVALVNIGWVLLFLFVFAYGIKFFNFQKR  1469



>ref|XP_008442813.1| PREDICTED: pleiotropic drug resistance protein 2-like [Cucumis 
melo]
Length=1418

 Score =   277 bits (709),  Expect(2) = 9e-133, Method: Compositional matrix adjust.
 Identities = 120/181 (66%), Positives = 154/181 (85%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              +A+PG+PKI+NG NPATWMLE++   +E Q  +DFA+ +A SP+++RNQELI ELSTP 
Sbjct  1065  FEAIPGIPKIENGKNPATWMLEVTAPPMETQLDIDFADAFAKSPIYRRNQELIMELSTPA  1124

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             PGS+DL+FPT+YSQSF  QC+ACFWKQH SYWR+ QYNA+RFF+TIV+G++FG++FW KG
Sbjct  1125  PGSKDLHFPTEYSQSFFFQCRACFWKQHRSYWRHTQYNAIRFFITIVIGILFGLVFWKKG  1184

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
               +  QQD+LN++GAIY+AVIFLG+ N S VQ+ VA+ERT FYRE+AAGMYSALPYA AQ
Sbjct  1185  QILAKQQDVLNVMGAIYSAVIFLGATNASCVQSVVAIERTAFYREKAAGMYSALPYAFAQ  1244

Query  624   V  626
             V
Sbjct  1245  V  1245


 Score =   226 bits (575),  Expect(2) = 9e-133, Method: Compositional matrix adjust.
 Identities = 111/175 (63%), Positives = 134/175 (77%), Gaps = 0/175 (0%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  IE IYV VQ+I Y L++Y MIGFEWKLGKFL F Y +F  F YF LYGMM+VALTP 
Sbjct  1244  QVAIETIYVFVQSIIYCLIIYSMIGFEWKLGKFLLFCYLVFMCFTYFALYGMMVVALTPN  1303

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
                AAI MAF L FWNLF GF++PR  +PVWWRWYYWA+P  W++YG++ SQ+GDK+S V
Sbjct  1304  YHIAAIVMAFFLGFWNLFTGFLIPRPAIPVWWRWYYWANPVAWTIYGIVASQVGDKDSLV  1363

Query  1046  QVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
             Q+PG G + +K FLK+ FGY++ F+P V AAH  W L+F FVFAYGI FLNFQRR
Sbjct  1364  QIPGIGSVRLKLFLKEGFGYEHDFIPVVVAAHFVWVLVFVFVFAYGIKFLNFQRR  1418



>ref|XP_010509477.1| PREDICTED: ABC transporter G family member 34-like [Camelina 
sativa]
Length=1447

 Score =   269 bits (688),  Expect(2) = 1e-132, Method: Compositional matrix adjust.
 Identities = 119/181 (66%), Positives = 147/181 (81%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              +A+ GVPKI +GYNPATWML++++  +E Q  VDFA+I+ NS L+QRNQELIKELSTPP
Sbjct  1094  FEAIEGVPKITDGYNPATWMLDVTSPSMETQLSVDFAQIFTNSSLYQRNQELIKELSTPP  1153

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             PGS DLYF +KY+Q F  Q KACFWKQ WS WR PQYNA+RF +TIV+G MFG+IFW  G
Sbjct  1154  PGSNDLYFQSKYAQPFATQMKACFWKQFWSSWRYPQYNAIRFLMTIVIGFMFGLIFWQTG  1213

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
              +I  +QDL N  GA+YAAV+FLG  N S+VQ  +A+ERTVFYRE+AAGMYSA+PYA++Q
Sbjct  1214  TKIEKEQDLNNFFGAMYAAVMFLGGTNASTVQPAIAIERTVFYREKAAGMYSAIPYAISQ  1273

Query  624   V  626
             V
Sbjct  1274  V  1274


 Score =   233 bits (594),  Expect(2) = 1e-132, Method: Compositional matrix adjust.
 Identities = 103/177 (58%), Positives = 136/177 (77%), Gaps = 0/177 (0%)
 Frame = +2

Query  680   ILQAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALT  859
             I Q  +E +Y  VQT  Y+++LY MIG++W   KF WFY+FM TSF+YFTLYGMMLVALT
Sbjct  1271  ISQVAVEIMYNIVQTGLYTIILYSMIGYDWTAVKFFWFYFFMLTSFVYFTLYGMMLVALT  1330

Query  860   PGVQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKES  1039
             P  Q A I M+F ++ WNLF+GF++P+  +P+WWRWYYWASP  W+LYG+ITSQ+GD ++
Sbjct  1331  PNYQIAGICMSFFMSLWNLFSGFLIPKPLIPIWWRWYYWASPVAWTLYGIITSQVGDTDA  1390

Query  1040  RVQVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
              V++ G GD ++K  LKD FG+++ FLP VA  H+ W L+F FVFAYGI FLNFQ+R
Sbjct  1391  IVRISGVGDTSLKTLLKDGFGFEHDFLPVVAVVHIAWILVFLFVFAYGIKFLNFQKR  1447



>ref|XP_010505181.1| PREDICTED: ABC transporter G family member 34-like isoform X1 
[Camelina sativa]
 ref|XP_010505183.1| PREDICTED: ABC transporter G family member 34-like isoform X3 
[Camelina sativa]
Length=1471

 Score =   271 bits (692),  Expect(2) = 1e-132, Method: Compositional matrix adjust.
 Identities = 120/181 (66%), Positives = 148/181 (82%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              +A+ GVPKI +GYNPATWML++++  +E Q  VDFA+I+A S L+QRNQELIKELSTPP
Sbjct  1118  FEAIEGVPKITDGYNPATWMLDVTSPSMETQLSVDFAQIFAKSSLYQRNQELIKELSTPP  1177

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             PGS DLYF TKY+Q F  Q KACFWKQ+WS WR PQYNA+RF +TIV+G MFG+IFW  G
Sbjct  1178  PGSNDLYFQTKYAQPFATQMKACFWKQYWSSWRYPQYNAIRFLMTIVIGFMFGLIFWQTG  1237

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
              +I  +QDL N  GA+YAAV+FLG  N S+VQ  +A+ERTVFYRE+AAGMYSA+PYA++Q
Sbjct  1238  TKIEKEQDLNNFFGAMYAAVMFLGGTNASTVQPAIAIERTVFYREKAAGMYSAIPYAISQ  1297

Query  624   V  626
             V
Sbjct  1298  V  1298


 Score =   232 bits (591),  Expect(2) = 1e-132, Method: Compositional matrix adjust.
 Identities = 103/177 (58%), Positives = 136/177 (77%), Gaps = 0/177 (0%)
 Frame = +2

Query  680   ILQAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALT  859
             I Q  +E +Y  +QT  Y+L+LY MIG++W   KF WFY+FM TSF+YFTLYGMMLVALT
Sbjct  1295  ISQVAVEIMYNIIQTGLYTLILYSMIGYDWTAVKFFWFYFFMLTSFVYFTLYGMMLVALT  1354

Query  860   PGVQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKES  1039
             P  Q A I M+F ++ WNLF+GF++P+  +P+WWRWYYWASP  W+LYG+ITSQ+GD ++
Sbjct  1355  PNYQIAGICMSFFMSLWNLFSGFLIPKPLIPIWWRWYYWASPVAWTLYGIITSQVGDTDA  1414

Query  1040  RVQVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
              V++ G GD ++K  LKD FG+++ FLP VA  H+ W L+F FVFAYGI FLNFQ+R
Sbjct  1415  IVRISGVGDTSLKTLLKDGFGFEHDFLPVVAVVHIVWILVFLFVFAYGIKFLNFQKR  1471



>ref|XP_010505182.1| PREDICTED: ABC transporter G family member 34-like isoform X2 
[Camelina sativa]
Length=1447

 Score =   271 bits (692),  Expect(2) = 1e-132, Method: Compositional matrix adjust.
 Identities = 120/181 (66%), Positives = 148/181 (82%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              +A+ GVPKI +GYNPATWML++++  +E Q  VDFA+I+A S L+QRNQELIKELSTPP
Sbjct  1094  FEAIEGVPKITDGYNPATWMLDVTSPSMETQLSVDFAQIFAKSSLYQRNQELIKELSTPP  1153

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             PGS DLYF TKY+Q F  Q KACFWKQ+WS WR PQYNA+RF +TIV+G MFG+IFW  G
Sbjct  1154  PGSNDLYFQTKYAQPFATQMKACFWKQYWSSWRYPQYNAIRFLMTIVIGFMFGLIFWQTG  1213

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
              +I  +QDL N  GA+YAAV+FLG  N S+VQ  +A+ERTVFYRE+AAGMYSA+PYA++Q
Sbjct  1214  TKIEKEQDLNNFFGAMYAAVMFLGGTNASTVQPAIAIERTVFYREKAAGMYSAIPYAISQ  1273

Query  624   V  626
             V
Sbjct  1274  V  1274


 Score =   231 bits (590),  Expect(2) = 1e-132, Method: Compositional matrix adjust.
 Identities = 103/177 (58%), Positives = 136/177 (77%), Gaps = 0/177 (0%)
 Frame = +2

Query  680   ILQAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALT  859
             I Q  +E +Y  +QT  Y+L+LY MIG++W   KF WFY+FM TSF+YFTLYGMMLVALT
Sbjct  1271  ISQVAVEIMYNIIQTGLYTLILYSMIGYDWTAVKFFWFYFFMLTSFVYFTLYGMMLVALT  1330

Query  860   PGVQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKES  1039
             P  Q A I M+F ++ WNLF+GF++P+  +P+WWRWYYWASP  W+LYG+ITSQ+GD ++
Sbjct  1331  PNYQIAGICMSFFMSLWNLFSGFLIPKPLIPIWWRWYYWASPVAWTLYGIITSQVGDTDA  1390

Query  1040  RVQVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
              V++ G GD ++K  LKD FG+++ FLP VA  H+ W L+F FVFAYGI FLNFQ+R
Sbjct  1391  IVRISGVGDTSLKTLLKDGFGFEHDFLPVVAVVHIVWILVFLFVFAYGIKFLNFQKR  1447



>emb|CDP15381.1| unnamed protein product [Coffea canephora]
Length=1346

 Score =   273 bits (697),  Expect(2) = 1e-132, Method: Compositional matrix adjust.
 Identities = 124/178 (70%), Positives = 146/178 (82%), Gaps = 0/178 (0%)
 Frame = +3

Query  93    VPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPPPGS  272
             VPGVPKI  GYNPATWMLEIST  +EAQ  VDFA+I+A S L++RN+ELI ELST PPGS
Sbjct  996   VPGVPKITPGYNPATWMLEISTPSVEAQLQVDFADIFAESALYKRNEELIAELSTAPPGS  1055

Query  273   QDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKGDEI  452
             +DLYFPTKYSQ    Q +ACFWKQ  SYWRNP+YNA+RF +T+  GV+FGVIFW KG ++
Sbjct  1056  KDLYFPTKYSQPIFTQIRACFWKQRLSYWRNPRYNAIRFMLTVACGVIFGVIFWDKGGKM  1115

Query  453   HNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQV  626
               QQDLLNL+GAIY+ V+FLG+ N SSVQ  V++ERTVFYRER AGMYSA PYA+ QV
Sbjct  1116  QVQQDLLNLMGAIYSCVLFLGATNASSVQGVVSIERTVFYRERGAGMYSAFPYAIGQV  1173


 Score =   229 bits (585),  Expect(2) = 1e-132, Method: Compositional matrix adjust.
 Identities = 101/177 (57%), Positives = 133/177 (75%), Gaps = 0/177 (0%)
 Frame = +2

Query  680   ILQAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALT  859
             I Q  IE +YV++QT  Y+L++Y MIGFEW   KF  FYYF+ T + Y+T++GMMLVALT
Sbjct  1170  IGQVAIEVLYVSIQTFVYTLIIYSMIGFEWTAAKFFLFYYFLLTCYTYYTMFGMMLVALT  1229

Query  860   PGVQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKES  1039
             P +Q AAI+M+F ++FWNLF+GF++PR Q+P+WWRWYYW SP  WS+YG IT Q+GDK +
Sbjct  1230  PNIQVAAISMSFFMSFWNLFSGFLIPRTQIPIWWRWYYWGSPVAWSIYGTITCQIGDKTN  1289

Query  1040  RVQVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
             +V VPG  ++T+K +LK   GYD+ FLP V   H+ W LLF F FA GI +LNFQ R
Sbjct  1290  QVVVPGSPNVTVKGYLKHGLGYDHDFLPVVGVVHICWVLLFAFGFALGIRYLNFQTR  1346



>ref|XP_006361493.1| PREDICTED: pleiotropic drug resistance protein 2-like [Solanum 
tuberosum]
Length=1449

 Score =   286 bits (733),  Expect(2) = 3e-132, Method: Compositional matrix adjust.
 Identities = 129/181 (71%), Positives = 157/181 (87%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              Q++ GVP IK GYNPATWML+IS+  +EAQ  VDFA+IYANS L++RNQELIKELS P 
Sbjct  1096  FQSITGVPGIKEGYNPATWMLDISSPAVEAQLQVDFADIYANSELYRRNQELIKELSIPA  1155

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             PGS+DL+FPT++SQ F+EQCKACFWKQH SYWR+PQYNA RF +T ++GVMFG+IFW KG
Sbjct  1156  PGSKDLHFPTEFSQPFLEQCKACFWKQHLSYWRHPQYNAFRFAMTTMIGVMFGIIFWNKG  1215

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
             +++   QDLLN++GA+YAAV+FLG  NTS+VQ+ VAVERTVFYRE+AAGMYSALPYA AQ
Sbjct  1216  NQLSKLQDLLNIVGAMYAAVMFLGGTNTSAVQSIVAVERTVFYREKAAGMYSALPYAFAQ  1275

Query  624   V  626
             V
Sbjct  1276  V  1276


 Score =   215 bits (547),  Expect(2) = 3e-132, Method: Compositional matrix adjust.
 Identities = 107/175 (61%), Positives = 139/175 (79%), Gaps = 0/175 (0%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  IE IY+A+QT+ YS +LY MIGF W +GKF  FY+F+F  F+YFT+YGMMLVALTP 
Sbjct  1275  QVAIETIYIAIQTLIYSFILYAMIGFHWTVGKFFLFYFFVFMCFVYFTMYGMMLVALTPN  1334

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
                AAI M+F L+FWNLF+GF++PR Q+P+WWRWYYWASP  W++YGL+TSQ+GDK + +
Sbjct  1335  YHIAAIVMSFFLSFWNLFSGFLIPRTQIPIWWRWYYWASPVAWTIYGLVTSQIGDKNNLI  1394

Query  1046  QVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
             ++PG G+++IK +LKD FG++Y FL  VA  HV W++ F FVFAY I FLNFQRR
Sbjct  1395  EIPGGGEVSIKLYLKDSFGFEYDFLGVVAVVHVAWAVFFCFVFAYAIKFLNFQRR  1449



>ref|XP_006296271.1| hypothetical protein CARUB_v10025439mg [Capsella rubella]
 gb|EOA29169.1| hypothetical protein CARUB_v10025439mg [Capsella rubella]
Length=1452

 Score =   272 bits (695),  Expect(2) = 6e-132, Method: Compositional matrix adjust.
 Identities = 118/181 (65%), Positives = 152/181 (84%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              + + GV KIK+GYNPATWML+++T  +E+Q GVDFA+I+A S ++QRNQELIKELSTPP
Sbjct  1099  FEGIEGVSKIKDGYNPATWMLDVTTPSMESQMGVDFAQIFATSSVNQRNQELIKELSTPP  1158

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             PGS DLYFP+KY+Q F  Q KACFWK +WS WR PQYNA+RF +T+V+GV+FG+IFW  G
Sbjct  1159  PGSNDLYFPSKYAQPFATQTKACFWKHYWSNWRYPQYNAIRFLMTVVIGVLFGLIFWQTG  1218

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
              +I  +QDL N LGA+YAAV+FLG+ N ++VQ  +A+ERTVFYRE+AAGMYSA+PYA++Q
Sbjct  1219  TKIEKEQDLNNFLGAMYAAVLFLGATNAATVQPAIAIERTVFYREKAAGMYSAIPYAISQ  1278

Query  624   V  626
             V
Sbjct  1279  V  1279


 Score =   228 bits (582),  Expect(2) = 6e-132, Method: Compositional matrix adjust.
 Identities = 104/177 (59%), Positives = 132/177 (75%), Gaps = 0/177 (0%)
 Frame = +2

Query  680   ILQAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALT  859
             I Q  +E +Y  +QT  Y+++LY MIG++W + KFLWFYY+M TSFIYFTLYGMMLVALT
Sbjct  1276  ISQVAVEIMYNIIQTAIYTVILYSMIGYDWTVVKFLWFYYYMLTSFIYFTLYGMMLVALT  1335

Query  860   PGVQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKES  1039
             P  Q A I M+F L+ WNLF+GF++ R  +P+WWRWYYW SP  W+LYG+ITSQ+GD+ +
Sbjct  1336  PNYQIAGILMSFFLSLWNLFSGFLISRPLLPIWWRWYYWVSPVAWTLYGIITSQVGDRNT  1395

Query  1040  RVQVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
              V + G GD T+K  LKD FG++  FLP VA  H+ W L+F   FAYGI FLNFQRR
Sbjct  1396  VVYITGIGDTTLKTLLKDGFGFEQDFLPVVAVVHIAWILVFLVFFAYGIKFLNFQRR  1452



>ref|XP_006430269.1| hypothetical protein CICLE_v10010903mg [Citrus clementina]
 gb|ESR43509.1| hypothetical protein CICLE_v10010903mg [Citrus clementina]
Length=1456

 Score =   268 bits (684),  Expect(2) = 1e-131, Method: Compositional matrix adjust.
 Identities = 122/181 (67%), Positives = 143/181 (79%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              +AVPGVPKIK+ YNPATWMLE+S   +E Q GVDFAEIYANS LHQRNQELIKELSTP 
Sbjct  1103  FEAVPGVPKIKDAYNPATWMLEVSNISVENQLGVDFAEIYANSSLHQRNQELIKELSTPE  1162

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             PGS +L+FPTKYSQ F  Q KA FWKQ+WSYWRNPQYNA+RF +T  + + FG++FW KG
Sbjct  1163  PGSSELHFPTKYSQPFFTQFKASFWKQYWSYWRNPQYNAIRFLMTATIAIFFGLLFWDKG  1222

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
              +   QQDL NLLGA+Y+  +FLG+ N  S    + VERTV+YRERAAGM+SAL YAL Q
Sbjct  1223  QKSSRQQDLQNLLGAMYSVCLFLGTTNAVSAIPVICVERTVYYRERAAGMFSALSYALGQ  1282

Query  624   V  626
             V
Sbjct  1283  V  1283


 Score =   232 bits (591),  Expect(2) = 1e-131, Method: Compositional matrix adjust.
 Identities = 103/175 (59%), Positives = 132/175 (75%), Gaps = 0/175 (0%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  +E IYV  QT+ Y L+LY MIGF+W+LGKF  F+YFM+ SF+ FTLYGMM+VALTPG
Sbjct  1282  QVAVEIIYVTAQTVMYVLILYSMIGFKWELGKFFLFFYFMWASFVIFTLYGMMIVALTPG  1341

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
              Q A I ++F L  WNLFAGF++PR+++PVWWRWYYW SP  W+LYGL+T Q+GD E++V
Sbjct  1342  QQVATIVLSFFLALWNLFAGFMIPRQEIPVWWRWYYWLSPVAWNLYGLVTCQVGDVETQV  1401

Query  1046  QVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
             Q+P    MT+KQF+KD + Y   F+P VA  H+ W  +F FVFAY I  +NFQRR
Sbjct  1402  QIPDGTSMTVKQFVKDNYDYKTDFIPVVAVVHLAWIAVFLFVFAYAIKSINFQRR  1456



>ref|XP_006481825.1| PREDICTED: ABC transporter G family member 34-like [Citrus sinensis]
Length=1456

 Score =   267 bits (683),  Expect(2) = 5e-131, Method: Compositional matrix adjust.
 Identities = 122/181 (67%), Positives = 143/181 (79%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              +AVPGVPKIK+ YNPATWMLE+S   +E Q GVDFAEIYANS LHQRNQELIKELSTP 
Sbjct  1103  FEAVPGVPKIKDAYNPATWMLEVSNISVENQLGVDFAEIYANSSLHQRNQELIKELSTPQ  1162

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             PGS +L+FPTKYSQ F  Q KA FWKQ+WSYWRNPQYNA+RF +T  + + FG++FW KG
Sbjct  1163  PGSSELHFPTKYSQPFFTQFKASFWKQYWSYWRNPQYNAIRFLMTATIAIFFGLLFWDKG  1222

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
              +   QQDL NLLGA+Y+  +FLG+ N  S    + VERTV+YRERAAGM+SAL YAL Q
Sbjct  1223  QKSSRQQDLQNLLGAMYSVCLFLGTTNAVSAIPVICVERTVYYRERAAGMFSALSYALGQ  1282

Query  624   V  626
             V
Sbjct  1283  V  1283


 Score =   230 bits (586),  Expect(2) = 5e-131, Method: Compositional matrix adjust.
 Identities = 104/175 (59%), Positives = 131/175 (75%), Gaps = 0/175 (0%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  +E IYV  QT+ Y L+LY MIGF+W+LGKF  F+YFM+ SF+ FTLYGMM+VALTPG
Sbjct  1282  QVAVEIIYVTAQTVMYVLILYSMIGFKWELGKFFLFFYFMWASFVIFTLYGMMIVALTPG  1341

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
              Q A I ++F L  WNLFAGF++PR+++PVWWRWYYW SP  W+LYGL+T Q+GD E+ V
Sbjct  1342  QQVATIVLSFFLALWNLFAGFMIPREEIPVWWRWYYWLSPVAWNLYGLVTCQVGDIETLV  1401

Query  1046  QVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
             Q+P    MT+KQF+KD + Y   FLP VA  H+ W  +F FVFAY I  +NFQRR
Sbjct  1402  QIPDGTSMTVKQFVKDNYDYKTSFLPVVAVVHLAWIGVFLFVFAYAIKSINFQRR  1456



>gb|ADE77370.1| unknown [Picea sitchensis]
Length=412

 Score =   280 bits (716),  Expect(2) = 7e-131, Method: Compositional matrix adjust.
 Identities = 127/180 (71%), Positives = 148/180 (82%), Gaps = 0/180 (0%)
 Frame = +3

Query  84   LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
             +A+PGVPKI++GYNPATWMLEIS+   E   GVDFAE+Y+NSPL QRNQ LIKELSTP 
Sbjct  58   FEAIPGVPKIRDGYNPATWMLEISSPAAETHLGVDFAEVYSNSPLFQRNQALIKELSTPV  117

Query  264  PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
            PGS+DLYFPTKYSQSF  QC AC WKQHWSYWRNP YN VRFF T V  ++FG IFWG G
Sbjct  118  PGSRDLYFPTKYSQSFRVQCIACLWKQHWSYWRNPTYNVVRFFFTTVTALLFGSIFWGLG  177

Query  444  DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
             + + QQDL N+LGA+YA+ IFLG  N+S+VQ  V V+RTVFYRE+AAGMYSA+PYA+AQ
Sbjct  178  SKTYKQQDLFNVLGAMYASTIFLGVSNSSTVQPVVGVQRTVFYREKAAGMYSAIPYAVAQ  237


 Score =   217 bits (552),  Expect(2) = 7e-131, Method: Compositional matrix adjust.
 Identities = 105/178 (59%), Positives = 132/178 (74%), Gaps = 1/178 (1%)
 Frame = +2

Query  680   ILQAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALT  859
             + Q  IE  Y+ +QT  YSL++Y MI F+W   KF WF ++MF  F+YFTLYGMM VALT
Sbjct  235   VAQTAIEIPYILIQTTIYSLIVYSMIDFQWTTVKFFWFLFYMFMCFVYFTLYGMMAVALT  294

Query  860   PGVQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKES  1039
             PG Q AAI  +F   FWN+F+GF++ R Q+PVWWRWYYWA+P  W+LYGLITSQLGD   
Sbjct  295   PGHQIAAIVSSFFYGFWNIFSGFLITRPQIPVWWRWYYWANPVAWTLYGLITSQLGDLTG  354

Query  1040  RVQVPGEGD-MTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
              V+V GE D M+++QFL+ +FGY + FL  VAA HVG  +LFF VFA+GI +LNFQRR
Sbjct  355   FVEVAGEKDTMSVQQFLEGYFGYRHDFLGVVAAVHVGIVILFFSVFAFGIKYLNFQRR  412



>ref|XP_002313659.2| hypothetical protein POPTR_0009s14940g [Populus trichocarpa]
 gb|EEE87614.2| hypothetical protein POPTR_0009s14940g [Populus trichocarpa]
Length=1364

 Score =   267 bits (683),  Expect(2) = 7e-131, Method: Compositional matrix adjust.
 Identities = 118/175 (67%), Positives = 146/175 (83%), Gaps = 0/175 (0%)
 Frame = +3

Query  102   VPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPPPGSQDL  281
             VP+IK G NPATWMLEIS+  IEAQ  VDFAE+YANS L+++NQELIK+LSTP PGS+DL
Sbjct  1017  VPRIKQGSNPATWMLEISSEAIEAQLQVDFAEVYANSELYRKNQELIKKLSTPRPGSKDL  1076

Query  282   YFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKGDEIHNQ  461
              FP++YSQSF+ QC ACFWKQH SYWRN ++N  RF V I++G++FG++FW +GD I+ +
Sbjct  1077  SFPSQYSQSFITQCTACFWKQHKSYWRNSEFNYTRFVVAIIIGILFGLVFWSRGDRIYKR  1136

Query  462   QDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQV  626
              DL+NLLGA YAAV+FLG+ N S+VQ+ +A ERTVFYRERAAGMYS LPYA A V
Sbjct  1137  NDLINLLGATYAAVLFLGATNASAVQSVIATERTVFYRERAAGMYSELPYAFAHV  1191


 Score =   229 bits (585),  Expect(2) = 7e-131, Method: Compositional matrix adjust.
 Identities = 103/175 (59%), Positives = 137/175 (78%), Gaps = 0/175 (0%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
                IE IYV++QT  YSLLLY MIGFEW +GKFL+FYYF+F SF YF++YGMM+++LTPG
Sbjct  1190  HVAIEIIYVSIQTFLYSLLLYSMIGFEWNVGKFLYFYYFIFMSFTYFSMYGMMIISLTPG  1249

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
              + AA+ M+F ++FWNLF+G+++ R  +PVWWRWYYWASP  W++YG+ TSQ+ DK + +
Sbjct  1250  PEIAAVFMSFFISFWNLFSGYLIARPLIPVWWRWYYWASPVAWTIYGIFTSQVVDKNTLL  1309

Query  1046  QVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
             ++PG   + +K F++ + GYD+ FL  V  AHVGW LLFFF FAYGI FLNFQRR
Sbjct  1310  EIPGSEPVPLKAFVEKYLGYDHEFLLPVVLAHVGWVLLFFFAFAYGIKFLNFQRR  1364



>gb|KHN18744.1| ABC transporter G family member 39 [Glycine soja]
Length=1424

 Score =   271 bits (692),  Expect(2) = 9e-131, Method: Compositional matrix adjust.
 Identities = 121/182 (66%), Positives = 147/182 (81%), Gaps = 0/182 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              +A+ G+ KIK+GYNPATWML+IST  +EAQ  +DFA+IY NS L+Q NQELIKELSTP 
Sbjct  1071  FEAIAGIQKIKDGYNPATWMLDISTPSMEAQLDIDFAKIYVNSTLYQMNQELIKELSTPT  1130

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             PGS+DL+FPTKYSQSF  Q KAC WKQ+WSYWRNP YN +RFF T+  GVMFG+IFW + 
Sbjct  1131  PGSKDLFFPTKYSQSFFVQWKACLWKQYWSYWRNPPYNGIRFFFTLAYGVMFGLIFWKRA  1190

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
             + I  QQDL +LLGA+++ V+FLG++N   VQ  V +ERTV YRERAAGMYSALPYAL Q
Sbjct  1191  ENIQKQQDLFDLLGAMFSTVMFLGTMNAVGVQPVVDIERTVLYRERAAGMYSALPYALGQ  1250

Query  624   VI  629
             V+
Sbjct  1251  VV  1252


 Score =   225 bits (574),  Expect(2) = 9e-131, Method: Compositional matrix adjust.
 Identities = 95/175 (54%), Positives = 135/175 (77%), Gaps = 0/175 (0%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  IE +Y ++QT+ Y+++++ M+GF+W +GKFL FYY+M   FIYFTLYGMM +ALTP 
Sbjct  1250  QVVIEIMYSSIQTVMYTIIIHSMMGFKWNVGKFLSFYYYMLMCFIYFTLYGMMTIALTPS  1309

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
              Q A+I ++F L  WNLF+GF +PR ++PVWWRW+YWA+P  W++YGL+TSQLGD+ +++
Sbjct  1310  YQIASICISFFLCIWNLFSGFFIPRVEIPVWWRWFYWATPNAWTIYGLVTSQLGDEIAQI  1369

Query  1046  QVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
              VPG   M +K+ LK+  G+DY FLP VA  HVGW ++F F+F +G+ FLNFQ+R
Sbjct  1370  DVPGAKSMGLKELLKENMGFDYDFLPVVAIVHVGWVIIFLFLFVFGVKFLNFQKR  1424



>ref|XP_010519283.1| PREDICTED: ABC transporter G family member 39-like [Tarenaya 
hassleriana]
Length=1441

 Score =   288 bits (737),  Expect(2) = 3e-130, Method: Compositional matrix adjust.
 Identities = 131/181 (72%), Positives = 154/181 (85%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              +AVPGVP+IK+GYNPATWML++ST  +E Q GVDFAEIYANS L+QRNQELIKE+STP 
Sbjct  1088  FEAVPGVPEIKDGYNPATWMLDVSTPSMETQLGVDFAEIYANSSLYQRNQELIKEISTPR  1147

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
              GS DLYFPTKYSQSF  QCKACFWKQ  SYWRNPQYNA+RF +T+V+GV+FG+I+W KG
Sbjct  1148  RGSDDLYFPTKYSQSFSTQCKACFWKQFNSYWRNPQYNAIRFLMTVVIGVLFGLIYWQKG  1207

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
              +I  QQDL N  GA+YAA++FLG+ N  +VQ  VAVERTVFYRERAAG+YSA+PYA AQ
Sbjct  1208  TKIEKQQDLNNFFGAMYAAIMFLGATNAVTVQPVVAVERTVFYRERAAGLYSAIPYAFAQ  1267

Query  624   V  626
             V
Sbjct  1268  V  1268


 Score =   207 bits (526),  Expect(2) = 3e-130, Method: Compositional matrix adjust.
 Identities = 102/175 (58%), Positives = 132/175 (75%), Gaps = 0/175 (0%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  +E IY   Q + YSL+LY MIG++WK+ KFLWF+Y++ T FIYFTLYGMMLVALTP 
Sbjct  1267  QVAVEMIYNLAQAVIYSLILYSMIGYDWKVVKFLWFFYYIVTCFIYFTLYGMMLVALTPN  1326

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
                A I M+F L  WNLF+GFI+PR ++PVW RWYYWASP  W+LYG++TSQ+GD E+ V
Sbjct  1327  YHIAGICMSFFLVLWNLFSGFIIPRPEIPVWCRWYYWASPVAWTLYGIVTSQIGDNETSV  1386

Query  1046  QVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
             Q+PG GD++++  LKD  G+D+ FLP VA  HV W ++F FVFA  I + NFQ+R
Sbjct  1387  QIPGLGDISLRVLLKDGLGFDHDFLPIVAIVHVVWIVVFVFVFAISIKYFNFQKR  1441



>ref|XP_006345864.1| PREDICTED: pleiotropic drug resistance protein 2-like [Solanum 
tuberosum]
Length=1478

 Score =   278 bits (711),  Expect(2) = 7e-130, Method: Compositional matrix adjust.
 Identities = 132/181 (73%), Positives = 158/181 (87%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              Q+VPGVP +K GYNPATWML+I+T  +E Q  VDF +IYANS L++RNQELIK+LS P 
Sbjct  1125  FQSVPGVPTVKEGYNPATWMLDITTPAVEGQLNVDFGDIYANSDLYRRNQELIKQLSVPV  1184

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             PGSQDL+FPTKYSQ FV+QCKACFWKQH SYWR+PQYNAVRFF+T ++G++FG+IFW KG
Sbjct  1185  PGSQDLHFPTKYSQPFVDQCKACFWKQHLSYWRHPQYNAVRFFMTAIIGIIFGIIFWDKG  1244

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
             ++++  QDLLNLLGA+YAAV+FLG  NTS+VQ+ VAVERTVFYRER AGMYSALPYA AQ
Sbjct  1245  NKMYKLQDLLNLLGAMYAAVMFLGGTNTSTVQSVVAVERTVFYRERGAGMYSALPYAFAQ  1304

Query  624   V  626
             V
Sbjct  1305  V  1305


 Score =   216 bits (549),  Expect(2) = 7e-130, Method: Compositional matrix adjust.
 Identities = 112/175 (64%), Positives = 138/175 (79%), Gaps = 0/175 (0%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  IE IY+A+QT+ YSLLLY MIGF W   KF WFY+F+F  F+YFT+YGMMLVALTP 
Sbjct  1304  QVAIETIYIAIQTVIYSLLLYSMIGFHWTAAKFFWFYFFIFMCFVYFTMYGMMLVALTPN  1363

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
              Q AAI M F L+FWNLF+GF++PR Q+P+WWRWYYW SP  W++YGL+TS +GDK   V
Sbjct  1364  YQIAAIVMTFFLSFWNLFSGFLIPRLQIPIWWRWYYWGSPVAWTIYGLVTSLVGDKNDNV  1423

Query  1046  QVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
             +VPG G++ +K FLKD+ G++Y FL  VA AHV W++LF FVFAYGI FLNFQRR
Sbjct  1424  EVPGVGEIPLKLFLKDYLGFEYDFLGVVAVAHVAWAVLFSFVFAYGIKFLNFQRR  1478



>ref|XP_006430268.1| hypothetical protein CICLE_v10010902mg [Citrus clementina]
 gb|ESR43508.1| hypothetical protein CICLE_v10010902mg [Citrus clementina]
Length=1458

 Score =   279 bits (713),  Expect(2) = 1e-129, Method: Compositional matrix adjust.
 Identities = 129/182 (71%), Positives = 148/182 (81%), Gaps = 0/182 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              +AVPGVP+I NGYNPATWMLEIST   EAQ  VDFAEIY  S L+QRN+ELIKELSTP 
Sbjct  1104  FEAVPGVPRITNGYNPATWMLEISTPTAEAQLNVDFAEIYVRSSLYQRNEELIKELSTPA  1163

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             PGS DLYFPT+YSQ F+ QCKACFWKQ  SYWR+PQYNA+RF VTIV+G++FG+IFW KG
Sbjct  1164  PGSSDLYFPTQYSQPFLIQCKACFWKQRQSYWRDPQYNALRFAVTIVVGLLFGLIFWDKG  1223

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
              +   QQDL NL GA+Y AV FLGS N +SV + V+ ERTVFYRERAAGMYS L YA +Q
Sbjct  1224  QKTKKQQDLQNLFGALYCAVFFLGSTNANSVMSVVSTERTVFYRERAAGMYSTLAYAFSQ  1283

Query  624   VI  629
             V+
Sbjct  1284  VL  1285


 Score =   214 bits (544),  Expect(2) = 1e-129, Method: Compositional matrix adjust.
 Identities = 101/176 (57%), Positives = 124/176 (70%), Gaps = 1/176 (1%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  IE IYVA QT+ Y L+LY M+GF WK  +F WF Y +  SF+ FTLYGMM+VALTP 
Sbjct  1283  QVLIELIYVAFQTVVYVLILYSMMGFAWKAKRFFWFLYMVMMSFMQFTLYGMMIVALTPA  1342

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
              Q  AI   F L+ WNLF+GF++PR Q+P+WWRWYYW SP  W+LYGL+TSQ+GD E  V
Sbjct  1343  PQIGAILSGFFLSLWNLFSGFLIPRVQIPIWWRWYYWLSPVAWTLYGLVTSQVGDIEGNV  1402

Query  1046  QVPGE-GDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
             ++PG    MT+KQ LKD FG+ Y FLP VA   + W L+F FVF   I  +NFQRR
Sbjct  1403  EIPGSTATMTVKQLLKDSFGFKYDFLPVVAVVKLVWLLVFVFVFTLAITLINFQRR  1458



>ref|XP_006851555.1| hypothetical protein AMTR_s00040p00185210 [Amborella trichopoda]
 gb|ERN13136.1| hypothetical protein AMTR_s00040p00185210 [Amborella trichopoda]
Length=1530

 Score =   289 bits (740),  Expect(2) = 1e-129, Method: Compositional matrix adjust.
 Identities = 130/181 (72%), Positives = 152/181 (84%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              +AVPGVPKIK+GYNPATWMLE+S+  +EAQ GVDFAEIYANS L++ NQ+LIKEL+TP 
Sbjct  1177  FEAVPGVPKIKDGYNPATWMLEVSSPAVEAQLGVDFAEIYANSSLYEGNQKLIKELNTPA  1236

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             PGS+DLYFPTKYSQSF  QC ACFWKQHWSYWRNPQYNAVRFF+T+ + ++FG IFW  G
Sbjct  1237  PGSKDLYFPTKYSQSFRTQCIACFWKQHWSYWRNPQYNAVRFFMTLTIALLFGTIFWNTG  1296

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
              +   QQDL NL+GA+YAA +FLG+ N  SV   V +ERTVFYRERA+GMYSALPYA AQ
Sbjct  1297  RKTKKQQDLFNLVGAMYAATLFLGATNAMSVGPIVGIERTVFYRERASGMYSALPYAFAQ  1356

Query  624   V  626
             V
Sbjct  1357  V  1357


 Score =   203 bits (517),  Expect(2) = 1e-129, Method: Compositional matrix adjust.
 Identities = 106/175 (61%), Positives = 133/175 (76%), Gaps = 0/175 (0%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q GIE +Y+AVQT  YS+LL+ MI F W+ GKF +F YFMF  FIYFTLYGMM+VALTPG
Sbjct  1356  QVGIEVVYIAVQTTMYSVLLFSMINFGWEAGKFFYFLYFMFMCFIYFTLYGMMVVALTPG  1415

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
              Q AAI M+F L+FWNLFAGF++ R  +P+WWRWYYW  P  W+LYGLITSQ+G  +  +
Sbjct  1416  YQIAAICMSFFLSFWNLFAGFLITRPLIPIWWRWYYWVCPVAWTLYGLITSQVGQIDHEM  1475

Query  1046  QVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
             Q+PG+   T+++FLK+  GY+Y FL AV   HVG  +LF  VFA+GI +LNFQRR
Sbjct  1476  QIPGQDPQTVREFLKNSLGYEYSFLGAVVGVHVGIVVLFVLVFAFGIKYLNFQRR  1530



>ref|XP_008442814.1| PREDICTED: ABC transporter G family member 39-like [Cucumis melo]
Length=1416

 Score =   258 bits (660),  Expect(2) = 3e-129, Method: Compositional matrix adjust.
 Identities = 111/181 (61%), Positives = 148/181 (82%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
             L+A+PGVPKI++G NPATWMLE++   +EA+  +DFA+ +ANSPL++RNQELI +LSTP 
Sbjct  1063  LEAIPGVPKIEDGQNPATWMLEVTAPPMEAKLNIDFAKTFANSPLYRRNQELIMKLSTPT  1122

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
              GS DL F  ++S+SF  QCKACFWKQH SYW++ QYNA+RFF+TI LG++FG++FW KG
Sbjct  1123  EGSDDLRFSNEHSKSFFSQCKACFWKQHHSYWQHTQYNAIRFFITIFLGILFGLVFWNKG  1182

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
              +  N+ D+LN++GA+YAA++FLG  N S+V A V +ER VFYRE+ AGMYSALPYA +Q
Sbjct  1183  QKFANESDVLNIMGAMYAAILFLGIFNASTVVAVVGIERVVFYREKVAGMYSALPYAFSQ  1242

Query  624   V  626
             V
Sbjct  1243  V  1243


 Score =   233 bits (595),  Expect(2) = 3e-129, Method: Compositional matrix adjust.
 Identities = 105/175 (60%), Positives = 132/175 (75%), Gaps = 0/175 (0%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  IE IY++VQ + Y LLLY MIGFEWKLGKFL FYY     FIYFT +GMM+VALTP 
Sbjct  1242  QVAIETIYISVQALIYCLLLYSMIGFEWKLGKFLLFYYLFLMCFIYFTFFGMMVVALTPN  1301

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
                A++ + F ++ WNLFAGF++PR  +P+WWRWYYWASP  W++YGL+ SQ+GDK+  +
Sbjct  1302  HHIASVFVLFFISLWNLFAGFLIPRPLIPIWWRWYYWASPVAWTIYGLVASQVGDKDVEI  1361

Query  1046  QVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
             ++PG G+  ++ FLK  FGYDY F+P V AAHV W L+FFFVFA GI F NFQRR
Sbjct  1362  EIPGFGNAALQMFLKQQFGYDYDFIPTVVAAHVVWVLIFFFVFACGIKFFNFQRR  1416



>ref|XP_010312549.1| PREDICTED: pleiotropic drug resistance protein 2-like [Solanum 
lycopersicum]
Length=1468

 Score =   280 bits (717),  Expect(2) = 3e-129, Method: Compositional matrix adjust.
 Identities = 126/181 (70%), Positives = 153/181 (85%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              Q++PGVP IK GYNPATWML+IS+  +EAQ  VDF  IY NS L++RNQELIKELS P 
Sbjct  1115  FQSIPGVPGIKEGYNPATWMLDISSPAVEAQLQVDFTHIYVNSELYRRNQELIKELSIPA  1174

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             PGS+DL+FPT++SQ F EQCKACFWKQH SYWR+PQYNA RF +T ++GV+FG+IFW KG
Sbjct  1175  PGSKDLHFPTEFSQPFFEQCKACFWKQHLSYWRHPQYNAFRFAMTTMIGVIFGIIFWNKG  1234

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
             +++   QDLLN++GA+YAAV+FLG  NT +VQ+ VAVERTVFYRE+AAGMYSALPYA AQ
Sbjct  1235  NQLFKLQDLLNIVGAMYAAVMFLGGTNTLAVQSIVAVERTVFYREKAAGMYSALPYAFAQ  1294

Query  624   V  626
             V
Sbjct  1295  V  1295


 Score =   211 bits (537),  Expect(2) = 3e-129, Method: Compositional matrix adjust.
 Identities = 106/175 (61%), Positives = 137/175 (78%), Gaps = 0/175 (0%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  IE IY+A+QT  YS +LY MIGF W +GKF  FY+F+F  F+YFT+YGMMLVALTP 
Sbjct  1294  QVAIETIYIAIQTFIYSFILYAMIGFHWTVGKFFLFYFFVFMCFVYFTMYGMMLVALTPN  1353

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
                AAI M+F L+FWNLF+GF++PR Q+P+WWRWYYWASP  W++YGL+TSQ+GDK + +
Sbjct  1354  YHIAAIVMSFFLSFWNLFSGFVIPRTQIPIWWRWYYWASPVAWTIYGLVTSQIGDKNNPI  1413

Query  1046  QVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
              +PG G+++IK +LKD FG++Y FL  VA  HV W++ F FVFAY I FLNFQ+R
Sbjct  1414  VIPGGGEVSIKLYLKDSFGFEYDFLGVVAVVHVAWAVFFCFVFAYAIKFLNFQKR  1468



>ref|XP_008458615.1| PREDICTED: LOW QUALITY PROTEIN: pleiotropic drug resistance protein 
2-like [Cucumis melo]
Length=1443

 Score =   271 bits (693),  Expect(2) = 3e-129, Method: Compositional matrix adjust.
 Identities = 130/181 (72%), Positives = 156/181 (86%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              +A+ GVPKIK GYNPATWMLE+S+A +EAQ  VDFAEIYANS L+Q+NQ LIK+LSTP 
Sbjct  1090  FEAIQGVPKIKEGYNPATWMLEVSSAAVEAQLDVDFAEIYANSNLYQKNQILIKDLSTPQ  1149

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
               S+DLYFPTKYSQ F+ QCKACFWKQHWSYWRN +YNA+RFF+TI++G++FG+IFWGKG
Sbjct  1150  EESKDLYFPTKYSQGFITQCKACFWKQHWSYWRNSRYNAIRFFMTIIIGILFGIIFWGKG  1209

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
             + I  QQDL+NLLGAIY+AV+FLG+ N S+ Q  V++ER VFYRERAAGMYS LPYA AQ
Sbjct  1210  NIIEKQQDLMNLLGAIYSAVLFLGATNASAAQTVVSIERMVFYRERAAGMYSELPYAFAQ  1269

Query  624   V  626
             V
Sbjct  1270  V  1270


 Score =   220 bits (560),  Expect(2) = 3e-129, Method: Compositional matrix adjust.
 Identities = 107/175 (61%), Positives = 133/175 (76%), Gaps = 0/175 (0%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  IE IYVA+QTI Y LLLY MIGFEWK  KF +FYYF+F  F YF++YGMM+VALTPG
Sbjct  1269  QVAIETIYVAIQTIIYVLLLYSMIGFEWKADKFFYFYYFVFMCFTYFSMYGMMVVALTPG  1328

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
              Q AA+ M+F L FWNLF+GF++PR  +PVWWRWYYWASP  W++YG++ SQLGDK + +
Sbjct  1329  PQLAAVIMSFFLNFWNLFSGFLIPRLLIPVWWRWYYWASPVAWTIYGIVASQLGDKTNFL  1388

Query  1046  QVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
             ++PG   M + +FLK   G+D+ FL  +   H+GW  LF FVFAYGI FLNFQRR
Sbjct  1389  EIPGSEPMRVNEFLKKNLGFDHDFLIPLVIGHLGWVFLFLFVFAYGIRFLNFQRR  1443



>ref|XP_006481824.1| PREDICTED: ABC transporter G family member 34-like [Citrus sinensis]
Length=1458

 Score =   278 bits (710),  Expect(2) = 6e-129, Method: Compositional matrix adjust.
 Identities = 128/182 (70%), Positives = 148/182 (81%), Gaps = 0/182 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              +AVPGVP+I NGYNPATWMLEIST   EAQ  VDFA+IY  S L+QRN+ELIKELSTP 
Sbjct  1104  FEAVPGVPRITNGYNPATWMLEISTPTAEAQLNVDFADIYVRSSLYQRNEELIKELSTPA  1163

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             PGS DLYFPT+YSQ F+ QCKACFWKQ  SYWR+PQYNA+RF VTIV+G++FG+IFW KG
Sbjct  1164  PGSSDLYFPTQYSQPFLIQCKACFWKQRQSYWRDPQYNALRFAVTIVVGLLFGLIFWDKG  1223

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
              +   QQDL NL GA+Y AV FLGS N +SV + V+ ERTVFYRERAAGMYS L YA +Q
Sbjct  1224  QKTKKQQDLQNLFGALYCAVFFLGSTNANSVMSVVSTERTVFYRERAAGMYSTLAYAFSQ  1283

Query  624   VI  629
             V+
Sbjct  1284  VL  1285


 Score =   213 bits (542),  Expect(2) = 6e-129, Method: Compositional matrix adjust.
 Identities = 101/176 (57%), Positives = 123/176 (70%), Gaps = 1/176 (1%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  IE IYVA QT+ Y L+LY M+GF WK  +F WF Y +  SF+ FTLYGMM+VALTP 
Sbjct  1283  QVLIELIYVAFQTVVYVLILYSMMGFAWKAKRFFWFLYMVMMSFMQFTLYGMMIVALTPA  1342

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
              Q  AI   F L+ WNLF+GF++PR Q+P+WWRWYYW SP  W+LYGL+TSQ+GD E  V
Sbjct  1343  PQIGAILSGFFLSLWNLFSGFLIPRVQIPIWWRWYYWLSPVAWTLYGLVTSQVGDIEGNV  1402

Query  1046  QVPGE-GDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
             ++PG    MT+KQ LKD FG+ Y FLP VA   + W L F FVF   I  +NFQRR
Sbjct  1403  EIPGSTATMTVKQLLKDSFGFKYDFLPVVAVVKLVWLLAFVFVFTLAITLINFQRR  1458



>gb|KDO61074.1| hypothetical protein CISIN_1g0005062mg, partial [Citrus sinensis]
Length=589

 Score =   277 bits (708),  Expect(2) = 8e-129, Method: Compositional matrix adjust.
 Identities = 128/182 (70%), Positives = 148/182 (81%), Gaps = 0/182 (0%)
 Frame = +3

Query  84   LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
             +AVPGVP+I NGYNPATWMLEIST   EAQ  VDFA+IY  S L+QRN+ELIKELSTP 
Sbjct  235  FEAVPGVPRITNGYNPATWMLEISTPTAEAQLNVDFADIYVRSSLYQRNEELIKELSTPA  294

Query  264  PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
            PGS DLYFPT+YSQ F+ QCKACFWKQ  SYWR+PQYNA+RF VTIV+G++FG+IFW KG
Sbjct  295  PGSSDLYFPTQYSQPFLIQCKACFWKQRQSYWRDPQYNALRFAVTIVVGLLFGLIFWDKG  354

Query  444  DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
             +   QQDL NL GA+Y AV FLGS N +SV + V+ ERTVFYRERAAGMYS L YA +Q
Sbjct  355  QKTKKQQDLQNLFGALYCAVFFLGSTNANSVMSVVSTERTVFYRERAAGMYSTLAYAFSQ  414

Query  624  VI  629
            V+
Sbjct  415  VL  416


 Score =   213 bits (542),  Expect(2) = 8e-129, Method: Compositional matrix adjust.
 Identities = 101/176 (57%), Positives = 123/176 (70%), Gaps = 1/176 (1%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  IE IYVA QT+ Y L+LY M+GF WK  +F WF Y +  SF+ FTLYGMM+VALTP 
Sbjct  414   QVLIELIYVAFQTVVYVLILYSMMGFAWKAKRFFWFLYMVMMSFMQFTLYGMMIVALTPA  473

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
              Q  AI   F L+ WNLF+GF++PR Q+P+WWRWYYW SP  W+LYGL+TSQ+GD E  V
Sbjct  474   PQIGAILSGFFLSLWNLFSGFLIPRVQIPIWWRWYYWLSPVAWTLYGLVTSQVGDIEGNV  533

Query  1046  QVPGE-GDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
             ++PG    MT+KQ LKD FG+ Y FLP VA   + W L F FVF   I  +NFQRR
Sbjct  534   EIPGSTATMTVKQLLKDSFGFKYDFLPVVAVVKLVWLLAFVFVFTLAITLINFQRR  589



>ref|XP_004170354.1| PREDICTED: LOW QUALITY PROTEIN: pleiotropic drug resistance protein 
2-like [Cucumis sativus]
Length=1443

 Score =   268 bits (685),  Expect(2) = 8e-129, Method: Compositional matrix adjust.
 Identities = 130/181 (72%), Positives = 154/181 (85%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              +A+ GVPKIK GYNPATWMLE+S+A +EAQ  VDFAEIYANS L+Q NQ LIKELSTP 
Sbjct  1090  FEAIQGVPKIKEGYNPATWMLEVSSATVEAQLDVDFAEIYANSNLYQTNQILIKELSTPQ  1149

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
               S DLYFPTKYSQ F+ QCKACFWKQHWSYWRN +YNA+RFF+TI++G++FG+IFWGKG
Sbjct  1150  EESNDLYFPTKYSQGFITQCKACFWKQHWSYWRNSRYNAIRFFMTIIIGILFGIIFWGKG  1209

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
             + I  QQDL+N+LGAIY+AV+FLG+ N S+ Q  V++ER VFYRERAAGMYS LPYA AQ
Sbjct  1210  NIIEKQQDLMNVLGAIYSAVLFLGATNASAAQTVVSIERMVFYRERAAGMYSELPYAFAQ  1269

Query  624   V  626
             V
Sbjct  1270  V  1270


 Score =   222 bits (565),  Expect(2) = 8e-129, Method: Compositional matrix adjust.
 Identities = 107/175 (61%), Positives = 134/175 (77%), Gaps = 0/175 (0%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  IE IYVA+QTI Y LLLY MIGFEWK  KF +FYYF+F  F YF++YGMM+VALTPG
Sbjct  1269  QVAIETIYVAIQTIVYVLLLYSMIGFEWKADKFFYFYYFVFMCFTYFSMYGMMVVALTPG  1328

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
              Q AA+ M+F L FWNLF+GF++PR  +PVWWRWYYWASP  W++YG+  SQ+GDK + +
Sbjct  1329  PQVAAVIMSFFLNFWNLFSGFLIPRMLIPVWWRWYYWASPVAWTIYGIFASQIGDKTNFI  1388

Query  1046  QVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
             ++PG   M + +FLK+  G+D+ FL  +   H+GW LLF FVFAYGI FLNFQRR
Sbjct  1389  EIPGSEPMRVNEFLKENLGFDHDFLVPLVIGHLGWVLLFLFVFAYGIKFLNFQRR  1443



>ref|XP_004145784.1| PREDICTED: pleiotropic drug resistance protein 2-like [Cucumis 
sativus]
 gb|KGN46927.1| hypothetical protein Csa_6G151640 [Cucumis sativus]
Length=1443

 Score =   268 bits (685),  Expect(2) = 8e-129, Method: Compositional matrix adjust.
 Identities = 130/181 (72%), Positives = 154/181 (85%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              +A+ GVPKIK GYNPATWMLE+S+A +EAQ  VDFAEIYANS L+Q NQ LIKELSTP 
Sbjct  1090  FEAIQGVPKIKEGYNPATWMLEVSSATVEAQLDVDFAEIYANSNLYQTNQILIKELSTPQ  1149

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
               S DLYFPTKYSQ F+ QCKACFWKQHWSYWRN +YNA+RFF+TI++G++FG+IFWGKG
Sbjct  1150  EESNDLYFPTKYSQGFITQCKACFWKQHWSYWRNSRYNAIRFFMTIIIGILFGIIFWGKG  1209

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
             + I  QQDL+N+LGAIY+AV+FLG+ N S+ Q  V++ER VFYRERAAGMYS LPYA AQ
Sbjct  1210  NIIEKQQDLMNVLGAIYSAVLFLGATNASAAQTVVSIERMVFYRERAAGMYSELPYAFAQ  1269

Query  624   V  626
             V
Sbjct  1270  V  1270


 Score =   221 bits (564),  Expect(2) = 8e-129, Method: Compositional matrix adjust.
 Identities = 107/175 (61%), Positives = 134/175 (77%), Gaps = 0/175 (0%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  IE IYVA+QTI Y LLLY MIGFEWK  KF +FYYF+F  F YF++YGMM+VALTPG
Sbjct  1269  QVAIETIYVAIQTIVYVLLLYSMIGFEWKADKFFYFYYFVFMCFTYFSMYGMMVVALTPG  1328

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
              Q AA+ M+F L FWNLF+GF++PR  +PVWWRWYYWASP  W++YG+  SQ+GDK + +
Sbjct  1329  PQVAAVIMSFFLNFWNLFSGFLIPRMLIPVWWRWYYWASPVAWTIYGIFASQIGDKTNFI  1388

Query  1046  QVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
             ++PG   M + +FLK+  G+D+ FL  +   H+GW LLF FVFAYGI FLNFQRR
Sbjct  1389  EIPGSEPMRVNEFLKENLGFDHDFLVPLVIGHLGWVLLFLFVFAYGIKFLNFQRR  1443



>ref|XP_007143816.1| hypothetical protein PHAVU_007G104000g [Phaseolus vulgaris]
 gb|ESW15810.1| hypothetical protein PHAVU_007G104000g [Phaseolus vulgaris]
Length=1469

 Score =   269 bits (688),  Expect(2) = 1e-128, Method: Compositional matrix adjust.
 Identities = 118/181 (65%), Positives = 150/181 (83%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              +A+PGVPKIK+GYNPATW LEIS+  +E+Q  VDFAE+Y  S L+QRNQELIKELSTP 
Sbjct  1116  FEAIPGVPKIKDGYNPATWALEISSPEVESQLCVDFAELYTKSELYQRNQELIKELSTPS  1175

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
              G+++L FP KYSQSF+ QC ACFWKQ+ SYWRNPQYNA+R F++I +GV+FG++FW KG
Sbjct  1176  EGTKELDFPNKYSQSFITQCIACFWKQNLSYWRNPQYNAIRLFLSITIGVIFGLVFWKKG  1235

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
              +I  +QDL+NL+GA++ AV F+G  NT+SVQ  VA+ERTV YRE+AAG+YSALPY + Q
Sbjct  1236  KKIDTEQDLMNLMGAVFTAVFFVGGSNTTSVQPIVAIERTVLYREKAAGLYSALPYTIGQ  1295

Query  624   V  626
             V
Sbjct  1296  V  1296


 Score =   220 bits (560),  Expect(2) = 1e-128, Method: Compositional matrix adjust.
 Identities = 104/177 (59%), Positives = 135/177 (76%), Gaps = 0/177 (0%)
 Frame = +2

Query  680   ILQAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALT  859
             I Q  +E IYVA+QT ++SL+L+ M+GF W++ KFLWFY+FMF SF+YFTLYGMM  ALT
Sbjct  1293  IGQVAVECIYVAIQTFTFSLILFSMMGFPWQVDKFLWFYFFMFISFVYFTLYGMMTAALT  1352

Query  860   PGVQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKES  1039
             P  Q AAI MAF L FWN+F+GFI+P+ ++P+WWRWYYW  P  WSLYGL+TSQ+GDK +
Sbjct  1353  PNPQIAAIVMAFFLVFWNVFSGFIIPKSKIPIWWRWYYWVCPTAWSLYGLVTSQVGDKTN  1412

Query  1040  RVQVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
              + VPG   +++K +L++ F Y+YGFL  V  A V +  LF FVFAYGI  LNFQ+R
Sbjct  1413  TILVPGSISLSVKAYLREEFDYEYGFLGVVVVALVAFVTLFLFVFAYGIKVLNFQKR  1469



>emb|CBI28361.3| unnamed protein product [Vitis vinifera]
Length=1545

 Score =   300 bits (768),  Expect(2) = 3e-128, Method: Compositional matrix adjust.
 Identities = 134/181 (74%), Positives = 159/181 (88%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              ++VPGV KIK GYNPATWMLE+ST+ +EAQ  +DFAE+YANS L++RNQ+LI ELSTP 
Sbjct  1139  FESVPGVTKIKEGYNPATWMLEVSTSAVEAQLDIDFAEVYANSALYRRNQDLINELSTPA  1198

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             PGS+DLYFPT+YSQSF+ QCKACFWKQH+SYWRN +YNA+RFF+TIV+GV+FGVIFW KG
Sbjct  1199  PGSKDLYFPTQYSQSFITQCKACFWKQHYSYWRNSEYNAIRFFMTIVIGVLFGVIFWSKG  1258

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
             D+IH QQDL+NLLGA Y+A+IFLG+ N  +VQ  VAVERTVFYRERAAGMYS LP A AQ
Sbjct  1259  DQIHKQQDLINLLGATYSAIIFLGASNAFAVQPVVAVERTVFYRERAAGMYSELPNAFAQ  1318

Query  624   V  626
             V
Sbjct  1319  V  1319


 Score =   188 bits (477),  Expect(2) = 3e-128, Method: Compositional matrix adjust.
 Identities = 91/157 (58%), Positives = 116/157 (74%), Gaps = 0/157 (0%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  IE IYVAVQT+ Y+LLLY MIGF WK+ KF +FYYF+F SF YF++YGMM+ ALTPG
Sbjct  1318  QVAIETIYVAVQTLVYALLLYSMIGFHWKVDKFFYFYYFIFMSFTYFSMYGMMVTALTPG  1377

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
              Q AAI  +F L FWNLF+GF++PR  +P+WWRWYYWASP  W++YG+  SQLGD  S V
Sbjct  1378  HQIAAIVSSFFLNFWNLFSGFLIPRPLIPIWWRWYYWASPVAWTIYGIFASQLGDMTSEV  1437

Query  1046  QVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSL  1156
             ++ G     + +F+KD  G D+ FL  V  AHVGW++
Sbjct  1438  EITGRSPRPVNEFIKDELGLDHDFLVPVVFAHVGWAV  1474


 Score =   100 bits (250),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 47/68 (69%), Positives = 57/68 (84%), Gaps = 1/68 (1%)
 Frame = +3

Query  90    AVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPPPG  269
             AVPG  KIK+GYNPATWMLEIS++ +EA+  +DFAE+YA S L+QRNQELI E  TP PG
Sbjct  1473  AVPGT-KIKDGYNPATWMLEISSSTVEARLDIDFAEVYAYSTLYQRNQELINEPRTPAPG  1531

Query  270   SQDLYFPT  293
             S+DL+FPT
Sbjct  1532  SKDLHFPT  1539



>ref|XP_004515482.1| PREDICTED: pleiotropic drug resistance protein 2-like [Cicer 
arietinum]
Length=1473

 Score =   271 bits (693),  Expect(2) = 4e-128, Method: Compositional matrix adjust.
 Identities = 120/181 (66%), Positives = 152/181 (84%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              +A+ G+PKIK+ YNPATWMLEIS+  +E++  +DFAE+Y  S L+Q NQELIKELS   
Sbjct  1120  FEAITGIPKIKDRYNPATWMLEISSPLVESRLNIDFAELYTKSSLYQSNQELIKELSISA  1179

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             P ++DL+FP+KYSQSF+ QC ACFWKQ+ SYW+NPQY  VRFF+TIV+GVMFG+I+W KG
Sbjct  1180  PETKDLHFPSKYSQSFITQCIACFWKQYCSYWKNPQYIVVRFFITIVIGVMFGLIYWKKG  1239

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
             D++  +QDLLNL+GA+YA+VIFLG+ NTSSVQ  VA+ERTV YRERAAG+YS LPYA+ Q
Sbjct  1240  DKMEKEQDLLNLVGAMYASVIFLGATNTSSVQPIVAIERTVLYRERAAGLYSELPYAIGQ  1299

Query  624   V  626
             V
Sbjct  1300  V  1300


 Score =   216 bits (551),  Expect(2) = 4e-128, Method: Compositional matrix adjust.
 Identities = 106/177 (60%), Positives = 140/177 (79%), Gaps = 0/177 (0%)
 Frame = +2

Query  680   ILQAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALT  859
             I Q  IE +YVA+Q++ YS++LY MIGFE ++  F WFY+F+F SFIYFTLYGMM VALT
Sbjct  1297  IGQVAIEVVYVAIQSLIYSIILYWMIGFEQQVENFFWFYFFIFMSFIYFTLYGMMTVALT  1356

Query  860   PGVQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKES  1039
             P  Q AAI M+F ++FWNLF+GF++PR Q+P+WWRWYYWASP  W++YGL+TSQ+GDK S
Sbjct  1357  PNHQIAAIVMSFFISFWNLFSGFVIPRTQIPIWWRWYYWASPVAWTIYGLVTSQVGDKNS  1416

Query  1040  RVQVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
              ++VPG   MT+K +L+   G+++ FL  VA AH+ +S +F FVFAYGI FLNFQ+R
Sbjct  1417  PIEVPGFRPMTVKDYLERQLGFEHDFLGFVALAHLAFSFIFLFVFAYGIKFLNFQKR  1473



>ref|XP_010683848.1| PREDICTED: ABC transporter G family member 34-like isoform X1 
[Beta vulgaris subsp. vulgaris]
Length=1397

 Score =   261 bits (667),  Expect(2) = 5e-127, Method: Compositional matrix adjust.
 Identities = 116/180 (64%), Positives = 149/180 (83%), Gaps = 0/180 (0%)
 Frame = +3

Query  87    QAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPPP  266
             + +PGVPKIK+GYNPATWML+I+T  +E++  VDFA+IYANS L+Q NQE+I+ELSTP  
Sbjct  1045  EGIPGVPKIKDGYNPATWMLDITTPQVESEVNVDFAQIYANSKLYQTNQEIIRELSTPSH  1104

Query  267   GSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKGD  446
              S+DLYFPTKYSQ F+ Q KACFWKQ+ SYW+N  YN VRFF+TI++GV+ GV+FW KG 
Sbjct  1105  DSEDLYFPTKYSQPFIIQFKACFWKQYRSYWQNSSYNVVRFFMTIIMGVLLGVMFWDKGG  1164

Query  447   EIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQV  626
             ++   QDL+NLLG +++A++FLG  N  +VQ  VA ERTV+YRERAAGMYSALP+ALAQ+
Sbjct  1165  KLGKLQDLMNLLGILFSAILFLGGSNALNVQVVVASERTVYYRERAAGMYSALPFALAQL  1224


 Score =   223 bits (567),  Expect(2) = 5e-127, Method: Compositional matrix adjust.
 Identities = 108/175 (62%), Positives = 136/175 (78%), Gaps = 0/175 (0%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  IEAIY A    +Y+LLLY MIGFEW + KF +FYYF+F  F Y+T+YGMMLV+LTP 
Sbjct  1223  QLAIEAIYTATINSAYALLLYSMIGFEWTVVKFFYFYYFIFMCFAYYTVYGMMLVSLTPR  1282

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
              + +AI M F +T WNLFAGF+LPR Q+P+WWRWYYWASP  W++YGL+TSQ+GDK+S +
Sbjct  1283  HEISAILMTFFVTLWNLFAGFLLPRPQIPIWWRWYYWASPVAWTMYGLVTSQIGDKDSLI  1342

Query  1046  QVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
             +VPG G + +K +LK+  GYDY FLP VA AH+ W +LFF VFAY I FLNFQ+R
Sbjct  1343  EVPGAGSVPLKIYLKELLGYDYDFLPFVAVAHLAWVVLFFIVFAYSIKFLNFQKR  1397



>ref|XP_010683849.1| PREDICTED: ABC transporter G family member 34-like isoform X2 
[Beta vulgaris subsp. vulgaris]
Length=1267

 Score =   261 bits (666),  Expect(2) = 8e-127, Method: Compositional matrix adjust.
 Identities = 116/180 (64%), Positives = 149/180 (83%), Gaps = 0/180 (0%)
 Frame = +3

Query  87    QAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPPP  266
             + +PGVPKIK+GYNPATWML+I+T  +E++  VDFA+IYANS L+Q NQE+I+ELSTP  
Sbjct  915   EGIPGVPKIKDGYNPATWMLDITTPQVESEVNVDFAQIYANSKLYQTNQEIIRELSTPSH  974

Query  267   GSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKGD  446
              S+DLYFPTKYSQ F+ Q KACFWKQ+ SYW+N  YN VRFF+TI++GV+ GV+FW KG 
Sbjct  975   DSEDLYFPTKYSQPFIIQFKACFWKQYRSYWQNSSYNVVRFFMTIIMGVLLGVMFWDKGG  1034

Query  447   EIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQV  626
             ++   QDL+NLLG +++A++FLG  N  +VQ  VA ERTV+YRERAAGMYSALP+ALAQ+
Sbjct  1035  KLGKLQDLMNLLGILFSAILFLGGSNALNVQVVVASERTVYYRERAAGMYSALPFALAQL  1094


 Score =   222 bits (566),  Expect(2) = 8e-127, Method: Compositional matrix adjust.
 Identities = 108/175 (62%), Positives = 136/175 (78%), Gaps = 0/175 (0%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  IEAIY A    +Y+LLLY MIGFEW + KF +FYYF+F  F Y+T+YGMMLV+LTP 
Sbjct  1093  QLAIEAIYTATINSAYALLLYSMIGFEWTVVKFFYFYYFIFMCFAYYTVYGMMLVSLTPR  1152

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
              + +AI M F +T WNLFAGF+LPR Q+P+WWRWYYWASP  W++YGL+TSQ+GDK+S +
Sbjct  1153  HEISAILMTFFVTLWNLFAGFLLPRPQIPIWWRWYYWASPVAWTMYGLVTSQIGDKDSLI  1212

Query  1046  QVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
             +VPG G + +K +LK+  GYDY FLP VA AH+ W +LFF VFAY I FLNFQ+R
Sbjct  1213  EVPGAGSVPLKIYLKELLGYDYDFLPFVAVAHLAWVVLFFIVFAYSIKFLNFQKR  1267



>gb|EPS65201.1| hypothetical protein M569_09576, partial [Genlisea aurea]
Length=1078

 Score =   254 bits (650),  Expect(2) = 2e-126, Method: Compositional matrix adjust.
 Identities = 112/181 (62%), Positives = 143/181 (79%), Gaps = 0/181 (0%)
 Frame = +3

Query  84   LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
             +AV G+PKI+ G NPATWML+I+T  +EA   +DFAEIYANS +H++NQEL+K  S P 
Sbjct  725  FEAVAGIPKIREGQNPATWMLDITTPAVEALLKIDFAEIYANSDMHRKNQELVKRFSYPE  784

Query  264  PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             GS+DL FPTKY+QSF  QC+AC WK + SYWRNP YN++RFF TI +G++FG IFW KG
Sbjct  785  EGSKDLQFPTKYAQSFFTQCRACLWKHNLSYWRNPLYNSIRFFTTIGVGLVFGAIFWKKG  844

Query  444  DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
            ++I   QDL+NLLG +++AV+FLG +N  + QA V VERTV+YRE+A GMYSALPYA AQ
Sbjct  845  NQISKLQDLMNLLGGMFSAVVFLGGMNACAAQAVVDVERTVYYREKATGMYSALPYAFAQ  904

Query  624  V  626
            V
Sbjct  905  V  905


 Score =   227 bits (579),  Expect(2) = 2e-126, Method: Compositional matrix adjust.
 Identities = 103/175 (59%), Positives = 133/175 (76%), Gaps = 0/175 (0%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q GIE IYV +QT+ YSLLLY MIGFEW  G+FLWFY+F+F  FIYFT YGMMLV+LTP 
Sbjct  904   QVGIETIYVGIQTLIYSLLLYSMIGFEWTAGRFLWFYFFVFMCFIYFTAYGMMLVSLTPN  963

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
              Q AA+ ++F L  WNLF+GF++PR Q+P+WWRWYYW+SP  W++YGLITSQ+G K + V
Sbjct  964   YQIAAVILSFFLNCWNLFSGFLIPRTQIPIWWRWYYWSSPVSWTIYGLITSQIGGKRNPV  1023

Query  1046  QVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
             ++PG G + +  FL+ + G+ Y FL  V+A HV W + F  +FA GI FLNFQ+R
Sbjct  1024  EIPGFGSVDLNDFLEVYLGFRYDFLGIVSAVHVLWGIFFCVMFALGIKFLNFQKR  1078



>ref|XP_006430270.1| hypothetical protein CICLE_v10010901mg [Citrus clementina]
 gb|ESR43510.1| hypothetical protein CICLE_v10010901mg [Citrus clementina]
Length=1458

 Score =   278 bits (711),  Expect(2) = 2e-126, Method: Compositional matrix adjust.
 Identities = 123/181 (68%), Positives = 149/181 (82%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              +AVPGVPKIK  YNPATWMLE+S   +E Q G+DFAE+YA+S LHQRN+ELIKELSTPP
Sbjct  1103  FEAVPGVPKIKEAYNPATWMLEVSNISVENQLGIDFAEVYADSSLHQRNKELIKELSTPP  1162

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             PGS DLYFPTKYSQ F+ Q +ACFWKQ+WSYWRNPQYNA+RF +T+V+ + FG+I+W KG
Sbjct  1163  PGSSDLYFPTKYSQPFLTQFRACFWKQYWSYWRNPQYNAIRFGMTLVIAIFFGLIYWDKG  1222

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
              +   QQDL NL GA+Y+  IFLG+ N  SV   + VERTV+YRERAAGM++A+PYALAQ
Sbjct  1223  QKTSKQQDLQNLFGAMYSICIFLGTSNAISVIPVICVERTVYYRERAAGMFAAMPYALAQ  1282

Query  624   V  626
             V
Sbjct  1283  V  1283


 Score =   203 bits (517),  Expect(2) = 2e-126, Method: Compositional matrix adjust.
 Identities = 99/177 (56%), Positives = 132/177 (75%), Gaps = 2/177 (1%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  +E IYV+VQ++ Y L+LY MIGF+W+LGKF  F+YFM+ SFI FTLYGMM+VALTPG
Sbjct  1282  QVAVEIIYVSVQSVVYVLILYAMIGFKWELGKFCLFFYFMWASFIIFTLYGMMIVALTPG  1341

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
              Q A I ++F L+ WNLF+GF++ R  +PVWWRWYYW SP  W+LYGL+T Q+GD ES V
Sbjct  1342  QQVATIVLSFFLSVWNLFSGFLVARSDIPVWWRWYYWLSPVAWNLYGLVTCQVGDLESLV  1401

Query  1046  QVPGEGD--MTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
             ++P   +  MT+KQF++D + +   F+P V+  H+ W  +F FVFAY I  +NFQRR
Sbjct  1402  EIPDGNNTKMTVKQFIEDNYDFKKDFIPVVSIMHIVWMAVFLFVFAYAIKAINFQRR  1458



>ref|XP_006481826.1| PREDICTED: ABC transporter G family member 34-like [Citrus sinensis]
Length=1458

 Score =   278 bits (710),  Expect(2) = 3e-126, Method: Compositional matrix adjust.
 Identities = 123/181 (68%), Positives = 149/181 (82%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              +AVPGVPKIK  YNPATWMLE+S   +E Q G+DFAE+YA+S LHQRN+ELIKELSTPP
Sbjct  1103  FEAVPGVPKIKEAYNPATWMLEVSNISVENQLGIDFAEVYADSSLHQRNKELIKELSTPP  1162

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             PGS DLYFPTKYSQ F+ Q +ACFWKQ+WSYWRNPQYNA+RF +T+V+ + FG+I+W KG
Sbjct  1163  PGSSDLYFPTKYSQPFLTQFRACFWKQYWSYWRNPQYNAIRFGMTLVIAIFFGLIYWDKG  1222

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
              +   QQDL NL GA+Y+  IFLG+ N  SV   + VERTV+YRERAAGM++A+PYALAQ
Sbjct  1223  QKTSKQQDLQNLFGAMYSICIFLGTSNAISVIPVICVERTVYYRERAAGMFAAMPYALAQ  1282

Query  624   V  626
             V
Sbjct  1283  V  1283


 Score =   204 bits (518),  Expect(2) = 3e-126, Method: Compositional matrix adjust.
 Identities = 99/177 (56%), Positives = 132/177 (75%), Gaps = 2/177 (1%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  +E IYV+VQ++ Y L+LY MIGF+W+LGKF  F+YFM+ SFI FTLYGMM+VALTPG
Sbjct  1282  QVAVEIIYVSVQSVVYVLILYAMIGFKWELGKFCLFFYFMWASFIIFTLYGMMIVALTPG  1341

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
              Q A I ++F L+ WNLF+GF++ R  +PVWWRWYYW SP  W+LYGL+T Q+GD ES V
Sbjct  1342  QQVATIVLSFFLSVWNLFSGFLVARSDIPVWWRWYYWLSPVAWNLYGLVTCQVGDLESLV  1401

Query  1046  QVPGEGD--MTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
             ++P   +  MT+KQF++D + +   F+P V+  H+ W  +F FVFAY I  +NFQRR
Sbjct  1402  EIPDGNNTKMTVKQFIEDNYDFKKDFIPVVSIMHIVWMAVFLFVFAYAIKAINFQRR  1458



>ref|XP_004239721.1| PREDICTED: pleiotropic drug resistance protein 2-like [Solanum 
lycopersicum]
Length=1478

 Score =   273 bits (699),  Expect(2) = 3e-126, Method: Compositional matrix adjust.
 Identities = 129/181 (71%), Positives = 156/181 (86%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              Q+VPGVP +K GYNPATWML+I+T  +E Q  VDF +IY NS L++RNQELIK+LS P 
Sbjct  1125  FQSVPGVPTLKEGYNPATWMLDITTPAVEGQLNVDFGDIYTNSDLYRRNQELIKQLSVPV  1184

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             PGSQDL FPTKYSQ FV+QCKACFWKQH SYWR+PQYNA+RFF+T ++G++FG+IFW KG
Sbjct  1185  PGSQDLRFPTKYSQPFVDQCKACFWKQHLSYWRHPQYNAIRFFMTAIIGIIFGIIFWDKG  1244

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
             ++++  QDLLNLLGA+Y+AV+FLG  NTS+VQ+ VAVERTVFYRER AGMYSALPYA AQ
Sbjct  1245  NKMYKLQDLLNLLGAMYSAVMFLGGTNTSTVQSVVAVERTVFYRERGAGMYSALPYAFAQ  1304

Query  624   V  626
             V
Sbjct  1305  V  1305


 Score =   208 bits (529),  Expect(2) = 3e-126, Method: Compositional matrix adjust.
 Identities = 109/175 (62%), Positives = 135/175 (77%), Gaps = 0/175 (0%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  IE IY+A+QT+ YSL+LY MIGF W   KF WFY+F+F SF+YFT+YGMMLVALTP 
Sbjct  1304  QVAIETIYIAIQTVIYSLILYSMIGFHWTAAKFFWFYFFVFMSFVYFTMYGMMLVALTPS  1363

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
                AAI M F LT WNLF+GF++PR Q+P+WWRWYYW SP  W++YGL+TS +GDK   V
Sbjct  1364  YPIAAIVMTFFLTLWNLFSGFLIPRPQIPIWWRWYYWGSPVAWTIYGLVTSIVGDKNDNV  1423

Query  1046  QVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
             +VPG G++ +K FLKD  G+++ FL  VA AHV W++LF  VFAYGI FLNFQRR
Sbjct  1424  EVPGIGEIPLKLFLKDNLGFEFDFLGVVAVAHVAWAVLFSCVFAYGIKFLNFQRR  1478



>ref|XP_002532015.1| ATP-binding cassette transporter, putative [Ricinus communis]
 gb|EEF30370.1| ATP-binding cassette transporter, putative [Ricinus communis]
Length=1211

 Score =   288 bits (737),  Expect(2) = 1e-125, Method: Compositional matrix adjust.
 Identities = 133/181 (73%), Positives = 153/181 (85%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              +AVPGVPKI  GYNPATWMLEIS+A  EAQ  VDFAEIYANS L QRNQELI+ELSTP 
Sbjct  890   FEAVPGVPKITVGYNPATWMLEISSAAAEAQLDVDFAEIYANSELFQRNQELIEELSTPA  949

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             PG++DL FPT+YSQ F  QCKACF KQHWSYW+NP+YNA+R F+TI +G +FG+IFW KG
Sbjct  950   PGAKDLNFPTQYSQDFFTQCKACFVKQHWSYWKNPRYNAIRLFMTIAVGFIFGLIFWDKG  1009

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
              +   QQDL+NLLGA+Y+AV+FLG+ NTSSV + VAVERTVFYRERAAGMYS LPYA AQ
Sbjct  1010  QKTQKQQDLMNLLGAMYSAVMFLGATNTSSVMSIVAVERTVFYRERAAGMYSELPYAFAQ  1069

Query  624   V  626
             V
Sbjct  1070  V  1070


 Score =   191 bits (486),  Expect(2) = 1e-125, Method: Compositional matrix adjust.
 Identities = 95/175 (54%), Positives = 117/175 (67%), Gaps = 32/175 (18%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  IEAIYVA+QT+ YSLLLY MIGF WK   FLWFY+F+F  F+YFTLYGMML      
Sbjct  1069  QVAIEAIYVAIQTLVYSLLLYSMIGFPWKADNFLWFYFFIFMCFMYFTLYGMML------  1122

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
                                       ++P+WWRWYYWASP  W++YGLITSQ+G     V
Sbjct  1123  --------------------------EIPIWWRWYYWASPTAWTIYGLITSQVGKISDNV  1156

Query  1046  QVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
             ++PG+G + +K+FLK+  G++Y FL AVAAAH+G+ LLF FVFAYGI FLNFQRR
Sbjct  1157  EIPGQGFIPVKEFLKEALGFEYDFLGAVAAAHIGFVLLFLFVFAYGIKFLNFQRR  1211



>ref|XP_008339080.1| PREDICTED: pleiotropic drug resistance protein 2-like [Malus 
domestica]
Length=380

 Score =   248 bits (633),  Expect(2) = 1e-125, Method: Compositional matrix adjust.
 Identities = 112/181 (62%), Positives = 142/181 (78%), Gaps = 10/181 (6%)
 Frame = +3

Query  84   LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
             +A+PGVPKIK GYNPATWML++S+A IEAQ  +DFAEI+ANS L++RNQELIKELS P 
Sbjct  37   FEAIPGVPKIKEGYNPATWMLDVSSAAIEAQNDIDFAEIFANSDLYRRNQELIKELSMPQ  96

Query  264  PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             GS+DLYFPT++SQSF+ QCKACFWKQHWSYWRN QYNA+RFF+T+ +G++FG+IFW KG
Sbjct  97   QGSKDLYFPTQFSQSFLTQCKACFWKQHWSYWRNSQYNAIRFFMTVSVGIIFGIIFWNKG  156

Query  444  DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
             +++ QQD++NLLGA Y AV+FLG+ N S+              +   G YS LPYA +Q
Sbjct  157  KKMNTQQDIMNLLGAGYGAVLFLGAGNASAFSTV----------KELLGWYSELPYAFSQ  206

Query  624  V  626
            V
Sbjct  207  V  207


 Score =   231 bits (589),  Expect(2) = 1e-125, Method: Compositional matrix adjust.
 Identities = 105/175 (60%), Positives = 135/175 (77%), Gaps = 0/175 (0%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  IE +YV +QT +YSL+LY MIGF WK+ KFL+FYYF+F  F YF++YGMM VALTPG
Sbjct  206   QVAIETLYVLIQTFAYSLILYGMIGFNWKVDKFLYFYYFIFMCFTYFSMYGMMAVALTPG  265

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
              Q AAI M F ++FWNLF+GF++PR  +P+WWRWYYW SP  W++YGL  SQ+GD ++ V
Sbjct  266   PQIAAIVMGFFMSFWNLFSGFLVPRTLIPIWWRWYYWGSPIAWTIYGLFASQMGDVKTLV  325

Query  1046  QVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
             ++PGE    + QFLKD+ G++  F+  V  AHVGW LLFFF+FAYGI +LNFQRR
Sbjct  326   EIPGEKSKPVNQFLKDYLGFEEDFVIPVVFAHVGWVLLFFFLFAYGIKYLNFQRR  380



>ref|XP_009411967.1| PREDICTED: pleiotropic drug resistance protein 2-like isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=1407

 Score =   279 bits (713),  Expect(2) = 4e-125, Method: Compositional matrix adjust.
 Identities = 125/181 (69%), Positives = 150/181 (83%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              +A+PG+PKI  GYNPATWMLEIS+  +E+   +DF E+YA SPL+Q+NQELIKEL+ P 
Sbjct  1054  FEAIPGIPKITEGYNPATWMLEISSPSVESSVNLDFVEVYACSPLYQKNQELIKELNIPA  1113

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             P S+DLYFPTKYSQ F  QCKACFWKQ+WSYWRNP+YNA+RFF+TIV+G++FG +FW KG
Sbjct  1114  PDSKDLYFPTKYSQRFSIQCKACFWKQYWSYWRNPEYNAIRFFMTIVIGLIFGSVFWQKG  1173

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
              ++  QQD+L +LGAIYAAV FLG+ N   VQ  VAVERTVFYRERAAGMYSAL YA AQ
Sbjct  1174  GKMSKQQDILEILGAIYAAVFFLGATNAIIVQPIVAVERTVFYRERAAGMYSALAYAFAQ  1233

Query  624   V  626
             V
Sbjct  1234  V  1234


 Score =   198 bits (504),  Expect(2) = 4e-125, Method: Compositional matrix adjust.
 Identities = 93/175 (53%), Positives = 125/175 (71%), Gaps = 0/175 (0%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  IE IY+    + YSLLL+PMIGF W+   FLWF++F+   F+YF LYGMM++ALTP 
Sbjct  1233  QVSIELIYIPPMGLLYSLLLFPMIGFSWRADAFLWFFFFIVICFVYFVLYGMMVIALTPN  1292

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
                A+I  +F   FWNLFAGF++ R  +PVWWRWYYW  P  W++YG+++SQLG K+  V
Sbjct  1293  HHIASILSSFFYNFWNLFAGFVIARPLIPVWWRWYYWGDPVSWTIYGIVSSQLGTKDDLV  1352

Query  1046  QVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
              +PG G +T+KQFLKD  G+ + FL  VA AH+G+ LLFF +F Y I +LNFQ++
Sbjct  1353  AIPGAGSLTVKQFLKDNLGFQHSFLGCVALAHLGFVLLFFLIFGYSIKYLNFQKK  1407



>ref|XP_009411968.1| PREDICTED: pleiotropic drug resistance protein 2-like isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=1403

 Score =   279 bits (713),  Expect(2) = 4e-125, Method: Compositional matrix adjust.
 Identities = 125/181 (69%), Positives = 150/181 (83%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              +A+PG+PKI  GYNPATWMLEIS+  +E+   +DF E+YA SPL+Q+NQELIKEL+ P 
Sbjct  1050  FEAIPGIPKITEGYNPATWMLEISSPSVESSVNLDFVEVYACSPLYQKNQELIKELNIPA  1109

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             P S+DLYFPTKYSQ F  QCKACFWKQ+WSYWRNP+YNA+RFF+TIV+G++FG +FW KG
Sbjct  1110  PDSKDLYFPTKYSQRFSIQCKACFWKQYWSYWRNPEYNAIRFFMTIVIGLIFGSVFWQKG  1169

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
              ++  QQD+L +LGAIYAAV FLG+ N   VQ  VAVERTVFYRERAAGMYSAL YA AQ
Sbjct  1170  GKMSKQQDILEILGAIYAAVFFLGATNAIIVQPIVAVERTVFYRERAAGMYSALAYAFAQ  1229

Query  624   V  626
             V
Sbjct  1230  V  1230


 Score =   198 bits (504),  Expect(2) = 4e-125, Method: Compositional matrix adjust.
 Identities = 93/175 (53%), Positives = 125/175 (71%), Gaps = 0/175 (0%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  IE IY+    + YSLLL+PMIGF W+   FLWF++F+   F+YF LYGMM++ALTP 
Sbjct  1229  QVSIELIYIPPMGLLYSLLLFPMIGFSWRADAFLWFFFFIVICFVYFVLYGMMVIALTPN  1288

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
                A+I  +F   FWNLFAGF++ R  +PVWWRWYYW  P  W++YG+++SQLG K+  V
Sbjct  1289  HHIASILSSFFYNFWNLFAGFVIARPLIPVWWRWYYWGDPVSWTIYGIVSSQLGTKDDLV  1348

Query  1046  QVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
              +PG G +T+KQFLKD  G+ + FL  VA AH+G+ LLFF +F Y I +LNFQ++
Sbjct  1349  AIPGAGSLTVKQFLKDNLGFQHSFLGCVALAHLGFVLLFFLIFGYSIKYLNFQKK  1403



>ref|XP_010683850.1| PREDICTED: ABC transporter G family member 39-like [Beta vulgaris 
subsp. vulgaris]
Length=1407

 Score =   247 bits (630),  Expect(2) = 3e-122, Method: Compositional matrix adjust.
 Identities = 111/182 (61%), Positives = 143/182 (79%), Gaps = 0/182 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              +A+ GVPKI+ GYNPATWMLEI++   E+Q  +D+AEIYA S L+QRNQ++I+ELSTP 
Sbjct  1054  FEAIHGVPKIREGYNPATWMLEITSPQAESQMDLDYAEIYAKSELYQRNQDIIRELSTPA  1113

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             P S+DLYF TKYSQ F+ Q KAC WKQ+ SYW+NPQY  VRFF+ I++G + G+IFW KG
Sbjct  1114  PNSKDLYFKTKYSQPFLVQFKACLWKQYRSYWQNPQYTGVRFFMAILMGALIGLIFWNKG  1173

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
              ++   QD+ NLLG +YA ++FLG+ N  +VQ  VA ERTVFYRERAA MYS LP+ALAQ
Sbjct  1174  GKLTKLQDMTNLLGVLYAPIMFLGASNALNVQIVVATERTVFYRERAAIMYSTLPFALAQ  1233

Query  624   VI  629
             ++
Sbjct  1234  LV  1235


 Score =   221 bits (563),  Expect(2) = 3e-122, Method: Compositional matrix adjust.
 Identities = 101/175 (58%), Positives = 126/175 (72%), Gaps = 0/175 (0%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  IE +Y+A+  + Y  LLY MIGFEW +GKFL+FYYF+F  F Y T  GMMLV+LTP 
Sbjct  1233  QLVIETVYLAIVNMIYVPLLYSMIGFEWTIGKFLYFYYFVFMCFTYHTALGMMLVSLTPR  1292

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
              + A+I M    TFWNLFAGF LPR Q+P+WWRW YW SP  W++YGL+TSQ+GDK S +
Sbjct  1293  HEIASIFMTLFATFWNLFAGFFLPRPQIPIWWRWSYWTSPVAWTMYGLVTSQVGDKSSLI  1352

Query  1046  QVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
             ++PG   + +K FLK+  GY+Y FLP V  AH+ W LLFF VFAY I F NFQ+R
Sbjct  1353  EIPGISSVPVKIFLKELLGYEYDFLPVVVVAHLAWVLLFFMVFAYSIKFFNFQKR  1407



>ref|XP_007162868.1| hypothetical protein PHAVU_001G187800g [Phaseolus vulgaris]
 gb|ESW34862.1| hypothetical protein PHAVU_001G187800g [Phaseolus vulgaris]
Length=1419

 Score =   248 bits (633),  Expect(2) = 6e-122, Method: Compositional matrix adjust.
 Identities = 123/181 (68%), Positives = 146/181 (81%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              +A+PGVPKIK+GYNPATWMLEIST   EAQ G+DFA+IY NS L++ NQELIKELSTP 
Sbjct  1066  FEAIPGVPKIKDGYNPATWMLEISTPSYEAQLGIDFADIYVNSTLYRDNQELIKELSTPS  1125

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             P S DL+FPTKYSQSF  QCKACFWKQ+WSYWRNP YN  RF  TI++G++FG+IF  K 
Sbjct  1126  PNSNDLHFPTKYSQSFSVQCKACFWKQYWSYWRNPSYNGPRFVFTILIGIIFGLIFLNKA  1185

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
               I  QQD+ +LLGA+YAAV+FLG+ NT  VQ  + +ERTV YRERAAGMYS L YA++Q
Sbjct  1186  KNIKKQQDIWDLLGAMYAAVMFLGTSNTMGVQPILDIERTVLYRERAAGMYSTLTYAVSQ  1245

Query  624   V  626
             V
Sbjct  1246  V  1246


 Score =   219 bits (558),  Expect(2) = 6e-122, Method: Compositional matrix adjust.
 Identities = 101/177 (57%), Positives = 132/177 (75%), Gaps = 0/177 (0%)
 Frame = +2

Query  680   ILQAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALT  859
             + Q  +E IY A+QT  + +++Y M+GFEWK  KF  FYYF+F   IY+TLYGMM+V+LT
Sbjct  1243  VSQVAVEGIYNAIQTTVFCVIIYSMMGFEWKATKFFSFYYFIFICLIYYTLYGMMIVSLT  1302

Query  860   PGVQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKES  1039
             P  Q A+I  +F LT WN F GFI+PR Q+PVWWRWYYW +P  W+LYG++TSQLGD  +
Sbjct  1303  PSFQIASICNSFFLTVWNTFCGFIIPRTQIPVWWRWYYWLTPNAWTLYGIVTSQLGDDNA  1362

Query  1040  RVQVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
              V++PG  +M +K+ +K+ FGY+Y FLP V   H+GW LLF FVFAYGI FLNFQ+R
Sbjct  1363  EVEIPGAKNMMVKELIKETFGYEYHFLPVVVIVHLGWVLLFLFVFAYGIKFLNFQKR  1419



>ref|XP_004515487.1| PREDICTED: ABC transporter G family member 39-like [Cicer arietinum]
Length=1438

 Score =   257 bits (657),  Expect(2) = 7e-122, Method: Compositional matrix adjust.
 Identities = 113/181 (62%), Positives = 146/181 (81%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              +A+ G+PKI++GYNPA+WML+I++  +E+Q  +DFAE+Y  S L+QRNQELIKELSTP 
Sbjct  1085  FEAIKGIPKIEDGYNPASWMLDITSLVVESQLNIDFAELYIKSGLYQRNQELIKELSTPA  1144

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
              G +DLYFP+K SQSFV QC AC WKQ+ SYWRNPQYNA RFF+TIV GV+FG+ +W KG
Sbjct  1145  LGIKDLYFPSKCSQSFVTQCYACLWKQYLSYWRNPQYNANRFFMTIVFGVIFGLAYWKKG  1204

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
             D++  +QDLLN++G +Y++ IFLG  N + VQ  VA+ER V YRER+AGMYS LPYA+ Q
Sbjct  1205  DKMQKEQDLLNMIGVMYSSCIFLGGANANIVQPVVAIERIVLYRERSAGMYSELPYAIGQ  1264

Query  624   V  626
             V
Sbjct  1265  V  1265


 Score =   209 bits (533),  Expect(2) = 7e-122, Method: Compositional matrix adjust.
 Identities = 94/175 (54%), Positives = 129/175 (74%), Gaps = 0/175 (0%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  IE  YV +Q++ YS++L+ MIGF  ++  FLW Y+F+F SFI FTLYGMM+VALTP 
Sbjct  1264  QVAIEITYVVIQSLVYSIILFSMIGFHQQVEHFLWLYFFIFMSFICFTLYGMMIVALTPN  1323

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
             +Q + I + F    WNLF+GF++P  ++P+WWRWYYWASP  W++ GL+TSQ+GD  + +
Sbjct  1324  LQISTIVITFFTCLWNLFSGFLIPMTKIPIWWRWYYWASPVAWTIDGLVTSQVGDMNNPI  1383

Query  1046  QVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
             +VPG   MT+K +L+  FG+   FL  VA AH+ +SL+F FVFAYGI FLNFQ+R
Sbjct  1384  EVPGFRPMTVKDYLERQFGFRENFLGFVALAHIAFSLVFLFVFAYGIKFLNFQKR  1438



>ref|XP_003625772.1| ABC transporter G family member [Medicago truncatula]
Length=1453

 Score =   253 bits (647),  Expect(2) = 9e-122, Method: Compositional matrix adjust.
 Identities = 117/181 (65%), Positives = 140/181 (77%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              +A+ GVPKIK GYNPATWMLEIS++  EAQ  VDFAEIYANS L++RNQELI+E+STP 
Sbjct  1100  FEAIEGVPKIKVGYNPATWMLEISSSSTEAQLNVDFAEIYANSTLYRRNQELIQEISTPT  1159

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
              GS+DL+FPTKYSQ F  Q KACFWKQ+WSYWRNP YN  RF  TI +G++FG+IFW KG
Sbjct  1160  AGSEDLFFPTKYSQPFFMQFKACFWKQYWSYWRNPPYNCARFIFTISIGLLFGLIFWNKG  1219

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
             +    +QDL NL+GA+Y+ V+ LG+IN   VQ  VA+ER V YRE AA MYS L YA  Q
Sbjct  1220  ETFQKEQDLSNLVGAMYSVVMILGTINVMGVQPVVAMERIVLYRESAARMYSELAYAFGQ  1279

Query  624   V  626
             V
Sbjct  1280  V  1280


 Score =   213 bits (542),  Expect(2) = 9e-122, Method: Compositional matrix adjust.
 Identities = 99/175 (57%), Positives = 128/175 (73%), Gaps = 0/175 (0%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  IE IY  +QT  Y+ L+Y M+GF W   KFL+ YYF+    I+ TLYGMM VALTP 
Sbjct  1279  QVAIEIIYNLIQTAVYTTLIYFMMGFAWNATKFLFLYYFLSMCLIFLTLYGMMTVALTPS  1338

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
              Q A I    L++ WNLF+GFI+PR ++P+WWRWYYWASP  W++YG+ITSQLGDK + +
Sbjct  1339  YQLACIFGPVLMSIWNLFSGFIIPRMKIPIWWRWYYWASPNAWAVYGIITSQLGDKIAEI  1398

Query  1046  QVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
             ++PG G M +K++LK  +G++Y FL  VA AHVGW LLF FVFAY + FLNFQ+R
Sbjct  1399  EIPGVGYMGLKEYLKQTYGFEYHFLSVVAIAHVGWVLLFLFVFAYAMKFLNFQKR  1453



>gb|AES81990.2| drug resistance transporter-like ABC domain protein [Medicago 
truncatula]
Length=1455

 Score =   253 bits (647),  Expect(2) = 1e-121, Method: Compositional matrix adjust.
 Identities = 117/181 (65%), Positives = 140/181 (77%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              +A+ GVPKIK GYNPATWMLEIS++  EAQ  VDFAEIYANS L++RNQELI+E+STP 
Sbjct  1102  FEAIEGVPKIKVGYNPATWMLEISSSSTEAQLNVDFAEIYANSTLYRRNQELIQEISTPT  1161

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
              GS+DL+FPTKYSQ F  Q KACFWKQ+WSYWRNP YN  RF  TI +G++FG+IFW KG
Sbjct  1162  AGSEDLFFPTKYSQPFFMQFKACFWKQYWSYWRNPPYNCARFIFTISIGLLFGLIFWNKG  1221

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
             +    +QDL NL+GA+Y+ V+ LG+IN   VQ  VA+ER V YRE AA MYS L YA  Q
Sbjct  1222  ETFQKEQDLSNLVGAMYSVVMILGTINVMGVQPVVAMERIVLYRESAARMYSELAYAFGQ  1281

Query  624   V  626
             V
Sbjct  1282  V  1282


 Score =   213 bits (541),  Expect(2) = 1e-121, Method: Compositional matrix adjust.
 Identities = 99/175 (57%), Positives = 128/175 (73%), Gaps = 0/175 (0%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  IE IY  +QT  Y+ L+Y M+GF W   KFL+ YYF+    I+ TLYGMM VALTP 
Sbjct  1281  QVAIEIIYNLIQTAVYTTLIYFMMGFAWNATKFLFLYYFLSMCLIFLTLYGMMTVALTPS  1340

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
              Q A I    L++ WNLF+GFI+PR ++P+WWRWYYWASP  W++YG+ITSQLGDK + +
Sbjct  1341  YQLACIFGPVLMSIWNLFSGFIIPRMKIPIWWRWYYWASPNAWAVYGIITSQLGDKIAEI  1400

Query  1046  QVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
             ++PG G M +K++LK  +G++Y FL  VA AHVGW LLF FVFAY + FLNFQ+R
Sbjct  1401  EIPGVGYMGLKEYLKQTYGFEYHFLSVVAIAHVGWVLLFLFVFAYAMKFLNFQKR  1455



>gb|AEG76903.1| putative ATP-binding cassette transporter [Linum usitatissimum]
Length=927

 Score =   234 bits (596),  Expect(2) = 6e-120, Method: Compositional matrix adjust.
 Identities = 106/181 (59%), Positives = 138/181 (76%), Gaps = 0/181 (0%)
 Frame = +3

Query  84   LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
             +AVPGVP+I+ G NPATWML+IS+A +E+Q  VDF+EIY++S L++RNQ+LI+ELSTP 
Sbjct  458  FEAVPGVPRIQEGINPATWMLDISSAAVESQLNVDFSEIYSHSELYKRNQKLIEELSTPA  517

Query  264  PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
            P S+DLYFPT+Y+Q F+ Q  ACF KQ+ SYW+NPQYN  RF +T   G++FG+IFW KG
Sbjct  518  PESRDLYFPTQYAQDFLNQFAACFMKQNRSYWQNPQYNGTRFLLTTGFGLLFGLIFWNKG  577

Query  444  DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
                  QD+ NLLGA Y +V FL +  +S V   V++ERT+ YRE+AAGMYS L YA AQ
Sbjct  578  QHTKKDQDVYNLLGATYCSVAFLAAACSSGVMPVVSIERTILYREKAAGMYSELAYATAQ  637

Query  624  V  626
            V
Sbjct  638  V  638


 Score =   226 bits (577),  Expect(2) = 6e-120, Method: Compositional matrix adjust.
 Identities = 107/177 (60%), Positives = 134/177 (76%), Gaps = 0/177 (0%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  IE IYVA+QT  YS++++ MIG+ W    FLWFY+F  T F+Y+ LYGMML+ALTP 
Sbjct  637   QVSIETIYVALQTFIYSVIIFLMIGYPWHASNFLWFYFFTCTCFLYYALYGMMLLALTPS  696

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
                AAI+M+F LT WNLF+GF++P K++P+WWRWYYWASP  W++YGL  SQLGD ES +
Sbjct  697   YPIAAISMSFFLTIWNLFSGFLIPLKEIPIWWRWYYWASPLAWTVYGLFVSQLGDIESPI  756

Query  1046  QVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR*G  1216
             +V G+G M +KQFLK  FG+DY FLPAVAAAHVG+ LLF F FAYGI  +  Q R G
Sbjct  757   EVVGQGSMPVKQFLKQTFGFDYDFLPAVAAAHVGFVLLFLFAFAYGISSITRQFRRG  813



>emb|CDP04695.1| unnamed protein product [Coffea canephora]
Length=546

 Score =   246 bits (627),  Expect(2) = 2e-118, Method: Compositional matrix adjust.
 Identities = 118/180 (66%), Positives = 140/180 (78%), Gaps = 22/180 (12%)
 Frame = +3

Query  87   QAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPPP  266
            +A+PGVPKIK GYN ATWML++ST+ +EAQ  VDFA IYANS L++RNQELIKELSTP  
Sbjct  216  EAIPGVPKIKEGYNLATWMLDVSTSAMEAQLEVDFAVIYANSELYRRNQELIKELSTP--  273

Query  267  GSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKGD  446
                                ACFWK +WSYWRN QYNA+RFF+T+V G++FGVIFWGKG+
Sbjct  274  --------------------ACFWKHNWSYWRNSQYNAIRFFMTVVFGLIFGVIFWGKGN  313

Query  447  EIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQV  626
             I  QQDL+NLLGAIYAAV++LG+ N S+VQ+ VA+ERTVFYRERAAGMYS LPYA AQV
Sbjct  314  VIFKQQDLINLLGAIYAAVLYLGATNASAVQSVVAIERTVFYRERAAGMYSELPYAFAQV  373


 Score =   209 bits (532),  Expect(2) = 2e-118, Method: Compositional matrix adjust.
 Identities = 102/175 (58%), Positives = 130/175 (74%), Gaps = 0/175 (0%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  +E IYVA+QT+ Y+LLLY MIGF+W   +F +FYYF+F  + YF++YGMM++ALTPG
Sbjct  372   QVAMETIYVAIQTLVYTLLLYSMIGFQWTGQQFFYFYYFIFMCYTYFSMYGMMVIALTPG  431

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
              Q AAI M+F L FWNLF+GF++P   +PVWW WYYW SP  WS+YG+  SQLGD+   +
Sbjct  432   QQIAAIVMSFFLNFWNLFSGFLIPHPLIPVWWSWYYWCSPVAWSIYGIFASQLGDRTKDI  491

Query  1046  QVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
             ++  +  M I +FLKD  GYD+ FL  V  AH+GW LLFF VFAYGI FLNFQRR
Sbjct  492   ELSDKSTMPINKFLKDNLGYDHDFLIPVVFAHLGWVLLFFLVFAYGIKFLNFQRR  546



>ref|XP_002297807.2| hypothetical protein POPTR_0001s14660g [Populus trichocarpa]
 gb|EEE82612.2| hypothetical protein POPTR_0001s14660g [Populus trichocarpa]
Length=1449

 Score =   261 bits (667),  Expect(2) = 2e-116, Method: Compositional matrix adjust.
 Identities = 121/182 (66%), Positives = 140/182 (77%), Gaps = 0/182 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              +A+ GV KIK+GYNPATWMLEIS++  E    VDF+ IY NS L +RN+ LI ELSTP 
Sbjct  1100  FEAIEGVSKIKDGYNPATWMLEISSSAQEMALEVDFSNIYKNSDLFRRNKALIVELSTPA  1159

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             PGS DLYFPTKYS SF+ QC AC WKQHWSYWRNP Y AVRF  T  + +MFG +FW  G
Sbjct  1160  PGSTDLYFPTKYSTSFLTQCMACLWKQHWSYWRNPPYTAVRFLFTTFIALMFGTMFWDLG  1219

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
              ++ + QDL N +G++YAAVIFLG  N SSVQ  VAVERTVFYRERAAGMYSALPYA AQ
Sbjct  1220  SKVDSTQDLFNAMGSMYAAVIFLGVQNASSVQPVVAVERTVFYRERAAGMYSALPYAFAQ  1279

Query  624   VI  629
             V+
Sbjct  1280  VL  1281


 Score =   187 bits (475),  Expect(2) = 2e-116, Method: Compositional matrix adjust.
 Identities = 89/175 (51%), Positives = 118/175 (67%), Gaps = 4/175 (2%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  IE  Y+ VQ   Y +++Y MIGFEW + KF W+ +FM+ + +YFT YGMM VA+TP 
Sbjct  1279  QVLIELPYIFVQAAVYGIIVYAMIGFEWTVVKFFWYLFFMYFTLLYFTFYGMMAVAMTPN  1338

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
                AAI  +     WNLF+GFI+PR  MP+WWRWY WA P  W+LYGL+ SQ GD    +
Sbjct  1339  HHIAAIVSSAFYGIWNLFSGFIIPRPSMPIWWRWYSWACPIAWTLYGLVVSQFGD----I  1394

Query  1046  QVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
             Q       T+K+++KD+FG+D+ FL  VAAA VGW++LF F+FA+ I   NFQRR
Sbjct  1395  QKDLTETQTVKEYVKDYFGFDHDFLGVVAAAIVGWTVLFAFIFAFAIKAFNFQRR  1449



>ref|XP_010249929.1| PREDICTED: pleiotropic drug resistance protein 1-like [Nelumbo 
nucifera]
Length=1445

 Score =   265 bits (676),  Expect(2) = 2e-116, Method: Compositional matrix adjust.
 Identities = 121/182 (66%), Positives = 141/182 (77%), Gaps = 0/182 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              + + GV KIK+GYNPATWMLE++T   E   GV+FAE+Y NS LH+RN+ LI+ELSTPP
Sbjct  1096  FEGIEGVSKIKDGYNPATWMLEVTTMAQEEILGVNFAEVYKNSELHRRNKSLIQELSTPP  1155

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             PGS+DLYFPT YSQSF  QC AC WKQHWSYWRNP Y AVRF  T  + ++FG IFW  G
Sbjct  1156  PGSKDLYFPTMYSQSFFTQCMACLWKQHWSYWRNPPYIAVRFIFTTFIALLFGTIFWDLG  1215

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
              +   QQDL N +G++YAAV+FLG  N SSVQ  VAVERTVFYRERAAGMYSALPYA  Q
Sbjct  1216  SKRSRQQDLFNAMGSMYAAVLFLGIQNASSVQPVVAVERTVFYRERAAGMYSALPYAFGQ  1275

Query  624   VI  629
             V+
Sbjct  1276  VM  1277


 Score =   184 bits (466),  Expect(2) = 2e-116, Method: Compositional matrix adjust.
 Identities = 84/175 (48%), Positives = 119/175 (68%), Gaps = 4/175 (2%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  IE  ++ VQ + Y +++Y MIGFEW   KF W+ +FM+ + +YFT YGMM VA+TP 
Sbjct  1275  QVMIEIPHIFVQAVVYGVIVYAMIGFEWTAAKFFWYLFFMYFTLLYFTFYGMMAVAVTPN  1334

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
                AAI  +     WNLF+GFI+PR +MPVWWRWYYW  P  W+LYGL+ SQ GD + ++
Sbjct  1335  HNVAAIVSSAFYGIWNLFSGFIVPRTRMPVWWRWYYWICPVAWTLYGLVASQFGDIQDKI  1394

Query  1046  QVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
                 E D T+++FL+ +FG+ + FL  V+A  +G+++LF F+FA+ I   NFQRR
Sbjct  1395  ----ETDQTVEEFLRSYFGFRHDFLGVVSAVIIGFTVLFAFIFAFSIRAFNFQRR  1445



>ref|XP_008392128.1| PREDICTED: pleiotropic drug resistance protein 1-like isoform 
X2 [Malus domestica]
Length=1451

 Score =   266 bits (679),  Expect(2) = 2e-115, Method: Compositional matrix adjust.
 Identities = 121/182 (66%), Positives = 143/182 (79%), Gaps = 0/182 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              + + GVPKIK+GYNPATWMLEI+ A  EA  GV+F EIY NS L++RN+ +IKELSTPP
Sbjct  1102  FEDIDGVPKIKDGYNPATWMLEITAAAQEAVLGVNFTEIYRNSELYRRNKAMIKELSTPP  1161

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
              GS+DLYFPT+YSQSF  QC AC WKQH SYWRNP Y+AVR   T  + +MFG IFW  G
Sbjct  1162  AGSKDLYFPTQYSQSFFSQCMACLWKQHLSYWRNPPYSAVRLLFTTFIALMFGTIFWDLG  1221

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
              +  NQQDL N +G+IYAAV+F+G  N+SSVQ  VA+ERTVFYRERAAGMYSALPYA  Q
Sbjct  1222  SKRRNQQDLFNAMGSIYAAVLFIGXQNSSSVQPVVAIERTVFYRERAAGMYSALPYAFGQ  1281

Query  624   VI  629
             V+
Sbjct  1282  VV  1283


 Score =   180 bits (456),  Expect(2) = 2e-115, Method: Compositional matrix adjust.
 Identities = 87/175 (50%), Positives = 117/175 (67%), Gaps = 4/175 (2%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  IE  Y+ VQTI Y +++Y MIGFEW + KFLW+ +FM+ +F+YFT YGMM VA+TP 
Sbjct  1281  QVVIELPYIFVQTIIYGVIVYTMIGFEWTVSKFLWYIFFMYFTFLYFTFYGMMTVAVTPN  1340

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
                 AI  +     WNLF+GFI+PR +MP+WWRWYYW  P  ++LYGLI SQ GD + + 
Sbjct  1341  HNIGAIVASAFYAIWNLFSGFIVPRTRMPIWWRWYYWICPVSYTLYGLIASQFGDIKDKF  1400

Query  1046  QVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
                GE   +++ F++++FGY    L  VAA HVG  +LF F FA+ I   NFQ+R
Sbjct  1401  D-SGE---SVEHFVRNYFGYRRDLLGVVAAVHVGICVLFGFTFAFSIKAFNFQKR  1451



>ref|XP_008392127.1| PREDICTED: pleiotropic drug resistance protein 1-like isoform 
X1 [Malus domestica]
Length=1477

 Score =   265 bits (677),  Expect(2) = 2e-115, Method: Compositional matrix adjust.
 Identities = 121/182 (66%), Positives = 143/182 (79%), Gaps = 0/182 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              + + GVPKIK+GYNPATWMLEI+ A  EA  GV+F EIY NS L++RN+ +IKELSTPP
Sbjct  1128  FEDIDGVPKIKDGYNPATWMLEITAAAQEAVLGVNFTEIYRNSELYRRNKAMIKELSTPP  1187

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
              GS+DLYFPT+YSQSF  QC AC WKQH SYWRNP Y+AVR   T  + +MFG IFW  G
Sbjct  1188  AGSKDLYFPTQYSQSFFSQCMACLWKQHLSYWRNPPYSAVRLLFTTFIALMFGTIFWDLG  1247

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
              +  NQQDL N +G+IYAAV+F+G  N+SSVQ  VA+ERTVFYRERAAGMYSALPYA  Q
Sbjct  1248  SKRRNQQDLFNAMGSIYAAVLFIGXQNSSSVQPVVAIERTVFYRERAAGMYSALPYAFGQ  1307

Query  624   VI  629
             V+
Sbjct  1308  VV  1309


 Score =   180 bits (457),  Expect(2) = 2e-115, Method: Compositional matrix adjust.
 Identities = 87/175 (50%), Positives = 117/175 (67%), Gaps = 4/175 (2%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  IE  Y+ VQTI Y +++Y MIGFEW + KFLW+ +FM+ +F+YFT YGMM VA+TP 
Sbjct  1307  QVVIELPYIFVQTIIYGVIVYTMIGFEWTVSKFLWYIFFMYFTFLYFTFYGMMTVAVTPN  1366

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
                 AI  +     WNLF+GFI+PR +MP+WWRWYYW  P  ++LYGLI SQ GD + + 
Sbjct  1367  HNIGAIVASAFYAIWNLFSGFIVPRTRMPIWWRWYYWICPVSYTLYGLIASQFGDIKDKF  1426

Query  1046  QVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
                GE   +++ F++++FGY    L  VAA HVG  +LF F FA+ I   NFQ+R
Sbjct  1427  D-SGE---SVEHFVRNYFGYRRDLLGVVAAVHVGICVLFGFTFAFSIKAFNFQKR  1477



>ref|XP_010249930.1| PREDICTED: pleiotropic drug resistance protein 1-like [Nelumbo 
nucifera]
Length=1444

 Score =   261 bits (668),  Expect(2) = 2e-115, Method: Compositional matrix adjust.
 Identities = 120/182 (66%), Positives = 140/182 (77%), Gaps = 0/182 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              + + GV KIK GYNPATWMLE++T   E   GV FA++Y NS L++RN+ LI+ELSTPP
Sbjct  1095  FEEIEGVSKIKYGYNPATWMLEVTTVAQEETLGVSFADVYKNSELYRRNKSLIQELSTPP  1154

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             PGS+DLYFPTKYSQSF  QC AC WKQHWSYWRNP Y AVRF  T  + ++FG IFW  G
Sbjct  1155  PGSKDLYFPTKYSQSFFTQCMACLWKQHWSYWRNPPYIAVRFIFTTFIALLFGTIFWDLG  1214

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
              +   QQDL N +G++YAAV+FLG  N SSVQ  VAVERTVFYRERAAGMYSALPYA  Q
Sbjct  1215  SKRSRQQDLFNAMGSMYAAVLFLGIQNASSVQPVVAVERTVFYRERAAGMYSALPYAFGQ  1274

Query  624   VI  629
             V+
Sbjct  1275  VM  1276


 Score =   184 bits (466),  Expect(2) = 2e-115, Method: Compositional matrix adjust.
 Identities = 84/175 (48%), Positives = 119/175 (68%), Gaps = 4/175 (2%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  IE  ++ VQ + Y +++Y MIGFEW   KF W+ +FM+ + +YFT YGMM VA+TP 
Sbjct  1274  QVMIEIPHIFVQAVVYGVIVYAMIGFEWTAAKFFWYLFFMYFTLLYFTFYGMMAVAVTPN  1333

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
                AAI  +     WNLF+GFI+PR +MPVWWRWYYW  P  W+LYGL+ SQ GD + ++
Sbjct  1334  HNVAAIVSSAFYGIWNLFSGFIVPRTRMPVWWRWYYWICPVAWTLYGLVASQFGDIQDKI  1393

Query  1046  QVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
                 E D T+++FL+ +FG+ + FL  V+A  +G+++LF F+FA+ I   NFQRR
Sbjct  1394  ----ETDQTVEEFLRSYFGFRHDFLGVVSAVIIGFTVLFAFIFAFSIRAFNFQRR  1444



>ref|XP_007227084.1| hypothetical protein PRUPE_ppa000234mg [Prunus persica]
 gb|EMJ28283.1| hypothetical protein PRUPE_ppa000234mg [Prunus persica]
Length=1421

 Score =   259 bits (662),  Expect(2) = 3e-115, Method: Compositional matrix adjust.
 Identities = 118/182 (65%), Positives = 141/182 (77%), Gaps = 0/182 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              + + GVPKIK+GYNPATWML+I+ A  EA  GV+F EIY NS L+ RN+ LIK+LSTPP
Sbjct  1068  FEEIDGVPKIKDGYNPATWMLDITAAAQEAALGVNFTEIYKNSELYGRNKALIKDLSTPP  1127

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
              GS+DLYFPT+YSQSF  QC AC WKQH SYWRNP Y+AVR   T  + +MFG IFW  G
Sbjct  1128  AGSKDLYFPTQYSQSFFSQCMACLWKQHLSYWRNPPYSAVRLLFTTFIALMFGTIFWDLG  1187

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
              +  +QQDL N +G++YAAV+F+G  N SSVQ  VA+ERTVFYRERAAGMYSALPYA  Q
Sbjct  1188  SKRRSQQDLFNAMGSMYAAVLFIGVQNASSVQPVVAIERTVFYRERAAGMYSALPYAFGQ  1247

Query  624   VI  629
             V+
Sbjct  1248  VV  1249


 Score =   185 bits (470),  Expect(2) = 3e-115, Method: Compositional matrix adjust.
 Identities = 87/175 (50%), Positives = 116/175 (66%), Gaps = 0/175 (0%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  IE  Y+ VQTI Y +++Y MIGF+W + KFLW+ +FM+ +F+YFT YGMM VA+TP 
Sbjct  1247  QVVIELPYIFVQTIIYGVIVYAMIGFDWTVSKFLWYLFFMYFTFLYFTFYGMMTVAVTPN  1306

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
                AAI  +     WNLF+GFI+PR +MP+WWRWYYW  P  ++LYGL+ SQ GD +   
Sbjct  1307  HNIAAIVSSAFYAIWNLFSGFIIPRTRMPIWWRWYYWICPVSYTLYGLVASQFGDIKEIF  1366

Query  1046  QVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
                     +++ F+KD+FGY   FL  VAA HVG  +LF F FA+ I   NFQ+R
Sbjct  1367  DSGESAGKSVEHFVKDYFGYRQDFLGVVAAVHVGICVLFGFTFAFSIKVFNFQKR  1421



>ref|XP_010227927.1| PREDICTED: pleiotropic drug resistance protein 5-like [Brachypodium 
distachyon]
Length=1253

 Score =   255 bits (652),  Expect(2) = 3e-115, Method: Compositional matrix adjust.
 Identities = 117/180 (65%), Positives = 144/180 (80%), Gaps = 0/180 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              +A+PGVPKI  GYNPATWMLE+S+   EA+  ++FAEIYANS L+ +NQELIKELS PP
Sbjct  900   FEAIPGVPKITEGYNPATWMLEVSSPLAEARLDINFAEIYANSVLYTKNQELIKELSVPP  959

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             PG QDL FPTKYSQ+F  QC A FWKQ+ SYW+NP YNA+R+ +T++ G++FG +FW KG
Sbjct  960   PGYQDLSFPTKYSQNFYNQCVANFWKQYKSYWKNPPYNAMRYLMTLLNGIVFGTVFWQKG  1019

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
               + +QQDL NLLGA YAA+ FLG+ N  +VQ  VA+ERTVFYRE+AAGMYS L YALAQ
Sbjct  1020  KNLDSQQDLFNLLGATYAAIFFLGAANCITVQPVVAIERTVFYREKAAGMYSPLSYALAQ  1079


 Score =   189 bits (480),  Expect(2) = 3e-115, Method: Compositional matrix adjust.
 Identities = 88/175 (50%), Positives = 119/175 (68%), Gaps = 0/175 (0%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q G+E IY  +Q I Y+LL+Y MIG+EW+  KF +F +F+  SF YFTL+GMMLV+LTP 
Sbjct  1079  QTGVEVIYNILQGILYTLLIYVMIGYEWRADKFFYFLFFIVASFNYFTLFGMMLVSLTPS  1138

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
                A I ++F L  WNLFAGF++ R  +P+WWRWYYWA+P  W++YG++ SQ G+    +
Sbjct  1139  ALIANILISFALPLWNLFAGFLVVRTAIPIWWRWYYWANPVSWTIYGVVASQFGENGGSL  1198

Query  1046  QVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
              VPG   + +KQFL+D  G  + FL  V  AH  + + FFFVF Y I F NFQ+R
Sbjct  1199  TVPGGNPVVVKQFLEDNLGIRHDFLGYVVLAHFAYIIAFFFVFGYSIKFFNFQKR  1253



>ref|XP_011094543.1| PREDICTED: pleiotropic drug resistance protein 2-like, partial 
[Sesamum indicum]
Length=441

 Score =   263 bits (671),  Expect(2) = 4e-115, Method: Compositional matrix adjust.
 Identities = 121/182 (66%), Positives = 145/182 (80%), Gaps = 1/182 (1%)
 Frame = +3

Query  84   LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYA-NSPLHQRNQELIKELSTP  260
             +A+PGVPK+K+G NPATWML++ST  +E Q GV+FA+IY  N P    NQELIKELS+P
Sbjct  87   FEAIPGVPKVKDGCNPATWMLDVSTPAVEVQLGVEFADIYMLNQPFICNNQELIKELSSP  146

Query  261  PPGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGK  440
             PGS+DLYFP K+SQ F+ QCKACFWKQH SYW+NPQYNA+R+   IV+GV  G +FW K
Sbjct  147  SPGSKDLYFPAKHSQPFLNQCKACFWKQHCSYWKNPQYNAIRYCWAIVIGVTLGTVFWNK  206

Query  441  GDEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALA  620
            G +I  QQDL NL+GAIY  VIF+G+ NT SVQ  VA+E+TVFYRERAA MYSALPYA A
Sbjct  207  GQKIEKQQDLRNLMGAIYCTVIFIGATNTYSVQGVVAMEKTVFYRERAAMMYSALPYAFA  266

Query  621  QV  626
            QV
Sbjct  267  QV  268


 Score =   181 bits (460),  Expect(2) = 4e-115, Method: Compositional matrix adjust.
 Identities = 95/175 (54%), Positives = 125/175 (71%), Gaps = 0/175 (0%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  IE IY+AVQT+ YSL+ YPMIGF+W +GKF WF+YF F SF Y TLYG+M+VALTPG
Sbjct  267   QVAIEIIYIAVQTVVYSLVFYPMIGFKWTVGKFFWFFYFSFMSFAYCTLYGLMVVALTPG  326

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
               F+AI  ++  + WNLF+GF++PR Q+P+WWRW YW SP  W++YGL TSQLGD  S +
Sbjct  327   SHFSAILSSYFFSIWNLFSGFLIPRTQIPIWWRWCYWGSPVAWTIYGLTTSQLGDITSEI  386

Query  1046  QVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
             +VPG G + ++ +LK     D+ FLP +A  H+ + LL   +FA  I  LNFQ R
Sbjct  387   EVPGVGAIRVEAYLKQILCLDHDFLPVLAVMHLVFVLLCALLFALAIKHLNFQTR  441



>ref|XP_009334795.1| PREDICTED: pleiotropic drug resistance protein 1-like [Pyrus 
x bretschneideri]
Length=1451

 Score =   258 bits (658),  Expect(2) = 5e-115, Method: Compositional matrix adjust.
 Identities = 117/182 (64%), Positives = 141/182 (77%), Gaps = 0/182 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              + + GVPKIK+GYNPATWMLEI+ A  EA  GV+F EIY NS L+ RN+ +IKELSTPP
Sbjct  1102  FEDIDGVPKIKDGYNPATWMLEITAAAQEASIGVNFTEIYRNSELYGRNKAMIKELSTPP  1161

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
              GS+DLYFPT+YSQSF  QC AC WKQH SYWRNP Y+AVR   T  + +MFG IFW  G
Sbjct  1162  AGSKDLYFPTQYSQSFFSQCMACLWKQHLSYWRNPPYSAVRLLFTTFIALMFGTIFWDLG  1221

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
              +  ++QDL N +G++YAAV+F+G  N +SVQ  VA+ERTVFYRERAAGMYSALPYA  Q
Sbjct  1222  SKRTSRQDLFNAMGSMYAAVLFIGVQNAASVQPVVAIERTVFYRERAAGMYSALPYAFGQ  1281

Query  624   VI  629
             V+
Sbjct  1282  VV  1283


 Score =   186 bits (472),  Expect(2) = 5e-115, Method: Compositional matrix adjust.
 Identities = 89/175 (51%), Positives = 119/175 (68%), Gaps = 4/175 (2%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  IE  Y+ VQTI Y +++Y MIGF+W + KFLW+ +FM+ +F+YFT YGMM VA+TP 
Sbjct  1281  QVVIELPYIFVQTIIYGVIVYTMIGFDWTVSKFLWYLFFMYFTFLYFTFYGMMTVAVTPN  1340

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
                AAI  +     WNLF+GFI+PR +MP+WWRWYYW  P  ++LYGL+ SQ GD   + 
Sbjct  1341  HNIAAIVSSAFYAIWNLFSGFIVPRTRMPIWWRWYYWICPVSYTLYGLVASQFGDINDKF  1400

Query  1046  QVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
                GE   +++ F++D+FGY   FL AVAA HVG  +LF F FA+ I   NFQ+R
Sbjct  1401  DT-GE---SVEHFVRDYFGYRRDFLGAVAAVHVGICVLFGFTFAFSIKVFNFQKR  1451



>ref|XP_008394025.1| PREDICTED: pleiotropic drug resistance protein 1-like [Malus 
domestica]
Length=1451

 Score =   258 bits (658),  Expect(2) = 5e-115, Method: Compositional matrix adjust.
 Identities = 117/182 (64%), Positives = 141/182 (77%), Gaps = 0/182 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              + + GVPKIK+GYNPATWMLEI+ A  EA  GV+F EIY NS L+ RN+ +IKELSTPP
Sbjct  1102  FEDIDGVPKIKDGYNPATWMLEITAAAQEASIGVNFTEIYRNSELYGRNKAMIKELSTPP  1161

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
              GS+DLYFPT+YSQSF  QC AC WKQH SYWRNP Y+AVR   T  + +MFG IFW  G
Sbjct  1162  AGSKDLYFPTQYSQSFFSQCMACLWKQHLSYWRNPPYSAVRLMFTTFIALMFGTIFWDLG  1221

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
              +  ++QDL N +G++YAAV+F+G  N +SVQ  VA+ERTVFYRERAAGMYSALPYA  Q
Sbjct  1222  SKRTSKQDLFNAMGSMYAAVLFIGVQNAASVQPVVAIERTVFYRERAAGMYSALPYAFGQ  1281

Query  624   VI  629
             V+
Sbjct  1282  VV  1283


 Score =   186 bits (473),  Expect(2) = 5e-115, Method: Compositional matrix adjust.
 Identities = 89/175 (51%), Positives = 120/175 (69%), Gaps = 4/175 (2%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  IE  Y+ VQTI Y +++Y MIGF+W + KFLW+ +FM+ +F+YFT YGMM VA+TP 
Sbjct  1281  QVVIELPYIFVQTIIYGVIVYAMIGFDWTVSKFLWYLFFMYFTFLYFTFYGMMTVAVTPN  1340

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
                AAI  +     WNLF+GFI+PR +MP+WWRWYYW  P  ++LYGL+ SQ GD + + 
Sbjct  1341  HNIAAIVSSAFYAIWNLFSGFIVPRTRMPIWWRWYYWICPVSYTLYGLVASQFGDIKDKF  1400

Query  1046  QVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
                GE   +++ F++D+FGY   FL AVAA HVG  +LF F FA+ I   NFQ+R
Sbjct  1401  DT-GE---SVEHFVRDYFGYRRDFLGAVAAVHVGICVLFGFTFAFSIKVFNFQKR  1451



>ref|XP_004161244.1| PREDICTED: LOW QUALITY PROTEIN: pleiotropic drug resistance protein 
2-like [Cucumis sativus]
Length=2199

 Score =   243 bits (619),  Expect(2) = 7e-115, Method: Compositional matrix adjust.
 Identities = 106/181 (59%), Positives = 138/181 (76%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
             L+A+PG+PKI++G NPATWMLE++   +EAQ  ++FAEI+A SPL++RNQELI +LSTP 
Sbjct  1846  LEAIPGIPKIEDGQNPATWMLEVTAPPMEAQLDINFAEIFAKSPLYRRNQELIMQLSTPT  1905

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
              GS+DL+F  +YSQSF+ QCKACFWK   SYWRN QYNA+RF VTI +  +FG++FW  G
Sbjct  1906  QGSEDLHFSNEYSQSFLSQCKACFWKHCHSYWRNTQYNAIRFLVTIFISFLFGLVFWNTG  1965

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
                  +QD+LN++G IYA  +FLG  N+++V   V  ER VFYRER AGMY+ L YA AQ
Sbjct  1966  QNFAKEQDVLNIMGVIYATALFLGIFNSATVIPVVDTERVVFYRERVAGMYTTLSYAFAQ  2025

Query  624   V  626
             V
Sbjct  2026  V  2026


 Score =   201 bits (510),  Expect(2) = 7e-115, Method: Compositional matrix adjust.
 Identities = 94/175 (54%), Positives = 124/175 (71%), Gaps = 0/175 (0%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  IE IY++VQ ++Y L LY M+GFEWK+GKFL FYYF    FIYFTLYGMM VALTP 
Sbjct  2025  QVAIEIIYISVQALTYCLPLYSMLGFEWKVGKFLLFYYFYLMCFIYFTLYGMMAVALTPN  2084

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
                A I + F    WNLF GF +P+  +P+WWRW YWASP  W++YGL+ S +GD++  +
Sbjct  2085  HHIAFIFVFFFFALWNLFTGFFIPQPLIPIWWRWCYWASPVAWTMYGLVASLVGDRDVDI  2144

Query  1046  QVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
             ++PG G++ ++  LK+ FGY + F+P V AAH  W L+FF VF  GI FLNFQ++
Sbjct  2145  EIPGFGNIGLQMLLKERFGYHHDFIPVVVAAHGFWVLIFFVVFVCGIKFLNFQKK  2199



>ref|XP_002324840.1| hypothetical protein POPTR_0018s01240g [Populus trichocarpa]
 gb|EEF03405.1| hypothetical protein POPTR_0018s01240g [Populus trichocarpa]
Length=1429

 Score =   265 bits (677),  Expect(2) = 7e-115, Method: Compositional matrix adjust.
 Identities = 118/182 (65%), Positives = 143/182 (79%), Gaps = 0/182 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
             L+ + GVPKIK+G+NPATWMLE+++A  EA  GVDF +IY NS L +RN+ LIKELS+PP
Sbjct  1080  LEEIEGVPKIKDGHNPATWMLEVTSAAQEALLGVDFTDIYKNSELFRRNKALIKELSSPP  1139

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             PGS DLYFPT+YS SF  QC AC WKQHWSYWRNP Y AVR   T  + +MFG IFW  G
Sbjct  1140  PGSNDLYFPTQYSHSFFTQCMACLWKQHWSYWRNPPYTAVRLLFTTFIALMFGTIFWDMG  1199

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
              +  N+QD+ N +G++YAAV+F+G  N +SVQ  VA+ERTVFYRERAAGMYSALPYA AQ
Sbjct  1200  SKRRNRQDIFNSMGSMYAAVLFIGVQNATSVQPVVAIERTVFYRERAAGMYSALPYAFAQ  1259

Query  624   VI  629
             V+
Sbjct  1260  VM  1261


 Score =   178 bits (452),  Expect(2) = 7e-115, Method: Compositional matrix adjust.
 Identities = 83/175 (47%), Positives = 117/175 (67%), Gaps = 4/175 (2%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  IE  YV VQT+ Y +++Y MIGF+W + KF W+ +FM+ + +Y T YGMM VA+TP 
Sbjct  1259  QVMIEIPYVLVQTLIYGVIVYTMIGFDWTVSKFFWYIFFMYFTLLYMTFYGMMTVAVTPN  1318

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
                AAI  +     WNLF+GFI+PR ++P+WWRWY+WA P  W+LYGLI SQ GD + ++
Sbjct  1319  HNVAAIVSSAFYAIWNLFSGFIVPRTRIPIWWRWYFWACPISWTLYGLIASQYGDIKDKL  1378

Query  1046  QVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
                 EGD T++ F++++FG+ + F+   A   VG  +LF F FA+ I   NFQRR
Sbjct  1379  ----EGDETVEDFVRNYFGFRHDFVGTCAIVIVGICVLFAFTFAFSIRAFNFQRR  1429


 Score = 39.3 bits (90),  Expect(2) = 8e-04, Method: Compositional matrix adjust.
 Identities = 48/180 (27%), Positives = 74/180 (41%), Gaps = 17/180 (9%)
 Frame = +2

Query  680   ILQAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFY-YFMFTSFIYFTLYGMMLVAL  856
             IL+  I  + VA+ TI    + Y +IGF+  +G+F   Y  F+  + +   L+  M  AL
Sbjct  607   ILKIPITFVEVAIWTI----MTYYVIGFDPNIGRFFKQYLIFVLANQMSSGLF-RMTGAL  661

Query  857   TPGVQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKE  1036
                +  A    +F      +  GFIL R  +  WW W YW SP  +       ++     
Sbjct  662   GRNIIVANTFGSFAFLAVLVLGGFILSRDNVKPWWIWGYWVSPLMYVQNAASVNEFLGHS  721

Query  1037  SRVQVPGEGDMTIKQFLKDFFGYDYGFLPAVA------AAHVGWSLLFFFVFAYGIMFLN  1198
              R   P   +      LK       G  P          A +G++LLF F+F   + +LN
Sbjct  722   WRHIPPNSTESLGVVVLK-----SRGIFPEAHWYWIGIGALIGYTLLFNFLFTLALKYLN  776


 Score = 32.3 bits (72),  Expect(2) = 8e-04, Method: Compositional matrix adjust.
 Identities = 37/134 (28%), Positives = 57/134 (43%), Gaps = 8/134 (6%)
 Frame = +3

Query  231  QELIKELSTPPPGSQD---LYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTI  401
            ++L  EL+TP   S+         KY  S  E  KAC  ++     RN      +F   I
Sbjct  473  RKLGDELATPFDKSKSHPAALTTEKYGVSKKELLKACISREFLLMKRNSFVYIFKFTQLI  532

Query  402  VLGVMFGVIFWGKGDEIHNQQ--DLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYR  575
            +L  +   IF     E+H     D    LGA++ A+I +   N  S  A   ++  +FY+
Sbjct  533  ILASITMTIFLRT--EMHRNTIVDGGIYLGALFFAIIVI-MFNGFSELAMTIMKLPIFYK  589

Query  576  ERAAGMYSALPYAL  617
            +R    Y    YA+
Sbjct  590  QRDLLFYPPWAYAI  603



>ref|XP_008442815.1| PREDICTED: ABC transporter G family member 34-like [Cucumis melo]
Length=1431

 Score =   240 bits (613),  Expect(2) = 9e-115, Method: Compositional matrix adjust.
 Identities = 108/181 (60%), Positives = 139/181 (77%), Gaps = 0/181 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
             L+A+PG+PKI++G NPATWMLE++   +EAQ  ++FAEI+A SPL++RNQELI +LSTP 
Sbjct  1078  LEAIPGIPKIEDGQNPATWMLEVTAPTMEAQLDINFAEIFAISPLYRRNQELIMQLSTPT  1137

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
              GS+DL+F  +YSQS + Q KACFWKQ  SYWRN QYNA+RF VTI +G +FG++FW  G
Sbjct  1138  QGSEDLHFSNEYSQSCLSQFKACFWKQCHSYWRNTQYNAIRFLVTIFIGFLFGLVFWNMG  1197

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
                  + D+LN++GAIYA  +FLG  N++ V   +  ER VFYRERAAGMYS LPYA AQ
Sbjct  1198  QNFAKEHDVLNIMGAIYATALFLGIFNSAIVLPVLDTERVVFYRERAAGMYSTLPYAFAQ  1257

Query  624   V  626
             V
Sbjct  1258  V  1258


 Score =   202 bits (515),  Expect(2) = 9e-115, Method: Compositional matrix adjust.
 Identities = 97/175 (55%), Positives = 124/175 (71%), Gaps = 0/175 (0%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  IE IY++VQ + Y L LY MIGFEWK+ KFL FYYF    FIYFTLYGMM VALTP 
Sbjct  1257  QVAIETIYISVQALIYCLPLYSMIGFEWKVAKFLLFYYFFLMCFIYFTLYGMMAVALTPN  1316

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
                A I + F   FWNLF GF +PR  +P+WWRW YWASP  W++YGL+ S +GD++  +
Sbjct  1317  HHIAFIFVFFFFAFWNLFTGFFIPRPLIPIWWRWCYWASPVAWTMYGLVASLVGDRDVDI  1376

Query  1046  QVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
             ++PG G++ +K  L++ FGY + F+P V AAH  W L+FFFVF  GI FLNFQ++
Sbjct  1377  EIPGFGNVGLKMLLEERFGYHHDFIPVVVAAHGFWVLIFFFVFVSGIKFLNFQKK  1431



>ref|XP_008361068.1| PREDICTED: pleiotropic drug resistance protein 1-like isoform 
X2 [Malus domestica]
Length=1424

 Score =   253 bits (646),  Expect(2) = 1e-114, Method: Compositional matrix adjust.
 Identities = 110/181 (61%), Positives = 143/181 (79%), Gaps = 0/181 (0%)
 Frame = +3

Query  87    QAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPPP  266
             + + GV K+++ +NPATWMLE+++AG +   GV F++IY NS LH+RN+ LIKELSTPPP
Sbjct  1076  EGISGVSKLRDSHNPATWMLEVTSAGQQEALGVSFSDIYKNSELHRRNKVLIKELSTPPP  1135

Query  267   GSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKGD  446
              S+DL+F T+YSQSF  QC AC WKQHWSYWRNP Y+AVR   T ++ ++FG IFWG G 
Sbjct  1136  NSRDLHFSTQYSQSFFNQCIACLWKQHWSYWRNPSYSAVRLLYTAMMALVFGTIFWGLGS  1195

Query  447   EIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQV  626
             + +NQQD+LN +G++Y+AV+F+G  N SSVQ  V +ER VFYRERAAGMYSA PYAL Q+
Sbjct  1196  KRNNQQDVLNAMGSMYSAVLFIGIQNASSVQPVVGIERIVFYRERAAGMYSAFPYALGQI  1255

Query  627   I  629
             I
Sbjct  1256  I  1256


 Score =   190 bits (482),  Expect(2) = 1e-114, Method: Compositional matrix adjust.
 Identities = 89/172 (52%), Positives = 123/172 (72%), Gaps = 4/172 (2%)
 Frame = +2

Query  695   IEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPGVQF  874
             IE  Y   QTI Y L++Y MIGF+W +GKFLW+ +FM+ +F+Y+TLYGMM+V +TP    
Sbjct  1257  IELPYTLFQTIIYGLIVYTMIGFDWTVGKFLWYLFFMYFTFLYYTLYGMMIVGITPNTTI  1316

Query  875   AAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRVQVP  1054
             AA+A + +   WN+F+GFI+PR ++P+WWRW+YW  P  W+LYGL+TSQ G  +  +   
Sbjct  1317  AAVASSAVYPLWNVFSGFIIPRTRIPIWWRWFYWVCPVSWTLYGLLTSQFGGIKDTLD-S  1375

Query  1055  GEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
             GE   T++ F+KD+FGY  GFL  VA  HVG S+LF F+FA+ I  LNFQ+R
Sbjct  1376  GE---TVEDFMKDYFGYREGFLGVVAIVHVGISVLFGFIFAFSIKXLNFQKR  1424



>ref|XP_008361067.1| PREDICTED: pleiotropic drug resistance protein 1-like isoform 
X1 [Malus domestica]
Length=1448

 Score =   253 bits (645),  Expect(2) = 1e-114, Method: Compositional matrix adjust.
 Identities = 110/182 (60%), Positives = 143/182 (79%), Gaps = 0/182 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              + + GV K+++ +NPATWMLE+++AG +   GV F++IY NS LH+RN+ LIKELSTPP
Sbjct  1099  FEGISGVSKLRDSHNPATWMLEVTSAGQQEALGVSFSDIYKNSELHRRNKVLIKELSTPP  1158

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             P S+DL+F T+YSQSF  QC AC WKQHWSYWRNP Y+AVR   T ++ ++FG IFWG G
Sbjct  1159  PNSRDLHFSTQYSQSFFNQCIACLWKQHWSYWRNPSYSAVRLLYTAMMALVFGTIFWGLG  1218

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
              + +NQQD+LN +G++Y+AV+F+G  N SSVQ  V +ER VFYRERAAGMYSA PYAL Q
Sbjct  1219  SKRNNQQDVLNAMGSMYSAVLFIGIQNASSVQPVVGIERIVFYRERAAGMYSAFPYALGQ  1278

Query  624   VI  629
             +I
Sbjct  1279  II  1280


 Score =   190 bits (482),  Expect(2) = 1e-114, Method: Compositional matrix adjust.
 Identities = 89/172 (52%), Positives = 123/172 (72%), Gaps = 4/172 (2%)
 Frame = +2

Query  695   IEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPGVQF  874
             IE  Y   QTI Y L++Y MIGF+W +GKFLW+ +FM+ +F+Y+TLYGMM+V +TP    
Sbjct  1281  IELPYTLFQTIIYGLIVYTMIGFDWTVGKFLWYLFFMYFTFLYYTLYGMMIVGITPNTTI  1340

Query  875   AAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRVQVP  1054
             AA+A + +   WN+F+GFI+PR ++P+WWRW+YW  P  W+LYGL+TSQ G  +  +   
Sbjct  1341  AAVASSAVYPLWNVFSGFIIPRTRIPIWWRWFYWVCPVSWTLYGLLTSQFGGIKDTLD-S  1399

Query  1055  GEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
             GE   T++ F+KD+FGY  GFL  VA  HVG S+LF F+FA+ I  LNFQ+R
Sbjct  1400  GE---TVEDFMKDYFGYREGFLGVVAIVHVGISVLFGFIFAFSIKXLNFQKR  1448



>gb|ABA94465.2| ABC transporter, putative, expressed [Oryza sativa Japonica Group]
Length=1445

 Score =   258 bits (659),  Expect(2) = 1e-114, Method: Compositional matrix adjust.
 Identities = 119/180 (66%), Positives = 146/180 (81%), Gaps = 0/180 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              +AVPGVPKI  GYNPATWMLE+++   EA+  V+FAEIYANS L+++NQELIKELSTPP
Sbjct  1092  FEAVPGVPKITEGYNPATWMLEVTSPIAEARLNVNFAEIYANSELYRKNQELIKELSTPP  1151

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             PG QDL FPTKYSQ+F  QC A FWKQ+ SYW+NP YNA+R+ +T++ G++FG +FW KG
Sbjct  1152  PGYQDLSFPTKYSQNFYSQCIANFWKQYRSYWKNPPYNAMRYLMTLLNGLVFGTVFWQKG  1211

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
              +I +QQDL NLLGA YAA  FLG+ N  +VQ  V++ERTVFYRERAAGMYS+L YA AQ
Sbjct  1212  TKISSQQDLFNLLGATYAATFFLGAANCITVQPVVSIERTVFYRERAAGMYSSLSYAFAQ  1271


 Score =   184 bits (468),  Expect(2) = 1e-114, Method: Compositional matrix adjust.
 Identities = 84/175 (48%), Positives = 118/175 (67%), Gaps = 0/175 (0%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             QA +E IY  +Q I Y++++Y MIG++WK  KF +F +F+  SF YFTL+GMMLVA TP 
Sbjct  1271  QACVEVIYNILQGILYTIIIYAMIGYDWKADKFFYFMFFIVASFNYFTLFGMMLVACTPS  1330

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
                A I ++F+L  WNLFAGF++ R  +P+WWRWYYWA+P  W++YG++ SQ G     +
Sbjct  1331  AMLANILISFVLPLWNLFAGFLVVRPLIPIWWRWYYWANPVSWTIYGVVASQFGKNGDVL  1390

Query  1046  QVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
              VPG     +KQFL+D  G  + FL  V   H G+ ++FFF+F Y I + NFQ+R
Sbjct  1391  SVPGGSPTVVKQFLEDNLGMRHSFLGYVVLTHFGYIIVFFFIFGYAIKYFNFQKR  1445



>gb|EMS54450.1| Pleiotropic drug resistance protein 5 [Triticum urartu]
Length=1304

 Score =   251 bits (640),  Expect(2) = 1e-114, Method: Compositional matrix adjust.
 Identities = 117/180 (65%), Positives = 144/180 (80%), Gaps = 0/180 (0%)
 Frame = +3

Query  84    LQAVPGVPKIKNGYNPATWMLEISTAGIEAQTGVDFAEIYANSPLHQRNQELIKELSTPP  263
              +A+PGV KI  GYNPATWMLE+S+   EA+  V+FAEIYANS L+++NQELIKELS PP
Sbjct  951   FEAIPGVEKITEGYNPATWMLEVSSPLAEARLNVNFAEIYANSDLYRKNQELIKELSIPP  1010

Query  264   PGSQDLYFPTKYSQSFVEQCKACFWKQHWSYWRNPQYNAVRFFVTIVLGVMFGVIFWGKG  443
             PG +DL FPTKYSQ+F  QC A FWKQ+ SYW+NP +NA+RF +T++ G++FG +FW KG
Sbjct  1011  PGYEDLSFPTKYSQNFYNQCVANFWKQYRSYWKNPPHNAMRFLMTMIYGLVFGTVFWQKG  1070

Query  444   DEIHNQQDLLNLLGAIYAAVIFLGSINTSSVQATVAVERTVFYRERAAGMYSALPYALAQ  623
              +I + QDL NLLGA YAAV FLGS N  +VQ  V++ERTVFYRE+AAGMYS L YALAQ
Sbjct  1071  TKIDSPQDLSNLLGATYAAVFFLGSANCITVQPVVSIERTVFYREKAAGMYSPLSYALAQ  1130


 Score =   191 bits (486),  Expect(2) = 1e-114, Method: Compositional matrix adjust.
 Identities = 90/175 (51%), Positives = 118/175 (67%), Gaps = 0/175 (0%)
 Frame = +2

Query  686   QAGIEAIYVAVQTISYSLLLYPMIGFEWKLGKFLWFYYFMFTSFIYFTLYGMMLVALTPG  865
             Q  +E IY  VQ I Y++ +Y MIG+EWK+ KF +F +F+ + F YFTL+GMMLVALT  
Sbjct  1130  QTCVEMIYNIVQGIQYTVTIYVMIGYEWKVAKFFYFLFFIISCFNYFTLFGMMLVALTSS  1189

Query  866   VQFAAIAMAFLLTFWNLFAGFILPRKQMPVWWRWYYWASPCGWSLYGLITSQLGDKESRV  1045
                A I +AF+L  WNLFAGF++ R  +P+WWRWYYWA+P  W++YG+I SQ GD  SR+
Sbjct  1190  SMLANIPIAFILPLWNLFAGFLVARPLLPIWWRWYYWANPVSWTIYGVIGSQFGDNTSRL  1249

Query  1046  QVPGEGDMTIKQFLKDFFGYDYGFLPAVAAAHVGWSLLFFFVFAYGIMFLNFQRR  1210
              VPG     +KQFL+D  G  + FL  V  AH  + + FF VF Y I  LNFQ+R
Sbjct  1250  SVPGGSPTVVKQFLEDNMGIKHDFLGYVVLAHFAYVIGFFLVFGYSIKVLNFQKR  1304



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4519421289488