BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c24325_g1_i2 len=575 path=[911:0-33 944:34-81 557:82-175
3410:176-180 1090:181-184 3418:185-204 3438:205-255 3453:256-269
3467:270-286 92:287-293 99:294-307 113:308-574]

Length=575
                                                                      Score     E

gb|EYU20539.1|  hypothetical protein MIMGU_mgv1a013072mg                251   2e-80   
gb|EYU20535.1|  hypothetical protein MIMGU_mgv1a013054mg                251   2e-80   
gb|EYU28622.1|  hypothetical protein MIMGU_mgv1a018753mg                249   9e-80   
ref|XP_009784933.1|  PREDICTED: germin-like protein subfamily 1 m...    248   3e-79   
gb|EYU38444.1|  hypothetical protein MIMGU_mgv1a013102mg                247   3e-79   
ref|XP_009795503.1|  PREDICTED: germin-like protein subfamily 1 m...    246   7e-79   
ref|XP_009625530.1|  PREDICTED: putative germin-like protein 2-1        245   2e-78   
gb|EYU20549.1|  hypothetical protein MIMGU_mgv1a020596mg                245   2e-78   
ref|XP_009612543.1|  PREDICTED: germin-like protein subfamily 1 m...    245   3e-78   
ref|XP_006358464.1|  PREDICTED: germin-like protein subfamily 1 m...    245   3e-78   
ref|XP_009612542.1|  PREDICTED: putative germin-like protein 2-1        244   4e-78   
ref|XP_009786127.1|  PREDICTED: putative germin-like protein 2-1        244   4e-78   
ref|XP_006358462.1|  PREDICTED: germin-like protein subfamily 1 m...    244   4e-78   
gb|EYU40211.1|  hypothetical protein MIMGU_mgv1a013108mg                244   6e-78   
ref|XP_006349261.1|  PREDICTED: putative germin-like protein 2-1-...    244   7e-78   
ref|XP_009627660.1|  PREDICTED: germin-like protein subfamily 1 m...    243   2e-77   
ref|XP_009620404.1|  PREDICTED: germin-like protein subfamily 1 m...    243   2e-77   
gb|EYU20548.1|  hypothetical protein MIMGU_mgv1a013109mg                243   3e-77   
ref|XP_006358463.1|  PREDICTED: germin-like protein subfamily 1 m...    241   6e-77   
ref|XP_009795501.1|  PREDICTED: putative germin-like protein 2-1        241   1e-76   
ref|XP_006349264.1|  PREDICTED: germin-like protein subfamily 1 m...    241   2e-76   
gb|EYU20540.1|  hypothetical protein MIMGU_mgv1a013117mg                240   2e-76   
ref|XP_004230404.1|  PREDICTED: putative germin-like protein 2-1        240   2e-76   
gb|EYU20545.1|  hypothetical protein MIMGU_mgv1a020779mg                240   2e-76   
gb|EYU20546.1|  hypothetical protein MIMGU_mgv1a013111mg                240   2e-76   
ref|XP_006349268.1|  PREDICTED: germin-like protein subfamily 1 m...    240   3e-76   
ref|XP_009620917.1|  PREDICTED: germin-like protein subfamily 1 m...    240   3e-76   
ref|XP_009612541.1|  PREDICTED: germin-like protein subfamily 1 m...    239   4e-76   
ref|XP_006358459.1|  PREDICTED: germin-like protein subfamily 1 m...    239   7e-76   
ref|XP_004230403.1|  PREDICTED: putative germin-like protein 2-1        238   1e-75   
gb|EYU40209.1|  hypothetical protein MIMGU_mgv1a013129mg                239   1e-75   
ref|XP_006349267.1|  PREDICTED: germin-like protein subfamily 1 m...    238   1e-75   
gb|EYU20541.1|  hypothetical protein MIMGU_mgv1a018988mg                238   1e-75   
ref|XP_006358460.1|  PREDICTED: LOW QUALITY PROTEIN: germin-like ...    238   1e-75   
gb|EYU20542.1|  hypothetical protein MIMGU_mgv1a020630mg                238   2e-75   
ref|XP_011099651.1|  PREDICTED: germin-like protein subfamily 1 m...    238   2e-75   
ref|XP_006346966.1|  PREDICTED: putative germin-like protein 2-1-...    237   3e-75   
gb|EYU40208.1|  hypothetical protein MIMGU_mgv1a020439mg                237   5e-75   
ref|XP_006358461.1|  PREDICTED: germin-like protein subfamily 1 m...    237   5e-75   
gb|AFW90592.1|  germin-like protein subfamily 1 member 20 precursor     236   6e-75   
gb|EYU20547.1|  hypothetical protein MIMGU_mgv1a023357mg                236   7e-75   
gb|EYU20536.1|  hypothetical protein MIMGU_mgv1a025658mg                236   1e-74   
ref|XP_006349265.1|  PREDICTED: germin-like protein subfamily 1 m...    235   2e-74   
ref|XP_009786129.1|  PREDICTED: putative germin-like protein 2-1        234   4e-74   
gb|EYU40210.1|  hypothetical protein MIMGU_mgv1a022317mg                234   6e-74   
ref|XP_004230405.1|  PREDICTED: germin-like protein subfamily 1 m...    234   8e-74   
ref|XP_006349263.1|  PREDICTED: germin-like protein subfamily 1 m...    233   2e-73   
emb|CDP10695.1|  unnamed protein product                                232   4e-73   
ref|XP_011099652.1|  PREDICTED: putative germin-like protein 2-1        231   5e-73   
emb|CDP10701.1|  unnamed protein product                                230   3e-72   
emb|CDP16787.1|  unnamed protein product                                228   1e-71   
emb|CDP10694.1|  unnamed protein product                                227   2e-71   
emb|CDP16790.1|  unnamed protein product                                227   4e-71   
ref|XP_010251871.1|  PREDICTED: putative germin-like protein 2-1        225   1e-70   
ref|XP_010251870.1|  PREDICTED: putative germin-like protein 2-1 ...    225   1e-70   
emb|CDP22064.1|  unnamed protein product                                225   2e-70   
ref|XP_010251869.1|  PREDICTED: putative germin-like protein 2-1 ...    223   9e-70   
ref|XP_010251867.1|  PREDICTED: putative germin-like protein 2-1        222   2e-69   
ref|XP_010251872.1|  PREDICTED: putative germin-like protein 2-1        222   3e-69   
emb|CDP10693.1|  unnamed protein product                                221   4e-69   
emb|CBI33612.3|  unnamed protein product                                221   8e-69   
emb|CDP16791.1|  unnamed protein product                                221   1e-68   
ref|XP_003633724.1|  PREDICTED: putative germin-like protein 2-1        220   2e-68   
emb|CDP16789.1|  unnamed protein product                                227   3e-68   
ref|XP_010257844.1|  PREDICTED: putative germin-like protein 2-1        219   3e-68   
ref|XP_011099650.1|  PREDICTED: germin-like protein subfamily 1 m...    219   3e-68   
emb|CDP16788.1|  unnamed protein product                                219   4e-68   
ref|XP_002265608.1|  PREDICTED: putative germin-like protein 2-1        219   4e-68   Vitis vinifera
emb|CBI33611.3|  unnamed protein product                                221   5e-68   
ref|XP_002276644.1|  PREDICTED: putative germin-like protein 2-1        218   8e-68   Vitis vinifera
emb|CDP21353.1|  unnamed protein product                                225   9e-68   
ref|XP_010241946.1|  PREDICTED: putative germin-like protein 2-1        218   1e-67   
ref|XP_003633711.2|  PREDICTED: putative germin-like protein 2-1        218   1e-67   
ref|XP_002277055.1|  PREDICTED: putative germin-like protein 2-1        218   1e-67   Vitis vinifera
ref|XP_003633723.2|  PREDICTED: putative germin-like protein 2-1        217   2e-67   
emb|CBI33610.3|  unnamed protein product                                220   2e-67   
ref|XP_007030273.1|  RmlC-like cupins superfamily protein               217   2e-67   
ref|XP_007210592.1|  hypothetical protein PRUPE_ppa016616mg             216   4e-67   
ref|XP_002276315.2|  PREDICTED: putative germin-like protein 2-1        216   5e-67   Vitis vinifera
ref|XP_008240380.1|  PREDICTED: germin-like protein subfamily 1 m...    216   6e-67   
ref|XP_002276756.2|  PREDICTED: putative germin-like protein 2-1        216   6e-67   Vitis vinifera
emb|CAN72994.1|  hypothetical protein VITISV_000563                     215   8e-67   Vitis vinifera
ref|XP_007200157.1|  hypothetical protein PRUPE_ppa016753mg             215   1e-66   
ref|XP_007200183.1|  hypothetical protein PRUPE_ppa016284mg             215   1e-66   
emb|CAN80134.1|  hypothetical protein VITISV_012033                     215   1e-66   Vitis vinifera
ref|XP_007030276.1|  RmlC-like cupins superfamily protein               214   2e-66   
ref|XP_002265857.1|  PREDICTED: putative germin-like protein 2-1        214   3e-66   Vitis vinifera
ref|XP_002281186.2|  PREDICTED: uncharacterized protein LOC100244552    222   3e-66   Vitis vinifera
emb|CDP16786.1|  unnamed protein product                                226   3e-66   
emb|CAN66771.1|  hypothetical protein VITISV_022559                     213   3e-66   Vitis vinifera
gb|AAM76226.1|  putative germin E protein precursor                     213   4e-66   Gossypium raimondii
ref|XP_007201862.1|  hypothetical protein PRUPE_ppa020162mg             214   4e-66   
ref|XP_002270404.2|  PREDICTED: putative germin-like protein 2-1        214   5e-66   Vitis vinifera
emb|CDP10698.1|  unnamed protein product                                214   5e-66   
ref|XP_002265447.3|  PREDICTED: uncharacterized protein LOC100242782    219   1e-65   Vitis vinifera
gb|AAM76225.1|  putative germin E protein precursor                     210   3e-65   Gossypium herbaceum [Arabian cotton]
gb|AAM76227.1|  putative germin E protein precursor                     210   3e-65   Gossypium hirsutum [American cotton]
ref|XP_007030289.1|  RmlC-like cupins superfamily protein               211   3e-65   
ref|XP_002265297.3|  PREDICTED: uncharacterized protein LOC100247931    219   3e-65   Vitis vinifera
gb|EPS67173.1|  hypothetical protein M569_07603                         211   4e-65   
ref|XP_007030272.1|  RmlC-like cupins superfamily protein               211   4e-65   
ref|XP_007200176.1|  hypothetical protein PRUPE_ppa016529mg             211   5e-65   
ref|XP_008363404.1|  PREDICTED: LOW QUALITY PROTEIN: germin-like ...    211   7e-65   
ref|XP_007201148.1|  hypothetical protein PRUPE_ppa016020mg             211   9e-65   
ref|XP_010251866.1|  PREDICTED: putative germin-like protein 2-1        210   1e-64   
ref|XP_004142551.1|  PREDICTED: germin-like protein subfamily 1 m...    209   2e-64   
emb|CAN70904.1|  hypothetical protein VITISV_032927                     209   2e-64   Vitis vinifera
ref|XP_008237524.1|  PREDICTED: germin-like protein subfamily 1 m...    209   3e-64   
ref|XP_006840206.1|  hypothetical protein AMTR_s00089p00127600          209   3e-64   
ref|XP_008237526.1|  PREDICTED: germin-like protein subfamily 1 m...    209   4e-64   
ref|XP_003590904.1|  Germin-like protein subfamily 1 member             209   4e-64   
gb|AAM76229.1|  putative germin E protein precursor                     207   5e-64   Gossypioides kirkii
ref|XP_008237522.1|  PREDICTED: germin-like protein subfamily 1 m...    209   5e-64   
ref|XP_008375054.1|  PREDICTED: germin-like protein subfamily 1 m...    208   7e-64   
ref|XP_002276926.2|  PREDICTED: uncharacterized protein LOC100251187    215   7e-64   Vitis vinifera
ref|XP_007030278.1|  Germin-like protein subfamily 1 member 18          215   8e-64   
ref|XP_006845051.1|  hypothetical protein AMTR_s00794p00001640          207   9e-64   
ref|XP_008393146.1|  PREDICTED: germin-like protein subfamily 1 m...    208   9e-64   
ref|XP_004155681.1|  PREDICTED: LOW QUALITY PROTEIN: germin-like ...    207   1e-63   
gb|KCW80409.1|  hypothetical protein EUGRSUZ_C01766                     207   1e-63   
gb|KCW76699.1|  hypothetical protein EUGRSUZ_D01059                     207   1e-63   
ref|XP_007199217.1|  hypothetical protein PRUPE_ppa021882mg             207   1e-63   
ref|XP_008237521.1|  PREDICTED: germin-like protein subfamily 1 m...    207   2e-63   
ref|XP_009349816.1|  PREDICTED: germin-like protein subfamily 1 m...    207   2e-63   
ref|XP_006375874.1|  germin-like protein 1                              206   2e-63   
gb|KCW61443.1|  hypothetical protein EUGRSUZ_H04174                     206   3e-63   
gb|KCW61445.1|  hypothetical protein EUGRSUZ_H04176                     206   3e-63   
ref|XP_010024915.1|  PREDICTED: putative germin-like protein 2-1        206   3e-63   
gb|KCW61437.1|  hypothetical protein EUGRSUZ_H04167                     206   3e-63   
ref|XP_008351931.1|  PREDICTED: germin-like protein subfamily 1 m...    206   4e-63   
ref|XP_007201563.1|  hypothetical protein PRUPE_ppa018105mg             206   4e-63   
ref|XP_002531992.1|  Rhicadhesin receptor precursor, putative           206   5e-63   Ricinus communis
ref|XP_010042132.1|  PREDICTED: germin-like protein subfamily 1 m...    206   5e-63   
ref|XP_008443751.1|  PREDICTED: germin-like protein subfamily 1 m...    206   5e-63   
ref|XP_009357348.1|  PREDICTED: germin-like protein subfamily 1 m...    206   5e-63   
ref|XP_009355938.1|  PREDICTED: germin-like protein subfamily 1 m...    206   5e-63   
ref|XP_008443754.1|  PREDICTED: germin-like protein subfamily 1 m...    206   6e-63   
ref|XP_008367619.1|  PREDICTED: germin-like protein subfamily 1 m...    206   7e-63   
gb|KCW61442.1|  hypothetical protein EUGRSUZ_H04173                     205   8e-63   
ref|XP_008393483.1|  PREDICTED: germin-like protein subfamily 1 m...    206   8e-63   
gb|KCW76697.1|  hypothetical protein EUGRSUZ_D01057                     205   8e-63   
ref|NP_001268128.1|  germin-like protein 5                              205   9e-63   
ref|XP_008360941.1|  PREDICTED: germin-like protein subfamily 1 m...    205   9e-63   
ref|XP_010052624.1|  PREDICTED: germin-like protein subfamily 1 m...    205   9e-63   
ref|XP_010027139.1|  PREDICTED: germin-like protein subfamily 1 m...    205   9e-63   
gb|KCW44232.1|  hypothetical protein EUGRSUZ_L02342                     205   1e-62   
gb|KCW61438.1|  hypothetical protein EUGRSUZ_H04168                     205   1e-62   
ref|XP_002276445.2|  PREDICTED: uncharacterized protein LOC100254460    214   1e-62   Vitis vinifera
ref|XP_010041604.1|  PREDICTED: germin-like protein subfamily 1 m...    205   1e-62   
ref|XP_007030270.1|  Germin-like protein subfamily 1 member 18          208   1e-62   
ref|XP_010066342.1|  PREDICTED: germin-like protein subfamily 1 m...    204   2e-62   
ref|XP_010024914.1|  PREDICTED: putative germin-like protein 2-1        204   2e-62   
ref|NP_001237300.1|  uncharacterized protein LOC100527781 precursor     204   2e-62   
ref|XP_010048221.1|  PREDICTED: germin-like protein subfamily 1 m...    204   2e-62   
ref|XP_004142552.1|  PREDICTED: germin-like protein subfamily 1 m...    204   2e-62   
gb|KCW61436.1|  hypothetical protein EUGRSUZ_H04166                     204   2e-62   
ref|XP_007143989.1|  hypothetical protein PHAVU_007G119700g             204   2e-62   
ref|XP_006375870.1|  germin-like protein 1                              204   2e-62   
ref|XP_008393482.1|  PREDICTED: germin-like protein subfamily 1 m...    204   2e-62   
ref|XP_010024919.1|  PREDICTED: germin-like protein subfamily 1 m...    204   3e-62   
gb|KCW61456.1|  hypothetical protein EUGRSUZ_H04192                     204   3e-62   
ref|XP_010024918.1|  PREDICTED: germin-like protein subfamily 1 m...    204   3e-62   
ref|XP_002319674.2|  hypothetical protein POPTR_0013s04920g             204   3e-62   Populus trichocarpa [western balsam poplar]
ref|XP_010024920.1|  PREDICTED: germin-like protein subfamily 1 m...    204   4e-62   
ref|XP_010041605.1|  PREDICTED: germin-like protein subfamily 1 m...    203   4e-62   
ref|XP_007030284.1|  RmlC-like cupins superfamily protein               204   4e-62   
ref|XP_008237525.1|  PREDICTED: germin-like protein subfamily 1 m...    204   5e-62   
ref|XP_010050157.1|  PREDICTED: germin-like protein subfamily 1 m...    203   6e-62   
ref|XP_007030280.1|  RmlC-like cupins superfamily protein isoform 1     203   6e-62   
ref|XP_011002009.1|  PREDICTED: germin-like protein subfamily 1 m...    203   6e-62   
gb|KCW64218.1|  hypothetical protein EUGRSUZ_G01868                     203   6e-62   
ref|XP_010050166.1|  PREDICTED: germin-like protein subfamily 1 m...    203   6e-62   
ref|XP_010024921.1|  PREDICTED: germin-like protein subfamily 1 m...    203   6e-62   
ref|XP_007030281.1|  RmlC-like cupins superfamily protein isoform 2     203   6e-62   
ref|XP_010066338.1|  PREDICTED: germin-like protein subfamily 1 m...    203   7e-62   
gb|KCW44233.1|  hypothetical protein EUGRSUZ_L02343                     203   9e-62   
gb|EYU40207.1|  hypothetical protein MIMGU_mgv1a012993mg                203   9e-62   
ref|XP_010066343.1|  PREDICTED: germin-like protein subfamily 1 m...    202   9e-62   
ref|XP_010024911.1|  PREDICTED: germin-like protein subfamily 1 m...    202   9e-62   
ref|XP_006857270.1|  hypothetical protein AMTR_s00067p00014150          202   9e-62   
ref|XP_007030274.1|  Germin-like protein subfamily 1 member 18          214   9e-62   
ref|XP_006840195.1|  hypothetical protein AMTR_s00089p00119070          202   1e-61   
ref|XP_011038438.1|  PREDICTED: germin-like protein subfamily 1 m...    202   1e-61   
ref|XP_011034444.1|  PREDICTED: germin-like protein subfamily 1 m...    202   1e-61   
ref|XP_011034442.1|  PREDICTED: germin-like protein subfamily 1 m...    202   1e-61   
ref|XP_006840196.1|  hypothetical protein AMTR_s00089p00119480          202   1e-61   
ref|XP_011038440.1|  PREDICTED: germin-like protein subfamily 1 m...    202   2e-61   
ref|XP_008243694.1|  PREDICTED: germin-like protein 9-1                 209   2e-61   
ref|XP_010024917.1|  PREDICTED: germin-like protein subfamily 1 m...    202   2e-61   
ref|XP_008776811.1|  PREDICTED: putative germin-like protein 2-1 ...    201   2e-61   
ref|XP_011034443.1|  PREDICTED: germin-like protein subfamily 1 m...    201   3e-61   
gb|KCW64213.1|  hypothetical protein EUGRSUZ_G01863                     201   3e-61   
emb|CBI36816.3|  unnamed protein product                                201   3e-61   
ref|XP_010050748.1|  PREDICTED: uncharacterized protein LOC104439371    208   3e-61   
ref|XP_010024913.1|  PREDICTED: germin-like protein subfamily 1 m...    201   4e-61   
ref|XP_010050174.1|  PREDICTED: germin-like protein subfamily 1 m...    201   4e-61   
ref|XP_010054506.1|  PREDICTED: uncharacterized protein LOC104442816    207   5e-61   
emb|CAN63434.1|  hypothetical protein VITISV_033830                     200   5e-61   Vitis vinifera
ref|XP_007030265.1|  Germin-like protein 2                              201   5e-61   
ref|XP_011034445.1|  PREDICTED: germin-like protein subfamily 1 m...    201   5e-61   
ref|XP_007030267.1|  Germin-like protein subfamily 1 member 18          203   6e-61   
ref|XP_010027145.1|  PREDICTED: germin-like protein subfamily 1 m...    201   6e-61   
ref|XP_002284624.1|  PREDICTED: germin-like protein subfamily 1 m...    200   7e-61   Vitis vinifera
gb|AFK48994.1|  unknown                                                 200   7e-61   
ref|XP_008237387.1|  PREDICTED: germin-like protein subfamily 1 m...    201   8e-61   
ref|XP_002325797.2|  hypothetical protein POPTR_0019s04340g             200   9e-61   Populus trichocarpa [western balsam poplar]
ref|NP_001267943.1|  germin-like protein 4 precursor                    200   1e-60   
gb|KCW80407.1|  hypothetical protein EUGRSUZ_C01764                     199   1e-60   
ref|XP_002319672.1|  hypothetical protein POPTR_0013s04850g             199   1e-60   Populus trichocarpa [western balsam poplar]
ref|XP_006375871.1|  hypothetical protein POPTR_0013s04880g             199   2e-60   
ref|XP_011075126.1|  PREDICTED: putative germin-like protein 2-1 ...    199   2e-60   
ref|XP_002284320.1|  PREDICTED: germin-like protein subfamily 1 m...    199   2e-60   Vitis vinifera
ref|XP_002325370.2|  hypothetical protein POPTR_0019s04270g             198   2e-60   Populus trichocarpa [western balsam poplar]
emb|CBI36811.3|  unnamed protein product                                199   3e-60   
ref|XP_008775104.1|  PREDICTED: putative germin-like protein 2-1        199   3e-60   
ref|XP_003618162.1|  Germin-like protein subfamily 1 member             199   3e-60   
ref|XP_002319671.1|  hypothetical protein POPTR_0013s04840g             199   3e-60   Populus trichocarpa [western balsam poplar]
ref|XP_006298965.1|  hypothetical protein CARUB_v10015090mg             199   3e-60   
gb|KCW82834.1|  hypothetical protein EUGRSUZ_C04205                     199   4e-60   
ref|XP_011075128.1|  PREDICTED: putative germin-like protein 2-1        198   4e-60   
ref|XP_007030176.1|  Germin-like protein subfamily 1 member 18          201   4e-60   
ref|XP_007143990.1|  hypothetical protein PHAVU_007G119700g             199   4e-60   
ref|XP_010024926.1|  PREDICTED: germin-like protein subfamily 1 m...    198   4e-60   
ref|XP_006371120.1|  hypothetical protein POPTR_0019s04280g             198   4e-60   
ref|XP_003618164.1|  Germin-like protein subfamily 1 member             198   4e-60   
ref|XP_011038439.1|  PREDICTED: germin-like protein subfamily 1 m...    199   4e-60   
ref|XP_009341765.1|  PREDICTED: germin-like protein subfamily 1 m...    199   4e-60   
ref|XP_011046612.1|  PREDICTED: germin-like protein subfamily 1 m...    199   5e-60   
ref|XP_010027136.1|  PREDICTED: uncharacterized protein LOC104417584    206   5e-60   
ref|XP_010659615.1|  PREDICTED: germin-like protein subfamily 1 m...    198   5e-60   
ref|XP_006371122.1|  Germin-like protein subfamily 1 member 6 pre...    198   5e-60   
ref|XP_010464157.1|  PREDICTED: germin-like protein subfamily 1 m...    198   5e-60   
gb|KFK24125.1|  hypothetical protein AALP_AAs58370U000100               198   5e-60   
emb|CAN72946.1|  hypothetical protein VITISV_034968                     209   6e-60   Vitis vinifera
ref|NP_187246.1|  germin-like protein subfamily 1 member 7              198   6e-60   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010024924.1|  PREDICTED: germin-like protein subfamily 1 m...    198   6e-60   
ref|XP_004290344.1|  PREDICTED: germin-like protein subfamily 1 m...    198   6e-60   
ref|XP_003618167.1|  Germin-like protein                                198   6e-60   
ref|XP_010049996.1|  PREDICTED: germin-like protein subfamily 1 m...    198   6e-60   
ref|XP_010049995.1|  PREDICTED: germin-like protein subfamily 1 m...    198   6e-60   
ref|XP_010049993.1|  PREDICTED: germin-like protein subfamily 1 m...    198   6e-60   
ref|XP_008808106.1|  PREDICTED: putative germin-like protein 2-1 ...    198   6e-60   
ref|XP_010027140.1|  PREDICTED: uncharacterized protein LOC104417587    207   7e-60   
ref|XP_010049991.1|  PREDICTED: germin-like protein subfamily 1 m...    198   7e-60   
ref|XP_008776810.1|  PREDICTED: putative germin-like protein 2-1 ...    197   7e-60   
ref|XP_011075119.1|  PREDICTED: putative germin-like protein 2-1 ...    197   8e-60   
emb|CAN71140.1|  hypothetical protein VITISV_005471                     197   8e-60   Vitis vinifera
gb|KHN14792.1|  Germin-like protein subfamily 1 member 7                198   8e-60   
emb|CBI36790.3|  unnamed protein product                                197   8e-60   
emb|CBI39477.3|  unnamed protein product                                197   8e-60   
ref|XP_010659856.1|  PREDICTED: germin-like protein subfamily 1 m...    197   9e-60   
ref|NP_001267940.1|  germin-like protein 1                              197   9e-60   
emb|CDP10932.1|  unnamed protein product                                197   1e-59   
ref|XP_010434310.1|  PREDICTED: germin-like protein subfamily 1 m...    197   1e-59   
ref|XP_009124949.1|  PREDICTED: germin-like protein subfamily 1 m...    197   1e-59   
gb|KCW77248.1|  hypothetical protein EUGRSUZ_D01606                     197   1e-59   
emb|CBI36815.3|  unnamed protein product                                197   1e-59   
ref|XP_002523177.1|  Rhicadhesin receptor precursor, putative           197   1e-59   Ricinus communis
ref|XP_004293672.1|  PREDICTED: putative germin-like protein 2-1-...    197   1e-59   
ref|XP_010024923.1|  PREDICTED: germin-like protein subfamily 1 m...    197   1e-59   
gb|EMT02678.1|  Putative germin-like protein 2-1                        197   1e-59   
ref|XP_011046609.1|  PREDICTED: germin-like protein subfamily 1 m...    197   1e-59   
ref|XP_007201630.1|  hypothetical protein PRUPE_ppa020060mg             197   1e-59   
ref|XP_004293674.1|  PREDICTED: putative germin-like protein 2-1-...    197   1e-59   
ref|XP_010024925.1|  PREDICTED: germin-like protein subfamily 1 m...    196   2e-59   
ref|XP_010027143.1|  PREDICTED: uncharacterized protein LOC104417591    204   2e-59   
ref|XP_011046611.1|  PREDICTED: germin-like protein subfamily 1 m...    198   2e-59   
emb|CBI36810.3|  unnamed protein product                                199   2e-59   
ref|XP_010049990.1|  PREDICTED: germin-like protein subfamily 1 m...    197   2e-59   
ref|XP_011002008.1|  PREDICTED: germin-like protein subfamily 1 m...    197   2e-59   
ref|XP_010051710.1|  PREDICTED: germin-like protein subfamily 1 m...    197   2e-59   
ref|XP_011039266.1|  PREDICTED: germin-like protein subfamily 1 m...    197   2e-59   
ref|XP_003618165.1|  Germin-like protein subfamily 1 member             196   2e-59   
ref|XP_010672478.1|  PREDICTED: germin-like protein subfamily 1 m...    196   2e-59   
ref|XP_010053012.1|  PREDICTED: putative germin-like protein 2-1        196   3e-59   
emb|CAN80133.1|  hypothetical protein VITISV_012032                     196   3e-59   Vitis vinifera
ref|XP_006840197.1|  hypothetical protein AMTR_s00089p00120230          197   3e-59   
ref|XP_010049992.1|  PREDICTED: germin-like protein subfamily 1 m...    196   4e-59   
emb|CBI36791.3|  unnamed protein product                                196   4e-59   
ref|XP_004293675.1|  PREDICTED: putative germin-like protein 2-1-...    196   4e-59   
ref|NP_193199.1|  germin-like protein 9                                 196   4e-59   
gb|EYU39944.1|  hypothetical protein MIMGU_mgv1a020036mg                196   4e-59   
emb|CDY37880.1|  BnaC04g31260D                                          196   4e-59   
ref|XP_004489240.1|  PREDICTED: germin-like protein subfamily 1 m...    196   5e-59   
gb|KHN04965.1|  Germin-like protein subfamily 1 member 7                196   5e-59   
ref|XP_009385875.1|  PREDICTED: putative germin-like protein 2-1        196   5e-59   
ref|XP_006405658.1|  hypothetical protein EUTSA_v10027918mg             196   5e-59   
ref|XP_007199406.1|  hypothetical protein PRUPE_ppa026225mg             196   5e-59   
gb|AFK49577.1|  unknown                                                 196   5e-59   
gb|AAD00509.1|  germin-like protein                                     195   5e-59   
ref|NP_001240963.1|  germin-like protein subfamily 1 member 7-lik...    196   5e-59   
sp|P45852.1|GLP1_MESCR  RecName: Full=Germin-like protein; Flags:...    196   6e-59   
gb|KDP34915.1|  hypothetical protein JCGZ_09203                         195   7e-59   
ref|XP_008778966.1|  PREDICTED: putative germin-like protein 2-1        195   7e-59   
ref|XP_010911724.1|  PREDICTED: putative germin-like protein 2-1        195   7e-59   
emb|CBI36814.3|  unnamed protein product                                195   8e-59   
ref|XP_010053013.1|  PREDICTED: putative germin-like protein 2-1        195   8e-59   
ref|XP_007030263.1|  Germin-like protein subfamily 1 member 18          196   8e-59   
ref|XP_011075129.1|  PREDICTED: putative germin-like protein 2-1 ...    195   8e-59   
gb|KDP23759.1|  hypothetical protein JCGZ_23592                         194   9e-59   
emb|CDY15957.1|  BnaA04g11540D                                          195   9e-59   
ref|XP_010051709.1|  PREDICTED: germin-like protein subfamily 1 m...    195   9e-59   
ref|XP_006414672.1|  hypothetical protein EUTSA_v10026186mg             195   1e-58   
ref|XP_002306210.1|  hypothetical protein POPTR_0004s18690g             195   1e-58   
ref|XP_009129904.1|  PREDICTED: germin-like protein subfamily 1 m...    195   1e-58   
ref|XP_008371812.1|  PREDICTED: germin-like protein subfamily 1 m...    195   1e-58   
ref|XP_002284343.2|  PREDICTED: uncharacterized protein LOC100256308    202   1e-58   
emb|CDP10106.1|  unnamed protein product                                194   1e-58   
emb|CDX99669.1|  BnaC04g34260D                                          195   1e-58   
gb|KDP23768.1|  hypothetical protein JCGZ_23601                         195   1e-58   
emb|CDP10107.1|  unnamed protein product                                194   1e-58   
ref|XP_011034305.1|  PREDICTED: germin-like protein subfamily 1 m...    194   1e-58   
ref|XP_002523178.1|  Rhicadhesin receptor precursor, putative           194   1e-58   
gb|EYU38442.1|  hypothetical protein MIMGU_mgv1a013089mg                195   1e-58   
ref|XP_007213411.1|  hypothetical protein PRUPE_ppa026076mg             194   1e-58   
ref|XP_010528770.1|  PREDICTED: germin-like protein subfamily 1 m...    195   2e-58   
ref|XP_006408007.1|  hypothetical protein EUTSA_v10021469mg             194   2e-58   
emb|CDP10933.1|  unnamed protein product                                194   2e-58   
emb|CBI36812.3|  unnamed protein product                                201   2e-58   
ref|XP_006285306.1|  hypothetical protein CARUB_v10006688mg             194   2e-58   
emb|CAN70189.1|  hypothetical protein VITISV_016562                     194   2e-58   
ref|XP_003536153.1|  PREDICTED: germin-like protein subfamily 1 m...    194   2e-58   
gb|KFK33208.1|  hypothetical protein AALP_AA6G344800                    194   2e-58   
ref|XP_011046610.1|  PREDICTED: germin-like protein subfamily 1 m...    195   2e-58   
ref|XP_011046613.1|  PREDICTED: germin-like protein subfamily 1 m...    195   2e-58   
ref|XP_004489241.1|  PREDICTED: putative germin-like protein 2-1-...    194   2e-58   
ref|XP_011034307.1|  PREDICTED: germin-like protein subfamily 1 m...    194   3e-58   
ref|XP_010412923.1|  PREDICTED: germin-like protein subfamily 1 m...    194   3e-58   
ref|XP_009139822.1|  PREDICTED: germin-like protein subfamily 1 m...    194   3e-58   
ref|XP_011075120.1|  PREDICTED: putative germin-like protein 2-1 ...    193   3e-58   
ref|XP_010528694.1|  PREDICTED: germin-like protein subfamily 1 m...    193   4e-58   
ref|XP_009604370.1|  PREDICTED: putative germin-like protein 2-3        193   4e-58   
ref|XP_010435820.1|  PREDICTED: germin-like protein subfamily 1 m...    193   4e-58   
gb|ACG69479.1|  germin-like protein 3                                   193   4e-58   
ref|XP_011012323.1|  PREDICTED: germin-like protein subfamily 1 m...    198   4e-58   
ref|XP_006284934.1|  hypothetical protein CARUB_v10006233mg             193   4e-58   
ref|XP_011013026.1|  PREDICTED: germin-like protein subfamily 1 m...    193   4e-58   
gb|KDP23767.1|  hypothetical protein JCGZ_23600                         191   5e-58   
ref|XP_006387364.1|  hypothetical protein POPTR_1158s00200g             193   5e-58   
ref|XP_006443311.1|  hypothetical protein CICLE_v10022142mg             193   5e-58   
ref|XP_010528697.1|  PREDICTED: germin-like protein subfamily 1 m...    193   5e-58   
emb|CBI36783.3|  unnamed protein product                                195   5e-58   
ref|XP_002284616.2|  PREDICTED: germin-like protein subfamily 1 m...    193   6e-58   
sp|P92997.2|GL113_ARATH  RecName: Full=Germin-like protein subfam...    193   6e-58   
gb|AAB51572.1|  germin-like protein                                     193   6e-58   
gb|KDP23769.1|  hypothetical protein JCGZ_23602                         193   6e-58   
ref|NP_001236994.1|  uncharacterized protein LOC100527249 precursor     192   6e-58   
ref|XP_006405663.1|  hypothetical protein EUTSA_v10027916mg             192   7e-58   
ref|XP_009414512.1|  PREDICTED: putative germin-like protein 2-1        192   7e-58   
ref|XP_008225645.1|  PREDICTED: putative germin-like protein 2-1        192   8e-58   
ref|NP_001268198.1|  germin-like protein 3 precursor                    192   8e-58   
ref|XP_009402547.1|  PREDICTED: putative germin-like protein 2-1 ...    192   8e-58   
gb|KDP23764.1|  hypothetical protein JCGZ_23597                         193   8e-58   
gb|EYU20537.1|  hypothetical protein MIMGU_mgv1a013077mg                193   8e-58   
ref|XP_002868798.1|  predicted protein                                  192   8e-58   
ref|XP_006405659.1|  hypothetical protein EUTSA_v10028158mg             192   1e-57   
ref|XP_009140209.1|  PREDICTED: germin-like protein subfamily 1 m...    192   1e-57   
emb|CAN71631.1|  hypothetical protein VITISV_015711                     192   1e-57   
ref|XP_010435818.1|  PREDICTED: germin-like protein subfamily 1 m...    192   1e-57   
ref|XP_006286150.1|  hypothetical protein CARUB_v10007709mg             192   1e-57   
ref|XP_011075127.1|  PREDICTED: putative germin-like protein 2-1 ...    192   1e-57   
ref|XP_011075130.1|  PREDICTED: putative germin-like protein 2-1 ...    192   1e-57   
ref|XP_002319184.1|  hypothetical protein POPTR_0013s06030g             192   1e-57   
ref|XP_003604729.1|  Germin-like protein subfamily 1 member             192   1e-57   
ref|XP_002870302.1|  predicted protein                                  192   1e-57   
gb|KDP23763.1|  hypothetical protein JCGZ_23596                         190   1e-57   
gb|KDO42113.1|  hypothetical protein CISIN_1g027369mg                   192   1e-57   
ref|XP_004513533.1|  PREDICTED: germin-like protein subfamily 1 m...    192   1e-57   
emb|CBI39473.3|  unnamed protein product                                192   1e-57   
ref|XP_006282503.1|  hypothetical protein CARUB_v10006909mg             192   1e-57   
gb|KCW82831.1|  hypothetical protein EUGRSUZ_C04202                     191   2e-57   
ref|XP_002269347.1|  PREDICTED: putative germin-like protein 2-1        191   2e-57   
ref|XP_009107789.1|  PREDICTED: germin-like protein subfamily 1 m...    192   2e-57   
ref|XP_006405676.1|  hypothetical protein EUTSA_v10027913mg             192   2e-57   
ref|XP_008777419.1|  PREDICTED: uncharacterized protein LOC103697358    199   2e-57   
ref|XP_010441036.1|  PREDICTED: germin-like protein subfamily 1 m...    192   2e-57   
ref|XP_010051708.1|  PREDICTED: germin-like protein subfamily 1 m...    192   2e-57   
emb|CDY11695.1|  BnaC06g13030D                                          191   2e-57   
ref|XP_006840201.1|  hypothetical protein AMTR_s00089p00122070          189   2e-57   
gb|KDO42111.1|  hypothetical protein CISIN_1g027345mg                   191   2e-57   
ref|XP_006840198.1|  hypothetical protein AMTR_s00089p00121240          190   2e-57   
ref|XP_003604731.1|  Germin-like protein subfamily 1 member             191   2e-57   
emb|CDY36875.1|  BnaC08g09720D                                          191   2e-57   
ref|XP_009402558.1|  PREDICTED: putative germin-like protein 2-1        191   2e-57   
emb|CDY69099.1|  BnaA07g37570D                                          191   2e-57   
gb|EYU42478.1|  hypothetical protein MIMGU_mgv1a022407mg                192   2e-57   
ref|XP_008383377.1|  PREDICTED: putative germin-like protein 2-1        191   2e-57   
ref|XP_010450837.1|  PREDICTED: germin-like protein subfamily 1 m...    191   2e-57   
ref|XP_002868743.1|  predicted protein                                  191   2e-57   
ref|XP_006405680.1|  hypothetical protein EUTSA_v10027917mg             191   2e-57   
ref|NP_198732.2|  germin-like protein subfamily 1 member 18             191   2e-57   
emb|CBI36786.3|  unnamed protein product                                190   2e-57   
ref|XP_006299201.1|  hypothetical protein CARUB_v10015347mg             191   2e-57   
ref|XP_006443312.1|  hypothetical protein CICLE_v10022118mg             191   3e-57   
ref|XP_011045439.1|  PREDICTED: germin-like protein subfamily 1 m...    191   3e-57   
gb|EPS68345.1|  hypothetical protein M569_06426                         189   3e-57   
ref|NP_001046874.1|  Os02g0491600                                       191   3e-57   
gb|KFK23658.1|  germin-like protein                                     191   3e-57   
ref|XP_002284284.2|  PREDICTED: germin-like protein subfamily 1 m...    192   3e-57   
ref|XP_011034308.1|  PREDICTED: germin-like protein subfamily 1 m...    191   3e-57   
ref|XP_003532644.2|  PREDICTED: putative germin-like protein 2-1-...    190   4e-57   
ref|XP_006599050.1|  PREDICTED: germin-like protein subfamily 1 m...    191   4e-57   
ref|XP_002868742.1|  predicted protein                                  191   4e-57   
ref|XP_009362202.1|  PREDICTED: putative germin-like protein 2-1        191   4e-57   
gb|KDP34914.1|  hypothetical protein JCGZ_09202                         191   4e-57   
ref|XP_010672088.1|  PREDICTED: germin-like protein subfamily 1 m...    191   4e-57   
emb|CAN73847.1|  hypothetical protein VITISV_021638                     191   4e-57   
emb|CDP14601.1|  unnamed protein product                                191   4e-57   
ref|XP_010463900.1|  PREDICTED: germin-like protein subfamily 1 m...    191   4e-57   
ref|XP_002313686.1|  germin-like protein 1                              191   4e-57   
gb|EYU38443.1|  hypothetical protein MIMGU_mgv1a013090mg                191   4e-57   
ref|XP_002884546.1|  hypothetical protein ARALYDRAFT_477892             191   5e-57   
gb|EYU40849.1|  hypothetical protein MIMGU_mgv1a021360mg                191   5e-57   
ref|XP_010528696.1|  PREDICTED: germin-like protein subfamily 1 m...    190   5e-57   
gb|KHN39146.1|  Putative germin-like protein 2-1                        190   5e-57   
ref|XP_011075121.1|  PREDICTED: putative germin-like protein 2-1 ...    190   5e-57   
ref|XP_010054737.1|  PREDICTED: putative germin-like protein 2-1        190   6e-57   
ref|XP_006443310.1|  hypothetical protein CICLE_v10022111mg             190   6e-57   
gb|KCW61433.1|  hypothetical protein EUGRSUZ_H04161                     190   7e-57   
ref|XP_004513532.1|  PREDICTED: germin-like protein subfamily 1 m...    190   7e-57   
ref|XP_010683101.1|  PREDICTED: germin-like protein subfamily 1 m...    190   8e-57   
gb|KHN25860.1|  Putative germin-like protein 2-1                        190   9e-57   
ref|XP_002452101.1|  hypothetical protein SORBIDRAFT_04g019700          189   9e-57   
ref|XP_006442438.1|  hypothetical protein CICLE_v10024000mg             190   9e-57   
ref|XP_002531991.1|  Rhicadhesin receptor precursor, putative           189   9e-57   
emb|CDY36876.1|  BnaC08g09710D                                          189   1e-56   
ref|XP_003593910.1|  Germin-like protein subfamily 1 member             189   1e-56   
emb|CDP10146.1|  unnamed protein product                                189   1e-56   
ref|XP_002452098.1|  hypothetical protein SORBIDRAFT_04g019650          189   1e-56   
ref|XP_003547666.1|  PREDICTED: germin-like protein subfamily 1 m...    189   1e-56   
ref|XP_008225644.1|  PREDICTED: putative germin-like protein 2-1        189   1e-56   
ref|NP_198727.1|  germin-like protein subfamily 1 member 14             189   1e-56   
ref|XP_008679725.1|  PREDICTED: putative germin-like protein 2-1        189   1e-56   
ref|NP_198735.1|  germin-like protein 2a                                189   1e-56   
ref|NP_198729.1|  germin-like protein subfamily 1 member 16             189   2e-56   
gb|EYU20538.1|  hypothetical protein MIMGU_mgv1a012929mg                189   2e-56   
ref|NP_001267944.1|  germin-like protein 7 precursor                    189   2e-56   
ref|XP_002868741.1|  predicted protein                                  189   2e-56   
ref|XP_009414511.1|  PREDICTED: putative germin-like protein 2-1        189   2e-56   
ref|XP_006442436.1|  hypothetical protein CICLE_v10024280mg             189   2e-56   
ref|XP_006580034.1|  PREDICTED: putative germin-like protein 2-1-...    189   2e-56   
ref|XP_002870812.1|  predicted protein                                  189   2e-56   
ref|XP_009113441.1|  PREDICTED: germin-like protein subfamily 1 m...    189   2e-56   
gb|KDP23867.1|  hypothetical protein JCGZ_27136                         189   2e-56   
ref|XP_003604730.1|  Germin-like protein subfamily 1 member             189   2e-56   
emb|CAN71348.1|  hypothetical protein VITISV_024253                     189   2e-56   
ref|XP_002284661.2|  PREDICTED: uncharacterized protein LOC100240807    195   2e-56   
ref|XP_006841333.1|  hypothetical protein AMTR_s01299p00010680          186   2e-56   
gb|KDP23773.1|  hypothetical protein JCGZ_23606                         187   2e-56   
ref|NP_001046876.1|  Os02g0491800                                       189   3e-56   
ref|XP_002523176.1|  Rhicadhesin receptor precursor, putative           188   3e-56   
ref|XP_006477875.1|  PREDICTED: germin-like protein subfamily 1 m...    188   3e-56   
ref|XP_006442442.1|  hypothetical protein CICLE_v10022152mg             188   3e-56   
sp|Q6K5P9.1|GL22_ORYSJ  RecName: Full=Putative germin-like protei...    189   3e-56   
ref|XP_010688720.1|  PREDICTED: germin-like protein subfamily 1 m...    189   3e-56   
ref|NP_001046875.2|  Os02g0491700                                       189   3e-56   
ref|XP_008808516.1|  PREDICTED: putative germin-like protein 2-1        188   3e-56   
ref|XP_004952511.1|  PREDICTED: putative germin-like protein 2-2-...    188   3e-56   
ref|XP_006856738.1|  hypothetical protein AMTR_s03266p00004160          187   3e-56   
ref|XP_006405677.1|  hypothetical protein EUTSA_v10027920mg             188   3e-56   
ref|XP_006477877.1|  PREDICTED: germin-like protein subfamily 1 m...    188   3e-56   
ref|XP_006477879.1|  PREDICTED: germin-like protein subfamily 1 m...    188   4e-56   
ref|XP_002313687.2|  hypothetical protein POPTR_0009s14250g             188   4e-56   
ref|XP_006354544.1|  PREDICTED: germin-like protein subfamily 1 m...    188   4e-56   
ref|XP_002530594.1|  Rhicadhesin receptor precursor, putative           187   4e-56   
ref|XP_006477883.1|  PREDICTED: germin-like protein subfamily 1 m...    188   5e-56   
ref|XP_008383378.1|  PREDICTED: putative germin-like protein 2-1        187   5e-56   
ref|XP_011037744.1|  PREDICTED: putative germin-like protein 2-1        187   5e-56   
ref|XP_002280481.2|  PREDICTED: uncharacterized protein LOC100252737    198   5e-56   
ref|XP_010053014.1|  PREDICTED: putative germin-like protein 2-3        187   5e-56   
ref|XP_006442444.1|  hypothetical protein CICLE_v10023384mg             187   6e-56   
ref|XP_004293677.1|  PREDICTED: putative germin-like protein 2-1-...    187   6e-56   
ref|XP_006442447.1|  hypothetical protein CICLE_v10024005mg             187   6e-56   
gb|KHN28583.1|  Germin-like protein subfamily 1 member 16               187   6e-56   
ref|XP_006477881.1|  PREDICTED: germin-like protein subfamily 1 m...    187   6e-56   
ref|XP_010662282.1|  PREDICTED: putative germin-like protein 2-1        186   7e-56   
ref|XP_007213316.1|  hypothetical protein PRUPE_ppb017655mg             187   7e-56   
ref|XP_010485791.1|  PREDICTED: germin-like protein subfamily 1 m...    187   7e-56   
ref|XP_002868738.1|  hypothetical protein ARALYDRAFT_494073             187   7e-56   
ref|XP_006442440.1|  hypothetical protein CICLE_v10023726mg             187   7e-56   
gb|EMS53398.1|  Putative germin-like protein 2-1                        187   7e-56   
ref|XP_010911182.1|  PREDICTED: putative germin-like protein 2-1        187   7e-56   
gb|EAY85909.1|  hypothetical protein OsI_07272                          187   7e-56   
ref|XP_009402557.1|  PREDICTED: putative germin-like protein 2-1        187   7e-56   
emb|CAN63889.1|  hypothetical protein VITISV_027218                     187   8e-56   
gb|KDO36579.1|  hypothetical protein CISIN_1g048097mg                   187   8e-56   
ref|XP_002452099.1|  hypothetical protein SORBIDRAFT_04g019670          187   8e-56   
gb|EMT10776.1|  Putative germin-like protein 2-1                        187   9e-56   
ref|XP_010450836.1|  PREDICTED: germin-like protein subfamily 1 m...    187   9e-56   
ref|XP_007212425.1|  hypothetical protein PRUPE_ppa017161mg             187   9e-56   
gb|KFK33230.1|  hypothetical protein AALP_AA6G347300                    187   1e-55   
ref|XP_009125150.1|  PREDICTED: germin-like protein subfamily 1 m...    187   1e-55   
emb|CDP14600.1|  unnamed protein product                                187   1e-55   
ref|XP_010662281.1|  PREDICTED: putative germin-like protein 2-1        186   1e-55   
ref|XP_002267172.1|  PREDICTED: putative germin-like protein 2-2        187   1e-55   
ref|XP_004247721.1|  PREDICTED: germin-like protein subfamily 1 m...    187   1e-55   
ref|NP_198734.1|  germin-like protein subfamily 1 member 19             187   1e-55   
ref|XP_004134614.1|  PREDICTED: putative germin-like protein 2-3-...    187   1e-55   
ref|NP_198731.1|  germin-like protein subfamily 1 member 17             187   1e-55   
ref|XP_006405679.1|  hypothetical protein EUTSA_v10027925mg             187   1e-55   



>gb|EYU20539.1| hypothetical protein MIMGU_mgv1a013072mg [Erythranthe guttata]
Length=231

 Score =   251 bits (640),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 123/147 (84%), Positives = 132/147 (90%), Gaps = 1/147 (1%)
 Frame = +3

Query  138  LQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFLFRGLNMPGNTSNPLGSKVTPVNVNNL  317
            LQDFCVAVND+ +AVFVNGK+CKNP  VVA DFLFRGLN PGNTSNPLGS+VTPVNVN L
Sbjct  30   LQDFCVAVNDAKSAVFVNGKVCKNPNMVVAKDFLFRGLNKPGNTSNPLGSRVTPVNVNQL  89

Query  318  PGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLYVGFVLSNPP-PGMKNPLFT  494
            PGLNTLGIS VRID+APNGLNPPHTHPRATE+L+V+EGTLYVGFV SNP  P +KN LFT
Sbjct  90   PGLNTLGISAVRIDYAPNGLNPPHTHPRATEILVVIEGTLYVGFVTSNPADPALKNKLFT  149

Query  495  KTLVAGDVFVFPEGLIHFQFNVGKTNA  575
            K L  GDVFVFPEGLIHFQFNVGKTNA
Sbjct  150  KYLYPGDVFVFPEGLIHFQFNVGKTNA  176



>gb|EYU20535.1| hypothetical protein MIMGU_mgv1a013054mg [Erythranthe guttata]
Length=231

 Score =   251 bits (640),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 123/147 (84%), Positives = 132/147 (90%), Gaps = 1/147 (1%)
 Frame = +3

Query  138  LQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFLFRGLNMPGNTSNPLGSKVTPVNVNNL  317
            LQDFCVAVND+ +AVFVNGK+CKNP  VVA DFLFRGLN PGNTSNPLGS+VTPVNVN L
Sbjct  30   LQDFCVAVNDAQSAVFVNGKVCKNPNMVVAEDFLFRGLNKPGNTSNPLGSRVTPVNVNQL  89

Query  318  PGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLYVGFVLSNPP-PGMKNPLFT  494
            PGLNTLGIS VRID+APNGLNPPHTHPRATE+L+V+EGTLYVGFV SNP  P +KN LFT
Sbjct  90   PGLNTLGISAVRIDYAPNGLNPPHTHPRATEILVVIEGTLYVGFVTSNPANPALKNKLFT  149

Query  495  KTLVAGDVFVFPEGLIHFQFNVGKTNA  575
            K L  GDVFVFPEGLIHFQFNVGKTNA
Sbjct  150  KYLYPGDVFVFPEGLIHFQFNVGKTNA  176



>gb|EYU28622.1| hypothetical protein MIMGU_mgv1a018753mg [Erythranthe guttata]
Length=230

 Score =   249 bits (635),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 122/147 (83%), Positives = 132/147 (90%), Gaps = 1/147 (1%)
 Frame = +3

Query  138  LQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFLFRGLNMPGNTSNPLGSKVTPVNVNNL  317
            LQDFCVAV D++AAVFVNGKICKNP  VVA DF++RGLN PGNTSNP+GS+VTPVNVN L
Sbjct  29   LQDFCVAVKDADAAVFVNGKICKNPDLVVAEDFIYRGLNKPGNTSNPIGSRVTPVNVNQL  88

Query  318  PGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLYVGFVLSNPP-PGMKNPLFT  494
            PGLNTLGIS VRID+APNGLNPPHTHPRATE+L+VLEGTLYVGFV SNP  P +KN LFT
Sbjct  89   PGLNTLGISAVRIDYAPNGLNPPHTHPRATEILVVLEGTLYVGFVTSNPANPAIKNKLFT  148

Query  495  KTLVAGDVFVFPEGLIHFQFNVGKTNA  575
            K L  GDVFVFPEGLIHFQFNVGKTNA
Sbjct  149  KYLYPGDVFVFPEGLIHFQFNVGKTNA  175



>ref|XP_009784933.1| PREDICTED: germin-like protein subfamily 1 member 20 [Nicotiana 
sylvestris]
Length=228

 Score =   248 bits (632),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 136/173 (79%), Positives = 145/173 (84%), Gaps = 0/173 (0%)
 Frame = +3

Query  57   MALRFIVFVIAMVALAssfshasdpssLQDFCVAVNDSNAAVFVNGKICKNPMQVVANDF  236
            MALR +V  IA++AL SS SHA DPS LQD CVAV+DS AAVFVNGKICK+P QV+ANDF
Sbjct  1    MALRTLVLTIAIMALLSSMSHAFDPSPLQDICVAVDDSMAAVFVNGKICKDPKQVMANDF  60

Query  237  LFRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVL  416
               GLN+PGNTSN LGS VT VNV NLPGLNTLGISL RID+AP GLNPPHTHPR TE+L
Sbjct  61   FKSGLNIPGNTSNQLGSAVTAVNVGNLPGLNTLGISLARIDYAPYGLNPPHTHPRGTEIL  120

Query  417  LVLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNA  575
             VLEGTLYVGFVLSNP P MKN LFTK L  GDVFVFP GLIHFQFNVGKTNA
Sbjct  121  AVLEGTLYVGFVLSNPGPNMKNKLFTKILNPGDVFVFPIGLIHFQFNVGKTNA  173



>gb|EYU38444.1| hypothetical protein MIMGU_mgv1a013102mg [Erythranthe guttata]
Length=230

 Score =   247 bits (631),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 121/147 (82%), Positives = 131/147 (89%), Gaps = 1/147 (1%)
 Frame = +3

Query  138  LQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFLFRGLNMPGNTSNPLGSKVTPVNVNNL  317
            LQDFCVAV D++AAVFVNGKICKNP  VVA DF++RGLN PGNTSNP+GS+VTPVNVN L
Sbjct  29   LQDFCVAVKDADAAVFVNGKICKNPELVVAEDFIYRGLNKPGNTSNPIGSRVTPVNVNQL  88

Query  318  PGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLYVGFVLSNPP-PGMKNPLFT  494
            PGLNTLGIS VRID+APNGLNPPHTHPRATE+L+VLEGTLYVGFV SNP  P +KN LF 
Sbjct  89   PGLNTLGISAVRIDYAPNGLNPPHTHPRATEILVVLEGTLYVGFVTSNPANPAIKNKLFA  148

Query  495  KTLVAGDVFVFPEGLIHFQFNVGKTNA  575
            K L  GDVFVFPEGLIHFQFNVGKTNA
Sbjct  149  KYLYPGDVFVFPEGLIHFQFNVGKTNA  175



>ref|XP_009795503.1| PREDICTED: germin-like protein subfamily 1 member 20 isoform 
X1 [Nicotiana sylvestris]
 ref|XP_009795504.1| PREDICTED: germin-like protein subfamily 1 member 20 isoform 
X2 [Nicotiana sylvestris]
Length=228

 Score =   246 bits (629),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 136/173 (79%), Positives = 145/173 (84%), Gaps = 0/173 (0%)
 Frame = +3

Query  57   MALRFIVFVIAMVALAssfshasdpssLQDFCVAVNDSNAAVFVNGKICKNPMQVVANDF  236
            MALR +V  IA++AL SS SHA DPS LQD CVAV+DS AAVFVNGKICK+P QV+ANDF
Sbjct  1    MALRTLVLTIAIMALLSSMSHAFDPSPLQDICVAVDDSMAAVFVNGKICKDPKQVMANDF  60

Query  237  LFRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVL  416
               GLN+PGNTSN LGS VT VNV NLPGLNTLGISL RID+AP GLNPPHTHPR TE+L
Sbjct  61   FKSGLNIPGNTSNQLGSVVTAVNVGNLPGLNTLGISLARIDYAPYGLNPPHTHPRGTEIL  120

Query  417  LVLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNA  575
             VLEGTLYVGFVLSNP P MKN LFTK L  GDVFVFP GLIHFQFNVGKTNA
Sbjct  121  AVLEGTLYVGFVLSNPGPNMKNKLFTKILNPGDVFVFPIGLIHFQFNVGKTNA  173



>ref|XP_009625530.1| PREDICTED: putative germin-like protein 2-1 [Nicotiana tomentosiformis]
Length=228

 Score =   245 bits (626),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 135/173 (78%), Positives = 147/173 (85%), Gaps = 0/173 (0%)
 Frame = +3

Query  57   MALRFIVFVIAMVALAssfshasdpssLQDFCVAVNDSNAAVFVNGKICKNPMQVVANDF  236
            MAL+ +V  IA++A+ SS SHASDPS LQDFCVAVNDS AAVFVNGKICK+P  V A+DF
Sbjct  1    MALKSLVLTIAILAVVSSISHASDPSPLQDFCVAVNDSMAAVFVNGKICKDPKVVNADDF  60

Query  237  LFRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVL  416
               GLN+PGNTSN +GS VT VNV NLPGLNTLGISLVRID+AP GLNPPHTHPRATEVL
Sbjct  61   FKSGLNIPGNTSNQVGSAVTAVNVGNLPGLNTLGISLVRIDYAPYGLNPPHTHPRATEVL  120

Query  417  LVLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNA  575
            +VLEGTLYVGFVLSNP P MKN LFTK L  GDVFVFP GLIHFQFN+GKT A
Sbjct  121  VVLEGTLYVGFVLSNPGPNMKNKLFTKILKPGDVFVFPIGLIHFQFNIGKTTA  173



>gb|EYU20549.1| hypothetical protein MIMGU_mgv1a020596mg [Erythranthe guttata]
Length=231

 Score =   245 bits (626),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 128/177 (72%), Positives = 143/177 (81%), Gaps = 7/177 (4%)
 Frame = +3

Query  48   ILDMALRFIVFVIAMVALAssfshasdpssLQDFCVAVNDSNAAVFVNGKICKNPMQVVA  227
            +L +   FIV  +A +A AS  S       LQDFCVAV D++AAVFVNGK+CKNP  VVA
Sbjct  6    LLSVTTIFIVSCLATLAYASDPSP------LQDFCVAVKDADAAVFVNGKVCKNPNMVVA  59

Query  228  NDFLFRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRAT  407
             DF F GLN PGNTSNP+GS+VTPVNVN +PGLNTLGIS VRID+APNGLNPPHTHPRAT
Sbjct  60   EDFFFPGLNKPGNTSNPVGSRVTPVNVNQIPGLNTLGISAVRIDYAPNGLNPPHTHPRAT  119

Query  408  EVLLVLEGTLYVGFVLSNPP-PGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNA  575
            E+L+V+EGTLYVGFV SNP  P +KN LFTK L  GDVFVFPEGLIHFQFNVGKTNA
Sbjct  120  EILVVMEGTLYVGFVTSNPADPALKNKLFTKYLYPGDVFVFPEGLIHFQFNVGKTNA  176



>ref|XP_009612543.1| PREDICTED: germin-like protein subfamily 1 member 20 [Nicotiana 
tomentosiformis]
Length=228

 Score =   245 bits (625),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 135/173 (78%), Positives = 144/173 (83%), Gaps = 0/173 (0%)
 Frame = +3

Query  57   MALRFIVFVIAMVALAssfshasdpssLQDFCVAVNDSNAAVFVNGKICKNPMQVVANDF  236
            MAL+  V  IA++AL SS SHA DPS LQD CVAV+DS AAVFVNGKICK+P QV+ANDF
Sbjct  1    MALKAFVLTIAIMALLSSMSHAFDPSPLQDICVAVDDSMAAVFVNGKICKDPKQVMANDF  60

Query  237  LFRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVL  416
               GLN+PGNTSN LGS VT VNV NLPGLNTLGISL RID+AP GLNPPHTHPR TE+L
Sbjct  61   FKSGLNIPGNTSNQLGSTVTAVNVGNLPGLNTLGISLARIDYAPYGLNPPHTHPRGTEIL  120

Query  417  LVLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNA  575
             VLEGTLYVGFVLSNP P MKN LFTK L  GDVFVFP GLIHFQFNVGKTNA
Sbjct  121  AVLEGTLYVGFVLSNPGPNMKNKLFTKILNPGDVFVFPIGLIHFQFNVGKTNA  173



>ref|XP_006358464.1| PREDICTED: germin-like protein subfamily 1 member 14-like [Solanum 
tuberosum]
Length=230

 Score =   245 bits (625),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 133/175 (76%), Positives = 144/175 (82%), Gaps = 0/175 (0%)
 Frame = +3

Query  51   LDMALRFIVFVIAMVALAssfshasdpssLQDFCVAVNDSNAAVFVNGKICKNPMQVVAN  230
            + +AL+F+V  IA++ALASS S ASDPS LQDFCVAVNDS   VFVNGK+CK P  V A+
Sbjct  1    MALALKFLVITIAILALASSPSTASDPSPLQDFCVAVNDSKTTVFVNGKVCKYPKLVTAD  60

Query  231  DFLFRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATE  410
            DF   GLN PGNTSN LGS VT VNVNNLPGLNTLGISL RIDFA  GLNPPHTHPR TE
Sbjct  61   DFFRSGLNKPGNTSNQLGSIVTAVNVNNLPGLNTLGISLARIDFARRGLNPPHTHPRGTE  120

Query  411  VLLVLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNA  575
            VL+VL+G LYVGFVLSNP P MKN LFTK L +GDVFVFPEGLIHFQ NVGKTNA
Sbjct  121  VLVVLKGRLYVGFVLSNPGPNMKNKLFTKILNSGDVFVFPEGLIHFQLNVGKTNA  175



>ref|XP_009612542.1| PREDICTED: putative germin-like protein 2-1 [Nicotiana tomentosiformis]
Length=228

 Score =   244 bits (624),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 135/173 (78%), Positives = 146/173 (84%), Gaps = 0/173 (0%)
 Frame = +3

Query  57   MALRFIVFVIAMVALAssfshasdpssLQDFCVAVNDSNAAVFVNGKICKNPMQVVANDF  236
            MAL+  V  IA++A+ SS SHASDPS LQDFCVAVNDS AAVFVNGKICK+P  V A+DF
Sbjct  1    MALKLFVLTIAILAVVSSISHASDPSPLQDFCVAVNDSMAAVFVNGKICKDPKVVNADDF  60

Query  237  LFRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVL  416
               GLN+PGNTSN +GS VT VNV NLPGLNTLGISLVRID+AP GLNPPHTHPRATEVL
Sbjct  61   FKSGLNIPGNTSNQVGSAVTAVNVGNLPGLNTLGISLVRIDYAPYGLNPPHTHPRATEVL  120

Query  417  LVLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNA  575
            +VLEGTLYVGFVLSNP P MKN LFTK L  GDVFVFP GLIHFQFN+GKT A
Sbjct  121  VVLEGTLYVGFVLSNPGPNMKNKLFTKILKPGDVFVFPIGLIHFQFNIGKTTA  173



>ref|XP_009786127.1| PREDICTED: putative germin-like protein 2-1 [Nicotiana sylvestris]
Length=229

 Score =   244 bits (624),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 136/173 (79%), Positives = 145/173 (84%), Gaps = 0/173 (0%)
 Frame = +3

Query  57   MALRFIVFVIAMVALAssfshasdpssLQDFCVAVNDSNAAVFVNGKICKNPMQVVANDF  236
            MAL+  V  IA++A+ SS SHASDPS LQDFCVAVNDS AAVFVNGKICK+P  V A+DF
Sbjct  1    MALKSFVLTIAILAIVSSISHASDPSPLQDFCVAVNDSMAAVFVNGKICKDPKVVNADDF  60

Query  237  LFRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVL  416
               GLN+PGNTSN +GS VT VNV NLPGLNTLGISLVRID+AP GLNPPHTHPRATEVL
Sbjct  61   FKSGLNIPGNTSNQVGSAVTAVNVGNLPGLNTLGISLVRIDYAPYGLNPPHTHPRATEVL  120

Query  417  LVLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNA  575
             VLEGTLYVGFVLSNP P MKN LFTK L  GDVFVFP GLIHFQFNVGKT A
Sbjct  121  AVLEGTLYVGFVLSNPGPNMKNKLFTKILKPGDVFVFPIGLIHFQFNVGKTKA  173



>ref|XP_006358462.1| PREDICTED: germin-like protein subfamily 1 member 14-like [Solanum 
tuberosum]
Length=230

 Score =   244 bits (624),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 133/175 (76%), Positives = 144/175 (82%), Gaps = 0/175 (0%)
 Frame = +3

Query  51   LDMALRFIVFVIAMVALAssfshasdpssLQDFCVAVNDSNAAVFVNGKICKNPMQVVAN  230
            + +AL+F+V  IA++ALASS S ASDPS LQDFCVAVNDS   VFVNGK+CK+P  V A+
Sbjct  1    MALALKFLVITIAILALASSPSTASDPSPLQDFCVAVNDSKTTVFVNGKVCKDPKLVTAD  60

Query  231  DFLFRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATE  410
            DF   GLN PGNTSN LGS VT VNVNNLPGLNTLGISL RIDFA  GLNPPHTHPR TE
Sbjct  61   DFFRSGLNKPGNTSNQLGSIVTAVNVNNLPGLNTLGISLARIDFARRGLNPPHTHPRGTE  120

Query  411  VLLVLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNA  575
            VL+VL+G LYVGFVLSNP P MKN LFTK L  GDVFVFPEGLIHFQ NVGKTNA
Sbjct  121  VLVVLKGRLYVGFVLSNPGPNMKNKLFTKILNPGDVFVFPEGLIHFQLNVGKTNA  175



>gb|EYU40211.1| hypothetical protein MIMGU_mgv1a013108mg [Erythranthe guttata]
Length=230

 Score =   244 bits (623),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 129/177 (73%), Positives = 142/177 (80%), Gaps = 7/177 (4%)
 Frame = +3

Query  48   ILDMALRFIVFVIAMVALAssfshasdpssLQDFCVAVNDSNAAVFVNGKICKNPMQVVA  227
            ++ +A  F+V   A  A AS  S       LQDFCVAVND+ A VFVNGKICKNP  VVA
Sbjct  5    LVSLATIFVVASFATFAYASDPSP------LQDFCVAVNDTEAFVFVNGKICKNPNMVVA  58

Query  228  NDFLFRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRAT  407
             DFLFRGLN PGNTSNPLGS+VTPV VN LPGLNTLGIS VRID+APNGLNPPHTHPRAT
Sbjct  59   EDFLFRGLNKPGNTSNPLGSRVTPVTVNQLPGLNTLGISAVRIDYAPNGLNPPHTHPRAT  118

Query  408  EVLLVLEGTLYVGFVLSNPP-PGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNA  575
            E+L++L+GTLYVGFV SNP  P +KN LFTK L  GDVFVFP+GLIHFQFNVGKTNA
Sbjct  119  EILILLKGTLYVGFVTSNPADPALKNKLFTKYLHPGDVFVFPQGLIHFQFNVGKTNA  175



>ref|XP_006349261.1| PREDICTED: putative germin-like protein 2-1-like [Solanum tuberosum]
 ref|XP_006349262.1| PREDICTED: putative germin-like protein 2-1-like [Solanum tuberosum]
Length=228

 Score =   244 bits (623),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 134/173 (77%), Positives = 143/173 (83%), Gaps = 0/173 (0%)
 Frame = +3

Query  57   MALRFIVFVIAMVALAssfshasdpssLQDFCVAVNDSNAAVFVNGKICKNPMQVVANDF  236
            MAL++ V +IA++A+ +S SHASDPS LQDFCVAVNDS  AVFVNGK CKNPM V A+DF
Sbjct  1    MALKYFVLIIAILAVVTSISHASDPSPLQDFCVAVNDSMNAVFVNGKFCKNPMDVTADDF  60

Query  237  LFRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVL  416
               GLNM GNTSN LGS VT VNVNNL GLNTLGISL RIDFAP GLNPPHTHPR TEVL
Sbjct  61   FRPGLNMAGNTSNQLGSAVTAVNVNNLAGLNTLGISLARIDFAPYGLNPPHTHPRGTEVL  120

Query  417  LVLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNA  575
             + EGTLYVGFVLSNP P MKN LFTK L  GDVFVFP GLIHFQFNVGKTNA
Sbjct  121  ALFEGTLYVGFVLSNPGPNMKNKLFTKILHPGDVFVFPVGLIHFQFNVGKTNA  173



>ref|XP_009627660.1| PREDICTED: germin-like protein subfamily 1 member 20 [Nicotiana 
tomentosiformis]
Length=228

 Score =   243 bits (620),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 134/173 (77%), Positives = 143/173 (83%), Gaps = 0/173 (0%)
 Frame = +3

Query  57   MALRFIVFVIAMVALAssfshasdpssLQDFCVAVNDSNAAVFVNGKICKNPMQVVANDF  236
            MAL+  V  IA++AL SS SHA DPS LQD CVAV+DS AAVFVNGKICK+P QV+ANDF
Sbjct  1    MALKAFVITIAIMALLSSMSHAFDPSPLQDICVAVDDSMAAVFVNGKICKDPKQVMANDF  60

Query  237  LFRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVL  416
               GLN+PGNTSN LGS VT VNV NLPGLNTLGISL RID+AP GLNPPHTHPR TE+L
Sbjct  61   FKSGLNIPGNTSNQLGSAVTAVNVGNLPGLNTLGISLARIDYAPYGLNPPHTHPRGTEIL  120

Query  417  LVLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNA  575
             VLEGTLYVGFVLSNP P MKN LFTK L  GDVFVFP GLIHFQFNVGKT A
Sbjct  121  AVLEGTLYVGFVLSNPGPNMKNKLFTKILNPGDVFVFPIGLIHFQFNVGKTKA  173



>ref|XP_009620404.1| PREDICTED: germin-like protein subfamily 1 member 17 [Nicotiana 
tomentosiformis]
Length=228

 Score =   243 bits (619),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 132/173 (76%), Positives = 144/173 (83%), Gaps = 0/173 (0%)
 Frame = +3

Query  57   MALRFIVFVIAMVALAssfshasdpssLQDFCVAVNDSNAAVFVNGKICKNPMQVVANDF  236
            MAL+  V  I ++A+ SS SHA DPS LQDFCVAVNDS AAVFVNGKICK+P  V A+DF
Sbjct  1    MALKLFVLTIGILAIVSSISHAYDPSPLQDFCVAVNDSMAAVFVNGKICKDPKVVNADDF  60

Query  237  LFRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVL  416
               GLN+PGNTSN +GS VT VNV NLPGLNTLGISLVRID+AP GLNPPHTHPRATE+L
Sbjct  61   FKSGLNIPGNTSNQVGSAVTAVNVGNLPGLNTLGISLVRIDYAPYGLNPPHTHPRATEIL  120

Query  417  LVLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNA  575
            +VLEGTLYVGFVLSNP P MKN LFTK L  GDVFVFP GLIHFQFN+GKT A
Sbjct  121  VVLEGTLYVGFVLSNPGPNMKNKLFTKILKPGDVFVFPIGLIHFQFNIGKTTA  173



>gb|EYU20548.1| hypothetical protein MIMGU_mgv1a013109mg [Erythranthe guttata]
Length=230

 Score =   243 bits (619),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 126/170 (74%), Positives = 138/170 (81%), Gaps = 7/170 (4%)
 Frame = +3

Query  69   FIVFVIAMVALAssfshasdpssLQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFLFRG  248
            FIV  +A +A AS  S       LQDFCVAV D++AAVFVNGK+CKNP  VVA DF   G
Sbjct  12   FIVSCLATLAYASDPSP------LQDFCVAVKDADAAVFVNGKVCKNPNMVVAEDFFLSG  65

Query  249  LNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLE  428
            LN PGNTSNP+GS+VTP NVN +PGLNTLGIS VRID+APNGLNPPHTHPRATE+L+VLE
Sbjct  66   LNKPGNTSNPVGSRVTPANVNQIPGLNTLGISAVRIDYAPNGLNPPHTHPRATEILVVLE  125

Query  429  GTLYVGFVLSNPP-PGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNA  575
            GTLYVGFV SNP  P +KN LFTK L  GDVFVFPEGLIHFQFNVGKTNA
Sbjct  126  GTLYVGFVTSNPADPTLKNKLFTKYLYPGDVFVFPEGLIHFQFNVGKTNA  175



>ref|XP_006358463.1| PREDICTED: germin-like protein subfamily 1 member 20-like [Solanum 
tuberosum]
Length=228

 Score =   241 bits (616),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 132/173 (76%), Positives = 143/173 (83%), Gaps = 0/173 (0%)
 Frame = +3

Query  57   MALRFIVFVIAMVALAssfshasdpssLQDFCVAVNDSNAAVFVNGKICKNPMQVVANDF  236
            MAL++ V  IA++A+ +S SHASDPS LQDFCVAV DS +AVFVNGK CK+P  V A+DF
Sbjct  1    MALKYFVLTIAILAVVTSISHASDPSPLQDFCVAVEDSKSAVFVNGKFCKDPKDVTADDF  60

Query  237  LFRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVL  416
               GLN+PGNTSN LGS V  VNVNNLPGLNTLGISL RIDFAP GLNPPHTHPR TEVL
Sbjct  61   FRPGLNVPGNTSNQLGSVVIAVNVNNLPGLNTLGISLARIDFAPYGLNPPHTHPRGTEVL  120

Query  417  LVLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNA  575
            +VLEGTLYVGFVLSNP P MKN LFTK L  GDVFVFP GLIHFQFNVGKT A
Sbjct  121  VVLEGTLYVGFVLSNPGPNMKNKLFTKILHPGDVFVFPIGLIHFQFNVGKTKA  173



>ref|XP_009795501.1| PREDICTED: putative germin-like protein 2-1 [Nicotiana sylvestris]
Length=228

 Score =   241 bits (615),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 134/173 (77%), Positives = 144/173 (83%), Gaps = 0/173 (0%)
 Frame = +3

Query  57   MALRFIVFVIAMVALAssfshasdpssLQDFCVAVNDSNAAVFVNGKICKNPMQVVANDF  236
            MAL+  V  IA++A+ SS SHASDPS LQDFCVAVNDS AAVFVNGKICK+P  V A+DF
Sbjct  1    MALKSFVLTIAILAVVSSISHASDPSPLQDFCVAVNDSMAAVFVNGKICKDPKVVNADDF  60

Query  237  LFRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVL  416
               GLN+PGNTSN +GS VT VNV NLPGLNTLGISLVRID+AP GLNPPHTHPRATEVL
Sbjct  61   FKSGLNIPGNTSNQVGSAVTAVNVGNLPGLNTLGISLVRIDYAPYGLNPPHTHPRATEVL  120

Query  417  LVLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNA  575
             VLEGTLYVGFVLSNP P MKN LFTK L  GDVFVFP GLIHFQFN+GK  A
Sbjct  121  AVLEGTLYVGFVLSNPGPNMKNKLFTKILKPGDVFVFPIGLIHFQFNIGKNKA  173



>ref|XP_006349264.1| PREDICTED: germin-like protein subfamily 1 member 13-like [Solanum 
tuberosum]
Length=228

 Score =   241 bits (614),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 133/173 (77%), Positives = 142/173 (82%), Gaps = 0/173 (0%)
 Frame = +3

Query  57   MALRFIVFVIAMVALAssfshasdpssLQDFCVAVNDSNAAVFVNGKICKNPMQVVANDF  236
            M  + +V VIA++A+ SS SHASDPS LQDFCVAV+DS +AVFVNGK CKNPM V A+DF
Sbjct  1    MTFKSLVLVIAIMAVLSSMSHASDPSPLQDFCVAVDDSKSAVFVNGKFCKNPMDVTADDF  60

Query  237  LFRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVL  416
               GLNM GNTSN LGS VT VNVNNL GLNTLGISL RIDFAP GLNPPHTHPR TEVL
Sbjct  61   FRPGLNMAGNTSNQLGSAVTAVNVNNLAGLNTLGISLARIDFAPYGLNPPHTHPRGTEVL  120

Query  417  LVLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNA  575
             + EGTLYVGFVLSNP P MKN LFTK L  GDVFVFP GLIHFQFNVGKTNA
Sbjct  121  ALFEGTLYVGFVLSNPGPNMKNKLFTKILHPGDVFVFPVGLIHFQFNVGKTNA  173



>gb|EYU20540.1| hypothetical protein MIMGU_mgv1a013117mg [Erythranthe guttata]
Length=230

 Score =   240 bits (613),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 124/176 (70%), Positives = 140/176 (80%), Gaps = 2/176 (1%)
 Frame = +3

Query  51   LDMALRFIVFVIAMVALAssfshasdpssLQDFCVAVNDSNAAVFVNGKICKNPMQVVAN  230
            + MAL  +  + A+ + A+    +     LQDFCVAVND+ A VFVNGKICKNP  VVA 
Sbjct  1    MKMALVSLATIFAIASFATFGYASDPSP-LQDFCVAVNDTEAFVFVNGKICKNPNMVVAE  59

Query  231  DFLFRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATE  410
            DFLFRGLN PGNTSNPLGS+VTPV VN LPGLNTLGIS VRID+APNGLNPPHTHPRATE
Sbjct  60   DFLFRGLNKPGNTSNPLGSRVTPVTVNQLPGLNTLGISAVRIDYAPNGLNPPHTHPRATE  119

Query  411  VLLVLEGTLYVGFVLSNPP-PGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNA  575
            +L++L+GTLYVGFV SNP  P +KN LF   L  GDVFVFP+GLIHFQFNVGKTNA
Sbjct  120  ILILLKGTLYVGFVTSNPADPALKNKLFATYLHPGDVFVFPQGLIHFQFNVGKTNA  175



>ref|XP_004230404.1| PREDICTED: putative germin-like protein 2-1 [Solanum lycopersicum]
Length=228

 Score =   240 bits (613),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 132/173 (76%), Positives = 144/173 (83%), Gaps = 0/173 (0%)
 Frame = +3

Query  57   MALRFIVFVIAMVALAssfshasdpssLQDFCVAVNDSNAAVFVNGKICKNPMQVVANDF  236
            MAL++ V +IA++A+ +S SHASDPS LQDFCVAVNDS   VFVNGK+CK+P  V ANDF
Sbjct  1    MALKYAVLIIAILAVVTSISHASDPSPLQDFCVAVNDSMTPVFVNGKVCKDPKVVSANDF  60

Query  237  LFRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVL  416
               GLN+ GNTSN +GS VT VNVNNLPGLNTLGISLVRID+AP GLNPPHTHPR TEVL
Sbjct  61   FKSGLNVAGNTSNNVGSAVTAVNVNNLPGLNTLGISLVRIDYAPYGLNPPHTHPRGTEVL  120

Query  417  LVLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNA  575
             VLEGTLYVGFVLSNP P MKN LFTK L  GDVFVFP GLIHFQFNVGKT A
Sbjct  121  TVLEGTLYVGFVLSNPGPNMKNKLFTKILHPGDVFVFPIGLIHFQFNVGKTKA  173



>gb|EYU20545.1| hypothetical protein MIMGU_mgv1a020779mg [Erythranthe guttata]
Length=231

 Score =   240 bits (613),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 126/177 (71%), Positives = 141/177 (80%), Gaps = 7/177 (4%)
 Frame = +3

Query  48   ILDMALRFIVFVIAMVALAssfshasdpssLQDFCVAVNDSNAAVFVNGKICKNPMQVVA  227
            +L +   F+V  +A +A AS  S       LQDFCVAV D +AAVFVNGK+CKNP  VVA
Sbjct  6    LLSVTTIFVVSCLATLAYASDPSP------LQDFCVAVKDEDAAVFVNGKVCKNPDMVVA  59

Query  228  NDFLFRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRAT  407
             DF F GLN PGNTSN +GS+VTPVNVN +PGLNTLGIS VRID+APNGLNPPHTHPRAT
Sbjct  60   EDFFFPGLNKPGNTSNLVGSRVTPVNVNQIPGLNTLGISAVRIDYAPNGLNPPHTHPRAT  119

Query  408  EVLLVLEGTLYVGFVLSNPP-PGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNA  575
            E+L+V+EGTLYVGFV SNP  P +KN LFTK L  GDVFVFPEGLIHFQFNVGKTNA
Sbjct  120  EILVVMEGTLYVGFVTSNPADPALKNKLFTKYLYPGDVFVFPEGLIHFQFNVGKTNA  176



>gb|EYU20546.1| hypothetical protein MIMGU_mgv1a013111mg [Erythranthe guttata]
Length=230

 Score =   240 bits (613),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 132/176 (75%), Positives = 147/176 (84%), Gaps = 2/176 (1%)
 Frame = +3

Query  51   LDMALRFIVFVIAMVALAssfshasdpssLQDFCVAVNDSNAAVFVNGKICKNPMQVVAN  230
            + MAL  I   I +VA  ++F++ASDPS LQDFCVAVND+ A VFVNGKICKNP  VVA 
Sbjct  1    MKMALVSIA-TIFVVAFFATFAYASDPSPLQDFCVAVNDTEAFVFVNGKICKNPNMVVAE  59

Query  231  DFLFRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATE  410
            DFLFRGLN PGNTSNPLGS+VTPV VN LPGLNTLGIS VRID+APNGLNPPHTHPRATE
Sbjct  60   DFLFRGLNKPGNTSNPLGSRVTPVTVNQLPGLNTLGISAVRIDYAPNGLNPPHTHPRATE  119

Query  411  VLLVLEGTLYVGFVLSNPP-PGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNA  575
            +L++L+GTLYVGFV SNP  P +KN LF   L  GDVFVFP+GLIHFQFNVGKTNA
Sbjct  120  ILILLKGTLYVGFVTSNPADPALKNKLFATYLHPGDVFVFPQGLIHFQFNVGKTNA  175



>ref|XP_006349268.1| PREDICTED: germin-like protein subfamily 1 member 13-like [Solanum 
tuberosum]
Length=228

 Score =   240 bits (612),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 132/173 (76%), Positives = 142/173 (82%), Gaps = 0/173 (0%)
 Frame = +3

Query  57   MALRFIVFVIAMVALAssfshasdpssLQDFCVAVNDSNAAVFVNGKICKNPMQVVANDF  236
            M  + +V +IA++A+ SS SHASDPS LQDFCVAV+DS +AVFVNGK CKNPM V A+DF
Sbjct  1    MTFKSLVLIIAIMAVLSSMSHASDPSPLQDFCVAVDDSKSAVFVNGKFCKNPMDVTADDF  60

Query  237  LFRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVL  416
               GLNM GNTSN LGS VT VNVNNL GLNTLGISL RIDFAP GLNPPHTHPR TEVL
Sbjct  61   FRPGLNMAGNTSNQLGSAVTAVNVNNLAGLNTLGISLARIDFAPYGLNPPHTHPRGTEVL  120

Query  417  LVLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNA  575
             + EGTLYVGFVLSNP P MKN LFTK L  GDVFVFP GLIHFQFNVGKTNA
Sbjct  121  ALFEGTLYVGFVLSNPGPNMKNKLFTKILHPGDVFVFPVGLIHFQFNVGKTNA  173



>ref|XP_009620917.1| PREDICTED: germin-like protein subfamily 1 member 17 [Nicotiana 
tomentosiformis]
Length=228

 Score =   240 bits (612),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 130/173 (75%), Positives = 142/173 (82%), Gaps = 0/173 (0%)
 Frame = +3

Query  57   MALRFIVFVIAMVALAssfshasdpssLQDFCVAVNDSNAAVFVNGKICKNPMQVVANDF  236
            MAL+ ++  IA +A+  S SHA DPS LQD CVAV+DS AAVFVNGKICK+P QV+ANDF
Sbjct  1    MALKVLILTIATMAVLFSMSHAFDPSPLQDICVAVDDSMAAVFVNGKICKDPKQVMANDF  60

Query  237  LFRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVL  416
               GLN+PGNTSN LGS VT VNV NLPGLNTLGISL RID+AP GLNPPHTHPR TE+L
Sbjct  61   FKSGLNIPGNTSNQLGSAVTAVNVGNLPGLNTLGISLARIDYAPYGLNPPHTHPRGTEIL  120

Query  417  LVLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNA  575
             VLEGTLYVGFVLSNP P +KN LFTK L  GDVFVFP GLIHFQFNVGKT A
Sbjct  121  AVLEGTLYVGFVLSNPGPNIKNKLFTKILNPGDVFVFPIGLIHFQFNVGKTKA  173



>ref|XP_009612541.1| PREDICTED: germin-like protein subfamily 1 member 17 [Nicotiana 
tomentosiformis]
Length=228

 Score =   239 bits (611),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 131/173 (76%), Positives = 141/173 (82%), Gaps = 0/173 (0%)
 Frame = +3

Query  57   MALRFIVFVIAMVALAssfshasdpssLQDFCVAVNDSNAAVFVNGKICKNPMQVVANDF  236
            MAL+ +   IA +A+  S SHA DPS LQD CVAV+DS AAVFVNGKICK+P QV+ANDF
Sbjct  1    MALKVLKLTIATMAVLFSMSHAFDPSPLQDICVAVDDSMAAVFVNGKICKDPKQVMANDF  60

Query  237  LFRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVL  416
               GLN+PGNTSN LGS VT VNV NLPGLNTLGISL RID+AP GLNPPHTHPR TE+L
Sbjct  61   FKSGLNIPGNTSNQLGSAVTAVNVGNLPGLNTLGISLARIDYAPYGLNPPHTHPRGTEIL  120

Query  417  LVLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNA  575
             VLEGTLYVGFVLSNP P MKN LFTK L  GDVFVFP GLIHFQFNVGKT A
Sbjct  121  AVLEGTLYVGFVLSNPGPNMKNKLFTKILNPGDVFVFPIGLIHFQFNVGKTKA  173



>ref|XP_006358459.1| PREDICTED: germin-like protein subfamily 1 member 20-like [Solanum 
tuberosum]
Length=228

 Score =   239 bits (609),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 132/173 (76%), Positives = 141/173 (82%), Gaps = 0/173 (0%)
 Frame = +3

Query  57   MALRFIVFVIAMVALAssfshasdpssLQDFCVAVNDSNAAVFVNGKICKNPMQVVANDF  236
            MAL++ V  IA++A  +S SHASDPS LQDFCVAVNDS +AVFVNGK CK+P  V A+DF
Sbjct  1    MALKYFVLTIAILAAVTSISHASDPSPLQDFCVAVNDSKSAVFVNGKFCKDPKDVTADDF  60

Query  237  LFRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVL  416
               GLN+PGNTSN LGS VT VNVNNL GLNTLGISL RIDFAP G NPPHTHPR TEVL
Sbjct  61   FRPGLNVPGNTSNQLGSVVTAVNVNNLLGLNTLGISLARIDFAPYGFNPPHTHPRGTEVL  120

Query  417  LVLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNA  575
             VLEGTLYVGFVLSNP P MKN LFTK L  GDVFVFP GLIHFQFNVGKT A
Sbjct  121  AVLEGTLYVGFVLSNPGPNMKNKLFTKILHPGDVFVFPIGLIHFQFNVGKTKA  173



>ref|XP_004230403.1| PREDICTED: putative germin-like protein 2-1 [Solanum lycopersicum]
Length=228

 Score =   238 bits (608),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 132/173 (76%), Positives = 143/173 (83%), Gaps = 0/173 (0%)
 Frame = +3

Query  57   MALRFIVFVIAMVALAssfshasdpssLQDFCVAVNDSNAAVFVNGKICKNPMQVVANDF  236
            MAL+  + +IA++A+ +S SHASDPS LQDFCVAVNDS  AVFVNGK CKNPM V A+DF
Sbjct  1    MALKSFILIIAILAVVTSISHASDPSPLQDFCVAVNDSMNAVFVNGKFCKNPMDVNADDF  60

Query  237  LFRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVL  416
               GLN+ GNTSN LGS VT VNVNNL GLNTLGISL RIDFAP GLNPPHTHPRATEVL
Sbjct  61   FRPGLNLAGNTSNQLGSAVTAVNVNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVL  120

Query  417  LVLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNA  575
             + EGTLYVGFVLSNP P MKN LFTK L  GDVFVFP GLIHFQFNVGKT+A
Sbjct  121  TLFEGTLYVGFVLSNPGPNMKNKLFTKILHPGDVFVFPVGLIHFQFNVGKTDA  173



>gb|EYU40209.1| hypothetical protein MIMGU_mgv1a013129mg [Erythranthe guttata]
Length=230

 Score =   239 bits (609),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 118/147 (80%), Positives = 127/147 (86%), Gaps = 1/147 (1%)
 Frame = +3

Query  138  LQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFLFRGLNMPGNTSNPLGSKVTPVNVNNL  317
            LQDFCVAVND+ A VFVNGKICKNP  VVA DFLFRGLN PGNTSNPLGS+VTPV VN L
Sbjct  29   LQDFCVAVNDTKAFVFVNGKICKNPNMVVAEDFLFRGLNKPGNTSNPLGSRVTPVTVNQL  88

Query  318  PGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLYVGFVLSNPP-PGMKNPLFT  494
            PGLNTLGIS VRID+AP GLNPPHTHPRATE+L++L+GTLYVGFV SNP  P +KN LF 
Sbjct  89   PGLNTLGISAVRIDYAPKGLNPPHTHPRATEILILLKGTLYVGFVTSNPADPALKNKLFA  148

Query  495  KTLVAGDVFVFPEGLIHFQFNVGKTNA  575
              L  GDVFVFP+GLIHFQFNVGKTNA
Sbjct  149  TYLHPGDVFVFPQGLIHFQFNVGKTNA  175



>ref|XP_006349267.1| PREDICTED: germin-like protein subfamily 1 member 13-like [Solanum 
tuberosum]
Length=228

 Score =   238 bits (608),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 131/173 (76%), Positives = 143/173 (83%), Gaps = 0/173 (0%)
 Frame = +3

Query  57   MALRFIVFVIAMVALAssfshasdpssLQDFCVAVNDSNAAVFVNGKICKNPMQVVANDF  236
            MAL+  V +IA++A+ +S SHASDPS LQDFCVAVNDS   VFVNGK+CK+P  V A+DF
Sbjct  1    MALKSFVLIIAILAVVTSISHASDPSPLQDFCVAVNDSMTTVFVNGKVCKDPRVVTADDF  60

Query  237  LFRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVL  416
               GLN+ GNTSN +GS VT VNVNNLPGLNTLGISLVRID+AP GLNPPHTHPR TEVL
Sbjct  61   FKSGLNVAGNTSNNVGSAVTAVNVNNLPGLNTLGISLVRIDYAPYGLNPPHTHPRGTEVL  120

Query  417  LVLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNA  575
             VLEGTLYVGFVLSNP P MKN LFTK L  GDVFVFP GLIHFQFNVGKT A
Sbjct  121  TVLEGTLYVGFVLSNPGPNMKNKLFTKILHPGDVFVFPIGLIHFQFNVGKTKA  173



>gb|EYU20541.1| hypothetical protein MIMGU_mgv1a018988mg [Erythranthe guttata]
Length=230

 Score =   238 bits (608),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 117/147 (80%), Positives = 129/147 (88%), Gaps = 1/147 (1%)
 Frame = +3

Query  138  LQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFLFRGLNMPGNTSNPLGSKVTPVNVNNL  317
            LQDFCVAV D++AAVFVNGK+CKNP  VVA +F F GLN  GNTSNP+GS+VTPVNVN +
Sbjct  29   LQDFCVAVKDADAAVFVNGKVCKNPDMVVAENFFFPGLNKSGNTSNPVGSRVTPVNVNQI  88

Query  318  PGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLYVGFVLSNPP-PGMKNPLFT  494
            PGLNTLGIS VRID+APNGLNPPHTHPRATE+L+V+EGTLYVGFV SNP  P +KN LFT
Sbjct  89   PGLNTLGISAVRIDYAPNGLNPPHTHPRATEILVVMEGTLYVGFVTSNPANPALKNKLFT  148

Query  495  KTLVAGDVFVFPEGLIHFQFNVGKTNA  575
            K L  GDVFVFPEGLIHFQFNVGKTNA
Sbjct  149  KYLYPGDVFVFPEGLIHFQFNVGKTNA  175



>ref|XP_006358460.1| PREDICTED: LOW QUALITY PROTEIN: germin-like protein subfamily 
1 member 18-like [Solanum tuberosum]
Length=233

 Score =   238 bits (608),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 131/175 (75%), Positives = 144/175 (82%), Gaps = 0/175 (0%)
 Frame = +3

Query  51   LDMALRFIVFVIAMVALAssfshasdpssLQDFCVAVNDSNAAVFVNGKICKNPMQVVAN  230
            + +AL+F+V  IA++ALASS S ASDPS L+ FCVAVNDS   VFVNGK+CK+P  V A+
Sbjct  1    MALALKFLVITIAILALASSPSTASDPSPLKIFCVAVNDSKTTVFVNGKVCKDPKLVTAD  60

Query  231  DFLFRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATE  410
            DF   GLN PGNTSN LGS VT VNVNNLPGLNTLGISL RIDFA +GLNPPHTHPR TE
Sbjct  61   DFFRSGLNKPGNTSNQLGSIVTAVNVNNLPGLNTLGISLARIDFARHGLNPPHTHPRGTE  120

Query  411  VLLVLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNA  575
            VL+VL+G LYVGFVLSNP P MKN LFTK L  GDVFVFPEGLIHFQ NVGKTNA
Sbjct  121  VLVVLKGRLYVGFVLSNPGPNMKNKLFTKILNPGDVFVFPEGLIHFQLNVGKTNA  175



>gb|EYU20542.1| hypothetical protein MIMGU_mgv1a020630mg [Erythranthe guttata]
Length=231

 Score =   238 bits (607),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 117/147 (80%), Positives = 128/147 (87%), Gaps = 1/147 (1%)
 Frame = +3

Query  138  LQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFLFRGLNMPGNTSNPLGSKVTPVNVNNL  317
            LQDFCVAV D++AAVFVNGK+CKNP  VVA DF F GLN PGNTSN +GS+VTPVNVN +
Sbjct  30   LQDFCVAVKDADAAVFVNGKVCKNPDMVVAEDFFFPGLNKPGNTSNLVGSRVTPVNVNQI  89

Query  318  PGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLYVGFVLSNPP-PGMKNPLFT  494
            PGLNTLGIS VRID+APNG NPPHTHPRATE+L+V+EGTLYVGFV SNP  P +KN LFT
Sbjct  90   PGLNTLGISAVRIDYAPNGSNPPHTHPRATEILVVMEGTLYVGFVTSNPANPALKNKLFT  149

Query  495  KTLVAGDVFVFPEGLIHFQFNVGKTNA  575
            K L  GDVFVFPEGLIHFQFNVGKTNA
Sbjct  150  KYLYPGDVFVFPEGLIHFQFNVGKTNA  176



>ref|XP_011099651.1| PREDICTED: germin-like protein subfamily 1 member 13 [Sesamum 
indicum]
Length=229

 Score =   238 bits (606),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 121/147 (82%), Positives = 127/147 (86%), Gaps = 1/147 (1%)
 Frame = +3

Query  138  LQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFLFRGLNMPGNTSNPLGSKVTPVNVNNL  317
            LQDFCVAVNDS AAVFVNGKICKNP  VVA DF F GLN PGNTSN +GS VTPVNVN L
Sbjct  28   LQDFCVAVNDSVAAVFVNGKICKNPNMVVAEDFFFPGLNKPGNTSNQVGSMVTPVNVNQL  87

Query  318  PGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLYVGFVLSNPP-PGMKNPLFT  494
            PGLNTLGISL RIDFAP G+NPPHTHPRA+E+LLV+EGTLYVGFV SNP  P MKN LFT
Sbjct  88   PGLNTLGISLARIDFAPYGINPPHTHPRASEILLVVEGTLYVGFVTSNPANPTMKNKLFT  147

Query  495  KTLVAGDVFVFPEGLIHFQFNVGKTNA  575
            K L  GDVFVFP+GLIHFQFNVGKTNA
Sbjct  148  KYLYPGDVFVFPQGLIHFQFNVGKTNA  174



>ref|XP_006346966.1| PREDICTED: putative germin-like protein 2-1-like [Solanum tuberosum]
Length=228

 Score =   237 bits (605),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 129/173 (75%), Positives = 142/173 (82%), Gaps = 0/173 (0%)
 Frame = +3

Query  57   MALRFIVFVIAMVALAssfshasdpssLQDFCVAVNDSNAAVFVNGKICKNPMQVVANDF  236
            MAL+  V +IA++A+ +S SHASDPS LQDFCVA+NDS   VFVNGK+CK+P  V A+DF
Sbjct  1    MALKSFVLIIAILAVVTSISHASDPSPLQDFCVAINDSMTTVFVNGKVCKDPKVVTADDF  60

Query  237  LFRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVL  416
               GLN+ GNTSN +GS VT VNVNNLPGLNTLGISL RID+AP GLNPPHTHPR TEVL
Sbjct  61   FKSGLNIAGNTSNNVGSAVTAVNVNNLPGLNTLGISLARIDYAPYGLNPPHTHPRGTEVL  120

Query  417  LVLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNA  575
             VLEGTLYVGFVLSNP P MKN LFTK L  GDVFVFP GLIHFQFNVGKT A
Sbjct  121  TVLEGTLYVGFVLSNPGPNMKNKLFTKILHPGDVFVFPIGLIHFQFNVGKTKA  173



>gb|EYU40208.1| hypothetical protein MIMGU_mgv1a020439mg [Erythranthe guttata]
Length=230

 Score =   237 bits (604),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 116/147 (79%), Positives = 126/147 (86%), Gaps = 1/147 (1%)
 Frame = +3

Query  138  LQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFLFRGLNMPGNTSNPLGSKVTPVNVNNL  317
            LQDFCVAV D++AAVFVNGKICK+P  VVA DF   GLN PGNTSNP+GS+VTP NVN +
Sbjct  29   LQDFCVAVKDADAAVFVNGKICKDPNMVVAEDFFLSGLNKPGNTSNPVGSRVTPANVNQI  88

Query  318  PGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLYVGFVLSNPP-PGMKNPLFT  494
             GLNTLGIS VRID+APNGLNPPHTHPRATE+L+VLEGTLYVGFV SNP  P +KN LFT
Sbjct  89   AGLNTLGISAVRIDYAPNGLNPPHTHPRATEILVVLEGTLYVGFVTSNPANPAIKNKLFT  148

Query  495  KTLVAGDVFVFPEGLIHFQFNVGKTNA  575
            K L  GDVFVFPEGLIHFQFNVGKT A
Sbjct  149  KYLYPGDVFVFPEGLIHFQFNVGKTKA  175



>ref|XP_006358461.1| PREDICTED: germin-like protein subfamily 1 member 14-like [Solanum 
tuberosum]
Length=230

 Score =   237 bits (604),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 129/175 (74%), Positives = 141/175 (81%), Gaps = 0/175 (0%)
 Frame = +3

Query  51   LDMALRFIVFVIAMVALAssfshasdpssLQDFCVAVNDSNAAVFVNGKICKNPMQVVAN  230
            + + L+F V  IA++AL SS S ASDPS LQDFCVAVN+S   VFVNGK+CK+P  V A+
Sbjct  1    MALTLKFFVITIAILALTSSPSTASDPSPLQDFCVAVNESKETVFVNGKVCKDPKLVTAD  60

Query  231  DFLFRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATE  410
            DF   GLN PGNTSN LGS VT VNVNNLPGLNTLGISL RIDFA  GLNPPHTHPR TE
Sbjct  61   DFFRPGLNKPGNTSNQLGSIVTAVNVNNLPGLNTLGISLARIDFARRGLNPPHTHPRGTE  120

Query  411  VLLVLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNA  575
            VL+VL+G LYVGFVLSNP P MKN LFTK L  GDVFVFPEGL+HFQ NVGKTNA
Sbjct  121  VLVVLKGRLYVGFVLSNPGPNMKNKLFTKILNPGDVFVFPEGLVHFQLNVGKTNA  175



>gb|AFW90592.1| germin-like protein subfamily 1 member 20 precursor [Solanum 
tuberosum]
Length=228

 Score =   236 bits (603),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 130/173 (75%), Positives = 142/173 (82%), Gaps = 0/173 (0%)
 Frame = +3

Query  57   MALRFIVFVIAMVALAssfshasdpssLQDFCVAVNDSNAAVFVNGKICKNPMQVVANDF  236
            MAL+  V +IA++A+ +S SHASDPS LQDFCVAVNDS   VFVNGK+CK+P  V A+DF
Sbjct  1    MALKSFVLIIAILAVVTSISHASDPSPLQDFCVAVNDSMTTVFVNGKVCKDPRVVTADDF  60

Query  237  LFRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVL  416
               GLN+ GNTSN +GS VT VNVNNLPGLN LGISLVRID+AP GLNPPHTHPR TEVL
Sbjct  61   FKSGLNVAGNTSNNVGSAVTAVNVNNLPGLNALGISLVRIDYAPYGLNPPHTHPRGTEVL  120

Query  417  LVLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNA  575
             VLEGTLYVGFVLSNP P MKN LFTK L  GDVFVFP GLIHFQFNVGKT A
Sbjct  121  TVLEGTLYVGFVLSNPGPNMKNKLFTKILHPGDVFVFPIGLIHFQFNVGKTKA  173



>gb|EYU20547.1| hypothetical protein MIMGU_mgv1a023357mg [Erythranthe guttata]
Length=231

 Score =   236 bits (603),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 125/177 (71%), Positives = 139/177 (79%), Gaps = 7/177 (4%)
 Frame = +3

Query  48   ILDMALRFIVFVIAMVALAssfshasdpssLQDFCVAVNDSNAAVFVNGKICKNPMQVVA  227
            +L +   F+V  +A +A AS  S       LQDFCVAV D +AAVFVNGK+CKNP  VVA
Sbjct  6    LLSVTTIFVVSCLATLAYASDPSP------LQDFCVAVKDEDAAVFVNGKVCKNPDMVVA  59

Query  228  NDFLFRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRAT  407
             DF F GLN PGNTSN +GS+VTPVNVN +PGLNTLGIS VRID+APNGLNPPHTHPRAT
Sbjct  60   EDFFFPGLNKPGNTSNLVGSRVTPVNVNQIPGLNTLGISAVRIDYAPNGLNPPHTHPRAT  119

Query  408  EVLLVLEGTLYVGFVLSNPPP-GMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNA  575
            E+L V+EGTLYVGFV SNP    +KN LFTK L  GDVFVFPEGLIHFQFNVGKTNA
Sbjct  120  EILFVMEGTLYVGFVTSNPADLALKNKLFTKYLYPGDVFVFPEGLIHFQFNVGKTNA  176



>gb|EYU20536.1| hypothetical protein MIMGU_mgv1a025658mg [Erythranthe guttata]
Length=231

 Score =   236 bits (601),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 117/147 (80%), Positives = 126/147 (86%), Gaps = 1/147 (1%)
 Frame = +3

Query  138  LQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFLFRGLNMPGNTSNPLGSKVTPVNVNNL  317
            LQDFCVAVND+ +AVFVNGK+CK+P  VVA DF   GLN  GNTSNPLGS+VTPVNVN L
Sbjct  30   LQDFCVAVNDAKSAVFVNGKVCKDPNMVVAEDFFLSGLNKLGNTSNPLGSRVTPVNVNQL  89

Query  318  PGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLYVGFVLSNPP-PGMKNPLFT  494
            PGLNTLGIS VRID+A NGLNPPHTHPRATE+L+VLEGTLYVGFV SNP  P +KN LFT
Sbjct  90   PGLNTLGISAVRIDYALNGLNPPHTHPRATEILVVLEGTLYVGFVTSNPANPALKNKLFT  149

Query  495  KTLVAGDVFVFPEGLIHFQFNVGKTNA  575
            K L  GDVFVFPEGLIHFQFN GKTNA
Sbjct  150  KYLYPGDVFVFPEGLIHFQFNAGKTNA  176



>ref|XP_006349265.1| PREDICTED: germin-like protein subfamily 1 member 13-like [Solanum 
tuberosum]
Length=228

 Score =   235 bits (599),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 129/171 (75%), Positives = 141/171 (82%), Gaps = 0/171 (0%)
 Frame = +3

Query  57   MALRFIVFVIAMVALAssfshasdpssLQDFCVAVNDSNAAVFVNGKICKNPMQVVANDF  236
            MA + ++  IA++A+ SS SHASDPS LQDFCVAV+D+  AVFVNGK CK+P  VVA DF
Sbjct  1    MAFKSLILAIAIMAVLSSMSHASDPSPLQDFCVAVDDTKNAVFVNGKFCKDPKLVVAEDF  60

Query  237  LFRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVL  416
               GLNMPGNTSN +GS VTPVNVNNLPGLNTLGISL RID+AP GLNPPHTHPR TE L
Sbjct  61   FKSGLNMPGNTSNNVGSAVTPVNVNNLPGLNTLGISLARIDYAPYGLNPPHTHPRGTEFL  120

Query  417  LVLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKT  569
            +VLEGTLYVGFVLSNP P MKN LFTK L  GDVFVFP GLIHFQFN GKT
Sbjct  121  VVLEGTLYVGFVLSNPGPNMKNKLFTKILHPGDVFVFPIGLIHFQFNPGKT  171



>ref|XP_009786129.1| PREDICTED: putative germin-like protein 2-1 [Nicotiana sylvestris]
Length=228

 Score =   234 bits (598),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 130/173 (75%), Positives = 141/173 (82%), Gaps = 0/173 (0%)
 Frame = +3

Query  57   MALRFIVFVIAMVALAssfshasdpssLQDFCVAVNDSNAAVFVNGKICKNPMQVVANDF  236
            MA +  V  +A++A+  S SHA DPS LQDFCVAVNDS AAVFVNGKICK+P  V A+DF
Sbjct  1    MARKLFVLTVAILAVVFSISHAYDPSPLQDFCVAVNDSMAAVFVNGKICKDPNVVNADDF  60

Query  237  LFRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVL  416
               GLN+PGNTSN +GS VT VNV NL GLNTLGISLVRID+AP GLNPPHTHPRA EVL
Sbjct  61   FKSGLNIPGNTSNQVGSAVTAVNVINLHGLNTLGISLVRIDYAPYGLNPPHTHPRAAEVL  120

Query  417  LVLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNA  575
            +VLEGTLYVGFVLSNP P MKN LFTK L  GDVFVFP GLIHFQFNVGKT A
Sbjct  121  VVLEGTLYVGFVLSNPGPNMKNKLFTKILKPGDVFVFPIGLIHFQFNVGKTKA  173



>gb|EYU40210.1| hypothetical protein MIMGU_mgv1a022317mg [Erythranthe guttata]
Length=230

 Score =   234 bits (597),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 115/147 (78%), Positives = 126/147 (86%), Gaps = 1/147 (1%)
 Frame = +3

Query  138  LQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFLFRGLNMPGNTSNPLGSKVTPVNVNNL  317
            LQDFCVAV +++AAVFVNGKICK+P  VVA DF   GLN PGNT NP+GS+VTP NVN +
Sbjct  29   LQDFCVAVKEADAAVFVNGKICKDPNMVVAEDFFLSGLNKPGNTLNPVGSRVTPANVNQI  88

Query  318  PGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLYVGFVLSNPP-PGMKNPLFT  494
            PGLNTLGIS VRID+APNGLNPPHTHPRATE+L+V EGTLYVGFV SNP  P +KN LFT
Sbjct  89   PGLNTLGISAVRIDYAPNGLNPPHTHPRATEILVVSEGTLYVGFVTSNPANPAIKNKLFT  148

Query  495  KTLVAGDVFVFPEGLIHFQFNVGKTNA  575
            K L  GDVFVFPEGLIHFQFNVGKTNA
Sbjct  149  KYLYPGDVFVFPEGLIHFQFNVGKTNA  175



>ref|XP_004230405.1| PREDICTED: germin-like protein subfamily 1 member 14 [Solanum 
lycopersicum]
Length=228

 Score =   234 bits (596),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 130/173 (75%), Positives = 139/173 (80%), Gaps = 0/173 (0%)
 Frame = +3

Query  57   MALRFIVFVIAMVALAssfshasdpssLQDFCVAVNDSNAAVFVNGKICKNPMQVVANDF  236
            M  +  V  I+++A+  S SHASDPS LQDFCVAVNDS  AVFVNGK CKNP+ V A+DF
Sbjct  1    MTFKSFVLTISIMAVLFSLSHASDPSPLQDFCVAVNDSKNAVFVNGKFCKNPLDVNADDF  60

Query  237  LFRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVL  416
               GLN+ GNTSN LGS VT VNVNNL GLNTLGISL RIDFAP GLNPPHTHPRATEVL
Sbjct  61   FRPGLNLAGNTSNQLGSAVTAVNVNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVL  120

Query  417  LVLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNA  575
             + EGTLYVGFVLSNP P MKN LFTK L  GDVFVFP GLIHFQFNVGKTNA
Sbjct  121  TLFEGTLYVGFVLSNPGPNMKNKLFTKILHPGDVFVFPVGLIHFQFNVGKTNA  173



>ref|XP_006349263.1| PREDICTED: germin-like protein subfamily 1 member 13-like [Solanum 
tuberosum]
Length=228

 Score =   233 bits (593),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 127/173 (73%), Positives = 141/173 (82%), Gaps = 0/173 (0%)
 Frame = +3

Query  57   MALRFIVFVIAMVALAssfshasdpssLQDFCVAVNDSNAAVFVNGKICKNPMQVVANDF  236
            MAL+  V +IA++++ +S SHASDPS LQDFCVAVNDS   VFVNGK+CK+P  V A+DF
Sbjct  1    MALKSFVLIIAILSVVTSISHASDPSPLQDFCVAVNDSMTTVFVNGKVCKDPKIVTADDF  60

Query  237  LFRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVL  416
               GLN+ GNTSN +GS VT VNVNNLPGLNTLGISL RID+AP G+NPPHTHPR TEVL
Sbjct  61   FKSGLNVAGNTSNNVGSAVTAVNVNNLPGLNTLGISLARIDYAPYGVNPPHTHPRGTEVL  120

Query  417  LVLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNA  575
             VLEGTLYVGFVLSNP   MKN LFTK L  GDVFVFP GLIHFQFNVGKT A
Sbjct  121  TVLEGTLYVGFVLSNPGANMKNKLFTKILHPGDVFVFPIGLIHFQFNVGKTKA  173



>emb|CDP10695.1| unnamed protein product [Coffea canephora]
Length=223

 Score =   232 bits (591),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 127/165 (77%), Positives = 136/165 (82%), Gaps = 0/165 (0%)
 Frame = +3

Query  81   VIAMVALAssfshasdpssLQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFLFRGLNMP  260
             IA +AL SS + ASDPS LQDFCVA+ND   AVFVNGKICK+P  V ANDFLF+GLN P
Sbjct  8    TIATMALFSSLATASDPSPLQDFCVAINDPKTAVFVNGKICKDPKVVKANDFLFQGLNKP  67

Query  261  GNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLY  440
             NT+N  GS VT VNVNNL GLNTLG+SL R+DFAP GLNPPHTHPRATEVL VLEGTL+
Sbjct  68   RNTANRQGSNVTAVNVNNLAGLNTLGVSLARLDFAPFGLNPPHTHPRATEVLFVLEGTLH  127

Query  441  VGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNA  575
            VGFV SNPP  MKN LFTKTL  GDVFVFPEGLIHFQFN GKTNA
Sbjct  128  VGFVTSNPPNNMKNQLFTKTLNPGDVFVFPEGLIHFQFNFGKTNA  172



>ref|XP_011099652.1| PREDICTED: putative germin-like protein 2-1 [Sesamum indicum]
Length=228

 Score =   231 bits (590),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 115/147 (78%), Positives = 125/147 (85%), Gaps = 1/147 (1%)
 Frame = +3

Query  138  LQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFLFRGLNMPGNTSNPLGSKVTPVNVNNL  317
            LQDFCVAVNDS A+VFVNGKICK+P  V  +DF F GLN PGNTS+PLGS+VTPV VN L
Sbjct  27   LQDFCVAVNDSRASVFVNGKICKDPNTVTPDDFFFSGLNKPGNTSSPLGSRVTPVTVNQL  86

Query  318  PGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLYVGFVLSNPP-PGMKNPLFT  494
             GLNTLGISL RIDFAP GLNPPHTHPRATE+L+++EG+LYVGFV SNP  P  KN LFT
Sbjct  87   AGLNTLGISLARIDFAPYGLNPPHTHPRATEILVLVEGSLYVGFVTSNPANPNQKNKLFT  146

Query  495  KTLVAGDVFVFPEGLIHFQFNVGKTNA  575
            KTL  GDVFVFPEGLIHFQFNVG TNA
Sbjct  147  KTLYPGDVFVFPEGLIHFQFNVGNTNA  173



>emb|CDP10701.1| unnamed protein product [Coffea canephora]
Length=230

 Score =   230 bits (586),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 125/167 (75%), Positives = 136/167 (81%), Gaps = 0/167 (0%)
 Frame = +3

Query  75   VFVIAMVALAssfshasdpssLQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFLFRGLN  254
            +  IA +AL SS + ASDPS LQDFCVA+ND   AVFVNGKICK+P  V ANDF F+GLN
Sbjct  6    LITIATMALFSSLATASDPSPLQDFCVAINDPKTAVFVNGKICKDPKVVKANDFFFQGLN  65

Query  255  MPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGT  434
             P NT+N  GS VT VNVNNL GLNTLG+SL R+DFAP+GLNPPHTHPRATEVL VLEGT
Sbjct  66   KPRNTANRQGSTVTAVNVNNLAGLNTLGVSLARLDFAPHGLNPPHTHPRATEVLFVLEGT  125

Query  435  LYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNA  575
            L+VGFV SNPP  MKN LFTKTL  GDVFVFPEGLIHFQFN GKT A
Sbjct  126  LHVGFVTSNPPNNMKNQLFTKTLNPGDVFVFPEGLIHFQFNFGKTKA  172



>emb|CDP16787.1| unnamed protein product [Coffea canephora]
Length=230

 Score =   228 bits (581),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 126/173 (73%), Positives = 138/173 (80%), Gaps = 1/173 (1%)
 Frame = +3

Query  57   MALRFIVFVIAMVALAssfshasdpssLQDFCVAVNDSNAAVFVNGKICKNPMQVVANDF  236
            MA RF +   A++AL  +  HASDPS LQDFCVAV D+NA VFVNGKICK+P  V A DF
Sbjct  1    MAFRFHI-AAAILALVFTIVHASDPSPLQDFCVAVPDANAGVFVNGKICKDPKLVEAEDF  59

Query  237  LFRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVL  416
             F GLN PG+TSNPLGS VT VNVN +PGLNTLG+SL RIDFAP GLNPPHTHPRATE+L
Sbjct  60   FFPGLNEPGSTSNPLGSNVTTVNVNQIPGLNTLGVSLARIDFAPYGLNPPHTHPRATEIL  119

Query  417  LVLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNA  575
            +VLEGTL VGFV SNP   MKN LFTK L  GDVFVFPEGLIHFQFN G +NA
Sbjct  120  VVLEGTLLVGFVTSNPGMNMKNKLFTKVLNPGDVFVFPEGLIHFQFNKGHSNA  172



>emb|CDP10694.1| unnamed protein product [Coffea canephora]
Length=224

 Score =   227 bits (579),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 127/173 (73%), Positives = 139/173 (80%), Gaps = 1/173 (1%)
 Frame = +3

Query  57   MALRFIVFVIAMVALAssfshasdpssLQDFCVAVNDSNAAVFVNGKICKNPMQVVANDF  236
            M   F++  IA +AL SS + ASDPS LQDFCVA+ND   AVFVNGKICK+P  V ANDF
Sbjct  1    MGAPFLI-TIATMALLSSLAIASDPSPLQDFCVAINDPKTAVFVNGKICKDPKVVNANDF  59

Query  237  LFRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVL  416
             F+GLN+P +T+N  GS VT VNVNNL GLNTLG+SL R+DFAP GLNPPHTHPRATEVL
Sbjct  60   FFQGLNIPRSTANRQGSNVTAVNVNNLAGLNTLGVSLARLDFAPYGLNPPHTHPRATEVL  119

Query  417  LVLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNA  575
             VLEG L VGFV SNPP  MKN LFTKTL  GDVFVFPEGLIHFQFNVGKTNA
Sbjct  120  FVLEGVLNVGFVTSNPPNNMKNQLFTKTLNPGDVFVFPEGLIHFQFNVGKTNA  172



>emb|CDP16790.1| unnamed protein product [Coffea canephora]
Length=232

 Score =   227 bits (578),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 123/175 (70%), Positives = 139/175 (79%), Gaps = 1/175 (1%)
 Frame = +3

Query  51   LDMALRFIVFVIAMVALAssfshasdpssLQDFCVAVNDSNAAVFVNGKICKNPMQVVAN  230
            + MA RF +   A++AL  +  HASDPS LQDFCVAV D+NA VFVNGKIC++P  V   
Sbjct  1    MTMAFRFHI-AAAILALVFTSVHASDPSPLQDFCVAVPDANAGVFVNGKICQDPKLVKPE  59

Query  231  DFLFRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATE  410
            DF F+GLN PG+TSNPLGS VT VNVN +PGLNTLG+SL R+DFAP GLNPPHTHPRATE
Sbjct  60   DFFFQGLNKPGSTSNPLGSNVTAVNVNQIPGLNTLGVSLARLDFAPYGLNPPHTHPRATE  119

Query  411  VLLVLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNA  575
            +L+VLEGTL VGFV SNP   MKN LFTK L  GDVFVFPEGLIHFQFN G +NA
Sbjct  120  ILVVLEGTLLVGFVTSNPGMNMKNKLFTKVLNPGDVFVFPEGLIHFQFNQGHSNA  174



>ref|XP_010251871.1| PREDICTED: putative germin-like protein 2-1 [Nelumbo nucifera]
Length=222

 Score =   225 bits (574),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 112/146 (77%), Positives = 121/146 (83%), Gaps = 4/146 (3%)
 Frame = +3

Query  138  LQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFLFRGLNMPGNTSNPLGSKVTPVNVNNL  317
            LQDFCVA+ D+   VFVNGK CKNP    A+DF F GL+ PGNTSNP+GSKVTPVNV  L
Sbjct  26   LQDFCVAIKDTETPVFVNGKFCKNPNYTTADDFFFSGLDKPGNTSNPVGSKVTPVNVMQL  85

Query  318  PGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLYVGFVLSNPPPGMKNPLFTK  497
            PGLNTLG+SLVRID+AP GLNPPHTHPRATEVL+VLEGTLYVGFV SNP    +N LFTK
Sbjct  86   PGLNTLGVSLVRIDYAPYGLNPPHTHPRATEVLVVLEGTLYVGFVTSNP----ENRLFTK  141

Query  498  TLVAGDVFVFPEGLIHFQFNVGKTNA  575
             L  GDVFVFPEGLIHFQFNVG TNA
Sbjct  142  VLNKGDVFVFPEGLIHFQFNVGHTNA  167



>ref|XP_010251870.1| PREDICTED: putative germin-like protein 2-1 isoform X2 [Nelumbo 
nucifera]
Length=222

 Score =   225 bits (574),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 120/173 (69%), Positives = 133/173 (77%), Gaps = 6/173 (3%)
 Frame = +3

Query  57   MALRFIVFVIAMVALAssfshasdpssLQDFCVAVNDSNAAVFVNGKICKNPMQVVANDF  236
            M  R + F +A++AL S    +     LQDFCVA+ND+ + VFVNGK CKNP    A+DF
Sbjct  1    MGSRMLAF-LAILALCSQALASDPSP-LQDFCVAINDTESPVFVNGKFCKNPNYTTADDF  58

Query  237  LFRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVL  416
             F GL+ PGNTSNP+GSKVTPVNV  LPGLNTLGISLVRID+AP GLNPPHTHPRATEVL
Sbjct  59   FFSGLDKPGNTSNPVGSKVTPVNVMQLPGLNTLGISLVRIDYAPYGLNPPHTHPRATEVL  118

Query  417  LVLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNA  575
            +VLEG LYVGFV SNP     N LFTK L  GDVFVFPEGLIHFQFNVG TNA
Sbjct  119  VVLEGRLYVGFVTSNP----DNRLFTKVLNKGDVFVFPEGLIHFQFNVGHTNA  167



>emb|CDP22064.1| unnamed protein product [Coffea canephora]
Length=230

 Score =   225 bits (574),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 124/173 (72%), Positives = 137/173 (79%), Gaps = 1/173 (1%)
 Frame = +3

Query  57   MALRFIVFVIAMVALAssfshasdpssLQDFCVAVNDSNAAVFVNGKICKNPMQVVANDF  236
            MA RF +   A++AL  +  HASDPS LQDFCVAV D+NA VFVNGKICK+P  V A DF
Sbjct  1    MAFRFHI-AAAILALVFTIVHASDPSPLQDFCVAVPDANAGVFVNGKICKDPKLVEAKDF  59

Query  237  LFRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVL  416
             F GL  PG+TSNPLGS VT VNVN +PGLNTLG+SL RIDFAP GLNPPHTHPRATE+L
Sbjct  60   FFPGLKEPGSTSNPLGSNVTAVNVNQIPGLNTLGVSLARIDFAPYGLNPPHTHPRATEIL  119

Query  417  LVLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNA  575
            +VLEGTL VGFV SNP   MKN LFTK L  GDVFVFPEGLIHFQFN G ++A
Sbjct  120  VVLEGTLLVGFVTSNPGMNMKNKLFTKVLNPGDVFVFPEGLIHFQFNKGHSSA  172



>ref|XP_010251869.1| PREDICTED: putative germin-like protein 2-1 isoform X1 [Nelumbo 
nucifera]
Length=222

 Score =   223 bits (568),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 112/146 (77%), Positives = 119/146 (82%), Gaps = 4/146 (3%)
 Frame = +3

Query  138  LQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFLFRGLNMPGNTSNPLGSKVTPVNVNNL  317
            LQDFCVA+ D+   VFVNGK CKNP    A+DF F GL+ PGNTSNP+GSKVTPVNV  L
Sbjct  26   LQDFCVAIKDTETPVFVNGKFCKNPNYTTADDFFFSGLDKPGNTSNPVGSKVTPVNVMQL  85

Query  318  PGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLYVGFVLSNPPPGMKNPLFTK  497
            PGLNTLGISLVRID+AP GLNPPHTHPRATEVL+VLEG LYVGFV SNP     N LFTK
Sbjct  86   PGLNTLGISLVRIDYAPYGLNPPHTHPRATEVLVVLEGRLYVGFVTSNP----DNRLFTK  141

Query  498  TLVAGDVFVFPEGLIHFQFNVGKTNA  575
             L  GDVFVFPEGLIHFQFNVG TNA
Sbjct  142  VLNKGDVFVFPEGLIHFQFNVGHTNA  167



>ref|XP_010251867.1| PREDICTED: putative germin-like protein 2-1 [Nelumbo nucifera]
Length=222

 Score =   222 bits (566),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 112/146 (77%), Positives = 120/146 (82%), Gaps = 4/146 (3%)
 Frame = +3

Query  138  LQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFLFRGLNMPGNTSNPLGSKVTPVNVNNL  317
            LQDFCVA+ D++  VFVNGK CKNP    A+DF F GL+ PGNTSNP+GSKVTPVNV  L
Sbjct  26   LQDFCVAIKDTDYPVFVNGKFCKNPNYTTADDFFFSGLDKPGNTSNPVGSKVTPVNVMQL  85

Query  318  PGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLYVGFVLSNPPPGMKNPLFTK  497
            PGLNTLGISLVRID+AP GLNPPHTHPRATEVL+VLEG LYVGFV SNP     N LFTK
Sbjct  86   PGLNTLGISLVRIDYAPYGLNPPHTHPRATEVLVVLEGRLYVGFVTSNP----DNRLFTK  141

Query  498  TLVAGDVFVFPEGLIHFQFNVGKTNA  575
             L  GDVFVFPEGLIHFQFNVG TNA
Sbjct  142  VLNKGDVFVFPEGLIHFQFNVGHTNA  167



>ref|XP_010251872.1| PREDICTED: putative germin-like protein 2-1 [Nelumbo nucifera]
Length=222

 Score =   222 bits (565),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 112/146 (77%), Positives = 120/146 (82%), Gaps = 4/146 (3%)
 Frame = +3

Query  138  LQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFLFRGLNMPGNTSNPLGSKVTPVNVNNL  317
            LQDFCVA+ D+   VFVNGK CKNP    A+DF F GL+ PGNTSNP+GSKVTPVNV  L
Sbjct  26   LQDFCVAIKDTETPVFVNGKFCKNPNYTTADDFFFSGLDKPGNTSNPVGSKVTPVNVMQL  85

Query  318  PGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLYVGFVLSNPPPGMKNPLFTK  497
            PGLNTLGISLVRID+AP GLNPPHTHPRATEVL+VLEGTLYVGFV SNP    +N L TK
Sbjct  86   PGLNTLGISLVRIDYAPYGLNPPHTHPRATEVLVVLEGTLYVGFVTSNP----ENRLITK  141

Query  498  TLVAGDVFVFPEGLIHFQFNVGKTNA  575
            TL  GDVFVFP GLIHFQFNVG TNA
Sbjct  142  TLNKGDVFVFPVGLIHFQFNVGHTNA  167



>emb|CDP10693.1| unnamed protein product [Coffea canephora]
Length=219

 Score =   221 bits (563),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 115/152 (76%), Positives = 123/152 (81%), Gaps = 6/152 (4%)
 Frame = +3

Query  138  LQDFCVAVNDSNAA------VFVNGKICKNPMQVVANDFLFRGLNMPGNTSNPLGSKVTP  299
            LQDFCVA+ND   A      VFVNGKICK+P  V ANDF F+GLN+P +T+N  GS VT 
Sbjct  16   LQDFCVAINDPKTAASFFNAVFVNGKICKDPKVVNANDFFFQGLNIPRSTANRQGSNVTA  75

Query  300  VNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLYVGFVLSNPPPGMK  479
            VNVNNL GLNTLG+SL R+DFAP GLNPPHTHPRATEVL VLEGTL VGFV SNPP  MK
Sbjct  76   VNVNNLAGLNTLGVSLARLDFAPYGLNPPHTHPRATEVLFVLEGTLNVGFVTSNPPNNMK  135

Query  480  NPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNA  575
            N LFTKTL  GDVFVFPEGLIHFQFNVGKTNA
Sbjct  136  NQLFTKTLNPGDVFVFPEGLIHFQFNVGKTNA  167



>emb|CBI33612.3| unnamed protein product [Vitis vinifera]
Length=221

 Score =   221 bits (562),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 114/164 (70%), Positives = 128/164 (78%), Gaps = 4/164 (2%)
 Frame = +3

Query  84   IAMVALAssfshasdpssLQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFLFRGLNMPG  263
            IA++A++   + ASDPS LQDFCVAVND+   VFVNGK+CK+P    ANDF F GL +PG
Sbjct  12   IALLAMSFFLASASDPSPLQDFCVAVNDTKTTVFVNGKVCKDPKVATANDFFFSGLRVPG  71

Query  264  NTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLYV  443
            NTSN LGS VTP NV  +PGLNTLGISL R+D+AP GLNPPHTHPRATE+L VLEGTLYV
Sbjct  72   NTSNKLGSMVTPANVAQIPGLNTLGISLARVDYAPYGLNPPHTHPRATEILTVLEGTLYV  131

Query  444  GFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNA  575
            GFV SNP     N L +K L  GDVFVFPEGLIHFQ NVGKT A
Sbjct  132  GFVTSNP----DNRLISKVLYKGDVFVFPEGLIHFQLNVGKTKA  171



>emb|CDP16791.1| unnamed protein product [Coffea canephora]
Length=230

 Score =   221 bits (562),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 121/173 (70%), Positives = 135/173 (78%), Gaps = 1/173 (1%)
 Frame = +3

Query  57   MALRFIVFVIAMVALAssfshasdpssLQDFCVAVNDSNAAVFVNGKICKNPMQVVANDF  236
            MA RF +  + ++ L  +   ASDPS LQDFCVAV D+NA VFVNGKICK+P  V   DF
Sbjct  1    MAFRFHIAAV-ILTLVFAIVCASDPSPLQDFCVAVPDANATVFVNGKICKDPKLVKPKDF  59

Query  237  LFRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVL  416
             F GLN PG+T+NPLGS VT VNVN +PGLNTLG+SL R+DFAP GLNPPHTHPRATEVL
Sbjct  60   FFPGLNKPGSTANPLGSNVTQVNVNQIPGLNTLGVSLARLDFAPYGLNPPHTHPRATEVL  119

Query  417  LVLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNA  575
             VLEGTL VGFV SNP   MKN LFTK L  GDVFVFP+GLIHFQFN GKT+A
Sbjct  120  FVLEGTLLVGFVTSNPGMNMKNKLFTKVLNPGDVFVFPQGLIHFQFNQGKTDA  172



>ref|XP_003633724.1| PREDICTED: putative germin-like protein 2-1 [Vitis vinifera]
Length=221

 Score =   220 bits (560),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 114/164 (70%), Positives = 127/164 (77%), Gaps = 4/164 (2%)
 Frame = +3

Query  84   IAMVALAssfshasdpssLQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFLFRGLNMPG  263
            IA+ A++   + ASDPS LQDFCVAVND+   VFVNGK+CK+P    ANDF F GL +PG
Sbjct  12   IALSAMSFFLASASDPSPLQDFCVAVNDTKTTVFVNGKVCKDPKVATANDFFFSGLRVPG  71

Query  264  NTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLYV  443
            NTSN LGS VTP NV  +PGLNTLGISL R+D+AP GLNPPHTHPRATE+L VLEGTLYV
Sbjct  72   NTSNKLGSMVTPANVAQIPGLNTLGISLARVDYAPYGLNPPHTHPRATEILTVLEGTLYV  131

Query  444  GFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNA  575
            GFV SNP     N L +K L  GDVFVFPEGLIHFQ NVGKT A
Sbjct  132  GFVTSNP----DNRLISKVLYKGDVFVFPEGLIHFQLNVGKTKA  171



>emb|CDP16789.1| unnamed protein product [Coffea canephora]
Length=488

 Score =   227 bits (579),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 124/177 (70%), Positives = 141/177 (80%), Gaps = 1/177 (1%)
 Frame = +3

Query  45   NILDMALRFIVFVIAMVALAssfshasdpssLQDFCVAVNDSNAAVFVNGKICKNPMQVV  224
            N++ MA+R +    A++ L  +  HASDPS LQDFCVAV D+NA VFVNGKICK+P  V 
Sbjct  255  NLITMAVR-VHIAAAILTLVFAVVHASDPSPLQDFCVAVPDANAGVFVNGKICKDPKLVK  313

Query  225  ANDFLFRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRA  404
              DF F GLNMPG+T+NPLGS VT VNVN +PGLNTLG+SL R+DFAP GLNPPHTHPRA
Sbjct  314  PEDFFFPGLNMPGSTANPLGSNVTAVNVNQIPGLNTLGVSLARLDFAPYGLNPPHTHPRA  373

Query  405  TEVLLVLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNA  575
            TE+L+VLEGTL VGFV SNP   MKN LFTK L  GDVFVFPEGLIHFQFN G+TNA
Sbjct  374  TEILVVLEGTLLVGFVTSNPGMNMKNKLFTKVLNPGDVFVFPEGLIHFQFNQGQTNA  430


 Score =   223 bits (568),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 122/173 (71%), Positives = 137/173 (79%), Gaps = 1/173 (1%)
 Frame = +3

Query  57   MALRFIVFVIAMVALAssfshasdpssLQDFCVAVNDSNAAVFVNGKICKNPMQVVANDF  236
            MA RF +   A++AL  +  HASDPS LQDFCVAV D+NA VFVNGKICK+P  V   DF
Sbjct  1    MAFRFHI-AAALLALVFTIVHASDPSPLQDFCVAVPDANAGVFVNGKICKDPKLVKPEDF  59

Query  237  LFRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVL  416
             F GLN PG+T+NPLGS VT VNVN +PGLNTLG+SL R+DFAP GLNPPHTHPRATE+L
Sbjct  60   FFPGLNKPGSTANPLGSNVTAVNVNQIPGLNTLGVSLARLDFAPYGLNPPHTHPRATEIL  119

Query  417  LVLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNA  575
            +VLEGTL VGFV SNP   MKN LFTK L  GDVFVFP+GLIHFQFN G +NA
Sbjct  120  VVLEGTLLVGFVTSNPGMNMKNKLFTKVLNPGDVFVFPQGLIHFQFNQGHSNA  172



>ref|XP_010257844.1| PREDICTED: putative germin-like protein 2-1 [Nelumbo nucifera]
Length=224

 Score =   219 bits (559),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 121/173 (70%), Positives = 133/173 (77%), Gaps = 4/173 (2%)
 Frame = +3

Query  57   MALRFIVFVIAMVALAssfshasdpssLQDFCVAVNDSNAAVFVNGKICKNPMQVVANDF  236
            MA   ++ V  ++ALASS + ASDPS LQDFCVA+ D  AAV VNGK CKNP    A DF
Sbjct  1    MAAAQVLAVSILLALASSLAFASDPSPLQDFCVAIKDPKAAVLVNGKFCKNPKLAKAKDF  60

Query  237  LFRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVL  416
             F GL+ PGNTSNP+GSKVT VNV  +PGLNTLGISL RIDFAP GLNPPHTHPRATE+L
Sbjct  61   FFSGLHKPGNTSNPVGSKVTAVNVEQIPGLNTLGISLARIDFAPYGLNPPHTHPRATEIL  120

Query  417  LVLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNA  575
            +VLEGTLYVGF  SNP     N L TKTL  GDVFVFP GLIHFQFN G+TNA
Sbjct  121  VVLEGTLYVGFATSNP----DNRLITKTLNKGDVFVFPVGLIHFQFNTGETNA  169



>ref|XP_011099650.1| PREDICTED: germin-like protein subfamily 1 member 13 [Sesamum 
indicum]
Length=231

 Score =   219 bits (559),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 112/176 (64%), Positives = 138/176 (78%), Gaps = 1/176 (1%)
 Frame = +3

Query  51   LDMALRFIVFVIAMVALAssfshasdpssLQDFCVAVNDSNAAVFVNGKICKNPMQVVAN  230
            ++++    V  +A++ + SS + A DP  LQDFCVAVNDS AAVFVNGKICK+P  V ++
Sbjct  1    MEISAFHFVLSMAILVVGSSPADAYDPDPLQDFCVAVNDSKAAVFVNGKICKDPKTVTSD  60

Query  231  DFLFRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATE  410
            DF   GLN PGNTSNP GS+VT   V++LPGLNTLGIS+VRIDFAPNG+NPPH HPRA+E
Sbjct  61   DFFISGLNKPGNTSNPFGSRVTHAFVDDLPGLNTLGISIVRIDFAPNGVNPPHEHPRASE  120

Query  411  VLLVLEGTLYVGFVLSNPP-PGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNA  575
            +L+VL+G LY GF+ +NPP P  KN LF K L  GD FVFP+GLIHFQ+NVGKT+A
Sbjct  121  ILVVLKGKLYAGFITTNPPNPNHKNKLFAKILKPGDAFVFPKGLIHFQYNVGKTSA  176



>emb|CDP16788.1| unnamed protein product [Coffea canephora]
Length=229

 Score =   219 bits (558),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 123/173 (71%), Positives = 135/173 (78%), Gaps = 1/173 (1%)
 Frame = +3

Query  57   MALRFIVFVIAMVALAssfshasdpssLQDFCVAVNDSNAAVFVNGKICKNPMQVVANDF  236
            MA+R I    A++AL  +  HASDPS LQDFCVAV D+NA VFVNGKICK+P  V   DF
Sbjct  1    MAVR-IHIAAAILALVFTVVHASDPSPLQDFCVAVPDANAGVFVNGKICKDPKLVKPEDF  59

Query  237  LFRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVL  416
             F GLN PG+T+NPLGS VT VNVN +PGLNTLG+SL RIDFAP GLNPPH HPRATEVL
Sbjct  60   FFPGLNKPGSTANPLGSNVTAVNVNQIPGLNTLGVSLARIDFAPYGLNPPHIHPRATEVL  119

Query  417  LVLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNA  575
             VLEGTL VGFV SNP   MKN LFTK L  GDVFVFP+GLIHFQFN G +NA
Sbjct  120  FVLEGTLVVGFVTSNPGMNMKNKLFTKVLNPGDVFVFPQGLIHFQFNQGHSNA  172



>ref|XP_002265608.1| PREDICTED: putative germin-like protein 2-1 [Vitis vinifera]
Length=221

 Score =   219 bits (557),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 113/164 (69%), Positives = 127/164 (77%), Gaps = 4/164 (2%)
 Frame = +3

Query  84   IAMVALAssfshasdpssLQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFLFRGLNMPG  263
            IA+ A++   + ASDPS LQDFCVAVND+   VFVNGK+CK+P    ANDF F GL +PG
Sbjct  12   IALSAMSFFLASASDPSPLQDFCVAVNDTKTTVFVNGKVCKDPKVATANDFFFSGLRVPG  71

Query  264  NTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLYV  443
            NTSN +GS VTP NV  +PGLNTLGISL R+D+AP GLNPPHTHPRATE+L VLEGTLYV
Sbjct  72   NTSNKVGSMVTPANVAQIPGLNTLGISLARVDYAPYGLNPPHTHPRATEILTVLEGTLYV  131

Query  444  GFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNA  575
            GFV SNP     N L +K L  GDVFVFPEGLIHFQ NVGKT A
Sbjct  132  GFVTSNP----DNRLISKVLYKGDVFVFPEGLIHFQLNVGKTKA  171



>emb|CBI33611.3| unnamed protein product [Vitis vinifera]
Length=289

 Score =   221 bits (563),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 113/164 (69%), Positives = 128/164 (78%), Gaps = 4/164 (2%)
 Frame = +3

Query  84   IAMVALAssfshasdpssLQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFLFRGLNMPG  263
            IA++A++   + ASDPS LQDFCVAVND+   VFVNGK+CK+P    ANDF F GL +PG
Sbjct  70   IALLAMSFFLASASDPSPLQDFCVAVNDTKTTVFVNGKVCKDPKVATANDFFFSGLRVPG  129

Query  264  NTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLYV  443
            NTSN +GS VTP NV  +PGLNTLGISL R+D+AP GLNPPHTHPRATE+L VLEGTLYV
Sbjct  130  NTSNKVGSMVTPANVAQIPGLNTLGISLARVDYAPYGLNPPHTHPRATEILTVLEGTLYV  189

Query  444  GFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNA  575
            GFV SNP     N L +K L  GDVFVFPEGLIHFQ NVGKT A
Sbjct  190  GFVTSNP----DNRLISKVLYKGDVFVFPEGLIHFQLNVGKTKA  229



>ref|XP_002276644.1| PREDICTED: putative germin-like protein 2-1 [Vitis vinifera]
Length=228

 Score =   218 bits (556),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 114/164 (70%), Positives = 129/164 (79%), Gaps = 4/164 (2%)
 Frame = +3

Query  84   IAMVALAssfshasdpssLQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFLFRGLNMPG  263
            I ++A+A S + ASDPS LQDFCVAVND+N +VFVNGK CK+P     NDF F GL +PG
Sbjct  12   IVLLAMAFSVASASDPSPLQDFCVAVNDTNDSVFVNGKFCKDPKLATPNDFFFSGLRVPG  71

Query  264  NTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLYV  443
            NTSN LGS VTP NV  +PGLNTLG+SL R+D+AP GLNPPHTHPRATE+L VLEGTLYV
Sbjct  72   NTSNKLGSMVTPANVAQIPGLNTLGVSLARVDYAPYGLNPPHTHPRATEILTVLEGTLYV  131

Query  444  GFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNA  575
            GFV SNP     N L +K L  GDVFVFP+GLIHFQ NVGKTNA
Sbjct  132  GFVTSNP----DNRLISKVLYKGDVFVFPQGLIHFQLNVGKTNA  171



>emb|CDP21353.1| unnamed protein product [Coffea canephora]
Length=459

 Score =   225 bits (574),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 125/173 (72%), Positives = 137/173 (79%), Gaps = 1/173 (1%)
 Frame = +3

Query  57   MALRFIVFVIAMVALAssfshasdpssLQDFCVAVNDSNAAVFVNGKICKNPMQVVANDF  236
            MA RF +   A++AL  +  HASDPS LQDFCVAV D+NA VFVNGKICK+P  V   DF
Sbjct  230  MAFRFHI-AAAILALVFTIVHASDPSPLQDFCVAVPDANAGVFVNGKICKDPKLVKPEDF  288

Query  237  LFRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVL  416
             F GLN PG+TSNPLGS VT VNVN +PGLNTLG+SL RIDFAP GLNPPHTHPRATE+L
Sbjct  289  FFPGLNEPGSTSNPLGSNVTAVNVNQIPGLNTLGVSLARIDFAPYGLNPPHTHPRATEIL  348

Query  417  LVLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNA  575
            +VLEGTL VGFV SNP   MKN LFTK L  GDVFVFPEGLIHFQFN G +NA
Sbjct  349  VVLEGTLLVGFVTSNPGMNMKNKLFTKVLNPGDVFVFPEGLIHFQFNKGHSNA  401


 Score =   219 bits (559),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 123/173 (71%), Positives = 135/173 (78%), Gaps = 1/173 (1%)
 Frame = +3

Query  57   MALRFIVFVIAMVALAssfshasdpssLQDFCVAVNDSNAAVFVNGKICKNPMQVVANDF  236
            MA+R I    A++AL  +  HASDPS LQDFCVAV D+NA VFVNGKICK+P  V   DF
Sbjct  1    MAVR-IHIAAAILALVFTVVHASDPSPLQDFCVAVPDANAGVFVNGKICKDPKLVKPEDF  59

Query  237  LFRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVL  416
             F GLN PG+T+NPLGS VT VNVN +PGLNTLG+SL RIDFAP GLNPPH HPRATEVL
Sbjct  60   FFPGLNKPGSTANPLGSNVTAVNVNQIPGLNTLGVSLARIDFAPYGLNPPHIHPRATEVL  119

Query  417  LVLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNA  575
             VLEGTL VGFV SNP   MKN LFTK L  GDVFVFP+GLIHFQFN G +NA
Sbjct  120  FVLEGTLVVGFVTSNPGMNMKNKLFTKVLNPGDVFVFPQGLIHFQFNQGHSNA  172



>ref|XP_010241946.1| PREDICTED: putative germin-like protein 2-1 [Nelumbo nucifera]
Length=223

 Score =   218 bits (555),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 111/147 (76%), Positives = 120/147 (82%), Gaps = 5/147 (3%)
 Frame = +3

Query  138  LQDFCVAVNDSNA-AVFVNGKICKNPMQVVANDFLFRGLNMPGNTSNPLGSKVTPVNVNN  314
            LQDFCVA+ D+ + AVFVNGK CKNP    A+DF F GL+ PGNTSNP+GSKVTPVNV  
Sbjct  26   LQDFCVAIKDTESPAVFVNGKFCKNPNYTTADDFFFSGLDKPGNTSNPVGSKVTPVNVMQ  85

Query  315  LPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLYVGFVLSNPPPGMKNPLFT  494
            LPGLNTLGISLVRID+AP GLNPPHTHPRATEVL+VLEG LYVGFV SNP     N LFT
Sbjct  86   LPGLNTLGISLVRIDYAPYGLNPPHTHPRATEVLVVLEGRLYVGFVTSNP----DNRLFT  141

Query  495  KTLVAGDVFVFPEGLIHFQFNVGKTNA  575
            K L  GDVFVFP+GL HFQFNVG TNA
Sbjct  142  KVLNKGDVFVFPQGLTHFQFNVGHTNA  168



>ref|XP_003633711.2| PREDICTED: putative germin-like protein 2-1 [Vitis vinifera]
Length=221

 Score =   218 bits (554),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 113/164 (69%), Positives = 126/164 (77%), Gaps = 4/164 (2%)
 Frame = +3

Query  84   IAMVALAssfshasdpssLQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFLFRGLNMPG  263
            IA++A++   + ASDPS LQDFCVAVND+   VFVNGK+CK+P    ANDF F GL +PG
Sbjct  12   IALLAMSFFLASASDPSPLQDFCVAVNDTKTTVFVNGKVCKDPKVATANDFFFSGLRVPG  71

Query  264  NTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLYV  443
            NTSN LGS VTP NV  +PGLNTLGISL R+D+AP GLNPPHTHPRATE+L VLEGTLYV
Sbjct  72   NTSNKLGSMVTPANVAQIPGLNTLGISLARVDYAPYGLNPPHTHPRATEILTVLEGTLYV  131

Query  444  GFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNA  575
            GFV SNP     N L  K L  GDVFVFPEGLIHF  NVGKT A
Sbjct  132  GFVTSNP----DNRLIAKVLYKGDVFVFPEGLIHFHLNVGKTKA  171



>ref|XP_002277055.1| PREDICTED: putative germin-like protein 2-1 [Vitis vinifera]
 emb|CBI38542.3| unnamed protein product [Vitis vinifera]
Length=228

 Score =   218 bits (554),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 114/164 (70%), Positives = 130/164 (79%), Gaps = 4/164 (2%)
 Frame = +3

Query  84   IAMVALAssfshasdpssLQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFLFRGLNMPG  263
            IA+ A+A S ++ASDPS LQDFCVAVND+NAAVFVNGK C++P     NDF F GL +PG
Sbjct  12   IALFAMAFSLAYASDPSPLQDFCVAVNDTNAAVFVNGKFCQDPKLATPNDFSFSGLRLPG  71

Query  264  NTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLYV  443
            NTSN LGS VTP +V  +PGLNTLG+SL R+D+AP GLNPPHTHPRATE+L VLEGTLYV
Sbjct  72   NTSNQLGSMVTPASVAQIPGLNTLGVSLARVDYAPYGLNPPHTHPRATEILTVLEGTLYV  131

Query  444  GFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNA  575
            GFV SNP     N L +K L  GDVFVFP+GLIHFQ NVG TNA
Sbjct  132  GFVTSNP----DNRLISKVLYKGDVFVFPQGLIHFQLNVGTTNA  171



>ref|XP_003633723.2| PREDICTED: putative germin-like protein 2-1 [Vitis vinifera]
Length=226

 Score =   217 bits (553),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 113/164 (69%), Positives = 126/164 (77%), Gaps = 4/164 (2%)
 Frame = +3

Query  84   IAMVALAssfshasdpssLQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFLFRGLNMPG  263
            IA+ A++   + ASDPS LQDFCVAVND+   VFVNGK+CK+P    ANDF F GL +PG
Sbjct  17   IALSAMSFFLASASDPSPLQDFCVAVNDTKTTVFVNGKVCKDPKVATANDFFFSGLRVPG  76

Query  264  NTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLYV  443
            NTSN +GS VTP NV  +PGLNTLGISL R+D+AP GLNPPHTHPRATE+L VLEGTLYV
Sbjct  77   NTSNKVGSMVTPANVAQIPGLNTLGISLARVDYAPYGLNPPHTHPRATEILTVLEGTLYV  136

Query  444  GFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNA  575
            GFV SNP     N L  K L  GDVFVFPEGLIHFQ NVGKT A
Sbjct  137  GFVTSNP----DNRLICKVLYKGDVFVFPEGLIHFQLNVGKTKA  176



>emb|CBI33610.3| unnamed protein product [Vitis vinifera]
Length=315

 Score =   220 bits (560),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 113/164 (69%), Positives = 127/164 (77%), Gaps = 4/164 (2%)
 Frame = +3

Query  84   IAMVALAssfshasdpssLQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFLFRGLNMPG  263
            IA+ A++   + ASDPS LQDFCVAVND+   VFVNGK+CK+P    ANDF F GL +PG
Sbjct  106  IALSAMSFFLASASDPSPLQDFCVAVNDTKTTVFVNGKVCKDPKVATANDFFFSGLRVPG  165

Query  264  NTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLYV  443
            NTSN +GS VTP NV  +PGLNTLGISL R+D+AP GLNPPHTHPRATE+L VLEGTLYV
Sbjct  166  NTSNKVGSMVTPANVAQIPGLNTLGISLARVDYAPYGLNPPHTHPRATEILTVLEGTLYV  225

Query  444  GFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNA  575
            GFV SNP     N L +K L  GDVFVFPEGLIHFQ NVGKT A
Sbjct  226  GFVTSNP----DNRLISKVLYKGDVFVFPEGLIHFQLNVGKTKA  265



>ref|XP_007030273.1| RmlC-like cupins superfamily protein [Theobroma cacao]
 gb|EOY10775.1| RmlC-like cupins superfamily protein [Theobroma cacao]
Length=224

 Score =   217 bits (552),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 115/173 (66%), Positives = 135/173 (78%), Gaps = 5/173 (3%)
 Frame = +3

Query  60   ALRFIVFVIAMVALAssfshasdpssLQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFL  239
             +R  +    ++A A+S + A DPS LQDFCVA+ND+   VFVNGK CK+P   VA+DF 
Sbjct  3    GMRCFLVAFTLLAFANSLASAFDPSPLQDFCVAINDTKNGVFVNGKFCKDPKLAVADDFF  62

Query  240  FRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAP-NGLNPPHTHPRATEVL  416
            + GLNMPGNTSNP+GS VT VNV+ +PGLNTLGISLVRID+AP  GLNPPHTHPR TE+L
Sbjct  63   YSGLNMPGNTSNPVGSNVTTVNVDQIPGLNTLGISLVRIDYAPYGGLNPPHTHPRGTEIL  122

Query  417  LVLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNA  575
            +V+EGTLYVGFV SNP    +N LFTK L  GDVFVFP GLIHFQFN+GKT A
Sbjct  123  VVVEGTLYVGFVTSNP----ENRLFTKVLYPGDVFVFPIGLIHFQFNIGKTEA  171



>ref|XP_007210592.1| hypothetical protein PRUPE_ppa016616mg [Prunus persica]
 gb|EMJ11791.1| hypothetical protein PRUPE_ppa016616mg [Prunus persica]
Length=227

 Score =   216 bits (551),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 117/172 (68%), Positives = 132/172 (77%), Gaps = 3/172 (2%)
 Frame = +3

Query  60   ALRFIVFVIAMVALAssfshasdpssLQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFL  239
             + F + ++A +ALA+    ASDPS LQDFCVA+N++ +AVFVNGK CK+P  V ANDF 
Sbjct  4    GVHFQLSIVATLALATFLVSASDPSPLQDFCVAINNTESAVFVNGKFCKDPKFVTANDFF  63

Query  240  FRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLL  419
            F GL +PGNTSNP+GS VTP NV  + GLNTLGISL RIDFAPNGLNPPHTHPR TE L+
Sbjct  64   FSGLRIPGNTSNPVGSFVTPANVEQIAGLNTLGISLARIDFAPNGLNPPHTHPRGTEFLI  123

Query  420  VLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNA  575
            VLEGTLYVGFV SN   G  N LFTK L  GDVFVFP GLIHFQ NVG  NA
Sbjct  124  VLEGTLYVGFVTSN---GDNNRLFTKVLNKGDVFVFPVGLIHFQLNVGHVNA  172



>ref|XP_002276315.2| PREDICTED: putative germin-like protein 2-1 [Vitis vinifera]
Length=228

 Score =   216 bits (550),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 112/164 (68%), Positives = 128/164 (78%), Gaps = 4/164 (2%)
 Frame = +3

Query  84   IAMVALAssfshasdpssLQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFLFRGLNMPG  263
            + ++A+A S + ASDPS LQDFCVAVND+N  VFVNGK C++P     NDF F GL +PG
Sbjct  12   VVLLAMAFSVASASDPSPLQDFCVAVNDTNDTVFVNGKFCRDPKLATPNDFFFSGLRVPG  71

Query  264  NTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLYV  443
            NTSN LGS VTP NV  +PGLNTLG+SL R+D+AP GLNPPHTHPRATE+L VLEGTLYV
Sbjct  72   NTSNKLGSMVTPANVAQIPGLNTLGVSLARVDYAPYGLNPPHTHPRATEILTVLEGTLYV  131

Query  444  GFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNA  575
            GFV SNP     N L +K L  GDVFVFP+GLIHFQ NVGKTNA
Sbjct  132  GFVTSNP----DNRLISKVLYKGDVFVFPQGLIHFQLNVGKTNA  171



>ref|XP_008240380.1| PREDICTED: germin-like protein subfamily 1 member 20 [Prunus 
mume]
Length=227

 Score =   216 bits (550),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 117/172 (68%), Positives = 132/172 (77%), Gaps = 3/172 (2%)
 Frame = +3

Query  60   ALRFIVFVIAMVALAssfshasdpssLQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFL  239
             + F + ++A +ALA+    ASDPS LQDFCVA+N++ +AVFVNGK CK+P  V ANDF 
Sbjct  4    GVHFPLSIVATLALATFLVSASDPSPLQDFCVAINNTESAVFVNGKFCKDPKLVTANDFF  63

Query  240  FRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLL  419
            F GL +PGNTSNP+GS VTP NV  + GLNTLGISL RIDFAPNGLNPPHTHPR TE L+
Sbjct  64   FSGLRIPGNTSNPVGSFVTPANVEQIAGLNTLGISLARIDFAPNGLNPPHTHPRGTEFLI  123

Query  420  VLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNA  575
            VLEGTLYVGFV SN   G  N LFTK L  GDVFVFP GLIHFQ NVG  NA
Sbjct  124  VLEGTLYVGFVSSN---GDNNRLFTKVLNKGDVFVFPVGLIHFQLNVGHVNA  172



>ref|XP_002276756.2| PREDICTED: putative germin-like protein 2-1 [Vitis vinifera]
Length=228

 Score =   216 bits (550),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 113/164 (69%), Positives = 129/164 (79%), Gaps = 4/164 (2%)
 Frame = +3

Query  84   IAMVALAssfshasdpssLQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFLFRGLNMPG  263
            I ++A+A S + ASDPS LQDFCVAVND+N +VFVNGK CK+P     NDF F GL +PG
Sbjct  12   IVLLAMAFSVASASDPSPLQDFCVAVNDTNDSVFVNGKFCKDPKLATPNDFFFSGLRVPG  71

Query  264  NTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLYV  443
            NTSN LGS VTP NV  +PGLNTLG+SL R+D+AP GLNPPH+HPRATE+L VLEGTLYV
Sbjct  72   NTSNKLGSMVTPANVAQIPGLNTLGVSLARVDYAPYGLNPPHSHPRATEILTVLEGTLYV  131

Query  444  GFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNA  575
            GFV SNP     N L +K L  GDVFVFP+GLIHFQ NVGKTNA
Sbjct  132  GFVTSNP----DNRLISKVLHKGDVFVFPQGLIHFQLNVGKTNA  171



>emb|CAN72994.1| hypothetical protein VITISV_000563 [Vitis vinifera]
Length=205

 Score =   215 bits (547),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 105/146 (72%), Positives = 113/146 (77%), Gaps = 4/146 (3%)
 Frame = +3

Query  138  LQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFLFRGLNMPGNTSNPLGSKVTPVNVNNL  317
            LQDFCVAVND+   VFVNGK+CK+P    ANDF F GL +PGNTSN LGS VTP NV  +
Sbjct  14   LQDFCVAVNDTKTTVFVNGKVCKDPKVATANDFFFSGLRVPGNTSNKLGSMVTPANVAQI  73

Query  318  PGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLYVGFVLSNPPPGMKNPLFTK  497
            PGLNTLGISL R+D+AP GLNPPHTHPRATE+L VLEGTLYVGFV SNP     N L  K
Sbjct  74   PGLNTLGISLARVDYAPYGLNPPHTHPRATEILTVLEGTLYVGFVTSNP----DNRLIAK  129

Query  498  TLVAGDVFVFPEGLIHFQFNVGKTNA  575
             L  GDVFVFPEGLIHF  NVGKT A
Sbjct  130  VLYKGDVFVFPEGLIHFHLNVGKTKA  155



>ref|XP_007200157.1| hypothetical protein PRUPE_ppa016753mg [Prunus persica]
 gb|EMJ01356.1| hypothetical protein PRUPE_ppa016753mg [Prunus persica]
Length=226

 Score =   215 bits (548),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 119/172 (69%), Positives = 133/172 (77%), Gaps = 3/172 (2%)
 Frame = +3

Query  60   ALRFIVFVIAMVALAssfshasdpssLQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFL  239
            A+ F++  +A++A A+    ASDPS LQDFCVA+ND+ +AVFVNGK CK+P    ANDF 
Sbjct  3    AVYFLISTLAILASATFLVSASDPSPLQDFCVALNDTKSAVFVNGKFCKDPKLANANDFF  62

Query  240  FRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLL  419
            F GL  P NT NPLGS VT VNV+NL GLNTLGISL RIDFAPNGLNPPHTHPRATE+L+
Sbjct  63   FSGLQNPRNTQNPLGSNVTAVNVDNLLGLNTLGISLARIDFAPNGLNPPHTHPRATEILV  122

Query  420  VLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNA  575
            VLEGTLYVGFV SN   G  N LFTK L  GDVFVFP GLIHFQ NVG  NA
Sbjct  123  VLEGTLYVGFVTSN---GDGNRLFTKVLNKGDVFVFPIGLIHFQLNVGHVNA  171



>ref|XP_007200183.1| hypothetical protein PRUPE_ppa016284mg [Prunus persica]
 gb|EMJ01382.1| hypothetical protein PRUPE_ppa016284mg [Prunus persica]
Length=226

 Score =   215 bits (548),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 118/172 (69%), Positives = 133/172 (77%), Gaps = 3/172 (2%)
 Frame = +3

Query  60   ALRFIVFVIAMVALAssfshasdpssLQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFL  239
             + F++  +A++A A+    ASDPS LQDFCVA+ND+ +AVFVNGK CK+P  V ANDF 
Sbjct  3    GVHFLISTLAILASATFLVSASDPSPLQDFCVALNDTKSAVFVNGKFCKDPKLVNANDFF  62

Query  240  FRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLL  419
            F GL  P NT NP+GS VT VNV+NL GLNTLGISL RIDFAPNGLNPPHTHPRATE+L+
Sbjct  63   FSGLQNPRNTQNPVGSNVTAVNVDNLAGLNTLGISLARIDFAPNGLNPPHTHPRATEILV  122

Query  420  VLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNA  575
            VLEGTLYVGFV SN   G  N LFTK L  GDVFVFP GLIHFQ NVG  NA
Sbjct  123  VLEGTLYVGFVTSN---GDGNRLFTKVLNEGDVFVFPIGLIHFQLNVGHVNA  171



>emb|CAN80134.1| hypothetical protein VITISV_012033 [Vitis vinifera]
Length=224

 Score =   215 bits (547),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 117/171 (68%), Positives = 135/171 (79%), Gaps = 5/171 (3%)
 Frame = +3

Query  60   ALRFIVFVIAMVALAssfshasdpssLQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFL  239
            ++R +V  IA +ALA S S A DPS LQD CVAV+D  AAVFVNGK CK+P   +A+DF 
Sbjct  4    SVRLLV-TIAFMALACSISSAYDPSPLQDTCVAVDDPKAAVFVNGKFCKDPKLAMADDFF  62

Query  240  FRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLL  419
            F GL++PGNTSNP+GS VTPVNV  + GLNTLGISL R+D+AP GLNPPHTHPRATE+L+
Sbjct  63   FSGLHIPGNTSNPVGSAVTPVNVAQIAGLNTLGISLARVDYAPYGLNPPHTHPRATEILV  122

Query  420  VLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTN  572
            VLEGTLYVGFV SNP    +N L +K L  GDVFVFP GLIHFQFNVG TN
Sbjct  123  VLEGTLYVGFVTSNP----ENRLISKVLNKGDVFVFPIGLIHFQFNVGHTN  169



>ref|XP_007030276.1| RmlC-like cupins superfamily protein [Theobroma cacao]
 ref|XP_007030282.1| RmlC-like cupins superfamily protein [Theobroma cacao]
 gb|EOY10778.1| RmlC-like cupins superfamily protein [Theobroma cacao]
 gb|EOY10784.1| RmlC-like cupins superfamily protein [Theobroma cacao]
Length=225

 Score =   214 bits (546),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 109/147 (74%), Positives = 119/147 (81%), Gaps = 5/147 (3%)
 Frame = +3

Query  138  LQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFLFRGLNMPGNTSNPLGSKVTPVNVNNL  317
            LQDFCVA+ND+  AVFVNGK CK+PM   A DF F GLN+PGNTSN LGSKVTPVNV  +
Sbjct  28   LQDFCVALNDTKNAVFVNGKFCKDPMLAKAEDFFFSGLNVPGNTSNQLGSKVTPVNVEQI  87

Query  318  PGLNTLGISLVRIDFAP-NGLNPPHTHPRATEVLLVLEGTLYVGFVLSNPPPGMKNPLFT  494
            PGLNTLG+SL R+DFAP  GLNPPHTHPRATE+L+VLEGTLYVGFV SNP     N L T
Sbjct  88   PGLNTLGVSLARVDFAPYGGLNPPHTHPRATEILVVLEGTLYVGFVTSNP----DNRLIT  143

Query  495  KTLVAGDVFVFPEGLIHFQFNVGKTNA  575
            K L  GDVFVFP GLIHFQ N+GKTNA
Sbjct  144  KVLYPGDVFVFPVGLIHFQLNIGKTNA  170



>ref|XP_002265857.1| PREDICTED: putative germin-like protein 2-1 [Vitis vinifera]
Length=221

 Score =   214 bits (545),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 104/146 (71%), Positives = 114/146 (78%), Gaps = 4/146 (3%)
 Frame = +3

Query  138  LQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFLFRGLNMPGNTSNPLGSKVTPVNVNNL  317
            LQDFCVAVND+   VFVNGK+CK+P     NDF F GL +PGNTSN +GS VTP NV  +
Sbjct  30   LQDFCVAVNDTKTTVFVNGKVCKDPKVATPNDFFFSGLRVPGNTSNKVGSMVTPANVAQI  89

Query  318  PGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLYVGFVLSNPPPGMKNPLFTK  497
            PGLNTLGISL R+D+AP GLNPPHTHPRATE+L VLEGTLYVGFV SNP     N L +K
Sbjct  90   PGLNTLGISLARVDYAPYGLNPPHTHPRATEILTVLEGTLYVGFVTSNP----DNRLISK  145

Query  498  TLVAGDVFVFPEGLIHFQFNVGKTNA  575
             L  GDVFVFPEGLIHFQ NVGKT A
Sbjct  146  VLYKGDVFVFPEGLIHFQLNVGKTKA  171



>ref|XP_002281186.2| PREDICTED: uncharacterized protein LOC100244552 [Vitis vinifera]
Length=478

 Score =   222 bits (565),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 114/164 (70%), Positives = 128/164 (78%), Gaps = 4/164 (2%)
 Frame = +3

Query  84   IAMVALAssfshasdpssLQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFLFRGLNMPG  263
            IA++A++   + ASDPS LQDFCVAVND+   VFVNGK+CK+P    ANDF F GL +PG
Sbjct  269  IALLAMSFFLASASDPSPLQDFCVAVNDTKTTVFVNGKVCKDPKVATANDFFFSGLRVPG  328

Query  264  NTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLYV  443
            NTSN LGS VTP NV  +PGLNTLGISL R+D+AP GLNPPHTHPRATE+L VLEGTLYV
Sbjct  329  NTSNKLGSMVTPANVAQIPGLNTLGISLARVDYAPYGLNPPHTHPRATEILTVLEGTLYV  388

Query  444  GFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNA  575
            GFV SNP     N L +K L  GDVFVFPEGLIHFQ NVGKT A
Sbjct  389  GFVTSNP----DNRLISKVLYKGDVFVFPEGLIHFQLNVGKTKA  428


 Score =   185 bits (470),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 93/146 (64%), Positives = 106/146 (73%), Gaps = 4/146 (3%)
 Frame = +3

Query  138  LQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFLFRGLNMPGNTSNPLGSKVTPVNVNNL  317
            LQ+FCVAVND+   VFVNGK+CK+     AND  F  L + G+TSN L S VT  NV  +
Sbjct  14   LQEFCVAVNDTKTTVFVNGKVCKDLKVATANDLFFSRLQVLGHTSNKLESMVTQANVAQI  73

Query  318  PGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLYVGFVLSNPPPGMKNPLFTK  497
            P LNTLGISL R+D+AP GLNPPHT+PRATE+L VLEGTLYVGFV SNP     N L +K
Sbjct  74   PELNTLGISLARVDYAPYGLNPPHTYPRATEILTVLEGTLYVGFVTSNP----DNRLISK  129

Query  498  TLVAGDVFVFPEGLIHFQFNVGKTNA  575
             L  GDVF+F EGLIHFQ NV KT A
Sbjct  130  VLYKGDVFIFLEGLIHFQLNVRKTKA  155



>emb|CDP16786.1| unnamed protein product [Coffea canephora]
Length=690

 Score =   226 bits (577),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 123/173 (71%), Positives = 139/173 (80%), Gaps = 1/173 (1%)
 Frame = +3

Query  57   MALRFIVFVIAMVALAssfshasdpssLQDFCVAVNDSNAAVFVNGKICKNPMQVVANDF  236
            MA RF +   A++AL  +  +ASDPS LQDFCVAV D+NA VFVNGKICK+P  V A DF
Sbjct  1    MAFRFHI-AAAILALVFTIVYASDPSPLQDFCVAVPDANAGVFVNGKICKDPKLVKAEDF  59

Query  237  LFRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVL  416
             F+GLN PG+T+NPLGS VT VNVN +PGLNTLG+SL R+DFAP GLNPPHTHPRATEVL
Sbjct  60   FFQGLNKPGSTANPLGSNVTQVNVNQIPGLNTLGVSLARLDFAPYGLNPPHTHPRATEVL  119

Query  417  LVLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNA  575
             VLEGTL VGFV SNP   MKN LFTK L  GDVFVFP+GLIHFQFN G+T+A
Sbjct  120  FVLEGTLLVGFVTSNPGMNMKNKLFTKVLNPGDVFVFPQGLIHFQFNQGETDA  172


 Score =   220 bits (561),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 123/176 (70%), Positives = 137/176 (78%), Gaps = 1/176 (1%)
 Frame = +3

Query  48   ILDMALRFIVFVIAMVALAssfshasdpssLQDFCVAVNDSNAAVFVNGKICKNPMQVVA  227
            ++ MA+R I    A++AL  +  HASDPS LQDFCVAV D+NA VFVNGKICK+P  V  
Sbjct  229  VITMAVR-IHIAAAILALVFTVVHASDPSPLQDFCVAVPDANAGVFVNGKICKDPKLVKP  287

Query  228  NDFLFRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRAT  407
             DF F GLN PG+T+NPLGS VT VNVN +PGLNTLG+SL RIDFAP GLNPPH HPRAT
Sbjct  288  EDFFFPGLNKPGSTANPLGSNVTAVNVNQIPGLNTLGVSLARIDFAPYGLNPPHIHPRAT  347

Query  408  EVLLVLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNA  575
            EVL VLEGTL VGFV SNP   MKN LFTK L  GDVFVFP+GLIHFQFN G +NA
Sbjct  348  EVLFVLEGTLVVGFVTSNPGMNMKNKLFTKVLNPGDVFVFPQGLIHFQFNQGHSNA  403


 Score =   220 bits (561),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 123/176 (70%), Positives = 137/176 (78%), Gaps = 1/176 (1%)
 Frame = +3

Query  48   ILDMALRFIVFVIAMVALAssfshasdpssLQDFCVAVNDSNAAVFVNGKICKNPMQVVA  227
            ++ MA+R I    A++AL  +  HASDPS LQDFCVAV D+NA VFVNGKICK+P  V  
Sbjct  459  VITMAVR-IHIAAAILALVFTVVHASDPSPLQDFCVAVPDANAGVFVNGKICKDPKLVKP  517

Query  228  NDFLFRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRAT  407
             DF F GLN PG+T+NPLGS VT VNVN +PGLNTLG+SL RIDFAP GLNPPH HPRAT
Sbjct  518  EDFFFPGLNKPGSTANPLGSNVTAVNVNQIPGLNTLGVSLARIDFAPYGLNPPHIHPRAT  577

Query  408  EVLLVLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNA  575
            EVL VLEGTL VGFV SNP   MKN LFTK L  GDVFVFP+GLIHFQFN G +NA
Sbjct  578  EVLFVLEGTLVVGFVTSNPGMNMKNKLFTKVLNPGDVFVFPQGLIHFQFNQGHSNA  633



>emb|CAN66771.1| hypothetical protein VITISV_022559 [Vitis vinifera]
Length=205

 Score =   213 bits (543),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 104/146 (71%), Positives = 114/146 (78%), Gaps = 4/146 (3%)
 Frame = +3

Query  138  LQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFLFRGLNMPGNTSNPLGSKVTPVNVNNL  317
            LQDFCVAVND+   VFVNGK+CK+P     NDF F GL +PGNTSN +GS VTP NV  +
Sbjct  14   LQDFCVAVNDTKTTVFVNGKVCKDPKVATPNDFFFSGLRVPGNTSNKVGSMVTPANVAQI  73

Query  318  PGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLYVGFVLSNPPPGMKNPLFTK  497
            PGLNTLGISL R+D+AP GLNPPHTHPRATE+L VLEGTLYVGFV SNP     N L +K
Sbjct  74   PGLNTLGISLARVDYAPYGLNPPHTHPRATEILTVLEGTLYVGFVTSNP----DNRLISK  129

Query  498  TLVAGDVFVFPEGLIHFQFNVGKTNA  575
             L  GDVFVFPEGLIHFQ NVGKT A
Sbjct  130  VLYKGDVFVFPEGLIHFQLNVGKTKA  155



>gb|AAM76226.1| putative germin E protein precursor [Gossypium raimondii]
 gb|AAM76228.1| putative germin E protein precursor [Gossypium hirsutum]
Length=187

 Score =   213 bits (541),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 106/147 (72%), Positives = 121/147 (82%), Gaps = 5/147 (3%)
 Frame = +3

Query  138  LQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFLFRGLNMPGNTSNPLGSKVTPVNVNNL  317
            LQDFCVA+N +  AVFVNGK+CK+P    A+DF F GL+ PGNTSN +GS+VTPVNV+ +
Sbjct  2    LQDFCVALNSTKHAVFVNGKLCKDPKLATADDFFFSGLDKPGNTSNAVGSRVTPVNVDQI  61

Query  318  PGLNTLGISLVRIDFAPN-GLNPPHTHPRATEVLLVLEGTLYVGFVLSNPPPGMKNPLFT  494
            PGLNTLGISLVRID+APN G NPPHTHPRATE+L+V +GTLYVGFV SNP     N LFT
Sbjct  62   PGLNTLGISLVRIDYAPNGGQNPPHTHPRATEILVVTKGTLYVGFVTSNP----DNRLFT  117

Query  495  KTLVAGDVFVFPEGLIHFQFNVGKTNA  575
            K L  GDVFVFP GLIHFQFN+GKTNA
Sbjct  118  KVLKTGDVFVFPVGLIHFQFNIGKTNA  144



>ref|XP_007201862.1| hypothetical protein PRUPE_ppa020162mg [Prunus persica]
 gb|EMJ03061.1| hypothetical protein PRUPE_ppa020162mg [Prunus persica]
Length=226

 Score =   214 bits (544),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 118/172 (69%), Positives = 132/172 (77%), Gaps = 3/172 (2%)
 Frame = +3

Query  60   ALRFIVFVIAMVALAssfshasdpssLQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFL  239
             + F++  +A++A A+    ASDPS LQDFCVA+ND+ +AVFVNGK CK+P    ANDF 
Sbjct  3    GVYFLISTLAILASATFLVSASDPSPLQDFCVALNDTKSAVFVNGKFCKDPKLANANDFF  62

Query  240  FRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLL  419
            F GL  P NT NPLGS VT VNV+NL GLNTLGISL RIDFAPNGLNPPHTHPRATE+L+
Sbjct  63   FSGLQNPRNTQNPLGSNVTAVNVDNLLGLNTLGISLARIDFAPNGLNPPHTHPRATEILV  122

Query  420  VLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNA  575
            VLEGTLYVGFV SN   G  N LFTK L  GDVFVFP GLIHFQ NVG  NA
Sbjct  123  VLEGTLYVGFVTSN---GDGNRLFTKVLNKGDVFVFPIGLIHFQLNVGHVNA  171



>ref|XP_002270404.2| PREDICTED: putative germin-like protein 2-1 [Vitis vinifera]
Length=221

 Score =   214 bits (544),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 112/164 (68%), Positives = 128/164 (78%), Gaps = 4/164 (2%)
 Frame = +3

Query  84   IAMVALAssfshasdpssLQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFLFRGLNMPG  263
            + ++A+A SF+ ASDPS LQDFCVAVND+N  VFVNGK C++P     NDF F GL +PG
Sbjct  12   VVLLAMAFSFASASDPSPLQDFCVAVNDTNDTVFVNGKFCRDPKLATPNDFFFSGLRLPG  71

Query  264  NTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLYV  443
            NTSN LGS VTP NV  +PGLNTLGISL R+D+AP GLNPPH HPRATE+L VLEGTLYV
Sbjct  72   NTSNKLGSMVTPANVAQIPGLNTLGISLARVDYAPYGLNPPHIHPRATEILTVLEGTLYV  131

Query  444  GFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNA  575
            GFV SNP    +N L +K L  GDVFVFP+GLIHFQ NVG TNA
Sbjct  132  GFVTSNP----ENRLISKVLYKGDVFVFPQGLIHFQLNVGTTNA  171



>emb|CDP10698.1| unnamed protein product [Coffea canephora]
Length=223

 Score =   214 bits (544),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 119/173 (69%), Positives = 135/173 (78%), Gaps = 1/173 (1%)
 Frame = +3

Query  57   MALRFIVFVIAMVALAssfshasdpssLQDFCVAVNDSNAAVFVNGKICKNPMQVVANDF  236
            M   F++ + AM AL SS + ASDPS LQDFCVA+NDS AAVFVNGKICK+P  V ANDF
Sbjct  1    MGAPFLITLAAM-ALLSSLAIASDPSPLQDFCVAINDSKAAVFVNGKICKDPKVVNANDF  59

Query  237  LFRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVL  416
             F+G N+PGNT+NP+GS VT V VNNLPGLNT GISL RIDFAP G+N PHTHPRATEV+
Sbjct  60   FFQGFNIPGNTNNPVGSNVTRVLVNNLPGLNTFGISLARIDFAPYGVNTPHTHPRATEVI  119

Query  417  LVLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNA  575
              +EGTL   FV SNPP  MKN LFTK L  GDVFVFP+GL+HF  N+GKT A
Sbjct  120  FAVEGTLAASFVTSNPPNNMKNRLFTKVLNPGDVFVFPQGLVHFIQNLGKTKA  172



>ref|XP_002265447.3| PREDICTED: uncharacterized protein LOC100242782 [Vitis vinifera]
Length=450

 Score =   219 bits (559),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 113/164 (69%), Positives = 128/164 (78%), Gaps = 4/164 (2%)
 Frame = +3

Query  84   IAMVALAssfshasdpssLQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFLFRGLNMPG  263
            IA++A++   + ASDPS LQDFCVAVND+   VFVNGK+CK+P    ANDF F GL +PG
Sbjct  241  IALLAMSFFLASASDPSPLQDFCVAVNDTKTTVFVNGKVCKDPKVATANDFFFSGLRVPG  300

Query  264  NTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLYV  443
            NTSN +GS VTP NV  +PGLNTLGISL R+D+AP GLNPPHTHPRATE+L VLEGTLYV
Sbjct  301  NTSNKVGSMVTPANVAQIPGLNTLGISLARVDYAPYGLNPPHTHPRATEILTVLEGTLYV  360

Query  444  GFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNA  575
            GFV SNP     N L +K L  GDVFVFPEGLIHFQ NVGKT A
Sbjct  361  GFVTSNP----DNRLISKVLYKGDVFVFPEGLIHFQLNVGKTKA  400


 Score =   182 bits (463),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 90/132 (68%), Positives = 98/132 (74%), Gaps = 4/132 (3%)
 Frame = +3

Query  180  VFVNGKICKNPMQVVANDFLFRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRID  359
            VFVNGK+CK+P    ANDF F GL +PGNTSN LGS VTP NV  +P L TLGISL R+D
Sbjct  7    VFVNGKVCKDPKVATANDFFFSGLRVPGNTSNKLGSMVTPANVAQIPDLKTLGISLARVD  66

Query  360  FAPNGLNPPHTHPRATEVLLVLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGL  539
            +AP GLNPPHTHPR TE+L  LEGTLYVGFV SNP     N L +K L  GDVFVFPE L
Sbjct  67   YAPYGLNPPHTHPRDTEILTFLEGTLYVGFVTSNP----DNRLISKVLYKGDVFVFPEDL  122

Query  540  IHFQFNVGKTNA  575
            IHFQ NV KT A
Sbjct  123  IHFQLNVEKTKA  134



>gb|AAM76225.1| putative germin E protein precursor [Gossypium herbaceum]
Length=187

 Score =   210 bits (535),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 105/147 (71%), Positives = 120/147 (82%), Gaps = 5/147 (3%)
 Frame = +3

Query  138  LQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFLFRGLNMPGNTSNPLGSKVTPVNVNNL  317
            LQD CVA+N +  AVFVNGK+CK+P    A+DF F GL+ PGNTSN +GS+VTPVNV+ +
Sbjct  2    LQDLCVALNSTKHAVFVNGKLCKDPKLATADDFFFSGLDKPGNTSNAVGSRVTPVNVDQI  61

Query  318  PGLNTLGISLVRIDFAPN-GLNPPHTHPRATEVLLVLEGTLYVGFVLSNPPPGMKNPLFT  494
            PGLNTLGISLVRID+APN G NPPHTHPRATE+L+V +GTLYVGFV SNP     N LFT
Sbjct  62   PGLNTLGISLVRIDYAPNGGQNPPHTHPRATEILVVTKGTLYVGFVTSNP----DNRLFT  117

Query  495  KTLVAGDVFVFPEGLIHFQFNVGKTNA  575
            K L  GDVFVFP GLIHFQFN+GKTNA
Sbjct  118  KVLKTGDVFVFPVGLIHFQFNIGKTNA  144



>gb|AAM76227.1| putative germin E protein precursor [Gossypium hirsutum]
Length=187

 Score =   210 bits (535),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 105/147 (71%), Positives = 120/147 (82%), Gaps = 5/147 (3%)
 Frame = +3

Query  138  LQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFLFRGLNMPGNTSNPLGSKVTPVNVNNL  317
            LQD CVA+N +  AVFVNGK+CK+P    A+DF F GL+ PGNTSN +GS+VTPVNV+ +
Sbjct  2    LQDLCVALNSTEHAVFVNGKLCKDPKLATADDFFFSGLDKPGNTSNAVGSRVTPVNVDQI  61

Query  318  PGLNTLGISLVRIDFAPN-GLNPPHTHPRATEVLLVLEGTLYVGFVLSNPPPGMKNPLFT  494
            PGLNTLGISLVRID+APN G NPPHTHPRATE+L+V +GTLYVGFV SNP     N LFT
Sbjct  62   PGLNTLGISLVRIDYAPNGGQNPPHTHPRATEILVVTKGTLYVGFVTSNP----DNRLFT  117

Query  495  KTLVAGDVFVFPEGLIHFQFNVGKTNA  575
            K L  GDVFVFP GLIHFQFN+GKTNA
Sbjct  118  KVLKTGDVFVFPVGLIHFQFNIGKTNA  144



>ref|XP_007030289.1| RmlC-like cupins superfamily protein [Theobroma cacao]
 gb|EOY10791.1| RmlC-like cupins superfamily protein [Theobroma cacao]
Length=221

 Score =   211 bits (538),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 114/166 (69%), Positives = 131/166 (79%), Gaps = 5/166 (3%)
 Frame = +3

Query  81   VIAMVALAssfshasdpssLQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFLFRGLNMP  260
            V A++ LA S + ASDPSSLQDFCVA+ND+  A+FVNGK CK+P    A+DF F GL+  
Sbjct  10   VFALLTLAFSLASASDPSSLQDFCVALNDTKHAIFVNGKFCKDPKLATADDFFFSGLDKA  69

Query  261  GNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAP-NGLNPPHTHPRATEVLLVLEGTL  437
            GNTSN +GS+VTPVNV+ +PGLNTLGISL RID+AP  GLNPPHTHPRATE+L V +GTL
Sbjct  70   GNTSNAVGSRVTPVNVDQIPGLNTLGISLARIDYAPYGGLNPPHTHPRATEILAVKKGTL  129

Query  438  YVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNA  575
            YVGFV SNP     N  FTK L  GDVFVFP GLIHFQFN+GKTNA
Sbjct  130  YVGFVTSNP----DNKFFTKILKTGDVFVFPVGLIHFQFNIGKTNA  171



>ref|XP_002265297.3| PREDICTED: uncharacterized protein LOC100247931 [Vitis vinifera]
Length=490

 Score =   219 bits (559),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 113/164 (69%), Positives = 128/164 (78%), Gaps = 4/164 (2%)
 Frame = +3

Query  84   IAMVALAssfshasdpssLQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFLFRGLNMPG  263
            IA++A++   + ASDPS LQDFCVAVND+   VFVNGK+CK+P    ANDF F GL +PG
Sbjct  12   IALLAMSFFLASASDPSPLQDFCVAVNDTKTTVFVNGKVCKDPKVATANDFFFSGLRVPG  71

Query  264  NTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLYV  443
            NTSN +GS VTP NV  +PGLNTLGISL R+D+AP GLNPPHTHPRATE+L VLEGTLYV
Sbjct  72   NTSNKVGSMVTPANVAQIPGLNTLGISLARVDYAPYGLNPPHTHPRATEILTVLEGTLYV  131

Query  444  GFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNA  575
            GFV SNP     N L +K L  GDVFVFPEGLIHFQ NVGKT A
Sbjct  132  GFVTSNP----DNRLISKVLYKGDVFVFPEGLIHFQLNVGKTKA  171


 Score =   216 bits (550),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 111/164 (68%), Positives = 126/164 (77%), Gaps = 4/164 (2%)
 Frame = +3

Query  84   IAMVALAssfshasdpssLQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFLFRGLNMPG  263
            IA+ A++   + ASDPS LQDFCVAVND+   VFVNGK+CK+P    A+DF F GL +PG
Sbjct  281  IALSAMSFFLASASDPSPLQDFCVAVNDTKTTVFVNGKVCKDPKVATADDFFFSGLRVPG  340

Query  264  NTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLYV  443
            NTSN +GS VTP NV  +PGLNTLGISL R+D+AP GLNPPHTHPRATE+L VLEGTLYV
Sbjct  341  NTSNKVGSMVTPANVAQIPGLNTLGISLARVDYAPYGLNPPHTHPRATEILTVLEGTLYV  400

Query  444  GFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNA  575
            GFV SNP     N L  K L  GDVF+FPEGLIHFQ NVGKT A
Sbjct  401  GFVTSNP----DNRLICKVLYKGDVFIFPEGLIHFQLNVGKTKA  440



>gb|EPS67173.1| hypothetical protein M569_07603 [Genlisea aurea]
Length=220

 Score =   211 bits (537),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 106/146 (73%), Positives = 117/146 (80%), Gaps = 4/146 (3%)
 Frame = +3

Query  138  LQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFLFRGLNMPGNTSNPLGSKVTPVNVNNL  317
            LQDFCVAV DS   VFVNGK CKNP  VVA+DF+F GLN+PGNT+N  GS VTPV V+ L
Sbjct  29   LQDFCVAVPDSANPVFVNGKFCKNPATVVADDFVFHGLNVPGNTTNKEGSAVTPVFVSQL  88

Query  318  PGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLYVGFVLSNPPPGMKNPLFTK  497
            PGLNTLG+++ RIDFAP+GLNPPH HPRA+E LLVLEG LYVGFV SNP     N LF K
Sbjct  89   PGLNTLGVAMARIDFAPHGLNPPHVHPRASEALLVLEGNLYVGFVTSNP----DNKLFAK  144

Query  498  TLVAGDVFVFPEGLIHFQFNVGKTNA  575
            TL  GDVFVFP+GLIHFQ NVG TNA
Sbjct  145  TLCPGDVFVFPQGLIHFQLNVGSTNA  170



>ref|XP_007030272.1| RmlC-like cupins superfamily protein [Theobroma cacao]
 gb|EOY10774.1| RmlC-like cupins superfamily protein [Theobroma cacao]
Length=225

 Score =   211 bits (538),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 108/147 (73%), Positives = 118/147 (80%), Gaps = 5/147 (3%)
 Frame = +3

Query  138  LQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFLFRGLNMPGNTSNPLGSKVTPVNVNNL  317
            LQD+CVA+ND+   VFVNGK CK+P    A DF F GLN+P N SNP+GS VTPVNV  +
Sbjct  28   LQDYCVAINDAKDGVFVNGKFCKDPKLAKAEDFFFSGLNIPRNKSNPVGSTVTPVNVAQI  87

Query  318  PGLNTLGISLVRIDFAPN-GLNPPHTHPRATEVLLVLEGTLYVGFVLSNPPPGMKNPLFT  494
            PGLNTLGISLVRID+APN GLNPPHTHPRATE+L+VLEGTLYVGFV SNP     N L T
Sbjct  88   PGLNTLGISLVRIDYAPNDGLNPPHTHPRATEILVVLEGTLYVGFVTSNP----DNRLIT  143

Query  495  KTLVAGDVFVFPEGLIHFQFNVGKTNA  575
            K L  GDVFVFP GLIHFQFNVGKTNA
Sbjct  144  KILYPGDVFVFPIGLIHFQFNVGKTNA  170



>ref|XP_007200176.1| hypothetical protein PRUPE_ppa016529mg [Prunus persica]
 gb|EMJ01375.1| hypothetical protein PRUPE_ppa016529mg [Prunus persica]
Length=226

 Score =   211 bits (537),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 115/170 (68%), Positives = 128/170 (75%), Gaps = 3/170 (2%)
 Frame = +3

Query  66   RFIVFVIAMVALAssfshasdpssLQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFLFR  245
             F++  +A++A A+  + A DPS LQDFCVAV D  + VFVNGK CK+P    ANDF F 
Sbjct  5    HFLIITLAILAFATFLASAYDPSPLQDFCVAVKDIKSGVFVNGKFCKDPKLANANDFFFS  64

Query  246  GLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVL  425
            GL  P NT NP+GS VT VNV+NL GLNTLGISL RIDFAPNGLNPPHTHPRATE+L+VL
Sbjct  65   GLQNPRNTKNPVGSNVTAVNVDNLEGLNTLGISLARIDFAPNGLNPPHTHPRATEILVVL  124

Query  426  EGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNA  575
            EGTLYVGFV SN   G  N LFTK L  GDVFVFP GLIHFQ NVG  NA
Sbjct  125  EGTLYVGFVTSN---GDGNRLFTKVLNKGDVFVFPIGLIHFQLNVGHVNA  171



>ref|XP_008363404.1| PREDICTED: LOW QUALITY PROTEIN: germin-like protein subfamily 
1 member 11 [Malus domestica]
Length=225

 Score =   211 bits (536),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 115/170 (68%), Positives = 130/170 (76%), Gaps = 4/170 (2%)
 Frame = +3

Query  66   RFIVFVIAMVALAssfshasdpssLQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFLFR  245
            +F V ++A++A A+SF  ASDPS  QDFCVA+ND+   VFVNGK CK+P    AN F F 
Sbjct  5    QFXVCIVAILAFATSFVSASDPSPXQDFCVALNDTKLGVFVNGKFCKDPKLASANYFFFS  64

Query  246  GLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVL  425
            GL +P +T NPLGS VTPVNV+ +PGLNTL ISLVRIDFAPNGLNPPHTHPR TE+L + 
Sbjct  65   GLQIPRSTQNPLGSTVTPVNVDQIPGLNTLSISLVRIDFAPNGLNPPHTHPRGTEILFLQ  124

Query  426  EGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNA  575
            EGTLYVGFV SNP     N LFTK L  GDVFVFP GLIHFQ NVG TNA
Sbjct  125  EGTLYVGFVTSNP----DNRLFTKVLNKGDVFVFPVGLIHFQLNVGHTNA  170



>ref|XP_007201148.1| hypothetical protein PRUPE_ppa016020mg [Prunus persica]
 gb|EMJ02347.1| hypothetical protein PRUPE_ppa016020mg [Prunus persica]
Length=226

 Score =   211 bits (536),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 116/172 (67%), Positives = 131/172 (76%), Gaps = 3/172 (2%)
 Frame = +3

Query  60   ALRFIVFVIAMVALAssfshasdpssLQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFL  239
             + F++  +A++A A+    ASDPS LQDFCVA+ND+ +AVFVNGK CK+P  V ANDF 
Sbjct  3    GVHFLISTLAILASATFLVSASDPSPLQDFCVALNDNKSAVFVNGKFCKDPKLVNANDFF  62

Query  240  FRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLL  419
            F GL  P NT NPLGS VT VNV+ + GLNTLGISL RIDFAPNGLNPPHTHPRA+E L+
Sbjct  63   FSGLQNPRNTQNPLGSNVTTVNVDQIAGLNTLGISLTRIDFAPNGLNPPHTHPRASEFLV  122

Query  420  VLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNA  575
            VLEGTLYVGFV SN   G  N LFTK L  GDVFVFP GLIHFQ NVG  NA
Sbjct  123  VLEGTLYVGFVTSN---GDGNRLFTKVLNKGDVFVFPIGLIHFQLNVGHVNA  171



>ref|XP_010251866.1| PREDICTED: putative germin-like protein 2-1 [Nelumbo nucifera]
Length=222

 Score =   210 bits (535),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 104/146 (71%), Positives = 117/146 (80%), Gaps = 4/146 (3%)
 Frame = +3

Query  138  LQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFLFRGLNMPGNTSNPLGSKVTPVNVNNL  317
            LQDFCVA+ D+++ VFVNGK CKNP    A+DF F GL+ PGNTSN +GSKVTPVNV  L
Sbjct  26   LQDFCVAIKDTDSRVFVNGKFCKNPYYTTADDFFFSGLDKPGNTSNSVGSKVTPVNVMQL  85

Query  318  PGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLYVGFVLSNPPPGMKNPLFTK  497
            PGLNTLGIS+ RID+AP GLNP H HPRAT+VL+VLEGTLYV FV SN    + N LFTK
Sbjct  86   PGLNTLGISMARIDYAPYGLNPLHMHPRATKVLVVLEGTLYVSFVTSN----LDNRLFTK  141

Query  498  TLVAGDVFVFPEGLIHFQFNVGKTNA  575
             L  GDVFVFP+GLIHFQFNVG TNA
Sbjct  142  VLNKGDVFVFPKGLIHFQFNVGHTNA  167



>ref|XP_004142551.1| PREDICTED: germin-like protein subfamily 1 member 7-like [Cucumis 
sativus]
 gb|KGN66717.1| hypothetical protein Csa_1G662810 [Cucumis sativus]
Length=223

 Score =   209 bits (533),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 104/146 (71%), Positives = 119/146 (82%), Gaps = 4/146 (3%)
 Frame = +3

Query  138  LQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFLFRGLNMPGNTSNPLGSKVTPVNVNNL  317
            LQDFCVA+ND+ + VF+NGK CK+P   V NDFLF+GLN+PGNT NP GS VT VNV+ L
Sbjct  26   LQDFCVAINDARSPVFLNGKFCKDPKYAVVNDFLFQGLNIPGNTENPNGSNVTLVNVDKL  85

Query  318  PGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLYVGFVLSNPPPGMKNPLFTK  497
            PGLNTLGISL RID+AP GLNPPHTHPRATE+L+V+EG+L VGFV SNP     N LF+K
Sbjct  86   PGLNTLGISLARIDYAPYGLNPPHTHPRATEILVVMEGSLLVGFVTSNP----DNKLFSK  141

Query  498  TLVAGDVFVFPEGLIHFQFNVGKTNA  575
             L  GDVFVFP GLIHFQFNVG+T A
Sbjct  142  VLYKGDVFVFPVGLIHFQFNVGRTPA  167



>emb|CAN70904.1| hypothetical protein VITISV_032927 [Vitis vinifera]
Length=196

 Score =   209 bits (531),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 103/146 (71%), Positives = 111/146 (76%), Gaps = 4/146 (3%)
 Frame = +3

Query  138  LQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFLFRGLNMPGNTSNPLGSKVTPVNVNNL  317
            LQDFCVAVND+   VFVNGK+CK+P    ANDF F GL +PG TSN LGS VTP NV  +
Sbjct  5    LQDFCVAVNDTKTTVFVNGKVCKDPKVATANDFFFSGLRVPGYTSNKLGSMVTPANVAQI  64

Query  318  PGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLYVGFVLSNPPPGMKNPLFTK  497
            PGLNTLGISL R+D+AP GLNPPHTH RATE+L VLEGTLYVGFV SNP     N L  K
Sbjct  65   PGLNTLGISLARVDYAPYGLNPPHTHLRATEILTVLEGTLYVGFVTSNP----DNRLIAK  120

Query  498  TLVAGDVFVFPEGLIHFQFNVGKTNA  575
             L  GDVFVFPEGLIHF  NVGKT A
Sbjct  121  VLYKGDVFVFPEGLIHFHLNVGKTKA  146



>ref|XP_008237524.1| PREDICTED: germin-like protein subfamily 1 member 11 isoform 
X2 [Prunus mume]
Length=228

 Score =   209 bits (532),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 118/174 (68%), Positives = 132/174 (76%), Gaps = 5/174 (3%)
 Frame = +3

Query  60   ALRFIVFVIAMVALAssfshasdpssLQDFCVAVNDSNAA--VFVNGKICKNPMQVVAND  233
             + F++  +A++A A+    ASDPS LQDFCVA+ND+ +A  VFVNGK CK+P    AND
Sbjct  3    GVYFLISTLAILASATFLVSASDPSPLQDFCVALNDTKSAEAVFVNGKFCKDPKLANAND  62

Query  234  FLFRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEV  413
            F F GL  P NT NPLGS VT VNV+NL GLNTLGISL RIDFAPNGLNPPHTHPRATE+
Sbjct  63   FFFSGLQNPRNTQNPLGSNVTAVNVDNLLGLNTLGISLARIDFAPNGLNPPHTHPRATEI  122

Query  414  LLVLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNA  575
            L+VLEGTLYVGFV SN   G  N LFTK L  GDVFVFP GLIHFQ NVG  NA
Sbjct  123  LVVLEGTLYVGFVTSN---GDGNRLFTKVLNKGDVFVFPIGLIHFQLNVGHVNA  173



>ref|XP_006840206.1| hypothetical protein AMTR_s00089p00127600 [Amborella trichopoda]
 gb|ERN01881.1| hypothetical protein AMTR_s00089p00127600 [Amborella trichopoda]
Length=219

 Score =   209 bits (531),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 116/172 (67%), Positives = 129/172 (75%), Gaps = 9/172 (5%)
 Frame = +3

Query  57   MALRFIVFVIAMVALAssfshasdpssLQDFCVAVNDSNAAVFVNGKICKNPMQVVANDF  236
            M L  +   ++M+A   S   ASDPS LQDFCVA  D+ + VFVNGK+CK+PM   ANDF
Sbjct  1    MKLTIVFLTLSMIA---SLGLASDPSPLQDFCVA--DNYSKVFVNGKVCKDPMLATANDF  55

Query  237  LFRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVL  416
             + GLN PGNTSNPLGS VTPVNV  +PGLNTLGISL RIDFAP G NPPHTHPR TE+L
Sbjct  56   FYDGLNKPGNTSNPLGSMVTPVNVMQIPGLNTLGISLARIDFAPGGQNPPHTHPRGTEIL  115

Query  417  LVLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTN  572
             VLEGTLYVGFV SNP    +N L +KTL  GDVFVFPEGLIHFQ NVG  N
Sbjct  116  TVLEGTLYVGFVTSNP----ENRLISKTLKKGDVFVFPEGLIHFQQNVGYGN  163



>ref|XP_008237526.1| PREDICTED: germin-like protein subfamily 1 member 11 [Prunus 
mume]
Length=228

 Score =   209 bits (531),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 118/174 (68%), Positives = 132/174 (76%), Gaps = 5/174 (3%)
 Frame = +3

Query  60   ALRFIVFVIAMVALAssfshasdpssLQDFCVAVNDSNAA--VFVNGKICKNPMQVVAND  233
             + F++  +A++A A+    ASDPS LQDFCVA+ND+ +A  VFVNGK CK+P    AND
Sbjct  3    GVYFLISTLAILASATFLVSASDPSPLQDFCVALNDTKSAEAVFVNGKFCKDPKLANAND  62

Query  234  FLFRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEV  413
            F F GL  P NT NPLGS VT VNV+NL GLNTLGISL RIDFAPNGLNPPHTHPRATE+
Sbjct  63   FFFSGLQNPRNTQNPLGSNVTAVNVDNLLGLNTLGISLARIDFAPNGLNPPHTHPRATEI  122

Query  414  LLVLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNA  575
            L+VLEGTLYVGFV SN   G  N LFTK L  GDVFVFP GLIHFQ NVG  NA
Sbjct  123  LVVLEGTLYVGFVTSN---GDGNRLFTKVLNKGDVFVFPIGLIHFQLNVGHVNA  173



>ref|XP_003590904.1| Germin-like protein subfamily 1 member [Medicago truncatula]
 gb|AES61155.1| germin family protein [Medicago truncatula]
 gb|AFK44678.1| unknown [Medicago truncatula]
Length=222

 Score =   209 bits (531),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 115/166 (69%), Positives = 128/166 (77%), Gaps = 4/166 (2%)
 Frame = +3

Query  78   FVIAMVALAssfshasdpssLQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFLFRGLNM  257
            F++A++ALASS   A DPS LQDFCVA+ND+   VFVNGK CK+P    A+DF F+GL  
Sbjct  6    FIVALLALASSVGFAYDPSPLQDFCVAINDTKTGVFVNGKFCKDPKLANADDFFFQGLG-  64

Query  258  PGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTL  437
            PGNTSNPLGSKVTPV VN + GLNTLGISL R+DFAP GLNPPHTHPR TE+L+VLEGTL
Sbjct  65   PGNTSNPLGSKVTPVTVNEILGLNTLGISLARVDFAPKGLNPPHTHPRGTEILVVLEGTL  124

Query  438  YVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNA  575
            YVGFV SN      N LFTK L  GDVFVFP GLIHFQ NVG   A
Sbjct  125  YVGFVSSNQD---NNRLFTKVLNKGDVFVFPIGLIHFQLNVGYGEA  167



>gb|AAM76229.1| putative germin E protein precursor [Gossypioides kirkii]
Length=187

 Score =   207 bits (527),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 103/147 (70%), Positives = 119/147 (81%), Gaps = 5/147 (3%)
 Frame = +3

Query  138  LQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFLFRGLNMPGNTSNPLGSKVTPVNVNNL  317
            LQDFCVA+N +  AVFVNGK+CK+P    A+DF F GL+ PGNTSN +GS+VTPVNV+ +
Sbjct  2    LQDFCVALNSTKHAVFVNGKLCKDPKLATADDFFFSGLDKPGNTSNAVGSRVTPVNVDQI  61

Query  318  PGLNTLGISLVRIDFAPN-GLNPPHTHPRATEVLLVLEGTLYVGFVLSNPPPGMKNPLFT  494
            PGLNTL ISLVRID+APN G NPPHTHPRATE+L+V +GTLYVGF+ SNP     N LFT
Sbjct  62   PGLNTLSISLVRIDYAPNGGQNPPHTHPRATEILVVTKGTLYVGFITSNP----DNRLFT  117

Query  495  KTLVAGDVFVFPEGLIHFQFNVGKTNA  575
            K L  GDVFVFP GLI FQFN+GKTNA
Sbjct  118  KVLKTGDVFVFPVGLIQFQFNIGKTNA  144



>ref|XP_008237522.1| PREDICTED: germin-like protein subfamily 1 member 11 isoform 
X1 [Prunus mume]
Length=229

 Score =   209 bits (531),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 118/175 (67%), Positives = 132/175 (75%), Gaps = 6/175 (3%)
 Frame = +3

Query  60   ALRFIVFVIAMVALAssfshasdpssLQDFCVAVNDSNAAV---FVNGKICKNPMQVVAN  230
             + F++  +A++A A+    ASDPS LQDFCVA+ND+ +AV   FVNGK CK+P    AN
Sbjct  3    GVYFLISTLAILASATFLVSASDPSPLQDFCVALNDTKSAVEAVFVNGKFCKDPKLANAN  62

Query  231  DFLFRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATE  410
            DF F GL  P NT NPLGS VT VNV+NL GLNTLGISL RIDFAPNGLNPPHTHPRATE
Sbjct  63   DFFFSGLQNPRNTQNPLGSNVTAVNVDNLLGLNTLGISLARIDFAPNGLNPPHTHPRATE  122

Query  411  VLLVLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNA  575
            +L+VLEGTLYVGFV SN   G  N LFTK L  GDVFVFP GLIHFQ NVG  NA
Sbjct  123  ILVVLEGTLYVGFVTSN---GDGNRLFTKVLNKGDVFVFPIGLIHFQLNVGHVNA  174



>ref|XP_008375054.1| PREDICTED: germin-like protein subfamily 1 member 13 [Malus domestica]
Length=226

 Score =   208 bits (530),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 105/146 (72%), Positives = 117/146 (80%), Gaps = 3/146 (2%)
 Frame = +3

Query  138  LQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFLFRGLNMPGNTSNPLGSKVTPVNVNNL  317
            LQDFCVA+N+++ AVFVNGK CKNP    ANDF    L  PGNTSNP+GS VT  NV+++
Sbjct  29   LQDFCVAINNTDPAVFVNGKFCKNPKLASANDFFSDKLRNPGNTSNPIGSIVTAANVDDI  88

Query  318  PGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLYVGFVLSNPPPGMKNPLFTK  497
            PGLNTLGIS  R+DFAPNGLNPPHTHPRATE+L+VLEG+LYVGFV SN   G  N LFTK
Sbjct  89   PGLNTLGISFARVDFAPNGLNPPHTHPRATEILIVLEGSLYVGFVTSN---GDGNRLFTK  145

Query  498  TLVAGDVFVFPEGLIHFQFNVGKTNA  575
             L  GDVFVFP GLIHFQ NVGKTNA
Sbjct  146  VLYKGDVFVFPVGLIHFQLNVGKTNA  171



>ref|XP_002276926.2| PREDICTED: uncharacterized protein LOC100251187, partial [Vitis 
vinifera]
Length=447

 Score =   215 bits (547),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 113/164 (69%), Positives = 127/164 (77%), Gaps = 4/164 (2%)
 Frame = +3

Query  84   IAMVALAssfshasdpssLQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFLFRGLNMPG  263
            IA++A+A S + ASDPS LQDFCVAVNDSNAAVFV GK C++P     NDF F GL +PG
Sbjct  231  IALLAMAFSLASASDPSPLQDFCVAVNDSNAAVFVKGKFCRDPKLATPNDFFFSGLRLPG  290

Query  264  NTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLYV  443
            NTSN LGS VTP NV  +PGLNTLG+SL R+D+AP GLNPPH HPRATE+L VLEGTLYV
Sbjct  291  NTSNKLGSMVTPANVAQIPGLNTLGVSLARVDYAPYGLNPPHIHPRATEILTVLEGTLYV  350

Query  444  GFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNA  575
             FV SNP     N L +K L  GDVFVFP+GLIHFQ NVG TNA
Sbjct  351  AFVTSNP----DNHLISKVLYKGDVFVFPQGLIHFQLNVGTTNA  390


 Score =   210 bits (534),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 111/164 (68%), Positives = 124/164 (76%), Gaps = 4/164 (2%)
 Frame = +3

Query  84   IAMVALAssfshasdpssLQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFLFRGLNMPG  263
            I ++A A S + ASDPS LQDFCVAVND+  AVFVNGK CK+P     NDF F GL +PG
Sbjct  5    IVLLATAFSVASASDPSPLQDFCVAVNDTKDAVFVNGKFCKDPKLATPNDFFFSGLRLPG  64

Query  264  NTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLYV  443
            NTSN LGS VTP NV  +PGLNTLG+SL R+D+AP GLNPPH HPRATE+L VLEG LYV
Sbjct  65   NTSNKLGSMVTPANVAQIPGLNTLGVSLARVDYAPYGLNPPHIHPRATEILTVLEGALYV  124

Query  444  GFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNA  575
            GFV SNP     N L +K L  GDVFVFP+GLIHFQ NVG TNA
Sbjct  125  GFVTSNP----DNRLISKVLYKGDVFVFPQGLIHFQLNVGTTNA  164



>ref|XP_007030278.1| Germin-like protein subfamily 1 member 18 [Theobroma cacao]
 gb|EOY10780.1| Germin-like protein subfamily 1 member 18 [Theobroma cacao]
Length=476

 Score =   215 bits (548),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 109/147 (74%), Positives = 119/147 (81%), Gaps = 5/147 (3%)
 Frame = +3

Query  138  LQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFLFRGLNMPGNTSNPLGSKVTPVNVNNL  317
            LQDFCVA+ND+  AVFVNGK CK+PM   A DF F GLN+PGNTSN LGSKVTPVNV  +
Sbjct  279  LQDFCVALNDTKNAVFVNGKFCKDPMLAKAEDFFFSGLNVPGNTSNQLGSKVTPVNVEQI  338

Query  318  PGLNTLGISLVRIDFAP-NGLNPPHTHPRATEVLLVLEGTLYVGFVLSNPPPGMKNPLFT  494
            PGLNTLG+SL R+DFAP  GLNPPHTHPRATE+L+VLEGTLYVGFV SNP     N L T
Sbjct  339  PGLNTLGVSLARVDFAPYGGLNPPHTHPRATEILVVLEGTLYVGFVTSNP----DNRLIT  394

Query  495  KTLVAGDVFVFPEGLIHFQFNVGKTNA  575
            K L  GDVFVFP GLIHFQ N+GKTNA
Sbjct  395  KVLYPGDVFVFPVGLIHFQLNIGKTNA  421


 Score =   201 bits (510),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 109/164 (66%), Positives = 125/164 (76%), Gaps = 5/164 (3%)
 Frame = +3

Query  87   AMVALAssfshasdpssLQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFLFRGLNMPGN  266
            A +A A S + ASDP  LQDFCVA+ND+   VFVNGK C++P    A DF + GLN+P N
Sbjct  12   AFLAFAWSLASASDPDPLQDFCVAINDTKDGVFVNGKFCQDPKLAKAEDFFYSGLNIPRN  71

Query  267  TSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAP-NGLNPPHTHPRATEVLLVLEGTLYV  443
            TSNP+GS VT VNV  + GLNTLGISL RID+AP  GLNPPHTHPRA+E+L+VLEGTLYV
Sbjct  72   TSNPVGSTVTQVNVAQILGLNTLGISLARIDYAPYGGLNPPHTHPRASEILVVLEGTLYV  131

Query  444  GFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNA  575
            GFV SNP    +N L TK L  GDVFVFP GLIHFQ N+GKTNA
Sbjct  132  GFVTSNP----ENRLITKVLYPGDVFVFPVGLIHFQLNIGKTNA  171



>ref|XP_006845051.1| hypothetical protein AMTR_s00794p00001640 [Amborella trichopoda]
 gb|ERN06726.1| hypothetical protein AMTR_s00794p00001640 [Amborella trichopoda]
Length=220

 Score =   207 bits (528),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 115/171 (67%), Positives = 132/171 (77%), Gaps = 6/171 (4%)
 Frame = +3

Query  63   LRFIVFVIAMVALAssfshasdpssLQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFLF  242
            ++    V++  AL +SF+ ASDPS LQDFCVA  D+ + VFVNGK+CK+P    ANDF F
Sbjct  1    MKSFFLVLSFFALVASFALASDPSPLQDFCVA--DNASKVFVNGKVCKDPKLAQANDFFF  58

Query  243  RGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLV  422
             GLN PGNT+NPLGS+VTPVNV  +PGLNTLGISLVRID+A  G NPPHTHPRATE+L V
Sbjct  59   CGLNKPGNTANPLGSRVTPVNVAQIPGLNTLGISLVRIDYARGGQNPPHTHPRATEILTV  118

Query  423  LEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNA  575
            LEG+LYVGFV SNP     N L TKT+  GDVFVFPEGLIHFQ NVG  NA
Sbjct  119  LEGSLYVGFVTSNP----DNRLITKTIQKGDVFVFPEGLIHFQQNVGSKNA  165



>ref|XP_008393146.1| PREDICTED: germin-like protein subfamily 1 member 11 [Malus domestica]
Length=225

 Score =   208 bits (529),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 111/170 (65%), Positives = 128/170 (75%), Gaps = 4/170 (2%)
 Frame = +3

Query  66   RFIVFVIAMVALAssfshasdpssLQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFLFR  245
            +F+  ++A++A A+S   ASDPS LQDFCVA+ND+   VFVNGK CK+     ANDF F 
Sbjct  5    QFLXCIVAILAFATSLVSASDPSPLQDFCVALNDTKLGVFVNGKFCKDSRLASANDFFFS  64

Query  246  GLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVL  425
            GL +P +T NPLGS VTP NV+ + GLNTLGISL RIDFAPNGLNPPHTHPR TE+L + 
Sbjct  65   GLQIPRSTQNPLGSTVTPANVDQIAGLNTLGISLARIDFAPNGLNPPHTHPRGTEILFLQ  124

Query  426  EGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNA  575
            EGTLYVGFV SNP     N LFTK L  GDVFVFP GLIHFQ NVG T+A
Sbjct  125  EGTLYVGFVTSNP----NNRLFTKVLNKGDVFVFPVGLIHFQLNVGHTSA  170



>ref|XP_004155681.1| PREDICTED: LOW QUALITY PROTEIN: germin-like protein subfamily 
1 member 7-like [Cucumis sativus]
Length=223

 Score =   207 bits (528),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 103/146 (71%), Positives = 118/146 (81%), Gaps = 4/146 (3%)
 Frame = +3

Query  138  LQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFLFRGLNMPGNTSNPLGSKVTPVNVNNL  317
            LQDFCVA+ND+ + VF+NGK CK+P   V NDF F+GLN+PGNT NP GS VT VNV+ L
Sbjct  26   LQDFCVAINDARSPVFLNGKFCKDPKYAVVNDFXFQGLNIPGNTENPNGSNVTLVNVDKL  85

Query  318  PGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLYVGFVLSNPPPGMKNPLFTK  497
            PGLNTLGISL RID+AP GLNPPHTHPRATE+L+V+EG+L VGFV SNP     N LF+K
Sbjct  86   PGLNTLGISLARIDYAPYGLNPPHTHPRATEILVVMEGSLLVGFVTSNP----DNKLFSK  141

Query  498  TLVAGDVFVFPEGLIHFQFNVGKTNA  575
             L  GDVFVFP GLIHFQFNVG+T A
Sbjct  142  VLYKGDVFVFPVGLIHFQFNVGRTPA  167



>gb|KCW80409.1| hypothetical protein EUGRSUZ_C01766 [Eucalyptus grandis]
Length=221

 Score =   207 bits (528),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 111/171 (65%), Positives = 130/171 (76%), Gaps = 5/171 (3%)
 Frame = +3

Query  63   LRFIVFVIAMVALAssfshasdpssLQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFLF  242
            ++F+   + ++ALA++ S A DPS LQDFCVA+ND    VFVNGK CK+P QV A+DFLF
Sbjct  1    MKFLPISLLILALATATSFAYDPSPLQDFCVAINDPK--VFVNGKFCKDPKQVTADDFLF  58

Query  243  RGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLV  422
            +G   PGNT NPLGSKVTP  V+ LPGLNTLGIS+ RIDFAP GLNPPHTHPR +E+L+V
Sbjct  59   KGFRYPGNTVNPLGSKVTPAFVDQLPGLNTLGISMARIDFAPGGLNPPHTHPRGSEILVV  118

Query  423  LEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNA  575
             EGTL VGFV SN    + N  FTK L  GDVFVFP GLIHFQ N+GKT A
Sbjct  119  AEGTLLVGFVTSN---QLNNTFFTKVLYKGDVFVFPIGLIHFQLNIGKTPA  166



>gb|KCW76699.1| hypothetical protein EUGRSUZ_D01059 [Eucalyptus grandis]
Length=221

 Score =   207 bits (528),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 111/171 (65%), Positives = 130/171 (76%), Gaps = 5/171 (3%)
 Frame = +3

Query  63   LRFIVFVIAMVALAssfshasdpssLQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFLF  242
            ++F+   + ++ALA++ S A DPS LQDFCVA+ND    VFVNGK CK+P QV A+DFLF
Sbjct  1    MKFLPISLLILALATATSFAYDPSPLQDFCVAINDPK--VFVNGKFCKDPKQVTADDFLF  58

Query  243  RGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLV  422
            +G   PGNT NPLGSKVTP  V+ LPGLNTLGIS+ RIDFAP GLNPPHTHPR +E+L+V
Sbjct  59   KGFRYPGNTVNPLGSKVTPAFVDQLPGLNTLGISMARIDFAPGGLNPPHTHPRGSEILVV  118

Query  423  LEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNA  575
             EGTL VGFV SN    + N  FTK L  GDVFVFP GLIHFQ N+GKT A
Sbjct  119  AEGTLLVGFVTSN---QLNNTFFTKVLYKGDVFVFPIGLIHFQLNIGKTPA  166



>ref|XP_007199217.1| hypothetical protein PRUPE_ppa021882mg [Prunus persica]
 gb|EMJ00416.1| hypothetical protein PRUPE_ppa021882mg [Prunus persica]
Length=226

 Score =   207 bits (528),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 114/170 (67%), Positives = 126/170 (74%), Gaps = 3/170 (2%)
 Frame = +3

Query  66   RFIVFVIAMVALAssfshasdpssLQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFLFR  245
             F++  +A +A A+  + A DPS LQDFCVA+ D    VFVNGK CK+P    ANDF F 
Sbjct  5    HFLISTLAFLAFATFLASAYDPSPLQDFCVALKDIKDGVFVNGKFCKDPKLANANDFFFS  64

Query  246  GLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVL  425
            GL  P NT NP+GS VT VNV+NL GLNTLGISL RIDFAPNGLNPPHTHPRATE+L+VL
Sbjct  65   GLQNPRNTQNPVGSNVTAVNVDNLAGLNTLGISLARIDFAPNGLNPPHTHPRATEILVVL  124

Query  426  EGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNA  575
            EGTLYVGFV SN   G  N LFTK L  GDVFVFP GLIHFQ NVG  NA
Sbjct  125  EGTLYVGFVTSN---GDGNRLFTKVLNKGDVFVFPIGLIHFQLNVGHVNA  171



>ref|XP_008237521.1| PREDICTED: germin-like protein subfamily 1 member 16 [Prunus 
mume]
Length=234

 Score =   207 bits (528),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 118/180 (66%), Positives = 133/180 (74%), Gaps = 11/180 (6%)
 Frame = +3

Query  60   ALRFIVFVIAMVALAssfshasdpssLQDFCVAVNDSNAA--------VFVNGKICKNPM  215
             + F++  +A++A A+    ASDPS LQDFCVA+ND+ +A        VFVNGK CK+P 
Sbjct  3    GVHFLISTLAILASATFLVSASDPSPLQDFCVALNDTKSAGGYFGAGAVFVNGKFCKDPK  62

Query  216  QVVANDFLFRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTH  395
             V ANDF F GL  P NT NP+GS VT VNV+NL GLNTLGISL RIDFAPNGLNPPHTH
Sbjct  63   LVNANDFFFSGLQNPRNTQNPVGSNVTAVNVDNLAGLNTLGISLARIDFAPNGLNPPHTH  122

Query  396  PRATEVLLVLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNA  575
            PRATE+L+VLEGTLYVGFV SN   G  N LFTK L  GDVFVFP GLIHFQ NVG  NA
Sbjct  123  PRATEILVVLEGTLYVGFVTSN---GDGNRLFTKVLNKGDVFVFPIGLIHFQLNVGYVNA  179



>ref|XP_009349816.1| PREDICTED: germin-like protein subfamily 1 member 13 [Pyrus x 
bretschneideri]
Length=228

 Score =   207 bits (527),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 109/164 (66%), Positives = 129/164 (79%), Gaps = 3/164 (2%)
 Frame = +3

Query  84   IAMVALAssfshasdpssLQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFLFRGLNMPG  263
            ++++A A+  + ASDP  LQDFCVA+N++++AVFVNGK CK+P    ANDF    L  PG
Sbjct  13   LSVLAFATLLAFASDPDPLQDFCVAINNTDSAVFVNGKFCKDPKLASANDFFSDKLRYPG  72

Query  264  NTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLYV  443
            NT NP+GS VT  NV+N+PGLNTLGIS  R+DFAPNGLNPPHTHPRATE+L+V+EG+LYV
Sbjct  73   NTLNPVGSIVTAANVDNIPGLNTLGISFARVDFAPNGLNPPHTHPRATEILIVVEGSLYV  132

Query  444  GFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNA  575
            GFV SN   G  N LFTK L  GDVFVFP GLIHFQ NVGKTNA
Sbjct  133  GFVTSN---GDGNRLFTKVLYKGDVFVFPIGLIHFQLNVGKTNA  173



>ref|XP_006375874.1| germin-like protein 1, partial [Populus trichocarpa]
 gb|ERP53671.1| germin-like protein 1, partial [Populus trichocarpa]
Length=199

 Score =   206 bits (524),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 107/147 (73%), Positives = 115/147 (78%), Gaps = 5/147 (3%)
 Frame = +3

Query  138  LQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFLFRGLNMPGNTSNPLGSKVTPVNVNNL  317
            LQDFCVA+ND+   VFVNGK CK+P     NDF F GLN+  NTSNP+GS VTP NV  +
Sbjct  2    LQDFCVAINDTKDGVFVNGKFCKDPKLATENDFFFPGLNIARNTSNPVGSVVTPANVAQI  61

Query  318  PGLNTLGISLVRIDFAP-NGLNPPHTHPRATEVLLVLEGTLYVGFVLSNPPPGMKNPLFT  494
            PGLNTLGISLVRID+AP  GLNPPHTHPRATE+L VLEGTLYVGFV SNP     N L T
Sbjct  62   PGLNTLGISLVRIDYAPYGGLNPPHTHPRATEILTVLEGTLYVGFVTSNP----DNRLIT  117

Query  495  KTLVAGDVFVFPEGLIHFQFNVGKTNA  575
            K L AGDVFVFP GLIHFQFNVGKT A
Sbjct  118  KVLNAGDVFVFPVGLIHFQFNVGKTKA  144



>gb|KCW61443.1| hypothetical protein EUGRSUZ_H04174 [Eucalyptus grandis]
Length=222

 Score =   206 bits (525),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 110/171 (64%), Positives = 132/171 (77%), Gaps = 4/171 (2%)
 Frame = +3

Query  63   LRFIVFVIAMVALAssfshasdpssLQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFLF  242
            ++F++    ++ALASS + ASDPS LQDFCVA+NDSN+AV VNGK CK+P   VA+DF F
Sbjct  1    MKFLL-TFVLLALASSHAFASDPSPLQDFCVAINDSNSAVLVNGKFCKDPKLAVADDFSF  59

Query  243  RGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLV  422
                 PGNTSNPLGSKVT   V+  PGLNTLGI++ R+DFAP GLNPPH HPR TE+L+V
Sbjct  60   TKFRYPGNTSNPLGSKVTTAFVDQFPGLNTLGITMARLDFAPYGLNPPHIHPRGTEMLVV  119

Query  423  LEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNA  575
            +EGTLYVGFV SN    + N LFTK L  GDVFVFP+GLIHFQ N+G+ NA
Sbjct  120  VEGTLYVGFVTSNQ---LNNTLFTKVLTKGDVFVFPQGLIHFQLNIGQANA  167



>gb|KCW61445.1| hypothetical protein EUGRSUZ_H04176 [Eucalyptus grandis]
Length=223

 Score =   206 bits (525),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 109/162 (67%), Positives = 124/162 (77%), Gaps = 3/162 (2%)
 Frame = +3

Query  90   MVALAssfshasdpssLQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFLFRGLNMPGNT  269
            ++ALA++ + A DPS LQD CVA+ND  +AVFVNG+ CK+P Q  A+DF F G+  PGNT
Sbjct  10   ILALATTTAFAYDPSPLQDICVAINDPKSAVFVNGEFCKDPKQANADDFTFMGVRKPGNT  69

Query  270  SNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLYVGF  449
            +NPLGSKVTP  VN  PGLNTLGIS  RIDFAP GLNPPHTHPR TEVL+V+EGTL VGF
Sbjct  70   ANPLGSKVTPATVNEFPGLNTLGISAARIDFAPGGLNPPHTHPRGTEVLVVIEGTLLVGF  129

Query  450  VLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNA  575
            V SN    + N LFTK L  GDVFVFP GLIHFQ N GKT A
Sbjct  130  VTSN---QLNNTLFTKVLYKGDVFVFPIGLIHFQLNTGKTPA  168



>ref|XP_010024915.1| PREDICTED: putative germin-like protein 2-1 [Eucalyptus grandis]
Length=223

 Score =   206 bits (525),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 110/171 (64%), Positives = 132/171 (77%), Gaps = 4/171 (2%)
 Frame = +3

Query  63   LRFIVFVIAMVALAssfshasdpssLQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFLF  242
            ++F++    ++ALASS + ASDPS LQDFCVA+NDSN+AV VNGK CK+P   VA+DF F
Sbjct  2    MKFLL-TFVLLALASSHAFASDPSPLQDFCVAINDSNSAVLVNGKFCKDPKLAVADDFSF  60

Query  243  RGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLV  422
                 PGNTSNPLGSKVT   V+  PGLNTLGI++ R+DFAP GLNPPH HPR TE+L+V
Sbjct  61   TKFRYPGNTSNPLGSKVTTAFVDQFPGLNTLGIAMARLDFAPYGLNPPHIHPRGTEMLVV  120

Query  423  LEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNA  575
            +EGTLYVGFV SN    + N LFTK L  GDVFVFP+GLIHFQ N+G+ NA
Sbjct  121  VEGTLYVGFVTSNQ---LNNTLFTKVLTKGDVFVFPQGLIHFQLNIGQANA  168



>gb|KCW61437.1| hypothetical protein EUGRSUZ_H04167 [Eucalyptus grandis]
Length=222

 Score =   206 bits (525),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 110/171 (64%), Positives = 132/171 (77%), Gaps = 4/171 (2%)
 Frame = +3

Query  63   LRFIVFVIAMVALAssfshasdpssLQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFLF  242
            ++F++    ++ALASS + ASDPS LQDFCVA+NDSN+AV VNGK CK+P   VA+DF F
Sbjct  1    MKFLL-TFVLLALASSHAFASDPSPLQDFCVAINDSNSAVLVNGKFCKDPKLAVADDFSF  59

Query  243  RGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLV  422
                 PGNTSNPLGSKVT   V+  PGLNTLGI++ R+DFAP GLNPPH HPR TE+L+V
Sbjct  60   TKFRYPGNTSNPLGSKVTTAFVDQFPGLNTLGIAMARLDFAPYGLNPPHIHPRGTEMLVV  119

Query  423  LEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNA  575
            +EGTLYVGFV SN    + N LFTK L  GDVFVFP+GLIHFQ N+G+ NA
Sbjct  120  VEGTLYVGFVTSNQ---LNNTLFTKVLTKGDVFVFPQGLIHFQLNIGQANA  167



>ref|XP_008351931.1| PREDICTED: germin-like protein subfamily 1 member 13 [Malus domestica]
Length=228

 Score =   206 bits (525),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 108/164 (66%), Positives = 129/164 (79%), Gaps = 3/164 (2%)
 Frame = +3

Query  84   IAMVALAssfshasdpssLQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFLFRGLNMPG  263
            ++++A A+  + ASDP  LQDFCVA+N++++AVFVNGK CK+P    ANDF    L  P 
Sbjct  13   LSVLAFATLLASASDPXPLQDFCVAINNTDSAVFVNGKFCKDPKLASANDFFSDKLRYPR  72

Query  264  NTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLYV  443
            NTSNP+GS VT  NV+++PGLNTLGIS  R+DFAPNGLNPPHTHPRATE+L+V+EG+LYV
Sbjct  73   NTSNPVGSIVTAANVDDIPGLNTLGISFARVDFAPNGLNPPHTHPRATEILIVVEGSLYV  132

Query  444  GFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNA  575
            GFV SN   G  N LFTK L  GDVFVFP GLIHFQ NVGKTNA
Sbjct  133  GFVTSN---GDGNRLFTKVLYKGDVFVFPIGLIHFQLNVGKTNA  173



>ref|XP_007201563.1| hypothetical protein PRUPE_ppa018105mg [Prunus persica]
 gb|EMJ02762.1| hypothetical protein PRUPE_ppa018105mg [Prunus persica]
Length=227

 Score =   206 bits (524),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 112/171 (65%), Positives = 130/171 (76%), Gaps = 3/171 (2%)
 Frame = +3

Query  63   LRFIVFVIAMVALAssfshasdpssLQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFLF  242
            + F++  +A++A A+    ASDPS LQDFCVA+ND+ +AVFVNGK CK+P    ANDF F
Sbjct  4    VHFLINTLAILAFATILVFASDPSPLQDFCVALNDTKSAVFVNGKFCKDPKLANANDFFF  63

Query  243  RGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLV  422
             GL +  +T NPLGS VT VNV+ + GLNTLGISL RIDFA NGLNPPHTHPRATE+LLV
Sbjct  64   SGLQIARSTQNPLGSTVTAVNVDQIAGLNTLGISLARIDFARNGLNPPHTHPRATEILLV  123

Query  423  LEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNA  575
            LEGTLYVGFV SN      N LFTK L  GDVFVFP GLIHFQ NVG+ +A
Sbjct  124  LEGTLYVGFVTSNAD---NNRLFTKVLNKGDVFVFPIGLIHFQLNVGEGDA  171



>ref|XP_002531992.1| Rhicadhesin receptor precursor, putative [Ricinus communis]
 gb|EEF30391.1| Rhicadhesin receptor precursor, putative [Ricinus communis]
Length=223

 Score =   206 bits (524),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 103/146 (71%), Positives = 116/146 (79%), Gaps = 5/146 (3%)
 Frame = +3

Query  138  LQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFLFRGLNMPGNTSNPLGSKVTPVNVNNL  317
            LQDFCVA +D   AVFVNGK+CK+P    ANDF F GLN+P +TSNP+GS VT +N + +
Sbjct  28   LQDFCVATDDPKDAVFVNGKLCKDPKLATANDFSFSGLNVPRDTSNPVGSNVTLLNADRI  87

Query  318  PGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLYVGFVLSNPPPGMKNPLFTK  497
            PGLNTLGISL RID+AP GLNPPHTHPRATE+L+VLEGTLYVGFV SNP     N L TK
Sbjct  88   PGLNTLGISLARIDYAPYGLNPPHTHPRATEILVVLEGTLYVGFVTSNP-----NRLITK  142

Query  498  TLVAGDVFVFPEGLIHFQFNVGKTNA  575
            TL  GDVFVFP G+IHFQFN G TNA
Sbjct  143  TLKPGDVFVFPIGMIHFQFNTGNTNA  168



>ref|XP_010042132.1| PREDICTED: germin-like protein subfamily 1 member 13 [Eucalyptus 
grandis]
Length=223

 Score =   206 bits (524),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 102/146 (70%), Positives = 112/146 (77%), Gaps = 3/146 (2%)
 Frame = +3

Query  138  LQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFLFRGLNMPGNTSNPLGSKVTPVNVNNL  317
            LQD CVA+ND  +AVFVNG+ CK+P Q  A+DF F G   PGNT+NPLGSKVTP  VN  
Sbjct  26   LQDICVAINDPKSAVFVNGEFCKDPKQATADDFTFMGFRNPGNTANPLGSKVTPATVNEF  85

Query  318  PGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLYVGFVLSNPPPGMKNPLFTK  497
            PGLNTLGIS+ RIDFAP GLNPPHTHPR TEVL+V+EGTL VGFV SN    + N LFTK
Sbjct  86   PGLNTLGISMARIDFAPGGLNPPHTHPRGTEVLVVIEGTLLVGFVTSN---QLNNTLFTK  142

Query  498  TLVAGDVFVFPEGLIHFQFNVGKTNA  575
             L  GDVFVFP GLIHFQ N GKT A
Sbjct  143  VLYKGDVFVFPIGLIHFQLNTGKTPA  168



>ref|XP_008443751.1| PREDICTED: germin-like protein subfamily 1 member 7 [Cucumis 
melo]
Length=223

 Score =   206 bits (524),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 102/146 (70%), Positives = 118/146 (81%), Gaps = 4/146 (3%)
 Frame = +3

Query  138  LQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFLFRGLNMPGNTSNPLGSKVTPVNVNNL  317
            LQDFCVA+ND+ + VF+NGK CK+P   VANDFLF+GLN+ GNT NP GS VT VNV+ L
Sbjct  26   LQDFCVAINDARSPVFLNGKFCKDPKYAVANDFLFQGLNIAGNTDNPNGSNVTLVNVDKL  85

Query  318  PGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLYVGFVLSNPPPGMKNPLFTK  497
            PGLNTLG+SL RID+AP GLNPPHTHPRATE+L+V+EG+L VGFV SNP     N  F+K
Sbjct  86   PGLNTLGVSLARIDYAPYGLNPPHTHPRATEILVVVEGSLLVGFVTSNP----DNKFFSK  141

Query  498  TLVAGDVFVFPEGLIHFQFNVGKTNA  575
             L  GDVFVFP GLIHFQFNVG+T A
Sbjct  142  VLYKGDVFVFPVGLIHFQFNVGRTPA  167



>ref|XP_009357348.1| PREDICTED: germin-like protein subfamily 1 member 13 [Pyrus x 
bretschneideri]
Length=226

 Score =   206 bits (524),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 104/146 (71%), Positives = 116/146 (79%), Gaps = 3/146 (2%)
 Frame = +3

Query  138  LQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFLFRGLNMPGNTSNPLGSKVTPVNVNNL  317
            LQDFCVA+N+++ AVFVNGK CKNP    ANDF    L  PGNTSNP+GS VT  NV+++
Sbjct  29   LQDFCVAINNTDPAVFVNGKFCKNPKLASANDFFSDKLRNPGNTSNPIGSIVTAANVDDI  88

Query  318  PGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLYVGFVLSNPPPGMKNPLFTK  497
            PGLNTLGIS  R+DFAPNGLNPPHTHPRATE+L+VLEG+LYVGFV SN      N LFTK
Sbjct  89   PGLNTLGISFARLDFAPNGLNPPHTHPRATEILIVLEGSLYVGFVTSN---ADGNRLFTK  145

Query  498  TLVAGDVFVFPEGLIHFQFNVGKTNA  575
             L  GDVFVFP GLIHFQ NVGKTNA
Sbjct  146  VLYKGDVFVFPVGLIHFQLNVGKTNA  171



>ref|XP_009355938.1| PREDICTED: germin-like protein subfamily 1 member 13 [Pyrus x 
bretschneideri]
Length=226

 Score =   206 bits (524),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 104/146 (71%), Positives = 116/146 (79%), Gaps = 3/146 (2%)
 Frame = +3

Query  138  LQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFLFRGLNMPGNTSNPLGSKVTPVNVNNL  317
            LQDFCVA+N+++ AVFVNGK CKNP    ANDF    L  PGNTSNP+GS VT  NV+++
Sbjct  29   LQDFCVAINNTDPAVFVNGKFCKNPKLASANDFFSDKLRNPGNTSNPIGSIVTAANVDDI  88

Query  318  PGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLYVGFVLSNPPPGMKNPLFTK  497
            PGLNTLGIS  R+DFAPNGLNPPHTHPRATE+L+VLEG+LYVGFV SN      N LFTK
Sbjct  89   PGLNTLGISFARLDFAPNGLNPPHTHPRATEILIVLEGSLYVGFVTSN---ADGNRLFTK  145

Query  498  TLVAGDVFVFPEGLIHFQFNVGKTNA  575
             L  GDVFVFP GLIHFQ NVGKTNA
Sbjct  146  VLYKGDVFVFPVGLIHFQLNVGKTNA  171



>ref|XP_008443754.1| PREDICTED: germin-like protein subfamily 1 member 17 [Cucumis 
melo]
Length=223

 Score =   206 bits (523),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 106/142 (75%), Positives = 115/142 (81%), Gaps = 5/142 (4%)
 Frame = +3

Query  138  LQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFLFRGLNMPGNTSNPLGSKVTPVNVNNL  317
            LQDFCVAV++  +AVFVNGK CKNP  V A DFLFRGLN+ GNT N  GS VT VNV+ L
Sbjct  31   LQDFCVAVDEPKSAVFVNGKFCKNPKFVRAEDFLFRGLNIAGNTMNKQGSNVTLVNVDRL  90

Query  318  PGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLYVGFVLSNPPPGMKNPLFTK  497
            PGLNTLGISL RID+APNGLNPPHTHPRATE+L+V+EGTL VGFV SNP     N LFTK
Sbjct  91   PGLNTLGISLARIDYAPNGLNPPHTHPRATEILVVVEGTLLVGFVTSNP-----NKLFTK  145

Query  498  TLVAGDVFVFPEGLIHFQFNVG  563
             L  GDVFVFP GLIHFQFNVG
Sbjct  146  VLNKGDVFVFPVGLIHFQFNVG  167



>ref|XP_008367619.1| PREDICTED: germin-like protein subfamily 1 member 13 [Malus domestica]
Length=228

 Score =   206 bits (523),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 108/165 (65%), Positives = 128/165 (78%), Gaps = 3/165 (2%)
 Frame = +3

Query  81   VIAMVALAssfshasdpssLQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFLFRGLNMP  260
             ++++A A+  + ASDP  LQDFCVA+N++++AVFVNGK CK+P    ANDF    L  P
Sbjct  12   ALSVLAFATLLASASDPGPLQDFCVAINNTDSAVFVNGKFCKDPKLASANDFFSDKLRYP  71

Query  261  GNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLY  440
             NTSNP+GS VT  NV+++PGLNTLGIS  R+DFAPNGLNPPHTHPRATE+L+V EG+LY
Sbjct  72   XNTSNPVGSIVTAANVDDIPGLNTLGISFARVDFAPNGLNPPHTHPRATEILIVXEGSLY  131

Query  441  VGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNA  575
            VGFV SN   G  N LFTK L  GDVFVFP GLIHFQ NVGKTNA
Sbjct  132  VGFVTSN---GDGNRLFTKVLYKGDVFVFPIGLIHFQLNVGKTNA  173



>gb|KCW61442.1| hypothetical protein EUGRSUZ_H04173, partial [Eucalyptus grandis]
Length=216

 Score =   205 bits (522),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 109/171 (64%), Positives = 129/171 (75%), Gaps = 5/171 (3%)
 Frame = +3

Query  63   LRFIVFVIAMVALAssfshasdpssLQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFLF  242
            ++F+   + ++ALA++ ++A DPS LQDFCVA+ND    VFVNGK CK+P QV A+DFLF
Sbjct  1    MKFLPISLLILALATATTYAYDPSPLQDFCVAINDPK--VFVNGKFCKDPKQVTADDFLF  58

Query  243  RGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLV  422
            +G   PGNT NPLGSKVTP  V+   GLNTLGIS+ RIDFAP GLNPPHTHPR TE+L+V
Sbjct  59   KGFRYPGNTVNPLGSKVTPAFVDQFAGLNTLGISMARIDFAPGGLNPPHTHPRGTEILVV  118

Query  423  LEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNA  575
             EGTL VGFV SN    + N  FTK L  GDVFVFP GLIHFQ N+GKT A
Sbjct  119  TEGTLLVGFVTSN---QLNNTFFTKVLYKGDVFVFPIGLIHFQLNIGKTPA  166



>ref|XP_008393483.1| PREDICTED: germin-like protein subfamily 1 member 13 [Malus domestica]
Length=228

 Score =   206 bits (523),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 107/164 (65%), Positives = 129/164 (79%), Gaps = 3/164 (2%)
 Frame = +3

Query  84   IAMVALAssfshasdpssLQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFLFRGLNMPG  263
            ++++A A+  + ASDP  LQDFCVA+N++++AVFVNGK CK+P    AN+F    L  P 
Sbjct  13   LSVLAFATLLASASDPDPLQDFCVAINNTDSAVFVNGKFCKDPKLASANBFFSDKLRYPR  72

Query  264  NTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLYV  443
            NTSNP+GS VT  NV+++PGLNTLGIS  R+DFAPNGLNPPHTHPRATE+L+V+EG+LYV
Sbjct  73   NTSNPVGSIVTAANVDDIPGLNTLGISFARVDFAPNGLNPPHTHPRATEILIVVEGSLYV  132

Query  444  GFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNA  575
            GFV SN   G  N LFTK L  GDVFVFP GLIHFQ NVGKTNA
Sbjct  133  GFVTSN---GDGNRLFTKVLYKGDVFVFPIGLIHFQLNVGKTNA  173



>gb|KCW76697.1| hypothetical protein EUGRSUZ_D01057 [Eucalyptus grandis]
Length=221

 Score =   205 bits (522),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 103/146 (71%), Positives = 114/146 (78%), Gaps = 5/146 (3%)
 Frame = +3

Query  138  LQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFLFRGLNMPGNTSNPLGSKVTPVNVNNL  317
            LQDFCVA+ND    VFVNGK CK+P Q+ A+DFLF+G   PGNT+NPLGSKVTP  V+  
Sbjct  26   LQDFCVAINDPE--VFVNGKFCKDPKQITADDFLFKGFRYPGNTANPLGSKVTPAFVDQF  83

Query  318  PGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLYVGFVLSNPPPGMKNPLFTK  497
            PGLNTLGIS+ RIDFAP GLNPPHTHPR TEVL+V EGTL VGFV SN    + N LFTK
Sbjct  84   PGLNTLGISMARIDFAPGGLNPPHTHPRGTEVLVVTEGTLLVGFVTSN---QLNNTLFTK  140

Query  498  TLVAGDVFVFPEGLIHFQFNVGKTNA  575
             L  GDVFVFP GLIHFQ N+GKT A
Sbjct  141  VLYKGDVFVFPIGLIHFQLNIGKTPA  166



>ref|NP_001268128.1| germin-like protein 5 [Vitis vinifera]
 gb|ABL60874.1| germin-like protein 5 [Vitis vinifera]
 emb|CBI39475.3| unnamed protein product [Vitis vinifera]
Length=207

 Score =   205 bits (521),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 103/146 (71%), Positives = 115/146 (79%), Gaps = 4/146 (3%)
 Frame = +3

Query  138  LQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFLFRGLNMPGNTSNPLGSKVTPVNVNNL  317
            LQD CVA++D  AAVFVNGK CKNP   VA DF F+GLN+PGNT NPLG  VT VNV+ +
Sbjct  16   LQDTCVAIDDPKAAVFVNGKFCKNPNLTVAEDFFFQGLNIPGNTENPLGFNVTTVNVDQI  75

Query  318  PGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLYVGFVLSNPPPGMKNPLFTK  497
            PGLNTLGISLVRID+AP G NPPHTHPR TE++ VLEGTLYVGFV SNP    +N L +K
Sbjct  76   PGLNTLGISLVRIDYAPYGQNPPHTHPRGTEIITVLEGTLYVGFVTSNP----ENRLISK  131

Query  498  TLVAGDVFVFPEGLIHFQFNVGKTNA  575
             L  GDV+VFP GLIHFQFNVG  NA
Sbjct  132  LLNKGDVYVFPIGLIHFQFNVGHANA  157



>ref|XP_008360941.1| PREDICTED: germin-like protein subfamily 1 member 17 [Malus domestica]
Length=228

 Score =   205 bits (522),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 103/146 (71%), Positives = 117/146 (80%), Gaps = 3/146 (2%)
 Frame = +3

Query  138  LQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFLFRGLNMPGNTSNPLGSKVTPVNVNNL  317
            LQDFCVA+N++++AVFVNGK CK+P    ANDF    L  PGNTSNP+GS VT  NV+ +
Sbjct  31   LQDFCVAINNTDSAVFVNGKFCKDPKLASANDFFSDKLRYPGNTSNPVGSIVTAANVDVI  90

Query  318  PGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLYVGFVLSNPPPGMKNPLFTK  497
            PGLNTLGIS  R+DFAPNGLNPPHTHPRATE+L+V+EG+LYVGFV SN   G  N LFTK
Sbjct  91   PGLNTLGISFARVDFAPNGLNPPHTHPRATEILIVVEGSLYVGFVTSN---GDGNRLFTK  147

Query  498  TLVAGDVFVFPEGLIHFQFNVGKTNA  575
             L  GDVFVFP GLIHFQ NVGKTNA
Sbjct  148  VLYKGDVFVFPIGLIHFQLNVGKTNA  173



>ref|XP_010052624.1| PREDICTED: germin-like protein subfamily 1 member 13 [Eucalyptus 
grandis]
 gb|KCW76696.1| hypothetical protein EUGRSUZ_D01056 [Eucalyptus grandis]
Length=223

 Score =   205 bits (522),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 101/146 (69%), Positives = 112/146 (77%), Gaps = 3/146 (2%)
 Frame = +3

Query  138  LQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFLFRGLNMPGNTSNPLGSKVTPVNVNNL  317
            LQD CVA+ND  +AVFVNG+ CK+P Q  A+DF F G   PGNT+NPLGSKVTP  VN  
Sbjct  26   LQDICVAINDPKSAVFVNGEFCKDPKQATADDFTFMGFRNPGNTANPLGSKVTPATVNEF  85

Query  318  PGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLYVGFVLSNPPPGMKNPLFTK  497
            PGLNTLGIS+ RIDFAP GLNPPHTHPR TEVL+++EGTL VGFV SN    + N LFTK
Sbjct  86   PGLNTLGISMARIDFAPGGLNPPHTHPRGTEVLVIIEGTLLVGFVTSN---QLNNTLFTK  142

Query  498  TLVAGDVFVFPEGLIHFQFNVGKTNA  575
             L  GDVFVFP GLIHFQ N GKT A
Sbjct  143  VLYKGDVFVFPIGLIHFQLNTGKTPA  168



>ref|XP_010027139.1| PREDICTED: germin-like protein subfamily 1 member 7 [Eucalyptus 
grandis]
Length=221

 Score =   205 bits (522),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 109/171 (64%), Positives = 129/171 (75%), Gaps = 5/171 (3%)
 Frame = +3

Query  63   LRFIVFVIAMVALAssfshasdpssLQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFLF  242
            ++F+   + ++ALA++ ++A DPS LQDFCVA+ND    VFVNGK CK+P QV A+DFLF
Sbjct  1    MKFLPISLLILALATATTYAYDPSPLQDFCVAINDPK--VFVNGKFCKDPKQVTADDFLF  58

Query  243  RGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLV  422
            +G   PGNT NPLGSKVTP  V+   GLNTLGIS+ RIDFAP GLNPPHTHPR TE+L+V
Sbjct  59   KGFRYPGNTVNPLGSKVTPAFVDQFAGLNTLGISMARIDFAPGGLNPPHTHPRGTEILVV  118

Query  423  LEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNA  575
             EGTL VGFV SN    + N  FTK L  GDVFVFP GLIHFQ N+GKT A
Sbjct  119  TEGTLLVGFVTSN---QLNNTFFTKVLYKGDVFVFPIGLIHFQLNIGKTPA  166



>gb|KCW44232.1| hypothetical protein EUGRSUZ_L02342, partial [Eucalyptus grandis]
Length=218

 Score =   205 bits (521),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 110/171 (64%), Positives = 132/171 (77%), Gaps = 4/171 (2%)
 Frame = +3

Query  63   LRFIVFVIAMVALAssfshasdpssLQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFLF  242
            ++F++    ++ALAS  + ASDPS LQDFCVAVND N+AVFVNGK CK+P  V+A+DF F
Sbjct  2    MKFLL-TFVLLALASCHAFASDPSPLQDFCVAVNDPNSAVFVNGKFCKDPKLVIADDFSF  60

Query  243  RGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLV  422
                 PG+TSNPLGSKVT   V+  PGLNTLGI+  R+DFAP GLNPPH HPR TE+LLV
Sbjct  61   TKFRYPGSTSNPLGSKVTTAFVDQFPGLNTLGIATARLDFAPYGLNPPHIHPRGTEMLLV  120

Query  423  LEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNA  575
            +EGTL+VGFV SN    + N LFTK L  GDVFVFP+GLIHFQ N+G+TNA
Sbjct  121  VEGTLHVGFVTSN---QLNNTLFTKVLTKGDVFVFPQGLIHFQLNIGQTNA  168



>gb|KCW61438.1| hypothetical protein EUGRSUZ_H04168 [Eucalyptus grandis]
Length=221

 Score =   205 bits (521),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 110/171 (64%), Positives = 129/171 (75%), Gaps = 5/171 (3%)
 Frame = +3

Query  63   LRFIVFVIAMVALAssfshasdpssLQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFLF  242
            ++F+   + ++ALA++ S A DPS LQDFCVA+ND    VFVNGK CK+P QV A+DFLF
Sbjct  1    MKFLPISLLILALATATSFAYDPSPLQDFCVAINDPK--VFVNGKFCKDPKQVTADDFLF  58

Query  243  RGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLV  422
            +G   PGNT NPLGSKVTP  V+ LPGLNTLGIS+ RIDFAP GLNPPHTHPR +E+L+V
Sbjct  59   KGFRYPGNTVNPLGSKVTPAFVDQLPGLNTLGISMARIDFAPGGLNPPHTHPRGSEILVV  118

Query  423  LEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNA  575
             EGTL VGFV  N    + N  FTK L  GDVFVFP GLIHFQ N+GKT A
Sbjct  119  AEGTLLVGFVTFN---QLNNTFFTKVLYKGDVFVFPIGLIHFQLNIGKTPA  166



>ref|XP_002276445.2| PREDICTED: uncharacterized protein LOC100254460 [Vitis vinifera]
Length=546

 Score =   214 bits (544),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 113/177 (64%), Positives = 133/177 (75%), Gaps = 5/177 (3%)
 Frame = +3

Query  45   NILDMALRFIVFVIAMVALAssfshasdpssLQDFCVAVNDSNAAVFVNGKICKNPMQVV  224
            N+  M    + +V+ ++A+A S + ASDPS LQDFCVAVND+N  VFVNGK C++P    
Sbjct  325  NMKKMGANTLTYVV-LLAMAFSVASASDPSPLQDFCVAVNDTNDTVFVNGKFCRDPKLAT  383

Query  225  ANDFLFRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRA  404
             NDF F GL +PGNTSN LGS VTP NV  +PGLNTLG+SL R+D+AP GLNPPH HPRA
Sbjct  384  PNDFFFSGLRLPGNTSNKLGSMVTPANVAQIPGLNTLGVSLARVDYAPYGLNPPHIHPRA  443

Query  405  TEVLLVLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNA  575
            TE+L VLEGTLYVGFV SNP    +N L +K L  GDVFVFP+GLIHFQ NVG TNA
Sbjct  444  TEILTVLEGTLYVGFVTSNP----ENRLISKVLYKGDVFVFPQGLIHFQLNVGTTNA  496


 Score =   207 bits (528),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 109/164 (66%), Positives = 126/164 (77%), Gaps = 4/164 (2%)
 Frame = +3

Query  84   IAMVALAssfshasdpssLQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFLFRGLNMPG  263
            I ++A+A S + ASDPS LQDFCVAVND+N +VFV+GK CK+P     N+F F GL +PG
Sbjct  12   IVLLAVAFSVASASDPSPLQDFCVAVNDTNDSVFVSGKFCKDPKLATPNNFFFSGLRLPG  71

Query  264  NTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLYV  443
            NTSN LGS VTP NV  +PGLNTLG+SL R+D+A  GLNPPH HPRATE+L VLEGTLYV
Sbjct  72   NTSNKLGSMVTPANVEQIPGLNTLGVSLARVDYAAYGLNPPHIHPRATEILTVLEGTLYV  131

Query  444  GFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNA  575
            GFV SNP     N L +K L  GDVFVFP+GLIHFQ NVG TNA
Sbjct  132  GFVTSNP----DNSLISKVLYKGDVFVFPQGLIHFQLNVGTTNA  171



>ref|XP_010041604.1| PREDICTED: germin-like protein subfamily 1 member 13 [Eucalyptus 
grandis]
Length=223

 Score =   205 bits (521),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 110/171 (64%), Positives = 132/171 (77%), Gaps = 4/171 (2%)
 Frame = +3

Query  63   LRFIVFVIAMVALAssfshasdpssLQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFLF  242
            ++F++    ++ALAS  + ASDPS LQDFCVAVND N+AVFVNGK CK+P  V+A+DF F
Sbjct  2    MKFLL-TFVLLALASCHAFASDPSPLQDFCVAVNDPNSAVFVNGKFCKDPKLVIADDFSF  60

Query  243  RGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLV  422
                 PG+TSNPLGSKVT   V+  PGLNTLGI+  R+DFAP GLNPPH HPR TE+LLV
Sbjct  61   TKFRYPGSTSNPLGSKVTTAFVDQFPGLNTLGIATARLDFAPYGLNPPHIHPRGTEMLLV  120

Query  423  LEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNA  575
            +EGTL+VGFV SN    + N LFTK L  GDVFVFP+GLIHFQ N+G+TNA
Sbjct  121  VEGTLHVGFVTSN---QLNNTLFTKVLTKGDVFVFPQGLIHFQLNIGQTNA  168



>ref|XP_007030270.1| Germin-like protein subfamily 1 member 18 [Theobroma cacao]
 gb|EOY10772.1| Germin-like protein subfamily 1 member 18 [Theobroma cacao]
Length=329

 Score =   208 bits (529),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 114/169 (67%), Positives = 128/169 (76%), Gaps = 5/169 (3%)
 Frame = +3

Query  72   IVFVIAMVALAssfshasdpssLQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFLFRGL  251
            I+    ++AL SS + ASDPS LQDFCVA+ND+   VFVNGK CK+P    A+DF F GL
Sbjct  83   ILVAFVLLALVSSLASASDPSPLQDFCVAINDAKNGVFVNGKFCKDPKLANADDFFFSGL  142

Query  252  NMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAP-NGLNPPHTHPRATEVLLVLE  428
            N  GNTSN LGSKVTPVNV  +PGLNTLGIS  R+D+AP  GLNPPHTHPRATE+L+V+E
Sbjct  143  NKQGNTSNQLGSKVTPVNVEQIPGLNTLGISFARVDYAPYGGLNPPHTHPRATEILVVVE  202

Query  429  GTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNA  575
            GTLYVGFV SNP     N L TK L  GDVFVFP GLIHFQFN G TNA
Sbjct  203  GTLYVGFVTSNP----DNRLITKVLYPGDVFVFPVGLIHFQFNKGNTNA  247



>ref|XP_010066342.1| PREDICTED: germin-like protein subfamily 1 member 13 [Eucalyptus 
grandis]
Length=223

 Score =   204 bits (520),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 110/171 (64%), Positives = 132/171 (77%), Gaps = 4/171 (2%)
 Frame = +3

Query  63   LRFIVFVIAMVALAssfshasdpssLQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFLF  242
            ++F++    ++ALAS  + ASDPS LQDFCVAVND N+AVFVNGK CK+P  V+A+DF F
Sbjct  2    MKFLL-TFVLLALASCHAFASDPSPLQDFCVAVNDPNSAVFVNGKFCKDPKLVIADDFSF  60

Query  243  RGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLV  422
                 PG+TSNPLGSKVT   V+  PGLNTLGI+  R+DFAP GLNPPH HPR TE+LLV
Sbjct  61   TKFRYPGSTSNPLGSKVTTAFVDQFPGLNTLGIATARLDFAPYGLNPPHIHPRGTEMLLV  120

Query  423  LEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNA  575
            +EGTL+VGFV SN    + N LFTK L  GDVFVFP+GLIHFQ N+G+TNA
Sbjct  121  VEGTLHVGFVTSN---QLNNTLFTKVLTKGDVFVFPQGLIHFQLNIGQTNA  168



>ref|XP_010024914.1| PREDICTED: putative germin-like protein 2-1 [Eucalyptus grandis]
 gb|KCW61439.1| hypothetical protein EUGRSUZ_H04169 [Eucalyptus grandis]
Length=222

 Score =   204 bits (520),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 109/171 (64%), Positives = 131/171 (77%), Gaps = 4/171 (2%)
 Frame = +3

Query  63   LRFIVFVIAMVALAssfshasdpssLQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFLF  242
            ++F++    ++ALASS + ASDPS LQDFCVA+NDSN+AV VNGK CK+P   VA+DF F
Sbjct  1    MKFLL-TFVLLALASSHAFASDPSPLQDFCVAINDSNSAVLVNGKFCKDPKLAVADDFSF  59

Query  243  RGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLV  422
                 PGNTSNPLGSKVT   V+  PGLNTLGI++ R+DFAP GLNPPH HPR TE+L+V
Sbjct  60   TKFRYPGNTSNPLGSKVTTAFVDQFPGLNTLGIAMARLDFAPYGLNPPHIHPRGTEMLVV  119

Query  423  LEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNA  575
            +EGTLYVGFV SN    + N L TK L  GDVFVFP+GLIHFQ N+G+ NA
Sbjct  120  MEGTLYVGFVTSNQ---LNNTLLTKVLTKGDVFVFPQGLIHFQLNIGQANA  167



>ref|NP_001237300.1| uncharacterized protein LOC100527781 precursor [Glycine max]
 gb|ACG69488.1| germin-like protein 12 [Glycine max]
 gb|ACU16953.1| unknown [Glycine max]
 gb|KHN04964.1| Germin-like protein subfamily 1 member 7 [Glycine soja]
Length=222

 Score =   204 bits (520),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 114/171 (67%), Positives = 128/171 (75%), Gaps = 4/171 (2%)
 Frame = +3

Query  63   LRFIVFVIAMVALAssfshasdpssLQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFLF  242
            ++ + F + ++ALASS + A DPS LQDFCVA+ND+   VFVNGK CK+P    A DF F
Sbjct  1    MKVVYFFVVLLALASSIAFAYDPSPLQDFCVAINDTKTGVFVNGKFCKDPKLAKAEDFFF  60

Query  243  RGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLV  422
             GL  PGNTSNPLGSKVT V VN + GLNTLGISL RIDFAP GLNPPHTHPR TE+L+V
Sbjct  61   PGLG-PGNTSNPLGSKVTAVTVNEILGLNTLGISLARIDFAPKGLNPPHTHPRGTEILVV  119

Query  423  LEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNA  575
            LEGTLYVGFV SN      N LFTK L  GDVFVFP GLIHFQ N+G  NA
Sbjct  120  LEGTLYVGFVASNQ---NDNRLFTKVLNKGDVFVFPIGLIHFQQNIGYGNA  167



>ref|XP_010048221.1| PREDICTED: germin-like protein subfamily 1 member 13 [Eucalyptus 
grandis]
 gb|KCW80406.1| hypothetical protein EUGRSUZ_C01763 [Eucalyptus grandis]
Length=223

 Score =   204 bits (520),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 101/146 (69%), Positives = 112/146 (77%), Gaps = 3/146 (2%)
 Frame = +3

Query  138  LQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFLFRGLNMPGNTSNPLGSKVTPVNVNNL  317
            LQD CVA+ND  +AVFVNG+ CK+P Q  A+DF F G   PGNT+NPLGSKVTP  VN  
Sbjct  26   LQDICVAINDPKSAVFVNGEFCKDPKQATADDFTFMGFRNPGNTANPLGSKVTPATVNEF  85

Query  318  PGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLYVGFVLSNPPPGMKNPLFTK  497
            PGLNTLGIS+ R+DFAP GLNPPHTHPR TEVL+V+EGTL VGFV SN    + N LFTK
Sbjct  86   PGLNTLGISMARLDFAPGGLNPPHTHPRGTEVLVVIEGTLLVGFVTSN---QLNNTLFTK  142

Query  498  TLVAGDVFVFPEGLIHFQFNVGKTNA  575
             L  GDVFVFP GLIHFQ N GKT A
Sbjct  143  VLYKGDVFVFPIGLIHFQLNTGKTPA  168



>ref|XP_004142552.1| PREDICTED: germin-like protein subfamily 1 member 17-like [Cucumis 
sativus]
 ref|XP_004155680.1| PREDICTED: germin-like protein subfamily 1 member 17-like [Cucumis 
sativus]
 gb|KGN66715.1| Rhicadhesin receptor [Cucumis sativus]
Length=224

 Score =   204 bits (520),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 106/146 (73%), Positives = 116/146 (79%), Gaps = 5/146 (3%)
 Frame = +3

Query  138  LQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFLFRGLNMPGNTSNPLGSKVTPVNVNNL  317
            LQDFCVA ++ N+AVFVNGK CKNP  V A DFLFRGLN+ GNT N  GS VT VNV+ L
Sbjct  32   LQDFCVAADEPNSAVFVNGKFCKNPKLVRAEDFLFRGLNIAGNTMNKQGSNVTLVNVDRL  91

Query  318  PGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLYVGFVLSNPPPGMKNPLFTK  497
            PGLNTLGISL RID+AP GLNPPHTHPRATE+L+V+EGTL VGFV SNP     N LFTK
Sbjct  92   PGLNTLGISLARIDYAPYGLNPPHTHPRATEILVVVEGTLLVGFVTSNP-----NKLFTK  146

Query  498  TLVAGDVFVFPEGLIHFQFNVGKTNA  575
             L  GDVFVFP GLIHFQFNVG + A
Sbjct  147  VLNKGDVFVFPIGLIHFQFNVGHSPA  172



>gb|KCW61436.1| hypothetical protein EUGRSUZ_H04166, partial [Eucalyptus grandis]
Length=216

 Score =   204 bits (519),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 108/171 (63%), Positives = 128/171 (75%), Gaps = 5/171 (3%)
 Frame = +3

Query  63   LRFIVFVIAMVALAssfshasdpssLQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFLF  242
            ++F+   + ++ALA++ + A DPS LQDFCVA+ND    VFVNGK CK+P QV A+DFLF
Sbjct  1    MKFLPISLLILALATATTFAYDPSPLQDFCVAINDPK--VFVNGKFCKDPKQVTADDFLF  58

Query  243  RGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLV  422
            +G   PGNT+NPLGSKVTP  V+   GLNTLGIS+ R DFAP GLNPPHTHPR TE+L+V
Sbjct  59   KGFRYPGNTANPLGSKVTPAFVDQFAGLNTLGISMARTDFAPGGLNPPHTHPRGTEILVV  118

Query  423  LEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNA  575
             EGTL VGFV SN    + N  FTK L  GDVFVFP GLIHFQ N+GKT A
Sbjct  119  TEGTLLVGFVTSN---QLNNTFFTKVLYKGDVFVFPIGLIHFQLNIGKTPA  166



>ref|XP_007143989.1| hypothetical protein PHAVU_007G119700g [Phaseolus vulgaris]
 gb|ESW15983.1| hypothetical protein PHAVU_007G119700g [Phaseolus vulgaris]
Length=224

 Score =   204 bits (520),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 113/171 (66%), Positives = 131/171 (77%), Gaps = 4/171 (2%)
 Frame = +3

Query  63   LRFIVFVIAMVALAssfshasdpssLQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFLF  242
            ++ + F++ ++ALASS + A DPS LQDFCVA+ND+   VFVNGK CK+P    A+DF F
Sbjct  1    MKVVQFLVVLLALASSVAFAYDPSPLQDFCVAINDTKTGVFVNGKFCKDPKFANADDFFF  60

Query  243  RGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLV  422
            RGL   G+T+NP+GSKVTPV VN + GLNTLGISL RIDFAP GLNPPHTHPR TE+L+V
Sbjct  61   RGLGA-GDTANPVGSKVTPVAVNEILGLNTLGISLARIDFAPKGLNPPHTHPRGTEILVV  119

Query  423  LEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNA  575
            LEGTLYVGFV SN      N LFTK L  GDVFVFP GLIHFQ NVG  NA
Sbjct  120  LEGTLYVGFVASNQ---NDNRLFTKVLNKGDVFVFPIGLIHFQQNVGYGNA  167



>ref|XP_006375870.1| germin-like protein 1 [Populus trichocarpa]
 gb|ERP53667.1| germin-like protein 1 [Populus trichocarpa]
Length=225

 Score =   204 bits (520),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 106/147 (72%), Positives = 114/147 (78%), Gaps = 5/147 (3%)
 Frame = +3

Query  138  LQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFLFRGLNMPGNTSNPLGSKVTPVNVNNL  317
            LQDFCVA+ND+   VFVNGK CK+P     NDF F GLN+  NTSNP+GS VTP NV  +
Sbjct  28   LQDFCVAINDTKDGVFVNGKFCKDPKLATENDFFFPGLNIARNTSNPVGSVVTPANVAQI  87

Query  318  PGLNTLGISLVRIDFAP-NGLNPPHTHPRATEVLLVLEGTLYVGFVLSNPPPGMKNPLFT  494
            PGLNTLGISLVRID+AP  GLNPPHTHPRATE+L VLEGTLYVGFV SNP     N L T
Sbjct  88   PGLNTLGISLVRIDYAPYGGLNPPHTHPRATEILTVLEGTLYVGFVTSNP----DNRLIT  143

Query  495  KTLVAGDVFVFPEGLIHFQFNVGKTNA  575
            K L  GDVFVFP GLIHFQFNVGKT A
Sbjct  144  KVLHPGDVFVFPVGLIHFQFNVGKTKA  170



>ref|XP_008393482.1| PREDICTED: germin-like protein subfamily 1 member 13 [Malus domestica]
 ref|XP_008351930.1| PREDICTED: germin-like protein subfamily 1 member 13 [Malus domestica]
Length=230

 Score =   204 bits (520),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 109/164 (66%), Positives = 127/164 (77%), Gaps = 1/164 (1%)
 Frame = +3

Query  84   IAMVALAssfshasdpssLQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFLFRGLNMPG  263
            ++++A A+  + ASDP  LQDFCVA+N+++ AVFVNGK CK+P    ANDF    L  PG
Sbjct  13   LSVLAFATLLASASDPGPLQDFCVAINNTDYAVFVNGKFCKDPNLASANDFFTDKLRYPG  72

Query  264  NTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLYV  443
            NTSNP+GS VT  NV+ +PGLNTLGIS  R+DFAPNGLNPPHTHPRATE+ +VLEG+LYV
Sbjct  73   NTSNPVGSIVTAANVDVIPGLNTLGISFARVDFAPNGLNPPHTHPRATEIFIVLEGSLYV  132

Query  444  GFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNA  575
            GFV SN   G  N LFTK L  GDVFVFP GLIHFQ NVGKTNA
Sbjct  133  GFVTSN-IEGDGNRLFTKVLYKGDVFVFPFGLIHFQLNVGKTNA  175



>ref|XP_010024919.1| PREDICTED: germin-like protein subfamily 1 member 13 [Eucalyptus 
grandis]
 ref|XP_010042113.1| PREDICTED: germin-like protein subfamily 1 member 13 [Eucalyptus 
grandis]
 gb|KCW61458.1| hypothetical protein EUGRSUZ_H04194 [Eucalyptus grandis]
Length=223

 Score =   204 bits (518),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 102/146 (70%), Positives = 111/146 (76%), Gaps = 3/146 (2%)
 Frame = +3

Query  138  LQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFLFRGLNMPGNTSNPLGSKVTPVNVNNL  317
            LQD CVA+ND  +AVFVNG+ CK+P Q  A+DF F G   PGNT+NPLGSKVTP  VN  
Sbjct  26   LQDICVAINDPKSAVFVNGEFCKDPKQANADDFTFMGFRKPGNTANPLGSKVTPATVNEF  85

Query  318  PGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLYVGFVLSNPPPGMKNPLFTK  497
            PGLNTLGIS  RIDFAP GLNPPHTHPR TEVL+V+EGTL VGFV SN    + N LFTK
Sbjct  86   PGLNTLGISAARIDFAPGGLNPPHTHPRGTEVLVVIEGTLLVGFVTSN---QLNNTLFTK  142

Query  498  TLVAGDVFVFPEGLIHFQFNVGKTNA  575
             L  GDVFVFP GLIHFQ N GKT A
Sbjct  143  VLYKGDVFVFPIGLIHFQLNTGKTPA  168



>gb|KCW61456.1| hypothetical protein EUGRSUZ_H04192 [Eucalyptus grandis]
Length=223

 Score =   204 bits (518),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 102/146 (70%), Positives = 111/146 (76%), Gaps = 3/146 (2%)
 Frame = +3

Query  138  LQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFLFRGLNMPGNTSNPLGSKVTPVNVNNL  317
            LQD CVA+ND  +AVFVNG+ CK+P Q  A+DF F G   PGNT+NPLGSKVTP  VN  
Sbjct  26   LQDICVAINDPKSAVFVNGEFCKDPKQANADDFTFMGFRKPGNTANPLGSKVTPATVNEF  85

Query  318  PGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLYVGFVLSNPPPGMKNPLFTK  497
            PGLNTLGIS  RIDFAP GLNPPHTHPR TEVL+V+EGTL VGFV SN    + N LFTK
Sbjct  86   PGLNTLGISAARIDFAPGGLNPPHTHPRGTEVLVVIEGTLLVGFVTSN---QLNNTLFTK  142

Query  498  TLVAGDVFVFPEGLIHFQFNVGKTNA  575
             L  GDVFVFP GLIHFQ N GKT A
Sbjct  143  VLYKGDVFVFPIGLIHFQLNTGKTPA  168



>ref|XP_010024918.1| PREDICTED: germin-like protein subfamily 1 member 13 [Eucalyptus 
grandis]
 gb|KCW61457.1| hypothetical protein EUGRSUZ_H04193 [Eucalyptus grandis]
Length=223

 Score =   204 bits (518),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 102/146 (70%), Positives = 111/146 (76%), Gaps = 3/146 (2%)
 Frame = +3

Query  138  LQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFLFRGLNMPGNTSNPLGSKVTPVNVNNL  317
            LQD CVA+ND  +AVFVNG+ CK+P Q  A+DF F G   PGNT+NPLGSKVTP  VN  
Sbjct  26   LQDICVAINDPKSAVFVNGEFCKDPKQANADDFTFMGFRKPGNTANPLGSKVTPATVNEF  85

Query  318  PGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLYVGFVLSNPPPGMKNPLFTK  497
            PGLNTLGIS  RIDFAP GLNPPHTHPR TEVL+V+EGTL VGFV SN    + N LFTK
Sbjct  86   PGLNTLGISAARIDFAPGGLNPPHTHPRGTEVLVVIEGTLLVGFVTSN---QLNNTLFTK  142

Query  498  TLVAGDVFVFPEGLIHFQFNVGKTNA  575
             L  GDVFVFP GLIHFQ N GKT A
Sbjct  143  VLYKGDVFVFPIGLIHFQLNTGKTPA  168



>ref|XP_002319674.2| hypothetical protein POPTR_0013s04920g [Populus trichocarpa]
 gb|EEE95597.2| hypothetical protein POPTR_0013s04920g [Populus trichocarpa]
Length=225

 Score =   204 bits (518),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 106/147 (72%), Positives = 114/147 (78%), Gaps = 5/147 (3%)
 Frame = +3

Query  138  LQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFLFRGLNMPGNTSNPLGSKVTPVNVNNL  317
            LQDFCVA+ND+   VFVNGK CK+P     NDF F GLN+  NTSNP+GS VTP NV  +
Sbjct  28   LQDFCVAINDTKDGVFVNGKFCKDPKLATENDFFFPGLNIARNTSNPVGSVVTPANVAQI  87

Query  318  PGLNTLGISLVRIDFAP-NGLNPPHTHPRATEVLLVLEGTLYVGFVLSNPPPGMKNPLFT  494
            PGLNTLGISLVRID+AP  GLNPPHTHPRATE+L VLEGTLYVGFV SNP     N L T
Sbjct  88   PGLNTLGISLVRIDYAPYGGLNPPHTHPRATEILTVLEGTLYVGFVTSNP----DNRLIT  143

Query  495  KTLVAGDVFVFPEGLIHFQFNVGKTNA  575
            K L  GDVFVFP GLIHFQFNVGKT A
Sbjct  144  KVLNPGDVFVFPIGLIHFQFNVGKTKA  170



>ref|XP_010024920.1| PREDICTED: germin-like protein subfamily 1 member 13 [Eucalyptus 
grandis]
 gb|KCW61459.1| hypothetical protein EUGRSUZ_H04195 [Eucalyptus grandis]
Length=223

 Score =   204 bits (518),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 107/171 (63%), Positives = 127/171 (74%), Gaps = 3/171 (2%)
 Frame = +3

Query  63   LRFIVFVIAMVALAssfshasdpssLQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFLF  242
            ++F+   + ++AL ++ + A DPS LQD CVA+ND  +AVFVNG+ CK+P Q  A+DF F
Sbjct  1    MKFLPISLLILALVAATAFAYDPSPLQDICVAINDPKSAVFVNGEFCKDPKQANADDFTF  60

Query  243  RGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLV  422
             G   PGNT+NPLGSKVTP  V   PGLNTLGIS+ RIDFAP+GLNPPH HPR TEVL+V
Sbjct  61   MGFRKPGNTANPLGSKVTPATVMEFPGLNTLGISMARIDFAPSGLNPPHIHPRGTEVLVV  120

Query  423  LEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNA  575
            +EGTL VGFV SN    + N LFTK L  GDVFVFP GLIHFQ N GKT A
Sbjct  121  IEGTLLVGFVTSN---QLNNTLFTKVLYKGDVFVFPIGLIHFQLNTGKTPA  168



>ref|XP_010041605.1| PREDICTED: germin-like protein subfamily 1 member 7 [Eucalyptus 
grandis]
Length=221

 Score =   203 bits (517),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 102/146 (70%), Positives = 112/146 (77%), Gaps = 5/146 (3%)
 Frame = +3

Query  138  LQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFLFRGLNMPGNTSNPLGSKVTPVNVNNL  317
            LQDFCVA+ND    VFVNGK CK+P QV A DFLF+G   PGNT+NPLGSKVTP  V+  
Sbjct  26   LQDFCVAINDPK--VFVNGKFCKDPKQVTAEDFLFKGFRYPGNTANPLGSKVTPAFVDQF  83

Query  318  PGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLYVGFVLSNPPPGMKNPLFTK  497
            PGLNTLGIS+ RIDFAP GLNPPHTHPR TE+L+V EGTL VGFV SN    + N  FTK
Sbjct  84   PGLNTLGISMARIDFAPGGLNPPHTHPRGTEILVVAEGTLLVGFVTSN---QLNNTFFTK  140

Query  498  TLVAGDVFVFPEGLIHFQFNVGKTNA  575
             L  GDVFVFP GLIHFQ N+GKT A
Sbjct  141  VLYKGDVFVFPIGLIHFQLNIGKTPA  166



>ref|XP_007030284.1| RmlC-like cupins superfamily protein [Theobroma cacao]
 gb|EOY10786.1| RmlC-like cupins superfamily protein [Theobroma cacao]
Length=226

 Score =   204 bits (518),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 111/164 (68%), Positives = 126/164 (77%), Gaps = 5/164 (3%)
 Frame = +3

Query  87   AMVALAssfshasdpssLQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFLFRGLNMPGN  266
            A +A A S + ASDPS LQDFCVA+ND+   VFVNGK C++P    A DF + GLN+P N
Sbjct  12   AFLAFAWSLASASDPSPLQDFCVAINDTKDGVFVNGKFCQDPKLAKAEDFFYSGLNIPRN  71

Query  267  TSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAP-NGLNPPHTHPRATEVLLVLEGTLYV  443
            TSNPLGS VT VNV  + GLNTLGISL RID+AP  GLNPPHTHPRA+E+L+VLEGTLYV
Sbjct  72   TSNPLGSTVTQVNVAQILGLNTLGISLARIDYAPYGGLNPPHTHPRASEILVVLEGTLYV  131

Query  444  GFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNA  575
            GFV SNP    +N L TK L  GDVFVFP GLIHFQ N+GKTNA
Sbjct  132  GFVTSNP----ENRLITKVLYPGDVFVFPVGLIHFQLNIGKTNA  171



>ref|XP_008237525.1| PREDICTED: germin-like protein subfamily 1 member 18 [Prunus 
mume]
Length=234

 Score =   204 bits (518),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 115/180 (64%), Positives = 132/180 (73%), Gaps = 11/180 (6%)
 Frame = +3

Query  60   ALRFIVFVIAMVALAssfshasdpssLQDFCVAVNDSNAA--------VFVNGKICKNPM  215
             + F++  +A++A A+    ASDPS LQDFCVA++D+ +A        VFVNGK CK+P 
Sbjct  3    GVHFLISTLAILASATFLVSASDPSPLQDFCVALDDTKSAGGYFGAGAVFVNGKFCKDPK  62

Query  216  QVVANDFLFRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTH  395
             V ANDF F GL  P NT NPLGS VT VNV+ + GLNTLGISL RIDFAPNGLNPPHTH
Sbjct  63   LVNANDFFFSGLQNPRNTQNPLGSNVTTVNVDQIAGLNTLGISLTRIDFAPNGLNPPHTH  122

Query  396  PRATEVLLVLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNA  575
            PRA+E L+VLEG+LYVGFV SN   G  N LFTK L  GDVFVFP GLIHFQFNVG  NA
Sbjct  123  PRASEFLVVLEGSLYVGFVTSN---GDGNRLFTKVLNKGDVFVFPIGLIHFQFNVGHVNA  179



>ref|XP_010050157.1| PREDICTED: germin-like protein subfamily 1 member 13 [Eucalyptus 
grandis]
 gb|KCW89287.1| hypothetical protein EUGRSUZ_A01577 [Eucalyptus grandis]
Length=223

 Score =   203 bits (517),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 107/162 (66%), Positives = 122/162 (75%), Gaps = 3/162 (2%)
 Frame = +3

Query  90   MVALAssfshasdpssLQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFLFRGLNMPGNT  269
            ++ALA+  + A DPS LQD CVA ND N+ VFVNGK CK+P Q  A+DFLF G   PGNT
Sbjct  10   ILALATVTAFAYDPSPLQDICVATNDLNSGVFVNGKFCKDPKQATADDFLFMGFRNPGNT  69

Query  270  SNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLYVGF  449
            +NPLGSKVTP  V+  PGLNTLGIS+ R+DFAP GLNPPHTHPR TEVL+V+EGTL VGF
Sbjct  70   TNPLGSKVTPAFVDQFPGLNTLGISMARLDFAPGGLNPPHTHPRGTEVLVVVEGTLLVGF  129

Query  450  VLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNA  575
            + SN    + N LFTK L  GDVFVFP GLIHFQ N G T A
Sbjct  130  ITSNQ---LNNTLFTKVLYKGDVFVFPIGLIHFQLNCGNTYA  168



>ref|XP_007030280.1| RmlC-like cupins superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY10782.1| RmlC-like cupins superfamily protein isoform 1 [Theobroma cacao]
Length=226

 Score =   203 bits (517),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 110/164 (67%), Positives = 125/164 (76%), Gaps = 5/164 (3%)
 Frame = +3

Query  87   AMVALAssfshasdpssLQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFLFRGLNMPGN  266
            A +A A S + ASDP  LQDFCVA+ND+   VFVNGK CK+P    A DF + GLN+P N
Sbjct  12   AFLAFAWSLASASDPDPLQDFCVAINDTKDGVFVNGKFCKDPKLAKAEDFFYSGLNIPRN  71

Query  267  TSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAP-NGLNPPHTHPRATEVLLVLEGTLYV  443
            TSNP+GS VT VNV  + GLNTLGISL RID+AP  GLNPPHTHPRA+E+L+VLEGTLYV
Sbjct  72   TSNPVGSTVTQVNVAQILGLNTLGISLARIDYAPYGGLNPPHTHPRASEILVVLEGTLYV  131

Query  444  GFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNA  575
            GFV SNP    +N L TK L  GDVFVFP GLIHFQ N+GKTNA
Sbjct  132  GFVTSNP----ENRLITKVLYPGDVFVFPVGLIHFQLNIGKTNA  171



>ref|XP_011002009.1| PREDICTED: germin-like protein subfamily 1 member 13 [Populus 
euphratica]
Length=225

 Score =   203 bits (517),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 113/174 (65%), Positives = 133/174 (76%), Gaps = 7/174 (4%)
 Frame = +3

Query  63   LRFIVFVIAMV--ALAssfshasdpssLQDFCVAVNDSNAAVFVNGKICKNPMQVVANDF  236
            +R + F++A V   LASS + A DPS LQDFCVA+ND  AAVFVNGK CK+P    ANDF
Sbjct  1    MRSVHFLLAFVLLTLASSIASAYDPSPLQDFCVAINDPKAAVFVNGKFCKDPKMATANDF  60

Query  237  LFRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPN-GLNPPHTHPRATEV  413
             F GLN+P +T NP+GS VT +NV+ +PGLNTLGISL RID+APN GLNPPHTHPRATE+
Sbjct  61   SFSGLNIPRDTGNPVGSNVTLLNVDQIPGLNTLGISLARIDYAPNGGLNPPHTHPRATEI  120

Query  414  LLVLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNA  575
            L+V+EGTLYVGFV SNP    +N   +K L  GDVFVFP GLIHFQ N+ KT A
Sbjct  121  LVVVEGTLYVGFVTSNP----ENRFISKVLYPGDVFVFPFGLIHFQLNIAKTPA  170



>gb|KCW64218.1| hypothetical protein EUGRSUZ_G01868, partial [Eucalyptus grandis]
 gb|KCW64219.1| hypothetical protein EUGRSUZ_G01869, partial [Eucalyptus grandis]
 gb|KCW64222.1| hypothetical protein EUGRSUZ_G01872, partial [Eucalyptus grandis]
 gb|KCW64223.1| hypothetical protein EUGRSUZ_G01873, partial [Eucalyptus grandis]
Length=216

 Score =   203 bits (516),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 101/146 (69%), Positives = 112/146 (77%), Gaps = 5/146 (3%)
 Frame = +3

Query  138  LQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFLFRGLNMPGNTSNPLGSKVTPVNVNNL  317
            LQDFCVA+ND    VFVNGK CK+P QV A DFLF+G   PGNT+NPLGSKVTP  V+  
Sbjct  26   LQDFCVAINDPK--VFVNGKFCKDPKQVTAEDFLFKGFRYPGNTANPLGSKVTPAFVDQF  83

Query  318  PGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLYVGFVLSNPPPGMKNPLFTK  497
            PG+NTLGIS+ RIDFAP GLNPPHTHPR TE+L+V EGTL VGFV SN    + N  FTK
Sbjct  84   PGINTLGISMARIDFAPGGLNPPHTHPRGTEILVVAEGTLLVGFVTSN---QLNNTFFTK  140

Query  498  TLVAGDVFVFPEGLIHFQFNVGKTNA  575
             L  GDVFVFP GLIHFQ N+GKT A
Sbjct  141  VLYKGDVFVFPIGLIHFQLNIGKTPA  166



>ref|XP_010050166.1| PREDICTED: germin-like protein subfamily 1 member 7 [Eucalyptus 
grandis]
 gb|KCW89288.1| hypothetical protein EUGRSUZ_A01578 [Eucalyptus grandis]
Length=223

 Score =   203 bits (516),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 101/146 (69%), Positives = 112/146 (77%), Gaps = 3/146 (2%)
 Frame = +3

Query  138  LQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFLFRGLNMPGNTSNPLGSKVTPVNVNNL  317
            LQD CVA ND N+ VFVNGK CK+P Q  A+DFLF G   PGNT+NPLGSKVTP  V+  
Sbjct  26   LQDICVATNDLNSGVFVNGKFCKDPKQATADDFLFMGFRNPGNTTNPLGSKVTPAFVDQF  85

Query  318  PGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLYVGFVLSNPPPGMKNPLFTK  497
            PGLNTLGIS+ R+DFAP GLNPPHTHPR TEVL+V+EGTL VGFV SN    + N LFTK
Sbjct  86   PGLNTLGISMARLDFAPGGLNPPHTHPRGTEVLVVVEGTLLVGFVTSNQ---LNNTLFTK  142

Query  498  TLVAGDVFVFPEGLIHFQFNVGKTNA  575
             L  GDVFVFP GLIHFQ N+G T A
Sbjct  143  VLYKGDVFVFPIGLIHFQLNIGNTYA  168



>ref|XP_010024921.1| PREDICTED: germin-like protein subfamily 1 member 13 [Eucalyptus 
grandis]
 gb|KCW61460.1| hypothetical protein EUGRSUZ_H04196 [Eucalyptus grandis]
Length=223

 Score =   203 bits (516),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 101/146 (69%), Positives = 112/146 (77%), Gaps = 3/146 (2%)
 Frame = +3

Query  138  LQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFLFRGLNMPGNTSNPLGSKVTPVNVNNL  317
            LQD CVA+ND  +AVFVNG+ CK+P Q  A+DF F G   PGNT+NPLGSKVTP  V   
Sbjct  26   LQDICVAINDPKSAVFVNGEFCKDPKQANADDFTFMGFRKPGNTANPLGSKVTPATVMEF  85

Query  318  PGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLYVGFVLSNPPPGMKNPLFTK  497
            PGLNTLGIS+ RIDFAP+GLNPPHTHPR TEVL+V+EGTL VGFV SN    + N LFTK
Sbjct  86   PGLNTLGISMARIDFAPDGLNPPHTHPRGTEVLVVVEGTLLVGFVTSN---QLNNTLFTK  142

Query  498  TLVAGDVFVFPEGLIHFQFNVGKTNA  575
             L  GDVFVFP GLIHFQ N GKT A
Sbjct  143  VLYKGDVFVFPIGLIHFQLNTGKTPA  168



>ref|XP_007030281.1| RmlC-like cupins superfamily protein isoform 2 [Theobroma cacao]
 gb|EOY10783.1| RmlC-like cupins superfamily protein isoform 2 [Theobroma cacao]
Length=226

 Score =   203 bits (516),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 110/164 (67%), Positives = 125/164 (76%), Gaps = 5/164 (3%)
 Frame = +3

Query  87   AMVALAssfshasdpssLQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFLFRGLNMPGN  266
            A +A A S + ASDP  LQDFCVA+ND+   VFVNGK CK+P    A DF + GLN+P N
Sbjct  12   AFLAFAWSLASASDPDPLQDFCVAINDTKDGVFVNGKFCKDPKLAKAEDFFYSGLNIPRN  71

Query  267  TSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAP-NGLNPPHTHPRATEVLLVLEGTLYV  443
            TSNP+GS VT VNV  + GLNTLGISL RID+AP  GLNPPHTHPRA+E+L+VLEGTLYV
Sbjct  72   TSNPVGSTVTQVNVAQILGLNTLGISLARIDYAPYGGLNPPHTHPRASEILVVLEGTLYV  131

Query  444  GFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNA  575
            GFV SNP    +N L TK L  GDVFVFP GLIHFQ N+GKTNA
Sbjct  132  GFVTSNP----ENRLITKVLYPGDVFVFPVGLIHFQLNIGKTNA  171



>ref|XP_010066338.1| PREDICTED: germin-like protein subfamily 1 member 7 isoform X1 
[Eucalyptus grandis]
 ref|XP_010066339.1| PREDICTED: germin-like protein subfamily 1 member 7 isoform X2 
[Eucalyptus grandis]
 ref|XP_010066340.1| PREDICTED: germin-like protein subfamily 1 member 7 isoform X3 
[Eucalyptus grandis]
 ref|XP_010066341.1| PREDICTED: germin-like protein subfamily 1 member 7 [Eucalyptus 
grandis]
 ref|XP_010066345.1| PREDICTED: germin-like protein subfamily 1 member 7 [Eucalyptus 
grandis]
 ref|XP_010066346.1| PREDICTED: germin-like protein subfamily 1 member 7 [Eucalyptus 
grandis]
Length=220

 Score =   203 bits (516),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 101/146 (69%), Positives = 112/146 (77%), Gaps = 5/146 (3%)
 Frame = +3

Query  138  LQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFLFRGLNMPGNTSNPLGSKVTPVNVNNL  317
            LQDFCVA+ND    VFVNGK CK+P QV A DFLF+G   PGNT+NPLGSKVTP  V+  
Sbjct  26   LQDFCVAINDPK--VFVNGKFCKDPKQVTAEDFLFKGFRYPGNTANPLGSKVTPAFVDQF  83

Query  318  PGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLYVGFVLSNPPPGMKNPLFTK  497
            PG+NTLGIS+ RIDFAP GLNPPHTHPR TE+L+V EGTL VGFV SN    + N  FTK
Sbjct  84   PGINTLGISMARIDFAPGGLNPPHTHPRGTEILVVAEGTLLVGFVTSN---QLNNTFFTK  140

Query  498  TLVAGDVFVFPEGLIHFQFNVGKTNA  575
             L  GDVFVFP GLIHFQ N+GKT A
Sbjct  141  VLYKGDVFVFPIGLIHFQLNIGKTPA  166



>gb|KCW44233.1| hypothetical protein EUGRSUZ_L02343 [Eucalyptus grandis]
Length=231

 Score =   203 bits (516),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 102/146 (70%), Positives = 112/146 (77%), Gaps = 5/146 (3%)
 Frame = +3

Query  138  LQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFLFRGLNMPGNTSNPLGSKVTPVNVNNL  317
            LQDFCVA+ND    VFVNGK CK+P QV A DFLF+G   PGNT+NPLGSKVTP  V+  
Sbjct  26   LQDFCVAINDPK--VFVNGKFCKDPKQVTAEDFLFKGFRYPGNTANPLGSKVTPAFVDQF  83

Query  318  PGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLYVGFVLSNPPPGMKNPLFTK  497
            PGLNTLGIS+ RIDFAP GLNPPHTHPR TE+L+V EGTL VGFV SN    + N  FTK
Sbjct  84   PGLNTLGISMARIDFAPGGLNPPHTHPRGTEILVVAEGTLLVGFVTSN---QLNNTFFTK  140

Query  498  TLVAGDVFVFPEGLIHFQFNVGKTNA  575
             L  GDVFVFP GLIHFQ N+GKT A
Sbjct  141  VLYKGDVFVFPIGLIHFQLNIGKTPA  166



>gb|EYU40207.1| hypothetical protein MIMGU_mgv1a012993mg [Erythranthe guttata]
Length=233

 Score =   203 bits (516),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 100/148 (68%), Positives = 120/148 (81%), Gaps = 2/148 (1%)
 Frame = +3

Query  138  LQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFLFRG-LNMPGNTSNPLGSKVTPVNVNN  314
            LQDFCVAVNDS+AAVFVNGKICK+P  V A+DF   G LN PGN ++P G+KVT V +N 
Sbjct  31   LQDFCVAVNDSDAAVFVNGKICKDPETVTADDFFHSGRLNRPGNITSPFGTKVTMVFINQ  90

Query  315  LPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLYVGFVLSNPP-PGMKNPLF  491
            LPG+NTLG++  RIDFAP G+NPPH HPRA+E+L+VL+GTLY GFV SNP  P  KN LF
Sbjct  91   LPGVNTLGVATARIDFAPGGVNPPHLHPRASEILVVLKGTLYAGFVTSNPSNPTDKNRLF  150

Query  492  TKTLVAGDVFVFPEGLIHFQFNVGKTNA  575
             K L  GDVFVFP+GLIHFQ+N+GK++A
Sbjct  151  AKILKPGDVFVFPKGLIHFQYNIGKSSA  178



>ref|XP_010066343.1| PREDICTED: germin-like protein subfamily 1 member 17 [Eucalyptus 
grandis]
 ref|XP_010066344.1| PREDICTED: germin-like protein subfamily 1 member 17 [Eucalyptus 
grandis]
 ref|XP_010066348.1| PREDICTED: germin-like protein subfamily 1 member 17 [Eucalyptus 
grandis]
 gb|KCW64220.1| hypothetical protein EUGRSUZ_G01870 [Eucalyptus grandis]
 gb|KCW64221.1| hypothetical protein EUGRSUZ_G01871 [Eucalyptus grandis]
 gb|KCW64224.1| hypothetical protein EUGRSUZ_G01874 [Eucalyptus grandis]
Length=222

 Score =   202 bits (515),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 100/146 (68%), Positives = 115/146 (79%), Gaps = 3/146 (2%)
 Frame = +3

Query  138  LQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFLFRGLNMPGNTSNPLGSKVTPVNVNNL  317
            LQDFCVAVND N+AVFVNGK CK+P  V+A+DF F     PG+TSNPLGSKVT   V+  
Sbjct  25   LQDFCVAVNDPNSAVFVNGKFCKDPKLVIADDFSFTKFRYPGSTSNPLGSKVTTAFVDQF  84

Query  318  PGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLYVGFVLSNPPPGMKNPLFTK  497
            PGLNTLGI+  R+DFAP GLNPPH HPR TE+LLV+EGTL+VGFV SN    + N LFTK
Sbjct  85   PGLNTLGIATARLDFAPYGLNPPHIHPRGTEMLLVVEGTLHVGFVTSN---QLNNTLFTK  141

Query  498  TLVAGDVFVFPEGLIHFQFNVGKTNA  575
             L  GDVFVFP+GLIHFQ N+G+TNA
Sbjct  142  VLTKGDVFVFPQGLIHFQLNIGQTNA  167



>ref|XP_010024911.1| PREDICTED: germin-like protein subfamily 1 member 7 [Eucalyptus 
grandis]
 gb|KCW61444.1| hypothetical protein EUGRSUZ_H04175 [Eucalyptus grandis]
Length=221

 Score =   202 bits (515),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 103/146 (71%), Positives = 113/146 (77%), Gaps = 5/146 (3%)
 Frame = +3

Query  138  LQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFLFRGLNMPGNTSNPLGSKVTPVNVNNL  317
            LQDFCVA+ND    VFVNGK CK+  QV A+DFLF+G   PGNT+NPLGSKVTP  V+  
Sbjct  26   LQDFCVAINDPK--VFVNGKFCKDQKQVTADDFLFKGFRYPGNTANPLGSKVTPAFVDQF  83

Query  318  PGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLYVGFVLSNPPPGMKNPLFTK  497
            PGLNTLGIS+ RIDFAP GLNPPHTHPR TEVL+V EGTL VGFV SN    + N LFTK
Sbjct  84   PGLNTLGISMARIDFAPGGLNPPHTHPRGTEVLVVTEGTLLVGFVTSN---QLNNTLFTK  140

Query  498  TLVAGDVFVFPEGLIHFQFNVGKTNA  575
             L  GDVFVFP GLIHFQ N+GKT A
Sbjct  141  VLYKGDVFVFPIGLIHFQLNIGKTPA  166



>ref|XP_006857270.1| hypothetical protein AMTR_s00067p00014150 [Amborella trichopoda]
 gb|ERN18737.1| hypothetical protein AMTR_s00067p00014150 [Amborella trichopoda]
Length=218

 Score =   202 bits (515),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 109/167 (65%), Positives = 130/167 (78%), Gaps = 6/167 (4%)
 Frame = +3

Query  75   VFVIAMVALAssfshasdpssLQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFLFRGLN  254
            +F++  ++L +S ++ASDPS LQDFCVA  D+ + +FVNGK+CK+P    ANDF F GL+
Sbjct  3    LFLVVFLSLTASLTYASDPSPLQDFCVA--DNASQLFVNGKVCKDPQLAQANDFFFAGLD  60

Query  255  MPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGT  434
             PGNT+N LGS+VT VNV  + GLNTLGIS+VRID+AP G NPPHTHPRATE+L VLEG+
Sbjct  61   KPGNTANALGSRVTQVNVAQIAGLNTLGISMVRIDYAPGGQNPPHTHPRATEILTVLEGS  120

Query  435  LYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNA  575
            LYVGFV SNP     N L TKTL  GDVFVFPEGLIHFQ NVG  NA
Sbjct  121  LYVGFVTSNP----DNRLITKTLQKGDVFVFPEGLIHFQQNVGYKNA  163



>ref|XP_007030274.1| Germin-like protein subfamily 1 member 18 [Theobroma cacao]
 gb|EOY10776.1| Germin-like protein subfamily 1 member 18 [Theobroma cacao]
Length=675

 Score =   214 bits (544),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 107/147 (73%), Positives = 121/147 (82%), Gaps = 5/147 (3%)
 Frame = +3

Query  138  LQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFLFRGLNMPGNTSNPLGSKVTPVNVNNL  317
            LQDFCVA+ND+   VFVNGK CK+P   VA+DF + GLNMPGNTSNP+GS VT VNV+ +
Sbjct  256  LQDFCVAINDTKNGVFVNGKFCKDPKLAVADDFFYSGLNMPGNTSNPVGSNVTTVNVDQI  315

Query  318  PGLNTLGISLVRIDFAP-NGLNPPHTHPRATEVLLVLEGTLYVGFVLSNPPPGMKNPLFT  494
            PGLNTLGISLVRID+AP  GLNPPHTHPR TE+L+V+EGTLYVGFV SNP    +N LFT
Sbjct  316  PGLNTLGISLVRIDYAPYGGLNPPHTHPRGTEILVVVEGTLYVGFVTSNP----ENRLFT  371

Query  495  KTLVAGDVFVFPEGLIHFQFNVGKTNA  575
            K L  GDVFVFP GLIHFQFN+GKT A
Sbjct  372  KVLNPGDVFVFPIGLIHFQFNIGKTAA  398


 Score =   210 bits (534),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 116/180 (64%), Positives = 133/180 (74%), Gaps = 5/180 (3%)
 Frame = +3

Query  39   SKNILDMALRFIVFVIAMVALAssfshasdpssLQDFCVAVNDSNAAVFVNGKICKNPMQ  218
            +  IL   ++  V   A +A A S + ASDPS LQDFCVA+ND+   VFVNGK CK+P  
Sbjct  445  ASGILMKGVQLFVVASAFLAFAWSLASASDPSPLQDFCVAINDTKDGVFVNGKFCKDPKL  504

Query  219  VVANDFLFRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAP-NGLNPPHTH  395
              A DF + GLN+P NTSNP+GS VTPVNV  + GLNTLGISL RID+AP  GLNPPHTH
Sbjct  505  AKAEDFFYSGLNIPRNTSNPVGSTVTPVNVAQILGLNTLGISLARIDYAPYGGLNPPHTH  564

Query  396  PRATEVLLVLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNA  575
            PRATE+L+VLEGTLYVGFV SNP    +N L TK L  GDVFVFP GLIHFQ N+GKTNA
Sbjct  565  PRATEILVVLEGTLYVGFVTSNP----ENRLITKVLYPGDVFVFPVGLIHFQLNIGKTNA  620


 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 44/60 (73%), Gaps = 4/60 (7%)
 Frame = +3

Query  396  PRATEVLLVLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNA  575
            P+  ++L+++EGTLYVG V SNP    +N   TK L  GD F+FP GLIHFQFNVGKTNA
Sbjct  52   PKHGKILVIMEGTLYVGLVTSNP----ENHPITKVLNPGDGFLFPVGLIHFQFNVGKTNA  107



>ref|XP_006840195.1| hypothetical protein AMTR_s00089p00119070 [Amborella trichopoda]
 gb|ERN01870.1| hypothetical protein AMTR_s00089p00119070 [Amborella trichopoda]
Length=219

 Score =   202 bits (514),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 104/146 (71%), Positives = 115/146 (79%), Gaps = 6/146 (4%)
 Frame = +3

Query  138  LQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFLFRGLNMPGNTSNPLGSKVTPVNVNNL  317
            LQDFCVA  D+ + VFVNGK+CK+P    ANDF F GL+ PGNTSNP+GSKVTPVNV  +
Sbjct  25   LQDFCVA--DNYSKVFVNGKVCKDPKLATANDFFFAGLDKPGNTSNPVGSKVTPVNVMQI  82

Query  318  PGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLYVGFVLSNPPPGMKNPLFTK  497
             GLNTLGISL RIDFAP G NPPHTHPRATE+L VLEGTLYVGFV SNP    +N L +K
Sbjct  83   AGLNTLGISLARIDFAPGGQNPPHTHPRATEILTVLEGTLYVGFVTSNP----ENRLISK  138

Query  498  TLVAGDVFVFPEGLIHFQFNVGKTNA  575
             L  GDVFVFP GLIHFQ NVG +NA
Sbjct  139  ILNKGDVFVFPVGLIHFQQNVGYSNA  164



>ref|XP_011038438.1| PREDICTED: germin-like protein subfamily 1 member 13 [Populus 
euphratica]
Length=225

 Score =   202 bits (514),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 104/147 (71%), Positives = 114/147 (78%), Gaps = 5/147 (3%)
 Frame = +3

Query  138  LQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFLFRGLNMPGNTSNPLGSKVTPVNVNNL  317
            LQDFCVA+ND+   VFVNGK CK+P    ANDF F GLN+  +TSNP+GS VT  NV  +
Sbjct  28   LQDFCVAINDTKDGVFVNGKFCKDPKLATANDFFFSGLNIARDTSNPVGSVVTQANVAQI  87

Query  318  PGLNTLGISLVRIDFAP-NGLNPPHTHPRATEVLLVLEGTLYVGFVLSNPPPGMKNPLFT  494
            PGLNTLGIS+VRID+AP  GLNPPHTHPRATEV+ VLEGTLYVGFV SNP     N L T
Sbjct  88   PGLNTLGISVVRIDYAPYGGLNPPHTHPRATEVITVLEGTLYVGFVTSNP----DNRLIT  143

Query  495  KTLVAGDVFVFPEGLIHFQFNVGKTNA  575
            K L  GDVFVFP GLIHFQFNVGKT A
Sbjct  144  KVLKPGDVFVFPFGLIHFQFNVGKTKA  170



>ref|XP_011034444.1| PREDICTED: germin-like protein subfamily 1 member 13 [Populus 
euphratica]
Length=225

 Score =   202 bits (514),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 104/147 (71%), Positives = 114/147 (78%), Gaps = 5/147 (3%)
 Frame = +3

Query  138  LQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFLFRGLNMPGNTSNPLGSKVTPVNVNNL  317
            LQDFCVA+ND+   VFVNGK CK+P    ANDF F GLN+  +TSNP+GS VT  NV  +
Sbjct  28   LQDFCVAINDTKDGVFVNGKFCKDPKLATANDFFFSGLNIARDTSNPVGSVVTQANVAQI  87

Query  318  PGLNTLGISLVRIDFAP-NGLNPPHTHPRATEVLLVLEGTLYVGFVLSNPPPGMKNPLFT  494
            PGLNTLGIS+VRID+AP  GLNPPHTHPRATEV+ VLEGTLYVGFV SNP     N L T
Sbjct  88   PGLNTLGISVVRIDYAPYGGLNPPHTHPRATEVITVLEGTLYVGFVTSNP----DNRLIT  143

Query  495  KTLVAGDVFVFPEGLIHFQFNVGKTNA  575
            K L  GDVFVFP GLIHFQFNVGKT A
Sbjct  144  KVLKPGDVFVFPFGLIHFQFNVGKTKA  170



>ref|XP_011034442.1| PREDICTED: germin-like protein subfamily 1 member 13 [Populus 
euphratica]
Length=225

 Score =   202 bits (514),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 104/147 (71%), Positives = 114/147 (78%), Gaps = 5/147 (3%)
 Frame = +3

Query  138  LQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFLFRGLNMPGNTSNPLGSKVTPVNVNNL  317
            LQDFCVA+ND+   VFVNGK CK+P    ANDF F GLN+  +TSNP+GS VT  NV  +
Sbjct  28   LQDFCVAINDTKDGVFVNGKFCKDPKLATANDFFFSGLNIARDTSNPVGSVVTQANVAQI  87

Query  318  PGLNTLGISLVRIDFAP-NGLNPPHTHPRATEVLLVLEGTLYVGFVLSNPPPGMKNPLFT  494
            PGLNTLGIS+VRID+AP  GLNPPHTHPRATEV+ VLEGTLYVGFV SNP     N L T
Sbjct  88   PGLNTLGISVVRIDYAPYGGLNPPHTHPRATEVITVLEGTLYVGFVTSNP----DNRLIT  143

Query  495  KTLVAGDVFVFPEGLIHFQFNVGKTNA  575
            K L  GDVFVFP GLIHFQFNVGKT A
Sbjct  144  KVLKPGDVFVFPFGLIHFQFNVGKTKA  170



>ref|XP_006840196.1| hypothetical protein AMTR_s00089p00119480 [Amborella trichopoda]
 gb|ERN01871.1| hypothetical protein AMTR_s00089p00119480 [Amborella trichopoda]
Length=219

 Score =   202 bits (514),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 104/146 (71%), Positives = 116/146 (79%), Gaps = 6/146 (4%)
 Frame = +3

Query  138  LQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFLFRGLNMPGNTSNPLGSKVTPVNVNNL  317
            LQDFCVA  D+ + VFVNGK+CK+PM V A DF + GL+ PGNTSNPLGS VT VNV  +
Sbjct  25   LQDFCVA--DNYSKVFVNGKVCKDPMLVTAKDFFYDGLDKPGNTSNPLGSMVTQVNVMQI  82

Query  318  PGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLYVGFVLSNPPPGMKNPLFTK  497
             GLNTLGISLVRIDFAP G NPPHTHPRATE+L VLEGTLYVGFV SNP    +N L +K
Sbjct  83   LGLNTLGISLVRIDFAPGGQNPPHTHPRATEILTVLEGTLYVGFVTSNP----ENRLISK  138

Query  498  TLVAGDVFVFPEGLIHFQFNVGKTNA  575
            TL  GDVFVFP+GLIHFQ NVG  N+
Sbjct  139  TLNKGDVFVFPQGLIHFQQNVGYGNS  164



>ref|XP_011038440.1| PREDICTED: germin-like protein subfamily 1 member 7 [Populus 
euphratica]
Length=221

 Score =   202 bits (513),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 115/172 (67%), Positives = 133/172 (77%), Gaps = 3/172 (2%)
 Frame = +3

Query  60   ALRFIVFVIAMVALAssfshasdpssLQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFL  239
             L+F V V  ++ALASSF+ A DPS LQDFCVAV++++  VFVNGK CK+P  V A DF 
Sbjct  3    GLKF-VLVFVLLALASSFASAFDPSPLQDFCVAVDETDG-VFVNGKFCKDPKDVTAKDFF  60

Query  240  FRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLL  419
              GLN+PG+TS  +GS VT VNV  +PGLNTLGISL RIDFAP GLNPPHTHPRATE+++
Sbjct  61   SSGLNIPGDTSGRVGSNVTAVNVEKIPGLNTLGISLARIDFAPYGLNPPHTHPRATEIIV  120

Query  420  VLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNA  575
            V+EGTLYVGFV SN   G  N L TK L  GDVFVFP GLIHFQFN+GKT A
Sbjct  121  VVEGTLYVGFVTSNLANG-DNRLITKALKPGDVFVFPIGLIHFQFNMGKTKA  171



>ref|XP_008243694.1| PREDICTED: germin-like protein 9-1 [Prunus mume]
Length=456

 Score =   209 bits (531),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 113/170 (66%), Positives = 127/170 (75%), Gaps = 3/170 (2%)
 Frame = +3

Query  66   RFIVFVIAMVALAssfshasdpssLQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFLFR  245
             F++ ++A++A +   + A DPS LQDFCVA+ D    VFVNGK CK+P    ANDF F 
Sbjct  235  HFLISILAILAFSMFLASAYDPSPLQDFCVAIKDIKDGVFVNGKFCKDPKLANANDFFFS  294

Query  246  GLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVL  425
            GL  P NT NP+GS VT VNV+NL GLNTLGISL RIDFAPNGLNPPHTHPRATE+L+VL
Sbjct  295  GLQNPRNTQNPVGSNVTAVNVDNLAGLNTLGISLARIDFAPNGLNPPHTHPRATEILVVL  354

Query  426  EGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNA  575
            EGTLYVGFV SN   G  N LFTK L  GDVFVFP GLIHFQ NVG  NA
Sbjct  355  EGTLYVGFVTSN---GDGNRLFTKELNKGDVFVFPIGLIHFQLNVGHVNA  401


 Score =   208 bits (530),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 114/170 (67%), Positives = 127/170 (75%), Gaps = 3/170 (2%)
 Frame = +3

Query  66   RFIVFVIAMVALAssfshasdpssLQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFLFR  245
             F++  +A++A A+  + A DPS LQDFCVA+ D    VFVNGK CK+P    ANDF F 
Sbjct  5    HFLISTLAILAFATFLASADDPSPLQDFCVALKDIKDGVFVNGKFCKDPKLANANDFFFS  64

Query  246  GLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVL  425
            GL  P NT NP+GS VT VNV+NL GLNTLGISL RIDFAPNGLNPPHTHPRATE+L+VL
Sbjct  65   GLQNPRNTQNPVGSNVTAVNVDNLAGLNTLGISLARIDFAPNGLNPPHTHPRATEILVVL  124

Query  426  EGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNA  575
            EGTLYVGFV SN   G  N LFTK L  GDVFVFP GLIHFQ NVG  NA
Sbjct  125  EGTLYVGFVTSN---GDGNRLFTKELNKGDVFVFPIGLIHFQLNVGHVNA  171



>ref|XP_010024917.1| PREDICTED: germin-like protein subfamily 1 member 7 [Eucalyptus 
grandis]
 gb|KCW61455.1| hypothetical protein EUGRSUZ_H04191 [Eucalyptus grandis]
Length=221

 Score =   202 bits (513),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 101/144 (70%), Positives = 111/144 (77%), Gaps = 5/144 (3%)
 Frame = +3

Query  138  LQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFLFRGLNMPGNTSNPLGSKVTPVNVNNL  317
            LQDFCVA+ND    VFVNGK CK+P QV A+DFLF+G   PGNT NPLGSKVTP  V+  
Sbjct  26   LQDFCVAINDPE--VFVNGKFCKDPKQVTADDFLFKGFRYPGNTVNPLGSKVTPAFVDQF  83

Query  318  PGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLYVGFVLSNPPPGMKNPLFTK  497
            PGLNTLGIS+ RIDFAP GLNPPHTHPR TE+L+V EGTL VGFV SN    + N  FTK
Sbjct  84   PGLNTLGISMARIDFAPGGLNPPHTHPRGTEILVVAEGTLLVGFVTSN---QLNNTFFTK  140

Query  498  TLVAGDVFVFPEGLIHFQFNVGKT  569
             L  GDVFVFP GLIHFQ N+GKT
Sbjct  141  VLYKGDVFVFPIGLIHFQLNIGKT  164



>ref|XP_008776811.1| PREDICTED: putative germin-like protein 2-1 isoform X2 [Phoenix 
dactylifera]
Length=206

 Score =   201 bits (511),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 106/146 (73%), Positives = 114/146 (78%), Gaps = 2/146 (1%)
 Frame = +3

Query  138  LQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFLFRGLNMPGNTSNPLGSKVTPVNVNNL  317
            LQDFCVA   S  AV VNG +CK PM V A+DF F GL+MP NTSN LGSKVT VNVN +
Sbjct  8    LQDFCVADLKSPNAVLVNGFVCKPPMHVTADDFFFSGLDMPDNTSNQLGSKVTLVNVNQI  67

Query  318  PGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLYVGFVLSNPPPGMKNPLFTK  497
             GLNTLGISL RID+AP GLNPPHTHP+ATE+L VLEGTLYVGFV SN   G  N LFTK
Sbjct  68   AGLNTLGISLARIDYAPYGLNPPHTHPQATEILTVLEGTLYVGFVTSNTNNG--NLLFTK  125

Query  498  TLVAGDVFVFPEGLIHFQFNVGKTNA  575
             L  GDVFVFPEGLIHFQFN G T+A
Sbjct  126  MLKKGDVFVFPEGLIHFQFNYGPTHA  151



>ref|XP_011034443.1| PREDICTED: germin-like protein subfamily 1 member 13 [Populus 
euphratica]
Length=225

 Score =   201 bits (512),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 103/147 (70%), Positives = 114/147 (78%), Gaps = 5/147 (3%)
 Frame = +3

Query  138  LQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFLFRGLNMPGNTSNPLGSKVTPVNVNNL  317
            LQDFCVA+ND+   VFVNG+ CK+P    ANDF F GLN+  +TSNP+GS VT  NV  +
Sbjct  28   LQDFCVAINDTKDGVFVNGRFCKDPKLATANDFFFSGLNIARDTSNPVGSVVTQANVAQI  87

Query  318  PGLNTLGISLVRIDFAP-NGLNPPHTHPRATEVLLVLEGTLYVGFVLSNPPPGMKNPLFT  494
            PGLNTLGIS+VRID+AP  GLNPPHTHPRATEV+ VLEGTLYVGFV SNP     N L T
Sbjct  88   PGLNTLGISVVRIDYAPYGGLNPPHTHPRATEVITVLEGTLYVGFVTSNP----DNRLIT  143

Query  495  KTLVAGDVFVFPEGLIHFQFNVGKTNA  575
            K L  GDVFVFP GLIHFQFNVGKT A
Sbjct  144  KVLKPGDVFVFPFGLIHFQFNVGKTKA  170



>gb|KCW64213.1| hypothetical protein EUGRSUZ_G01863 [Eucalyptus grandis]
Length=199

 Score =   201 bits (510),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 101/146 (69%), Positives = 111/146 (76%), Gaps = 5/146 (3%)
 Frame = +3

Query  138  LQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFLFRGLNMPGNTSNPLGSKVTPVNVNNL  317
            LQDFCVA+ND    VFVNGK CK+  QV A+DFLF+G   PGNT NPLGSKVTP  V+  
Sbjct  26   LQDFCVAINDPK--VFVNGKFCKDAKQVTADDFLFKGFRYPGNTKNPLGSKVTPAFVDQF  83

Query  318  PGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLYVGFVLSNPPPGMKNPLFTK  497
            PGLNTLGIS+ RIDFAP GLNPPHTHPR +E+L+V EGTL VGFV SN    M N  FTK
Sbjct  84   PGLNTLGISMARIDFAPGGLNPPHTHPRGSEILVVAEGTLLVGFVTSN---QMNNTFFTK  140

Query  498  TLVAGDVFVFPEGLIHFQFNVGKTNA  575
             L  GDVFVFP GLIHFQ N+GKT A
Sbjct  141  VLYKGDVFVFPIGLIHFQLNIGKTPA  166



>emb|CBI36816.3| unnamed protein product [Vitis vinifera]
Length=220

 Score =   201 bits (511),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 111/175 (63%), Positives = 130/175 (74%), Gaps = 5/175 (3%)
 Frame = +3

Query  51   LDMALRFIVFVIAMVALAssfshasdpssLQDFCVAVNDSNAAVFVNGKICKNPMQVVAN  230
            +   + F+V  +A+VAL SS + ASDPS LQD CVA+++   AVFVNGK CK+P   VA 
Sbjct  1    MKKGVSFLV-TVALVALVSSLASASDPSPLQDTCVAIDEPKDAVFVNGKFCKDPKLTVAE  59

Query  231  DFLFRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATE  410
            DF F GL+ PGNTSN + S VT VNV  + GLNTLGIS+VRID+ P G NPPHTHPRATE
Sbjct  60   DFFFSGLDKPGNTSNAVASNVTTVNVEQIKGLNTLGISMVRIDYEPYGQNPPHTHPRATE  119

Query  411  VLLVLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNA  575
            +L VLEGTLYVGFV SN     +N L +K L  GDVFVFP GLIHFQFN+GKTNA
Sbjct  120  ILTVLEGTLYVGFVTSN----TENRLISKVLNKGDVFVFPIGLIHFQFNIGKTNA  170



>ref|XP_010050748.1| PREDICTED: uncharacterized protein LOC104439371 [Eucalyptus grandis]
Length=448

 Score =   208 bits (529),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 111/171 (65%), Positives = 130/171 (76%), Gaps = 5/171 (3%)
 Frame = +3

Query  63   LRFIVFVIAMVALAssfshasdpssLQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFLF  242
            ++F+   + ++ALA++ S A DPS LQDFCVA+ND    VFVNGK CK+P QV A+DFLF
Sbjct  228  MKFLPISLLILALATATSFAYDPSPLQDFCVAINDPK--VFVNGKFCKDPKQVTADDFLF  285

Query  243  RGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLV  422
            +G   PGNT NPLGSKVTP  V+ LPGLNTLGIS+ RIDFAP GLNPPHTHPR +E+L+V
Sbjct  286  KGFRYPGNTVNPLGSKVTPAFVDQLPGLNTLGISMARIDFAPGGLNPPHTHPRGSEILVV  345

Query  423  LEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNA  575
             EGTL VGFV SN    + N  FTK L  GDVFVFP GLIHFQ N+GKT A
Sbjct  346  AEGTLLVGFVTSN---QLNNTFFTKVLYKGDVFVFPIGLIHFQLNIGKTPA  393


 Score =   200 bits (509),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 102/146 (70%), Positives = 112/146 (77%), Gaps = 5/146 (3%)
 Frame = +3

Query  138  LQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFLFRGLNMPGNTSNPLGSKVTPVNVNNL  317
            LQDFCVA+ND    VFVNGK CK+P QV A+DFLF+G   PGNT+NPLGSKVTP  V+  
Sbjct  26   LQDFCVAINDPE--VFVNGKFCKDPKQVTADDFLFKGFRYPGNTANPLGSKVTPAFVDQF  83

Query  318  PGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLYVGFVLSNPPPGMKNPLFTK  497
            PGLNTLGIS+ RIDFA  GLNPPHTHPR TEVL+V EGTL V FV SN    + N LFTK
Sbjct  84   PGLNTLGISMARIDFALGGLNPPHTHPRGTEVLVVTEGTLLVSFVTSN---QLNNTLFTK  140

Query  498  TLVAGDVFVFPEGLIHFQFNVGKTNA  575
             L  GDVFVFP GLIHFQ N+GKT A
Sbjct  141  VLYKGDVFVFPIGLIHFQLNIGKTPA  166



>ref|XP_010024913.1| PREDICTED: germin-like protein subfamily 1 member 7 [Eucalyptus 
grandis]
 gb|KCW61440.1| hypothetical protein EUGRSUZ_H04170 [Eucalyptus grandis]
Length=221

 Score =   201 bits (511),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 102/146 (70%), Positives = 112/146 (77%), Gaps = 5/146 (3%)
 Frame = +3

Query  138  LQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFLFRGLNMPGNTSNPLGSKVTPVNVNNL  317
            LQDFCVA+ND    VFVNGK CK+  QV A+DFLF+G   PGNT+NPLGSKVTP  V+  
Sbjct  26   LQDFCVAINDPK--VFVNGKFCKDQKQVTADDFLFKGFRYPGNTANPLGSKVTPAFVDQF  83

Query  318  PGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLYVGFVLSNPPPGMKNPLFTK  497
            PGLNTLGIS+ RIDFAP GLNPPHTHPR TEVL+V EG L VGFV SN    + N LFTK
Sbjct  84   PGLNTLGISMARIDFAPGGLNPPHTHPRGTEVLVVTEGALLVGFVTSN---QLNNTLFTK  140

Query  498  TLVAGDVFVFPEGLIHFQFNVGKTNA  575
             L  GDVFVFP GLIHFQ N+GKT A
Sbjct  141  VLYKGDVFVFPIGLIHFQLNIGKTPA  166



>ref|XP_010050174.1| PREDICTED: germin-like protein subfamily 1 member 7 [Eucalyptus 
grandis]
 gb|KCW89289.1| hypothetical protein EUGRSUZ_A01579 [Eucalyptus grandis]
Length=223

 Score =   201 bits (511),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 101/146 (69%), Positives = 111/146 (76%), Gaps = 3/146 (2%)
 Frame = +3

Query  138  LQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFLFRGLNMPGNTSNPLGSKVTPVNVNNL  317
            LQD CVA ND N+ VFVNGK CK+P Q  A+DFLF GL  PGNT+NPLGSKVT   V+  
Sbjct  26   LQDICVATNDPNSGVFVNGKFCKDPKQASADDFLFMGLRNPGNTANPLGSKVTQAFVDQF  85

Query  318  PGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLYVGFVLSNPPPGMKNPLFTK  497
            PGLNTLGIS+ R+DFAP GLNPPHTHPR TEVL+V+EG L VGFV SN    + N LFTK
Sbjct  86   PGLNTLGISMARLDFAPGGLNPPHTHPRGTEVLVVVEGMLLVGFVTSNQ---LNNTLFTK  142

Query  498  TLVAGDVFVFPEGLIHFQFNVGKTNA  575
             L  GDVFVFP GLIHFQ N G TNA
Sbjct  143  VLYKGDVFVFPIGLIHFQLNTGNTNA  168



>ref|XP_010054506.1| PREDICTED: uncharacterized protein LOC104442816 [Eucalyptus grandis]
Length=448

 Score =   207 bits (528),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 111/171 (65%), Positives = 130/171 (76%), Gaps = 5/171 (3%)
 Frame = +3

Query  63   LRFIVFVIAMVALAssfshasdpssLQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFLF  242
            ++F+   + ++ALA++ S A DPS LQDFCVA+ND    VFVNGK CK+P QV A+DFLF
Sbjct  228  MKFLPISLLILALATATSFAYDPSPLQDFCVAINDPK--VFVNGKFCKDPKQVTADDFLF  285

Query  243  RGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLV  422
            +G   PGNT NPLGSKVTP  V+ LPGLNTLGIS+ RIDFAP GLNPPHTHPR +E+L+V
Sbjct  286  KGFRYPGNTVNPLGSKVTPAFVDQLPGLNTLGISMARIDFAPGGLNPPHTHPRGSEILVV  345

Query  423  LEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNA  575
             EGTL VGFV SN    + N  FTK L  GDVFVFP GLIHFQ N+GKT A
Sbjct  346  AEGTLLVGFVTSN---QLNNTFFTKVLYKGDVFVFPIGLIHFQLNIGKTPA  393


 Score =   206 bits (523),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 103/146 (71%), Positives = 114/146 (78%), Gaps = 5/146 (3%)
 Frame = +3

Query  138  LQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFLFRGLNMPGNTSNPLGSKVTPVNVNNL  317
            LQDFCVA+ND    VFVNGK CK+P Q+ A+DFLF+G   PGNT+NPLGSKVTP  V+  
Sbjct  26   LQDFCVAINDPE--VFVNGKFCKDPKQITADDFLFKGFRYPGNTANPLGSKVTPAFVDQF  83

Query  318  PGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLYVGFVLSNPPPGMKNPLFTK  497
            PGLNTLGIS+ RIDFAP GLNPPHTHPR TEVL+V EGTL VGFV SN    + N LFTK
Sbjct  84   PGLNTLGISMARIDFAPGGLNPPHTHPRGTEVLVVTEGTLLVGFVTSN---QLNNTLFTK  140

Query  498  TLVAGDVFVFPEGLIHFQFNVGKTNA  575
             L  GDVFVFP GLIHFQ N+GKT A
Sbjct  141  VLYKGDVFVFPIGLIHFQLNIGKTPA  166



>emb|CAN63434.1| hypothetical protein VITISV_033830 [Vitis vinifera]
Length=212

 Score =   200 bits (509),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 99/146 (68%), Positives = 111/146 (76%), Gaps = 4/146 (3%)
 Frame = +3

Query  138  LQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFLFRGLNMPGNTSNPLGSKVTPVNVNNL  317
            LQDFCVAVND+N  VF+NGK C++P  V  NDF F GL +PGNTSN LGS VTP NV  +
Sbjct  14   LQDFCVAVNDTNVVVFMNGKFCQDPNLVTPNDFSFSGLRLPGNTSNQLGSMVTPANVAQI  73

Query  318  PGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLYVGFVLSNPPPGMKNPLFTK  497
            P LNTLG+SL R+D+A  GLNPPHTHPRATE+L VLEGTLYVGFV SNP     N L +K
Sbjct  74   PRLNTLGVSLARVDYATYGLNPPHTHPRATEILXVLEGTLYVGFVTSNP----DNRLISK  129

Query  498  TLVAGDVFVFPEGLIHFQFNVGKTNA  575
                GD+FVFP GLIHFQ NVG TNA
Sbjct  130  VXYKGDLFVFPXGLIHFQLNVGTTNA  155



>ref|XP_007030265.1| Germin-like protein 2 [Theobroma cacao]
 gb|EOY10767.1| Germin-like protein 2 [Theobroma cacao]
Length=221

 Score =   201 bits (510),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 115/175 (66%), Positives = 132/175 (75%), Gaps = 6/175 (3%)
 Frame = +3

Query  57   MALRFIVFVIAMVALAssfshasdpssLQDFCVAVNDSN-AAVFVNGKICKNPMQVVAND  233
            M   + +    ++ LASSF+ A DPS LQDFCVA+ND+   +V VNGK CK+P     ND
Sbjct  1    MKGAYFILGFILLILASSFASACDPSPLQDFCVAINDTKKGSVIVNGKFCKDPKLATVND  60

Query  234  FLFRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPN-GLNPPHTHPRATE  410
            F F GLN+P NTSN +GS VTPVNV+ +PGLNTLGISLVRID+APN GLNPPHTHPR TE
Sbjct  61   FFFSGLNIPKNTSNSVGSVVTPVNVDQIPGLNTLGISLVRIDYAPNGGLNPPHTHPRGTE  120

Query  411  VLLVLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNA  575
            +L+VLEGTLYVGFV SNP     N L +K L  GDVFVFP GLIHFQ NVGKTNA
Sbjct  121  ILVVLEGTLYVGFVTSNP----NNRLISKILSPGDVFVFPIGLIHFQQNVGKTNA  171



>ref|XP_011034445.1| PREDICTED: germin-like protein subfamily 1 member 7 [Populus 
euphratica]
 ref|XP_011038441.1| PREDICTED: germin-like protein subfamily 1 member 7 [Populus 
euphratica]
Length=221

 Score =   201 bits (510),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 114/172 (66%), Positives = 133/172 (77%), Gaps = 3/172 (2%)
 Frame = +3

Query  60   ALRFIVFVIAMVALAssfshasdpssLQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFL  239
             L+F V V  ++ALASSF+ A DPS LQDFCVAV++++  VFVNGK CK+P  V A DF 
Sbjct  3    GLKF-VLVFVLLALASSFASAFDPSPLQDFCVAVDETDG-VFVNGKFCKDPKDVTAKDFF  60

Query  240  FRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLL  419
              GLN+PG+TS  +GS VT VNV  +PGLNTLGISL RIDFAP GLNPPHTHPRATE+++
Sbjct  61   SSGLNIPGDTSGRVGSNVTAVNVEKIPGLNTLGISLARIDFAPYGLNPPHTHPRATEIIV  120

Query  420  VLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNA  575
            V+EGTLYVGFV SN   G  N L TK L  GDVFVFP GLIHFQFN+G+T A
Sbjct  121  VVEGTLYVGFVTSNLANG-DNRLITKALKPGDVFVFPIGLIHFQFNMGQTKA  171



>ref|XP_007030267.1| Germin-like protein subfamily 1 member 18 [Theobroma cacao]
 gb|EOY10769.1| Germin-like protein subfamily 1 member 18 [Theobroma cacao]
Length=298

 Score =   203 bits (516),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 104/147 (71%), Positives = 114/147 (78%), Gaps = 5/147 (3%)
 Frame = +3

Query  138  LQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFLFRGLNMPGNTSNPLGSKVTPVNVNNL  317
            LQDFCVA+ND+   VFVNGK CK+P  V A DF F GLN  GNTSN LGSKVT VNV  +
Sbjct  29   LQDFCVAINDTKNGVFVNGKFCKDPKLVNAEDFFFSGLNKQGNTSNQLGSKVTLVNVGQI  88

Query  318  PGLNTLGISLVRIDFAP-NGLNPPHTHPRATEVLLVLEGTLYVGFVLSNPPPGMKNPLFT  494
             GLNTLGISL R+D+AP  GLNPPHTHPRATE+L+V+EGTLYVGFV SNP     N L T
Sbjct  89   SGLNTLGISLARVDYAPYGGLNPPHTHPRATEILVVVEGTLYVGFVTSNP----DNRLIT  144

Query  495  KTLVAGDVFVFPEGLIHFQFNVGKTNA  575
            K L  GDVFVFP GLIHFQFN+G TNA
Sbjct  145  KVLYPGDVFVFPVGLIHFQFNIGNTNA  171



>ref|XP_010027145.1| PREDICTED: germin-like protein subfamily 1 member 7 [Eucalyptus 
grandis]
 gb|KCW61467.1| hypothetical protein EUGRSUZ_H04203 [Eucalyptus grandis]
Length=223

 Score =   201 bits (510),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 101/146 (69%), Positives = 112/146 (77%), Gaps = 3/146 (2%)
 Frame = +3

Query  138  LQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFLFRGLNMPGNTSNPLGSKVTPVNVNNL  317
            LQD CVA ND N+ VFVNGK CK+P Q  A+DFLF+G  +P NTSN LGSKVTP  V+  
Sbjct  26   LQDICVATNDLNSGVFVNGKFCKDPNQATADDFLFKGFRIPRNTSNLLGSKVTPAFVDQF  85

Query  318  PGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLYVGFVLSNPPPGMKNPLFTK  497
            PGLNTLGIS+ RIDFAP GLNPPHTHPR TEVL+V+EGTL VGFV SN    + N LFTK
Sbjct  86   PGLNTLGISMARIDFAPGGLNPPHTHPRGTEVLVVVEGTLLVGFVTSNQ---LNNTLFTK  142

Query  498  TLVAGDVFVFPEGLIHFQFNVGKTNA  575
             L  GDVFVFP GLIHFQ N+G T A
Sbjct  143  VLYKGDVFVFPIGLIHFQLNIGNTYA  168



>ref|XP_002284624.1| PREDICTED: germin-like protein subfamily 1 member 7 [Vitis vinifera]
 emb|CBI36787.3| unnamed protein product [Vitis vinifera]
Length=220

 Score =   200 bits (509),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 103/146 (71%), Positives = 116/146 (79%), Gaps = 4/146 (3%)
 Frame = +3

Query  138  LQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFLFRGLNMPGNTSNPLGSKVTPVNVNNL  317
            LQD CVA+ +   AVFVNGK CKNP   VA DF F+GLN+PGNT+N +GS VT VNV+ +
Sbjct  29   LQDTCVAIPEPENAVFVNGKFCKNPNLTVAEDFFFQGLNIPGNTANRVGSNVTTVNVDAI  88

Query  318  PGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLYVGFVLSNPPPGMKNPLFTK  497
            PGLNTLGISLVRID+AP G NPPHTHPRATE+L VLEGTL VGFV SNP    +N LF+K
Sbjct  89   PGLNTLGISLVRIDYAPYGQNPPHTHPRATEILTVLEGTLLVGFVTSNP----QNRLFSK  144

Query  498  TLVAGDVFVFPEGLIHFQFNVGKTNA  575
             L  GDVFVFP GLIHFQFN+G TNA
Sbjct  145  VLNKGDVFVFPIGLIHFQFNIGHTNA  170



>gb|AFK48994.1| unknown [Lotus japonicus]
Length=223

 Score =   200 bits (509),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 115/171 (67%), Positives = 131/171 (77%), Gaps = 3/171 (2%)
 Frame = +3

Query  63   LRFIVFVIAMVALAssfshasdpssLQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFLF  242
            ++ + F++ ++ALASSF+ A DPS LQDFCV +ND    VFVNGK CK+P  V A DF F
Sbjct  1    MKVVYFLVTILALASSFASAYDPSPLQDFCVGINDPKDGVFVNGKFCKDPALVKAEDF-F  59

Query  243  RGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLV  422
            + +  PG+TSNPLGSKVTPV V  L GLNTLGISL RIDFAP GLNPPHTHPRATE+L+V
Sbjct  60   KHVE-PGSTSNPLGSKVTPVTVEQLFGLNTLGISLARIDFAPKGLNPPHTHPRATEILIV  118

Query  423  LEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNA  575
            LEGTLYVGFV SN   G  N LFTK L  G+VFVFP GLIHFQ NVG  NA
Sbjct  119  LEGTLYVGFVTSNNANG-GNRLFTKVLNKGNVFVFPIGLIHFQLNVGSGNA  168



>ref|XP_008237387.1| PREDICTED: germin-like protein subfamily 1 member 20 [Prunus 
mume]
Length=233

 Score =   201 bits (510),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 110/179 (61%), Positives = 129/179 (72%), Gaps = 10/179 (6%)
 Frame = +3

Query  60   ALRFIVFVIAMVALAssfshasdpssLQDFCVAVNDSNA-------AVFVNGKICKNPMQ  218
             + F++  +A++A A+  + ASDPS LQDFCVA+ND+ +       AVFVNGK CK+P  
Sbjct  3    GVHFLISTLAILAFATFLASASDPSPLQDFCVAINDTKSPVILNGIAVFVNGKFCKDPKL  62

Query  219  VVANDFLFRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHP  398
              ANDF   G  +P +T NP+GS VTP NV+ + GLNTLGISL RIDF PNGLNPPHTHP
Sbjct  63   ANANDFFLSGFQIPRSTQNPVGSTVTPANVDQIAGLNTLGISLARIDFGPNGLNPPHTHP  122

Query  399  RATEVLLVLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNA  575
            R TE+L+VLEGTLYVGFV SN   G  N LFTK L  GDVFVFP GLIHFQ NVG  NA
Sbjct  123  RGTEILVVLEGTLYVGFVTSN---GDGNRLFTKVLNKGDVFVFPIGLIHFQLNVGHVNA  178



>ref|XP_002325797.2| hypothetical protein POPTR_0019s04340g [Populus trichocarpa]
 gb|EEF00179.2| hypothetical protein POPTR_0019s04340g [Populus trichocarpa]
Length=225

 Score =   200 bits (509),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 113/174 (65%), Positives = 133/174 (76%), Gaps = 7/174 (4%)
 Frame = +3

Query  63   LRFIVFVIAMV--ALAssfshasdpssLQDFCVAVNDSNAAVFVNGKICKNPMQVVANDF  236
            +R + F++A V   LASS + ASDPS LQDFCVA+ND  AAVFVNGK CK+P    ANDF
Sbjct  1    MRSVHFLLAFVLLTLASSIASASDPSPLQDFCVAINDPKAAVFVNGKFCKDPKMATANDF  60

Query  237  LFRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPN-GLNPPHTHPRATEV  413
             F GLN+P +T N +GS VT +NV+ +PGLNTLGISL RID+APN GLNPPHTHPRATE+
Sbjct  61   SFSGLNIPRDTGNRVGSNVTLLNVDQIPGLNTLGISLARIDYAPNGGLNPPHTHPRATEI  120

Query  414  LLVLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNA  575
            L+V+EGTLYVGFV SNP    +N   +K L  GDVFVFP GLIHFQ N+ KT A
Sbjct  121  LVVVEGTLYVGFVTSNP----ENRFISKVLYPGDVFVFPFGLIHFQLNIAKTPA  170



>ref|NP_001267943.1| germin-like protein 4 precursor [Vitis vinifera]
 gb|ABL60873.1| germin-like protein 4 [Vitis vinifera]
Length=220

 Score =   200 bits (508),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 111/175 (63%), Positives = 129/175 (74%), Gaps = 5/175 (3%)
 Frame = +3

Query  51   LDMALRFIVFVIAMVALAssfshasdpssLQDFCVAVNDSNAAVFVNGKICKNPMQVVAN  230
            +   + F+V  +A+VAL SS + ASDPS LQD CVA+++   AVFVNGK CK+P   VA 
Sbjct  1    MKKGVSFLV-TVALVALVSSLASASDPSPLQDTCVAIDEPKDAVFVNGKFCKDPKLTVAE  59

Query  231  DFLFRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATE  410
            DF F GL+ PGNTSN + S VT VNV  + GLNTLGIS+VRID+ P G NPPHTHPRATE
Sbjct  60   DFFFSGLDKPGNTSNAVASNVTTVNVEKIKGLNTLGISMVRIDYEPYGQNPPHTHPRATE  119

Query  411  VLLVLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNA  575
            +L VLEGTLYVGFV SN     +N L +K L  GDVFVFP GLIHFQFNVGKT A
Sbjct  120  ILTVLEGTLYVGFVTSN----TENRLISKVLNKGDVFVFPIGLIHFQFNVGKTKA  170



>gb|KCW80407.1| hypothetical protein EUGRSUZ_C01764 [Eucalyptus grandis]
Length=221

 Score =   199 bits (507),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 102/146 (70%), Positives = 112/146 (77%), Gaps = 5/146 (3%)
 Frame = +3

Query  138  LQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFLFRGLNMPGNTSNPLGSKVTPVNVNNL  317
            LQDFCVA+ND    VFVNGK CK+P QV A+DFLF+G   PGNT+NPLGSKVTP  V+  
Sbjct  26   LQDFCVAINDPE--VFVNGKFCKDPKQVTADDFLFKGFRYPGNTANPLGSKVTPAFVDQF  83

Query  318  PGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLYVGFVLSNPPPGMKNPLFTK  497
            PGLNTLGIS+ RIDFA  GLNPPHTHPR TEVL+V EGTL V FV SN    + N LFTK
Sbjct  84   PGLNTLGISMARIDFALGGLNPPHTHPRGTEVLVVTEGTLLVSFVTSN---QLNNTLFTK  140

Query  498  TLVAGDVFVFPEGLIHFQFNVGKTNA  575
             L  GDVFVFP GLIHFQ N+GKT A
Sbjct  141  VLYKGDVFVFPIGLIHFQLNIGKTPA  166



>ref|XP_002319672.1| hypothetical protein POPTR_0013s04850g [Populus trichocarpa]
 gb|EEE95595.1| hypothetical protein POPTR_0013s04850g [Populus trichocarpa]
Length=221

 Score =   199 bits (507),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 113/172 (66%), Positives = 131/172 (76%), Gaps = 3/172 (2%)
 Frame = +3

Query  60   ALRFIVFVIAMVALAssfshasdpssLQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFL  239
             L+F V V  ++ALASSF+ A DPS LQDFCVAV++++  VFVNGK CK+P  V   DF 
Sbjct  3    GLKF-VLVFVLLALASSFASAFDPSPLQDFCVAVDETDG-VFVNGKFCKDPKDVTEKDFF  60

Query  240  FRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLL  419
              GLN+PG+TS  +GS VT VN+  +PGLNTLGIS  RIDFAP GLNPPHTHPRATE+++
Sbjct  61   SSGLNIPGDTSGRVGSNVTAVNIEKIPGLNTLGISFARIDFAPYGLNPPHTHPRATEIIV  120

Query  420  VLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNA  575
            V+EGTLYVGFV SN   G  N L TK L  GDVFVFP GLIHFQFNVGKT A
Sbjct  121  VVEGTLYVGFVTSNLANG-DNRLITKALKPGDVFVFPIGLIHFQFNVGKTKA  171



>ref|XP_006375871.1| hypothetical protein POPTR_0013s04880g, partial [Populus trichocarpa]
 gb|ERP53668.1| hypothetical protein POPTR_0013s04880g, partial [Populus trichocarpa]
Length=221

 Score =   199 bits (507),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 106/147 (72%), Positives = 114/147 (78%), Gaps = 6/147 (4%)
 Frame = +3

Query  138  LQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFLFRGLNMPGNTSNPLGSKVTPVNVNNL  317
            LQDFCVA+ND+   VFVNGK CK+P     NDF F GLN+  NTSNP+GS VTP NV  +
Sbjct  25   LQDFCVAINDTKD-VFVNGKFCKDPKLATENDFFFPGLNIARNTSNPVGSVVTPANVAQI  83

Query  318  PGLNTLGISLVRIDFAP-NGLNPPHTHPRATEVLLVLEGTLYVGFVLSNPPPGMKNPLFT  494
            PGLNTLGISLVRID+AP  GLNPPHTHPRATE+L VLEGTLYVGFV SNP     N L T
Sbjct  84   PGLNTLGISLVRIDYAPYGGLNPPHTHPRATEILTVLEGTLYVGFVTSNP----DNRLIT  139

Query  495  KTLVAGDVFVFPEGLIHFQFNVGKTNA  575
            K L  GDVFVFP GLIHFQFNVGKT A
Sbjct  140  KVLHPGDVFVFPVGLIHFQFNVGKTKA  166



>ref|XP_011075126.1| PREDICTED: putative germin-like protein 2-1 isoform X1 [Sesamum 
indicum]
Length=216

 Score =   199 bits (506),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 103/146 (71%), Positives = 115/146 (79%), Gaps = 6/146 (4%)
 Frame = +3

Query  138  LQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFLFRGLNMPGNTSNPLGSKVTPVNVNNL  317
            LQDFCVA  DS ++  VNG+ CKNP  V A+DF F GL++PGNTSNP GSKVTPV+V  L
Sbjct  27   LQDFCVA--DSTSSARVNGQPCKNPALVQASDFSFSGLHLPGNTSNPNGSKVTPVSVAQL  84

Query  318  PGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLYVGFVLSNPPPGMKNPLFTK  497
            PGLNTLGIS+VRID+AP G+NPPHTHPRATE+L VLEG+L VGFV SNP     N L TK
Sbjct  85   PGLNTLGISMVRIDYAPWGINPPHTHPRATEILTVLEGSLQVGFVTSNP----DNSLITK  140

Query  498  TLVAGDVFVFPEGLIHFQFNVGKTNA  575
            TL  GDVFVFP GLIHFQ NVG  NA
Sbjct  141  TLQKGDVFVFPVGLIHFQRNVGTGNA  166



>ref|XP_002284320.1| PREDICTED: germin-like protein subfamily 1 member 14 [Vitis vinifera]
 emb|CBI36817.3| unnamed protein product [Vitis vinifera]
Length=220

 Score =   199 bits (506),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 111/175 (63%), Positives = 129/175 (74%), Gaps = 5/175 (3%)
 Frame = +3

Query  51   LDMALRFIVFVIAMVALAssfshasdpssLQDFCVAVNDSNAAVFVNGKICKNPMQVVAN  230
            +   + F+V  +A+VAL SS + ASDPS LQD CVA+++   AVFVNGK CK+P   VA 
Sbjct  1    MKKGVSFLV-TVALVALVSSLASASDPSPLQDTCVAIDEPKDAVFVNGKFCKDPKLTVAE  59

Query  231  DFLFRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATE  410
            DF F GL+ PGNTSN + S VT VNV  + GLNTLGIS+VRID+ P G NPPHTHPRATE
Sbjct  60   DFFFSGLDKPGNTSNAVASNVTTVNVEQIKGLNTLGISMVRIDYEPYGQNPPHTHPRATE  119

Query  411  VLLVLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNA  575
            +L VL GTLYVGFV SNP    +N L +K L  GDVFVFP GLIHFQFNVGKT A
Sbjct  120  ILTVLGGTLYVGFVTSNP----ENRLISKVLNKGDVFVFPIGLIHFQFNVGKTKA  170



>ref|XP_002325370.2| hypothetical protein POPTR_0019s04270g [Populus trichocarpa]
 gb|EEE99751.2| hypothetical protein POPTR_0019s04270g [Populus trichocarpa]
Length=205

 Score =   198 bits (504),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 113/174 (65%), Positives = 132/174 (76%), Gaps = 7/174 (4%)
 Frame = +3

Query  63   LRFIVFVIAMV--ALAssfshasdpssLQDFCVAVNDSNAAVFVNGKICKNPMQVVANDF  236
            +R + F++A V   LASS + ASDPS LQDFCVA+ND  AAVFVNGK CK+P    ANDF
Sbjct  1    MRSVHFLLAFVLLTLASSIASASDPSPLQDFCVAINDPKAAVFVNGKFCKDPKLATANDF  60

Query  237  LFRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPN-GLNPPHTHPRATEV  413
             F GLN+P +T N +GS VT +NV+ +PGLNTLGISL RID+APN GLNPPHTHPRATE+
Sbjct  61   SFSGLNIPRDTGNRVGSNVTLLNVDQIPGLNTLGISLARIDYAPNGGLNPPHTHPRATEI  120

Query  414  LLVLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNA  575
            L+V+EGTLYVGFV SNP     N   +K L  GDVFVFP GLIHFQ N+ KT A
Sbjct  121  LVVVEGTLYVGFVTSNP----DNRFISKVLYPGDVFVFPFGLIHFQLNIAKTPA  170



>emb|CBI36811.3| unnamed protein product [Vitis vinifera]
Length=220

 Score =   199 bits (505),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 111/175 (63%), Positives = 129/175 (74%), Gaps = 5/175 (3%)
 Frame = +3

Query  51   LDMALRFIVFVIAMVALAssfshasdpssLQDFCVAVNDSNAAVFVNGKICKNPMQVVAN  230
            +   + F+V  +A+VAL SS + ASDPS LQD CVA+++   AVFVNGK CK+P   VA 
Sbjct  1    MKKGVSFLV-TVALVALVSSLASASDPSPLQDTCVAIDEPKDAVFVNGKFCKDPNLTVAE  59

Query  231  DFLFRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATE  410
            DF F GL+ PGNTSN   S VT VNV+ + GLNTLGIS+VRID+ P G NPPHTHPRATE
Sbjct  60   DFFFSGLDKPGNTSNAAASNVTTVNVDKIKGLNTLGISMVRIDYEPYGQNPPHTHPRATE  119

Query  411  VLLVLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNA  575
            +L VLEGTLYVGFV SN     +N L +K L  GDVFVFP GLIHFQFNVGKT A
Sbjct  120  ILTVLEGTLYVGFVTSN----TENRLISKVLNKGDVFVFPIGLIHFQFNVGKTKA  170



>ref|XP_008775104.1| PREDICTED: putative germin-like protein 2-1 [Phoenix dactylifera]
Length=222

 Score =   199 bits (505),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 104/146 (71%), Positives = 113/146 (77%), Gaps = 4/146 (3%)
 Frame = +3

Query  138  LQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFLFRGLNMPGNTSNPLGSKVTPVNVNNL  317
            LQDFCVA  D  + + VNG +CK PM V A+DF F GL+MPGNTSN LGSKVT VNVN +
Sbjct  26   LQDFCVA--DLKSPILVNGFVCKPPMHVTADDFFFSGLDMPGNTSNQLGSKVTQVNVNQI  83

Query  318  PGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLYVGFVLSNPPPGMKNPLFTK  497
             GLNTLGISL RID+ P GLNPPHTHPRATEVL VLEGTLY+GFV SN   G  N LFTK
Sbjct  84   AGLNTLGISLARIDYEPYGLNPPHTHPRATEVLTVLEGTLYLGFVTSNTNNG--NLLFTK  141

Query  498  TLVAGDVFVFPEGLIHFQFNVGKTNA  575
             L  GDVFVFP+GLIHFQFN G T A
Sbjct  142  MLKKGDVFVFPQGLIHFQFNYGPTPA  167



>ref|XP_003618162.1| Germin-like protein subfamily 1 member [Medicago truncatula]
 gb|AES74380.1| germin family protein [Medicago truncatula]
 gb|AFK39197.1| unknown [Medicago truncatula]
Length=220

 Score =   199 bits (505),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 111/168 (66%), Positives = 121/168 (72%), Gaps = 7/168 (4%)
 Frame = +3

Query  72   IVFVIAMVALAssfshasdpssLQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFLFRGL  251
            I+FV A +ALAS          LQDFCVA+ND+   VFVNGK CK+P     NDF F   
Sbjct  5    ILFVTAFLALASCAFAFDPSP-LQDFCVAINDTKNGVFVNGKFCKDPKLATPNDFFFSV-  62

Query  252  NMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEG  431
               GNTSNPLGSKVTPV VN++ GLNTLGISL RIDFA  GLNPPHTHPRATE+L+VLEG
Sbjct  63   -KEGNTSNPLGSKVTPVTVNDILGLNTLGISLARIDFASRGLNPPHTHPRATEILIVLEG  121

Query  432  TLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNA  575
            TLYVGFV SNP    +N L TK L  GDVFVFP GLIHFQ NVG  NA
Sbjct  122  TLYVGFVTSNP----ENRLITKVLNKGDVFVFPIGLIHFQLNVGYGNA  165



>ref|XP_002319671.1| hypothetical protein POPTR_0013s04840g [Populus trichocarpa]
 gb|EEE95594.1| hypothetical protein POPTR_0013s04840g [Populus trichocarpa]
Length=221

 Score =   199 bits (505),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 112/172 (65%), Positives = 131/172 (76%), Gaps = 3/172 (2%)
 Frame = +3

Query  60   ALRFIVFVIAMVALAssfshasdpssLQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFL  239
             L+F V V  ++ALASSF+ A DPS LQDFCVAV++++  VFVNGK CK+P  V   DF 
Sbjct  3    GLKF-VLVFVLLALASSFASAFDPSPLQDFCVAVDETDG-VFVNGKFCKDPKDVTEKDFF  60

Query  240  FRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLL  419
              GL++PG+TS  +GS VT VN+  +PGLNTLGIS  RIDFAP GLNPPHTHPRATE+++
Sbjct  61   SSGLDIPGDTSGRVGSNVTAVNIEKIPGLNTLGISFARIDFAPYGLNPPHTHPRATEIIV  120

Query  420  VLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNA  575
            V+EGTLYVGFV SN   G  N L TK L  GDVFVFP GLIHFQFNVGKT A
Sbjct  121  VVEGTLYVGFVTSNLANG-DNRLITKALKPGDVFVFPIGLIHFQFNVGKTKA  171



>ref|XP_006298965.1| hypothetical protein CARUB_v10015090mg [Capsella rubella]
 gb|EOA31863.1| hypothetical protein CARUB_v10015090mg [Capsella rubella]
Length=229

 Score =   199 bits (505),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 112/171 (65%), Positives = 130/171 (76%), Gaps = 4/171 (2%)
 Frame = +3

Query  63   LRFIVFVIAMVALAssfshasdpssLQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFLF  242
            LRF+V    ++A+ASSF    DPS LQDFCVAVND+N  VFVNGK CK+P  V A DF  
Sbjct  5    LRFLVAKAILLAIASSFVSCYDPSPLQDFCVAVNDANG-VFVNGKFCKDPKYVKAEDFFT  63

Query  243  RGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLV  422
             GLN+ GNT N +GS VT VNV+ +PGLNTLG+SLVRIDFAP G NPPHTHPRATE+L++
Sbjct  64   SGLNIAGNTMNRVGSNVTNVNVDKIPGLNTLGVSLVRIDFAPGGQNPPHTHPRATEILVL  123

Query  423  LEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNA  575
            +EGTL VGFV SN      N LF+K L  GDVFVFP G+IHFQ NVG+TNA
Sbjct  124  VEGTLLVGFVTSNQD---NNRLFSKVLYPGDVFVFPVGMIHFQVNVGRTNA  171



>gb|KCW82834.1| hypothetical protein EUGRSUZ_C04205 [Eucalyptus grandis]
Length=223

 Score =   199 bits (505),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 99/146 (68%), Positives = 110/146 (75%), Gaps = 3/146 (2%)
 Frame = +3

Query  138  LQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFLFRGLNMPGNTSNPLGSKVTPVNVNNL  317
            LQD CVA ND  + VFVNGK CK+P Q  A+DF+F GL  PGNTSNPLGSKVT   V   
Sbjct  26   LQDICVATNDLESGVFVNGKFCKDPRQATADDFVFMGLRNPGNTSNPLGSKVTQAFVQQF  85

Query  318  PGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLYVGFVLSNPPPGMKNPLFTK  497
            PGLNTLGIS+ RIDFAP GLNPPHTHPR TE+L+V+EGTL VGFV S+    + N LFTK
Sbjct  86   PGLNTLGISMARIDFAPGGLNPPHTHPRGTELLVVVEGTLLVGFVTSDQ---LNNTLFTK  142

Query  498  TLVAGDVFVFPEGLIHFQFNVGKTNA  575
             L  GDVFVFP GLIHFQ N+G T A
Sbjct  143  VLYKGDVFVFPIGLIHFQLNIGNTYA  168



>ref|XP_011075128.1| PREDICTED: putative germin-like protein 2-1 [Sesamum indicum]
Length=217

 Score =   198 bits (504),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 102/146 (70%), Positives = 115/146 (79%), Gaps = 6/146 (4%)
 Frame = +3

Query  138  LQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFLFRGLNMPGNTSNPLGSKVTPVNVNNL  317
            LQDFCVA  DS ++  VNG+ CKNP  V A+DF F GL++PGNTSNP GSKVTPV+V  L
Sbjct  28   LQDFCVA--DSTSSARVNGQPCKNPALVQASDFSFSGLHLPGNTSNPNGSKVTPVSVAQL  85

Query  318  PGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLYVGFVLSNPPPGMKNPLFTK  497
            PGLNTLGIS+VRID+AP G+NPPHTHPRATE+L VLEG+L VGFV SNP     N L TK
Sbjct  86   PGLNTLGISMVRIDYAPWGINPPHTHPRATEILTVLEGSLQVGFVTSNP----DNSLITK  141

Query  498  TLVAGDVFVFPEGLIHFQFNVGKTNA  575
            TL  GDVFVFP GL+HFQ NVG  NA
Sbjct  142  TLQKGDVFVFPVGLVHFQRNVGTGNA  167



>ref|XP_007030176.1| Germin-like protein subfamily 1 member 18 [Theobroma cacao]
 gb|EOY10678.1| Germin-like protein subfamily 1 member 18 [Theobroma cacao]
Length=295

 Score =   201 bits (510),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 116/172 (67%), Positives = 131/172 (76%), Gaps = 12/172 (7%)
 Frame = +3

Query  84   IAMVALAssfshasdpssLQDFCVAVNDS-NAA------VFVNGKICKNPMQVVANDFLF  242
            I+++ LA SF+ ASDPS LQDFCVA+ D+ N A      +FVNGK CK+P  V A D  F
Sbjct  44   ISLLVLAFSFATASDPSPLQDFCVALRDAQNGAMFSLYFLFVNGKFCKDPKLVKAEDLFF  103

Query  243  RGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAP-NGLNPPHTHPRATEVLL  419
             GLNMPGNTSN LGSK T VNV  +PGLNTLGISL RID+AP  GLNPPHTHPRA+E+L+
Sbjct  104  SGLNMPGNTSNQLGSKFTLVNVEQIPGLNTLGISLARIDYAPYGGLNPPHTHPRASEILV  163

Query  420  VLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNA  575
            V+EGTLYVGFV SNP     N L TK L  GDVFVFP GLIHFQFN+GKTNA
Sbjct  164  VMEGTLYVGFVTSNP----NNHLITKVLYPGDVFVFPVGLIHFQFNIGKTNA  211



>ref|XP_007143990.1| hypothetical protein PHAVU_007G119700g [Phaseolus vulgaris]
 gb|ESW15984.1| hypothetical protein PHAVU_007G119700g [Phaseolus vulgaris]
Length=228

 Score =   199 bits (505),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 113/175 (65%), Positives = 131/175 (75%), Gaps = 8/175 (5%)
 Frame = +3

Query  63   LRFIVFVIAMVALAssfshasdpssLQDFCVAVNDSNAA----VFVNGKICKNPMQVVAN  230
            ++ + F++ ++ALASS + A DPS LQDFCVA+ND+       VFVNGK CK+P    A+
Sbjct  1    MKVVQFLVVLLALASSVAFAYDPSPLQDFCVAINDTKTGGIYGVFVNGKFCKDPKFANAD  60

Query  231  DFLFRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATE  410
            DF FRGL   G+T+NP+GSKVTPV VN + GLNTLGISL RIDFAP GLNPPHTHPR TE
Sbjct  61   DFFFRGLGA-GDTANPVGSKVTPVAVNEILGLNTLGISLARIDFAPKGLNPPHTHPRGTE  119

Query  411  VLLVLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNA  575
            +L+VLEGTLYVGFV SN      N LFTK L  GDVFVFP GLIHFQ NVG  NA
Sbjct  120  ILVVLEGTLYVGFVASNQ---NDNRLFTKVLNKGDVFVFPIGLIHFQQNVGYGNA  171



>ref|XP_010024926.1| PREDICTED: germin-like protein subfamily 1 member 7 [Eucalyptus 
grandis]
 gb|KCW61466.1| hypothetical protein EUGRSUZ_H04202 [Eucalyptus grandis]
Length=223

 Score =   198 bits (504),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 100/146 (68%), Positives = 111/146 (76%), Gaps = 3/146 (2%)
 Frame = +3

Query  138  LQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFLFRGLNMPGNTSNPLGSKVTPVNVNNL  317
            LQD CVA ND N+ VFVNGK CK+P Q  A+DFLF G   PGNTSNPLGSKVT   V+  
Sbjct  26   LQDICVATNDLNSGVFVNGKFCKDPNQASADDFLFTGFRNPGNTSNPLGSKVTTAFVDQF  85

Query  318  PGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLYVGFVLSNPPPGMKNPLFTK  497
            PGLNTLGIS+ R+DFAP GLNPPHTHPR TEVL+V+EGTL VGFV S+    + N LFTK
Sbjct  86   PGLNTLGISMARLDFAPGGLNPPHTHPRGTEVLVVVEGTLLVGFVTSDQ---LNNTLFTK  142

Query  498  TLVAGDVFVFPEGLIHFQFNVGKTNA  575
             L  GDVFVFP GLIHFQ N+G T A
Sbjct  143  VLYKGDVFVFPIGLIHFQLNIGNTYA  168



>ref|XP_006371120.1| hypothetical protein POPTR_0019s04280g [Populus trichocarpa]
 ref|XP_002325371.2| hypothetical protein POPTR_0019s04290g [Populus trichocarpa]
 gb|ERP48917.1| hypothetical protein POPTR_0019s04280g [Populus trichocarpa]
 gb|EEE99752.2| hypothetical protein POPTR_0019s04290g [Populus trichocarpa]
Length=225

 Score =   198 bits (504),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 113/174 (65%), Positives = 132/174 (76%), Gaps = 7/174 (4%)
 Frame = +3

Query  63   LRFIVFVIAMV--ALAssfshasdpssLQDFCVAVNDSNAAVFVNGKICKNPMQVVANDF  236
            +R + F++A V   LASS + ASDPS LQDFCVA+ND  AAVFVNGK CK+P    ANDF
Sbjct  1    MRSVHFLLAFVLLTLASSIASASDPSPLQDFCVAINDPKAAVFVNGKFCKDPKLATANDF  60

Query  237  LFRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPN-GLNPPHTHPRATEV  413
             F GLN+P +T N +GS VT +NV+ +PGLNTLGISL RID+APN GLNPPHTHPRATE+
Sbjct  61   SFSGLNIPRDTGNRVGSNVTLLNVDQIPGLNTLGISLARIDYAPNGGLNPPHTHPRATEI  120

Query  414  LLVLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNA  575
            L+V+EGTLYVGFV SNP     N   +K L  GDVFVFP GLIHFQ N+ KT A
Sbjct  121  LVVVEGTLYVGFVTSNP----DNRFISKVLYPGDVFVFPFGLIHFQLNIAKTPA  170



>ref|XP_003618164.1| Germin-like protein subfamily 1 member [Medicago truncatula]
 gb|AES74382.1| germin family protein [Medicago truncatula]
Length=220

 Score =   198 bits (504),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 104/146 (71%), Positives = 111/146 (76%), Gaps = 6/146 (4%)
 Frame = +3

Query  138  LQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFLFRGLNMPGNTSNPLGSKVTPVNVNNL  317
            LQDFCVA+ND+   VFVNGK CKNP     NDF F      GNTSNPLGSKVTPV VN++
Sbjct  26   LQDFCVAINDTKTGVFVNGKFCKNPKLATPNDFFFSV--KEGNTSNPLGSKVTPVTVNDI  83

Query  318  PGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLYVGFVLSNPPPGMKNPLFTK  497
             GLNTLGISL RIDFA  GLNPPHTHPRATE+L+VLEGTLYVGFV SNP    +N L TK
Sbjct  84   LGLNTLGISLARIDFASRGLNPPHTHPRATEILIVLEGTLYVGFVTSNP----ENRLITK  139

Query  498  TLVAGDVFVFPEGLIHFQFNVGKTNA  575
             L  GDVFVFP GLIHFQ NVG  NA
Sbjct  140  VLNKGDVFVFPIGLIHFQLNVGYGNA  165



>ref|XP_011038439.1| PREDICTED: germin-like protein subfamily 1 member 13 [Populus 
euphratica]
Length=236

 Score =   199 bits (505),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 107/158 (68%), Positives = 115/158 (73%), Gaps = 16/158 (10%)
 Frame = +3

Query  138  LQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFLFRGLNM-----------PGNTSNPLG  284
            LQDFCVA+ND+   VFVNGK CK+P    ANDF F GLN+             NTSNP+G
Sbjct  28   LQDFCVAINDTKDGVFVNGKFCKDPKLATANDFFFSGLNIARDTSNPVGSVARNTSNPVG  87

Query  285  SKVTPVNVNNLPGLNTLGISLVRIDFAP-NGLNPPHTHPRATEVLLVLEGTLYVGFVLSN  461
            S VTP NV  +PGLNTLGISLVRID+AP  GLNPPHTHPRATEV+ VLEGTLYVGFV SN
Sbjct  88   SVVTPANVAQIPGLNTLGISLVRIDYAPYGGLNPPHTHPRATEVITVLEGTLYVGFVTSN  147

Query  462  PPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNA  575
            P     N L TK L  GDVFVFP GLIHFQFNVGKT A
Sbjct  148  P----DNRLITKVLKPGDVFVFPFGLIHFQFNVGKTKA  181



>ref|XP_009341765.1| PREDICTED: germin-like protein subfamily 1 member 17 [Pyrus x 
bretschneideri]
 ref|XP_009349818.1| PREDICTED: germin-like protein subfamily 1 member 17 [Pyrus x 
bretschneideri]
Length=230

 Score =   199 bits (505),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 107/164 (65%), Positives = 126/164 (77%), Gaps = 1/164 (1%)
 Frame = +3

Query  84   IAMVALAssfshasdpssLQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFLFRGLNMPG  263
            ++++A A+  + ASDP  LQDFCVA+N+++ AVFVNGK CK+P    ANDF    L   G
Sbjct  13   LSVLAFATLLASASDPDPLQDFCVAINNTDYAVFVNGKFCKDPNLASANDFFSDKLRYAG  72

Query  264  NTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLYV  443
            NTSNP+GS VT  NV+ +PGLNTLGIS  R+DFAPNG+NPPHTHPRATE+ +VLEG+LYV
Sbjct  73   NTSNPVGSIVTAANVDVIPGLNTLGISFARVDFAPNGVNPPHTHPRATEIFIVLEGSLYV  132

Query  444  GFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNA  575
            GFV SN   G  N LFTK L  GDVFVFP GLIHFQ NVGKTNA
Sbjct  133  GFVTSN-INGDGNRLFTKVLNKGDVFVFPIGLIHFQLNVGKTNA  175



>ref|XP_011046612.1| PREDICTED: germin-like protein subfamily 1 member 16 [Populus 
euphratica]
Length=256

 Score =   199 bits (507),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 111/192 (58%), Positives = 137/192 (71%), Gaps = 5/192 (3%)
 Frame = +3

Query  3    QHKKVFNNCDIVSKNILDMALRFIVFVIAMVALAssfshasdpssLQDFCVAVNDSNAAV  182
            + KK      + S+    M +  ++ V  ++ALASSF  A DPS LQDFCVA++D+N+AV
Sbjct  14   EGKKKRKEFKVASQRRTMMKVAHLIAVFILLALASSFVTAYDPSPLQDFCVAIDDANSAV  73

Query  183  FVNGKICKNPMQVVANDFLFRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDF  362
             VNGK+CKNP     +DF + GL++PGNTSN LG++V  +  + +PGLNTLGISL RID 
Sbjct  74   LVNGKLCKNPGLATPDDFSYSGLDVPGNTSNQLGARVNIITADLMPGLNTLGISLARIDL  133

Query  363  APN-GLNPPHTHPRATEVLLVLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGL  539
            APN GLNPPH HPR +EVLLVLEGTLY GFV SNP     + LFTK L  GD+FVFP GL
Sbjct  134  APNGGLNPPHYHPRGSEVLLVLEGTLYAGFVTSNP----DHRLFTKILKPGDLFVFPFGL  189

Query  540  IHFQFNVGKTNA  575
            IHFQ N+GKT A
Sbjct  190  IHFQLNIGKTPA  201



>ref|XP_010027136.1| PREDICTED: uncharacterized protein LOC104417584 [Eucalyptus grandis]
Length=492

 Score =   206 bits (524),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 109/175 (62%), Positives = 129/175 (74%), Gaps = 5/175 (3%)
 Frame = +3

Query  51   LDMALRFIVFVIAMVALAssfshasdpssLQDFCVAVNDSNAAVFVNGKICKNPMQVVAN  230
            L   ++F+   + ++ALA++ + A DPS LQDFCVA+ND    VFVNGK CK+P QV A+
Sbjct  268  LSTTMKFLPISLLILALATATTFAYDPSPLQDFCVAINDPK--VFVNGKFCKDPKQVTAD  325

Query  231  DFLFRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATE  410
            DFLF+G   PGNT+NPLGSKVTP  V+   GLNTLGIS+ R DFAP GLNPPHTHPR TE
Sbjct  326  DFLFKGFRYPGNTANPLGSKVTPAFVDQFAGLNTLGISMARTDFAPGGLNPPHTHPRGTE  385

Query  411  VLLVLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNA  575
            +L+V EGTL VGFV SN    + N  FTK L  GDVFVFP GLIHFQ N+GKT A
Sbjct  386  ILVVTEGTLLVGFVTSNQ---LNNTFFTKVLYKGDVFVFPIGLIHFQLNIGKTPA  437


 Score =   206 bits (523),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 110/171 (64%), Positives = 129/171 (75%), Gaps = 5/171 (3%)
 Frame = +3

Query  63   LRFIVFVIAMVALAssfshasdpssLQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFLF  242
            ++F+   + ++ALA++ S A DPS LQDFCVA+ND    VFVNGK CK+P QV A+DFLF
Sbjct  1    MKFLPISLLILALATATSFAYDPSPLQDFCVAINDPK--VFVNGKFCKDPKQVTADDFLF  58

Query  243  RGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLV  422
            +G   PGNT NPLGSKVTP  V+ LPGLNTLGIS+ RIDFAP GLNPPHTHPR +E+L+V
Sbjct  59   KGFRYPGNTVNPLGSKVTPAFVDQLPGLNTLGISMARIDFAPGGLNPPHTHPRGSEILVV  118

Query  423  LEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNA  575
             EGTL VGFV  N    + N  FTK L  GDVFVFP GLIHFQ N+GKT A
Sbjct  119  AEGTLLVGFVTFNQ---LNNTFFTKVLYKGDVFVFPIGLIHFQLNIGKTPA  166



>ref|XP_010659615.1| PREDICTED: germin-like protein subfamily 1 member 14 [Vitis vinifera]
 emb|CBI39472.3| unnamed protein product [Vitis vinifera]
Length=220

 Score =   198 bits (503),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 109/175 (62%), Positives = 128/175 (73%), Gaps = 5/175 (3%)
 Frame = +3

Query  51   LDMALRFIVFVIAMVALAssfshasdpssLQDFCVAVNDSNAAVFVNGKICKNPMQVVAN  230
            +   + F+V  +A+VAL SS + ASDPS LQD CVA+++   AVFVNGK CK+P    A 
Sbjct  1    MKKGVSFLV-TVALVALVSSLASASDPSPLQDTCVAIDEPKDAVFVNGKFCKDPKLTEAE  59

Query  231  DFLFRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATE  410
            DF F GL+ PGNTSNP+ S VT VNV  + GLNTLGIS+VRID+ P G NPPHTHPRATE
Sbjct  60   DFFFSGLDKPGNTSNPVASNVTTVNVEQIKGLNTLGISMVRIDYEPYGQNPPHTHPRATE  119

Query  411  VLLVLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNA  575
            +L VLEGTLYVGFV SN     ++   +K L  GDVFVFP GLIHFQFNVGKT A
Sbjct  120  ILTVLEGTLYVGFVTSN----TEDRFISKVLNKGDVFVFPIGLIHFQFNVGKTKA  170



>ref|XP_006371122.1| Germin-like protein subfamily 1 member 6 precursor [Populus trichocarpa]
 gb|ERP48919.1| Germin-like protein subfamily 1 member 6 precursor [Populus trichocarpa]
Length=224

 Score =   198 bits (504),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 112/174 (64%), Positives = 131/174 (75%), Gaps = 7/174 (4%)
 Frame = +3

Query  63   LRFIVFVIAMV--ALAssfshasdpssLQDFCVAVNDSNAAVFVNGKICKNPMQVVANDF  236
            +R + F++A V   LASS + A DPS LQDFCVA+ND  AAVFVNGK C +P    ANDF
Sbjct  1    MRSVHFLLAFVLLTLASSIASAYDPSPLQDFCVAINDPKAAVFVNGKFCTDPKMATANDF  60

Query  237  LFRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPN-GLNPPHTHPRATEV  413
             F GLN+P NT N +GS VT +NV+ +PGLNTLGISL RID+APN GLNPPHTHPRA+E+
Sbjct  61   SFSGLNIPRNTGNRVGSNVTLLNVDQIPGLNTLGISLARIDYAPNGGLNPPHTHPRASEI  120

Query  414  LLVLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNA  575
            L+V+EGTLYVGFV SNP     N L +K L  GDVFVFP GLIHFQ N+ KT A
Sbjct  121  LVVVEGTLYVGFVTSNP----DNRLISKVLYPGDVFVFPFGLIHFQLNIAKTPA  170



>ref|XP_010464157.1| PREDICTED: germin-like protein subfamily 1 member 7 [Camelina 
sativa]
Length=225

 Score =   198 bits (504),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 112/171 (65%), Positives = 130/171 (76%), Gaps = 4/171 (2%)
 Frame = +3

Query  63   LRFIVFVIAMVALAssfshasdpssLQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFLF  242
            LRF+V    ++ALASSF    DPS LQDFCVAV+D+N  VFVNGK CK+P  V A DF  
Sbjct  5    LRFLVAKAILLALASSFVSCYDPSPLQDFCVAVDDANG-VFVNGKFCKDPKYVKAEDFFT  63

Query  243  RGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLV  422
             GLN+ GNT N +GS VT VNV+ +PGLNTLG+SLVRIDFAP G NPPHTHPRATE+L++
Sbjct  64   SGLNIAGNTMNRVGSNVTNVNVDRIPGLNTLGVSLVRIDFAPGGQNPPHTHPRATEILVL  123

Query  423  LEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNA  575
            +EGTL VGFV SN      N LF+K L  GDVFVFP G+IHFQ NVG+TNA
Sbjct  124  VEGTLLVGFVTSNQD---NNRLFSKVLYPGDVFVFPIGMIHFQVNVGRTNA  171



>gb|KFK24125.1| hypothetical protein AALP_AAs58370U000100 [Arabis alpina]
Length=229

 Score =   198 bits (504),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 111/168 (66%), Positives = 126/168 (75%), Gaps = 5/168 (3%)
 Frame = +3

Query  78   FVIAMV--ALAssfshasdpssLQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFLFRGL  251
            FVIA +  ALA  F  A DPS LQDFCVA++  +  VFVNGK CK+P QV A DF F GL
Sbjct  6    FVIAFITLALAIPFGDAYDPSPLQDFCVAIDKLDNGVFVNGKFCKDPKQVKAEDFFFSGL  65

Query  252  NMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEG  431
            N+ GNT N + S VT VNV NLPGLNT+GISLVRID+AP G NPPHTHPR TE+L+++EG
Sbjct  66   NIAGNTDNDVKSNVTTVNVENLPGLNTMGISLVRIDYAPYGQNPPHTHPRGTEILVLVEG  125

Query  432  TLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNA  575
            TLYVGFV SN     KN LFTK L  GDVFVFP G+IHFQ N+GKT A
Sbjct  126  TLYVGFVSSNQD---KNRLFTKILHPGDVFVFPIGMIHFQVNIGKTPA  170



>emb|CAN72946.1| hypothetical protein VITISV_034968 [Vitis vinifera]
Length=714

 Score =   209 bits (533),  Expect = 6e-60, Method: Composition-based stats.
 Identities = 108/164 (66%), Positives = 121/164 (74%), Gaps = 4/164 (2%)
 Frame = +3

Query  84   IAMVALAssfshasdpssLQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFLFRGLNMPG  263
            IA++A++   +  SDPS LQDFCV VND+   VFVNGK+CK+P    ANDF F GL +P 
Sbjct  9    IALLAMSFFLASVSDPSPLQDFCVVVNDTKTTVFVNGKVCKDPKVATANDFFFSGLQVPR  68

Query  264  NTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLYV  443
            NTSN L S VT  NV  +P LNTL ISL RID+AP GLNPPHTHPRATE+L VLEGTLYV
Sbjct  69   NTSNKLESMVTQANVAQIPELNTLSISLARIDYAPYGLNPPHTHPRATEILTVLEGTLYV  128

Query  444  GFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNA  575
            GFV SNP     N L +K L  GDVFVFPEGLIHFQ NVGKT A
Sbjct  129  GFVTSNP----DNRLISKVLYKGDVFVFPEGLIHFQLNVGKTKA  168



>ref|NP_187246.1| germin-like protein subfamily 1 member 7 [Arabidopsis thaliana]
 sp|Q9SFF9.1|GL17_ARATH RecName: Full=Germin-like protein subfamily 1 member 7; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAF23221.1|AC013454_8 germin-like protein [Arabidopsis thaliana]
 gb|AAF26097.1|AC012393_23 germin-like protein [Arabidopsis thaliana]
 dbj|BAF01026.1| germin-like protein [Arabidopsis thaliana]
 gb|AEE74322.1| germin-like protein subfamily 1 member 7 [Arabidopsis thaliana]
Length=229

 Score =   198 bits (504),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 112/171 (65%), Positives = 130/171 (76%), Gaps = 4/171 (2%)
 Frame = +3

Query  63   LRFIVFVIAMVALAssfshasdpssLQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFLF  242
            LRF+V    ++ALASSF    DPS LQDFCVAV+D+ + VFVNGK CK+P  V A DF  
Sbjct  5    LRFLVAKAILLALASSFVSCYDPSPLQDFCVAVDDA-SGVFVNGKFCKDPKYVKAEDFFT  63

Query  243  RGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLV  422
             GLN+ GNT N +GS VT VNV+ +PGLNTLG+SLVRIDFAP G NPPHTHPRATE+L+V
Sbjct  64   SGLNIAGNTINRVGSNVTNVNVDKIPGLNTLGVSLVRIDFAPGGQNPPHTHPRATEILVV  123

Query  423  LEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNA  575
            +EGTL VGFV SN      N LF+K L  GDVFVFP G+IHFQ NVG+TNA
Sbjct  124  VEGTLLVGFVTSNQD---NNRLFSKVLYPGDVFVFPIGMIHFQVNVGRTNA  171



>ref|XP_010024924.1| PREDICTED: germin-like protein subfamily 1 member 7 [Eucalyptus 
grandis]
 gb|KCW61464.1| hypothetical protein EUGRSUZ_H04200 [Eucalyptus grandis]
Length=223

 Score =   198 bits (503),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 99/146 (68%), Positives = 111/146 (76%), Gaps = 3/146 (2%)
 Frame = +3

Query  138  LQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFLFRGLNMPGNTSNPLGSKVTPVNVNNL  317
            LQD CVA ND N+ VFVNGK CK+P Q  A+DFLF G   PGNTSNPLGSKVT   V+  
Sbjct  26   LQDICVATNDLNSGVFVNGKFCKDPNQASADDFLFTGFRNPGNTSNPLGSKVTTAFVDQF  85

Query  318  PGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLYVGFVLSNPPPGMKNPLFTK  497
            PGLNTLGIS+ R+DFAP GLNPPHTHPR TE+L+V+EGTL VGFV S+    + N LFTK
Sbjct  86   PGLNTLGISMARLDFAPGGLNPPHTHPRGTEILVVVEGTLLVGFVTSDQ---LNNTLFTK  142

Query  498  TLVAGDVFVFPEGLIHFQFNVGKTNA  575
             L  GDVFVFP GLIHFQ N+G T A
Sbjct  143  VLYKGDVFVFPIGLIHFQLNIGNTYA  168



>ref|XP_004290344.1| PREDICTED: germin-like protein subfamily 1 member 18-like [Fragaria 
vesca subsp. vesca]
Length=230

 Score =   198 bits (504),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 103/147 (70%), Positives = 113/147 (77%), Gaps = 5/147 (3%)
 Frame = +3

Query  138  LQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFLFRGLNMPGNTSNPLGSKVTPVNVNNL  317
            LQDFCVA+   N  VFVNGK CK+P  V  +DF F GL MPGNTSN +GSKVTP NV  +
Sbjct  33   LQDFCVAL--KNTDVFVNGKFCKDPKLVTEDDFFFSGLRMPGNTSNAVGSKVTPANVEQI  90

Query  318  PGLNTLGISLVRIDFAPN-GLNPPHTHPRATEVLLVLEGTLYVGFVLSNPPPGMKNPLFT  494
             GLNTLGISL RID+APN GLNPPHTHPRA+E L+V+EGTLYVGFV SN   G  N LFT
Sbjct  91   AGLNTLGISLARIDYAPNGGLNPPHTHPRASEFLVVMEGTLYVGFVTSNTDNG--NKLFT  148

Query  495  KTLVAGDVFVFPEGLIHFQFNVGKTNA  575
            K L  GDVFVFP GLIHFQFN+GK  A
Sbjct  149  KVLYPGDVFVFPVGLIHFQFNIGKVKA  175



>ref|XP_003618167.1| Germin-like protein [Medicago truncatula]
 gb|AES74385.1| germin family protein [Medicago truncatula]
Length=220

 Score =   198 bits (503),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 110/167 (66%), Positives = 121/167 (72%), Gaps = 7/167 (4%)
 Frame = +3

Query  75   VFVIAMVALAssfshasdpssLQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFLFRGLN  254
            +FV A +ALAS          LQDFCVA+ND+   VFVNGK+CK+P     NDF F    
Sbjct  6    LFVTAFLALASCAFAFDPSP-LQDFCVAINDTKNGVFVNGKVCKDPKLATPNDFFFSV--  62

Query  255  MPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGT  434
              GNTSNPLGSKVTPV VN++ GLNTLGISL RIDFA  GLNPPHTHPRATE+L+VLEGT
Sbjct  63   KEGNTSNPLGSKVTPVTVNDILGLNTLGISLARIDFASRGLNPPHTHPRATEILIVLEGT  122

Query  435  LYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNA  575
            LYVGFV SNP    +N L TK L  GDVFVFP GLIHFQ NVG  NA
Sbjct  123  LYVGFVTSNP----ENRLITKVLNKGDVFVFPIGLIHFQLNVGYGNA  165



>ref|XP_010049996.1| PREDICTED: germin-like protein subfamily 1 member 7 [Eucalyptus 
grandis]
 gb|KCW82841.1| hypothetical protein EUGRSUZ_C04212 [Eucalyptus grandis]
Length=223

 Score =   198 bits (503),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 99/146 (68%), Positives = 110/146 (75%), Gaps = 3/146 (2%)
 Frame = +3

Query  138  LQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFLFRGLNMPGNTSNPLGSKVTPVNVNNL  317
            LQD CVA ND  + VFVNGK CK+P Q  A+DF+F GL  PGNTSNPLGSKVT   V   
Sbjct  26   LQDICVATNDLESGVFVNGKFCKDPKQATADDFVFMGLRNPGNTSNPLGSKVTQAFVQQF  85

Query  318  PGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLYVGFVLSNPPPGMKNPLFTK  497
            PGLNTLGIS+ RIDFAP GLNPPHTHPR TE+L+V+EGTL VGFV S+    + N LFTK
Sbjct  86   PGLNTLGISMARIDFAPGGLNPPHTHPRGTELLVVVEGTLLVGFVTSDQ---LNNTLFTK  142

Query  498  TLVAGDVFVFPEGLIHFQFNVGKTNA  575
             L  GDVFVFP GLIHFQ N+G T A
Sbjct  143  VLYKGDVFVFPIGLIHFQLNIGNTYA  168



>ref|XP_010049995.1| PREDICTED: germin-like protein subfamily 1 member 7 [Eucalyptus 
grandis]
 ref|XP_010042080.1| PREDICTED: germin-like protein subfamily 1 member 7 [Eucalyptus 
grandis]
 gb|KCW82840.1| hypothetical protein EUGRSUZ_C04211 [Eucalyptus grandis]
Length=223

 Score =   198 bits (503),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 99/146 (68%), Positives = 110/146 (75%), Gaps = 3/146 (2%)
 Frame = +3

Query  138  LQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFLFRGLNMPGNTSNPLGSKVTPVNVNNL  317
            LQD CVA ND  + VFVNGK CK+P Q  A+DF+F GL  PGNTSNPLGSKVT   V   
Sbjct  26   LQDICVATNDLESGVFVNGKFCKDPKQATADDFVFMGLRNPGNTSNPLGSKVTQAFVQQF  85

Query  318  PGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLYVGFVLSNPPPGMKNPLFTK  497
            PGLNTLGIS+ RIDFAP GLNPPHTHPR TE+L+V+EGTL VGFV S+    + N LFTK
Sbjct  86   PGLNTLGISMARIDFAPGGLNPPHTHPRGTELLVVVEGTLLVGFVTSDQ---LNNTLFTK  142

Query  498  TLVAGDVFVFPEGLIHFQFNVGKTNA  575
             L  GDVFVFP GLIHFQ N+G T A
Sbjct  143  VLYKGDVFVFPIGLIHFQLNIGNTYA  168



>ref|XP_010049993.1| PREDICTED: germin-like protein subfamily 1 member 7 [Eucalyptus 
grandis]
 gb|KCW82839.1| hypothetical protein EUGRSUZ_C04210 [Eucalyptus grandis]
Length=223

 Score =   198 bits (503),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 99/146 (68%), Positives = 110/146 (75%), Gaps = 3/146 (2%)
 Frame = +3

Query  138  LQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFLFRGLNMPGNTSNPLGSKVTPVNVNNL  317
            LQD CVA ND  + VFVNGK CK+P Q  A+DF+F GL  PGNTSNPLGSKVT   V   
Sbjct  26   LQDICVATNDLESGVFVNGKFCKDPKQATADDFVFMGLRNPGNTSNPLGSKVTQAFVQQF  85

Query  318  PGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLYVGFVLSNPPPGMKNPLFTK  497
            PGLNTLGIS+ RIDFAP GLNPPHTHPR TE+L+V+EGTL VGFV S+    + N LFTK
Sbjct  86   PGLNTLGISMARIDFAPGGLNPPHTHPRGTELLVVVEGTLLVGFVTSDQ---LNNTLFTK  142

Query  498  TLVAGDVFVFPEGLIHFQFNVGKTNA  575
             L  GDVFVFP GLIHFQ N+G T A
Sbjct  143  VLYKGDVFVFPIGLIHFQLNIGNTYA  168



>ref|XP_008808106.1| PREDICTED: putative germin-like protein 2-1 isoform X1 [Phoenix 
dactylifera]
Length=222

 Score =   198 bits (503),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 104/146 (71%), Positives = 112/146 (77%), Gaps = 4/146 (3%)
 Frame = +3

Query  138  LQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFLFRGLNMPGNTSNPLGSKVTPVNVNNL  317
            LQDFCVA  D  + V VNG +CK PM V A+DF F G +MPGNTSN LGSKVT VNVN +
Sbjct  26   LQDFCVA--DLKSPVLVNGFVCKPPMHVTADDFFFSGHDMPGNTSNQLGSKVTQVNVNQI  83

Query  318  PGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLYVGFVLSNPPPGMKNPLFTK  497
             GLNTLGISL RID+AP GLNPPHTHPRATE+L VLEGTLYVGFV +N   G  N LFTK
Sbjct  84   AGLNTLGISLARIDYAPYGLNPPHTHPRATEILTVLEGTLYVGFVTTNTNNG--NLLFTK  141

Query  498  TLVAGDVFVFPEGLIHFQFNVGKTNA  575
                GDVFVFPEGLIHFQFN G T A
Sbjct  142  MFKKGDVFVFPEGLIHFQFNYGPTPA  167



>ref|XP_010027140.1| PREDICTED: uncharacterized protein LOC104417587 [Eucalyptus grandis]
Length=549

 Score =   207 bits (526),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 110/171 (64%), Positives = 132/171 (77%), Gaps = 4/171 (2%)
 Frame = +3

Query  63   LRFIVFVIAMVALAssfshasdpssLQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFLF  242
            ++F++    ++ALASS + ASDPS LQDFCVA+NDSN+AV VNGK CK+P   VA+DF F
Sbjct  2    MKFLL-TFVLLALASSHAFASDPSPLQDFCVAINDSNSAVLVNGKFCKDPKLAVADDFSF  60

Query  243  RGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLV  422
                 PGNTSNPLGSKVT   V+  PGLNTLGI++ R+DFAP GLNPPH HPR TE+L+V
Sbjct  61   TKFRYPGNTSNPLGSKVTTAFVDQFPGLNTLGITMARLDFAPYGLNPPHIHPRGTEMLVV  120

Query  423  LEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNA  575
            +EGTLYVGFV SN    + N LFTK L  GDVFVFP+GLIHFQ N+G+ NA
Sbjct  121  VEGTLYVGFVTSN---QLNNTLFTKVLTKGDVFVFPQGLIHFQLNIGQANA  168


 Score =   207 bits (526),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 109/162 (67%), Positives = 124/162 (77%), Gaps = 3/162 (2%)
 Frame = +3

Query  90   MVALAssfshasdpssLQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFLFRGLNMPGNT  269
            ++ALA++ + A DPS LQD CVA+ND  +AVFVNG+ CK+P Q  A+DF F G+  PGNT
Sbjct  336  ILALATTTAFAYDPSPLQDICVAINDPKSAVFVNGEFCKDPKQANADDFTFMGVRKPGNT  395

Query  270  SNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLYVGF  449
            +NPLGSKVTP  VN  PGLNTLGIS  RIDFAP GLNPPHTHPR TEVL+V+EGTL VGF
Sbjct  396  ANPLGSKVTPATVNEFPGLNTLGISAARIDFAPGGLNPPHTHPRGTEVLVVIEGTLLVGF  455

Query  450  VLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNA  575
            V SN    + N LFTK L  GDVFVFP GLIHFQ N GKT A
Sbjct  456  VTSN---QLNNTLFTKVLYKGDVFVFPIGLIHFQLNTGKTPA  494


 Score = 55.1 bits (131),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 35/58 (60%), Gaps = 3/58 (5%)
 Frame = -2

Query  568  VFPTLNWK*MRPSGNTNTSPATKVLVNRGFFMPGGGFESTNPT*RVPSKTSRTSVARG  395
            VFP  +WK MRP GNTNTSP    LV R  F      + T PT  VPS T+RTSV RG
Sbjct  261  VFPMFSWKWMRPIGNTNTSPLYNTLVKRVLF---NWLDVTKPTSSVPSVTTRTSVPRG  315



>ref|XP_010049991.1| PREDICTED: germin-like protein subfamily 1 member 7 [Eucalyptus 
grandis]
 gb|KCW82836.1| hypothetical protein EUGRSUZ_C04207 [Eucalyptus grandis]
Length=223

 Score =   198 bits (503),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 99/146 (68%), Positives = 110/146 (75%), Gaps = 3/146 (2%)
 Frame = +3

Query  138  LQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFLFRGLNMPGNTSNPLGSKVTPVNVNNL  317
            LQD CVA ND  + VFVNGK CK+P Q  A+DF+F GL  PGNTSNPLGSKVT   V   
Sbjct  26   LQDICVATNDLESGVFVNGKFCKDPKQATADDFVFMGLRNPGNTSNPLGSKVTQAFVQQF  85

Query  318  PGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLYVGFVLSNPPPGMKNPLFTK  497
            PGLNTLGIS+ RIDFAP GLNPPHTHPR TE+L+V+EGTL VGFV S+    + N LFTK
Sbjct  86   PGLNTLGISMARIDFAPGGLNPPHTHPRGTELLVVVEGTLLVGFVTSDQ---LNNTLFTK  142

Query  498  TLVAGDVFVFPEGLIHFQFNVGKTNA  575
             L  GDVFVFP GLIHFQ N+G T A
Sbjct  143  VLYKGDVFVFPIGLIHFQLNIGNTYA  168



>ref|XP_008776810.1| PREDICTED: putative germin-like protein 2-1 isoform X1 [Phoenix 
dactylifera]
Length=203

 Score =   197 bits (501),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 104/146 (71%), Positives = 114/146 (78%), Gaps = 5/146 (3%)
 Frame = +3

Query  138  LQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFLFRGLNMPGNTSNPLGSKVTPVNVNNL  317
            LQDFC+  +D   AV VNG +CK PM V A+DF F GL+MP NTSN LGSKVT VNVN +
Sbjct  8    LQDFCLLPSD---AVLVNGFVCKPPMHVTADDFFFSGLDMPDNTSNQLGSKVTLVNVNQI  64

Query  318  PGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLYVGFVLSNPPPGMKNPLFTK  497
             GLNTLGISL RID+AP GLNPPHTHP+ATE+L VLEGTLYVGFV SN   G  N LFTK
Sbjct  65   AGLNTLGISLARIDYAPYGLNPPHTHPQATEILTVLEGTLYVGFVTSNTNNG--NLLFTK  122

Query  498  TLVAGDVFVFPEGLIHFQFNVGKTNA  575
             L  GDVFVFPEGLIHFQFN G T+A
Sbjct  123  MLKKGDVFVFPEGLIHFQFNYGPTHA  148



>ref|XP_011075119.1| PREDICTED: putative germin-like protein 2-1 isoform X1 [Sesamum 
indicum]
Length=216

 Score =   197 bits (502),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 102/146 (70%), Positives = 115/146 (79%), Gaps = 6/146 (4%)
 Frame = +3

Query  138  LQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFLFRGLNMPGNTSNPLGSKVTPVNVNNL  317
            LQDFCVA  DS ++  VNG+ CKNP  V A+DF F GL++PGNTSNP GS+VTPV+V  L
Sbjct  27   LQDFCVA--DSTSSARVNGQPCKNPALVQASDFSFSGLHLPGNTSNPNGSRVTPVSVAQL  84

Query  318  PGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLYVGFVLSNPPPGMKNPLFTK  497
            PGLNTLGIS+VRID+AP G+NPPHTHPRATE+L VLEG+L VGFV SNP     N L TK
Sbjct  85   PGLNTLGISIVRIDYAPWGINPPHTHPRATEILTVLEGSLQVGFVTSNP----DNSLITK  140

Query  498  TLVAGDVFVFPEGLIHFQFNVGKTNA  575
            TL  GDVFVFP GLIHFQ NVG  NA
Sbjct  141  TLQKGDVFVFPVGLIHFQRNVGTGNA  166



>emb|CAN71140.1| hypothetical protein VITISV_005471 [Vitis vinifera]
Length=220

 Score =   197 bits (502),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 102/146 (70%), Positives = 115/146 (79%), Gaps = 4/146 (3%)
 Frame = +3

Query  138  LQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFLFRGLNMPGNTSNPLGSKVTPVNVNNL  317
            LQD CVA+++   AVFVNGK CKNP   VA DF  +GLN+PGNTSN +GS VT VNV+ +
Sbjct  29   LQDTCVAIDEPKNAVFVNGKFCKNPNLTVAEDFFSKGLNIPGNTSNLVGSSVTTVNVDVI  88

Query  318  PGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLYVGFVLSNPPPGMKNPLFTK  497
            PGLNTLGISLVRID+AP G NPPHTHPRATE+L VLEGTL VGFV SNP    +N LF+K
Sbjct  89   PGLNTLGISLVRIDYAPYGQNPPHTHPRATEILTVLEGTLLVGFVTSNP----QNRLFSK  144

Query  498  TLVAGDVFVFPEGLIHFQFNVGKTNA  575
             L  GDVFVFP GLIHFQFN+G  NA
Sbjct  145  VLNKGDVFVFPIGLIHFQFNIGHFNA  170



>gb|KHN14792.1| Germin-like protein subfamily 1 member 7 [Glycine soja]
Length=232

 Score =   198 bits (503),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 113/175 (65%), Positives = 128/175 (73%), Gaps = 8/175 (5%)
 Frame = +3

Query  63   LRFIVFVIAMVALAssfshasdpssLQDFCVAVNDSNAA----VFVNGKICKNPMQVVAN  230
            ++ +   + ++ALASS + A DPS LQDFCVA+ND+ A     VFVNGK CK+P    A+
Sbjct  1    MKVVYLFVVLMALASSVAFAYDPSPLQDFCVAINDTKAGGLYGVFVNGKFCKDPKFAYAD  60

Query  231  DFLFRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATE  410
            DF F GL  PGNT+NP GSKVT V VN + GLNTLGISL RIDFAP GLNPPHTHPR TE
Sbjct  61   DFFFGGLG-PGNTANPQGSKVTAVTVNEILGLNTLGISLARIDFAPKGLNPPHTHPRGTE  119

Query  411  VLLVLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNA  575
            +L+VLEGTLYVGFV SN      N LFTK L  GDVFVFP GLIHFQ NVG  NA
Sbjct  120  ILVVLEGTLYVGFVASNQ---NDNRLFTKVLYKGDVFVFPIGLIHFQQNVGYGNA  171



>emb|CBI36790.3| unnamed protein product [Vitis vinifera]
Length=207

 Score =   197 bits (501),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 102/146 (70%), Positives = 115/146 (79%), Gaps = 4/146 (3%)
 Frame = +3

Query  138  LQDFCVAVNDSNAAVFVNGKICKNPMQVVANDFLFRGLNMPGNTSNPLGSKVTPVNVNNL  317
            LQD CVA+++   AVFVNGK CKNP   VA DF  +GLN+PGNTSN +GS VT VNV+ +
Sbjct  16   LQDTCVAIDEPKNAVFVNGKFCKNPNLTVAEDFFSKGLNIPGNTSNLVGSSVTTVNVDVI  75

Query  318  PGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLYVGFVLSNPPPGMKNPLFTK  497
            PGLNTLGISLVRID+AP G NPPHTHPRATE+L VLEGTL VGFV SNP    +N LF+K
Sbjct  76   PGLNTLGISLVRIDYAPYGQNPPHTHPRATEILTVLEGTLLVGFVTSNP----QNRLFSK  131

Query  498  TLVAGDVFVFPEGLIHFQFNVGKTNA  575
             L  GDVFVFP GLIHFQFN+G  NA
Sbjct  132  VLNKGDVFVFPIGLIHFQFNIGHMNA  157



>emb|CBI39477.3| unnamed protein product [Vitis vinifera]
Length=220

 Score =   197 bits (502),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 108/173 (62%), Positives = 129/173 (75%), Gaps = 6/173 (3%)
 Frame = +3

Query  63   LRFIVFVIA--MVALAssfshasdpssLQDFCVAVNDSNAAVFVNGKICKNPMQVVANDF  236
            +R + F++A   + LA S ++A DPS LQD CVA++D  AAVFVNGK CK+P      DF
Sbjct  2    VRGVHFLVAATFMGLAFSLAYAYDPSPLQDTCVAIDDPKAAVFVNGKFCKDPKLATPEDF  61

Query  237  LFRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVL  416
             F GL++P NTSNP+GS VTPVNV  + GLNTLGIS+ R+D+AP GLNPPHTHPRATE+L
Sbjct  62   FFSGLHIPRNTSNPVGSTVTPVNVAQIAGLNTLGISMARVDYAPYGLNPPHTHPRATEIL  121

Query  417  LVLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNA  575
            +VL+GTLYVGFV SNP     N L +K L  GDVFVFP  LIHFQ NVG TNA
Sbjct  122  VVLKGTLYVGFVTSNP----DNRLISKVLNKGDVFVFPISLIHFQLNVGHTNA  170



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 660000809442