BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c24325_g1_i1 len=950 path=[2831:0-204 3410:205-209 1090:210-213
3418:214-233 1113:234-336 113:337-603 1480:604-648 3513:649-776
755:777-792 771:793-827 3272:828-828 1700:829-949]

Length=950
                                                                      Score     E

ref|XP_009784933.1|  PREDICTED: germin-like protein subfamily 1 m...    365   2e-123   
ref|XP_009795503.1|  PREDICTED: germin-like protein subfamily 1 m...    364   4e-123   
ref|XP_009612542.1|  PREDICTED: putative germin-like protein 2-1        360   2e-121   
ref|XP_009612543.1|  PREDICTED: germin-like protein subfamily 1 m...    359   4e-121   
ref|XP_009625530.1|  PREDICTED: putative germin-like protein 2-1        358   8e-121   
ref|XP_009627660.1|  PREDICTED: germin-like protein subfamily 1 m...    358   1e-120   
ref|XP_009620404.1|  PREDICTED: germin-like protein subfamily 1 m...    358   1e-120   
gb|EYU20539.1|  hypothetical protein MIMGU_mgv1a013072mg                357   3e-120   
ref|XP_009795501.1|  PREDICTED: putative germin-like protein 2-1        357   4e-120   
gb|EYU38444.1|  hypothetical protein MIMGU_mgv1a013102mg                356   6e-120   
gb|EYU20535.1|  hypothetical protein MIMGU_mgv1a013054mg                356   6e-120   
ref|XP_011099651.1|  PREDICTED: germin-like protein subfamily 1 m...    356   1e-119   
ref|XP_009786127.1|  PREDICTED: putative germin-like protein 2-1        355   1e-119   
gb|EYU40211.1|  hypothetical protein MIMGU_mgv1a013108mg                355   2e-119   
ref|XP_009620917.1|  PREDICTED: germin-like protein subfamily 1 m...    354   4e-119   
gb|EYU28622.1|  hypothetical protein MIMGU_mgv1a018753mg                354   5e-119   
ref|XP_009612541.1|  PREDICTED: germin-like protein subfamily 1 m...    354   6e-119   
gb|EYU20546.1|  hypothetical protein MIMGU_mgv1a013111mg                353   2e-118   
ref|XP_006349261.1|  PREDICTED: putative germin-like protein 2-1-...    352   2e-118   
gb|EYU20549.1|  hypothetical protein MIMGU_mgv1a020596mg                352   3e-118   
ref|XP_004230404.1|  PREDICTED: putative germin-like protein 2-1        351   9e-118   
ref|XP_006349267.1|  PREDICTED: germin-like protein subfamily 1 m...    349   4e-117   
ref|XP_004230403.1|  PREDICTED: putative germin-like protein 2-1        349   4e-117   
gb|EYU40209.1|  hypothetical protein MIMGU_mgv1a013129mg                349   5e-117   
gb|EYU20541.1|  hypothetical protein MIMGU_mgv1a018988mg                349   6e-117   
gb|EYU20545.1|  hypothetical protein MIMGU_mgv1a020779mg                348   7e-117   
ref|XP_009786129.1|  PREDICTED: putative germin-like protein 2-1        348   8e-117   
ref|XP_006358459.1|  PREDICTED: germin-like protein subfamily 1 m...    348   8e-117   
ref|XP_006349264.1|  PREDICTED: germin-like protein subfamily 1 m...    348   1e-116   
ref|XP_006358463.1|  PREDICTED: germin-like protein subfamily 1 m...    348   1e-116   
gb|EYU40208.1|  hypothetical protein MIMGU_mgv1a020439mg                348   1e-116   
gb|EYU20548.1|  hypothetical protein MIMGU_mgv1a013109mg                348   1e-116   
gb|EYU20542.1|  hypothetical protein MIMGU_mgv1a020630mg                348   1e-116   
gb|AFW90592.1|  germin-like protein subfamily 1 member 20 precursor     347   2e-116   
gb|EYU20540.1|  hypothetical protein MIMGU_mgv1a013117mg                347   2e-116   
gb|EYU20547.1|  hypothetical protein MIMGU_mgv1a023357mg                347   2e-116   
gb|EYU40210.1|  hypothetical protein MIMGU_mgv1a022317mg                347   4e-116   
gb|EYU20536.1|  hypothetical protein MIMGU_mgv1a025658mg                347   4e-116   
ref|XP_006346966.1|  PREDICTED: putative germin-like protein 2-1-...    346   7e-116   
ref|XP_006349268.1|  PREDICTED: germin-like protein subfamily 1 m...    346   9e-116   
ref|XP_004230405.1|  PREDICTED: germin-like protein subfamily 1 m...    345   2e-115   
ref|XP_006358464.1|  PREDICTED: germin-like protein subfamily 1 m...    344   5e-115   
ref|XP_006358462.1|  PREDICTED: germin-like protein subfamily 1 m...    343   6e-115   
ref|XP_006349265.1|  PREDICTED: germin-like protein subfamily 1 m...    343   9e-115   
ref|XP_006349263.1|  PREDICTED: germin-like protein subfamily 1 m...    337   2e-112   
ref|XP_006358461.1|  PREDICTED: germin-like protein subfamily 1 m...    337   4e-112   
ref|XP_006358460.1|  PREDICTED: LOW QUALITY PROTEIN: germin-like ...    332   2e-110   
ref|XP_011099652.1|  PREDICTED: putative germin-like protein 2-1        332   2e-110   
emb|CDP16787.1|  unnamed protein product                                331   4e-110   
emb|CDP16790.1|  unnamed protein product                                330   2e-109   
ref|XP_010251870.1|  PREDICTED: putative germin-like protein 2-1 ...    327   2e-108   
emb|CDP22064.1|  unnamed protein product                                327   2e-108   
ref|XP_010251871.1|  PREDICTED: putative germin-like protein 2-1        325   6e-108   
ref|XP_007200183.1|  hypothetical protein PRUPE_ppa016284mg             323   4e-107   
ref|XP_010251869.1|  PREDICTED: putative germin-like protein 2-1 ...    323   4e-107   
emb|CDP16788.1|  unnamed protein product                                322   1e-106   
emb|CDP21353.1|  unnamed protein product                                329   4e-106   
emb|CDP10701.1|  unnamed protein product                                320   1e-105   
ref|XP_007200176.1|  hypothetical protein PRUPE_ppa016529mg             320   1e-105   
ref|XP_007200157.1|  hypothetical protein PRUPE_ppa016753mg             320   1e-105   
emb|CDP16789.1|  unnamed protein product                                329   2e-105   
ref|XP_007030273.1|  RmlC-like cupins superfamily protein               318   7e-105   
ref|XP_007201862.1|  hypothetical protein PRUPE_ppa020162mg             318   7e-105   
ref|XP_007201148.1|  hypothetical protein PRUPE_ppa016020mg             318   7e-105   
ref|XP_009349816.1|  PREDICTED: germin-like protein subfamily 1 m...    318   1e-104   
ref|XP_010251872.1|  PREDICTED: putative germin-like protein 2-1        317   1e-104   
ref|XP_008237521.1|  PREDICTED: germin-like protein subfamily 1 m...    317   3e-104   
ref|XP_007210592.1|  hypothetical protein PRUPE_ppa016616mg             316   3e-104   
emb|CDP10694.1|  unnamed protein product                                316   3e-104   
ref|XP_002531992.1|  Rhicadhesin receptor precursor, putative           316   4e-104   Ricinus communis
ref|XP_008351931.1|  PREDICTED: germin-like protein subfamily 1 m...    316   4e-104   
ref|XP_008367619.1|  PREDICTED: germin-like protein subfamily 1 m...    316   5e-104   
ref|XP_008240380.1|  PREDICTED: germin-like protein subfamily 1 m...    315   6e-104   
ref|XP_008237526.1|  PREDICTED: germin-like protein subfamily 1 m...    315   6e-104   
ref|XP_008393483.1|  PREDICTED: germin-like protein subfamily 1 m...    315   7e-104   
ref|XP_010241946.1|  PREDICTED: putative germin-like protein 2-1        315   7e-104   
emb|CDP16791.1|  unnamed protein product                                315   8e-104   
ref|XP_002276644.1|  PREDICTED: putative germin-like protein 2-1        315   1e-103   Vitis vinifera
ref|XP_007199217.1|  hypothetical protein PRUPE_ppa021882mg             315   1e-103   
ref|NP_001237300.1|  uncharacterized protein LOC100527781 precursor     314   1e-103   
ref|XP_003590904.1|  Germin-like protein subfamily 1 member             314   1e-103   
ref|XP_010257844.1|  PREDICTED: putative germin-like protein 2-1        314   2e-103   
ref|XP_010251867.1|  PREDICTED: putative germin-like protein 2-1        313   4e-103   
emb|CDP10695.1|  unnamed protein product                                313   6e-103   
emb|CAN80134.1|  hypothetical protein VITISV_012033                     313   7e-103   Vitis vinifera
ref|XP_008363404.1|  PREDICTED: LOW QUALITY PROTEIN: germin-like ...    313   8e-103   
ref|XP_002276756.2|  PREDICTED: putative germin-like protein 2-1        312   2e-102   Vitis vinifera
ref|XP_007030272.1|  RmlC-like cupins superfamily protein               310   5e-102   
ref|XP_008237524.1|  PREDICTED: germin-like protein subfamily 1 m...    311   5e-102   
ref|XP_003633724.1|  PREDICTED: putative germin-like protein 2-1        310   6e-102   
ref|XP_007030276.1|  RmlC-like cupins superfamily protein               310   7e-102   
ref|XP_008393146.1|  PREDICTED: germin-like protein subfamily 1 m...    310   9e-102   
emb|CBI33612.3|  unnamed protein product                                310   1e-101   
ref|XP_008237522.1|  PREDICTED: germin-like protein subfamily 1 m...    310   1e-101   
ref|XP_008243694.1|  PREDICTED: germin-like protein 9-1                 318   1e-101   
ref|XP_008393482.1|  PREDICTED: germin-like protein subfamily 1 m...    310   1e-101   
ref|XP_002276315.2|  PREDICTED: putative germin-like protein 2-1        309   2e-101   Vitis vinifera
ref|XP_002265608.1|  PREDICTED: putative germin-like protein 2-1        308   2e-101   Vitis vinifera
emb|CBI33610.3|  unnamed protein product                                312   2e-101   
ref|XP_008237525.1|  PREDICTED: germin-like protein subfamily 1 m...    309   3e-101   
ref|XP_007143989.1|  hypothetical protein PHAVU_007G119700g             308   3e-101   
ref|XP_007201563.1|  hypothetical protein PRUPE_ppa018105mg             308   3e-101   
emb|CDP16786.1|  unnamed protein product                                323   3e-101   
ref|XP_003633723.2|  PREDICTED: putative germin-like protein 2-1        308   4e-101   
emb|CDP10693.1|  unnamed protein product                                308   4e-101   
ref|XP_008237387.1|  PREDICTED: germin-like protein subfamily 1 m...    308   5e-101   
ref|XP_008375054.1|  PREDICTED: germin-like protein subfamily 1 m...    308   7e-101   
ref|XP_003633711.2|  PREDICTED: putative germin-like protein 2-1        307   1e-100   
ref|XP_008360941.1|  PREDICTED: germin-like protein subfamily 1 m...    306   2e-100   
emb|CBI33611.3|  unnamed protein product                                308   2e-100   
ref|XP_007030284.1|  RmlC-like cupins superfamily protein               306   3e-100   
gb|KCW80409.1|  hypothetical protein EUGRSUZ_C01766                     305   4e-100   
gb|KCW61445.1|  hypothetical protein EUGRSUZ_H04176                     305   8e-100   
ref|XP_007030281.1|  RmlC-like cupins superfamily protein isoform 2     305   1e-99    
ref|XP_007030280.1|  RmlC-like cupins superfamily protein isoform 1     304   1e-99    
ref|XP_002265857.1|  PREDICTED: putative germin-like protein 2-1        304   2e-99    Vitis vinifera
ref|XP_010027139.1|  PREDICTED: germin-like protein subfamily 1 m...    304   2e-99    
ref|XP_007201630.1|  hypothetical protein PRUPE_ppa020060mg             304   3e-99    
ref|XP_007030278.1|  Germin-like protein subfamily 1 member 18          312   4e-99    
gb|KCW61438.1|  hypothetical protein EUGRSUZ_H04168                     303   5e-99    
emb|CAN72994.1|  hypothetical protein VITISV_000563                     302   5e-99    Vitis vinifera
ref|XP_010251866.1|  PREDICTED: putative germin-like protein 2-1        303   6e-99    
ref|XP_007143990.1|  hypothetical protein PHAVU_007G119700g             303   6e-99    
ref|XP_010024920.1|  PREDICTED: germin-like protein subfamily 1 m...    302   7e-99    
ref|XP_002281186.2|  PREDICTED: uncharacterized protein LOC100244552    311   7e-99    Vitis vinifera
ref|XP_007030289.1|  RmlC-like cupins superfamily protein               302   1e-98    
ref|XP_002270404.2|  PREDICTED: putative germin-like protein 2-1        302   1e-98    Vitis vinifera
ref|XP_006845051.1|  hypothetical protein AMTR_s00794p00001640          302   1e-98    
ref|XP_002265297.3|  PREDICTED: uncharacterized protein LOC100247931    311   1e-98    Vitis vinifera
ref|XP_009341765.1|  PREDICTED: germin-like protein subfamily 1 m...    301   2e-98    
ref|XP_007030265.1|  Germin-like protein 2                              301   2e-98    
gb|KCW76699.1|  hypothetical protein EUGRSUZ_D01059                     301   3e-98    
ref|XP_009357348.1|  PREDICTED: germin-like protein subfamily 1 m...    301   3e-98    
ref|XP_009355938.1|  PREDICTED: germin-like protein subfamily 1 m...    301   3e-98    
ref|XP_002265447.3|  PREDICTED: uncharacterized protein LOC100242782    308   5e-98    Vitis vinifera
emb|CAN66771.1|  hypothetical protein VITISV_022559                     300   5e-98    Vitis vinifera
ref|XP_006840206.1|  hypothetical protein AMTR_s00089p00127600          300   8e-98    
ref|XP_007199406.1|  hypothetical protein PRUPE_ppa026225mg             300   1e-97    
emb|CBI36816.3|  unnamed protein product                                299   1e-97    
emb|CBI36811.3|  unnamed protein product                                299   1e-97    
gb|KCW76697.1|  hypothetical protein EUGRSUZ_D01057                     299   2e-97    
ref|XP_010024915.1|  PREDICTED: putative germin-like protein 2-1        299   2e-97    
emb|CDP10698.1|  unnamed protein product                                299   2e-97    
gb|KCW61443.1|  hypothetical protein EUGRSUZ_H04174                     298   2e-97    
gb|KCW61437.1|  hypothetical protein EUGRSUZ_H04167                     298   2e-97    
ref|XP_011038440.1|  PREDICTED: germin-like protein subfamily 1 m...    298   3e-97    
ref|NP_001267943.1|  germin-like protein 4 precursor                    298   3e-97    
ref|XP_010041604.1|  PREDICTED: germin-like protein subfamily 1 m...    298   3e-97    
ref|XP_006857270.1|  hypothetical protein AMTR_s00067p00014150          298   4e-97    
ref|XP_010048221.1|  PREDICTED: germin-like protein subfamily 1 m...    298   4e-97    
ref|XP_010041605.1|  PREDICTED: germin-like protein subfamily 1 m...    298   4e-97    
ref|XP_010052624.1|  PREDICTED: germin-like protein subfamily 1 m...    298   5e-97    
ref|XP_010050748.1|  PREDICTED: uncharacterized protein LOC104439371    305   6e-97    
ref|XP_010066342.1|  PREDICTED: germin-like protein subfamily 1 m...    297   7e-97    
ref|XP_002277055.1|  PREDICTED: putative germin-like protein 2-1        297   7e-97    Vitis vinifera
ref|XP_007030274.1|  Germin-like protein subfamily 1 member 18          311   9e-97    
ref|XP_010066338.1|  PREDICTED: germin-like protein subfamily 1 m...    297   1e-96    
ref|XP_010024911.1|  PREDICTED: germin-like protein subfamily 1 m...    297   1e-96    
emb|CBI36815.3|  unnamed protein product                                296   1e-96    
ref|XP_002284320.1|  PREDICTED: germin-like protein subfamily 1 m...    296   1e-96    Vitis vinifera
ref|XP_010024918.1|  PREDICTED: germin-like protein subfamily 1 m...    296   1e-96    
ref|NP_001268128.1|  germin-like protein 5                              296   1e-96    
ref|XP_010024919.1|  PREDICTED: germin-like protein subfamily 1 m...    296   2e-96    
gb|EPS67173.1|  hypothetical protein M569_07603                         296   2e-96    
ref|XP_002276926.2|  PREDICTED: uncharacterized protein LOC100251187    304   2e-96    Vitis vinifera
ref|XP_011034445.1|  PREDICTED: germin-like protein subfamily 1 m...    296   2e-96    
ref|XP_010042132.1|  PREDICTED: germin-like protein subfamily 1 m...    296   2e-96    
ref|XP_010050157.1|  PREDICTED: germin-like protein subfamily 1 m...    296   2e-96    
ref|NP_001240963.1|  germin-like protein subfamily 1 member 7-lik...    296   3e-96    
ref|XP_010659615.1|  PREDICTED: germin-like protein subfamily 1 m...    295   3e-96    
gb|KHN14792.1|  Germin-like protein subfamily 1 member 7                296   4e-96    
ref|XP_002319672.1|  hypothetical protein POPTR_0013s04850g             295   4e-96    Populus trichocarpa [western balsam poplar]
gb|KHN04965.1|  Germin-like protein subfamily 1 member 7                296   4e-96    
ref|XP_011099650.1|  PREDICTED: germin-like protein subfamily 1 m...    295   5e-96    
ref|XP_007030176.1|  Germin-like protein subfamily 1 member 18          298   5e-96    
ref|XP_010024913.1|  PREDICTED: germin-like protein subfamily 1 m...    295   5e-96    
ref|XP_007030270.1|  Germin-like protein subfamily 1 member 18          299   5e-96    
ref|XP_010024914.1|  PREDICTED: putative germin-like protein 2-1        295   5e-96    
ref|XP_002319671.1|  hypothetical protein POPTR_0013s04840g             294   1e-95    Populus trichocarpa [western balsam poplar]
ref|XP_010024917.1|  PREDICTED: germin-like protein subfamily 1 m...    294   1e-95    
emb|CBI36810.3|  unnamed protein product                                297   1e-95    
ref|XP_004489240.1|  PREDICTED: germin-like protein subfamily 1 m...    294   2e-95    
ref|XP_008776811.1|  PREDICTED: putative germin-like protein 2-1 ...    293   2e-95    
gb|KCW61442.1|  hypothetical protein EUGRSUZ_H04173                     293   2e-95    
ref|XP_006840195.1|  hypothetical protein AMTR_s00089p00119070          293   2e-95    
ref|XP_010027140.1|  PREDICTED: uncharacterized protein LOC104417587    305   2e-95    
ref|XP_006375870.1|  germin-like protein 1                              294   2e-95    
ref|XP_006840196.1|  hypothetical protein AMTR_s00089p00119480          293   2e-95    
gb|KCW61456.1|  hypothetical protein EUGRSUZ_H04192                     293   2e-95    
ref|XP_010024921.1|  PREDICTED: germin-like protein subfamily 1 m...    293   3e-95    
gb|KCW80407.1|  hypothetical protein EUGRSUZ_C01764                     293   3e-95    
ref|XP_010050166.1|  PREDICTED: germin-like protein subfamily 1 m...    293   4e-95    
ref|XP_010054506.1|  PREDICTED: uncharacterized protein LOC104442816    300   4e-95    
ref|XP_009385875.1|  PREDICTED: putative germin-like protein 2-1        293   5e-95    
ref|XP_002319674.2|  hypothetical protein POPTR_0013s04920g             293   5e-95    Populus trichocarpa [western balsam poplar]
ref|XP_008775104.1|  PREDICTED: putative germin-like protein 2-1        293   5e-95    
ref|XP_007030263.1|  Germin-like protein subfamily 1 member 18          294   5e-95    
ref|XP_010027136.1|  PREDICTED: uncharacterized protein LOC104417584    301   6e-95    
ref|XP_003618162.1|  Germin-like protein subfamily 1 member             292   6e-95    
ref|XP_004489241.1|  PREDICTED: putative germin-like protein 2-1-...    292   7e-95    
ref|XP_003536153.1|  PREDICTED: germin-like protein subfamily 1 m...    292   8e-95    
gb|KCW44232.1|  hypothetical protein EUGRSUZ_L02342                     292   8e-95    
ref|XP_003618167.1|  Germin-like protein                                292   9e-95    
ref|XP_003618164.1|  Germin-like protein subfamily 1 member             291   1e-94    
ref|XP_010027145.1|  PREDICTED: germin-like protein subfamily 1 m...    291   1e-94    
ref|XP_008778966.1|  PREDICTED: putative germin-like protein 2-1        291   1e-94    
ref|XP_006405658.1|  hypothetical protein EUTSA_v10027918mg             291   2e-94    
ref|XP_010024923.1|  PREDICTED: germin-like protein subfamily 1 m...    291   2e-94    
ref|XP_002284343.2|  PREDICTED: uncharacterized protein LOC100256308    300   2e-94    Vitis vinifera
ref|XP_011038438.1|  PREDICTED: germin-like protein subfamily 1 m...    291   2e-94    
emb|CBI36791.3|  unnamed protein product                                291   3e-94    
gb|KCW61436.1|  hypothetical protein EUGRSUZ_H04166                     290   3e-94    
gb|AFK48994.1|  unknown                                                 290   4e-94    
emb|CBI36812.3|  unnamed protein product                                298   4e-94    
ref|XP_010066343.1|  PREDICTED: germin-like protein subfamily 1 m...    290   4e-94    
ref|XP_004290344.1|  PREDICTED: germin-like protein subfamily 1 m...    290   4e-94    
ref|XP_004513533.1|  PREDICTED: germin-like protein subfamily 1 m...    290   4e-94    
ref|XP_010024926.1|  PREDICTED: germin-like protein subfamily 1 m...    290   5e-94    
ref|XP_003618165.1|  Germin-like protein subfamily 1 member             290   5e-94    
ref|XP_011034444.1|  PREDICTED: germin-like protein subfamily 1 m...    290   5e-94    
ref|XP_008776810.1|  PREDICTED: putative germin-like protein 2-1 ...    289   6e-94    
ref|XP_002276445.2|  PREDICTED: uncharacterized protein LOC100254460    301   6e-94    Vitis vinifera
ref|XP_010024924.1|  PREDICTED: germin-like protein subfamily 1 m...    290   7e-94    
ref|XP_009402547.1|  PREDICTED: putative germin-like protein 2-1 ...    289   8e-94    
ref|XP_011034442.1|  PREDICTED: germin-like protein subfamily 1 m...    289   1e-93    
ref|XP_008808106.1|  PREDICTED: putative germin-like protein 2-1 ...    289   1e-93    
gb|KDP23769.1|  hypothetical protein JCGZ_23602                         289   1e-93    
ref|XP_011034305.1|  PREDICTED: germin-like protein subfamily 1 m...    289   1e-93    
ref|XP_004291649.1|  PREDICTED: germin-like protein subfamily 1 m...    289   1e-93    
ref|XP_008443754.1|  PREDICTED: germin-like protein subfamily 1 m...    289   2e-93    
ref|XP_006375871.1|  hypothetical protein POPTR_0013s04880g             288   2e-93    
ref|XP_010027143.1|  PREDICTED: uncharacterized protein LOC104417591    296   2e-93    
gb|AFK49577.1|  unknown                                                 288   3e-93    
emb|CBI39477.3|  unnamed protein product                                288   3e-93    
emb|CBI36814.3|  unnamed protein product                                288   3e-93    
gb|ACG69479.1|  germin-like protein 3                                   288   3e-93    Glycine max [soybeans]
ref|XP_011034443.1|  PREDICTED: germin-like protein subfamily 1 m...    288   3e-93    
ref|XP_004513532.1|  PREDICTED: germin-like protein subfamily 1 m...    288   4e-93    
ref|XP_010050174.1|  PREDICTED: germin-like protein subfamily 1 m...    288   5e-93    
ref|XP_006375874.1|  germin-like protein 1                              286   5e-93    
ref|XP_003604729.1|  Germin-like protein subfamily 1 member             287   5e-93    
ref|XP_003604731.1|  Germin-like protein subfamily 1 member             287   5e-93    
emb|CDY15957.1|  BnaA04g11540D                                          287   5e-93    
ref|XP_009129904.1|  PREDICTED: germin-like protein subfamily 1 m...    287   5e-93    
ref|NP_001236994.1|  uncharacterized protein LOC100527249 precursor     287   5e-93    
ref|NP_001268198.1|  germin-like protein 3 precursor                    287   7e-93    
ref|NP_187246.1|  germin-like protein subfamily 1 member 7              287   1e-92    Arabidopsis thaliana [mouse-ear cress]
gb|KCW64218.1|  hypothetical protein EUGRSUZ_G01868                     286   1e-92    
gb|KCW44233.1|  hypothetical protein EUGRSUZ_L02343                     287   1e-92    
ref|XP_011038439.1|  PREDICTED: germin-like protein subfamily 1 m...    287   1e-92    
ref|XP_006405659.1|  hypothetical protein EUTSA_v10028158mg             286   2e-92    
ref|XP_003593910.1|  Germin-like protein subfamily 1 member             286   2e-92    
emb|CAN70904.1|  hypothetical protein VITISV_032927                     285   2e-92    Vitis vinifera
emb|CDX99669.1|  BnaC04g34260D                                          286   2e-92    
ref|XP_011034308.1|  PREDICTED: germin-like protein subfamily 1 m...    286   3e-92    
emb|CAN80133.1|  hypothetical protein VITISV_012032                     285   3e-92    Vitis vinifera
ref|XP_010528770.1|  PREDICTED: germin-like protein subfamily 1 m...    286   3e-92    
ref|XP_003604730.1|  Germin-like protein subfamily 1 member             285   4e-92    
gb|KDP23768.1|  hypothetical protein JCGZ_23601                         285   4e-92    
gb|ADD71877.1|  germin-like protein subfamily 1 member 1 precursor      285   5e-92    Arachis hypogaea [goober]
ref|XP_004142551.1|  PREDICTED: germin-like protein subfamily 1 m...    285   5e-92    
ref|XP_011002009.1|  PREDICTED: germin-like protein subfamily 1 m...    284   9e-92    
gb|KCW82834.1|  hypothetical protein EUGRSUZ_C04205                     284   9e-92    
ref|XP_010464157.1|  PREDICTED: germin-like protein subfamily 1 m...    284   9e-92    
ref|XP_004155681.1|  PREDICTED: LOW QUALITY PROTEIN: germin-like ...    284   1e-91    
ref|XP_010049995.1|  PREDICTED: germin-like protein subfamily 1 m...    284   1e-91    
ref|XP_010049993.1|  PREDICTED: germin-like protein subfamily 1 m...    284   1e-91    
ref|XP_010049996.1|  PREDICTED: germin-like protein subfamily 1 m...    284   1e-91    
ref|XP_010911724.1|  PREDICTED: putative germin-like protein 2-1        284   1e-91    
ref|XP_008777419.1|  PREDICTED: uncharacterized protein LOC103697358    292   1e-91    
ref|XP_010659856.1|  PREDICTED: germin-like protein subfamily 1 m...    283   2e-91    
ref|XP_009140209.1|  PREDICTED: germin-like protein subfamily 1 m...    283   2e-91    
ref|XP_004142552.1|  PREDICTED: germin-like protein subfamily 1 m...    283   2e-91    
ref|XP_006371122.1|  Germin-like protein subfamily 1 member 6 pre...    283   2e-91    
ref|XP_010434310.1|  PREDICTED: germin-like protein subfamily 1 m...    283   2e-91    
gb|AFK39387.1|  unknown                                                 283   2e-91    
emb|CDY37880.1|  BnaC04g31260D                                          283   2e-91    
ref|XP_002325797.2|  hypothetical protein POPTR_0019s04340g             283   3e-91    Populus trichocarpa [western balsam poplar]
emb|CAN63434.1|  hypothetical protein VITISV_033830                     283   3e-91    Vitis vinifera
gb|KDP23764.1|  hypothetical protein JCGZ_23597                         283   3e-91    
ref|XP_010051710.1|  PREDICTED: germin-like protein subfamily 1 m...    283   3e-91    
emb|CBI36790.3|  unnamed protein product                                282   4e-91    
ref|XP_002284624.1|  PREDICTED: germin-like protein subfamily 1 m...    282   4e-91    
ref|XP_006387364.1|  hypothetical protein POPTR_1158s00200g             283   5e-91    
ref|XP_002280481.2|  PREDICTED: uncharacterized protein LOC100252737    297   5e-91    
ref|XP_006371120.1|  hypothetical protein POPTR_0019s04280g             282   6e-91    
ref|XP_010049991.1|  PREDICTED: germin-like protein subfamily 1 m...    282   6e-91    
ref|XP_010049992.1|  PREDICTED: germin-like protein subfamily 1 m...    282   6e-91    
ref|XP_008371812.1|  PREDICTED: germin-like protein subfamily 1 m...    282   7e-91    
ref|XP_011034307.1|  PREDICTED: germin-like protein subfamily 1 m...    282   8e-91    
ref|XP_007030267.1|  Germin-like protein subfamily 1 member 18          285   9e-91    
ref|XP_002319184.1|  hypothetical protein POPTR_0013s06030g             282   1e-90    
ref|XP_011013026.1|  PREDICTED: germin-like protein subfamily 1 m...    282   1e-90    
gb|KDP32127.1|  hypothetical protein JCGZ_12588                         281   1e-90    
ref|XP_010051709.1|  PREDICTED: germin-like protein subfamily 1 m...    281   1e-90    
emb|CAN71140.1|  hypothetical protein VITISV_005471                     281   2e-90    
ref|XP_003553592.1|  PREDICTED: germin-like protein subfamily 1 m...    281   2e-90    
ref|XP_002868742.1|  predicted protein                                  281   2e-90    
ref|XP_009139822.1|  PREDICTED: germin-like protein subfamily 1 m...    281   2e-90    
emb|CDY69099.1|  BnaA07g37570D                                          281   2e-90    
ref|XP_002868798.1|  predicted protein                                  281   2e-90    
ref|XP_006298965.1|  hypothetical protein CARUB_v10015090mg             281   2e-90    
ref|XP_002868743.1|  predicted protein                                  281   2e-90    
sp|P92997.2|GL113_ARATH  RecName: Full=Germin-like protein subfam...    281   2e-90    
gb|AAB51572.1|  germin-like protein                                     281   2e-90    
emb|CAN70189.1|  hypothetical protein VITISV_016562                     280   2e-90    
ref|XP_002531991.1|  Rhicadhesin receptor precursor, putative           279   3e-90    
gb|AAM76226.1|  putative germin E protein precursor                     279   3e-90    
ref|XP_010435818.1|  PREDICTED: germin-like protein subfamily 1 m...    280   4e-90    
emb|CBI36783.3|  unnamed protein product                                282   4e-90    
ref|XP_009124949.1|  PREDICTED: germin-like protein subfamily 1 m...    280   4e-90    
ref|XP_003547666.1|  PREDICTED: germin-like protein subfamily 1 m...    280   4e-90    
ref|NP_001267940.1|  germin-like protein 1                              280   4e-90    
ref|XP_002868741.1|  predicted protein                                  280   5e-90    
ref|NP_198729.1|  germin-like protein subfamily 1 member 16             280   5e-90    
ref|XP_010450837.1|  PREDICTED: germin-like protein subfamily 1 m...    279   8e-90    
ref|NP_198732.2|  germin-like protein subfamily 1 member 18             279   8e-90    
ref|XP_010051708.1|  PREDICTED: germin-like protein subfamily 1 m...    280   9e-90    
emb|CBI39473.3|  unnamed protein product                                279   9e-90    
ref|XP_010024912.1|  PREDICTED: germin-like protein subfamily 1 m...    279   9e-90    
emb|CDY11695.1|  BnaC06g13030D                                          279   1e-89    
gb|KCW82831.1|  hypothetical protein EUGRSUZ_C04202                     278   1e-89    
ref|XP_006408007.1|  hypothetical protein EUTSA_v10021469mg             279   1e-89    
ref|XP_006599050.1|  PREDICTED: germin-like protein subfamily 1 m...    278   1e-89    
ref|XP_011002008.1|  PREDICTED: germin-like protein subfamily 1 m...    279   1e-89    
gb|AAM76225.1|  putative germin E protein precursor                     277   1e-89    
gb|AAM76227.1|  putative germin E protein precursor                     277   2e-89    
ref|XP_006840197.1|  hypothetical protein AMTR_s00089p00120230          280   2e-89    
ref|XP_008443751.1|  PREDICTED: germin-like protein subfamily 1 m...    278   2e-89    
ref|XP_010528694.1|  PREDICTED: germin-like protein subfamily 1 m...    278   2e-89    
ref|XP_009125150.1|  PREDICTED: germin-like protein subfamily 1 m...    278   2e-89    
emb|CAN63889.1|  hypothetical protein VITISV_027218                     278   2e-89    
ref|XP_010441036.1|  PREDICTED: germin-like protein subfamily 1 m...    278   2e-89    
ref|XP_006282503.1|  hypothetical protein CARUB_v10006909mg             278   3e-89    
ref|XP_010528697.1|  PREDICTED: germin-like protein subfamily 1 m...    278   3e-89    
ref|NP_198727.1|  germin-like protein subfamily 1 member 14             278   3e-89    
ref|XP_002523178.1|  Rhicadhesin receptor precursor, putative           277   3e-89    
ref|XP_002530594.1|  Rhicadhesin receptor precursor, putative           276   4e-89    
ref|NP_001241319.1|  germin-like protein subfamily 1 member 7-lik...    277   4e-89    
ref|XP_002284284.2|  PREDICTED: germin-like protein subfamily 1 m...    278   4e-89    
ref|NP_198735.1|  germin-like protein 2a                                277   5e-89    
ref|XP_006286150.1|  hypothetical protein CARUB_v10007709mg             277   6e-89    
ref|XP_003553909.1|  PREDICTED: germin-like protein subfamily 1 m...    277   6e-89    
ref|XP_002452101.1|  hypothetical protein SORBIDRAFT_04g019700          276   7e-89    
gb|KHN28990.1|  Germin-like protein subfamily 1 member 7                277   7e-89    
ref|XP_002284616.2|  PREDICTED: germin-like protein subfamily 1 m...    276   8e-89    
emb|CDP10932.1|  unnamed protein product                                276   9e-89    
ref|XP_002284661.2|  PREDICTED: uncharacterized protein LOC100240807    285   1e-88    
gb|KFK33208.1|  hypothetical protein AALP_AA6G344800                    276   1e-88    
gb|EYU39944.1|  hypothetical protein MIMGU_mgv1a020036mg                276   1e-88    
ref|XP_010435820.1|  PREDICTED: germin-like protein subfamily 1 m...    276   1e-88    
ref|XP_011075119.1|  PREDICTED: putative germin-like protein 2-1 ...    276   1e-88    
ref|XP_010049990.1|  PREDICTED: germin-like protein subfamily 1 m...    276   1e-88    
ref|XP_003535383.1|  PREDICTED: LOW QUALITY PROTEIN: germin-like ...    277   2e-88    
ref|XP_002868738.1|  hypothetical protein ARALYDRAFT_494073             276   2e-88    
emb|CAN73847.1|  hypothetical protein VITISV_021638                     276   2e-88    
ref|XP_007201690.1|  hypothetical protein PRUPE_ppa016952mg             274   3e-88    
ref|XP_009402557.1|  PREDICTED: putative germin-like protein 2-1        275   3e-88    
gb|ACG69489.1|  germin-like protein 13                                  275   4e-88    
ref|XP_002884546.1|  hypothetical protein ARALYDRAFT_477892             275   4e-88    
gb|EYU40207.1|  hypothetical protein MIMGU_mgv1a012993mg                275   7e-88    
ref|XP_006405680.1|  hypothetical protein EUTSA_v10027917mg             274   7e-88    
ref|XP_011012323.1|  PREDICTED: germin-like protein subfamily 1 m...    280   8e-88    
ref|XP_009402558.1|  PREDICTED: putative germin-like protein 2-1        274   8e-88    
ref|XP_006405676.1|  hypothetical protein EUTSA_v10027913mg             274   9e-88    
ref|XP_006285306.1|  hypothetical protein CARUB_v10006688mg             274   9e-88    
ref|XP_004293674.1|  PREDICTED: putative germin-like protein 2-1-...    274   1e-87    
ref|XP_006443311.1|  hypothetical protein CICLE_v10022142mg             274   1e-87    
ref|XP_007140907.1|  hypothetical protein PHAVU_008G151200g             273   2e-87    
ref|XP_010689305.1|  PREDICTED: germin-like protein                     273   2e-87    
ref|XP_011075126.1|  PREDICTED: putative germin-like protein 2-1 ...    273   2e-87    
ref|XP_006284934.1|  hypothetical protein CARUB_v10006233mg             273   2e-87    
ref|XP_006405663.1|  hypothetical protein EUTSA_v10027916mg             273   2e-87    
ref|XP_002523177.1|  Rhicadhesin receptor precursor, putative           273   3e-87    
ref|XP_004293675.1|  PREDICTED: putative germin-like protein 2-1-...    273   3e-87    
gb|AAM76229.1|  putative germin E protein precursor                     271   3e-87    
ref|NP_001046874.1|  Os02g0491600                                       272   3e-87    
ref|XP_006443312.1|  hypothetical protein CICLE_v10022118mg             272   4e-87    
ref|XP_002530595.1|  Oxalate oxidase 2 precursor, putative              272   4e-87    
ref|XP_006442440.1|  hypothetical protein CICLE_v10023726mg             272   5e-87    
ref|XP_006442442.1|  hypothetical protein CICLE_v10022152mg             272   6e-87    
gb|KFK24125.1|  hypothetical protein AALP_AAs58370U000100               272   7e-87    
ref|XP_011075120.1|  PREDICTED: putative germin-like protein 2-1 ...    271   7e-87    
ref|XP_011075128.1|  PREDICTED: putative germin-like protein 2-1        271   7e-87    
ref|XP_006442444.1|  hypothetical protein CICLE_v10023384mg             271   8e-87    
gb|KDO42113.1|  hypothetical protein CISIN_1g027369mg                   271   8e-87    
ref|XP_007212425.1|  hypothetical protein PRUPE_ppa017161mg             271   1e-86    
ref|XP_006405677.1|  hypothetical protein EUTSA_v10027920mg             271   1e-86    
ref|XP_008381868.1|  PREDICTED: germin-like protein subfamily 1 m...    270   1e-86    
ref|XP_006477875.1|  PREDICTED: germin-like protein subfamily 1 m...    271   1e-86    
ref|XP_011075129.1|  PREDICTED: putative germin-like protein 2-1 ...    271   1e-86    
ref|XP_009362202.1|  PREDICTED: putative germin-like protein 2-1        271   1e-86    
ref|XP_006477877.1|  PREDICTED: germin-like protein subfamily 1 m...    271   1e-86    
ref|XP_006442447.1|  hypothetical protein CICLE_v10024005mg             271   1e-86    
ref|XP_009402546.1|  PREDICTED: germin-like protein 12-2                271   1e-86    
ref|NP_193199.1|  germin-like protein 9                                 271   2e-86    
ref|XP_006442438.1|  hypothetical protein CICLE_v10024000mg             271   2e-86    
ref|XP_009402551.1|  PREDICTED: putative germin-like protein 2-1        271   2e-86    
ref|XP_006477883.1|  PREDICTED: germin-like protein subfamily 1 m...    271   2e-86    
gb|ACG69478.1|  germin-like protein 2                                   270   2e-86    
ref|XP_010048594.1|  PREDICTED: germin-like protein subfamily 1 m...    271   2e-86    
ref|XP_004293672.1|  PREDICTED: putative germin-like protein 2-1-...    270   2e-86    
ref|XP_010528696.1|  PREDICTED: germin-like protein subfamily 1 m...    270   3e-86    
ref|XP_011046609.1|  PREDICTED: germin-like protein subfamily 1 m...    270   3e-86    
ref|XP_011045439.1|  PREDICTED: germin-like protein subfamily 1 m...    270   3e-86    
gb|EMT02678.1|  Putative germin-like protein 2-1                        270   3e-86    
ref|XP_011046611.1|  PREDICTED: germin-like protein subfamily 1 m...    271   4e-86    
emb|CAN74480.1|  hypothetical protein VITISV_042844                     268   5e-86    
ref|XP_010911182.1|  PREDICTED: putative germin-like protein 2-1        270   5e-86    
ref|XP_006442436.1|  hypothetical protein CICLE_v10024280mg             270   5e-86    
ref|NP_001238673.1|  uncharacterized protein LOC100527866 precursor     270   5e-86    
gb|KHN26390.1|  Germin-like protein subfamily 1 member 7                270   5e-86    
ref|XP_006405679.1|  hypothetical protein EUTSA_v10027925mg             270   5e-86    
gb|AAD00509.1|  germin-like protein                                     269   5e-86    
ref|NP_198731.1|  germin-like protein subfamily 1 member 17             269   6e-86    
ref|XP_009113441.1|  PREDICTED: germin-like protein subfamily 1 m...    269   6e-86    
emb|CAA63023.1|  germin type2                                           269   6e-86    
ref|XP_002452098.1|  hypothetical protein SORBIDRAFT_04g019650          269   8e-86    
ref|XP_011075121.1|  PREDICTED: putative germin-like protein 2-1 ...    269   8e-86    
gb|KCW61433.1|  hypothetical protein EUGRSUZ_H04161                     269   8e-86    
gb|KFK23658.1|  germin-like protein                                     269   9e-86    
ref|NP_198734.1|  germin-like protein subfamily 1 member 19             269   9e-86    
ref|NP_198728.1|  germin-like protein subfamily 1 member 15             269   1e-85    
ref|XP_009385876.1|  PREDICTED: germin-like protein 12-2                268   1e-85    
ref|XP_010450836.1|  PREDICTED: germin-like protein subfamily 1 m...    269   1e-85    
ref|XP_002870812.1|  predicted protein                                  269   1e-85    
ref|XP_011039266.1|  PREDICTED: germin-like protein subfamily 1 m...    270   1e-85    
ref|XP_003553912.1|  PREDICTED: germin-like protein subfamily 1 m...    268   1e-85    
gb|EMT32553.1|  Putative germin-like protein 2-2                        268   2e-85    
gb|KHN28994.1|  Germin-like protein subfamily 1 member 18               268   2e-85    
sp|Q6K5P9.1|GL22_ORYSJ  RecName: Full=Putative germin-like protei...    268   2e-85    
ref|XP_008225644.1|  PREDICTED: putative germin-like protein 2-1        268   2e-85    
ref|XP_006477881.1|  PREDICTED: germin-like protein subfamily 1 m...    268   2e-85    
ref|XP_007213411.1|  hypothetical protein PRUPE_ppa026076mg             268   2e-85    
ref|XP_011046612.1|  PREDICTED: germin-like protein subfamily 1 m...    269   2e-85    
ref|XP_006477879.1|  PREDICTED: germin-like protein subfamily 1 m...    268   2e-85    
ref|NP_001190438.1|  germin-like protein subfamily 1 member 18          267   3e-85    
gb|KDO36579.1|  hypothetical protein CISIN_1g048097mg                   268   3e-85    
ref|XP_010662281.1|  PREDICTED: putative germin-like protein 2-1        266   4e-85    
ref|XP_002267172.1|  PREDICTED: putative germin-like protein 2-2        267   4e-85    
ref|XP_010412923.1|  PREDICTED: germin-like protein subfamily 1 m...    268   4e-85    
gb|EAY85909.1|  hypothetical protein OsI_07272                          267   4e-85    
gb|KDP34914.1|  hypothetical protein JCGZ_09202                         267   4e-85    
ref|XP_009402550.1|  PREDICTED: putative germin-like protein 2-1        267   5e-85    
ref|XP_002306210.1|  hypothetical protein POPTR_0004s18690g             267   5e-85    
ref|XP_006377950.1|  germin-like protein 1                              267   5e-85    
gb|KDP34915.1|  hypothetical protein JCGZ_09203                         266   6e-85    
ref|XP_006414672.1|  hypothetical protein EUTSA_v10026186mg             267   6e-85    
ref|XP_002313686.1|  germin-like protein 1                              267   6e-85    
ref|XP_008808107.1|  PREDICTED: putative germin-like protein 2-1 ...    266   7e-85    
ref|XP_009107789.1|  PREDICTED: germin-like protein subfamily 1 m...    266   7e-85    
ref|XP_011046610.1|  PREDICTED: germin-like protein subfamily 1 m...    268   7e-85    
ref|XP_007213316.1|  hypothetical protein PRUPE_ppb017655mg             266   8e-85    
ref|XP_011075130.1|  PREDICTED: putative germin-like protein 2-1 ...    266   8e-85    
ref|XP_008778853.1|  PREDICTED: putative germin-like protein 2-1        266   9e-85    
ref|XP_009414512.1|  PREDICTED: putative germin-like protein 2-1        266   9e-85    
gb|EYU20537.1|  hypothetical protein MIMGU_mgv1a013077mg                267   9e-85    
emb|CDY36875.1|  BnaC08g09720D                                          266   9e-85    
ref|XP_004952510.1|  PREDICTED: putative germin-like protein 2-2-...    266   9e-85    
ref|XP_010659820.1|  PREDICTED: germin-like protein 3 isoform X1        265   1e-84    
gb|KDP23867.1|  hypothetical protein JCGZ_27136                         266   1e-84    
ref|XP_011075127.1|  PREDICTED: putative germin-like protein 2-1 ...    266   1e-84    
emb|CDP10933.1|  unnamed protein product                                266   1e-84    
ref|XP_002868739.1|  predicted protein                                  266   1e-84    
ref|XP_010672088.1|  PREDICTED: germin-like protein subfamily 1 m...    266   1e-84    
ref|XP_011046613.1|  PREDICTED: germin-like protein subfamily 1 m...    267   1e-84    
ref|XP_002870302.1|  predicted protein                                  266   1e-84    
ref|XP_008225645.1|  PREDICTED: putative germin-like protein 2-1        265   2e-84    
ref|XP_008383377.1|  PREDICTED: putative germin-like protein 2-1        265   2e-84    
ref|XP_002452097.1|  hypothetical protein SORBIDRAFT_04g019640          265   3e-84    
ref|XP_010450835.1|  PREDICTED: LOW QUALITY PROTEIN: germin-like ...    265   3e-84    
emb|CAN71631.1|  hypothetical protein VITISV_015711                     264   3e-84    
ref|XP_010463900.1|  PREDICTED: germin-like protein subfamily 1 m...    265   3e-84    
ref|NP_001267944.1|  germin-like protein 7 precursor                    265   4e-84    
ref|XP_002452099.1|  hypothetical protein SORBIDRAFT_04g019670          265   4e-84    
ref|XP_008678208.1|  PREDICTED: putative germin-like protein 12-4       265   4e-84    
gb|KFK33230.1|  hypothetical protein AALP_AA6G347300                    265   5e-84    
ref|XP_008808516.1|  PREDICTED: putative germin-like protein 2-1        264   5e-84    
ref|XP_011037744.1|  PREDICTED: putative germin-like protein 2-1        264   5e-84    
ref|XP_010024925.1|  PREDICTED: germin-like protein subfamily 1 m...    264   5e-84    
emb|CAB65370.1|  germin-like protein                                    263   6e-84    
ref|XP_004952511.1|  PREDICTED: putative germin-like protein 2-2-...    264   7e-84    
ref|XP_002284682.1|  PREDICTED: germin-like protein subfamily 1 m...    264   7e-84    
ref|XP_006405681.1|  hypothetical protein EUTSA_v10027922mg             264   7e-84    
ref|XP_002313687.2|  hypothetical protein POPTR_0009s14250g             264   7e-84    
ref|XP_002523176.1|  Rhicadhesin receptor precursor, putative           264   7e-84    
emb|CAN74828.1|  hypothetical protein VITISV_002139                     263   8e-84    
emb|CDP10106.1|  unnamed protein product                                264   8e-84    
ref|XP_002452096.1|  hypothetical protein SORBIDRAFT_04g019630          264   8e-84    
emb|CDY36876.1|  BnaC08g09710D                                          264   8e-84    
ref|XP_003532644.2|  PREDICTED: putative germin-like protein 2-1-...    263   9e-84    
ref|XP_006856738.1|  hypothetical protein AMTR_s03266p00004160          262   9e-84    
gb|KHN39146.1|  Putative germin-like protein 2-1                        263   1e-83    
ref|XP_002443979.1|  hypothetical protein SORBIDRAFT_07g005310          264   1e-83    
ref|XP_011037736.1|  PREDICTED: putative germin-like protein 2-1        263   1e-83    
gb|KDP34916.1|  hypothetical protein JCGZ_09204                         263   1e-83    
ref|XP_011037735.1|  PREDICTED: putative germin-like protein 2-1        263   1e-83    
ref|XP_003574976.1|  PREDICTED: putative germin-like protein 2-2 ...    263   1e-83    
emb|CBI36782.3|  unnamed protein product                                263   1e-83    
ref|XP_008678223.1|  PREDICTED: putative germin-like protein 12-4       263   1e-83    



>ref|XP_009784933.1| PREDICTED: germin-like protein subfamily 1 member 20 [Nicotiana 
sylvestris]
Length=228

 Score =   365 bits (937),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 180/227 (79%), Positives = 199/227 (88%), Gaps = 0/227 (0%)
 Frame = +2

Query  86   MAIRFIVFTITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDF  265
            MA+R +V TI ++AL SS +HA DPSPLQD CVAV+DSMAAVFVNGKICK+P QV+ANDF
Sbjct  1    MALRTLVLTIAIMALLSSMSHAFDPSPLQDICVAVDDSMAAVFVNGKICKDPKQVMANDF  60

Query  266  FFRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVL  445
            F  GLN+PGNTSN LGS VT VNV NLPGLNTLGISL RID+AP GLNPPHTHPR TE+L
Sbjct  61   FKSGLNIPGNTSNQLGSAVTAVNVGNLPGLNTLGISLARIDYAPYGLNPPHTHPRGTEIL  120

Query  446  LVLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLS  625
             VLEGTLYVGFVLSNP P MKN LFTK L  GDVFVFP GLIHFQFNVGKTNA+AFAGLS
Sbjct  121  AVLEGTLYVGFVLSNPGPNMKNKLFTKILNPGDVFVFPIGLIHFQFNVGKTNAVAFAGLS  180

Query  626  SQNPGVITIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQFWYNN  766
            SQNPGVITIANAVFGS+PPINP VLTKAFQV + V++YLQ+QFW++N
Sbjct  181  SQNPGVITIANAVFGSDPPINPDVLTKAFQVDKKVVDYLQSQFWWDN  227



>ref|XP_009795503.1| PREDICTED: germin-like protein subfamily 1 member 20 isoform 
X1 [Nicotiana sylvestris]
 ref|XP_009795504.1| PREDICTED: germin-like protein subfamily 1 member 20 isoform 
X2 [Nicotiana sylvestris]
Length=228

 Score =   364 bits (935),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 180/227 (79%), Positives = 199/227 (88%), Gaps = 0/227 (0%)
 Frame = +2

Query  86   MAIRFIVFTITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDF  265
            MA+R +V TI ++AL SS +HA DPSPLQD CVAV+DSMAAVFVNGKICK+P QV+ANDF
Sbjct  1    MALRTLVLTIAIMALLSSMSHAFDPSPLQDICVAVDDSMAAVFVNGKICKDPKQVMANDF  60

Query  266  FFRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVL  445
            F  GLN+PGNTSN LGS VT VNV NLPGLNTLGISL RID+AP GLNPPHTHPR TE+L
Sbjct  61   FKSGLNIPGNTSNQLGSVVTAVNVGNLPGLNTLGISLARIDYAPYGLNPPHTHPRGTEIL  120

Query  446  LVLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLS  625
             VLEGTLYVGFVLSNP P MKN LFTK L  GDVFVFP GLIHFQFNVGKTNA+AFAGLS
Sbjct  121  AVLEGTLYVGFVLSNPGPNMKNKLFTKILNPGDVFVFPIGLIHFQFNVGKTNAVAFAGLS  180

Query  626  SQNPGVITIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQFWYNN  766
            SQNPGVITIANAVFGS+PPINP VLTKAFQV + V++YLQ+QFW++N
Sbjct  181  SQNPGVITIANAVFGSDPPINPDVLTKAFQVDKKVVDYLQSQFWWDN  227



>ref|XP_009612542.1| PREDICTED: putative germin-like protein 2-1 [Nicotiana tomentosiformis]
Length=228

 Score =   360 bits (923),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 178/227 (78%), Positives = 198/227 (87%), Gaps = 0/227 (0%)
 Frame = +2

Query  86   MAIRFIVFTITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDF  265
            MA++  V TI ++A+ SS +HASDPSPLQDFCVAVNDSMAAVFVNGKICK+P  V A+DF
Sbjct  1    MALKLFVLTIAILAVVSSISHASDPSPLQDFCVAVNDSMAAVFVNGKICKDPKVVNADDF  60

Query  266  FFRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVL  445
            F  GLN+PGNTSN +GS VT VNV NLPGLNTLGISLVRID+AP GLNPPHTHPRATEVL
Sbjct  61   FKSGLNIPGNTSNQVGSAVTAVNVGNLPGLNTLGISLVRIDYAPYGLNPPHTHPRATEVL  120

Query  446  LVLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLS  625
            +VLEGTLYVGFVLSNP P MKN LFTK L  GDVFVFP GLIHFQFN+GKT A+AFAGLS
Sbjct  121  VVLEGTLYVGFVLSNPGPNMKNKLFTKILKPGDVFVFPIGLIHFQFNIGKTTAVAFAGLS  180

Query  626  SQNPGVITIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQFWYNN  766
            SQNPGVITIANAVFGS+PPIN  VL KAFQV + VI+YLQ+QFW++N
Sbjct  181  SQNPGVITIANAVFGSDPPINVDVLAKAFQVDKKVIDYLQSQFWWDN  227



>ref|XP_009612543.1| PREDICTED: germin-like protein subfamily 1 member 20 [Nicotiana 
tomentosiformis]
Length=228

 Score =   359 bits (922),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 178/227 (78%), Positives = 196/227 (86%), Gaps = 0/227 (0%)
 Frame = +2

Query  86   MAIRFIVFTITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDF  265
            MA++  V TI ++AL SS +HA DPSPLQD CVAV+DSMAAVFVNGKICK+P QV+ANDF
Sbjct  1    MALKAFVLTIAIMALLSSMSHAFDPSPLQDICVAVDDSMAAVFVNGKICKDPKQVMANDF  60

Query  266  FFRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVL  445
            F  GLN+PGNTSN LGS VT VNV NLPGLNTLGISL RID+AP GLNPPHTHPR TE+L
Sbjct  61   FKSGLNIPGNTSNQLGSTVTAVNVGNLPGLNTLGISLARIDYAPYGLNPPHTHPRGTEIL  120

Query  446  LVLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLS  625
             VLEGTLYVGFVLSNP P MKN LFTK L  GDVFVFP GLIHFQFNVGKTNA+AFAGLS
Sbjct  121  AVLEGTLYVGFVLSNPGPNMKNKLFTKILNPGDVFVFPIGLIHFQFNVGKTNAVAFAGLS  180

Query  626  SQNPGVITIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQFWYNN  766
            SQNPGVITIANAVFGS+PPINP VL KAFQV   V++YLQ+QFW++N
Sbjct  181  SQNPGVITIANAVFGSDPPINPDVLAKAFQVDNKVVDYLQSQFWWDN  227



>ref|XP_009625530.1| PREDICTED: putative germin-like protein 2-1 [Nicotiana tomentosiformis]
Length=228

 Score =   358 bits (920),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 177/227 (78%), Positives = 198/227 (87%), Gaps = 0/227 (0%)
 Frame = +2

Query  86   MAIRFIVFTITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDF  265
            MA++ +V TI ++A+ SS +HASDPSPLQDFCVAVNDSMAAVFVNGKICK+P  V A+DF
Sbjct  1    MALKSLVLTIAILAVVSSISHASDPSPLQDFCVAVNDSMAAVFVNGKICKDPKVVNADDF  60

Query  266  FFRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVL  445
            F  GLN+PGNTSN +GS VT VNV NLPGLNTLGISLVRID+AP GLNPPHTHPRATEVL
Sbjct  61   FKSGLNIPGNTSNQVGSAVTAVNVGNLPGLNTLGISLVRIDYAPYGLNPPHTHPRATEVL  120

Query  446  LVLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLS  625
            +VLEGTLYVGFVLSNP P MKN LFTK L  GDVFVFP GLIHFQFN+GKT A+AFAGLS
Sbjct  121  VVLEGTLYVGFVLSNPGPNMKNKLFTKILKPGDVFVFPIGLIHFQFNIGKTTAVAFAGLS  180

Query  626  SQNPGVITIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQFWYNN  766
            SQNPGVITIANAVFGS+P IN  VL KAFQV + VI+YLQ+QFW++N
Sbjct  181  SQNPGVITIANAVFGSDPSINADVLAKAFQVDKKVIDYLQSQFWWDN  227



>ref|XP_009627660.1| PREDICTED: germin-like protein subfamily 1 member 20 [Nicotiana 
tomentosiformis]
Length=228

 Score =   358 bits (919),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 177/227 (78%), Positives = 196/227 (86%), Gaps = 0/227 (0%)
 Frame = +2

Query  86   MAIRFIVFTITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDF  265
            MA++  V TI ++AL SS +HA DPSPLQD CVAV+DSMAAVFVNGKICK+P QV+ANDF
Sbjct  1    MALKAFVITIAIMALLSSMSHAFDPSPLQDICVAVDDSMAAVFVNGKICKDPKQVMANDF  60

Query  266  FFRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVL  445
            F  GLN+PGNTSN LGS VT VNV NLPGLNTLGISL RID+AP GLNPPHTHPR TE+L
Sbjct  61   FKSGLNIPGNTSNQLGSAVTAVNVGNLPGLNTLGISLARIDYAPYGLNPPHTHPRGTEIL  120

Query  446  LVLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLS  625
             VLEGTLYVGFVLSNP P MKN LFTK L  GDVFVFP GLIHFQFNVGKT A+AFAGLS
Sbjct  121  AVLEGTLYVGFVLSNPGPNMKNKLFTKILNPGDVFVFPIGLIHFQFNVGKTKAVAFAGLS  180

Query  626  SQNPGVITIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQFWYNN  766
            SQNPGVITIANAVFGS+PPINP VLTKAFQ+   V++YLQ+QFW++N
Sbjct  181  SQNPGVITIANAVFGSDPPINPDVLTKAFQLDNKVVDYLQSQFWWDN  227



>ref|XP_009620404.1| PREDICTED: germin-like protein subfamily 1 member 17 [Nicotiana 
tomentosiformis]
Length=228

 Score =   358 bits (919),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 177/227 (78%), Positives = 197/227 (87%), Gaps = 0/227 (0%)
 Frame = +2

Query  86   MAIRFIVFTITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDF  265
            MA++  V TI ++A+ SS +HA DPSPLQDFCVAVNDSMAAVFVNGKICK+P  V A+DF
Sbjct  1    MALKLFVLTIGILAIVSSISHAYDPSPLQDFCVAVNDSMAAVFVNGKICKDPKVVNADDF  60

Query  266  FFRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVL  445
            F  GLN+PGNTSN +GS VT VNV NLPGLNTLGISLVRID+AP GLNPPHTHPRATE+L
Sbjct  61   FKSGLNIPGNTSNQVGSAVTAVNVGNLPGLNTLGISLVRIDYAPYGLNPPHTHPRATEIL  120

Query  446  LVLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLS  625
            +VLEGTLYVGFVLSNP P MKN LFTK L  GDVFVFP GLIHFQFN+GKT A+AFAGLS
Sbjct  121  VVLEGTLYVGFVLSNPGPNMKNKLFTKILKPGDVFVFPIGLIHFQFNIGKTTAVAFAGLS  180

Query  626  SQNPGVITIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQFWYNN  766
            SQNPGVITIANAVFGS+PPIN  VL KAFQV + VINYLQ+QFW++N
Sbjct  181  SQNPGVITIANAVFGSDPPINDDVLAKAFQVDKKVINYLQSQFWWDN  227



>gb|EYU20539.1| hypothetical protein MIMGU_mgv1a013072mg [Erythranthe guttata]
Length=231

 Score =   357 bits (916),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 177/219 (81%), Positives = 194/219 (89%), Gaps = 1/219 (0%)
 Frame = +2

Query  110  TITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFFFRGLNMP  289
            TI VVA  ++   ASDPSPLQDFCVAVND+ +AVFVNGK+CKNP  VVA DF FRGLN P
Sbjct  11   TILVVASFATLGFASDPSPLQDFCVAVNDAKSAVFVNGKVCKNPNMVVAKDFLFRGLNKP  70

Query  290  GNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLY  469
            GNTSNPLGS+VTPVNVN LPGLNTLGIS VRID+APNGLNPPHTHPRATE+L+V+EGTLY
Sbjct  71   GNTSNPLGSRVTPVNVNQLPGLNTLGISAVRIDYAPNGLNPPHTHPRATEILVVIEGTLY  130

Query  470  VGFVLSNPP-PGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSSQNPGVI  646
            VGFV SNP  P +KN LFTK L  GDVFVFPEGLIHFQFNVGKTNA+AFAGLSSQNPGVI
Sbjct  131  VGFVTSNPADPALKNKLFTKYLYPGDVFVFPEGLIHFQFNVGKTNAVAFAGLSSQNPGVI  190

Query  647  TIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQFWYN  763
            TIANAVFGS+P INP VLTKAFQV +N+I+YLQAQFW+N
Sbjct  191  TIANAVFGSDPSINPAVLTKAFQVEKNIIDYLQAQFWWN  229



>ref|XP_009795501.1| PREDICTED: putative germin-like protein 2-1 [Nicotiana sylvestris]
Length=228

 Score =   357 bits (916),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 177/227 (78%), Positives = 196/227 (86%), Gaps = 0/227 (0%)
 Frame = +2

Query  86   MAIRFIVFTITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDF  265
            MA++  V TI ++A+ SS +HASDPSPLQDFCVAVNDSMAAVFVNGKICK+P  V A+DF
Sbjct  1    MALKSFVLTIAILAVVSSISHASDPSPLQDFCVAVNDSMAAVFVNGKICKDPKVVNADDF  60

Query  266  FFRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVL  445
            F  GLN+PGNTSN +GS VT VNV NLPGLNTLGISLVRID+AP GLNPPHTHPRATEVL
Sbjct  61   FKSGLNIPGNTSNQVGSAVTAVNVGNLPGLNTLGISLVRIDYAPYGLNPPHTHPRATEVL  120

Query  446  LVLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLS  625
             VLEGTLYVGFVLSNP P MKN LFTK L  GDVFVFP GLIHFQFN+GK  A+AFAGLS
Sbjct  121  AVLEGTLYVGFVLSNPGPNMKNKLFTKILKPGDVFVFPIGLIHFQFNIGKNKAVAFAGLS  180

Query  626  SQNPGVITIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQFWYNN  766
            SQNPGVITIANAVFGS+PPIN  VL KAFQV + VI+YLQ+QFW++N
Sbjct  181  SQNPGVITIANAVFGSDPPINDDVLAKAFQVDKKVIDYLQSQFWWDN  227



>gb|EYU38444.1| hypothetical protein MIMGU_mgv1a013102mg [Erythranthe guttata]
Length=230

 Score =   356 bits (914),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 178/228 (78%), Positives = 200/228 (88%), Gaps = 4/228 (2%)
 Frame = +2

Query  92   IRFIVFTITVVALSSSFA---HASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVAND  262
            ++  + ++TVV + +SFA   +ASDPSPLQDFCVAV D+ AAVFVNGKICKNP  VVA D
Sbjct  1    MKMTLVSLTVVFVLASFATLGYASDPSPLQDFCVAVKDADAAVFVNGKICKNPELVVAED  60

Query  263  FFFRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEV  442
            F +RGLN PGNTSNP+GS+VTPVNVN LPGLNTLGIS VRID+APNGLNPPHTHPRATE+
Sbjct  61   FIYRGLNKPGNTSNPIGSRVTPVNVNQLPGLNTLGISAVRIDYAPNGLNPPHTHPRATEI  120

Query  443  LLVLEGTLYVGFVLSNPP-PGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAG  619
            L+VLEGTLYVGFV SNP  P +KN LF K L  GDVFVFPEGLIHFQFNVGKTNA+AFAG
Sbjct  121  LVVLEGTLYVGFVTSNPANPAIKNKLFAKYLYPGDVFVFPEGLIHFQFNVGKTNAVAFAG  180

Query  620  LSSQNPGVITIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQFWYN  763
            LSSQNPGVIT+ANAVFGS+PPINP VLTKAFQV +NVI+YLQAQFW+N
Sbjct  181  LSSQNPGVITVANAVFGSDPPINPAVLTKAFQVEKNVIDYLQAQFWWN  228



>gb|EYU20535.1| hypothetical protein MIMGU_mgv1a013054mg [Erythranthe guttata]
Length=231

 Score =   356 bits (914),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 177/219 (81%), Positives = 193/219 (88%), Gaps = 1/219 (0%)
 Frame = +2

Query  110  TITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFFFRGLNMP  289
            TI VVA  ++   ASDPSPLQDFCVAVND+ +AVFVNGK+CKNP  VVA DF FRGLN P
Sbjct  11   TILVVASFATLGFASDPSPLQDFCVAVNDAQSAVFVNGKVCKNPNMVVAEDFLFRGLNKP  70

Query  290  GNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLY  469
            GNTSNPLGS+VTPVNVN LPGLNTLGIS VRID+APNGLNPPHTHPRATE+L+V+EGTLY
Sbjct  71   GNTSNPLGSRVTPVNVNQLPGLNTLGISAVRIDYAPNGLNPPHTHPRATEILVVIEGTLY  130

Query  470  VGFVLSNPP-PGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSSQNPGVI  646
            VGFV SNP  P +KN LFTK L  GDVFVFPEGLIHFQFNVGKTNA+AFAGLSSQNP VI
Sbjct  131  VGFVTSNPANPALKNKLFTKYLYPGDVFVFPEGLIHFQFNVGKTNAVAFAGLSSQNPSVI  190

Query  647  TIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQFWYN  763
            TIANAVFGS+PPINP VLTKAFQV +NVI+YLQ QFW+N
Sbjct  191  TIANAVFGSDPPINPAVLTKAFQVEKNVIDYLQKQFWWN  229



>ref|XP_011099651.1| PREDICTED: germin-like protein subfamily 1 member 13 [Sesamum 
indicum]
Length=229

 Score =   356 bits (913),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 182/227 (80%), Positives = 195/227 (86%), Gaps = 1/227 (0%)
 Frame = +2

Query  86   MAIRFIVFTITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDF  265
            M + F      +VA  S FAHASDPSPLQDFCVAVNDS+AAVFVNGKICKNP  VVA DF
Sbjct  1    MKMAFGFLAAILVASLSPFAHASDPSPLQDFCVAVNDSVAAVFVNGKICKNPNMVVAEDF  60

Query  266  FFRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVL  445
            FF GLN PGNTSN +GS VTPVNVN LPGLNTLGISL RIDFAP G+NPPHTHPRA+E+L
Sbjct  61   FFPGLNKPGNTSNQVGSMVTPVNVNQLPGLNTLGISLARIDFAPYGINPPHTHPRASEIL  120

Query  446  LVLEGTLYVGFVLSNPP-PGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGL  622
            LV+EGTLYVGFV SNP  P MKN LFTK L  GDVFVFP+GLIHFQFNVGKTNA+AFAGL
Sbjct  121  LVVEGTLYVGFVTSNPANPTMKNKLFTKYLYPGDVFVFPQGLIHFQFNVGKTNALAFAGL  180

Query  623  SSQNPGVITIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQFWYN  763
            SSQNPGVITIANAVFGSNPPINP VL KAFQV +NVI+YLQAQFW+N
Sbjct  181  SSQNPGVITIANAVFGSNPPINPDVLAKAFQVEKNVIDYLQAQFWWN  227



>ref|XP_009786127.1| PREDICTED: putative germin-like protein 2-1 [Nicotiana sylvestris]
Length=229

 Score =   355 bits (912),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 177/227 (78%), Positives = 195/227 (86%), Gaps = 0/227 (0%)
 Frame = +2

Query  86   MAIRFIVFTITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDF  265
            MA++  V TI ++A+ SS +HASDPSPLQDFCVAVNDSMAAVFVNGKICK+P  V A+DF
Sbjct  1    MALKSFVLTIAILAIVSSISHASDPSPLQDFCVAVNDSMAAVFVNGKICKDPKVVNADDF  60

Query  266  FFRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVL  445
            F  GLN+PGNTSN +GS VT VNV NLPGLNTLGISLVRID+AP GLNPPHTHPRATEVL
Sbjct  61   FKSGLNIPGNTSNQVGSAVTAVNVGNLPGLNTLGISLVRIDYAPYGLNPPHTHPRATEVL  120

Query  446  LVLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLS  625
             VLEGTLYVGFVLSNP P MKN LFTK L  GDVFVFP GLIHFQFNVGKT A+AFAGLS
Sbjct  121  AVLEGTLYVGFVLSNPGPNMKNKLFTKILKPGDVFVFPIGLIHFQFNVGKTKAVAFAGLS  180

Query  626  SQNPGVITIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQFWYNN  766
            SQNPGVITIAN VFGS+P IN  VL KAFQV + VI+YLQ+QFW++N
Sbjct  181  SQNPGVITIANTVFGSDPQINDDVLAKAFQVDKKVIDYLQSQFWWDN  227



>gb|EYU40211.1| hypothetical protein MIMGU_mgv1a013108mg [Erythranthe guttata]
Length=230

 Score =   355 bits (910),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 177/219 (81%), Positives = 196/219 (89%), Gaps = 1/219 (0%)
 Frame = +2

Query  110  TITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFFFRGLNMP  289
            TI VVA  ++FA+ASDPSPLQDFCVAVND+ A VFVNGKICKNP  VVA DF FRGLN P
Sbjct  10   TIFVVASFATFAYASDPSPLQDFCVAVNDTEAFVFVNGKICKNPNMVVAEDFLFRGLNKP  69

Query  290  GNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLY  469
            GNTSNPLGS+VTPV VN LPGLNTLGIS VRID+APNGLNPPHTHPRATE+L++L+GTLY
Sbjct  70   GNTSNPLGSRVTPVTVNQLPGLNTLGISAVRIDYAPNGLNPPHTHPRATEILILLKGTLY  129

Query  470  VGFVLSNPP-PGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSSQNPGVI  646
            VGFV SNP  P +KN LFTK L  GDVFVFP+GLIHFQFNVGKTNA+AFAGLSSQNPGVI
Sbjct  130  VGFVTSNPADPALKNKLFTKYLHPGDVFVFPQGLIHFQFNVGKTNAVAFAGLSSQNPGVI  189

Query  647  TIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQFWYN  763
            TIANAVFGS+PPI+P VLTKAFQV ++VI+YLQAQFW+N
Sbjct  190  TIANAVFGSDPPIDPAVLTKAFQVEKDVIDYLQAQFWWN  228



>ref|XP_009620917.1| PREDICTED: germin-like protein subfamily 1 member 17 [Nicotiana 
tomentosiformis]
Length=228

 Score =   354 bits (908),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 174/227 (77%), Positives = 196/227 (86%), Gaps = 0/227 (0%)
 Frame = +2

Query  86   MAIRFIVFTITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDF  265
            MA++ ++ TI  +A+  S +HA DPSPLQD CVAV+DSMAAVFVNGKICK+P QV+ANDF
Sbjct  1    MALKVLILTIATMAVLFSMSHAFDPSPLQDICVAVDDSMAAVFVNGKICKDPKQVMANDF  60

Query  266  FFRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVL  445
            F  GLN+PGNTSN LGS VT VNV NLPGLNTLGISL RID+AP GLNPPHTHPR TE+L
Sbjct  61   FKSGLNIPGNTSNQLGSAVTAVNVGNLPGLNTLGISLARIDYAPYGLNPPHTHPRGTEIL  120

Query  446  LVLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLS  625
             VLEGTLYVGFVLSNP P +KN LFTK L  GDVFVFP GLIHFQFNVGKT A+AFAGLS
Sbjct  121  AVLEGTLYVGFVLSNPGPNIKNKLFTKILNPGDVFVFPIGLIHFQFNVGKTKAVAFAGLS  180

Query  626  SQNPGVITIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQFWYNN  766
            SQNPGVITIANAVFGS+PPINP VLTKAFQV + V++YLQ+QFW++N
Sbjct  181  SQNPGVITIANAVFGSDPPINPDVLTKAFQVEKKVVDYLQSQFWWDN  227



>gb|EYU28622.1| hypothetical protein MIMGU_mgv1a018753mg [Erythranthe guttata]
Length=230

 Score =   354 bits (908),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 176/228 (77%), Positives = 197/228 (86%), Gaps = 2/228 (1%)
 Frame = +2

Query  86   MAIRFIVFTIT-VVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVAND  262
            M +  +  T+  V+A  ++  +ASDPSPLQDFCVAV D+ AAVFVNGKICKNP  VVA D
Sbjct  1    MKMTLVSLTVVFVLAYFATLGYASDPSPLQDFCVAVKDADAAVFVNGKICKNPDLVVAED  60

Query  263  FFFRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEV  442
            F +RGLN PGNTSNP+GS+VTPVNVN LPGLNTLGIS VRID+APNGLNPPHTHPRATE+
Sbjct  61   FIYRGLNKPGNTSNPIGSRVTPVNVNQLPGLNTLGISAVRIDYAPNGLNPPHTHPRATEI  120

Query  443  LLVLEGTLYVGFVLSNPP-PGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAG  619
            L+VLEGTLYVGFV SNP  P +KN LFTK L  GDVFVFPEGLIHFQFNVGKTNA+AFA 
Sbjct  121  LVVLEGTLYVGFVTSNPANPAIKNKLFTKYLYPGDVFVFPEGLIHFQFNVGKTNAVAFAA  180

Query  620  LSSQNPGVITIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQFWYN  763
            LSSQNPGVIT+ANAVFGS+PPINP VLTKAFQV +NVI+YLQAQFW+N
Sbjct  181  LSSQNPGVITVANAVFGSDPPINPAVLTKAFQVEKNVIDYLQAQFWWN  228



>ref|XP_009612541.1| PREDICTED: germin-like protein subfamily 1 member 17 [Nicotiana 
tomentosiformis]
Length=228

 Score =   354 bits (908),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 174/227 (77%), Positives = 195/227 (86%), Gaps = 0/227 (0%)
 Frame = +2

Query  86   MAIRFIVFTITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDF  265
            MA++ +  TI  +A+  S +HA DPSPLQD CVAV+DSMAAVFVNGKICK+P QV+ANDF
Sbjct  1    MALKVLKLTIATMAVLFSMSHAFDPSPLQDICVAVDDSMAAVFVNGKICKDPKQVMANDF  60

Query  266  FFRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVL  445
            F  GLN+PGNTSN LGS VT VNV NLPGLNTLGISL RID+AP GLNPPHTHPR TE+L
Sbjct  61   FKSGLNIPGNTSNQLGSAVTAVNVGNLPGLNTLGISLARIDYAPYGLNPPHTHPRGTEIL  120

Query  446  LVLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLS  625
             VLEGTLYVGFVLSNP P MKN LFTK L  GDVFVFP GLIHFQFNVGKT A+AFAGLS
Sbjct  121  AVLEGTLYVGFVLSNPGPNMKNKLFTKILNPGDVFVFPIGLIHFQFNVGKTKAVAFAGLS  180

Query  626  SQNPGVITIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQFWYNN  766
            SQNPGVITIANAVFGS+PPINP VLTKAFQ+ + V++YLQ+QFW++N
Sbjct  181  SQNPGVITIANAVFGSDPPINPDVLTKAFQLDKKVVDYLQSQFWWDN  227



>gb|EYU20546.1| hypothetical protein MIMGU_mgv1a013111mg [Erythranthe guttata]
Length=230

 Score =   353 bits (905),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 176/219 (80%), Positives = 193/219 (88%), Gaps = 1/219 (0%)
 Frame = +2

Query  110  TITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFFFRGLNMP  289
            TI VVA  ++FA+ASDPSPLQDFCVAVND+ A VFVNGKICKNP  VVA DF FRGLN P
Sbjct  10   TIFVVAFFATFAYASDPSPLQDFCVAVNDTEAFVFVNGKICKNPNMVVAEDFLFRGLNKP  69

Query  290  GNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLY  469
            GNTSNPLGS+VTPV VN LPGLNTLGIS VRID+APNGLNPPHTHPRATE+L++L+GTLY
Sbjct  70   GNTSNPLGSRVTPVTVNQLPGLNTLGISAVRIDYAPNGLNPPHTHPRATEILILLKGTLY  129

Query  470  VGFVLSNPP-PGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSSQNPGVI  646
            VGFV SNP  P +KN LF   L  GDVFVFP+GLIHFQFNVGKTNA+AFAGLSSQNPGVI
Sbjct  130  VGFVTSNPADPALKNKLFATYLHPGDVFVFPQGLIHFQFNVGKTNAVAFAGLSSQNPGVI  189

Query  647  TIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQFWYN  763
            TIANAVFGS+PPINP VLTKAFQV ++VI YLQAQFW+N
Sbjct  190  TIANAVFGSDPPINPAVLTKAFQVEKDVIEYLQAQFWWN  228



>ref|XP_006349261.1| PREDICTED: putative germin-like protein 2-1-like [Solanum tuberosum]
 ref|XP_006349262.1| PREDICTED: putative germin-like protein 2-1-like [Solanum tuberosum]
Length=228

 Score =   352 bits (904),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 173/228 (76%), Positives = 194/228 (85%), Gaps = 0/228 (0%)
 Frame = +2

Query  86   MAIRFIVFTITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDF  265
            MA+++ V  I ++A+ +S +HASDPSPLQDFCVAVNDSM AVFVNGK CKNPM V A+DF
Sbjct  1    MALKYFVLIIAILAVVTSISHASDPSPLQDFCVAVNDSMNAVFVNGKFCKNPMDVTADDF  60

Query  266  FFRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVL  445
            F  GLNM GNTSN LGS VT VNVNNL GLNTLGISL RIDFAP GLNPPHTHPR TEVL
Sbjct  61   FRPGLNMAGNTSNQLGSAVTAVNVNNLAGLNTLGISLARIDFAPYGLNPPHTHPRGTEVL  120

Query  446  LVLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLS  625
             + EGTLYVGFVLSNP P MKN LFTK L  GDVFVFP GLIHFQFNVGKTNA+AFAGLS
Sbjct  121  ALFEGTLYVGFVLSNPGPNMKNKLFTKILHPGDVFVFPVGLIHFQFNVGKTNAVAFAGLS  180

Query  626  SQNPGVITIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQFWYNNS  769
            SQNPGVITIANAVFGS+PPI+  VL KAFQ+ + V++YLQ+QFW++N+
Sbjct  181  SQNPGVITIANAVFGSDPPISDDVLAKAFQIDKKVVDYLQSQFWWDNN  228



>gb|EYU20549.1| hypothetical protein MIMGU_mgv1a020596mg [Erythranthe guttata]
Length=231

 Score =   352 bits (903),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 175/221 (79%), Positives = 195/221 (88%), Gaps = 1/221 (0%)
 Frame = +2

Query  104  VFTITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFFFRGLN  283
            V TI +V+  ++ A+ASDPSPLQDFCVAV D+ AAVFVNGK+CKNP  VVA DFFF GLN
Sbjct  9    VTTIFIVSCLATLAYASDPSPLQDFCVAVKDADAAVFVNGKVCKNPNMVVAEDFFFPGLN  68

Query  284  MPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGT  463
             PGNTSNP+GS+VTPVNVN +PGLNTLGIS VRID+APNGLNPPHTHPRATE+L+V+EGT
Sbjct  69   KPGNTSNPVGSRVTPVNVNQIPGLNTLGISAVRIDYAPNGLNPPHTHPRATEILVVMEGT  128

Query  464  LYVGFVLSNPP-PGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSSQNPG  640
            LYVGFV SNP  P +KN LFTK L  GDVFVFPEGLIHFQFNVGKTNA+AFAGLSSQNPG
Sbjct  129  LYVGFVTSNPADPALKNKLFTKYLYPGDVFVFPEGLIHFQFNVGKTNAVAFAGLSSQNPG  188

Query  641  VITIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQFWYN  763
            VIT+ANAVFGS+P INP VLTKAFQV +NVI+YLQAQFW N
Sbjct  189  VITVANAVFGSDPQINPAVLTKAFQVEKNVIDYLQAQFWTN  229



>ref|XP_004230404.1| PREDICTED: putative germin-like protein 2-1 [Solanum lycopersicum]
Length=228

 Score =   351 bits (900),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 173/227 (76%), Positives = 194/227 (85%), Gaps = 0/227 (0%)
 Frame = +2

Query  86   MAIRFIVFTITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDF  265
            MA+++ V  I ++A+ +S +HASDPSPLQDFCVAVNDSM  VFVNGK+CK+P  V ANDF
Sbjct  1    MALKYAVLIIAILAVVTSISHASDPSPLQDFCVAVNDSMTPVFVNGKVCKDPKVVSANDF  60

Query  266  FFRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVL  445
            F  GLN+ GNTSN +GS VT VNVNNLPGLNTLGISLVRID+AP GLNPPHTHPR TEVL
Sbjct  61   FKSGLNVAGNTSNNVGSAVTAVNVNNLPGLNTLGISLVRIDYAPYGLNPPHTHPRGTEVL  120

Query  446  LVLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLS  625
             VLEGTLYVGFVLSNP P MKN LFTK L  GDVFVFP GLIHFQFNVGKT A+AFAGLS
Sbjct  121  TVLEGTLYVGFVLSNPGPNMKNKLFTKILHPGDVFVFPIGLIHFQFNVGKTKAVAFAGLS  180

Query  626  SQNPGVITIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQFWYNN  766
            SQNPGVITIANAVFGS+PPIN  VL KAFQV + V++YLQ+QFW++N
Sbjct  181  SQNPGVITIANAVFGSDPPINDDVLAKAFQVDKKVVHYLQSQFWWDN  227



>ref|XP_006349267.1| PREDICTED: germin-like protein subfamily 1 member 13-like [Solanum 
tuberosum]
Length=228

 Score =   349 bits (896),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 171/227 (75%), Positives = 193/227 (85%), Gaps = 0/227 (0%)
 Frame = +2

Query  86   MAIRFIVFTITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDF  265
            MA++  V  I ++A+ +S +HASDPSPLQDFCVAVNDSM  VFVNGK+CK+P  V A+DF
Sbjct  1    MALKSFVLIIAILAVVTSISHASDPSPLQDFCVAVNDSMTTVFVNGKVCKDPRVVTADDF  60

Query  266  FFRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVL  445
            F  GLN+ GNTSN +GS VT VNVNNLPGLNTLGISLVRID+AP GLNPPHTHPR TEVL
Sbjct  61   FKSGLNVAGNTSNNVGSAVTAVNVNNLPGLNTLGISLVRIDYAPYGLNPPHTHPRGTEVL  120

Query  446  LVLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLS  625
             VLEGTLYVGFVLSNP P MKN LFTK L  GDVFVFP GLIHFQFNVGKT A+AFAGLS
Sbjct  121  TVLEGTLYVGFVLSNPGPNMKNKLFTKILHPGDVFVFPIGLIHFQFNVGKTKAVAFAGLS  180

Query  626  SQNPGVITIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQFWYNN  766
            SQNPGVITIANAVFGS+PPIN  +L KAFQV + V++YLQ+QFW++N
Sbjct  181  SQNPGVITIANAVFGSDPPINDDILAKAFQVDKKVVDYLQSQFWWDN  227



>ref|XP_004230403.1| PREDICTED: putative germin-like protein 2-1 [Solanum lycopersicum]
Length=228

 Score =   349 bits (895),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 172/228 (75%), Positives = 194/228 (85%), Gaps = 0/228 (0%)
 Frame = +2

Query  86   MAIRFIVFTITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDF  265
            MA++  +  I ++A+ +S +HASDPSPLQDFCVAVNDSM AVFVNGK CKNPM V A+DF
Sbjct  1    MALKSFILIIAILAVVTSISHASDPSPLQDFCVAVNDSMNAVFVNGKFCKNPMDVNADDF  60

Query  266  FFRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVL  445
            F  GLN+ GNTSN LGS VT VNVNNL GLNTLGISL RIDFAP GLNPPHTHPRATEVL
Sbjct  61   FRPGLNLAGNTSNQLGSAVTAVNVNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVL  120

Query  446  LVLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLS  625
             + EGTLYVGFVLSNP P MKN LFTK L  GDVFVFP GLIHFQFNVGKT+A+AFAGLS
Sbjct  121  TLFEGTLYVGFVLSNPGPNMKNKLFTKILHPGDVFVFPVGLIHFQFNVGKTDAVAFAGLS  180

Query  626  SQNPGVITIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQFWYNNS  769
            SQNPGVITIANAVFGS+PPIN  VL KAFQ+ + V++YLQ+QFW++N+
Sbjct  181  SQNPGVITIANAVFGSDPPINDDVLAKAFQIDKKVVDYLQSQFWWDNN  228



>gb|EYU40209.1| hypothetical protein MIMGU_mgv1a013129mg [Erythranthe guttata]
Length=230

 Score =   349 bits (895),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 174/219 (79%), Positives = 192/219 (88%), Gaps = 1/219 (0%)
 Frame = +2

Query  110  TITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFFFRGLNMP  289
            TI VVA  ++FA+ASDPSPLQDFCVAVND+ A VFVNGKICKNP  VVA DF FRGLN P
Sbjct  10   TIFVVASFATFAYASDPSPLQDFCVAVNDTKAFVFVNGKICKNPNMVVAEDFLFRGLNKP  69

Query  290  GNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLY  469
            GNTSNPLGS+VTPV VN LPGLNTLGIS VRID+AP GLNPPHTHPRATE+L++L+GTLY
Sbjct  70   GNTSNPLGSRVTPVTVNQLPGLNTLGISAVRIDYAPKGLNPPHTHPRATEILILLKGTLY  129

Query  470  VGFVLSNPP-PGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSSQNPGVI  646
            VGFV SNP  P +KN LF   L  GDVFVFP+GLIHFQFNVGKTNA+AFAGLSSQNPGVI
Sbjct  130  VGFVTSNPADPALKNKLFATYLHPGDVFVFPQGLIHFQFNVGKTNAVAFAGLSSQNPGVI  189

Query  647  TIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQFWYN  763
            TIANAVFGS+PPI+P VLTKAFQV ++VI YLQAQFW+N
Sbjct  190  TIANAVFGSDPPIDPVVLTKAFQVEKDVIEYLQAQFWWN  228



>gb|EYU20541.1| hypothetical protein MIMGU_mgv1a018988mg [Erythranthe guttata]
Length=230

 Score =   349 bits (895),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 172/219 (79%), Positives = 193/219 (88%), Gaps = 1/219 (0%)
 Frame = +2

Query  110  TITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFFFRGLNMP  289
            T+  +A  ++FA+ASDPSPLQDFCVAV D+ AAVFVNGK+CKNP  VVA +FFF GLN  
Sbjct  10   TLFFIACLATFAYASDPSPLQDFCVAVKDADAAVFVNGKVCKNPDMVVAENFFFPGLNKS  69

Query  290  GNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLY  469
            GNTSNP+GS+VTPVNVN +PGLNTLGIS VRID+APNGLNPPHTHPRATE+L+V+EGTLY
Sbjct  70   GNTSNPVGSRVTPVNVNQIPGLNTLGISAVRIDYAPNGLNPPHTHPRATEILVVMEGTLY  129

Query  470  VGFVLSNPP-PGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSSQNPGVI  646
            VGFV SNP  P +KN LFTK L  GDVFVFPEGLIHFQFNVGKTNA+AFA LSSQNPGVI
Sbjct  130  VGFVTSNPANPALKNKLFTKYLYPGDVFVFPEGLIHFQFNVGKTNAVAFAALSSQNPGVI  189

Query  647  TIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQFWYN  763
            TIAN VFGS+PPINP VLTKAFQV +NVI+YLQAQFW+N
Sbjct  190  TIANTVFGSDPPINPAVLTKAFQVKKNVIDYLQAQFWWN  228



>gb|EYU20545.1| hypothetical protein MIMGU_mgv1a020779mg [Erythranthe guttata]
Length=231

 Score =   348 bits (894),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 174/221 (79%), Positives = 193/221 (87%), Gaps = 1/221 (0%)
 Frame = +2

Query  104  VFTITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFFFRGLN  283
            V TI VV+  ++ A+ASDPSPLQDFCVAV D  AAVFVNGK+CKNP  VVA DFFF GLN
Sbjct  9    VTTIFVVSCLATLAYASDPSPLQDFCVAVKDEDAAVFVNGKVCKNPDMVVAEDFFFPGLN  68

Query  284  MPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGT  463
             PGNTSN +GS+VTPVNVN +PGLNTLGIS VRID+APNGLNPPHTHPRATE+L+V+EGT
Sbjct  69   KPGNTSNLVGSRVTPVNVNQIPGLNTLGISAVRIDYAPNGLNPPHTHPRATEILVVMEGT  128

Query  464  LYVGFVLSNPP-PGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSSQNPG  640
            LYVGFV SNP  P +KN LFTK L  GDVFVFPEGLIHFQFNVGKTNA+AFAGLSSQNPG
Sbjct  129  LYVGFVTSNPADPALKNKLFTKYLYPGDVFVFPEGLIHFQFNVGKTNAVAFAGLSSQNPG  188

Query  641  VITIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQFWYN  763
            VIT+ANAVFGS+P INP VLTKAFQV +NVI+YLQAQFW +
Sbjct  189  VITVANAVFGSDPKINPAVLTKAFQVEKNVIDYLQAQFWTD  229



>ref|XP_009786129.1| PREDICTED: putative germin-like protein 2-1 [Nicotiana sylvestris]
Length=228

 Score =   348 bits (893),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 174/228 (76%), Positives = 195/228 (86%), Gaps = 0/228 (0%)
 Frame = +2

Query  86   MAIRFIVFTITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDF  265
            MA +  V T+ ++A+  S +HA DPSPLQDFCVAVNDSMAAVFVNGKICK+P  V A+DF
Sbjct  1    MARKLFVLTVAILAVVFSISHAYDPSPLQDFCVAVNDSMAAVFVNGKICKDPNVVNADDF  60

Query  266  FFRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVL  445
            F  GLN+PGNTSN +GS VT VNV NL GLNTLGISLVRID+AP GLNPPHTHPRA EVL
Sbjct  61   FKSGLNIPGNTSNQVGSAVTAVNVINLHGLNTLGISLVRIDYAPYGLNPPHTHPRAAEVL  120

Query  446  LVLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLS  625
            +VLEGTLYVGFVLSNP P MKN LFTK L  GDVFVFP GLIHFQFNVGKT A+AFAGLS
Sbjct  121  VVLEGTLYVGFVLSNPGPNMKNKLFTKILKPGDVFVFPIGLIHFQFNVGKTKAVAFAGLS  180

Query  626  SQNPGVITIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQFWYNNS  769
            SQNPGVITIANA+FGS+PPIN  VLTKAFQV + VI+YLQ+QFW++N+
Sbjct  181  SQNPGVITIANAIFGSDPPINEDVLTKAFQVDKKVIDYLQSQFWWDNN  228



>ref|XP_006358459.1| PREDICTED: germin-like protein subfamily 1 member 20-like [Solanum 
tuberosum]
Length=228

 Score =   348 bits (893),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 172/227 (76%), Positives = 192/227 (85%), Gaps = 0/227 (0%)
 Frame = +2

Query  86   MAIRFIVFTITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDF  265
            MA+++ V TI ++A  +S +HASDPSPLQDFCVAVNDS +AVFVNGK CK+P  V A+DF
Sbjct  1    MALKYFVLTIAILAAVTSISHASDPSPLQDFCVAVNDSKSAVFVNGKFCKDPKDVTADDF  60

Query  266  FFRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVL  445
            F  GLN+PGNTSN LGS VT VNVNNL GLNTLGISL RIDFAP G NPPHTHPR TEVL
Sbjct  61   FRPGLNVPGNTSNQLGSVVTAVNVNNLLGLNTLGISLARIDFAPYGFNPPHTHPRGTEVL  120

Query  446  LVLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLS  625
             VLEGTLYVGFVLSNP P MKN LFTK L  GDVFVFP GLIHFQFNVGKT A+AFAGLS
Sbjct  121  AVLEGTLYVGFVLSNPGPNMKNKLFTKILHPGDVFVFPIGLIHFQFNVGKTKAVAFAGLS  180

Query  626  SQNPGVITIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQFWYNN  766
            SQNPGVIT+ANAVFGS+PPIN  VL KAFQV + V++YLQ+QFW++N
Sbjct  181  SQNPGVITVANAVFGSDPPINDDVLAKAFQVDKKVVDYLQSQFWWDN  227



>ref|XP_006349264.1| PREDICTED: germin-like protein subfamily 1 member 13-like [Solanum 
tuberosum]
Length=228

 Score =   348 bits (893),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 172/227 (76%), Positives = 190/227 (84%), Gaps = 0/227 (0%)
 Frame = +2

Query  86   MAIRFIVFTITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDF  265
            M  + +V  I ++A+ SS +HASDPSPLQDFCVAV+DS +AVFVNGK CKNPM V A+DF
Sbjct  1    MTFKSLVLVIAIMAVLSSMSHASDPSPLQDFCVAVDDSKSAVFVNGKFCKNPMDVTADDF  60

Query  266  FFRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVL  445
            F  GLNM GNTSN LGS VT VNVNNL GLNTLGISL RIDFAP GLNPPHTHPR TEVL
Sbjct  61   FRPGLNMAGNTSNQLGSAVTAVNVNNLAGLNTLGISLARIDFAPYGLNPPHTHPRGTEVL  120

Query  446  LVLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLS  625
             + EGTLYVGFVLSNP P MKN LFTK L  GDVFVFP GLIHFQFNVGKTNA+AFAGLS
Sbjct  121  ALFEGTLYVGFVLSNPGPNMKNKLFTKILHPGDVFVFPVGLIHFQFNVGKTNAVAFAGLS  180

Query  626  SQNPGVITIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQFWYNN  766
            SQNPGVITIANAVFGS+PPIN  VL KAFQ+   V++YLQ+QFW++N
Sbjct  181  SQNPGVITIANAVFGSDPPINDDVLAKAFQIENKVVDYLQSQFWWDN  227



>ref|XP_006358463.1| PREDICTED: germin-like protein subfamily 1 member 20-like [Solanum 
tuberosum]
Length=228

 Score =   348 bits (893),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 171/227 (75%), Positives = 193/227 (85%), Gaps = 0/227 (0%)
 Frame = +2

Query  86   MAIRFIVFTITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDF  265
            MA+++ V TI ++A+ +S +HASDPSPLQDFCVAV DS +AVFVNGK CK+P  V A+DF
Sbjct  1    MALKYFVLTIAILAVVTSISHASDPSPLQDFCVAVEDSKSAVFVNGKFCKDPKDVTADDF  60

Query  266  FFRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVL  445
            F  GLN+PGNTSN LGS V  VNVNNLPGLNTLGISL RIDFAP GLNPPHTHPR TEVL
Sbjct  61   FRPGLNVPGNTSNQLGSVVIAVNVNNLPGLNTLGISLARIDFAPYGLNPPHTHPRGTEVL  120

Query  446  LVLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLS  625
            +VLEGTLYVGFVLSNP P MKN LFTK L  GDVFVFP GLIHFQFNVGKT A+AFAGLS
Sbjct  121  VVLEGTLYVGFVLSNPGPNMKNKLFTKILHPGDVFVFPIGLIHFQFNVGKTKAVAFAGLS  180

Query  626  SQNPGVITIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQFWYNN  766
            SQNP VITIANA+FGS+PPIN  VL KAFQV + V++YLQ+QFW++N
Sbjct  181  SQNPVVITIANAIFGSDPPINDDVLAKAFQVDKKVVDYLQSQFWWDN  227



>gb|EYU40208.1| hypothetical protein MIMGU_mgv1a020439mg [Erythranthe guttata]
Length=230

 Score =   348 bits (892),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 172/219 (79%), Positives = 191/219 (87%), Gaps = 1/219 (0%)
 Frame = +2

Query  110  TITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFFFRGLNMP  289
            T+ V+A  +SFA+ASDPSPLQDFCVAV D+ AAVFVNGKICK+P  VVA DFF  GLN P
Sbjct  10   TLFVIACLASFAYASDPSPLQDFCVAVKDADAAVFVNGKICKDPNMVVAEDFFLSGLNKP  69

Query  290  GNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLY  469
            GNTSNP+GS+VTP NVN + GLNTLGIS VRID+APNGLNPPHTHPRATE+L+VLEGTLY
Sbjct  70   GNTSNPVGSRVTPANVNQIAGLNTLGISAVRIDYAPNGLNPPHTHPRATEILVVLEGTLY  129

Query  470  VGFVLSNPP-PGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSSQNPGVI  646
            VGFV SNP  P +KN LFTK L  GDVFVFPEGLIHFQFNVGKT A+AFA LSSQNPGVI
Sbjct  130  VGFVTSNPANPAIKNKLFTKYLYPGDVFVFPEGLIHFQFNVGKTKAVAFAALSSQNPGVI  189

Query  647  TIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQFWYN  763
            T+ANAVFGS+PPIN  VLTKAFQV +NVI+YLQAQFW+N
Sbjct  190  TVANAVFGSDPPINRAVLTKAFQVEKNVIDYLQAQFWWN  228



>gb|EYU20548.1| hypothetical protein MIMGU_mgv1a013109mg [Erythranthe guttata]
Length=230

 Score =   348 bits (892),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 172/221 (78%), Positives = 192/221 (87%), Gaps = 1/221 (0%)
 Frame = +2

Query  104  VFTITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFFFRGLN  283
            + TI +V+  ++ A+ASDPSPLQDFCVAV D+ AAVFVNGK+CKNP  VVA DFF  GLN
Sbjct  8    LITIFIVSCLATLAYASDPSPLQDFCVAVKDADAAVFVNGKVCKNPNMVVAEDFFLSGLN  67

Query  284  MPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGT  463
             PGNTSNP+GS+VTP NVN +PGLNTLGIS VRID+APNGLNPPHTHPRATE+L+VLEGT
Sbjct  68   KPGNTSNPVGSRVTPANVNQIPGLNTLGISAVRIDYAPNGLNPPHTHPRATEILVVLEGT  127

Query  464  LYVGFVLSNPP-PGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSSQNPG  640
            LYVGFV SNP  P +KN LFTK L  GDVFVFPEGLIHFQFNVGKTNA+AFA LSSQNPG
Sbjct  128  LYVGFVTSNPADPTLKNKLFTKYLYPGDVFVFPEGLIHFQFNVGKTNAVAFAALSSQNPG  187

Query  641  VITIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQFWYN  763
            VITIANAVFGS+P IN  VLTKAFQV +NVI+YLQAQFW+N
Sbjct  188  VITIANAVFGSDPTINTAVLTKAFQVEKNVIDYLQAQFWWN  228



>gb|EYU20542.1| hypothetical protein MIMGU_mgv1a020630mg [Erythranthe guttata]
Length=231

 Score =   348 bits (892),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 173/219 (79%), Positives = 193/219 (88%), Gaps = 1/219 (0%)
 Frame = +2

Query  104  VFTITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFFFRGLN  283
            V TI V++  ++FA+ASDPSPLQDFCVAV D+ AAVFVNGK+CKNP  VVA DFFF GLN
Sbjct  9    VTTIFVISCWATFAYASDPSPLQDFCVAVKDADAAVFVNGKVCKNPDMVVAEDFFFPGLN  68

Query  284  MPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGT  463
             PGNTSN +GS+VTPVNVN +PGLNTLGIS VRID+APNG NPPHTHPRATE+L+V+EGT
Sbjct  69   KPGNTSNLVGSRVTPVNVNQIPGLNTLGISAVRIDYAPNGSNPPHTHPRATEILVVMEGT  128

Query  464  LYVGFVLSNPP-PGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSSQNPG  640
            LYVGFV SNP  P +KN LFTK L  GDVFVFPEGLIHFQFNVGKTNA+AFAGLSSQNPG
Sbjct  129  LYVGFVTSNPANPALKNKLFTKYLYPGDVFVFPEGLIHFQFNVGKTNAVAFAGLSSQNPG  188

Query  641  VITIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQFW  757
            VIT+ANAVFGS+P INP VLTKAFQV +NVI+YLQAQFW
Sbjct  189  VITVANAVFGSDPKINPAVLTKAFQVEKNVIDYLQAQFW  227



>gb|AFW90592.1| germin-like protein subfamily 1 member 20 precursor [Solanum 
tuberosum]
Length=228

 Score =   347 bits (891),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 170/227 (75%), Positives = 192/227 (85%), Gaps = 0/227 (0%)
 Frame = +2

Query  86   MAIRFIVFTITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDF  265
            MA++  V  I ++A+ +S +HASDPSPLQDFCVAVNDSM  VFVNGK+CK+P  V A+DF
Sbjct  1    MALKSFVLIIAILAVVTSISHASDPSPLQDFCVAVNDSMTTVFVNGKVCKDPRVVTADDF  60

Query  266  FFRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVL  445
            F  GLN+ GNTSN +GS VT VNVNNLPGLN LGISLVRID+AP GLNPPHTHPR TEVL
Sbjct  61   FKSGLNVAGNTSNNVGSAVTAVNVNNLPGLNALGISLVRIDYAPYGLNPPHTHPRGTEVL  120

Query  446  LVLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLS  625
             VLEGTLYVGFVLSNP P MKN LFTK L  GDVFVFP GLIHFQFNVGKT A+AFAGLS
Sbjct  121  TVLEGTLYVGFVLSNPGPNMKNKLFTKILHPGDVFVFPIGLIHFQFNVGKTKAVAFAGLS  180

Query  626  SQNPGVITIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQFWYNN  766
            SQNPGVITIANAVFGS+PPIN  +L KAFQV + V++YLQ+QFW++N
Sbjct  181  SQNPGVITIANAVFGSDPPINDDILAKAFQVDKKVVDYLQSQFWWDN  227



>gb|EYU20540.1| hypothetical protein MIMGU_mgv1a013117mg [Erythranthe guttata]
Length=230

 Score =   347 bits (891),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 172/219 (79%), Positives = 191/219 (87%), Gaps = 1/219 (0%)
 Frame = +2

Query  110  TITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFFFRGLNMP  289
            TI  +A  ++F +ASDPSPLQDFCVAVND+ A VFVNGKICKNP  VVA DF FRGLN P
Sbjct  10   TIFAIASFATFGYASDPSPLQDFCVAVNDTEAFVFVNGKICKNPNMVVAEDFLFRGLNKP  69

Query  290  GNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLY  469
            GNTSNPLGS+VTPV VN LPGLNTLGIS VRID+APNGLNPPHTHPRATE+L++L+GTLY
Sbjct  70   GNTSNPLGSRVTPVTVNQLPGLNTLGISAVRIDYAPNGLNPPHTHPRATEILILLKGTLY  129

Query  470  VGFVLSNPP-PGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSSQNPGVI  646
            VGFV SNP  P +KN LF   L  GDVFVFP+GLIHFQFNVGKTNA+AFAGLSSQNPGVI
Sbjct  130  VGFVTSNPADPALKNKLFATYLHPGDVFVFPQGLIHFQFNVGKTNAVAFAGLSSQNPGVI  189

Query  647  TIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQFWYN  763
            TIANAVFGS+PPI+P VLTKAFQV ++VI YLQAQFW+N
Sbjct  190  TIANAVFGSDPPIDPAVLTKAFQVEKDVIEYLQAQFWWN  228



>gb|EYU20547.1| hypothetical protein MIMGU_mgv1a023357mg [Erythranthe guttata]
Length=231

 Score =   347 bits (891),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 175/221 (79%), Positives = 191/221 (86%), Gaps = 1/221 (0%)
 Frame = +2

Query  104  VFTITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFFFRGLN  283
            V TI VV+  ++ A+ASDPSPLQDFCVAV D  AAVFVNGK+CKNP  VVA DFFF GLN
Sbjct  9    VTTIFVVSCLATLAYASDPSPLQDFCVAVKDEDAAVFVNGKVCKNPDMVVAEDFFFPGLN  68

Query  284  MPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGT  463
             PGNTSN +GS+VTPVNVN +PGLNTLGIS VRID+APNGLNPPHTHPRATE+L V+EGT
Sbjct  69   KPGNTSNLVGSRVTPVNVNQIPGLNTLGISAVRIDYAPNGLNPPHTHPRATEILFVMEGT  128

Query  464  LYVGFVLSNPPP-GMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSSQNPG  640
            LYVGFV SNP    +KN LFTK L  GDVFVFPEGLIHFQFNVGKTNA+AFAGLSSQNPG
Sbjct  129  LYVGFVTSNPADLALKNKLFTKYLYPGDVFVFPEGLIHFQFNVGKTNAVAFAGLSSQNPG  188

Query  641  VITIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQFWYN  763
            VITIANAVFG +PPINP VLTKAFQV +NVI+YLQAQFW N
Sbjct  189  VITIANAVFGLDPPINPAVLTKAFQVEKNVIDYLQAQFWTN  229



>gb|EYU40210.1| hypothetical protein MIMGU_mgv1a022317mg [Erythranthe guttata]
Length=230

 Score =   347 bits (889),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 172/219 (79%), Positives = 191/219 (87%), Gaps = 1/219 (0%)
 Frame = +2

Query  110  TITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFFFRGLNMP  289
            T+ V+A  +SFA+ASDPSPLQDFCVAV ++ AAVFVNGKICK+P  VVA DFF  GLN P
Sbjct  10   TLFVIACLASFAYASDPSPLQDFCVAVKEADAAVFVNGKICKDPNMVVAEDFFLSGLNKP  69

Query  290  GNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLY  469
            GNT NP+GS+VTP NVN +PGLNTLGIS VRID+APNGLNPPHTHPRATE+L+V EGTLY
Sbjct  70   GNTLNPVGSRVTPANVNQIPGLNTLGISAVRIDYAPNGLNPPHTHPRATEILVVSEGTLY  129

Query  470  VGFVLSNPP-PGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSSQNPGVI  646
            VGFV SNP  P +KN LFTK L  GDVFVFPEGLIHFQFNVGKTNA+AFA LSSQNPGVI
Sbjct  130  VGFVTSNPANPAIKNKLFTKYLYPGDVFVFPEGLIHFQFNVGKTNAVAFAALSSQNPGVI  189

Query  647  TIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQFWYN  763
            TIANAVFGS+PPINP VLTK FQV +NVI+YLQAQFW+N
Sbjct  190  TIANAVFGSDPPINPAVLTKGFQVEKNVIDYLQAQFWWN  228



>gb|EYU20536.1| hypothetical protein MIMGU_mgv1a025658mg [Erythranthe guttata]
Length=231

 Score =   347 bits (889),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 174/219 (79%), Positives = 190/219 (87%), Gaps = 1/219 (0%)
 Frame = +2

Query  110  TITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFFFRGLNMP  289
            TI VVA  ++   ASDPSPLQDFCVAVND+ +AVFVNGK+CK+P  VVA DFF  GLN  
Sbjct  11   TILVVASFATLGFASDPSPLQDFCVAVNDAKSAVFVNGKVCKDPNMVVAEDFFLSGLNKL  70

Query  290  GNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLY  469
            GNTSNPLGS+VTPVNVN LPGLNTLGIS VRID+A NGLNPPHTHPRATE+L+VLEGTLY
Sbjct  71   GNTSNPLGSRVTPVNVNQLPGLNTLGISAVRIDYALNGLNPPHTHPRATEILVVLEGTLY  130

Query  470  VGFVLSNPP-PGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSSQNPGVI  646
            VGFV SNP  P +KN LFTK L  GDVFVFPEGLIHFQFN GKTNA+AFAGLSSQNPGVI
Sbjct  131  VGFVTSNPANPALKNKLFTKYLYPGDVFVFPEGLIHFQFNAGKTNAVAFAGLSSQNPGVI  190

Query  647  TIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQFWYN  763
            TIANAVFGS+P INP VLTKAFQV +NVI+YLQAQFW+N
Sbjct  191  TIANAVFGSDPSINPAVLTKAFQVEKNVIDYLQAQFWWN  229



>ref|XP_006346966.1| PREDICTED: putative germin-like protein 2-1-like [Solanum tuberosum]
Length=228

 Score =   346 bits (887),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 170/227 (75%), Positives = 191/227 (84%), Gaps = 0/227 (0%)
 Frame = +2

Query  86   MAIRFIVFTITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDF  265
            MA++  V  I ++A+ +S +HASDPSPLQDFCVA+NDSM  VFVNGK+CK+P  V A+DF
Sbjct  1    MALKSFVLIIAILAVVTSISHASDPSPLQDFCVAINDSMTTVFVNGKVCKDPKVVTADDF  60

Query  266  FFRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVL  445
            F  GLN+ GNTSN +GS VT VNVNNLPGLNTLGISL RID+AP GLNPPHTHPR TEVL
Sbjct  61   FKSGLNIAGNTSNNVGSAVTAVNVNNLPGLNTLGISLARIDYAPYGLNPPHTHPRGTEVL  120

Query  446  LVLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLS  625
             VLEGTLYVGFVLSNP P MKN LFTK L  GDVFVFP GLIHFQFNVGKT A+AFAGLS
Sbjct  121  TVLEGTLYVGFVLSNPGPNMKNKLFTKILHPGDVFVFPIGLIHFQFNVGKTKAVAFAGLS  180

Query  626  SQNPGVITIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQFWYNN  766
            SQNPGVITIANAVFGS+P IN  VL KAFQV + V+NYLQ+QFW++N
Sbjct  181  SQNPGVITIANAVFGSDPSINNDVLAKAFQVEKKVVNYLQSQFWWDN  227



>ref|XP_006349268.1| PREDICTED: germin-like protein subfamily 1 member 13-like [Solanum 
tuberosum]
Length=228

 Score =   346 bits (887),  Expect = 9e-116, Method: Compositional matrix adjust.
 Identities = 171/227 (75%), Positives = 189/227 (83%), Gaps = 0/227 (0%)
 Frame = +2

Query  86   MAIRFIVFTITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDF  265
            M  + +V  I ++A+ SS +HASDPSPLQDFCVAV+DS +AVFVNGK CKNPM V A+DF
Sbjct  1    MTFKSLVLIIAIMAVLSSMSHASDPSPLQDFCVAVDDSKSAVFVNGKFCKNPMDVTADDF  60

Query  266  FFRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVL  445
            F  GLNM GNTSN LGS VT VNVNNL GLNTLGISL RIDFAP GLNPPHTHPR TEVL
Sbjct  61   FRPGLNMAGNTSNQLGSAVTAVNVNNLAGLNTLGISLARIDFAPYGLNPPHTHPRGTEVL  120

Query  446  LVLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLS  625
             + EGTLYVGFVLSNP P MKN LFTK L  GDVFVFP GLIHFQFNVGKTNA+AFAGLS
Sbjct  121  ALFEGTLYVGFVLSNPGPNMKNKLFTKILHPGDVFVFPVGLIHFQFNVGKTNAVAFAGLS  180

Query  626  SQNPGVITIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQFWYNN  766
            SQNPGVI IANAVFGS+PPIN  VL KAFQ+   V++YLQ+QFW++N
Sbjct  181  SQNPGVIIIANAVFGSDPPINDDVLAKAFQIENKVVDYLQSQFWWDN  227



>ref|XP_004230405.1| PREDICTED: germin-like protein subfamily 1 member 14 [Solanum 
lycopersicum]
Length=228

 Score =   345 bits (885),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 172/228 (75%), Positives = 192/228 (84%), Gaps = 0/228 (0%)
 Frame = +2

Query  86   MAIRFIVFTITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDF  265
            M  +  V TI+++A+  S +HASDPSPLQDFCVAVNDS  AVFVNGK CKNP+ V A+DF
Sbjct  1    MTFKSFVLTISIMAVLFSLSHASDPSPLQDFCVAVNDSKNAVFVNGKFCKNPLDVNADDF  60

Query  266  FFRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVL  445
            F  GLN+ GNTSN LGS VT VNVNNL GLNTLGISL RIDFAP GLNPPHTHPRATEVL
Sbjct  61   FRPGLNLAGNTSNQLGSAVTAVNVNNLAGLNTLGISLARIDFAPYGLNPPHTHPRATEVL  120

Query  446  LVLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLS  625
             + EGTLYVGFVLSNP P MKN LFTK L  GDVFVFP GLIHFQFNVGKTNA+AFAGLS
Sbjct  121  TLFEGTLYVGFVLSNPGPNMKNKLFTKILHPGDVFVFPVGLIHFQFNVGKTNAVAFAGLS  180

Query  626  SQNPGVITIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQFWYNNS  769
            SQNPGVITIANAVFGS+PPIN  VL KAFQ+ + V++YLQ+QFW++N+
Sbjct  181  SQNPGVITIANAVFGSDPPINDDVLAKAFQIDKKVVDYLQSQFWWDNN  228



>ref|XP_006358464.1| PREDICTED: germin-like protein subfamily 1 member 14-like [Solanum 
tuberosum]
Length=230

 Score =   344 bits (882),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 171/227 (75%), Positives = 190/227 (84%), Gaps = 0/227 (0%)
 Frame = +2

Query  86   MAIRFIVFTITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDF  265
            +A++F+V TI ++AL+SS + ASDPSPLQDFCVAVNDS   VFVNGK+CK P  V A+DF
Sbjct  3    LALKFLVITIAILALASSPSTASDPSPLQDFCVAVNDSKTTVFVNGKVCKYPKLVTADDF  62

Query  266  FFRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVL  445
            F  GLN PGNTSN LGS VT VNVNNLPGLNTLGISL RIDFA  GLNPPHTHPR TEVL
Sbjct  63   FRSGLNKPGNTSNQLGSIVTAVNVNNLPGLNTLGISLARIDFARRGLNPPHTHPRGTEVL  122

Query  446  LVLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLS  625
            +VL+G LYVGFVLSNP P MKN LFTK L +GDVFVFPEGLIHFQ NVGKTNAIAFAGLS
Sbjct  123  VVLKGRLYVGFVLSNPGPNMKNKLFTKILNSGDVFVFPEGLIHFQLNVGKTNAIAFAGLS  182

Query  626  SQNPGVITIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQFWYNN  766
            SQN GVIT+ANAVFGS+PPIN  VL KAFQV +  I+ LQ QFW++N
Sbjct  183  SQNAGVITVANAVFGSDPPINDDVLAKAFQVDKKAIDDLQEQFWWDN  229



>ref|XP_006358462.1| PREDICTED: germin-like protein subfamily 1 member 14-like [Solanum 
tuberosum]
Length=230

 Score =   343 bits (881),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 171/227 (75%), Positives = 190/227 (84%), Gaps = 0/227 (0%)
 Frame = +2

Query  86   MAIRFIVFTITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDF  265
            +A++F+V TI ++AL+SS + ASDPSPLQDFCVAVNDS   VFVNGK+CK+P  V A+DF
Sbjct  3    LALKFLVITIAILALASSPSTASDPSPLQDFCVAVNDSKTTVFVNGKVCKDPKLVTADDF  62

Query  266  FFRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVL  445
            F  GLN PGNTSN LGS VT VNVNNLPGLNTLGISL RIDFA  GLNPPHTHPR TEVL
Sbjct  63   FRSGLNKPGNTSNQLGSIVTAVNVNNLPGLNTLGISLARIDFARRGLNPPHTHPRGTEVL  122

Query  446  LVLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLS  625
            +VL+G LYVGFVLSNP P MKN LFTK L  GDVFVFPEGLIHFQ NVGKTNAIAFAGLS
Sbjct  123  VVLKGRLYVGFVLSNPGPNMKNKLFTKILNPGDVFVFPEGLIHFQLNVGKTNAIAFAGLS  182

Query  626  SQNPGVITIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQFWYNN  766
            SQN GVIT+ANAVFGS+PPIN  VL KAFQV +  I+ LQ QFW++N
Sbjct  183  SQNAGVITVANAVFGSDPPINDDVLAKAFQVDKKAIDDLQEQFWWDN  229



>ref|XP_006349265.1| PREDICTED: germin-like protein subfamily 1 member 13-like [Solanum 
tuberosum]
Length=228

 Score =   343 bits (880),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 169/228 (74%), Positives = 191/228 (84%), Gaps = 0/228 (0%)
 Frame = +2

Query  86   MAIRFIVFTITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDF  265
            MA + ++  I ++A+ SS +HASDPSPLQDFCVAV+D+  AVFVNGK CK+P  VVA DF
Sbjct  1    MAFKSLILAIAIMAVLSSMSHASDPSPLQDFCVAVDDTKNAVFVNGKFCKDPKLVVAEDF  60

Query  266  FFRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVL  445
            F  GLNMPGNTSN +GS VTPVNVNNLPGLNTLGISL RID+AP GLNPPHTHPR TE L
Sbjct  61   FKSGLNMPGNTSNNVGSAVTPVNVNNLPGLNTLGISLARIDYAPYGLNPPHTHPRGTEFL  120

Query  446  LVLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLS  625
            +VLEGTLYVGFVLSNP P MKN LFTK L  GDVFVFP GLIHFQFN GKT  +AFAGLS
Sbjct  121  VVLEGTLYVGFVLSNPGPNMKNKLFTKILHPGDVFVFPIGLIHFQFNPGKTKTVAFAGLS  180

Query  626  SQNPGVITIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQFWYNNS  769
            SQNPGVITIANAVFGS+PPIN  VL KAFQ+   V++YLQ+QFW++N+
Sbjct  181  SQNPGVITIANAVFGSDPPINDDVLAKAFQIENKVVDYLQSQFWWDNN  228



>ref|XP_006349263.1| PREDICTED: germin-like protein subfamily 1 member 13-like [Solanum 
tuberosum]
Length=228

 Score =   337 bits (864),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 164/227 (72%), Positives = 189/227 (83%), Gaps = 0/227 (0%)
 Frame = +2

Query  86   MAIRFIVFTITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDF  265
            MA++  V  I ++++ +S +HASDPSPLQDFCVAVNDSM  VFVNGK+CK+P  V A+DF
Sbjct  1    MALKSFVLIIAILSVVTSISHASDPSPLQDFCVAVNDSMTTVFVNGKVCKDPKIVTADDF  60

Query  266  FFRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVL  445
            F  GLN+ GNTSN +GS VT VNVNNLPGLNTLGISL RID+AP G+NPPHTHPR TEVL
Sbjct  61   FKSGLNVAGNTSNNVGSAVTAVNVNNLPGLNTLGISLARIDYAPYGVNPPHTHPRGTEVL  120

Query  446  LVLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLS  625
             VLEGTLYVGFVLSNP   MKN LFTK L  GDVFVFP GLIHFQFNVGKT A+AFAG +
Sbjct  121  TVLEGTLYVGFVLSNPGANMKNKLFTKILHPGDVFVFPIGLIHFQFNVGKTKAVAFAGFN  180

Query  626  SQNPGVITIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQFWYNN  766
            SQN GVITIANAVFGS+PPIN  +L KAFQV + V++YLQ+QFW++N
Sbjct  181  SQNQGVITIANAVFGSDPPINDDILAKAFQVDKKVVDYLQSQFWWDN  227



>ref|XP_006358461.1| PREDICTED: germin-like protein subfamily 1 member 14-like [Solanum 
tuberosum]
Length=230

 Score =   337 bits (863),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 168/228 (74%), Positives = 189/228 (83%), Gaps = 0/228 (0%)
 Frame = +2

Query  86   MAIRFIVFTITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDF  265
            + ++F V TI ++AL+SS + ASDPSPLQDFCVAVN+S   VFVNGK+CK+P  V A+DF
Sbjct  3    LTLKFFVITIAILALTSSPSTASDPSPLQDFCVAVNESKETVFVNGKVCKDPKLVTADDF  62

Query  266  FFRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVL  445
            F  GLN PGNTSN LGS VT VNVNNLPGLNTLGISL RIDFA  GLNPPHTHPR TEVL
Sbjct  63   FRPGLNKPGNTSNQLGSIVTAVNVNNLPGLNTLGISLARIDFARRGLNPPHTHPRGTEVL  122

Query  446  LVLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLS  625
            +VL+G LYVGFVLSNP P MKN LFTK L  GDVFVFPEGL+HFQ NVGKTNAIAFAGLS
Sbjct  123  VVLKGRLYVGFVLSNPGPNMKNKLFTKILNPGDVFVFPEGLVHFQLNVGKTNAIAFAGLS  182

Query  626  SQNPGVITIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQFWYNNS  769
            SQN GVIT+ANAVFGS+PPIN  VL KAFQV + VI+ LQ Q W++N+
Sbjct  183  SQNAGVITVANAVFGSDPPINDDVLAKAFQVDKKVIDNLQEQIWWDNN  230



>ref|XP_006358460.1| PREDICTED: LOW QUALITY PROTEIN: germin-like protein subfamily 
1 member 18-like [Solanum tuberosum]
Length=233

 Score =   332 bits (852),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 169/230 (73%), Positives = 192/230 (83%), Gaps = 3/230 (1%)
 Frame = +2

Query  86   MAIRFIVFTITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDF  265
            +A++F+V TI ++AL+SS + ASDPSPL+ FCVAVNDS   VFVNGK+CK+P  V A+DF
Sbjct  3    LALKFLVITIAILALASSPSTASDPSPLKIFCVAVNDSKTTVFVNGKVCKDPKLVTADDF  62

Query  266  FFRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVL  445
            F  GLN PGNTSN LGS VT VNVNNLPGLNTLGISL RIDFA +GLNPPHTHPR TEVL
Sbjct  63   FRSGLNKPGNTSNQLGSIVTAVNVNNLPGLNTLGISLARIDFARHGLNPPHTHPRGTEVL  122

Query  446  LVLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLS  625
            +VL+G LYVGFVLSNP P MKN LFTK L  GDVFVFPEGLIHFQ NVGKTNAIAFAGLS
Sbjct  123  VVLKGRLYVGFVLSNPGPNMKNKLFTKILNPGDVFVFPEGLIHFQLNVGKTNAIAFAGLS  182

Query  626  SQNPGVITIANAVFGSN---PPINPQVLTKAFQVGQNVINYLQAQFWYNN  766
            SQN GVIT+ANAVFGS+   PPIN  VL+KAFQV + VI+ LQ +FW++N
Sbjct  183  SQNAGVITVANAVFGSDPPHPPINDNVLSKAFQVDKKVIDDLQEEFWWDN  232



>ref|XP_011099652.1| PREDICTED: putative germin-like protein 2-1 [Sesamum indicum]
Length=228

 Score =   332 bits (851),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 174/228 (76%), Positives = 196/228 (86%), Gaps = 2/228 (1%)
 Frame = +2

Query  86   MAIRFIVFTITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDF  265
            MA R ++ TI ++AL+S  AHASDPSPLQDFCVAVNDS A+VFVNGKICK+P  V  +DF
Sbjct  1    MAARLLL-TIVILALASLLAHASDPSPLQDFCVAVNDSRASVFVNGKICKDPNTVTPDDF  59

Query  266  FFRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVL  445
            FF GLN PGNTS+PLGS+VTPV VN L GLNTLGISL RIDFAP GLNPPHTHPRATE+L
Sbjct  60   FFSGLNKPGNTSSPLGSRVTPVTVNQLAGLNTLGISLARIDFAPYGLNPPHTHPRATEIL  119

Query  446  LVLEGTLYVGFVLSNPP-PGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGL  622
            +++EG+LYVGFV SNP  P  KN LFTKTL  GDVFVFPEGLIHFQFNVG TNA+AFAGL
Sbjct  120  VLVEGSLYVGFVTSNPANPNQKNKLFTKTLYPGDVFVFPEGLIHFQFNVGNTNAVAFAGL  179

Query  623  SSQNPGVITIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQFWYNN  766
            SSQNPGVITIANAVFGS+PPI+  VLT+AFQV +NVI YLQ QFW++N
Sbjct  180  SSQNPGVITIANAVFGSDPPISSDVLTRAFQVDKNVIKYLQGQFWWDN  227



>emb|CDP16787.1| unnamed protein product [Coffea canephora]
Length=230

 Score =   331 bits (849),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 168/227 (74%), Positives = 187/227 (82%), Gaps = 1/227 (0%)
 Frame = +2

Query  86   MAIRFIVFTITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDF  265
            MA RF +    ++AL  +  HASDPSPLQDFCVAV D+ A VFVNGKICK+P  V A DF
Sbjct  1    MAFRFHI-AAAILALVFTIVHASDPSPLQDFCVAVPDANAGVFVNGKICKDPKLVEAEDF  59

Query  266  FFRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVL  445
            FF GLN PG+TSNPLGS VT VNVN +PGLNTLG+SL RIDFAP GLNPPHTHPRATE+L
Sbjct  60   FFPGLNEPGSTSNPLGSNVTTVNVNQIPGLNTLGVSLARIDFAPYGLNPPHTHPRATEIL  119

Query  446  LVLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLS  625
            +VLEGTL VGFV SNP   MKN LFTK L  GDVFVFPEGLIHFQFN G +NA+AFAGLS
Sbjct  120  VVLEGTLLVGFVTSNPGMNMKNKLFTKVLNPGDVFVFPEGLIHFQFNKGHSNAVAFAGLS  179

Query  626  SQNPGVITIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQFWYNN  766
            SQNPGVITIANAVFGS PPI+  VLTKAFQV +NV+ YLQ+QFW++N
Sbjct  180  SQNPGVITIANAVFGSKPPISRDVLTKAFQVDKNVVKYLQSQFWWDN  226



>emb|CDP16790.1| unnamed protein product [Coffea canephora]
Length=232

 Score =   330 bits (846),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 167/227 (74%), Positives = 187/227 (82%), Gaps = 1/227 (0%)
 Frame = +2

Query  86   MAIRFIVFTITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDF  265
            MA RF +    ++AL  +  HASDPSPLQDFCVAV D+ A VFVNGKIC++P  V   DF
Sbjct  3    MAFRFHI-AAAILALVFTSVHASDPSPLQDFCVAVPDANAGVFVNGKICQDPKLVKPEDF  61

Query  266  FFRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVL  445
            FF+GLN PG+TSNPLGS VT VNVN +PGLNTLG+SL R+DFAP GLNPPHTHPRATE+L
Sbjct  62   FFQGLNKPGSTSNPLGSNVTAVNVNQIPGLNTLGVSLARLDFAPYGLNPPHTHPRATEIL  121

Query  446  LVLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLS  625
            +VLEGTL VGFV SNP   MKN LFTK L  GDVFVFPEGLIHFQFN G +NA+AFA LS
Sbjct  122  VVLEGTLLVGFVTSNPGMNMKNKLFTKVLNPGDVFVFPEGLIHFQFNQGHSNAVAFAALS  181

Query  626  SQNPGVITIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQFWYNN  766
            SQNPGVITIANAVFGSNPPI P VLTKAFQV +NVI YLQ+QFW++N
Sbjct  182  SQNPGVITIANAVFGSNPPIYPDVLTKAFQVDKNVIKYLQSQFWWDN  228



>ref|XP_010251870.1| PREDICTED: putative germin-like protein 2-1 isoform X2 [Nelumbo 
nucifera]
Length=222

 Score =   327 bits (837),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 168/227 (74%), Positives = 184/227 (81%), Gaps = 6/227 (3%)
 Frame = +2

Query  86   MAIRFIVFTITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDF  265
            M  R + F + ++AL S  A ASDPSPLQDFCVA+ND+ + VFVNGK CKNP    A+DF
Sbjct  1    MGSRMLAF-LAILALCSQ-ALASDPSPLQDFCVAINDTESPVFVNGKFCKNPNYTTADDF  58

Query  266  FFRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVL  445
            FF GL+ PGNTSNP+GSKVTPVNV  LPGLNTLGISLVRID+AP GLNPPHTHPRATEVL
Sbjct  59   FFSGLDKPGNTSNPVGSKVTPVNVMQLPGLNTLGISLVRIDYAPYGLNPPHTHPRATEVL  118

Query  446  LVLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLS  625
            +VLEG LYVGFV SNP     N LFTK L  GDVFVFPEGLIHFQFNVG TNA+AFAGLS
Sbjct  119  VVLEGRLYVGFVTSNP----DNRLFTKVLNKGDVFVFPEGLIHFQFNVGHTNAVAFAGLS  174

Query  626  SQNPGVITIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQFWYNN  766
            SQNPG ITIANAVFGS PPI   VL KAFQV + VI+YLQAQFW +N
Sbjct  175  SQNPGTITIANAVFGSKPPIKDDVLAKAFQVDKKVIDYLQAQFWMDN  221



>emb|CDP22064.1| unnamed protein product [Coffea canephora]
Length=230

 Score =   327 bits (838),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 166/227 (73%), Positives = 185/227 (81%), Gaps = 1/227 (0%)
 Frame = +2

Query  86   MAIRFIVFTITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDF  265
            MA RF +    ++AL  +  HASDPSPLQDFCVAV D+ A VFVNGKICK+P  V A DF
Sbjct  1    MAFRFHI-AAAILALVFTIVHASDPSPLQDFCVAVPDANAGVFVNGKICKDPKLVEAKDF  59

Query  266  FFRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVL  445
            FF GL  PG+TSNPLGS VT VNVN +PGLNTLG+SL RIDFAP GLNPPHTHPRATE+L
Sbjct  60   FFPGLKEPGSTSNPLGSNVTAVNVNQIPGLNTLGVSLARIDFAPYGLNPPHTHPRATEIL  119

Query  446  LVLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLS  625
            +VLEGTL VGFV SNP   MKN LFTK L  GDVFVFPEGLIHFQFN G ++A+AFAGLS
Sbjct  120  VVLEGTLLVGFVTSNPGMNMKNKLFTKVLNPGDVFVFPEGLIHFQFNKGHSSAVAFAGLS  179

Query  626  SQNPGVITIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQFWYNN  766
            SQNPGVITIANAVFGS PPI+  VLTKAFQV +NV+ YLQ+QFW +N
Sbjct  180  SQNPGVITIANAVFGSKPPISRDVLTKAFQVDKNVVKYLQSQFWRDN  226



>ref|XP_010251871.1| PREDICTED: putative germin-like protein 2-1 [Nelumbo nucifera]
Length=222

 Score =   325 bits (834),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 166/227 (73%), Positives = 183/227 (81%), Gaps = 6/227 (3%)
 Frame = +2

Query  86   MAIRFIVFTITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDF  265
            M+ R I   + ++A  S  A ASDPSPLQDFCVA+ D+   VFVNGK CKNP    A+DF
Sbjct  1    MSARMIA-VLVLLAJCSQ-ALASDPSPLQDFCVAIKDTETPVFVNGKFCKNPNYTTADDF  58

Query  266  FFRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVL  445
            FF GL+ PGNTSNP+GSKVTPVNV  LPGLNTLG+SLVRID+AP GLNPPHTHPRATEVL
Sbjct  59   FFSGLDKPGNTSNPVGSKVTPVNVMQLPGLNTLGVSLVRIDYAPYGLNPPHTHPRATEVL  118

Query  446  LVLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLS  625
            +VLEGTLYVGFV SNP    +N LFTK L  GDVFVFPEGLIHFQFNVG TNA+AFAGLS
Sbjct  119  VVLEGTLYVGFVTSNP----ENRLFTKVLNKGDVFVFPEGLIHFQFNVGHTNAVAFAGLS  174

Query  626  SQNPGVITIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQFWYNN  766
            SQNPG ITIANAVFGS PPI   VL KAFQV + VI+YLQAQFW +N
Sbjct  175  SQNPGTITIANAVFGSKPPIKDDVLAKAFQVDKKVIDYLQAQFWMDN  221



>ref|XP_007200183.1| hypothetical protein PRUPE_ppa016284mg [Prunus persica]
 gb|EMJ01382.1| hypothetical protein PRUPE_ppa016284mg [Prunus persica]
Length=226

 Score =   323 bits (829),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 162/227 (71%), Positives = 184/227 (81%), Gaps = 3/227 (1%)
 Frame = +2

Query  89   AIRFIVFTITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFF  268
             + F++ T+ ++A ++    ASDPSPLQDFCVA+ND+ +AVFVNGK CK+P  V ANDFF
Sbjct  3    GVHFLISTLAILASATFLVSASDPSPLQDFCVALNDTKSAVFVNGKFCKDPKLVNANDFF  62

Query  269  FRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLL  448
            F GL  P NT NP+GS VT VNV+NL GLNTLGISL RIDFAPNGLNPPHTHPRATE+L+
Sbjct  63   FSGLQNPRNTQNPVGSNVTAVNVDNLAGLNTLGISLARIDFAPNGLNPPHTHPRATEILV  122

Query  449  VLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSS  628
            VLEGTLYVGFV SN   G  N LFTK L  GDVFVFP GLIHFQ NVG  NA+AFAGLSS
Sbjct  123  VLEGTLYVGFVTSN---GDGNRLFTKVLNEGDVFVFPIGLIHFQLNVGHVNAVAFAGLSS  179

Query  629  QNPGVITIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQFWYNNS  769
            QNPGVITIANAVFGS PPINP VL KAFQV  N+++YLQ QFWY+N+
Sbjct  180  QNPGVITIANAVFGSKPPINPDVLAKAFQVDNNLVDYLQKQFWYDNN  226



>ref|XP_010251869.1| PREDICTED: putative germin-like protein 2-1 isoform X1 [Nelumbo 
nucifera]
Length=222

 Score =   323 bits (829),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 166/227 (73%), Positives = 181/227 (80%), Gaps = 6/227 (3%)
 Frame = +2

Query  86   MAIRFIVFTITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDF  265
            M+ R I   + ++A  S  A ASDPSPLQDFCVA+ D+   VFVNGK CKNP    A+DF
Sbjct  1    MSARMIA-VLVLLAJCSQ-ALASDPSPLQDFCVAIKDTETPVFVNGKFCKNPNYTTADDF  58

Query  266  FFRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVL  445
            FF GL+ PGNTSNP+GSKVTPVNV  LPGLNTLGISLVRID+AP GLNPPHTHPRATEVL
Sbjct  59   FFSGLDKPGNTSNPVGSKVTPVNVMQLPGLNTLGISLVRIDYAPYGLNPPHTHPRATEVL  118

Query  446  LVLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLS  625
            +VLEG LYVGFV SNP     N LFTK L  GDVFVFPEGLIHFQFNVG TNA+AFAGLS
Sbjct  119  VVLEGRLYVGFVTSNP----DNRLFTKVLNKGDVFVFPEGLIHFQFNVGHTNAVAFAGLS  174

Query  626  SQNPGVITIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQFWYNN  766
            SQNPG ITIANAVFGS PPI   VL KAFQV + VI+YLQAQFW +N
Sbjct  175  SQNPGTITIANAVFGSKPPIKDDVLAKAFQVDKKVIDYLQAQFWMDN  221



>emb|CDP16788.1| unnamed protein product [Coffea canephora]
Length=229

 Score =   322 bits (826),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 165/228 (72%), Positives = 185/228 (81%), Gaps = 1/228 (0%)
 Frame = +2

Query  86   MAIRFIVFTITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDF  265
            MA+R I     ++AL  +  HASDPSPLQDFCVAV D+ A VFVNGKICK+P  V   DF
Sbjct  1    MAVR-IHIAAAILALVFTVVHASDPSPLQDFCVAVPDANAGVFVNGKICKDPKLVKPEDF  59

Query  266  FFRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVL  445
            FF GLN PG+T+NPLGS VT VNVN +PGLNTLG+SL RIDFAP GLNPPH HPRATEVL
Sbjct  60   FFPGLNKPGSTANPLGSNVTAVNVNQIPGLNTLGVSLARIDFAPYGLNPPHIHPRATEVL  119

Query  446  LVLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLS  625
             VLEGTL VGFV SNP   MKN LFTK L  GDVFVFP+GLIHFQFN G +NA+AFAGL 
Sbjct  120  FVLEGTLVVGFVTSNPGMNMKNKLFTKVLNPGDVFVFPQGLIHFQFNQGHSNAVAFAGLG  179

Query  626  SQNPGVITIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQFWYNNS  769
            SQNPGVITIANAVFGS+PPI+P VLTKAFQVG +VI  LQ+QFW++N+
Sbjct  180  SQNPGVITIANAVFGSDPPISPDVLTKAFQVGNDVIKKLQSQFWWDNN  227



>emb|CDP21353.1| unnamed protein product [Coffea canephora]
Length=459

 Score =   329 bits (844),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 172/243 (71%), Positives = 192/243 (79%), Gaps = 3/243 (1%)
 Frame = +2

Query  38   KKLFYNSDTLTQNIFDMAIRFIVFTITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFV  217
            KKL   S     N + MA RF +    ++AL  +  HASDPSPLQDFCVAV D+ A VFV
Sbjct  216  KKL--QSQFWWDNNYPMAFRFHI-AAAILALVFTIVHASDPSPLQDFCVAVPDANAGVFV  272

Query  218  NGKICKNPMQVVANDFFFRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAP  397
            NGKICK+P  V   DFFF GLN PG+TSNPLGS VT VNVN +PGLNTLG+SL RIDFAP
Sbjct  273  NGKICKDPKLVKPEDFFFPGLNEPGSTSNPLGSNVTAVNVNQIPGLNTLGVSLARIDFAP  332

Query  398  NGLNPPHTHPRATEVLLVLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHF  577
             GLNPPHTHPRATE+L+VLEGTL VGFV SNP   MKN LFTK L  GDVFVFPEGLIHF
Sbjct  333  YGLNPPHTHPRATEILVVLEGTLLVGFVTSNPGMNMKNKLFTKVLNPGDVFVFPEGLIHF  392

Query  578  QFNVGKTNAIAFAGLSSQNPGVITIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQFW  757
            QFN G +NA+AFAGLSSQNPGVITIANAVFGS PPI+  VLTKAFQV +NV+ YLQ+QFW
Sbjct  393  QFNKGHSNAVAFAGLSSQNPGVITIANAVFGSKPPISRDVLTKAFQVDKNVVKYLQSQFW  452

Query  758  YNN  766
            ++N
Sbjct  453  WDN  455


 Score =   322 bits (825),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 165/228 (72%), Positives = 185/228 (81%), Gaps = 1/228 (0%)
 Frame = +2

Query  86   MAIRFIVFTITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDF  265
            MA+R I     ++AL  +  HASDPSPLQDFCVAV D+ A VFVNGKICK+P  V   DF
Sbjct  1    MAVR-IHIAAAILALVFTVVHASDPSPLQDFCVAVPDANAGVFVNGKICKDPKLVKPEDF  59

Query  266  FFRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVL  445
            FF GLN PG+T+NPLGS VT VNVN +PGLNTLG+SL RIDFAP GLNPPH HPRATEVL
Sbjct  60   FFPGLNKPGSTANPLGSNVTAVNVNQIPGLNTLGVSLARIDFAPYGLNPPHIHPRATEVL  119

Query  446  LVLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLS  625
             VLEGTL VGFV SNP   MKN LFTK L  GDVFVFP+GLIHFQFN G +NA+AFAGL 
Sbjct  120  FVLEGTLVVGFVTSNPGMNMKNKLFTKVLNPGDVFVFPQGLIHFQFNQGHSNAVAFAGLG  179

Query  626  SQNPGVITIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQFWYNNS  769
            SQNPGVITIANAVFGS+PPI+P VLTKAFQVG +VI  LQ+QFW++N+
Sbjct  180  SQNPGVITIANAVFGSDPPISPDVLTKAFQVGNDVIKKLQSQFWWDNN  227



>emb|CDP10701.1| unnamed protein product [Coffea canephora]
Length=230

 Score =   320 bits (820),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 163/218 (75%), Positives = 179/218 (82%), Gaps = 0/218 (0%)
 Frame = +2

Query  104  VFTITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFFFRGLN  283
            + TI  +AL SS A ASDPSPLQDFCVA+ND   AVFVNGKICK+P  V ANDFFF+GLN
Sbjct  6    LITIATMALFSSLATASDPSPLQDFCVAINDPKTAVFVNGKICKDPKVVKANDFFFQGLN  65

Query  284  MPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGT  463
             P NT+N  GS VT VNVNNL GLNTLG+SL R+DFAP+GLNPPHTHPRATEVL VLEGT
Sbjct  66   KPRNTANRQGSTVTAVNVNNLAGLNTLGVSLARLDFAPHGLNPPHTHPRATEVLFVLEGT  125

Query  464  LYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSSQNPGV  643
            L+VGFV SNPP  MKN LFTKTL  GDVFVFPEGLIHFQFN GKT A+AFAG  SQNPGV
Sbjct  126  LHVGFVTSNPPNNMKNQLFTKTLNPGDVFVFPEGLIHFQFNFGKTKAVAFAGFGSQNPGV  185

Query  644  ITIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQFW  757
            ITIANAVFGS+P I+P VL KAFQV + VI+ L+ QF 
Sbjct  186  ITIANAVFGSDPLISPAVLAKAFQVDKKVIDLLEGQFL  223



>ref|XP_007200176.1| hypothetical protein PRUPE_ppa016529mg [Prunus persica]
 gb|EMJ01375.1| hypothetical protein PRUPE_ppa016529mg [Prunus persica]
Length=226

 Score =   320 bits (819),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 161/225 (72%), Positives = 179/225 (80%), Gaps = 3/225 (1%)
 Frame = +2

Query  95   RFIVFTITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFFFR  274
             F++ T+ ++A ++  A A DPSPLQDFCVAV D  + VFVNGK CK+P    ANDFFF 
Sbjct  5    HFLIITLAILAFATFLASAYDPSPLQDFCVAVKDIKSGVFVNGKFCKDPKLANANDFFFS  64

Query  275  GLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVL  454
            GL  P NT NP+GS VT VNV+NL GLNTLGISL RIDFAPNGLNPPHTHPRATE+L+VL
Sbjct  65   GLQNPRNTKNPVGSNVTAVNVDNLEGLNTLGISLARIDFAPNGLNPPHTHPRATEILVVL  124

Query  455  EGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSSQN  634
            EGTLYVGFV SN   G  N LFTK L  GDVFVFP GLIHFQ NVG  NA+AFAGLSSQN
Sbjct  125  EGTLYVGFVTSN---GDGNRLFTKVLNKGDVFVFPIGLIHFQLNVGHVNAVAFAGLSSQN  181

Query  635  PGVITIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQFWYNNS  769
            PGVITIANAVFGS PPINP VLTKAFQV   V++YLQ QFWY+N+
Sbjct  182  PGVITIANAVFGSKPPINPDVLTKAFQVDNKVVDYLQKQFWYDNN  226



>ref|XP_007200157.1| hypothetical protein PRUPE_ppa016753mg [Prunus persica]
 gb|EMJ01356.1| hypothetical protein PRUPE_ppa016753mg [Prunus persica]
Length=226

 Score =   320 bits (819),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 162/227 (71%), Positives = 182/227 (80%), Gaps = 3/227 (1%)
 Frame = +2

Query  89   AIRFIVFTITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFF  268
            A+ F++ T+ ++A ++    ASDPSPLQDFCVA+ND+ +AVFVNGK CK+P    ANDFF
Sbjct  3    AVYFLISTLAILASATFLVSASDPSPLQDFCVALNDTKSAVFVNGKFCKDPKLANANDFF  62

Query  269  FRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLL  448
            F GL  P NT NPLGS VT VNV+NL GLNTLGISL RIDFAPNGLNPPHTHPRATE+L+
Sbjct  63   FSGLQNPRNTQNPLGSNVTAVNVDNLLGLNTLGISLARIDFAPNGLNPPHTHPRATEILV  122

Query  449  VLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSS  628
            VLEGTLYVGFV SN   G  N LFTK L  GDVFVFP GLIHFQ NVG  NA+AFAGLSS
Sbjct  123  VLEGTLYVGFVTSN---GDGNRLFTKVLNKGDVFVFPIGLIHFQLNVGHVNAVAFAGLSS  179

Query  629  QNPGVITIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQFWYNNS  769
            QNPGVITIA AVFGS PPINP VL KAFQV  NV++ LQ QFWY+N+
Sbjct  180  QNPGVITIAKAVFGSQPPINPDVLAKAFQVDDNVVDNLQKQFWYDNN  226



>emb|CDP16789.1| unnamed protein product [Coffea canephora]
Length=488

 Score =   329 bits (843),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 166/231 (72%), Positives = 188/231 (81%), Gaps = 1/231 (0%)
 Frame = +2

Query  74   NIFDMAIRFIVFTITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVV  253
            N+  MA+R +     ++ L  +  HASDPSPLQDFCVAV D+ A VFVNGKICK+P  V 
Sbjct  255  NLITMAVR-VHIAAAILTLVFAVVHASDPSPLQDFCVAVPDANAGVFVNGKICKDPKLVK  313

Query  254  ANDFFFRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRA  433
              DFFF GLNMPG+T+NPLGS VT VNVN +PGLNTLG+SL R+DFAP GLNPPHTHPRA
Sbjct  314  PEDFFFPGLNMPGSTANPLGSNVTAVNVNQIPGLNTLGVSLARLDFAPYGLNPPHTHPRA  373

Query  434  TEVLLVLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAF  613
            TE+L+VLEGTL VGFV SNP   MKN LFTK L  GDVFVFPEGLIHFQFN G+TNA+AF
Sbjct  374  TEILVVLEGTLLVGFVTSNPGMNMKNKLFTKVLNPGDVFVFPEGLIHFQFNQGQTNAVAF  433

Query  614  AGLSSQNPGVITIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQFWYNN  766
            A LSSQNPGVITIANAVFGS PPI+  VLTKAFQV +NVI YLQ+QFW++N
Sbjct  434  AALSSQNPGVITIANAVFGSKPPISRDVLTKAFQVDKNVIKYLQSQFWWDN  484


 Score =   323 bits (828),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 164/224 (73%), Positives = 183/224 (82%), Gaps = 1/224 (0%)
 Frame = +2

Query  86   MAIRFIVFTITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDF  265
            MA RF +    ++AL  +  HASDPSPLQDFCVAV D+ A VFVNGKICK+P  V   DF
Sbjct  1    MAFRFHI-AAALLALVFTIVHASDPSPLQDFCVAVPDANAGVFVNGKICKDPKLVKPEDF  59

Query  266  FFRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVL  445
            FF GLN PG+T+NPLGS VT VNVN +PGLNTLG+SL R+DFAP GLNPPHTHPRATE+L
Sbjct  60   FFPGLNKPGSTANPLGSNVTAVNVNQIPGLNTLGVSLARLDFAPYGLNPPHTHPRATEIL  119

Query  446  LVLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLS  625
            +VLEGTL VGFV SNP   MKN LFTK L  GDVFVFP+GLIHFQFN G +NA+AFAGL 
Sbjct  120  VVLEGTLLVGFVTSNPGMNMKNKLFTKVLNPGDVFVFPQGLIHFQFNQGHSNAVAFAGLG  179

Query  626  SQNPGVITIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQFW  757
            SQNPGVITIANAVFGSNPPI+P VLTKAFQV + VI YLQ+QFW
Sbjct  180  SQNPGVITIANAVFGSNPPISPDVLTKAFQVDKKVIKYLQSQFW  223



>ref|XP_007030273.1| RmlC-like cupins superfamily protein [Theobroma cacao]
 gb|EOY10775.1| RmlC-like cupins superfamily protein [Theobroma cacao]
Length=224

 Score =   318 bits (814),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 157/224 (70%), Positives = 185/224 (83%), Gaps = 5/224 (2%)
 Frame = +2

Query  89   AIRFIVFTITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFF  268
             +R  +   T++A ++S A A DPSPLQDFCVA+ND+   VFVNGK CK+P   VA+DFF
Sbjct  3    GMRCFLVAFTLLAFANSLASAFDPSPLQDFCVAINDTKNGVFVNGKFCKDPKLAVADDFF  62

Query  269  FRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAP-NGLNPPHTHPRATEVL  445
            + GLNMPGNTSNP+GS VT VNV+ +PGLNTLGISLVRID+AP  GLNPPHTHPR TE+L
Sbjct  63   YSGLNMPGNTSNPVGSNVTTVNVDQIPGLNTLGISLVRIDYAPYGGLNPPHTHPRGTEIL  122

Query  446  LVLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLS  625
            +V+EGTLYVGFV SNP    +N LFTK L  GDVFVFP GLIHFQFN+GKT A+AFAGLS
Sbjct  123  VVVEGTLYVGFVTSNP----ENRLFTKVLYPGDVFVFPIGLIHFQFNIGKTEAVAFAGLS  178

Query  626  SQNPGVITIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQFW  757
            SQN GVITIANAVFGS+PPINP VLTKAFQ+ +N++ YLQ++FW
Sbjct  179  SQNAGVITIANAVFGSDPPINPDVLTKAFQLDKNMVAYLQSRFW  222



>ref|XP_007201862.1| hypothetical protein PRUPE_ppa020162mg [Prunus persica]
 gb|EMJ03061.1| hypothetical protein PRUPE_ppa020162mg [Prunus persica]
Length=226

 Score =   318 bits (814),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 161/227 (71%), Positives = 181/227 (80%), Gaps = 3/227 (1%)
 Frame = +2

Query  89   AIRFIVFTITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFF  268
             + F++ T+ ++A ++    ASDPSPLQDFCVA+ND+ +AVFVNGK CK+P    ANDFF
Sbjct  3    GVYFLISTLAILASATFLVSASDPSPLQDFCVALNDTKSAVFVNGKFCKDPKLANANDFF  62

Query  269  FRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLL  448
            F GL  P NT NPLGS VT VNV+NL GLNTLGISL RIDFAPNGLNPPHTHPRATE+L+
Sbjct  63   FSGLQNPRNTQNPLGSNVTAVNVDNLLGLNTLGISLARIDFAPNGLNPPHTHPRATEILV  122

Query  449  VLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSS  628
            VLEGTLYVGFV SN   G  N LFTK L  GDVFVFP GLIHFQ NVG  NA+AFAGLSS
Sbjct  123  VLEGTLYVGFVTSN---GDGNRLFTKVLNKGDVFVFPIGLIHFQLNVGHVNAVAFAGLSS  179

Query  629  QNPGVITIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQFWYNNS  769
            QNPGVITIA AVFGS PPINP VL KAFQV  NV++ LQ QFWY+N+
Sbjct  180  QNPGVITIAKAVFGSQPPINPDVLAKAFQVDDNVVDNLQKQFWYDNN  226



>ref|XP_007201148.1| hypothetical protein PRUPE_ppa016020mg [Prunus persica]
 gb|EMJ02347.1| hypothetical protein PRUPE_ppa016020mg [Prunus persica]
Length=226

 Score =   318 bits (814),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 160/227 (70%), Positives = 181/227 (80%), Gaps = 3/227 (1%)
 Frame = +2

Query  89   AIRFIVFTITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFF  268
             + F++ T+ ++A ++    ASDPSPLQDFCVA+ND+ +AVFVNGK CK+P  V ANDFF
Sbjct  3    GVHFLISTLAILASATFLVSASDPSPLQDFCVALNDNKSAVFVNGKFCKDPKLVNANDFF  62

Query  269  FRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLL  448
            F GL  P NT NPLGS VT VNV+ + GLNTLGISL RIDFAPNGLNPPHTHPRA+E L+
Sbjct  63   FSGLQNPRNTQNPLGSNVTTVNVDQIAGLNTLGISLTRIDFAPNGLNPPHTHPRASEFLV  122

Query  449  VLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSS  628
            VLEGTLYVGFV SN   G  N LFTK L  GDVFVFP GLIHFQ NVG  NA+AFAGLSS
Sbjct  123  VLEGTLYVGFVTSN---GDGNRLFTKVLNKGDVFVFPIGLIHFQLNVGHVNAVAFAGLSS  179

Query  629  QNPGVITIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQFWYNNS  769
            QNPGVITIANAVFGS PPINP VL KAFQV  NV++YLQ Q WY+N+
Sbjct  180  QNPGVITIANAVFGSKPPINPDVLAKAFQVDDNVVDYLQKQLWYDNN  226



>ref|XP_009349816.1| PREDICTED: germin-like protein subfamily 1 member 13 [Pyrus x 
bretschneideri]
Length=228

 Score =   318 bits (814),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 158/219 (72%), Positives = 179/219 (82%), Gaps = 3/219 (1%)
 Frame = +2

Query  113  ITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFFFRGLNMPG  292
            ++V+A ++  A ASDP PLQDFCVA+N++ +AVFVNGK CK+P    ANDFF   L  PG
Sbjct  13   LSVLAFATLLAFASDPDPLQDFCVAINNTDSAVFVNGKFCKDPKLASANDFFSDKLRYPG  72

Query  293  NTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLYV  472
            NT NP+GS VT  NV+N+PGLNTLGIS  R+DFAPNGLNPPHTHPRATE+L+V+EG+LYV
Sbjct  73   NTLNPVGSIVTAANVDNIPGLNTLGISFARVDFAPNGLNPPHTHPRATEILIVVEGSLYV  132

Query  473  GFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSSQNPGVITI  652
            GFV SN   G  N LFTK L  GDVFVFP GLIHFQ NVGKTNA+A AGLSSQNPGVITI
Sbjct  133  GFVTSN---GDGNRLFTKVLYKGDVFVFPIGLIHFQLNVGKTNALAIAGLSSQNPGVITI  189

Query  653  ANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQFWYNNS  769
            ANAVFGSNPPINP VL KAFQV  NV++YLQ QFWYNNS
Sbjct  190  ANAVFGSNPPINPDVLAKAFQVDDNVVDYLQKQFWYNNS  228



>ref|XP_010251872.1| PREDICTED: putative germin-like protein 2-1 [Nelumbo nucifera]
Length=222

 Score =   317 bits (813),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 161/211 (76%), Positives = 175/211 (83%), Gaps = 4/211 (2%)
 Frame = +2

Query  137  SFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFFFRGLNMPGNTSNPLGS  316
            S A ASDP+PLQDFCVA+ D+   VFVNGK CKNP    A+DFFF GL+ PGNTSNP+GS
Sbjct  16   SQALASDPNPLQDFCVAIKDTETPVFVNGKFCKNPNYTTADDFFFSGLDKPGNTSNPVGS  75

Query  317  KVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLYVGFVLSNPP  496
            KVTPVNV  LPGLNTLGISLVRID+AP GLNPPHTHPRATEVL+VLEGTLYVGFV SNP 
Sbjct  76   KVTPVNVMQLPGLNTLGISLVRIDYAPYGLNPPHTHPRATEVLVVLEGTLYVGFVTSNP-  134

Query  497  PGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSSQNPGVITIANAVFGSN  676
               +N L TKTL  GDVFVFP GLIHFQFNVG TNA+AFAGLSSQNPG ITIANAVFGS 
Sbjct  135  ---ENRLITKTLNKGDVFVFPVGLIHFQFNVGHTNAVAFAGLSSQNPGTITIANAVFGSX  191

Query  677  PPINPQVLTKAFQVGQNVINYLQAQFWYNNS  769
            PPI   VL KAFQV + VI+YLQAQFW +N+
Sbjct  192  PPIKDDVLAKAFQVDKKVIDYLQAQFWMDNN  222



>ref|XP_008237521.1| PREDICTED: germin-like protein subfamily 1 member 16 [Prunus 
mume]
Length=234

 Score =   317 bits (811),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 163/235 (69%), Positives = 184/235 (78%), Gaps = 11/235 (5%)
 Frame = +2

Query  89   AIRFIVFTITVVALSSSFAHASDPSPLQDFCVAVNDSMAA--------VFVNGKICKNPM  244
             + F++ T+ ++A ++    ASDPSPLQDFCVA+ND+ +A        VFVNGK CK+P 
Sbjct  3    GVHFLISTLAILASATFLVSASDPSPLQDFCVALNDTKSAGGYFGAGAVFVNGKFCKDPK  62

Query  245  QVVANDFFFRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTH  424
             V ANDFFF GL  P NT NP+GS VT VNV+NL GLNTLGISL RIDFAPNGLNPPHTH
Sbjct  63   LVNANDFFFSGLQNPRNTQNPVGSNVTAVNVDNLAGLNTLGISLARIDFAPNGLNPPHTH  122

Query  425  PRATEVLLVLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNA  604
            PRATE+L+VLEGTLYVGFV SN   G  N LFTK L  GDVFVFP GLIHFQ NVG  NA
Sbjct  123  PRATEILVVLEGTLYVGFVTSN---GDGNRLFTKVLNKGDVFVFPIGLIHFQLNVGYVNA  179

Query  605  IAFAGLSSQNPGVITIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQFWYNNS  769
            +AFAGLSSQNPGVITIANAVFGS PPINP VL KAFQV  NV++YLQ QFWY+N+
Sbjct  180  VAFAGLSSQNPGVITIANAVFGSKPPINPDVLAKAFQVDNNVVDYLQKQFWYDNN  234



>ref|XP_007210592.1| hypothetical protein PRUPE_ppa016616mg [Prunus persica]
 gb|EMJ11791.1| hypothetical protein PRUPE_ppa016616mg [Prunus persica]
Length=227

 Score =   316 bits (810),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 159/227 (70%), Positives = 178/227 (78%), Gaps = 3/227 (1%)
 Frame = +2

Query  89   AIRFIVFTITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFF  268
             + F +  +  +AL++    ASDPSPLQDFCVA+N++ +AVFVNGK CK+P  V ANDFF
Sbjct  4    GVHFQLSIVATLALATFLVSASDPSPLQDFCVAINNTESAVFVNGKFCKDPKFVTANDFF  63

Query  269  FRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLL  448
            F GL +PGNTSNP+GS VTP NV  + GLNTLGISL RIDFAPNGLNPPHTHPR TE L+
Sbjct  64   FSGLRIPGNTSNPVGSFVTPANVEQIAGLNTLGISLARIDFAPNGLNPPHTHPRGTEFLI  123

Query  449  VLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSS  628
            VLEGTLYVGFV SN   G  N LFTK L  GDVFVFP GLIHFQ NVG  NA+A AGLSS
Sbjct  124  VLEGTLYVGFVTSN---GDNNRLFTKVLNKGDVFVFPVGLIHFQLNVGHVNALAVAGLSS  180

Query  629  QNPGVITIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQFWYNNS  769
            QNPGVITIANAVFGSNPPINP VL KAFQ+    + YLQ QFWYNN+
Sbjct  181  QNPGVITIANAVFGSNPPINPDVLAKAFQIDDKEVEYLQKQFWYNNN  227



>emb|CDP10694.1| unnamed protein product [Coffea canephora]
Length=224

 Score =   316 bits (810),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 163/218 (75%), Positives = 179/218 (82%), Gaps = 0/218 (0%)
 Frame = +2

Query  104  VFTITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFFFRGLN  283
            + TI  +AL SS A ASDPSPLQDFCVA+ND   AVFVNGKICK+P  V ANDFFF+GLN
Sbjct  6    LITIATMALLSSLAIASDPSPLQDFCVAINDPKTAVFVNGKICKDPKVVNANDFFFQGLN  65

Query  284  MPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGT  463
            +P +T+N  GS VT VNVNNL GLNTLG+SL R+DFAP GLNPPHTHPRATEVL VLEG 
Sbjct  66   IPRSTANRQGSNVTAVNVNNLAGLNTLGVSLARLDFAPYGLNPPHTHPRATEVLFVLEGV  125

Query  464  LYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSSQNPGV  643
            L VGFV SNPP  MKN LFTKTL  GDVFVFPEGLIHFQFNVGKTNA+AFAG  SQNPGV
Sbjct  126  LNVGFVTSNPPNNMKNQLFTKTLNPGDVFVFPEGLIHFQFNVGKTNAVAFAGFGSQNPGV  185

Query  644  ITIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQFW  757
            ITIANAVFGS+P I+  VL KAFQV + VI+ L+AQF 
Sbjct  186  ITIANAVFGSDPLISADVLAKAFQVDKKVIDLLEAQFL  223



>ref|XP_002531992.1| Rhicadhesin receptor precursor, putative [Ricinus communis]
 gb|EEF30391.1| Rhicadhesin receptor precursor, putative [Ricinus communis]
Length=223

 Score =   316 bits (809),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 159/216 (74%), Positives = 177/216 (82%), Gaps = 5/216 (2%)
 Frame = +2

Query  119  VVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFFFRGLNMPGNT  298
            ++ALSSSFA A DPSPLQDFCVA +D   AVFVNGK+CK+P    ANDF F GLN+P +T
Sbjct  12   ILALSSSFALAFDPSPLQDFCVATDDPKDAVFVNGKLCKDPKLATANDFSFSGLNVPRDT  71

Query  299  SNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLYVGF  478
            SNP+GS VT +N + +PGLNTLGISL RID+AP GLNPPHTHPRATE+L+VLEGTLYVGF
Sbjct  72   SNPVGSNVTLLNADRIPGLNTLGISLARIDYAPYGLNPPHTHPRATEILVVLEGTLYVGF  131

Query  479  VLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSSQNPGVITIAN  658
            V SNP     N L TKTL  GDVFVFP G+IHFQFN G TNA+AFAGLSSQNPG ITIAN
Sbjct  132  VTSNP-----NRLITKTLKPGDVFVFPIGMIHFQFNTGNTNAVAFAGLSSQNPGAITIAN  186

Query  659  AVFGSNPPINPQVLTKAFQVGQNVINYLQAQFWYNN  766
            AVFGSNPPIN  VLTKAFQV +NV+ YLQ QFW NN
Sbjct  187  AVFGSNPPINADVLTKAFQVDKNVVKYLQKQFWTNN  222



>ref|XP_008351931.1| PREDICTED: germin-like protein subfamily 1 member 13 [Malus domestica]
Length=228

 Score =   316 bits (809),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 157/219 (72%), Positives = 179/219 (82%), Gaps = 3/219 (1%)
 Frame = +2

Query  113  ITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFFFRGLNMPG  292
            ++V+A ++  A ASDP PLQDFCVA+N++ +AVFVNGK CK+P    ANDFF   L  P 
Sbjct  13   LSVLAFATLLASASDPXPLQDFCVAINNTDSAVFVNGKFCKDPKLASANDFFSDKLRYPR  72

Query  293  NTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLYV  472
            NTSNP+GS VT  NV+++PGLNTLGIS  R+DFAPNGLNPPHTHPRATE+L+V+EG+LYV
Sbjct  73   NTSNPVGSIVTAANVDDIPGLNTLGISFARVDFAPNGLNPPHTHPRATEILIVVEGSLYV  132

Query  473  GFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSSQNPGVITI  652
            GFV SN   G  N LFTK L  GDVFVFP GLIHFQ NVGKTNA+A AGLSSQNPGVITI
Sbjct  133  GFVTSN---GDGNRLFTKVLYKGDVFVFPIGLIHFQLNVGKTNALAIAGLSSQNPGVITI  189

Query  653  ANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQFWYNNS  769
            ANAVFGSNPPINP VL KAFQV  NV++YLQ QFWYNNS
Sbjct  190  ANAVFGSNPPINPDVLAKAFQVDBNVVDYLQKQFWYNNS  228



>ref|XP_008367619.1| PREDICTED: germin-like protein subfamily 1 member 13 [Malus domestica]
Length=228

 Score =   316 bits (809),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 157/219 (72%), Positives = 178/219 (81%), Gaps = 3/219 (1%)
 Frame = +2

Query  113  ITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFFFRGLNMPG  292
            ++V+A ++  A ASDP PLQDFCVA+N++ +AVFVNGK CK+P    ANDFF   L  P 
Sbjct  13   LSVLAFATLLASASDPGPLQDFCVAINNTDSAVFVNGKFCKDPKLASANDFFSDKLRYPX  72

Query  293  NTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLYV  472
            NTSNP+GS VT  NV+++PGLNTLGIS  R+DFAPNGLNPPHTHPRATE+L+V EG+LYV
Sbjct  73   NTSNPVGSIVTAANVDDIPGLNTLGISFARVDFAPNGLNPPHTHPRATEILIVXEGSLYV  132

Query  473  GFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSSQNPGVITI  652
            GFV SN   G  N LFTK L  GDVFVFP GLIHFQ NVGKTNA+A AGLSSQNPGVITI
Sbjct  133  GFVTSN---GDGNRLFTKVLYKGDVFVFPIGLIHFQLNVGKTNALAIAGLSSQNPGVITI  189

Query  653  ANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQFWYNNS  769
            ANAVFGSNPPINP VL KAFQV  NV++YLQ QFWYNNS
Sbjct  190  ANAVFGSNPPINPDVLAKAFQVDDNVVDYLQKQFWYNNS  228



>ref|XP_008240380.1| PREDICTED: germin-like protein subfamily 1 member 20 [Prunus 
mume]
Length=227

 Score =   315 bits (808),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 159/227 (70%), Positives = 178/227 (78%), Gaps = 3/227 (1%)
 Frame = +2

Query  89   AIRFIVFTITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFF  268
             + F +  +  +AL++    ASDPSPLQDFCVA+N++ +AVFVNGK CK+P  V ANDFF
Sbjct  4    GVHFPLSIVATLALATFLVSASDPSPLQDFCVAINNTESAVFVNGKFCKDPKLVTANDFF  63

Query  269  FRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLL  448
            F GL +PGNTSNP+GS VTP NV  + GLNTLGISL RIDFAPNGLNPPHTHPR TE L+
Sbjct  64   FSGLRIPGNTSNPVGSFVTPANVEQIAGLNTLGISLARIDFAPNGLNPPHTHPRGTEFLI  123

Query  449  VLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSS  628
            VLEGTLYVGFV SN   G  N LFTK L  GDVFVFP GLIHFQ NVG  NA+A AGLSS
Sbjct  124  VLEGTLYVGFVSSN---GDNNRLFTKVLNKGDVFVFPVGLIHFQLNVGHVNALAVAGLSS  180

Query  629  QNPGVITIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQFWYNNS  769
            QNPGVITIANAVFGSNPPINP VL KAFQ+    + YLQ QFWYNN+
Sbjct  181  QNPGVITIANAVFGSNPPINPDVLAKAFQIDDKEVEYLQKQFWYNNN  227



>ref|XP_008237526.1| PREDICTED: germin-like protein subfamily 1 member 11 [Prunus 
mume]
Length=228

 Score =   315 bits (808),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 163/229 (71%), Positives = 181/229 (79%), Gaps = 5/229 (2%)
 Frame = +2

Query  89   AIRFIVFTITVVALSSSFAHASDPSPLQDFCVAVND--SMAAVFVNGKICKNPMQVVAND  262
             + F++ T+ ++A ++    ASDPSPLQDFCVA+ND  S  AVFVNGK CK+P    AND
Sbjct  3    GVYFLISTLAILASATFLVSASDPSPLQDFCVALNDTKSAEAVFVNGKFCKDPKLANAND  62

Query  263  FFFRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEV  442
            FFF GL  P NT NPLGS VT VNV+NL GLNTLGISL RIDFAPNGLNPPHTHPRATE+
Sbjct  63   FFFSGLQNPRNTQNPLGSNVTAVNVDNLLGLNTLGISLARIDFAPNGLNPPHTHPRATEI  122

Query  443  LLVLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGL  622
            L+VLEGTLYVGFV SN   G  N LFTK L  GDVFVFP GLIHFQ NVG  NA+AFAGL
Sbjct  123  LVVLEGTLYVGFVTSN---GDGNRLFTKVLNKGDVFVFPIGLIHFQLNVGHVNAVAFAGL  179

Query  623  SSQNPGVITIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQFWYNNS  769
            SSQNPGVITIANAVFGS P INP VL KAFQV  NV++YLQ QFWY+N+
Sbjct  180  SSQNPGVITIANAVFGSKPLINPDVLAKAFQVDNNVVDYLQKQFWYDNN  228



>ref|XP_008393483.1| PREDICTED: germin-like protein subfamily 1 member 13 [Malus domestica]
Length=228

 Score =   315 bits (808),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 156/219 (71%), Positives = 179/219 (82%), Gaps = 3/219 (1%)
 Frame = +2

Query  113  ITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFFFRGLNMPG  292
            ++V+A ++  A ASDP PLQDFCVA+N++ +AVFVNGK CK+P    AN+FF   L  P 
Sbjct  13   LSVLAFATLLASASDPDPLQDFCVAINNTDSAVFVNGKFCKDPKLASANBFFSDKLRYPR  72

Query  293  NTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLYV  472
            NTSNP+GS VT  NV+++PGLNTLGIS  R+DFAPNGLNPPHTHPRATE+L+V+EG+LYV
Sbjct  73   NTSNPVGSIVTAANVDDIPGLNTLGISFARVDFAPNGLNPPHTHPRATEILIVVEGSLYV  132

Query  473  GFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSSQNPGVITI  652
            GFV SN   G  N LFTK L  GDVFVFP GLIHFQ NVGKTNA+A AGLSSQNPGVITI
Sbjct  133  GFVTSN---GDGNRLFTKVLYKGDVFVFPIGLIHFQLNVGKTNALAIAGLSSQNPGVITI  189

Query  653  ANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQFWYNNS  769
            ANAVFGSNPPINP VL KAFQV  NV++YLQ QFWYNNS
Sbjct  190  ANAVFGSNPPINPDVLAKAFQVDBNVVDYLQKQFWYNNS  228



>ref|XP_010241946.1| PREDICTED: putative germin-like protein 2-1 [Nelumbo nucifera]
Length=223

 Score =   315 bits (807),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 163/229 (71%), Positives = 182/229 (79%), Gaps = 7/229 (3%)
 Frame = +2

Query  86   MAIRFIVFTITVVALSSSFAHASDPSPLQDFCVAVNDSMA-AVFVNGKICKNPMQVVAND  262
            M  R + F + ++ L S  A ASDPSPLQDFCVA+ D+ + AVFVNGK CKNP    A+D
Sbjct  1    MGYRMLAF-LAILVLGSQ-ALASDPSPLQDFCVAIKDTESPAVFVNGKFCKNPNYTTADD  58

Query  263  FFFRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEV  442
            FFF GL+ PGNTSNP+GSKVTPVNV  LPGLNTLGISLVRID+AP GLNPPHTHPRATEV
Sbjct  59   FFFSGLDKPGNTSNPVGSKVTPVNVMQLPGLNTLGISLVRIDYAPYGLNPPHTHPRATEV  118

Query  443  LLVLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGL  622
            L+VLEG LYVGFV SNP     N LFTK L  GDVFVFP+GL HFQFNVG TNA+AFAGL
Sbjct  119  LVVLEGRLYVGFVTSNP----DNRLFTKVLNKGDVFVFPQGLTHFQFNVGHTNAVAFAGL  174

Query  623  SSQNPGVITIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQFWYNNS  769
            SSQNPG ITIANAVFG  PPI   VL KAFQV + VI+YLQAQ+W +N+
Sbjct  175  SSQNPGTITIANAVFGPKPPIKDDVLAKAFQVDKKVIDYLQAQYWMDNN  223



>emb|CDP16791.1| unnamed protein product [Coffea canephora]
Length=230

 Score =   315 bits (808),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 161/228 (71%), Positives = 183/228 (80%), Gaps = 1/228 (0%)
 Frame = +2

Query  86   MAIRFIVFTITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDF  265
            MA RF +  + ++ L  +   ASDPSPLQDFCVAV D+ A VFVNGKICK+P  V   DF
Sbjct  1    MAFRFHIAAV-ILTLVFAIVCASDPSPLQDFCVAVPDANATVFVNGKICKDPKLVKPKDF  59

Query  266  FFRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVL  445
            FF GLN PG+T+NPLGS VT VNVN +PGLNTLG+SL R+DFAP GLNPPHTHPRATEVL
Sbjct  60   FFPGLNKPGSTANPLGSNVTQVNVNQIPGLNTLGVSLARLDFAPYGLNPPHTHPRATEVL  119

Query  446  LVLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLS  625
             VLEGTL VGFV SNP   MKN LFTK L  GDVFVFP+GLIHFQFN GKT+A+AFAG  
Sbjct  120  FVLEGTLLVGFVTSNPGMNMKNKLFTKVLNPGDVFVFPQGLIHFQFNQGKTDAVAFAGFG  179

Query  626  SQNPGVITIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQFWYNNS  769
            SQNPGVITIANAV GS+PPI+P VLTKAFQVG + I  LQ+QFW++N+
Sbjct  180  SQNPGVITIANAVVGSDPPISPDVLTKAFQVGNDAIKKLQSQFWWDNN  227



>ref|XP_002276644.1| PREDICTED: putative germin-like protein 2-1 [Vitis vinifera]
Length=228

 Score =   315 bits (807),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 156/218 (72%), Positives = 176/218 (81%), Gaps = 4/218 (2%)
 Frame = +2

Query  113  ITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFFFRGLNMPG  292
            I ++A++ S A ASDPSPLQDFCVAVND+  +VFVNGK CK+P     NDFFF GL +PG
Sbjct  12   IVLLAMAFSVASASDPSPLQDFCVAVNDTNDSVFVNGKFCKDPKLATPNDFFFSGLRVPG  71

Query  293  NTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLYV  472
            NTSN LGS VTP NV  +PGLNTLG+SL R+D+AP GLNPPHTHPRATE+L VLEGTLYV
Sbjct  72   NTSNKLGSMVTPANVAQIPGLNTLGVSLARVDYAPYGLNPPHTHPRATEILTVLEGTLYV  131

Query  473  GFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSSQNPGVITI  652
            GFV SNP     N L +K L  GDVFVFP+GLIHFQ NVGKTNA+A A LSSQNPGVITI
Sbjct  132  GFVTSNP----DNRLISKVLYKGDVFVFPQGLIHFQLNVGKTNAVAIASLSSQNPGVITI  187

Query  653  ANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQFWYNN  766
            ANAVFGS P I+  VLTKAFQV +NVINYLQ+QFW +N
Sbjct  188  ANAVFGSKPAISADVLTKAFQVDKNVINYLQSQFWTDN  225



>ref|XP_007199217.1| hypothetical protein PRUPE_ppa021882mg [Prunus persica]
 gb|EMJ00416.1| hypothetical protein PRUPE_ppa021882mg [Prunus persica]
Length=226

 Score =   315 bits (806),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 160/225 (71%), Positives = 177/225 (79%), Gaps = 3/225 (1%)
 Frame = +2

Query  95   RFIVFTITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFFFR  274
             F++ T+  +A ++  A A DPSPLQDFCVA+ D    VFVNGK CK+P    ANDFFF 
Sbjct  5    HFLISTLAFLAFATFLASAYDPSPLQDFCVALKDIKDGVFVNGKFCKDPKLANANDFFFS  64

Query  275  GLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVL  454
            GL  P NT NP+GS VT VNV+NL GLNTLGISL RIDFAPNGLNPPHTHPRATE+L+VL
Sbjct  65   GLQNPRNTQNPVGSNVTAVNVDNLAGLNTLGISLARIDFAPNGLNPPHTHPRATEILVVL  124

Query  455  EGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSSQN  634
            EGTLYVGFV SN   G  N LFTK L  GDVFVFP GLIHFQ NVG  NA+AFAGLSSQN
Sbjct  125  EGTLYVGFVTSN---GDGNRLFTKVLNKGDVFVFPIGLIHFQLNVGHVNAVAFAGLSSQN  181

Query  635  PGVITIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQFWYNNS  769
            PGVITIANAVFGS PPINP VLTKAFQV   V++YLQ QFWY+N+
Sbjct  182  PGVITIANAVFGSKPPINPDVLTKAFQVDNKVVDYLQKQFWYDNN  226



>ref|NP_001237300.1| uncharacterized protein LOC100527781 precursor [Glycine max]
 gb|ACG69488.1| germin-like protein 12 [Glycine max]
 gb|ACU16953.1| unknown [Glycine max]
 gb|KHN04964.1| Germin-like protein subfamily 1 member 7 [Glycine soja]
Length=222

 Score =   314 bits (805),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 161/226 (71%), Positives = 180/226 (80%), Gaps = 4/226 (2%)
 Frame = +2

Query  92   IRFIVFTITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFFF  271
            ++ + F + ++AL+SS A A DPSPLQDFCVA+ND+   VFVNGK CK+P    A DFFF
Sbjct  1    MKVVYFFVVLLALASSIAFAYDPSPLQDFCVAINDTKTGVFVNGKFCKDPKLAKAEDFFF  60

Query  272  RGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLV  451
             GL  PGNTSNPLGSKVT V VN + GLNTLGISL RIDFAP GLNPPHTHPR TE+L+V
Sbjct  61   PGLG-PGNTSNPLGSKVTAVTVNEILGLNTLGISLARIDFAPKGLNPPHTHPRGTEILVV  119

Query  452  LEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSSQ  631
            LEGTLYVGFV SN      N LFTK L  GDVFVFP GLIHFQ N+G  NA+A AGLSSQ
Sbjct  120  LEGTLYVGFVASNQ---NDNRLFTKVLNKGDVFVFPIGLIHFQQNIGYGNALAIAGLSSQ  176

Query  632  NPGVITIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQFWYNNS  769
            NPGVITIANAVFGS PPI+ +VL KAFQVG+NVI+YLQ QFWYNNS
Sbjct  177  NPGVITIANAVFGSKPPISDEVLAKAFQVGKNVIDYLQKQFWYNNS  222



>ref|XP_003590904.1| Germin-like protein subfamily 1 member [Medicago truncatula]
 gb|AES61155.1| germin family protein [Medicago truncatula]
 gb|AFK44678.1| unknown [Medicago truncatula]
Length=222

 Score =   314 bits (805),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 161/221 (73%), Positives = 178/221 (81%), Gaps = 4/221 (2%)
 Frame = +2

Query  107  FTITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFFFRGLNM  286
            F + ++AL+SS   A DPSPLQDFCVA+ND+   VFVNGK CK+P    A+DFFF+GL  
Sbjct  6    FIVALLALASSVGFAYDPSPLQDFCVAINDTKTGVFVNGKFCKDPKLANADDFFFQGLG-  64

Query  287  PGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTL  466
            PGNTSNPLGSKVTPV VN + GLNTLGISL R+DFAP GLNPPHTHPR TE+L+VLEGTL
Sbjct  65   PGNTSNPLGSKVTPVTVNEILGLNTLGISLARVDFAPKGLNPPHTHPRGTEILVVLEGTL  124

Query  467  YVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSSQNPGVI  646
            YVGFV SN      N LFTK L  GDVFVFP GLIHFQ NVG   AIA AGLSSQNPGVI
Sbjct  125  YVGFVSSNQD---NNRLFTKVLNKGDVFVFPIGLIHFQLNVGYGEAIAIAGLSSQNPGVI  181

Query  647  TIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQFWYNNS  769
            TIANAVFGS PPI+ +VLTKAFQV +NVI+YLQ QFWYNNS
Sbjct  182  TIANAVFGSKPPISLEVLTKAFQVDKNVIDYLQKQFWYNNS  222



>ref|XP_010257844.1| PREDICTED: putative germin-like protein 2-1 [Nelumbo nucifera]
Length=224

 Score =   314 bits (805),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 159/227 (70%), Positives = 177/227 (78%), Gaps = 4/227 (2%)
 Frame = +2

Query  86   MAIRFIVFTITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDF  265
            MA   ++    ++AL+SS A ASDPSPLQDFCVA+ D  AAV VNGK CKNP    A DF
Sbjct  1    MAAAQVLAVSILLALASSLAFASDPSPLQDFCVAIKDPKAAVLVNGKFCKNPKLAKAKDF  60

Query  266  FFRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVL  445
            FF GL+ PGNTSNP+GSKVT VNV  +PGLNTLGISL RIDFAP GLNPPHTHPRATE+L
Sbjct  61   FFSGLHKPGNTSNPVGSKVTAVNVEQIPGLNTLGISLARIDFAPYGLNPPHTHPRATEIL  120

Query  446  LVLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLS  625
            +VLEGTLYVGF  SNP     N L TKTL  GDVFVFP GLIHFQFN G+TNA+A AGLS
Sbjct  121  VVLEGTLYVGFATSNP----DNRLITKTLNKGDVFVFPVGLIHFQFNTGETNAVALAGLS  176

Query  626  SQNPGVITIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQFWYNN  766
            SQNPGVITIANAVFGS PPI   VL +AF+V   +I+ LQAQFW +N
Sbjct  177  SQNPGVITIANAVFGSKPPIRDDVLARAFRVDTKLIDNLQAQFWMDN  223



>ref|XP_010251867.1| PREDICTED: putative germin-like protein 2-1 [Nelumbo nucifera]
Length=222

 Score =   313 bits (802),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 157/205 (77%), Positives = 170/205 (83%), Gaps = 4/205 (2%)
 Frame = +2

Query  155  DPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFFFRGLNMPGNTSNPLGSKVTPVN  334
            DPSPLQDFCVA+ D+   VFVNGK CKNP    A+DFFF GL+ PGNTSNP+GSKVTPVN
Sbjct  22   DPSPLQDFCVAIKDTDYPVFVNGKFCKNPNYTTADDFFFSGLDKPGNTSNPVGSKVTPVN  81

Query  335  VNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLYVGFVLSNPPPGMKNP  514
            V  LPGLNTLGISLVRID+AP GLNPPHTHPRATEVL+VLEG LYVGFV SNP     N 
Sbjct  82   VMQLPGLNTLGISLVRIDYAPYGLNPPHTHPRATEVLVVLEGRLYVGFVTSNP----DNR  137

Query  515  LFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSSQNPGVITIANAVFGSNPPINPQ  694
            LFTK L  GDVFVFPEGLIHFQFNVG TNA+AFAGLSSQNPG ITIANAVFG+ PPI   
Sbjct  138  LFTKVLNKGDVFVFPEGLIHFQFNVGHTNAVAFAGLSSQNPGTITIANAVFGAKPPIKDD  197

Query  695  VLTKAFQVGQNVINYLQAQFWYNNS  769
            VL KAFQV + VI+YLQAQFW +N+
Sbjct  198  VLAKAFQVDKKVIDYLQAQFWMDNN  222



>emb|CDP10695.1| unnamed protein product [Coffea canephora]
Length=223

 Score =   313 bits (801),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 161/217 (74%), Positives = 176/217 (81%), Gaps = 0/217 (0%)
 Frame = +2

Query  104  VFTITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFFFRGLN  283
            + TI  +AL SS A ASDPSPLQDFCVA+ND   AVFVNGKICK+P  V ANDF F+GLN
Sbjct  6    LITIATMALFSSLATASDPSPLQDFCVAINDPKTAVFVNGKICKDPKVVKANDFLFQGLN  65

Query  284  MPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGT  463
             P NT+N  GS VT VNVNNL GLNTLG+SL R+DFAP GLNPPHTHPRATEVL VLEGT
Sbjct  66   KPRNTANRQGSNVTAVNVNNLAGLNTLGVSLARLDFAPFGLNPPHTHPRATEVLFVLEGT  125

Query  464  LYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSSQNPGV  643
            L+VGFV SNPP  MKN LFTKTL  GDVFVFPEGLIHFQFN GKTNA+AF+   SQNPGV
Sbjct  126  LHVGFVTSNPPNNMKNQLFTKTLNPGDVFVFPEGLIHFQFNFGKTNAVAFSAFGSQNPGV  185

Query  644  ITIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQF  754
            ITIANAVFGS+P I+  VL KAFQV + VI  L+AQF
Sbjct  186  ITIANAVFGSDPLISADVLAKAFQVDKKVIYLLEAQF  222



>emb|CAN80134.1| hypothetical protein VITISV_012033 [Vitis vinifera]
Length=224

 Score =   313 bits (801),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 155/226 (69%), Positives = 185/226 (82%), Gaps = 5/226 (2%)
 Frame = +2

Query  89   AIRFIVFTITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFF  268
            ++R +V TI  +AL+ S + A DPSPLQD CVAV+D  AAVFVNGK CK+P   +A+DFF
Sbjct  4    SVRLLV-TIAFMALACSISSAYDPSPLQDTCVAVDDPKAAVFVNGKFCKDPKLAMADDFF  62

Query  269  FRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLL  448
            F GL++PGNTSNP+GS VTPVNV  + GLNTLGISL R+D+AP GLNPPHTHPRATE+L+
Sbjct  63   FSGLHIPGNTSNPVGSAVTPVNVAQIAGLNTLGISLARVDYAPYGLNPPHTHPRATEILV  122

Query  449  VLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSS  628
            VLEGTLYVGFV SNP    +N L +K L  GDVFVFP GLIHFQFNVG TN +A A LSS
Sbjct  123  VLEGTLYVGFVTSNP----ENRLISKVLNKGDVFVFPIGLIHFQFNVGHTNTVAIAALSS  178

Query  629  QNPGVITIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQFWYNN  766
            QNPGVITIANAVFGS+PPI+  VLTKAFQ+ ++V+NYLQ+ FW++N
Sbjct  179  QNPGVITIANAVFGSDPPISIDVLTKAFQLDKDVVNYLQSSFWWDN  224



>ref|XP_008363404.1| PREDICTED: LOW QUALITY PROTEIN: germin-like protein subfamily 
1 member 11 [Malus domestica]
Length=225

 Score =   313 bits (801),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 155/224 (69%), Positives = 176/224 (79%), Gaps = 4/224 (2%)
 Frame = +2

Query  95   RFIVFTITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFFFR  274
            +F V  + ++A ++SF  ASDPSP QDFCVA+ND+   VFVNGK CK+P    AN FFF 
Sbjct  5    QFXVCIVAILAFATSFVSASDPSPXQDFCVALNDTKLGVFVNGKFCKDPKLASANYFFFS  64

Query  275  GLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVL  454
            GL +P +T NPLGS VTPVNV+ +PGLNTL ISLVRIDFAPNGLNPPHTHPR TE+L + 
Sbjct  65   GLQIPRSTQNPLGSTVTPVNVDQIPGLNTLSISLVRIDFAPNGLNPPHTHPRGTEILFLQ  124

Query  455  EGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSSQN  634
            EGTLYVGFV SNP     N LFTK L  GDVFVFP GLIHFQ NVG TNA+A +GLSSQN
Sbjct  125  EGTLYVGFVTSNP----DNRLFTKVLNKGDVFVFPVGLIHFQLNVGHTNAVAISGLSSQN  180

Query  635  PGVITIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQFWYNN  766
            PGVITIANAVFG+NPPINP VL KAFQV   ++ YLQ QFWY+N
Sbjct  181  PGVITIANAVFGANPPINPDVLAKAFQVEBKLVTYLQKQFWYDN  224



>ref|XP_002276756.2| PREDICTED: putative germin-like protein 2-1 [Vitis vinifera]
Length=228

 Score =   312 bits (799),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 154/218 (71%), Positives = 176/218 (81%), Gaps = 4/218 (2%)
 Frame = +2

Query  113  ITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFFFRGLNMPG  292
            I ++A++ S A ASDPSPLQDFCVAVND+  +VFVNGK CK+P     NDFFF GL +PG
Sbjct  12   IVLLAMAFSVASASDPSPLQDFCVAVNDTNDSVFVNGKFCKDPKLATPNDFFFSGLRVPG  71

Query  293  NTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLYV  472
            NTSN LGS VTP NV  +PGLNTLG+SL R+D+AP GLNPPH+HPRATE+L VLEGTLYV
Sbjct  72   NTSNKLGSMVTPANVAQIPGLNTLGVSLARVDYAPYGLNPPHSHPRATEILTVLEGTLYV  131

Query  473  GFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSSQNPGVITI  652
            GFV SNP     N L +K L  GDVFVFP+GLIHFQ NVGKTNA+A A LSSQNPGVITI
Sbjct  132  GFVTSNP----DNRLISKVLHKGDVFVFPQGLIHFQLNVGKTNAVAIASLSSQNPGVITI  187

Query  653  ANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQFWYNN  766
            ANAVFGS P I+  VLTKAFQV +NV+NYLQ+QFW +N
Sbjct  188  ANAVFGSKPAISADVLTKAFQVDKNVVNYLQSQFWTDN  225



>ref|XP_007030272.1| RmlC-like cupins superfamily protein [Theobroma cacao]
 gb|EOY10774.1| RmlC-like cupins superfamily protein [Theobroma cacao]
Length=225

 Score =   310 bits (795),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 156/211 (74%), Positives = 176/211 (83%), Gaps = 5/211 (2%)
 Frame = +2

Query  140  FAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFFFRGLNMPGNTSNPLGSK  319
            FA+ASDPSPLQD+CVA+ND+   VFVNGK CK+P    A DFFF GLN+P N SNP+GS 
Sbjct  19   FAYASDPSPLQDYCVAINDAKDGVFVNGKFCKDPKLAKAEDFFFSGLNIPRNKSNPVGST  78

Query  320  VTPVNVNNLPGLNTLGISLVRIDFAPN-GLNPPHTHPRATEVLLVLEGTLYVGFVLSNPP  496
            VTPVNV  +PGLNTLGISLVRID+APN GLNPPHTHPRATE+L+VLEGTLYVGFV SNP 
Sbjct  79   VTPVNVAQIPGLNTLGISLVRIDYAPNDGLNPPHTHPRATEILVVLEGTLYVGFVTSNP-  137

Query  497  PGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSSQNPGVITIANAVFGSN  676
                N L TK L  GDVFVFP GLIHFQFNVGKTNA+AFA LSSQNPGVITIANAVFG+N
Sbjct  138  ---DNRLITKILYPGDVFVFPIGLIHFQFNVGKTNAVAFAALSSQNPGVITIANAVFGAN  194

Query  677  PPINPQVLTKAFQVGQNVINYLQAQFWYNNS  769
            PPINP VL KAFQ+ +NV+  LQ++FW+ N+
Sbjct  195  PPINPDVLVKAFQLDKNVVKNLQSKFWWANN  225



>ref|XP_008237524.1| PREDICTED: germin-like protein subfamily 1 member 11 isoform 
X2 [Prunus mume]
Length=228

 Score =   311 bits (796),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 161/229 (70%), Positives = 179/229 (78%), Gaps = 5/229 (2%)
 Frame = +2

Query  89   AIRFIVFTITVVALSSSFAHASDPSPLQDFCVAVND--SMAAVFVNGKICKNPMQVVAND  262
             + F++ T+ ++A ++    ASDPSPLQDFCVA+ND  S  AVFVNGK CK+P    AND
Sbjct  3    GVYFLISTLAILASATFLVSASDPSPLQDFCVALNDTKSAEAVFVNGKFCKDPKLANAND  62

Query  263  FFFRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEV  442
            FFF GL  P NT NPLGS VT VNV+NL GLNTLGISL RIDFAPNGLNPPHTHPRATE+
Sbjct  63   FFFSGLQNPRNTQNPLGSNVTAVNVDNLLGLNTLGISLARIDFAPNGLNPPHTHPRATEI  122

Query  443  LLVLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGL  622
            L+VLEGTLYVGFV SN   G  N LFTK L  GDVFVFP GLIHFQ NVG  NA+AFAGL
Sbjct  123  LVVLEGTLYVGFVTSN---GDGNRLFTKVLNKGDVFVFPIGLIHFQLNVGHVNAVAFAGL  179

Query  623  SSQNPGVITIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQFWYNNS  769
            SSQNPGVITIANAVFGS P INP VL KAFQV   V++ LQ QFWY+N+
Sbjct  180  SSQNPGVITIANAVFGSKPLINPDVLAKAFQVDDKVVDNLQKQFWYDNN  228



>ref|XP_003633724.1| PREDICTED: putative germin-like protein 2-1 [Vitis vinifera]
Length=221

 Score =   310 bits (794),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 156/223 (70%), Positives = 177/223 (79%), Gaps = 7/223 (3%)
 Frame = +2

Query  95   RFIVFTITVVALSS-SF--AHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDF  265
            + ++ T+  +ALS+ SF  A ASDPSPLQDFCVAVND+   VFVNGK+CK+P    ANDF
Sbjct  3    KMVINTLACIALSAMSFFLASASDPSPLQDFCVAVNDTKTTVFVNGKVCKDPKVATANDF  62

Query  266  FFRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVL  445
            FF GL +PGNTSN LGS VTP NV  +PGLNTLGISL R+D+AP GLNPPHTHPRATE+L
Sbjct  63   FFSGLRVPGNTSNKLGSMVTPANVAQIPGLNTLGISLARVDYAPYGLNPPHTHPRATEIL  122

Query  446  LVLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLS  625
             VLEGTLYVGFV SNP     N L +K L  GDVFVFPEGLIHFQ NVGKT A+A A LS
Sbjct  123  TVLEGTLYVGFVTSNP----DNRLISKVLYKGDVFVFPEGLIHFQLNVGKTKAVAIAALS  178

Query  626  SQNPGVITIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQF  754
            SQNPGVITIANAVFGS P I+  VLTKAFQV + V++YLQ+QF
Sbjct  179  SQNPGVITIANAVFGSKPAISADVLTKAFQVDKKVVDYLQSQF  221



>ref|XP_007030276.1| RmlC-like cupins superfamily protein [Theobroma cacao]
 ref|XP_007030282.1| RmlC-like cupins superfamily protein [Theobroma cacao]
 gb|EOY10778.1| RmlC-like cupins superfamily protein [Theobroma cacao]
 gb|EOY10784.1| RmlC-like cupins superfamily protein [Theobroma cacao]
Length=225

 Score =   310 bits (794),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 154/206 (75%), Positives = 172/206 (83%), Gaps = 5/206 (2%)
 Frame = +2

Query  155  DPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFFFRGLNMPGNTSNPLGSKVTPVN  334
            DPSPLQDFCVA+ND+  AVFVNGK CK+PM   A DFFF GLN+PGNTSN LGSKVTPVN
Sbjct  24   DPSPLQDFCVALNDTKNAVFVNGKFCKDPMLAKAEDFFFSGLNVPGNTSNQLGSKVTPVN  83

Query  335  VNNLPGLNTLGISLVRIDFAP-NGLNPPHTHPRATEVLLVLEGTLYVGFVLSNPPPGMKN  511
            V  +PGLNTLG+SL R+DFAP  GLNPPHTHPRATE+L+VLEGTLYVGFV SNP     N
Sbjct  84   VEQIPGLNTLGVSLARVDFAPYGGLNPPHTHPRATEILVVLEGTLYVGFVTSNP----DN  139

Query  512  PLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSSQNPGVITIANAVFGSNPPINP  691
             L TK L  GDVFVFP GLIHFQ N+GKTNA+AFA   SQNPGVITIA AVFGSNPPINP
Sbjct  140  RLITKVLYPGDVFVFPVGLIHFQLNIGKTNAVAFAAFGSQNPGVITIAKAVFGSNPPINP  199

Query  692  QVLTKAFQVGQNVINYLQAQFWYNNS  769
             VLTKAFQ+ +NV+ YLQ+QFW++N+
Sbjct  200  DVLTKAFQLDKNVVKYLQSQFWWDNN  225



>ref|XP_008393146.1| PREDICTED: germin-like protein subfamily 1 member 11 [Malus domestica]
Length=225

 Score =   310 bits (794),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 152/224 (68%), Positives = 175/224 (78%), Gaps = 4/224 (2%)
 Frame = +2

Query  95   RFIVFTITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFFFR  274
            +F+   + ++A ++S   ASDPSPLQDFCVA+ND+   VFVNGK CK+     ANDFFF 
Sbjct  5    QFLXCIVAILAFATSLVSASDPSPLQDFCVALNDTKLGVFVNGKFCKDSRLASANDFFFS  64

Query  275  GLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVL  454
            GL +P +T NPLGS VTP NV+ + GLNTLGISL RIDFAPNGLNPPHTHPR TE+L + 
Sbjct  65   GLQIPRSTQNPLGSTVTPANVDQIAGLNTLGISLARIDFAPNGLNPPHTHPRGTEILFLQ  124

Query  455  EGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSSQN  634
            EGTLYVGFV SNP     N LFTK L  GDVFVFP GLIHFQ NVG T+A+A AGLSSQN
Sbjct  125  EGTLYVGFVTSNP----NNRLFTKVLNKGDVFVFPVGLIHFQLNVGHTSAVAIAGLSSQN  180

Query  635  PGVITIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQFWYNN  766
            PGVITIANAVFG+NPPINP VL KAFQV   +++YLQ QFWY+N
Sbjct  181  PGVITIANAVFGANPPINPDVLAKAFQVDDKLVSYLQKQFWYDN  224



>emb|CBI33612.3| unnamed protein product [Vitis vinifera]
Length=221

 Score =   310 bits (793),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 153/214 (71%), Positives = 171/214 (80%), Gaps = 4/214 (2%)
 Frame = +2

Query  113  ITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFFFRGLNMPG  292
            I ++A+S   A ASDPSPLQDFCVAVND+   VFVNGK+CK+P    ANDFFF GL +PG
Sbjct  12   IALLAMSFFLASASDPSPLQDFCVAVNDTKTTVFVNGKVCKDPKVATANDFFFSGLRVPG  71

Query  293  NTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLYV  472
            NTSN LGS VTP NV  +PGLNTLGISL R+D+AP GLNPPHTHPRATE+L VLEGTLYV
Sbjct  72   NTSNKLGSMVTPANVAQIPGLNTLGISLARVDYAPYGLNPPHTHPRATEILTVLEGTLYV  131

Query  473  GFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSSQNPGVITI  652
            GFV SNP     N L +K L  GDVFVFPEGLIHFQ NVGKT A+A A LSSQNPGVITI
Sbjct  132  GFVTSNP----DNRLISKVLYKGDVFVFPEGLIHFQLNVGKTKAVAIAALSSQNPGVITI  187

Query  653  ANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQF  754
            ANAVFGS P I+  VLTKAFQV + V++YLQ+QF
Sbjct  188  ANAVFGSKPAISADVLTKAFQVDKKVVDYLQSQF  221



>ref|XP_008237522.1| PREDICTED: germin-like protein subfamily 1 member 11 isoform 
X1 [Prunus mume]
Length=229

 Score =   310 bits (793),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 160/230 (70%), Positives = 180/230 (78%), Gaps = 6/230 (3%)
 Frame = +2

Query  89   AIRFIVFTITVVALSSSFAHASDPSPLQDFCVAVNDS---MAAVFVNGKICKNPMQVVAN  259
             + F++ T+ ++A ++    ASDPSPLQDFCVA+ND+   + AVFVNGK CK+P    AN
Sbjct  3    GVYFLISTLAILASATFLVSASDPSPLQDFCVALNDTKSAVEAVFVNGKFCKDPKLANAN  62

Query  260  DFFFRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATE  439
            DFFF GL  P NT NPLGS VT VNV+NL GLNTLGISL RIDFAPNGLNPPHTHPRATE
Sbjct  63   DFFFSGLQNPRNTQNPLGSNVTAVNVDNLLGLNTLGISLARIDFAPNGLNPPHTHPRATE  122

Query  440  VLLVLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAG  619
            +L+VLEGTLYVGFV SN   G  N LFTK L  GDVFVFP GLIHFQ NVG  NA+AFAG
Sbjct  123  ILVVLEGTLYVGFVTSN---GDGNRLFTKVLNKGDVFVFPIGLIHFQLNVGHVNAVAFAG  179

Query  620  LSSQNPGVITIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQFWYNNS  769
            LSSQNPGVITIANAVFGS P INP VL KAFQV   V++ LQ QFWY+N+
Sbjct  180  LSSQNPGVITIANAVFGSKPLINPDVLAKAFQVDDKVVDNLQKQFWYDNN  229



>ref|XP_008243694.1| PREDICTED: germin-like protein 9-1 [Prunus mume]
Length=456

 Score =   318 bits (814),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 160/225 (71%), Positives = 178/225 (79%), Gaps = 3/225 (1%)
 Frame = +2

Query  95   RFIVFTITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFFFR  274
             F++ T+ ++A ++  A A DPSPLQDFCVA+ D    VFVNGK CK+P    ANDFFF 
Sbjct  5    HFLISTLAILAFATFLASADDPSPLQDFCVALKDIKDGVFVNGKFCKDPKLANANDFFFS  64

Query  275  GLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVL  454
            GL  P NT NP+GS VT VNV+NL GLNTLGISL RIDFAPNGLNPPHTHPRATE+L+VL
Sbjct  65   GLQNPRNTQNPVGSNVTAVNVDNLAGLNTLGISLARIDFAPNGLNPPHTHPRATEILVVL  124

Query  455  EGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSSQN  634
            EGTLYVGFV SN   G  N LFTK L  GDVFVFP GLIHFQ NVG  NA+AFAGLSSQN
Sbjct  125  EGTLYVGFVTSN---GDGNRLFTKELNKGDVFVFPIGLIHFQLNVGHVNAVAFAGLSSQN  181

Query  635  PGVITIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQFWYNNS  769
            PGVITIANAVFGS PPINP VLTKAFQV   V++YLQ QFWY+N+
Sbjct  182  PGVITIANAVFGSKPPINPDVLTKAFQVDNKVVDYLQKQFWYDNT  226


 Score =   315 bits (807),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 160/225 (71%), Positives = 176/225 (78%), Gaps = 3/225 (1%)
 Frame = +2

Query  95   RFIVFTITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFFFR  274
             F++  + ++A S   A A DPSPLQDFCVA+ D    VFVNGK CK+P    ANDFFF 
Sbjct  235  HFLISILAILAFSMFLASAYDPSPLQDFCVAIKDIKDGVFVNGKFCKDPKLANANDFFFS  294

Query  275  GLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVL  454
            GL  P NT NP+GS VT VNV+NL GLNTLGISL RIDFAPNGLNPPHTHPRATE+L+VL
Sbjct  295  GLQNPRNTQNPVGSNVTAVNVDNLAGLNTLGISLARIDFAPNGLNPPHTHPRATEILVVL  354

Query  455  EGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSSQN  634
            EGTLYVGFV SN   G  N LFTK L  GDVFVFP GLIHFQ NVG  NA+AFAGLSSQN
Sbjct  355  EGTLYVGFVTSN---GDGNRLFTKELNKGDVFVFPIGLIHFQLNVGHVNAVAFAGLSSQN  411

Query  635  PGVITIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQFWYNNS  769
            PGVITIANAVFGS PPINP VLTKAFQV   V++YLQ QFWY+N+
Sbjct  412  PGVITIANAVFGSKPPINPDVLTKAFQVDNKVVDYLQKQFWYDNN  456



>ref|XP_008393482.1| PREDICTED: germin-like protein subfamily 1 member 13 [Malus domestica]
 ref|XP_008351930.1| PREDICTED: germin-like protein subfamily 1 member 13 [Malus domestica]
Length=230

 Score =   310 bits (793),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 155/219 (71%), Positives = 175/219 (80%), Gaps = 1/219 (0%)
 Frame = +2

Query  113  ITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFFFRGLNMPG  292
            ++V+A ++  A ASDP PLQDFCVA+N++  AVFVNGK CK+P    ANDFF   L  PG
Sbjct  13   LSVLAFATLLASASDPGPLQDFCVAINNTDYAVFVNGKFCKDPNLASANDFFTDKLRYPG  72

Query  293  NTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLYV  472
            NTSNP+GS VT  NV+ +PGLNTLGIS  R+DFAPNGLNPPHTHPRATE+ +VLEG+LYV
Sbjct  73   NTSNPVGSIVTAANVDVIPGLNTLGISFARVDFAPNGLNPPHTHPRATEIFIVLEGSLYV  132

Query  473  GFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSSQNPGVITI  652
            GFV SN   G  N LFTK L  GDVFVFP GLIHFQ NVGKTNA+A A  SSQNPGVIT+
Sbjct  133  GFVTSN-IEGDGNRLFTKVLYKGDVFVFPFGLIHFQLNVGKTNAVAIAAFSSQNPGVITV  191

Query  653  ANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQFWYNNS  769
            ANAVFGS PPINP VLTKAFQV  NV++YLQ QFWYNNS
Sbjct  192  ANAVFGSKPPINPDVLTKAFQVDNNVVDYLQKQFWYNNS  230



>ref|XP_002276315.2| PREDICTED: putative germin-like protein 2-1 [Vitis vinifera]
Length=228

 Score =   309 bits (792),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 152/218 (70%), Positives = 174/218 (80%), Gaps = 4/218 (2%)
 Frame = +2

Query  113  ITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFFFRGLNMPG  292
            + ++A++ S A ASDPSPLQDFCVAVND+   VFVNGK C++P     NDFFF GL +PG
Sbjct  12   VVLLAMAFSVASASDPSPLQDFCVAVNDTNDTVFVNGKFCRDPKLATPNDFFFSGLRVPG  71

Query  293  NTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLYV  472
            NTSN LGS VTP NV  +PGLNTLG+SL R+D+AP GLNPPHTHPRATE+L VLEGTLYV
Sbjct  72   NTSNKLGSMVTPANVAQIPGLNTLGVSLARVDYAPYGLNPPHTHPRATEILTVLEGTLYV  131

Query  473  GFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSSQNPGVITI  652
            GFV SNP     N L +K L  GDVFVFP+GLIHFQ NVGKTNA+A A LSSQNPGVITI
Sbjct  132  GFVTSNP----DNRLISKVLYKGDVFVFPQGLIHFQLNVGKTNAVAIASLSSQNPGVITI  187

Query  653  ANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQFWYNN  766
            ANAVFGS P I+  VLTKAFQV +N +NYLQ+QFW +N
Sbjct  188  ANAVFGSKPAISADVLTKAFQVDKNEVNYLQSQFWTDN  225



>ref|XP_002265608.1| PREDICTED: putative germin-like protein 2-1 [Vitis vinifera]
Length=221

 Score =   308 bits (790),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 155/223 (70%), Positives = 177/223 (79%), Gaps = 7/223 (3%)
 Frame = +2

Query  95   RFIVFTITVVALSS-SF--AHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDF  265
            + ++ T+  +ALS+ SF  A ASDPSPLQDFCVAVND+   VFVNGK+CK+P    ANDF
Sbjct  3    KMVINTLACIALSAMSFFLASASDPSPLQDFCVAVNDTKTTVFVNGKVCKDPKVATANDF  62

Query  266  FFRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVL  445
            FF GL +PGNTSN +GS VTP NV  +PGLNTLGISL R+D+AP GLNPPHTHPRATE+L
Sbjct  63   FFSGLRVPGNTSNKVGSMVTPANVAQIPGLNTLGISLARVDYAPYGLNPPHTHPRATEIL  122

Query  446  LVLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLS  625
             VLEGTLYVGFV SNP     N L +K L  GDVFVFPEGLIHFQ NVGKT A+A A LS
Sbjct  123  TVLEGTLYVGFVTSNP----DNRLISKVLYKGDVFVFPEGLIHFQLNVGKTKAVAIAALS  178

Query  626  SQNPGVITIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQF  754
            SQNPGVITIANAVFGS P I+  VLTKAFQV + V++YLQ+QF
Sbjct  179  SQNPGVITIANAVFGSKPAISADVLTKAFQVDKKVVDYLQSQF  221



>emb|CBI33610.3| unnamed protein product [Vitis vinifera]
Length=315

 Score =   312 bits (799),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 158/237 (67%), Positives = 182/237 (77%), Gaps = 8/237 (3%)
 Frame = +2

Query  53   NSDTLTQNIFDMAIRFIVFTITVVALSS-SF--AHASDPSPLQDFCVAVNDSMAAVFVNG  223
              D L  +  +M  + ++ T+  +ALS+ SF  A ASDPSPLQDFCVAVND+   VFVNG
Sbjct  84   KKDCLRIHCINMK-KMVINTLACIALSAMSFFLASASDPSPLQDFCVAVNDTKTTVFVNG  142

Query  224  KICKNPMQVVANDFFFRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNG  403
            K+CK+P    ANDFFF GL +PGNTSN +GS VTP NV  +PGLNTLGISL R+D+AP G
Sbjct  143  KVCKDPKVATANDFFFSGLRVPGNTSNKVGSMVTPANVAQIPGLNTLGISLARVDYAPYG  202

Query  404  LNPPHTHPRATEVLLVLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQF  583
            LNPPHTHPRATE+L VLEGTLYVGFV SNP     N L +K L  GDVFVFPEGLIHFQ 
Sbjct  203  LNPPHTHPRATEILTVLEGTLYVGFVTSNP----DNRLISKVLYKGDVFVFPEGLIHFQL  258

Query  584  NVGKTNAIAFAGLSSQNPGVITIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQF  754
            NVGKT A+A A LSSQNPGVITIANAVFGS P I+  VLTKAFQV + V++YLQ+QF
Sbjct  259  NVGKTKAVAIAALSSQNPGVITIANAVFGSKPAISADVLTKAFQVDKKVVDYLQSQF  315



>ref|XP_008237525.1| PREDICTED: germin-like protein subfamily 1 member 18 [Prunus 
mume]
Length=234

 Score =   309 bits (792),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 159/235 (68%), Positives = 182/235 (77%), Gaps = 11/235 (5%)
 Frame = +2

Query  89   AIRFIVFTITVVALSSSFAHASDPSPLQDFCVAVNDSMAA--------VFVNGKICKNPM  244
             + F++ T+ ++A ++    ASDPSPLQDFCVA++D+ +A        VFVNGK CK+P 
Sbjct  3    GVHFLISTLAILASATFLVSASDPSPLQDFCVALDDTKSAGGYFGAGAVFVNGKFCKDPK  62

Query  245  QVVANDFFFRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTH  424
             V ANDFFF GL  P NT NPLGS VT VNV+ + GLNTLGISL RIDFAPNGLNPPHTH
Sbjct  63   LVNANDFFFSGLQNPRNTQNPLGSNVTTVNVDQIAGLNTLGISLTRIDFAPNGLNPPHTH  122

Query  425  PRATEVLLVLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNA  604
            PRA+E L+VLEG+LYVGFV SN   G  N LFTK L  GDVFVFP GLIHFQFNVG  NA
Sbjct  123  PRASEFLVVLEGSLYVGFVTSN---GDGNRLFTKVLNKGDVFVFPIGLIHFQFNVGHVNA  179

Query  605  IAFAGLSSQNPGVITIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQFWYNNS  769
            +AFAGLSSQNPGVITIANAVFGS P INP VL KAFQV  NV++YLQ QFWY+N+
Sbjct  180  VAFAGLSSQNPGVITIANAVFGSKPLINPDVLAKAFQVDNNVVDYLQKQFWYDNN  234



>ref|XP_007143989.1| hypothetical protein PHAVU_007G119700g [Phaseolus vulgaris]
 gb|ESW15983.1| hypothetical protein PHAVU_007G119700g [Phaseolus vulgaris]
Length=224

 Score =   308 bits (790),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 156/226 (69%), Positives = 180/226 (80%), Gaps = 4/226 (2%)
 Frame = +2

Query  92   IRFIVFTITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFFF  271
            ++ + F + ++AL+SS A A DPSPLQDFCVA+ND+   VFVNGK CK+P    A+DFFF
Sbjct  1    MKVVQFLVVLLALASSVAFAYDPSPLQDFCVAINDTKTGVFVNGKFCKDPKFANADDFFF  60

Query  272  RGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLV  451
            RGL   G+T+NP+GSKVTPV VN + GLNTLGISL RIDFAP GLNPPHTHPR TE+L+V
Sbjct  61   RGLGA-GDTANPVGSKVTPVAVNEILGLNTLGISLARIDFAPKGLNPPHTHPRGTEILVV  119

Query  452  LEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSSQ  631
            LEGTLYVGFV SN      N LFTK L  GDVFVFP GLIHFQ NVG  NA+A AGLSSQ
Sbjct  120  LEGTLYVGFVASNQ---NDNRLFTKVLNKGDVFVFPIGLIHFQQNVGYGNAVAIAGLSSQ  176

Query  632  NPGVITIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQFWYNNS  769
            NPGVITIANAVFGS PPI+ ++L KAFQV +N I+YLQ QFWYNN+
Sbjct  177  NPGVITIANAVFGSKPPISDEILAKAFQVDKNTIDYLQKQFWYNNN  222



>ref|XP_007201563.1| hypothetical protein PRUPE_ppa018105mg [Prunus persica]
 gb|EMJ02762.1| hypothetical protein PRUPE_ppa018105mg [Prunus persica]
Length=227

 Score =   308 bits (790),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 153/226 (68%), Positives = 178/226 (79%), Gaps = 3/226 (1%)
 Frame = +2

Query  92   IRFIVFTITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFFF  271
            + F++ T+ ++A ++    ASDPSPLQDFCVA+ND+ +AVFVNGK CK+P    ANDFFF
Sbjct  4    VHFLINTLAILAFATILVFASDPSPLQDFCVALNDTKSAVFVNGKFCKDPKLANANDFFF  63

Query  272  RGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLV  451
             GL +  +T NPLGS VT VNV+ + GLNTLGISL RIDFA NGLNPPHTHPRATE+LLV
Sbjct  64   SGLQIARSTQNPLGSTVTAVNVDQIAGLNTLGISLARIDFARNGLNPPHTHPRATEILLV  123

Query  452  LEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSSQ  631
            LEGTLYVGFV SN      N LFTK L  GDVFVFP GLIHFQ NVG+ +A+A A LSSQ
Sbjct  124  LEGTLYVGFVTSNAD---NNRLFTKVLNKGDVFVFPIGLIHFQLNVGEGDAVAQAALSSQ  180

Query  632  NPGVITIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQFWYNNS  769
            NPGVITIANAVFGS+PPINP+VL KAFQV    + YLQ QFWY+N+
Sbjct  181  NPGVITIANAVFGSDPPINPEVLAKAFQVDNKAVEYLQKQFWYDNN  226



>emb|CDP16786.1| unnamed protein product [Coffea canephora]
Length=690

 Score =   323 bits (829),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 166/234 (71%), Positives = 187/234 (80%), Gaps = 1/234 (0%)
 Frame = +2

Query  68   TQNIFDMAIRFIVFTITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQ  247
            T  +  MA+R I     ++AL  +  HASDPSPLQDFCVAV D+ A VFVNGKICK+P  
Sbjct  456  TSFVITMAVR-IHIAAAILALVFTVVHASDPSPLQDFCVAVPDANAGVFVNGKICKDPKL  514

Query  248  VVANDFFFRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHP  427
            V   DFFF GLN PG+T+NPLGS VT VNVN +PGLNTLG+SL RIDFAP GLNPPH HP
Sbjct  515  VKPEDFFFPGLNKPGSTANPLGSNVTAVNVNQIPGLNTLGVSLARIDFAPYGLNPPHIHP  574

Query  428  RATEVLLVLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAI  607
            RATEVL VLEGTL VGFV SNP   MKN LFTK L  GDVFVFP+GLIHFQFN G +NA+
Sbjct  575  RATEVLFVLEGTLVVGFVTSNPGMNMKNKLFTKVLNPGDVFVFPQGLIHFQFNQGHSNAV  634

Query  608  AFAGLSSQNPGVITIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQFWYNNS  769
            AFAGL SQNPGVITIANAVFGS+PPI+P VLTKAFQVG +VI  LQ+QFW++N+
Sbjct  635  AFAGLGSQNPGVITIANAVFGSDPPISPDVLTKAFQVGNDVIKKLQSQFWWDNN  688


 Score =   318 bits (814),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 163/228 (71%), Positives = 185/228 (81%), Gaps = 1/228 (0%)
 Frame = +2

Query  86   MAIRFIVFTITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDF  265
            MA RF +    ++AL  +  +ASDPSPLQDFCVAV D+ A VFVNGKICK+P  V A DF
Sbjct  1    MAFRFHI-AAAILALVFTIVYASDPSPLQDFCVAVPDANAGVFVNGKICKDPKLVKAEDF  59

Query  266  FFRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVL  445
            FF+GLN PG+T+NPLGS VT VNVN +PGLNTLG+SL R+DFAP GLNPPHTHPRATEVL
Sbjct  60   FFQGLNKPGSTANPLGSNVTQVNVNQIPGLNTLGVSLARLDFAPYGLNPPHTHPRATEVL  119

Query  446  LVLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLS  625
             VLEGTL VGFV SNP   MKN LFTK L  GDVFVFP+GLIHFQFN G+T+A+AFAGL 
Sbjct  120  FVLEGTLLVGFVTSNPGMNMKNKLFTKVLNPGDVFVFPQGLIHFQFNQGETDAVAFAGLG  179

Query  626  SQNPGVITIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQFWYNNS  769
            SQNPGVITIANAVFGS+PPI+P VLTKAFQVG +VI  LQ Q  ++ S
Sbjct  180  SQNPGVITIANAVFGSDPPISPDVLTKAFQVGNDVIKKLQVQLIFDTS  227


 Score =   305 bits (782),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 169/258 (66%), Positives = 189/258 (73%), Gaps = 12/258 (5%)
 Frame = +2

Query  14   PCIP*TQTKKLFYNSDTL----TQNIFD------MAIRFIVFTITVVALSSSFAHASDPS  163
            P  P   TK     +D +     Q IFD      MA+R I     ++AL  +  HASDPS
Sbjct  198  PISPDVLTKAFQVGNDVIKKLQVQLIFDTSFVITMAVR-IHIAAAILALVFTVVHASDPS  256

Query  164  PLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFFFRGLNMPGNTSNPLGSKVTPVNVNN  343
            PLQDFCVAV D+ A VFVNGKICK+P  V   DFFF GLN PG+T+NPLGS VT VNVN 
Sbjct  257  PLQDFCVAVPDANAGVFVNGKICKDPKLVKPEDFFFPGLNKPGSTANPLGSNVTAVNVNQ  316

Query  344  LPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLYVGFVLSNPPPGMKNPLFT  523
            +PGLNTLG+SL RIDFAP GLNPPH HPRATEVL VLEGTL VGFV SNP   MKN LFT
Sbjct  317  IPGLNTLGVSLARIDFAPYGLNPPHIHPRATEVLFVLEGTLVVGFVTSNPGMNMKNKLFT  376

Query  524  KTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSSQNPGVITIANAVFGSNPPINPQVLT  703
            K L  GDVFVFP+GLIHFQFN G +NA+AFAGL SQNPGVITIANAVFGS+PPI+P VLT
Sbjct  377  KVLNPGDVFVFPQGLIHFQFNQGHSNAVAFAGLGSQNPGVITIANAVFGSDPPISPDVLT  436

Query  704  KAFQVGQNVI-NYLQAQF  754
            KAFQVG +V+    + QF
Sbjct  437  KAFQVGNDVLPKKFEIQF  454



>ref|XP_003633723.2| PREDICTED: putative germin-like protein 2-1 [Vitis vinifera]
Length=226

 Score =   308 bits (790),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 156/223 (70%), Positives = 176/223 (79%), Gaps = 7/223 (3%)
 Frame = +2

Query  95   RFIVFTITVVALSS-SF--AHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDF  265
            + +V T+  +ALS+ SF  A ASDPSPLQDFCVAVND+   VFVNGK+CK+P    ANDF
Sbjct  8    KMVVNTLACIALSAMSFFLASASDPSPLQDFCVAVNDTKTTVFVNGKVCKDPKVATANDF  67

Query  266  FFRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVL  445
            FF GL +PGNTSN +GS VTP NV  +PGLNTLGISL R+D+AP GLNPPHTHPRATE+L
Sbjct  68   FFSGLRVPGNTSNKVGSMVTPANVAQIPGLNTLGISLARVDYAPYGLNPPHTHPRATEIL  127

Query  446  LVLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLS  625
             VLEGTLYVGFV SNP     N L  K L  GDVFVFPEGLIHFQ NVGKT A+A A LS
Sbjct  128  TVLEGTLYVGFVTSNP----DNRLICKVLYKGDVFVFPEGLIHFQLNVGKTKAVAIAALS  183

Query  626  SQNPGVITIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQF  754
            SQNPGVITIANAVFGS P I+  VLTKAFQV + V++YLQ+QF
Sbjct  184  SQNPGVITIANAVFGSKPAISADVLTKAFQVDKKVVDYLQSQF  226



>emb|CDP10693.1| unnamed protein product [Coffea canephora]
Length=219

 Score =   308 bits (789),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 162/218 (74%), Positives = 177/218 (81%), Gaps = 6/218 (3%)
 Frame = +2

Query  122  VALSSSFAHASDPSPLQDFCVAVNDSMAA------VFVNGKICKNPMQVVANDFFFRGLN  283
            +AL SS A ASDPSPLQDFCVA+ND   A      VFVNGKICK+P  V ANDFFF+GLN
Sbjct  1    MALLSSLAIASDPSPLQDFCVAINDPKTAASFFNAVFVNGKICKDPKVVNANDFFFQGLN  60

Query  284  MPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGT  463
            +P +T+N  GS VT VNVNNL GLNTLG+SL R+DFAP GLNPPHTHPRATEVL VLEGT
Sbjct  61   IPRSTANRQGSNVTAVNVNNLAGLNTLGVSLARLDFAPYGLNPPHTHPRATEVLFVLEGT  120

Query  464  LYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSSQNPGV  643
            L VGFV SNPP  MKN LFTKTL  GDVFVFPEGLIHFQFNVGKTNA+AFAG  SQNPGV
Sbjct  121  LNVGFVTSNPPNNMKNQLFTKTLNPGDVFVFPEGLIHFQFNVGKTNAVAFAGFGSQNPGV  180

Query  644  ITIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQFW  757
            ITIANAVFGS+P I+  VL KAFQV + VI+ L+AQF 
Sbjct  181  ITIANAVFGSDPLISADVLAKAFQVDKKVIDLLEAQFL  218



>ref|XP_008237387.1| PREDICTED: germin-like protein subfamily 1 member 20 [Prunus 
mume]
Length=233

 Score =   308 bits (789),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 156/234 (67%), Positives = 177/234 (76%), Gaps = 10/234 (4%)
 Frame = +2

Query  89   AIRFIVFTITVVALSSSFAHASDPSPLQDFCVAVNDSMA-------AVFVNGKICKNPMQ  247
             + F++ T+ ++A ++  A ASDPSPLQDFCVA+ND+ +       AVFVNGK CK+P  
Sbjct  3    GVHFLISTLAILAFATFLASASDPSPLQDFCVAINDTKSPVILNGIAVFVNGKFCKDPKL  62

Query  248  VVANDFFFRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHP  427
              ANDFF  G  +P +T NP+GS VTP NV+ + GLNTLGISL RIDF PNGLNPPHTHP
Sbjct  63   ANANDFFLSGFQIPRSTQNPVGSTVTPANVDQIAGLNTLGISLARIDFGPNGLNPPHTHP  122

Query  428  RATEVLLVLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAI  607
            R TE+L+VLEGTLYVGFV SN   G  N LFTK L  GDVFVFP GLIHFQ NVG  NA+
Sbjct  123  RGTEILVVLEGTLYVGFVTSN---GDGNRLFTKVLNKGDVFVFPIGLIHFQLNVGHVNAV  179

Query  608  AFAGLSSQNPGVITIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQFWYNNS  769
            A A LSSQNPGVITIANAVFGS PPINP VL KAFQV   V+NYLQ QFWYNNS
Sbjct  180  ALAALSSQNPGVITIANAVFGSKPPINPDVLAKAFQVDNKVVNYLQKQFWYNNS  233



>ref|XP_008375054.1| PREDICTED: germin-like protein subfamily 1 member 13 [Malus domestica]
Length=226

 Score =   308 bits (788),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 154/205 (75%), Positives = 169/205 (82%), Gaps = 3/205 (1%)
 Frame = +2

Query  152  SDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFFFRGLNMPGNTSNPLGSKVTPV  331
            SDPSPLQDFCVA+N++  AVFVNGK CKNP    ANDFF   L  PGNTSNP+GS VT  
Sbjct  24   SDPSPLQDFCVAINNTDPAVFVNGKFCKNPKLASANDFFSDKLRNPGNTSNPIGSIVTAA  83

Query  332  NVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLYVGFVLSNPPPGMKN  511
            NV+++PGLNTLGIS  R+DFAPNGLNPPHTHPRATE+L+VLEG+LYVGFV SN   G  N
Sbjct  84   NVDDIPGLNTLGISFARVDFAPNGLNPPHTHPRATEILIVLEGSLYVGFVTSN---GDGN  140

Query  512  PLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSSQNPGVITIANAVFGSNPPINP  691
             LFTK L  GDVFVFP GLIHFQ NVGKTNA+A AGLSSQNPGVITIANAVFGSNPPINP
Sbjct  141  RLFTKVLYKGDVFVFPVGLIHFQLNVGKTNALAIAGLSSQNPGVITIANAVFGSNPPINP  200

Query  692  QVLTKAFQVGQNVINYLQAQFWYNN  766
             VL KAFQV +  ++YLQ QFWYNN
Sbjct  201  DVLAKAFQVDEKEVDYLQKQFWYNN  225



>ref|XP_003633711.2| PREDICTED: putative germin-like protein 2-1 [Vitis vinifera]
Length=221

 Score =   307 bits (786),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 152/214 (71%), Positives = 169/214 (79%), Gaps = 4/214 (2%)
 Frame = +2

Query  113  ITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFFFRGLNMPG  292
            I ++A+S   A ASDPSPLQDFCVAVND+   VFVNGK+CK+P    ANDFFF GL +PG
Sbjct  12   IALLAMSFFLASASDPSPLQDFCVAVNDTKTTVFVNGKVCKDPKVATANDFFFSGLRVPG  71

Query  293  NTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLYV  472
            NTSN LGS VTP NV  +PGLNTLGISL R+D+AP GLNPPHTHPRATE+L VLEGTLYV
Sbjct  72   NTSNKLGSMVTPANVAQIPGLNTLGISLARVDYAPYGLNPPHTHPRATEILTVLEGTLYV  131

Query  473  GFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSSQNPGVITI  652
            GFV SNP     N L  K L  GDVFVFPEGLIHF  NVGKT A+A A LSSQNPGVITI
Sbjct  132  GFVTSNP----DNRLIAKVLYKGDVFVFPEGLIHFHLNVGKTKAVAIAALSSQNPGVITI  187

Query  653  ANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQF  754
            ANAVFGS P I+  VLTKAFQV + V++YLQ+QF
Sbjct  188  ANAVFGSKPAISADVLTKAFQVDKKVVDYLQSQF  221



>ref|XP_008360941.1| PREDICTED: germin-like protein subfamily 1 member 17 [Malus domestica]
Length=228

 Score =   306 bits (785),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 153/205 (75%), Positives = 169/205 (82%), Gaps = 3/205 (1%)
 Frame = +2

Query  155  DPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFFFRGLNMPGNTSNPLGSKVTPVN  334
            DP PLQDFCVA+N++ +AVFVNGK CK+P    ANDFF   L  PGNTSNP+GS VT  N
Sbjct  27   DPDPLQDFCVAINNTDSAVFVNGKFCKDPKLASANDFFSDKLRYPGNTSNPVGSIVTAAN  86

Query  335  VNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLYVGFVLSNPPPGMKNP  514
            V+ +PGLNTLGIS  R+DFAPNGLNPPHTHPRATE+L+V+EG+LYVGFV SN   G  N 
Sbjct  87   VDVIPGLNTLGISFARVDFAPNGLNPPHTHPRATEILIVVEGSLYVGFVTSN---GDGNR  143

Query  515  LFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSSQNPGVITIANAVFGSNPPINPQ  694
            LFTK L  GDVFVFP GLIHFQ NVGKTNA+A AGLSSQNPGVITIANAVFGSNPPINP 
Sbjct  144  LFTKVLYKGDVFVFPIGLIHFQLNVGKTNALAIAGLSSQNPGVITIANAVFGSNPPINPD  203

Query  695  VLTKAFQVGQNVINYLQAQFWYNNS  769
            VL KAFQV  NV++YLQ QFWYNNS
Sbjct  204  VLAKAFQVDDNVVDYLQKQFWYNNS  228



>emb|CBI33611.3| unnamed protein product [Vitis vinifera]
Length=289

 Score =   308 bits (790),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 151/213 (71%), Positives = 170/213 (80%), Gaps = 4/213 (2%)
 Frame = +2

Query  113  ITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFFFRGLNMPG  292
            I ++A+S   A ASDPSPLQDFCVAVND+   VFVNGK+CK+P    ANDFFF GL +PG
Sbjct  70   IALLAMSFFLASASDPSPLQDFCVAVNDTKTTVFVNGKVCKDPKVATANDFFFSGLRVPG  129

Query  293  NTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLYV  472
            NTSN +GS VTP NV  +PGLNTLGISL R+D+AP GLNPPHTHPRATE+L VLEGTLYV
Sbjct  130  NTSNKVGSMVTPANVAQIPGLNTLGISLARVDYAPYGLNPPHTHPRATEILTVLEGTLYV  189

Query  473  GFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSSQNPGVITI  652
            GFV SNP     N L +K L  GDVFVFPEGLIHFQ NVGKT A+A A LSSQNPGVITI
Sbjct  190  GFVTSNP----DNRLISKVLYKGDVFVFPEGLIHFQLNVGKTKAVAIAALSSQNPGVITI  245

Query  653  ANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQ  751
            ANAVFGS P I+  VLTKAFQV + V++YLQ+Q
Sbjct  246  ANAVFGSKPAISADVLTKAFQVDKKVVDYLQSQ  278



>ref|XP_007030284.1| RmlC-like cupins superfamily protein [Theobroma cacao]
 gb|EOY10786.1| RmlC-like cupins superfamily protein [Theobroma cacao]
Length=226

 Score =   306 bits (783),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 152/216 (70%), Positives = 176/216 (81%), Gaps = 5/216 (2%)
 Frame = +2

Query  122  VALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFFFRGLNMPGNTS  301
            +A + S A ASDPSPLQDFCVA+ND+   VFVNGK C++P    A DFF+ GLN+P NTS
Sbjct  14   LAFAWSLASASDPSPLQDFCVAINDTKDGVFVNGKFCQDPKLAKAEDFFYSGLNIPRNTS  73

Query  302  NPLGSKVTPVNVNNLPGLNTLGISLVRIDFAP-NGLNPPHTHPRATEVLLVLEGTLYVGF  478
            NPLGS VT VNV  + GLNTLGISL RID+AP  GLNPPHTHPRA+E+L+VLEGTLYVGF
Sbjct  74   NPLGSTVTQVNVAQILGLNTLGISLARIDYAPYGGLNPPHTHPRASEILVVLEGTLYVGF  133

Query  479  VLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSSQNPGVITIAN  658
            V SNP    +N L TK L  GDVFVFP GLIHFQ N+GKTNA+AFAGLSSQNPGVITIA 
Sbjct  134  VTSNP----ENRLITKVLYPGDVFVFPVGLIHFQLNIGKTNAVAFAGLSSQNPGVITIAK  189

Query  659  AVFGSNPPINPQVLTKAFQVGQNVINYLQAQFWYNN  766
            AVFGSNPPINP VLTKAFQ+ +N++  LQ++FW++N
Sbjct  190  AVFGSNPPINPDVLTKAFQLDKNIVTSLQSRFWWDN  225



>gb|KCW80409.1| hypothetical protein EUGRSUZ_C01766 [Eucalyptus grandis]
Length=221

 Score =   305 bits (782),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 150/225 (67%), Positives = 179/225 (80%), Gaps = 5/225 (2%)
 Frame = +2

Query  92   IRFIVFTITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFFF  271
            ++F+  ++ ++AL+++ + A DPSPLQDFCVA+ND    VFVNGK CK+P QV A+DF F
Sbjct  1    MKFLPISLLILALATATSFAYDPSPLQDFCVAINDP--KVFVNGKFCKDPKQVTADDFLF  58

Query  272  RGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLV  451
            +G   PGNT NPLGSKVTP  V+ LPGLNTLGIS+ RIDFAP GLNPPHTHPR +E+L+V
Sbjct  59   KGFRYPGNTVNPLGSKVTPAFVDQLPGLNTLGISMARIDFAPGGLNPPHTHPRGSEILVV  118

Query  452  LEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSSQ  631
             EGTL VGFV SN    + N  FTK L  GDVFVFP GLIHFQ N+GKT A+AFA LSSQ
Sbjct  119  AEGTLLVGFVTSN---QLNNTFFTKVLYKGDVFVFPIGLIHFQLNIGKTPALAFAALSSQ  175

Query  632  NPGVITIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQFWYNN  766
            NPGVITIAN+VFGS PPI+  VLTKAFQV + V++YLQAQFWY+N
Sbjct  176  NPGVITIANSVFGSKPPISADVLTKAFQVDKKVVDYLQAQFWYDN  220



>gb|KCW61445.1| hypothetical protein EUGRSUZ_H04176 [Eucalyptus grandis]
Length=223

 Score =   305 bits (781),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 150/219 (68%), Positives = 174/219 (79%), Gaps = 3/219 (1%)
 Frame = +2

Query  110  TITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFFFRGLNMP  289
            ++ ++AL+++ A A DPSPLQD CVA+ND  +AVFVNG+ CK+P Q  A+DF F G+  P
Sbjct  7    SLLILALATTTAFAYDPSPLQDICVAINDPKSAVFVNGEFCKDPKQANADDFTFMGVRKP  66

Query  290  GNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLY  469
            GNT+NPLGSKVTP  VN  PGLNTLGIS  RIDFAP GLNPPHTHPR TEVL+V+EGTL 
Sbjct  67   GNTANPLGSKVTPATVNEFPGLNTLGISAARIDFAPGGLNPPHTHPRGTEVLVVIEGTLL  126

Query  470  VGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSSQNPGVIT  649
            VGFV SN    + N LFTK L  GDVFVFP GLIHFQ N GKT A+AFAGLSSQNPGVIT
Sbjct  127  VGFVTSN---QLNNTLFTKVLYKGDVFVFPIGLIHFQLNTGKTPALAFAGLSSQNPGVIT  183

Query  650  IANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQFWYNN  766
            IAN+VFG+ PPI+   LTKAFQV +  I+YLQAQFWY+N
Sbjct  184  IANSVFGAKPPISADALTKAFQVDKKTIDYLQAQFWYDN  222



>ref|XP_007030281.1| RmlC-like cupins superfamily protein isoform 2 [Theobroma cacao]
 gb|EOY10783.1| RmlC-like cupins superfamily protein isoform 2 [Theobroma cacao]
Length=226

 Score =   305 bits (780),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 151/216 (70%), Positives = 175/216 (81%), Gaps = 5/216 (2%)
 Frame = +2

Query  122  VALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFFFRGLNMPGNTS  301
            +A + S A ASDP PLQDFCVA+ND+   VFVNGK CK+P    A DFF+ GLN+P NTS
Sbjct  14   LAFAWSLASASDPDPLQDFCVAINDTKDGVFVNGKFCKDPKLAKAEDFFYSGLNIPRNTS  73

Query  302  NPLGSKVTPVNVNNLPGLNTLGISLVRIDFAP-NGLNPPHTHPRATEVLLVLEGTLYVGF  478
            NP+GS VT VNV  + GLNTLGISL RID+AP  GLNPPHTHPRA+E+L+VLEGTLYVGF
Sbjct  74   NPVGSTVTQVNVAQILGLNTLGISLARIDYAPYGGLNPPHTHPRASEILVVLEGTLYVGF  133

Query  479  VLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSSQNPGVITIAN  658
            V SNP    +N L TK L  GDVFVFP GLIHFQ N+GKTNA+AFAGLSSQNPGVITIA 
Sbjct  134  VTSNP----ENRLITKVLYPGDVFVFPVGLIHFQLNIGKTNAVAFAGLSSQNPGVITIAK  189

Query  659  AVFGSNPPINPQVLTKAFQVGQNVINYLQAQFWYNN  766
            AVFGSNPPINP VLTKAFQ+ +N++  LQ++FW++N
Sbjct  190  AVFGSNPPINPDVLTKAFQLDKNIVTSLQSRFWWDN  225



>ref|XP_007030280.1| RmlC-like cupins superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY10782.1| RmlC-like cupins superfamily protein isoform 1 [Theobroma cacao]
Length=226

 Score =   304 bits (779),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 151/216 (70%), Positives = 175/216 (81%), Gaps = 5/216 (2%)
 Frame = +2

Query  122  VALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFFFRGLNMPGNTS  301
            +A + S A ASDP PLQDFCVA+ND+   VFVNGK CK+P    A DFF+ GLN+P NTS
Sbjct  14   LAFAWSLASASDPDPLQDFCVAINDTKDGVFVNGKFCKDPKLAKAEDFFYSGLNIPRNTS  73

Query  302  NPLGSKVTPVNVNNLPGLNTLGISLVRIDFAP-NGLNPPHTHPRATEVLLVLEGTLYVGF  478
            NP+GS VT VNV  + GLNTLGISL RID+AP  GLNPPHTHPRA+E+L+VLEGTLYVGF
Sbjct  74   NPVGSTVTQVNVAQILGLNTLGISLARIDYAPYGGLNPPHTHPRASEILVVLEGTLYVGF  133

Query  479  VLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSSQNPGVITIAN  658
            V SNP    +N L TK L  GDVFVFP GLIHFQ N+GKTNA+AFAGLSSQNPGVITIA 
Sbjct  134  VTSNP----ENRLITKVLYPGDVFVFPVGLIHFQLNIGKTNAVAFAGLSSQNPGVITIAK  189

Query  659  AVFGSNPPINPQVLTKAFQVGQNVINYLQAQFWYNN  766
            AVFGSNPPINP VLTKAFQ+ +N++  LQ++FW++N
Sbjct  190  AVFGSNPPINPDVLTKAFQLDKNIVTSLQSRFWWDN  225



>ref|XP_002265857.1| PREDICTED: putative germin-like protein 2-1 [Vitis vinifera]
Length=221

 Score =   304 bits (778),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 151/215 (70%), Positives = 171/215 (80%), Gaps = 4/215 (2%)
 Frame = +2

Query  110  TITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFFFRGLNMP  289
            +I ++A+S   A ASDPSPLQDFCVAVND+   VFVNGK+CK+P     NDFFF GL +P
Sbjct  11   SIPLLAMSFFLAFASDPSPLQDFCVAVNDTKTTVFVNGKVCKDPKVATPNDFFFSGLRVP  70

Query  290  GNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLY  469
            GNTSN +GS VTP NV  +PGLNTLGISL R+D+AP GLNPPHTHPRATE+L VLEGTLY
Sbjct  71   GNTSNKVGSMVTPANVAQIPGLNTLGISLARVDYAPYGLNPPHTHPRATEILTVLEGTLY  130

Query  470  VGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSSQNPGVIT  649
            VGFV SNP     N L +K L  GDVFVFPEGLIHFQ NVGKT A+A A LSSQNPGVIT
Sbjct  131  VGFVTSNP----DNRLISKVLYKGDVFVFPEGLIHFQLNVGKTKAVAIAALSSQNPGVIT  186

Query  650  IANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQF  754
            IANAVFGS P I+  VLTKAFQV + V++YLQ+QF
Sbjct  187  IANAVFGSKPAISADVLTKAFQVDKKVVDYLQSQF  221



>ref|XP_010027139.1| PREDICTED: germin-like protein subfamily 1 member 7 [Eucalyptus 
grandis]
Length=221

 Score =   304 bits (778),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 149/225 (66%), Positives = 177/225 (79%), Gaps = 5/225 (2%)
 Frame = +2

Query  92   IRFIVFTITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFFF  271
            ++F+  ++ ++AL+++  +A DPSPLQDFCVA+ND    VFVNGK CK+P QV A+DF F
Sbjct  1    MKFLPISLLILALATATTYAYDPSPLQDFCVAINDP--KVFVNGKFCKDPKQVTADDFLF  58

Query  272  RGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLV  451
            +G   PGNT NPLGSKVTP  V+   GLNTLGIS+ RIDFAP GLNPPHTHPR TE+L+V
Sbjct  59   KGFRYPGNTVNPLGSKVTPAFVDQFAGLNTLGISMARIDFAPGGLNPPHTHPRGTEILVV  118

Query  452  LEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSSQ  631
             EGTL VGFV SN    + N  FTK L  GDVFVFP GLIHFQ N+GKT A+AFA LSSQ
Sbjct  119  TEGTLLVGFVTSN---QLNNTFFTKVLYKGDVFVFPIGLIHFQLNIGKTPALAFAALSSQ  175

Query  632  NPGVITIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQFWYNN  766
            NPG+ITIANAVFGS PPI+  VLTKAFQV + V++YLQAQFWY+N
Sbjct  176  NPGLITIANAVFGSKPPISADVLTKAFQVDKKVVDYLQAQFWYDN  220



>ref|XP_007201630.1| hypothetical protein PRUPE_ppa020060mg [Prunus persica]
 gb|EMJ02829.1| hypothetical protein PRUPE_ppa020060mg [Prunus persica]
Length=233

 Score =   304 bits (778),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 153/233 (66%), Positives = 177/233 (76%), Gaps = 10/233 (4%)
 Frame = +2

Query  92   IRFIVFTITVVALSSSFAHASDPSPLQDFCVAVNDSMA-------AVFVNGKICKNPMQV  250
            + F++ T+ ++A ++  A ASDPSPLQDFCVA+ND+ +       AVFVNGK CK+P   
Sbjct  4    VLFLISTLAILAFATFLASASDPSPLQDFCVAINDTKSPVILNGIAVFVNGKFCKDPKLA  63

Query  251  VANDFFFRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPR  430
             ANDFF  G  +P +T NP+GS VTP +V+ + GLNTLGISL RIDF PNGLNPPHTHPR
Sbjct  64   NANDFFLSGFQIPRSTQNPVGSTVTPASVDQIAGLNTLGISLARIDFGPNGLNPPHTHPR  123

Query  431  ATEVLLVLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIA  610
             TE+L+V+EGTLYVGFV SN   G  N LFTK L  GDVFVFP GLIHFQ NVG  NA+A
Sbjct  124  GTEILVVVEGTLYVGFVTSN---GDGNRLFTKVLNKGDVFVFPIGLIHFQLNVGHVNAVA  180

Query  611  FAGLSSQNPGVITIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQFWYNNS  769
             A LSSQNPGVITIANAVFGS PPINP VL KAFQV   V++YLQ QFWYNNS
Sbjct  181  LAALSSQNPGVITIANAVFGSKPPINPDVLAKAFQVDNKVVDYLQKQFWYNNS  233



>ref|XP_007030278.1| Germin-like protein subfamily 1 member 18 [Theobroma cacao]
 gb|EOY10780.1| Germin-like protein subfamily 1 member 18 [Theobroma cacao]
Length=476

 Score =   312 bits (799),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 154/206 (75%), Positives = 172/206 (83%), Gaps = 5/206 (2%)
 Frame = +2

Query  155  DPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFFFRGLNMPGNTSNPLGSKVTPVN  334
            DPSPLQDFCVA+ND+  AVFVNGK CK+PM   A DFFF GLN+PGNTSN LGSKVTPVN
Sbjct  275  DPSPLQDFCVALNDTKNAVFVNGKFCKDPMLAKAEDFFFSGLNVPGNTSNQLGSKVTPVN  334

Query  335  VNNLPGLNTLGISLVRIDFAP-NGLNPPHTHPRATEVLLVLEGTLYVGFVLSNPPPGMKN  511
            V  +PGLNTLG+SL R+DFAP  GLNPPHTHPRATE+L+VLEGTLYVGFV SNP     N
Sbjct  335  VEQIPGLNTLGVSLARVDFAPYGGLNPPHTHPRATEILVVLEGTLYVGFVTSNP----DN  390

Query  512  PLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSSQNPGVITIANAVFGSNPPINP  691
             L TK L  GDVFVFP GLIHFQ N+GKTNA+AFA   SQNPGVITIA AVFGSNPPINP
Sbjct  391  RLITKVLYPGDVFVFPVGLIHFQLNIGKTNAVAFAAFGSQNPGVITIAKAVFGSNPPINP  450

Query  692  QVLTKAFQVGQNVINYLQAQFWYNNS  769
             VLTKAFQ+ +NV+ YLQ+QFW++N+
Sbjct  451  DVLTKAFQLDKNVVKYLQSQFWWDNN  476


 Score =   291 bits (744),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 147/212 (69%), Positives = 170/212 (80%), Gaps = 5/212 (2%)
 Frame = +2

Query  122  VALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFFFRGLNMPGNTS  301
            +A + S A ASDP PLQDFCVA+ND+   VFVNGK C++P    A DFF+ GLN+P NTS
Sbjct  14   LAFAWSLASASDPDPLQDFCVAINDTKDGVFVNGKFCQDPKLAKAEDFFYSGLNIPRNTS  73

Query  302  NPLGSKVTPVNVNNLPGLNTLGISLVRIDFAP-NGLNPPHTHPRATEVLLVLEGTLYVGF  478
            NP+GS VT VNV  + GLNTLGISL RID+AP  GLNPPHTHPRA+E+L+VLEGTLYVGF
Sbjct  74   NPVGSTVTQVNVAQILGLNTLGISLARIDYAPYGGLNPPHTHPRASEILVVLEGTLYVGF  133

Query  479  VLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSSQNPGVITIAN  658
            V SNP    +N L TK L  GDVFVFP GLIHFQ N+GKTNA+AFAGLSSQNPGVITIA 
Sbjct  134  VTSNP----ENRLITKVLYPGDVFVFPVGLIHFQLNIGKTNAVAFAGLSSQNPGVITIAK  189

Query  659  AVFGSNPPINPQVLTKAFQVGQNVINYLQAQF  754
            AVFGSNPPINP VLTKAFQ+ +N++  LQ++ 
Sbjct  190  AVFGSNPPINPDVLTKAFQLDKNIVTSLQSRL  221



>gb|KCW61438.1| hypothetical protein EUGRSUZ_H04168 [Eucalyptus grandis]
Length=221

 Score =   303 bits (775),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 149/225 (66%), Positives = 178/225 (79%), Gaps = 5/225 (2%)
 Frame = +2

Query  92   IRFIVFTITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFFF  271
            ++F+  ++ ++AL+++ + A DPSPLQDFCVA+ND    VFVNGK CK+P QV A+DF F
Sbjct  1    MKFLPISLLILALATATSFAYDPSPLQDFCVAINDP--KVFVNGKFCKDPKQVTADDFLF  58

Query  272  RGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLV  451
            +G   PGNT NPLGSKVTP  V+ LPGLNTLGIS+ RIDFAP GLNPPHTHPR +E+L+V
Sbjct  59   KGFRYPGNTVNPLGSKVTPAFVDQLPGLNTLGISMARIDFAPGGLNPPHTHPRGSEILVV  118

Query  452  LEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSSQ  631
             EGTL VGFV  N    + N  FTK L  GDVFVFP GLIHFQ N+GKT A+AFA LSSQ
Sbjct  119  AEGTLLVGFVTFN---QLNNTFFTKVLYKGDVFVFPIGLIHFQLNIGKTPALAFAALSSQ  175

Query  632  NPGVITIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQFWYNN  766
            NPGVITIAN+VFGS PPI+  VLTKAFQV + V++YLQAQFWY+N
Sbjct  176  NPGVITIANSVFGSKPPISADVLTKAFQVDKKVVDYLQAQFWYDN  220



>emb|CAN72994.1| hypothetical protein VITISV_000563 [Vitis vinifera]
Length=205

 Score =   302 bits (773),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 149/205 (73%), Positives = 163/205 (80%), Gaps = 4/205 (2%)
 Frame = +2

Query  140  FAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFFFRGLNMPGNTSNPLGSK  319
             A ASDPSPLQDFCVAVND+   VFVNGK+CK+P    ANDFFF GL +PGNTSN LGS 
Sbjct  5    LASASDPSPLQDFCVAVNDTKTTVFVNGKVCKDPKVATANDFFFSGLRVPGNTSNKLGSM  64

Query  320  VTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLYVGFVLSNPPP  499
            VTP NV  +PGLNTLGISL R+D+AP GLNPPHTHPRATE+L VLEGTLYVGFV SNP  
Sbjct  65   VTPANVAQIPGLNTLGISLARVDYAPYGLNPPHTHPRATEILTVLEGTLYVGFVTSNP--  122

Query  500  GMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSSQNPGVITIANAVFGSNP  679
               N L  K L  GDVFVFPEGLIHF  NVGKT A+A A LSSQNPGVITIANAVFGS P
Sbjct  123  --DNRLIAKVLYKGDVFVFPEGLIHFHLNVGKTKAVAIAALSSQNPGVITIANAVFGSKP  180

Query  680  PINPQVLTKAFQVGQNVINYLQAQF  754
             I+  VLTKAFQV + V++YLQ+QF
Sbjct  181  AISADVLTKAFQVDKKVVDYLQSQF  205



>ref|XP_010251866.1| PREDICTED: putative germin-like protein 2-1 [Nelumbo nucifera]
Length=222

 Score =   303 bits (775),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 151/210 (72%), Positives = 169/210 (80%), Gaps = 4/210 (2%)
 Frame = +2

Query  137  SFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFFFRGLNMPGNTSNPLGS  316
            S A ASDPSPLQDFCVA+ D+ + VFVNGK CKNP    A+DFFF GL+ PGNTSN +GS
Sbjct  16   SQALASDPSPLQDFCVAIKDTDSRVFVNGKFCKNPYYTTADDFFFSGLDKPGNTSNSVGS  75

Query  317  KVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLYVGFVLSNPP  496
            KVTPVNV  LPGLNTLGIS+ RID+AP GLNP H HPRAT+VL+VLEGTLYV FV SN  
Sbjct  76   KVTPVNVMQLPGLNTLGISMARIDYAPYGLNPLHMHPRATKVLVVLEGTLYVSFVTSN--  133

Query  497  PGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSSQNPGVITIANAVFGSN  676
              + N LFTK L  GDVFVFP+GLIHFQFNVG TNA+AFAGLSSQNPG ITIANAVF + 
Sbjct  134  --LDNRLFTKVLNKGDVFVFPKGLIHFQFNVGHTNAVAFAGLSSQNPGTITIANAVFEAK  191

Query  677  PPINPQVLTKAFQVGQNVINYLQAQFWYNN  766
            PPI   VL KAFQV + V++YLQAQFW +N
Sbjct  192  PPIKNDVLAKAFQVDKKVVDYLQAQFWMDN  221



>ref|XP_007143990.1| hypothetical protein PHAVU_007G119700g [Phaseolus vulgaris]
 gb|ESW15984.1| hypothetical protein PHAVU_007G119700g [Phaseolus vulgaris]
Length=228

 Score =   303 bits (775),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 156/230 (68%), Positives = 181/230 (79%), Gaps = 8/230 (3%)
 Frame = +2

Query  92   IRFIVFTITVVALSSSFAHASDPSPLQDFCVAVNDS----MAAVFVNGKICKNPMQVVAN  259
            ++ + F + ++AL+SS A A DPSPLQDFCVA+ND+    +  VFVNGK CK+P    A+
Sbjct  1    MKVVQFLVVLLALASSVAFAYDPSPLQDFCVAINDTKTGGIYGVFVNGKFCKDPKFANAD  60

Query  260  DFFFRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATE  439
            DFFFRGL   G+T+NP+GSKVTPV VN + GLNTLGISL RIDFAP GLNPPHTHPR TE
Sbjct  61   DFFFRGLGA-GDTANPVGSKVTPVAVNEILGLNTLGISLARIDFAPKGLNPPHTHPRGTE  119

Query  440  VLLVLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAG  619
            +L+VLEGTLYVGFV SN      N LFTK L  GDVFVFP GLIHFQ NVG  NA+A AG
Sbjct  120  ILVVLEGTLYVGFVASNQ---NDNRLFTKVLNKGDVFVFPIGLIHFQQNVGYGNAVAIAG  176

Query  620  LSSQNPGVITIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQFWYNNS  769
            LSSQNPGVITIANAVFGS PPI+ ++L KAFQV +N I+YLQ QFWYNN+
Sbjct  177  LSSQNPGVITIANAVFGSKPPISDEILAKAFQVDKNTIDYLQKQFWYNNN  226



>ref|XP_010024920.1| PREDICTED: germin-like protein subfamily 1 member 13 [Eucalyptus 
grandis]
 gb|KCW61459.1| hypothetical protein EUGRSUZ_H04195 [Eucalyptus grandis]
Length=223

 Score =   302 bits (774),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 149/225 (66%), Positives = 176/225 (78%), Gaps = 3/225 (1%)
 Frame = +2

Query  92   IRFIVFTITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFFF  271
            ++F+  ++ ++AL ++ A A DPSPLQD CVA+ND  +AVFVNG+ CK+P Q  A+DF F
Sbjct  1    MKFLPISLLILALVAATAFAYDPSPLQDICVAINDPKSAVFVNGEFCKDPKQANADDFTF  60

Query  272  RGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLV  451
             G   PGNT+NPLGSKVTP  V   PGLNTLGIS+ RIDFAP+GLNPPH HPR TEVL+V
Sbjct  61   MGFRKPGNTANPLGSKVTPATVMEFPGLNTLGISMARIDFAPSGLNPPHIHPRGTEVLVV  120

Query  452  LEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSSQ  631
            +EGTL VGFV SN    + N LFTK L  GDVFVFP GLIHFQ N GKT A+AFA LSSQ
Sbjct  121  IEGTLLVGFVTSN---QLNNTLFTKVLYKGDVFVFPIGLIHFQLNTGKTPALAFAALSSQ  177

Query  632  NPGVITIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQFWYNN  766
            NPGVITIAN+VFG+ PPI+  VLTKAFQV +  I+YLQAQFWY+N
Sbjct  178  NPGVITIANSVFGAKPPISVDVLTKAFQVDKKTIDYLQAQFWYDN  222



>ref|XP_002281186.2| PREDICTED: uncharacterized protein LOC100244552 [Vitis vinifera]
Length=478

 Score =   311 bits (797),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 153/214 (71%), Positives = 171/214 (80%), Gaps = 4/214 (2%)
 Frame = +2

Query  113  ITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFFFRGLNMPG  292
            I ++A+S   A ASDPSPLQDFCVAVND+   VFVNGK+CK+P    ANDFFF GL +PG
Sbjct  269  IALLAMSFFLASASDPSPLQDFCVAVNDTKTTVFVNGKVCKDPKVATANDFFFSGLRVPG  328

Query  293  NTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLYV  472
            NTSN LGS VTP NV  +PGLNTLGISL R+D+AP GLNPPHTHPRATE+L VLEGTLYV
Sbjct  329  NTSNKLGSMVTPANVAQIPGLNTLGISLARVDYAPYGLNPPHTHPRATEILTVLEGTLYV  388

Query  473  GFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSSQNPGVITI  652
            GFV SNP     N L +K L  GDVFVFPEGLIHFQ NVGKT A+A A LSSQNPGVITI
Sbjct  389  GFVTSNP----DNRLISKVLYKGDVFVFPEGLIHFQLNVGKTKAVAIAALSSQNPGVITI  444

Query  653  ANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQF  754
            ANAVFGS P I+  VLTKAFQV + V++YLQ+QF
Sbjct  445  ANAVFGSKPAISADVLTKAFQVDKKVVDYLQSQF  478


 Score =   276 bits (707),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 137/209 (66%), Positives = 157/209 (75%), Gaps = 4/209 (2%)
 Frame = +2

Query  140  FAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFFFRGLNMPGNTSNPLGSK  319
             A  SDPSPLQ+FCVAVND+   VFVNGK+CK+     AND FF  L + G+TSN L S 
Sbjct  5    LASVSDPSPLQEFCVAVNDTKTTVFVNGKVCKDLKVATANDLFFSRLQVLGHTSNKLESM  64

Query  320  VTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLYVGFVLSNPPP  499
            VT  NV  +P LNTLGISL R+D+AP GLNPPHT+PRATE+L VLEGTLYVGFV SNP  
Sbjct  65   VTQANVAQIPELNTLGISLARVDYAPYGLNPPHTYPRATEILTVLEGTLYVGFVTSNP--  122

Query  500  GMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSSQNPGVITIANAVFGSNP  679
               N L +K L  GDVF+F EGLIHFQ NV KT A+A A LSSQN GVITIANAVFGS P
Sbjct  123  --DNRLISKVLYKGDVFIFLEGLIHFQLNVRKTKAVAIAALSSQNLGVITIANAVFGSKP  180

Query  680  PINPQVLTKAFQVGQNVINYLQAQFWYNN  766
             I+  VLTKAFQV + V++YLQ+QFW +N
Sbjct  181  AISADVLTKAFQVDKKVVDYLQSQFWTDN  209



>ref|XP_007030289.1| RmlC-like cupins superfamily protein [Theobroma cacao]
 gb|EOY10791.1| RmlC-like cupins superfamily protein [Theobroma cacao]
Length=221

 Score =   302 bits (773),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 153/219 (70%), Positives = 175/219 (80%), Gaps = 7/219 (3%)
 Frame = +2

Query  101  IVFTITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFFFRGL  280
            +VF +  +A S   A ASDPS LQDFCVA+ND+  A+FVNGK CK+P    A+DFFF GL
Sbjct  9    VVFALLTLAFS--LASASDPSSLQDFCVALNDTKHAIFVNGKFCKDPKLATADDFFFSGL  66

Query  281  NMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAP-NGLNPPHTHPRATEVLLVLE  457
            +  GNTSN +GS+VTPVNV+ +PGLNTLGISL RID+AP  GLNPPHTHPRATE+L V +
Sbjct  67   DKAGNTSNAVGSRVTPVNVDQIPGLNTLGISLARIDYAPYGGLNPPHTHPRATEILAVKK  126

Query  458  GTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSSQNP  637
            GTLYVGFV SNP     N  FTK L  GDVFVFP GLIHFQFN+GKTNAIAFAGLSSQNP
Sbjct  127  GTLYVGFVTSNP----DNKFFTKILKTGDVFVFPVGLIHFQFNIGKTNAIAFAGLSSQNP  182

Query  638  GVITIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQF  754
            GVITIANAVFGSNPPINP VL KAF++ + V+ +LQ QF
Sbjct  183  GVITIANAVFGSNPPINPDVLAKAFKLDKKVVEFLQTQF  221



>ref|XP_002270404.2| PREDICTED: putative germin-like protein 2-1 [Vitis vinifera]
Length=221

 Score =   302 bits (773),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 149/214 (70%), Positives = 170/214 (79%), Gaps = 4/214 (2%)
 Frame = +2

Query  113  ITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFFFRGLNMPG  292
            + ++A++ SFA ASDPSPLQDFCVAVND+   VFVNGK C++P     NDFFF GL +PG
Sbjct  12   VVLLAMAFSFASASDPSPLQDFCVAVNDTNDTVFVNGKFCRDPKLATPNDFFFSGLRLPG  71

Query  293  NTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLYV  472
            NTSN LGS VTP NV  +PGLNTLGISL R+D+AP GLNPPH HPRATE+L VLEGTLYV
Sbjct  72   NTSNKLGSMVTPANVAQIPGLNTLGISLARVDYAPYGLNPPHIHPRATEILTVLEGTLYV  131

Query  473  GFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSSQNPGVITI  652
            GFV SNP    +N L +K L  GDVFVFP+GLIHFQ NVG TNA+A A LSSQNPGVITI
Sbjct  132  GFVTSNP----ENRLISKVLYKGDVFVFPQGLIHFQLNVGTTNAVAIASLSSQNPGVITI  187

Query  653  ANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQF  754
            A AVFGS P I+  VLTKAFQV +NV+ YLQ+QF
Sbjct  188  AKAVFGSKPAISADVLTKAFQVEKNVVEYLQSQF  221



>ref|XP_006845051.1| hypothetical protein AMTR_s00794p00001640 [Amborella trichopoda]
 gb|ERN06726.1| hypothetical protein AMTR_s00794p00001640 [Amborella trichopoda]
Length=220

 Score =   302 bits (773),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 154/220 (70%), Positives = 174/220 (79%), Gaps = 6/220 (3%)
 Frame = +2

Query  107  FTITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFFFRGLNM  286
              ++  AL +SFA ASDPSPLQDFCVA  D+ + VFVNGK+CK+P    ANDFFF GLN 
Sbjct  6    LVLSFFALVASFALASDPSPLQDFCVA--DNASKVFVNGKVCKDPKLAQANDFFFCGLNK  63

Query  287  PGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTL  466
            PGNT+NPLGS+VTPVNV  +PGLNTLGISLVRID+A  G NPPHTHPRATE+L VLEG+L
Sbjct  64   PGNTANPLGSRVTPVNVAQIPGLNTLGISLVRIDYARGGQNPPHTHPRATEILTVLEGSL  123

Query  467  YVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSSQNPGVI  646
            YVGFV SNP     N L TKT+  GDVFVFPEGLIHFQ NVG  NA+A A LSSQNPGVI
Sbjct  124  YVGFVTSNP----DNRLITKTIQKGDVFVFPEGLIHFQQNVGSKNAVAIAALSSQNPGVI  179

Query  647  TIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQFWYNN  766
            TIANAVFGS P I+  VL KAFQV + V+N LQ+QFW +N
Sbjct  180  TIANAVFGSKPAISNDVLAKAFQVDKKVVNRLQSQFWMDN  219



>ref|XP_002265297.3| PREDICTED: uncharacterized protein LOC100247931 [Vitis vinifera]
Length=490

 Score =   311 bits (797),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 159/240 (66%), Positives = 183/240 (76%), Gaps = 8/240 (3%)
 Frame = +2

Query  44   LFYNSDTLTQNIFDMAIRFIVFTITVVALSS-SF--AHASDPSPLQDFCVAVNDSMAAVF  214
            L    D L  +  +M  + +V T+  +ALS+ SF  A ASDPSPLQDFCVAVND+   VF
Sbjct  256  LSSKKDCLRMHCINMK-KMVVNTLACIALSAMSFFLASASDPSPLQDFCVAVNDTKTTVF  314

Query  215  VNGKICKNPMQVVANDFFFRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFA  394
            VNGK+CK+P    A+DFFF GL +PGNTSN +GS VTP NV  +PGLNTLGISL R+D+A
Sbjct  315  VNGKVCKDPKVATADDFFFSGLRVPGNTSNKVGSMVTPANVAQIPGLNTLGISLARVDYA  374

Query  395  PNGLNPPHTHPRATEVLLVLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIH  574
            P GLNPPHTHPRATE+L VLEGTLYVGFV SNP     N L  K L  GDVF+FPEGLIH
Sbjct  375  PYGLNPPHTHPRATEILTVLEGTLYVGFVTSNP----DNRLICKVLYKGDVFIFPEGLIH  430

Query  575  FQFNVGKTNAIAFAGLSSQNPGVITIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQF  754
            FQ NVGKT A+A A LSSQNPGVITIANAVFGS P I+  VLTKAFQV +NV++YLQ+QF
Sbjct  431  FQLNVGKTKAVAIAALSSQNPGVITIANAVFGSKPAISADVLTKAFQVDKNVVDYLQSQF  490


 Score =   308 bits (790),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 155/224 (69%), Positives = 174/224 (78%), Gaps = 7/224 (3%)
 Frame = +2

Query  113  ITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFFFRGLNMPG  292
            I ++A+S   A ASDPSPLQDFCVAVND+   VFVNGK+CK+P    ANDFFF GL +PG
Sbjct  12   IALLAMSFFLASASDPSPLQDFCVAVNDTKTTVFVNGKVCKDPKVATANDFFFSGLRVPG  71

Query  293  NTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLYV  472
            NTSN +GS VTP NV  +PGLNTLGISL R+D+AP GLNPPHTHPRATE+L VLEGTLYV
Sbjct  72   NTSNKVGSMVTPANVAQIPGLNTLGISLARVDYAPYGLNPPHTHPRATEILTVLEGTLYV  131

Query  473  GFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSSQNPGVITI  652
            GFV SNP     N L +K L  GDVFVFPEGLIHFQ NVGKT A+A A LSSQNPGVITI
Sbjct  132  GFVTSNP----DNRLISKVLYKGDVFVFPEGLIHFQLNVGKTKAVAIAALSSQNPGVITI  187

Query  653  ANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQFWYNNS*GIGR  784
            ANAVFGS P I+  VLTKAFQV + V++YLQ+QF      GI R
Sbjct  188  ANAVFGSKPAISADVLTKAFQVDKKVVDYLQSQFIAE---GINR  228



>ref|XP_009341765.1| PREDICTED: germin-like protein subfamily 1 member 17 [Pyrus x 
bretschneideri]
 ref|XP_009349818.1| PREDICTED: germin-like protein subfamily 1 member 17 [Pyrus x 
bretschneideri]
Length=230

 Score =   301 bits (772),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 152/219 (69%), Positives = 173/219 (79%), Gaps = 1/219 (0%)
 Frame = +2

Query  113  ITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFFFRGLNMPG  292
            ++V+A ++  A ASDP PLQDFCVA+N++  AVFVNGK CK+P    ANDFF   L   G
Sbjct  13   LSVLAFATLLASASDPDPLQDFCVAINNTDYAVFVNGKFCKDPNLASANDFFSDKLRYAG  72

Query  293  NTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLYV  472
            NTSNP+GS VT  NV+ +PGLNTLGIS  R+DFAPNG+NPPHTHPRATE+ +VLEG+LYV
Sbjct  73   NTSNPVGSIVTAANVDVIPGLNTLGISFARVDFAPNGVNPPHTHPRATEIFIVLEGSLYV  132

Query  473  GFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSSQNPGVITI  652
            GFV SN   G  N LFTK L  GDVFVFP GLIHFQ NVGKTNA+A A   SQNPGVITI
Sbjct  133  GFVTSN-INGDGNRLFTKVLNKGDVFVFPIGLIHFQLNVGKTNALAIAAFGSQNPGVITI  191

Query  653  ANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQFWYNNS  769
            ANAVFGS PPINP VLTKAFQ+  NV++YLQ QFWYNNS
Sbjct  192  ANAVFGSKPPINPDVLTKAFQLDNNVVDYLQKQFWYNNS  230



>ref|XP_007030265.1| Germin-like protein 2 [Theobroma cacao]
 gb|EOY10767.1| Germin-like protein 2 [Theobroma cacao]
Length=221

 Score =   301 bits (771),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 156/225 (69%), Positives = 179/225 (80%), Gaps = 6/225 (3%)
 Frame = +2

Query  86   MAIRFIVFTITVVALSSSFAHASDPSPLQDFCVAVNDSM-AAVFVNGKICKNPMQVVAND  262
            M   + +    ++ L+SSFA A DPSPLQDFCVA+ND+   +V VNGK CK+P     ND
Sbjct  1    MKGAYFILGFILLILASSFASACDPSPLQDFCVAINDTKKGSVIVNGKFCKDPKLATVND  60

Query  263  FFFRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNG-LNPPHTHPRATE  439
            FFF GLN+P NTSN +GS VTPVNV+ +PGLNTLGISLVRID+APNG LNPPHTHPR TE
Sbjct  61   FFFSGLNIPKNTSNSVGSVVTPVNVDQIPGLNTLGISLVRIDYAPNGGLNPPHTHPRGTE  120

Query  440  VLLVLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAG  619
            +L+VLEGTLYVGFV SNP     N L +K L  GDVFVFP GLIHFQ NVGKTNA+AFAG
Sbjct  121  ILVVLEGTLYVGFVTSNP----NNRLISKILSPGDVFVFPIGLIHFQQNVGKTNAVAFAG  176

Query  620  LSSQNPGVITIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQF  754
            LSSQNPGVITIANAVFGSNPPINP VLT AFQ+ + V+ YLQ++F
Sbjct  177  LSSQNPGVITIANAVFGSNPPINPDVLTGAFQLDKKVVKYLQSRF  221



>gb|KCW76699.1| hypothetical protein EUGRSUZ_D01059 [Eucalyptus grandis]
Length=221

 Score =   301 bits (770),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 148/225 (66%), Positives = 177/225 (79%), Gaps = 5/225 (2%)
 Frame = +2

Query  92   IRFIVFTITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFFF  271
            ++F+  ++ ++AL+++ + A DPSPLQDFCVA+ND    VFVNGK CK+P QV A+DF F
Sbjct  1    MKFLPISLLILALATATSFAYDPSPLQDFCVAINDP--KVFVNGKFCKDPKQVTADDFLF  58

Query  272  RGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLV  451
            +G   PGNT NPLGSKVTP  V+ LPGLNTLGIS+ RIDFAP GLNPPHTHPR +E+L+V
Sbjct  59   KGFRYPGNTVNPLGSKVTPAFVDQLPGLNTLGISMARIDFAPGGLNPPHTHPRGSEILVV  118

Query  452  LEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSSQ  631
             EGTL VGFV SN    + N  FTK L  GDVFVFP GLIHFQ N+GKT A+AFA LSSQ
Sbjct  119  AEGTLLVGFVTSN---QLNNTFFTKVLYKGDVFVFPIGLIHFQLNIGKTPALAFAALSSQ  175

Query  632  NPGVITIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQFWYNN  766
            NPGVITIAN+VF S PPI+  VLTKAFQV + V++YLQ QFWY+N
Sbjct  176  NPGVITIANSVFRSKPPISADVLTKAFQVDKKVVDYLQVQFWYDN  220



>ref|XP_009357348.1| PREDICTED: germin-like protein subfamily 1 member 13 [Pyrus x 
bretschneideri]
Length=226

 Score =   301 bits (770),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 151/205 (74%), Positives = 166/205 (81%), Gaps = 3/205 (1%)
 Frame = +2

Query  152  SDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFFFRGLNMPGNTSNPLGSKVTPV  331
            SDPSPLQDFCVA+N++  AVFVNGK CKNP    ANDFF   L  PGNTSNP+GS VT  
Sbjct  24   SDPSPLQDFCVAINNTDPAVFVNGKFCKNPKLASANDFFSDKLRNPGNTSNPIGSIVTAA  83

Query  332  NVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLYVGFVLSNPPPGMKN  511
            NV+++PGLNTLGIS  R+DFAPNGLNPPHTHPRATE+L+VLEG+LYVGFV SN      N
Sbjct  84   NVDDIPGLNTLGISFARLDFAPNGLNPPHTHPRATEILIVLEGSLYVGFVTSN---ADGN  140

Query  512  PLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSSQNPGVITIANAVFGSNPPINP  691
             LFTK L  GDVFVFP GLIHFQ NVGKTNA+A  GLSSQNPGVITIANAVFGSNP INP
Sbjct  141  RLFTKVLYKGDVFVFPVGLIHFQLNVGKTNALAIGGLSSQNPGVITIANAVFGSNPHINP  200

Query  692  QVLTKAFQVGQNVINYLQAQFWYNN  766
             VL KAFQV +  ++YLQ QFWYNN
Sbjct  201  DVLAKAFQVDEKEVDYLQKQFWYNN  225



>ref|XP_009355938.1| PREDICTED: germin-like protein subfamily 1 member 13 [Pyrus x 
bretschneideri]
Length=226

 Score =   301 bits (770),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 151/204 (74%), Positives = 166/204 (81%), Gaps = 3/204 (1%)
 Frame = +2

Query  155  DPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFFFRGLNMPGNTSNPLGSKVTPVN  334
            DPSPLQDFCVA+N++  AVFVNGK CKNP    ANDFF   L  PGNTSNP+GS VT  N
Sbjct  25   DPSPLQDFCVAINNTDPAVFVNGKFCKNPKLASANDFFSDKLRNPGNTSNPIGSIVTAAN  84

Query  335  VNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLYVGFVLSNPPPGMKNP  514
            V+++PGLNTLGIS  R+DFAPNGLNPPHTHPRATE+L+VLEG+LYVGFV SN      N 
Sbjct  85   VDDIPGLNTLGISFARLDFAPNGLNPPHTHPRATEILIVLEGSLYVGFVTSN---ADGNR  141

Query  515  LFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSSQNPGVITIANAVFGSNPPINPQ  694
            LFTK L  GDVFVFP GLIHFQ NVGKTNA+A AGLSSQNPGVITIANAVFGSNP INP 
Sbjct  142  LFTKVLYKGDVFVFPVGLIHFQLNVGKTNALAIAGLSSQNPGVITIANAVFGSNPHINPD  201

Query  695  VLTKAFQVGQNVINYLQAQFWYNN  766
            VL KAFQV +  ++YLQ QFWYNN
Sbjct  202  VLAKAFQVDEKEVDYLQKQFWYNN  225



>ref|XP_002265447.3| PREDICTED: uncharacterized protein LOC100242782 [Vitis vinifera]
Length=450

 Score =   308 bits (789),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 152/214 (71%), Positives = 171/214 (80%), Gaps = 4/214 (2%)
 Frame = +2

Query  113  ITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFFFRGLNMPG  292
            I ++A+S   A ASDPSPLQDFCVAVND+   VFVNGK+CK+P    ANDFFF GL +PG
Sbjct  241  IALLAMSFFLASASDPSPLQDFCVAVNDTKTTVFVNGKVCKDPKVATANDFFFSGLRVPG  300

Query  293  NTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLYV  472
            NTSN +GS VTP NV  +PGLNTLGISL R+D+AP GLNPPHTHPRATE+L VLEGTLYV
Sbjct  301  NTSNKVGSMVTPANVAQIPGLNTLGISLARVDYAPYGLNPPHTHPRATEILTVLEGTLYV  360

Query  473  GFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSSQNPGVITI  652
            GFV SNP     N L +K L  GDVFVFPEGLIHFQ NVGKT A+A A LSSQNPGVITI
Sbjct  361  GFVTSNP----DNRLISKVLYKGDVFVFPEGLIHFQLNVGKTKAVAIAALSSQNPGVITI  416

Query  653  ANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQF  754
            ANAVFGS P I+  VLTKAFQV + V++YLQ+QF
Sbjct  417  ANAVFGSKPAISADVLTKAFQVDKKVVDYLQSQF  450


 Score =   258 bits (659),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 128/186 (69%), Positives = 142/186 (76%), Gaps = 4/186 (2%)
 Frame = +2

Query  209  VFVNGKICKNPMQVVANDFFFRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRID  388
            VFVNGK+CK+P    ANDFFF GL +PGNTSN LGS VTP NV  +P L TLGISL R+D
Sbjct  7    VFVNGKVCKDPKVATANDFFFSGLRVPGNTSNKLGSMVTPANVAQIPDLKTLGISLARVD  66

Query  389  FAPNGLNPPHTHPRATEVLLVLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGL  568
            +AP GLNPPHTHPR TE+L  LEGTLYVGFV SNP     N L +K L  GDVFVFPE L
Sbjct  67   YAPYGLNPPHTHPRDTEILTFLEGTLYVGFVTSNP----DNRLISKVLYKGDVFVFPEDL  122

Query  569  IHFQFNVGKTNAIAFAGLSSQNPGVITIANAVFGSNPPINPQVLTKAFQVGQNVINYLQA  748
            IHFQ NV KT A+A A LSSQNPGVITIANAVFGS P I+  VLTKAFQV + V++YLQ+
Sbjct  123  IHFQLNVEKTKAVAIAALSSQNPGVITIANAVFGSKPAISADVLTKAFQVDKKVVDYLQS  182

Query  749  QFWYNN  766
            QF  N 
Sbjct  183  QFSINR  188



>emb|CAN66771.1| hypothetical protein VITISV_022559 [Vitis vinifera]
Length=205

 Score =   300 bits (767),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 149/209 (71%), Positives = 166/209 (79%), Gaps = 4/209 (2%)
 Frame = +2

Query  128  LSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFFFRGLNMPGNTSNP  307
            +S   A ASDPSPLQDFCVAVND+   VFVNGK+CK+P     NDFFF GL +PGNTSN 
Sbjct  1    MSFFLAFASDPSPLQDFCVAVNDTKTTVFVNGKVCKDPKVATPNDFFFSGLRVPGNTSNK  60

Query  308  LGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLYVGFVLS  487
            +GS VTP NV  +PGLNTLGISL R+D+AP GLNPPHTHPRATE+L VLEGTLYVGFV S
Sbjct  61   VGSMVTPANVAQIPGLNTLGISLARVDYAPYGLNPPHTHPRATEILTVLEGTLYVGFVTS  120

Query  488  NPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSSQNPGVITIANAVF  667
            NP     N L +K L  GDVFVFPEGLIHFQ NVGKT A+A A LSSQNPGVITIANAVF
Sbjct  121  NP----DNRLISKVLYKGDVFVFPEGLIHFQLNVGKTKAVAIAALSSQNPGVITIANAVF  176

Query  668  GSNPPINPQVLTKAFQVGQNVINYLQAQF  754
            GS P I+  VLTKAFQV + V++YLQ+QF
Sbjct  177  GSKPAISADVLTKAFQVDKKVVDYLQSQF  205



>ref|XP_006840206.1| hypothetical protein AMTR_s00089p00127600 [Amborella trichopoda]
 gb|ERN01881.1| hypothetical protein AMTR_s00089p00127600 [Amborella trichopoda]
Length=219

 Score =   300 bits (767),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 151/226 (67%), Positives = 176/226 (78%), Gaps = 9/226 (4%)
 Frame = +2

Query  86   MAIRFIVFTITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDF  265
            M +  +  T++++A   S   ASDPSPLQDFCVA  D+ + VFVNGK+CK+PM   ANDF
Sbjct  1    MKLTIVFLTLSMIA---SLGLASDPSPLQDFCVA--DNYSKVFVNGKVCKDPMLATANDF  55

Query  266  FFRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVL  445
            F+ GLN PGNTSNPLGS VTPVNV  +PGLNTLGISL RIDFAP G NPPHTHPR TE+L
Sbjct  56   FYDGLNKPGNTSNPLGSMVTPVNVMQIPGLNTLGISLARIDFAPGGQNPPHTHPRGTEIL  115

Query  446  LVLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLS  625
             VLEGTLYVGFV SNP    +N L +KTL  GDVFVFPEGLIHFQ NVG  N +A AGLS
Sbjct  116  TVLEGTLYVGFVTSNP----ENRLISKTLKKGDVFVFPEGLIHFQQNVGYGNTVAIAGLS  171

Query  626  SQNPGVITIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQFWYN  763
            SQNPGVITIANAVFG++PPI+  VL KAFQ+ + +++ LQA FW +
Sbjct  172  SQNPGVITIANAVFGADPPISDVVLAKAFQIDKKLVDKLQASFWMD  217



>ref|XP_007199406.1| hypothetical protein PRUPE_ppa026225mg [Prunus persica]
 gb|EMJ00605.1| hypothetical protein PRUPE_ppa026225mg [Prunus persica]
Length=226

 Score =   300 bits (767),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 149/226 (66%), Positives = 173/226 (77%), Gaps = 3/226 (1%)
 Frame = +2

Query  89   AIRFIVFTITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFF  268
             + F+  T+ ++A +S    A DPSPLQDFCVA+N   +AVFVNGK CK+P  V ANDFF
Sbjct  3    GVHFLTSTVAILAFTSFLVSAYDPSPLQDFCVAINKPPSAVFVNGKFCKDPKFVTANDFF  62

Query  269  FRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLL  448
            F GL +  +T+NP+GS VT VNV+ + GLNTLGISL RIDFAPNGLNPPHTHPR +E+L+
Sbjct  63   FSGLQIAKSTANPVGSTVTAVNVDQIAGLNTLGISLARIDFAPNGLNPPHTHPRGSEILV  122

Query  449  VLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSS  628
            VLEGTLYVGFV SN      N L +K L  GDVFVFP GLIHFQ N+G  NA+A AGLSS
Sbjct  123  VLEGTLYVGFVTSNAD---NNRLISKVLNKGDVFVFPIGLIHFQLNLGYGNAVALAGLSS  179

Query  629  QNPGVITIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQFWYNN  766
            QNPGVITIANAVFGS PPINP VL KAFQV   +++YLQ QFWY N
Sbjct  180  QNPGVITIANAVFGSKPPINPDVLAKAFQVDNKLVDYLQKQFWYEN  225



>emb|CBI36816.3| unnamed protein product [Vitis vinifera]
Length=220

 Score =   299 bits (766),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 150/221 (68%), Positives = 176/221 (80%), Gaps = 5/221 (2%)
 Frame = +2

Query  92   IRFIVFTITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFFF  271
            + F+V T+ +VAL SS A ASDPSPLQD CVA+++   AVFVNGK CK+P   VA DFFF
Sbjct  5    VSFLV-TVALVALVSSLASASDPSPLQDTCVAIDEPKDAVFVNGKFCKDPKLTVAEDFFF  63

Query  272  RGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLV  451
             GL+ PGNTSN + S VT VNV  + GLNTLGIS+VRID+ P G NPPHTHPRATE+L V
Sbjct  64   SGLDKPGNTSNAVASNVTTVNVEQIKGLNTLGISMVRIDYEPYGQNPPHTHPRATEILTV  123

Query  452  LEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSSQ  631
            LEGTLYVGFV SN     +N L +K L  GDVFVFP GLIHFQFN+GKTNA+A A LSSQ
Sbjct  124  LEGTLYVGFVTSN----TENRLISKVLNKGDVFVFPIGLIHFQFNIGKTNAVAIAALSSQ  179

Query  632  NPGVITIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQF  754
            NPGVITIANAVFGS+PPINP VLT+AFQ+ ++V+ YLQ++F
Sbjct  180  NPGVITIANAVFGSDPPINPDVLTRAFQLDKSVVKYLQSRF  220



>emb|CBI36811.3| unnamed protein product [Vitis vinifera]
Length=220

 Score =   299 bits (765),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 151/221 (68%), Positives = 176/221 (80%), Gaps = 5/221 (2%)
 Frame = +2

Query  92   IRFIVFTITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFFF  271
            + F+V T+ +VAL SS A ASDPSPLQD CVA+++   AVFVNGK CK+P   VA DFFF
Sbjct  5    VSFLV-TVALVALVSSLASASDPSPLQDTCVAIDEPKDAVFVNGKFCKDPNLTVAEDFFF  63

Query  272  RGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLV  451
             GL+ PGNTSN   S VT VNV+ + GLNTLGIS+VRID+ P G NPPHTHPRATE+L V
Sbjct  64   SGLDKPGNTSNAAASNVTTVNVDKIKGLNTLGISMVRIDYEPYGQNPPHTHPRATEILTV  123

Query  452  LEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSSQ  631
            LEGTLYVGFV SN     +N L +K L  GDVFVFP GLIHFQFNVGKT A+A AGLSSQ
Sbjct  124  LEGTLYVGFVTSN----TENRLISKVLNKGDVFVFPIGLIHFQFNVGKTKAVAIAGLSSQ  179

Query  632  NPGVITIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQF  754
            NPGVITIANAVFGS+PPINP VLT+AFQ+ + V++YLQ++F
Sbjct  180  NPGVITIANAVFGSDPPINPDVLTRAFQLDKKVVSYLQSRF  220



>gb|KCW76697.1| hypothetical protein EUGRSUZ_D01057 [Eucalyptus grandis]
Length=221

 Score =   299 bits (765),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 153/225 (68%), Positives = 180/225 (80%), Gaps = 5/225 (2%)
 Frame = +2

Query  92   IRFIVFTITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFFF  271
            ++F+  ++ ++AL+++ A A DPSPLQDFCVA+ND    VFVNGK CK+P Q+ A+DF F
Sbjct  1    MKFLPTSLLILALATATAFAFDPSPLQDFCVAINDP--EVFVNGKFCKDPKQITADDFLF  58

Query  272  RGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLV  451
            +G   PGNT+NPLGSKVTP  V+  PGLNTLGIS+ RIDFAP GLNPPHTHPR TEVL+V
Sbjct  59   KGFRYPGNTANPLGSKVTPAFVDQFPGLNTLGISMARIDFAPGGLNPPHTHPRGTEVLVV  118

Query  452  LEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSSQ  631
             EGTL VGFV SN    + N LFTK L  GDVFVFP GLIHFQ N+GKT A+AFA LSSQ
Sbjct  119  TEGTLLVGFVTSN---QLNNTLFTKVLYKGDVFVFPIGLIHFQLNIGKTPALAFAALSSQ  175

Query  632  NPGVITIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQFWYNN  766
            NPGVITIANAVFGS PPI+  VLTKAFQV + V++YLQAQFWY+N
Sbjct  176  NPGVITIANAVFGSKPPISADVLTKAFQVDKKVVDYLQAQFWYDN  220



>ref|XP_010024915.1| PREDICTED: putative germin-like protein 2-1 [Eucalyptus grandis]
Length=223

 Score =   299 bits (765),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 150/225 (67%), Positives = 178/225 (79%), Gaps = 4/225 (2%)
 Frame = +2

Query  92   IRFIVFTITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFFF  271
            ++F++ T  ++AL+SS A ASDPSPLQDFCVA+NDS +AV VNGK CK+P   VA+DF F
Sbjct  2    MKFLL-TFVLLALASSHAFASDPSPLQDFCVAINDSNSAVLVNGKFCKDPKLAVADDFSF  60

Query  272  RGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLV  451
                 PGNTSNPLGSKVT   V+  PGLNTLGI++ R+DFAP GLNPPH HPR TE+L+V
Sbjct  61   TKFRYPGNTSNPLGSKVTTAFVDQFPGLNTLGIAMARLDFAPYGLNPPHIHPRGTEMLVV  120

Query  452  LEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSSQ  631
            +EGTLYVGFV SN    + N LFTK L  GDVFVFP+GLIHFQ N+G+ NA+AFA LSSQ
Sbjct  121  VEGTLYVGFVTSNQ---LNNTLFTKVLTKGDVFVFPQGLIHFQLNIGQANALAFAFLSSQ  177

Query  632  NPGVITIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQFWYNN  766
            NPG+ITIAN+VFGS P IN  VLTKAFQV   +INYLQAQ W++N
Sbjct  178  NPGLITIANSVFGSKPLINVDVLTKAFQVDNKLINYLQAQNWFDN  222



>emb|CDP10698.1| unnamed protein product [Coffea canephora]
Length=223

 Score =   299 bits (765),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 153/217 (71%), Positives = 175/217 (81%), Gaps = 0/217 (0%)
 Frame = +2

Query  104  VFTITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFFFRGLN  283
            + T+  +AL SS A ASDPSPLQDFCVA+NDS AAVFVNGKICK+P  V ANDFFF+G N
Sbjct  6    LITLAAMALLSSLAIASDPSPLQDFCVAINDSKAAVFVNGKICKDPKVVNANDFFFQGFN  65

Query  284  MPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGT  463
            +PGNT+NP+GS VT V VNNLPGLNT GISL RIDFAP G+N PHTHPRATEV+  +EGT
Sbjct  66   IPGNTNNPVGSNVTRVLVNNLPGLNTFGISLARIDFAPYGVNTPHTHPRATEVIFAVEGT  125

Query  464  LYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSSQNPGV  643
            L   FV SNPP  MKN LFTK L  GDVFVFP+GL+HF  N+GKT A+AF+G SSQNPGV
Sbjct  126  LAASFVTSNPPNNMKNRLFTKVLNPGDVFVFPQGLVHFIQNLGKTKALAFSGFSSQNPGV  185

Query  644  ITIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQF  754
             TIAN VFG+ PPI+  VLTKAFQV + VI+ L+AQF
Sbjct  186  NTIANVVFGTEPPISLGVLTKAFQVDKKVIDALEAQF  222



>gb|KCW61443.1| hypothetical protein EUGRSUZ_H04174 [Eucalyptus grandis]
Length=222

 Score =   298 bits (764),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 150/225 (67%), Positives = 178/225 (79%), Gaps = 4/225 (2%)
 Frame = +2

Query  92   IRFIVFTITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFFF  271
            ++F++ T  ++AL+SS A ASDPSPLQDFCVA+NDS +AV VNGK CK+P   VA+DF F
Sbjct  1    MKFLL-TFVLLALASSHAFASDPSPLQDFCVAINDSNSAVLVNGKFCKDPKLAVADDFSF  59

Query  272  RGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLV  451
                 PGNTSNPLGSKVT   V+  PGLNTLGI++ R+DFAP GLNPPH HPR TE+L+V
Sbjct  60   TKFRYPGNTSNPLGSKVTTAFVDQFPGLNTLGITMARLDFAPYGLNPPHIHPRGTEMLVV  119

Query  452  LEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSSQ  631
            +EGTLYVGFV SN    + N LFTK L  GDVFVFP+GLIHFQ N+G+ NA+AFA LSSQ
Sbjct  120  VEGTLYVGFVTSNQ---LNNTLFTKVLTKGDVFVFPQGLIHFQLNIGQANALAFAFLSSQ  176

Query  632  NPGVITIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQFWYNN  766
            NPG+ITIAN+VFGS P IN  VLTKAFQV   +INYLQAQ W++N
Sbjct  177  NPGLITIANSVFGSKPLINVDVLTKAFQVDNKLINYLQAQNWFDN  221



>gb|KCW61437.1| hypothetical protein EUGRSUZ_H04167 [Eucalyptus grandis]
Length=222

 Score =   298 bits (764),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 150/225 (67%), Positives = 178/225 (79%), Gaps = 4/225 (2%)
 Frame = +2

Query  92   IRFIVFTITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFFF  271
            ++F++ T  ++AL+SS A ASDPSPLQDFCVA+NDS +AV VNGK CK+P   VA+DF F
Sbjct  1    MKFLL-TFVLLALASSHAFASDPSPLQDFCVAINDSNSAVLVNGKFCKDPKLAVADDFSF  59

Query  272  RGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLV  451
                 PGNTSNPLGSKVT   V+  PGLNTLGI++ R+DFAP GLNPPH HPR TE+L+V
Sbjct  60   TKFRYPGNTSNPLGSKVTTAFVDQFPGLNTLGIAMARLDFAPYGLNPPHIHPRGTEMLVV  119

Query  452  LEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSSQ  631
            +EGTLYVGFV SN    + N LFTK L  GDVFVFP+GLIHFQ N+G+ NA+AFA LSSQ
Sbjct  120  VEGTLYVGFVTSNQ---LNNTLFTKVLTKGDVFVFPQGLIHFQLNIGQANALAFAFLSSQ  176

Query  632  NPGVITIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQFWYNN  766
            NPG+ITIAN+VFGS P IN  VLTKAFQV   +INYLQAQ W++N
Sbjct  177  NPGLITIANSVFGSKPLINVDVLTKAFQVDNKLINYLQAQNWFDN  221



>ref|XP_011038440.1| PREDICTED: germin-like protein subfamily 1 member 7 [Populus 
euphratica]
Length=221

 Score =   298 bits (764),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 153/217 (71%), Positives = 172/217 (79%), Gaps = 2/217 (1%)
 Frame = +2

Query  104  VFTITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFFFRGLN  283
            V    ++AL+SSFA A DPSPLQDFCVAV D    VFVNGK CK+P  V A DFF  GLN
Sbjct  7    VLVFVLLALASSFASAFDPSPLQDFCVAV-DETDGVFVNGKFCKDPKDVTAKDFFSSGLN  65

Query  284  MPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGT  463
            +PG+TS  +GS VT VNV  +PGLNTLGISL RIDFAP GLNPPHTHPRATE+++V+EGT
Sbjct  66   IPGDTSGRVGSNVTAVNVEKIPGLNTLGISLARIDFAPYGLNPPHTHPRATEIIVVVEGT  125

Query  464  LYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSSQNPGV  643
            LYVGFV SN   G  N L TK L  GDVFVFP GLIHFQFN+GKT A+AFAGLSSQNPGV
Sbjct  126  LYVGFVTSNLANG-DNRLITKALKPGDVFVFPIGLIHFQFNMGKTKALAFAGLSSQNPGV  184

Query  644  ITIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQF  754
            ITIANAVFGS+PPINP VL KAFQ+ + V++YLQ  F
Sbjct  185  ITIANAVFGSDPPINPDVLAKAFQLDKKVVDYLQKSF  221



>ref|NP_001267943.1| germin-like protein 4 precursor [Vitis vinifera]
 gb|ABL60873.1| germin-like protein 4 [Vitis vinifera]
Length=220

 Score =   298 bits (763),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 150/220 (68%), Positives = 175/220 (80%), Gaps = 5/220 (2%)
 Frame = +2

Query  92   IRFIVFTITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFFF  271
            + F+V T+ +VAL SS A ASDPSPLQD CVA+++   AVFVNGK CK+P   VA DFFF
Sbjct  5    VSFLV-TVALVALVSSLASASDPSPLQDTCVAIDEPKDAVFVNGKFCKDPKLTVAEDFFF  63

Query  272  RGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLV  451
             GL+ PGNTSN + S VT VNV  + GLNTLGIS+VRID+ P G NPPHTHPRATE+L V
Sbjct  64   SGLDKPGNTSNAVASNVTTVNVEKIKGLNTLGISMVRIDYEPYGQNPPHTHPRATEILTV  123

Query  452  LEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSSQ  631
            LEGTLYVGFV SN     +N L +K L  GDVFVFP GLIHFQFNVGKT A+A AGLSSQ
Sbjct  124  LEGTLYVGFVTSN----TENRLISKVLNKGDVFVFPIGLIHFQFNVGKTKAVAIAGLSSQ  179

Query  632  NPGVITIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQ  751
            NPGVITIANAVFGS+PPINP VLT+AFQ+ + V++YLQ++
Sbjct  180  NPGVITIANAVFGSDPPINPDVLTRAFQLDKKVVSYLQSR  219



>ref|XP_010041604.1| PREDICTED: germin-like protein subfamily 1 member 13 [Eucalyptus 
grandis]
Length=223

 Score =   298 bits (763),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 151/225 (67%), Positives = 177/225 (79%), Gaps = 4/225 (2%)
 Frame = +2

Query  92   IRFIVFTITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFFF  271
            ++F++ T  ++AL+S  A ASDPSPLQDFCVAVND  +AVFVNGK CK+P  V+A+DF F
Sbjct  2    MKFLL-TFVLLALASCHAFASDPSPLQDFCVAVNDPNSAVFVNGKFCKDPKLVIADDFSF  60

Query  272  RGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLV  451
                 PG+TSNPLGSKVT   V+  PGLNTLGI+  R+DFAP GLNPPH HPR TE+LLV
Sbjct  61   TKFRYPGSTSNPLGSKVTTAFVDQFPGLNTLGIATARLDFAPYGLNPPHIHPRGTEMLLV  120

Query  452  LEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSSQ  631
            +EGTL+VGFV SN    + N LFTK L  GDVFVFP+GLIHFQ N+G+TNA+AFA LSSQ
Sbjct  121  VEGTLHVGFVTSNQ---LNNTLFTKVLTKGDVFVFPQGLIHFQLNIGQTNALAFAFLSSQ  177

Query  632  NPGVITIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQFWYNN  766
            NPG+ITIAN VFGS PPIN  VLTKAFQV   +INYLQAQ W+ N
Sbjct  178  NPGLITIANTVFGSKPPINVDVLTKAFQVDNKLINYLQAQSWFEN  222



>ref|XP_006857270.1| hypothetical protein AMTR_s00067p00014150 [Amborella trichopoda]
 gb|ERN18737.1| hypothetical protein AMTR_s00067p00014150 [Amborella trichopoda]
Length=218

 Score =   298 bits (762),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 149/221 (67%), Positives = 173/221 (78%), Gaps = 6/221 (3%)
 Frame = +2

Query  104  VFTITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFFFRGLN  283
            +F +  ++L++S  +ASDPSPLQDFCVA  D+ + +FVNGK+CK+P    ANDFFF GL+
Sbjct  3    LFLVVFLSLTASLTYASDPSPLQDFCVA--DNASQLFVNGKVCKDPQLAQANDFFFAGLD  60

Query  284  MPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGT  463
             PGNT+N LGS+VT VNV  + GLNTLGIS+VRID+AP G NPPHTHPRATE+L VLEG+
Sbjct  61   KPGNTANALGSRVTQVNVAQIAGLNTLGISMVRIDYAPGGQNPPHTHPRATEILTVLEGS  120

Query  464  LYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSSQNPGV  643
            LYVGFV SNP     N L TKTL  GDVFVFPEGLIHFQ NVG  NA+A A LSSQNPGV
Sbjct  121  LYVGFVTSNP----DNRLITKTLQKGDVFVFPEGLIHFQQNVGYKNAVAIAALSSQNPGV  176

Query  644  ITIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQFWYNN  766
            ITIANAVFGS P IN  VL KAFQV   V+N LQ+QFW +N
Sbjct  177  ITIANAVFGSKPAINSNVLAKAFQVDNKVVNQLQSQFWMDN  217



>ref|XP_010048221.1| PREDICTED: germin-like protein subfamily 1 member 13 [Eucalyptus 
grandis]
 gb|KCW80406.1| hypothetical protein EUGRSUZ_C01763 [Eucalyptus grandis]
Length=223

 Score =   298 bits (763),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 145/204 (71%), Positives = 165/204 (81%), Gaps = 3/204 (1%)
 Frame = +2

Query  155  DPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFFFRGLNMPGNTSNPLGSKVTPVN  334
            DPSPLQD CVA+ND  +AVFVNG+ CK+P Q  A+DF F G   PGNT+NPLGSKVTP  
Sbjct  22   DPSPLQDICVAINDPKSAVFVNGEFCKDPKQATADDFTFMGFRNPGNTANPLGSKVTPAT  81

Query  335  VNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLYVGFVLSNPPPGMKNP  514
            VN  PGLNTLGIS+ R+DFAP GLNPPHTHPR TEVL+V+EGTL VGFV SN    + N 
Sbjct  82   VNEFPGLNTLGISMARLDFAPGGLNPPHTHPRGTEVLVVIEGTLLVGFVTSN---QLNNT  138

Query  515  LFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSSQNPGVITIANAVFGSNPPINPQ  694
            LFTK L  GDVFVFP GLIHFQ N GKT A+AFAGLSSQNPGVITIAN+VFG+ PPI+  
Sbjct  139  LFTKVLYKGDVFVFPIGLIHFQLNTGKTPALAFAGLSSQNPGVITIANSVFGARPPISAD  198

Query  695  VLTKAFQVGQNVINYLQAQFWYNN  766
            VLTKAFQV + +++YLQAQFWY+N
Sbjct  199  VLTKAFQVDKKIVDYLQAQFWYDN  222



>ref|XP_010041605.1| PREDICTED: germin-like protein subfamily 1 member 7 [Eucalyptus 
grandis]
Length=221

 Score =   298 bits (762),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 152/225 (68%), Positives = 178/225 (79%), Gaps = 5/225 (2%)
 Frame = +2

Query  92   IRFIVFTITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFFF  271
            ++F+  ++ ++AL+++ A A DPSPLQDFCVA+ND    VFVNGK CK+P QV A DF F
Sbjct  1    MKFLPISLLILALATATAFAYDPSPLQDFCVAINDP--KVFVNGKFCKDPKQVTAEDFLF  58

Query  272  RGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLV  451
            +G   PGNT+NPLGSKVTP  V+  PGLNTLGIS+ RIDFAP GLNPPHTHPR TE+L+V
Sbjct  59   KGFRYPGNTANPLGSKVTPAFVDQFPGLNTLGISMARIDFAPGGLNPPHTHPRGTEILVV  118

Query  452  LEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSSQ  631
             EGTL VGFV SN    + N  FTK L  GDVFVFP GLIHFQ N+GKT A+AFA LSSQ
Sbjct  119  AEGTLLVGFVTSN---QLNNTFFTKVLYKGDVFVFPIGLIHFQLNIGKTPALAFAALSSQ  175

Query  632  NPGVITIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQFWYNN  766
            NPGVITIANAVFGS PPI+  VLTKAFQV + V++YLQAQFWY+N
Sbjct  176  NPGVITIANAVFGSKPPISADVLTKAFQVDKKVVDYLQAQFWYDN  220



>ref|XP_010052624.1| PREDICTED: germin-like protein subfamily 1 member 13 [Eucalyptus 
grandis]
 gb|KCW76696.1| hypothetical protein EUGRSUZ_D01056 [Eucalyptus grandis]
Length=223

 Score =   298 bits (762),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 145/204 (71%), Positives = 164/204 (80%), Gaps = 3/204 (1%)
 Frame = +2

Query  155  DPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFFFRGLNMPGNTSNPLGSKVTPVN  334
            DPSPLQD CVA+ND  +AVFVNG+ CK+P Q  A+DF F G   PGNT+NPLGSKVTP  
Sbjct  22   DPSPLQDICVAINDPKSAVFVNGEFCKDPKQATADDFTFMGFRNPGNTANPLGSKVTPAT  81

Query  335  VNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLYVGFVLSNPPPGMKNP  514
            VN  PGLNTLGIS+ RIDFAP GLNPPHTHPR TEVL+++EGTL VGFV SN    + N 
Sbjct  82   VNEFPGLNTLGISMARIDFAPGGLNPPHTHPRGTEVLVIIEGTLLVGFVTSN---QLNNT  138

Query  515  LFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSSQNPGVITIANAVFGSNPPINPQ  694
            LFTK L  GDVFVFP GLIHFQ N GKT A+AFAGLSSQNPGVITIAN+VFG+ PPI+  
Sbjct  139  LFTKVLYKGDVFVFPIGLIHFQLNTGKTPALAFAGLSSQNPGVITIANSVFGAKPPISAD  198

Query  695  VLTKAFQVGQNVINYLQAQFWYNN  766
            VLTKAFQV +  ++YLQAQFWY+N
Sbjct  199  VLTKAFQVDKKTVDYLQAQFWYDN  222



>ref|XP_010050748.1| PREDICTED: uncharacterized protein LOC104439371 [Eucalyptus grandis]
Length=448

 Score =   305 bits (782),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 153/242 (63%), Positives = 186/242 (77%), Gaps = 9/242 (4%)
 Frame = +2

Query  41   KLFYNSDTLTQNIFDMAIRFIVFTITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVN  220
            + +Y++ T    I    ++F+  ++ ++AL+++ + A DPSPLQDFCVA+ND    VFVN
Sbjct  215  QFWYDNKTPHSTI----MKFLPISLLILALATATSFAYDPSPLQDFCVAINDP--KVFVN  268

Query  221  GKICKNPMQVVANDFFFRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPN  400
            GK CK+P QV A+DF F+G   PGNT NPLGSKVTP  V+ LPGLNTLGIS+ RIDFAP 
Sbjct  269  GKFCKDPKQVTADDFLFKGFRYPGNTVNPLGSKVTPAFVDQLPGLNTLGISMARIDFAPG  328

Query  401  GLNPPHTHPRATEVLLVLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQ  580
            GLNPPHTHPR +E+L+V EGTL VGFV SN    + N  FTK L  GDVFVFP GLIHFQ
Sbjct  329  GLNPPHTHPRGSEILVVAEGTLLVGFVTSN---QLNNTFFTKVLYKGDVFVFPIGLIHFQ  385

Query  581  FNVGKTNAIAFAGLSSQNPGVITIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQFWY  760
             N+GKT A+AFA LSSQNPGVITIAN+VFGS PPI+  VLTKAFQV + V++YLQAQFWY
Sbjct  386  LNIGKTPALAFAALSSQNPGVITIANSVFGSKPPISADVLTKAFQVDKKVVDYLQAQFWY  445

Query  761  NN  766
            +N
Sbjct  446  DN  447


 Score =   293 bits (751),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 147/205 (72%), Positives = 163/205 (80%), Gaps = 5/205 (2%)
 Frame = +2

Query  155  DPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFFFRGLNMPGNTSNPLGSKVTPVN  334
            DPSPLQDFCVA+ND    VFVNGK CK+P QV A+DF F+G   PGNT+NPLGSKVTP  
Sbjct  22   DPSPLQDFCVAINDP--EVFVNGKFCKDPKQVTADDFLFKGFRYPGNTANPLGSKVTPAF  79

Query  335  VNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLYVGFVLSNPPPGMKNP  514
            V+  PGLNTLGIS+ RIDFA  GLNPPHTHPR TEVL+V EGTL V FV SN    + N 
Sbjct  80   VDQFPGLNTLGISMARIDFALGGLNPPHTHPRGTEVLVVTEGTLLVSFVTSN---QLNNT  136

Query  515  LFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSSQNPGVITIANAVFGSNPPINPQ  694
            LFTK L  GDVFVFP GLIHFQ N+GKT A+AFA LSSQNPGVITIANAVFGS PPI+  
Sbjct  137  LFTKVLYKGDVFVFPIGLIHFQLNIGKTPALAFAALSSQNPGVITIANAVFGSKPPISAD  196

Query  695  VLTKAFQVGQNVINYLQAQFWYNNS  769
            VLTKAFQV + V++YLQAQFWY+N 
Sbjct  197  VLTKAFQVDKKVVDYLQAQFWYDNK  221



>ref|XP_010066342.1| PREDICTED: germin-like protein subfamily 1 member 13 [Eucalyptus 
grandis]
Length=223

 Score =   297 bits (761),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 151/225 (67%), Positives = 177/225 (79%), Gaps = 4/225 (2%)
 Frame = +2

Query  92   IRFIVFTITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFFF  271
            ++F++ T  ++AL+S  A ASDPSPLQDFCVAVND  +AVFVNGK CK+P  V+A+DF F
Sbjct  2    MKFLL-TFVLLALASCHAFASDPSPLQDFCVAVNDPNSAVFVNGKFCKDPKLVIADDFSF  60

Query  272  RGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLV  451
                 PG+TSNPLGSKVT   V+  PGLNTLGI+  R+DFAP GLNPPH HPR TE+LLV
Sbjct  61   TKFRYPGSTSNPLGSKVTTAFVDQFPGLNTLGIATARLDFAPYGLNPPHIHPRGTEMLLV  120

Query  452  LEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSSQ  631
            +EGTL+VGFV SN    + N LFTK L  GDVFVFP+GLIHFQ N+G+TNA+AFA LSSQ
Sbjct  121  VEGTLHVGFVTSNQ---LNNTLFTKVLTKGDVFVFPQGLIHFQLNIGQTNALAFAFLSSQ  177

Query  632  NPGVITIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQFWYNN  766
            NPG+ITIAN VFGS PPIN  VLTKAFQV   +INYLQAQ W+ N
Sbjct  178  NPGLITIANTVFGSKPPINVDVLTKAFQVDNKLINYLQAQNWFEN  222



>ref|XP_002277055.1| PREDICTED: putative germin-like protein 2-1 [Vitis vinifera]
 emb|CBI38542.3| unnamed protein product [Vitis vinifera]
Length=228

 Score =   297 bits (761),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 147/218 (67%), Positives = 172/218 (79%), Gaps = 4/218 (2%)
 Frame = +2

Query  113  ITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFFFRGLNMPG  292
            I + A++ S A+ASDPSPLQDFCVAVND+ AAVFVNGK C++P     NDF F GL +PG
Sbjct  12   IALFAMAFSLAYASDPSPLQDFCVAVNDTNAAVFVNGKFCQDPKLATPNDFSFSGLRLPG  71

Query  293  NTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLYV  472
            NTSN LGS VTP +V  +PGLNTLG+SL R+D+AP GLNPPHTHPRATE+L VLEGTLYV
Sbjct  72   NTSNQLGSMVTPASVAQIPGLNTLGVSLARVDYAPYGLNPPHTHPRATEILTVLEGTLYV  131

Query  473  GFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSSQNPGVITI  652
            GFV SNP     N L +K L  GDVFVFP+GLIHFQ NVG TNA+A A LSSQNPGVITI
Sbjct  132  GFVTSNP----DNRLISKVLYKGDVFVFPQGLIHFQLNVGTTNAVAIASLSSQNPGVITI  187

Query  653  ANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQFWYNN  766
            A AVFGS P I+  VLTKAFQ+ ++V+  LQ++FW +N
Sbjct  188  ARAVFGSKPAISVDVLTKAFQLDKDVVANLQSKFWTDN  225



>ref|XP_007030274.1| Germin-like protein subfamily 1 member 18 [Theobroma cacao]
 gb|EOY10776.1| Germin-like protein subfamily 1 member 18 [Theobroma cacao]
Length=675

 Score =   311 bits (798),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 160/248 (65%), Positives = 187/248 (75%), Gaps = 6/248 (2%)
 Frame = +2

Query  29   TQTKKLFYNSDTL-TQNIFDMAIRFIVFTITVVALSSSFAHASDPSPLQDFCVAVNDSMA  205
            T+  +L  N D      I    ++  V     +A + S A ASDPSPLQDFCVA+ND+  
Sbjct  431  TKAFQLDKNVDRFPASGILMKGVQLFVVASAFLAFAWSLASASDPSPLQDFCVAINDTKD  490

Query  206  AVFVNGKICKNPMQVVANDFFFRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRI  385
             VFVNGK CK+P    A DFF+ GLN+P NTSNP+GS VTPVNV  + GLNTLGISL RI
Sbjct  491  GVFVNGKFCKDPKLAKAEDFFYSGLNIPRNTSNPVGSTVTPVNVAQILGLNTLGISLARI  550

Query  386  DFAP-NGLNPPHTHPRATEVLLVLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPE  562
            D+AP  GLNPPHTHPRATE+L+VLEGTLYVGFV SNP    +N L TK L  GDVFVFP 
Sbjct  551  DYAPYGGLNPPHTHPRATEILVVLEGTLYVGFVTSNP----ENRLITKVLYPGDVFVFPV  606

Query  563  GLIHFQFNVGKTNAIAFAGLSSQNPGVITIANAVFGSNPPINPQVLTKAFQVGQNVINYL  742
            GLIHFQ N+GKTNA+AFAGLSSQNPGVITIANAVFGS PPINP VLTKAFQ+ +N++  L
Sbjct  607  GLIHFQLNIGKTNAVAFAGLSSQNPGVITIANAVFGSKPPINPDVLTKAFQLDKNIVTSL  666

Query  743  QAQFWYNN  766
            Q++FW++N
Sbjct  667  QSRFWWDN  674


 Score =   290 bits (742),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 151/223 (68%), Positives = 175/223 (78%), Gaps = 5/223 (2%)
 Frame = +2

Query  74   NIFDMAIRFIVFTITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVV  253
             IF++  R ++         ++ A A DPSPLQDFCVA+ND+   VFVNGK CK+P   V
Sbjct  225  KIFEITNRTLILLHERCLAVAAAASAFDPSPLQDFCVAINDTKNGVFVNGKFCKDPKLAV  284

Query  254  ANDFFFRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAP-NGLNPPHTHPR  430
            A+DFF+ GLNMPGNTSNP+GS VT VNV+ +PGLNTLGISLVRID+AP  GLNPPHTHPR
Sbjct  285  ADDFFYSGLNMPGNTSNPVGSNVTTVNVDQIPGLNTLGISLVRIDYAPYGGLNPPHTHPR  344

Query  431  ATEVLLVLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIA  610
             TE+L+V+EGTLYVGFV SNP    +N LFTK L  GDVFVFP GLIHFQFN+GKT A+A
Sbjct  345  GTEILVVVEGTLYVGFVTSNP----ENRLFTKVLNPGDVFVFPIGLIHFQFNIGKTAAVA  400

Query  611  FAGLSSQNPGVITIANAVFGSNPPINPQVLTKAFQVGQNVINY  739
            FAGLSSQN GVITIA AVFGSNPPI P VLTKAFQ+ +NV  +
Sbjct  401  FAGLSSQNAGVITIAKAVFGSNPPIKPDVLTKAFQLDKNVDRF  443


 Score =   126 bits (316),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 67/104 (64%), Positives = 79/104 (76%), Gaps = 4/104 (4%)
 Frame = +2

Query  425  PRATEVLLVLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNA  604
            P+  ++L+++EGTLYVG V SNP    +N   TK L  GD F+FP GLIHFQFNVGKTNA
Sbjct  52   PKHGKILVIMEGTLYVGLVTSNP----ENHPITKVLNPGDGFLFPVGLIHFQFNVGKTNA  107

Query  605  IAFAGLSSQNPGVITIANAVFGSNPPINPQVLTKAFQVGQNVIN  736
            +AFA LSSQNP VITI NAVFGSNP INP VL K FQ+  N+I+
Sbjct  108  VAFAALSSQNPDVITIVNAVFGSNPAINPDVLVKDFQLDINMIS  151



>ref|XP_010066338.1| PREDICTED: germin-like protein subfamily 1 member 7 isoform X1 
[Eucalyptus grandis]
 ref|XP_010066339.1| PREDICTED: germin-like protein subfamily 1 member 7 isoform X2 
[Eucalyptus grandis]
 ref|XP_010066340.1| PREDICTED: germin-like protein subfamily 1 member 7 isoform X3 
[Eucalyptus grandis]
 ref|XP_010066341.1| PREDICTED: germin-like protein subfamily 1 member 7 [Eucalyptus 
grandis]
 ref|XP_010066345.1| PREDICTED: germin-like protein subfamily 1 member 7 [Eucalyptus 
grandis]
 ref|XP_010066346.1| PREDICTED: germin-like protein subfamily 1 member 7 [Eucalyptus 
grandis]
Length=220

 Score =   297 bits (760),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 151/225 (67%), Positives = 178/225 (79%), Gaps = 5/225 (2%)
 Frame = +2

Query  92   IRFIVFTITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFFF  271
            ++F+  ++ ++AL+++ A A DPSPLQDFCVA+ND    VFVNGK CK+P QV A DF F
Sbjct  1    MKFLPISLLILALATATAFAYDPSPLQDFCVAINDP--KVFVNGKFCKDPKQVTAEDFLF  58

Query  272  RGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLV  451
            +G   PGNT+NPLGSKVTP  V+  PG+NTLGIS+ RIDFAP GLNPPHTHPR TE+L+V
Sbjct  59   KGFRYPGNTANPLGSKVTPAFVDQFPGINTLGISMARIDFAPGGLNPPHTHPRGTEILVV  118

Query  452  LEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSSQ  631
             EGTL VGFV SN    + N  FTK L  GDVFVFP GLIHFQ N+GKT A+AFA LSSQ
Sbjct  119  AEGTLLVGFVTSN---QLNNTFFTKVLYKGDVFVFPIGLIHFQLNIGKTPALAFAALSSQ  175

Query  632  NPGVITIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQFWYNN  766
            NPGVITIANAVFGS PPI+  VLTKAFQV + V++YLQAQFWY+N
Sbjct  176  NPGVITIANAVFGSKPPISADVLTKAFQVDKKVVDYLQAQFWYDN  220



>ref|XP_010024911.1| PREDICTED: germin-like protein subfamily 1 member 7 [Eucalyptus 
grandis]
 gb|KCW61444.1| hypothetical protein EUGRSUZ_H04175 [Eucalyptus grandis]
Length=221

 Score =   297 bits (760),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 153/225 (68%), Positives = 179/225 (80%), Gaps = 5/225 (2%)
 Frame = +2

Query  92   IRFIVFTITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFFF  271
            ++F+  ++ ++AL+++ A A DPSPLQDFCVA+ND    VFVNGK CK+  QV A+DF F
Sbjct  1    MKFLPTSLLILALATATAFAFDPSPLQDFCVAINDP--KVFVNGKFCKDQKQVTADDFLF  58

Query  272  RGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLV  451
            +G   PGNT+NPLGSKVTP  V+  PGLNTLGIS+ RIDFAP GLNPPHTHPR TEVL+V
Sbjct  59   KGFRYPGNTANPLGSKVTPAFVDQFPGLNTLGISMARIDFAPGGLNPPHTHPRGTEVLVV  118

Query  452  LEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSSQ  631
             EGTL VGFV SN    + N LFTK L  GDVFVFP GLIHFQ N+GKT A+AFA LSSQ
Sbjct  119  TEGTLLVGFVTSN---QLNNTLFTKVLYKGDVFVFPIGLIHFQLNIGKTPALAFAALSSQ  175

Query  632  NPGVITIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQFWYNN  766
            NPGVITIANAVFGS PPI+  VLTKAFQV + V++YLQAQFWY+N
Sbjct  176  NPGVITIANAVFGSKPPISADVLTKAFQVDKKVVDYLQAQFWYDN  220



>emb|CBI36815.3| unnamed protein product [Vitis vinifera]
Length=220

 Score =   296 bits (759),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 149/222 (67%), Positives = 175/222 (79%), Gaps = 5/222 (2%)
 Frame = +2

Query  89   AIRFIVFTITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFF  268
             + F+V T+ ++AL SS A ASDPSPLQD CVA+++   AVFVNGK CK+P   VA DFF
Sbjct  4    GVSFLV-TVVLMALVSSLASASDPSPLQDTCVAIDEPKDAVFVNGKFCKDPKLTVAEDFF  62

Query  269  FRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLL  448
            F GL+ PGNTSN + S VT VNV  + GLNTLGIS+VRID+ P G NPPHTHPRATE+L 
Sbjct  63   FSGLDKPGNTSNAVASNVTTVNVEQIKGLNTLGISMVRIDYEPYGQNPPHTHPRATEILT  122

Query  449  VLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSS  628
            VLEGTLYVGFV SN     +N L +K L  GDVFVFP GLIHFQFN+G TNA+A AGLSS
Sbjct  123  VLEGTLYVGFVTSN----TENRLISKVLNKGDVFVFPMGLIHFQFNIGHTNAVAIAGLSS  178

Query  629  QNPGVITIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQF  754
            QNPGVITIANAVFGS+P INP  LT+AFQ+ +NV+NYLQ++F
Sbjct  179  QNPGVITIANAVFGSDPSINPDFLTRAFQLDKNVVNYLQSRF  220



>ref|XP_002284320.1| PREDICTED: germin-like protein subfamily 1 member 14 [Vitis vinifera]
 emb|CBI36817.3| unnamed protein product [Vitis vinifera]
Length=220

 Score =   296 bits (759),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 150/221 (68%), Positives = 175/221 (79%), Gaps = 5/221 (2%)
 Frame = +2

Query  92   IRFIVFTITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFFF  271
            + F+V T+ +VAL SS A ASDPSPLQD CVA+++   AVFVNGK CK+P   VA DFFF
Sbjct  5    VSFLV-TVALVALVSSLASASDPSPLQDTCVAIDEPKDAVFVNGKFCKDPKLTVAEDFFF  63

Query  272  RGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLV  451
             GL+ PGNTSN + S VT VNV  + GLNTLGIS+VRID+ P G NPPHTHPRATE+L V
Sbjct  64   SGLDKPGNTSNAVASNVTTVNVEQIKGLNTLGISMVRIDYEPYGQNPPHTHPRATEILTV  123

Query  452  LEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSSQ  631
            L GTLYVGFV SNP    +N L +K L  GDVFVFP GLIHFQFNVGKT A+A A LSSQ
Sbjct  124  LGGTLYVGFVTSNP----ENRLISKVLNKGDVFVFPIGLIHFQFNVGKTKAVAIAALSSQ  179

Query  632  NPGVITIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQF  754
            NPGVITIANAVFGS+PPINP VLT+AFQ+ + V++YLQ++F
Sbjct  180  NPGVITIANAVFGSDPPINPDVLTRAFQLDKKVVSYLQSRF  220



>ref|XP_010024918.1| PREDICTED: germin-like protein subfamily 1 member 13 [Eucalyptus 
grandis]
 gb|KCW61457.1| hypothetical protein EUGRSUZ_H04193 [Eucalyptus grandis]
Length=223

 Score =   296 bits (759),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 146/204 (72%), Positives = 163/204 (80%), Gaps = 3/204 (1%)
 Frame = +2

Query  155  DPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFFFRGLNMPGNTSNPLGSKVTPVN  334
            DPSPLQD CVA+ND  +AVFVNG+ CK+P Q  A+DF F G   PGNT+NPLGSKVTP  
Sbjct  22   DPSPLQDICVAINDPKSAVFVNGEFCKDPKQANADDFTFMGFRKPGNTANPLGSKVTPAT  81

Query  335  VNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLYVGFVLSNPPPGMKNP  514
            VN  PGLNTLGIS  RIDFAP GLNPPHTHPR TEVL+V+EGTL VGFV SN    + N 
Sbjct  82   VNEFPGLNTLGISAARIDFAPGGLNPPHTHPRGTEVLVVIEGTLLVGFVTSN---QLNNT  138

Query  515  LFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSSQNPGVITIANAVFGSNPPINPQ  694
            LFTK L  GDVFVFP GLIHFQ N GKT A+AFAGLSSQNPGVITIAN+VFG+ PPI+  
Sbjct  139  LFTKVLYKGDVFVFPIGLIHFQLNTGKTPALAFAGLSSQNPGVITIANSVFGTKPPISAD  198

Query  695  VLTKAFQVGQNVINYLQAQFWYNN  766
            VLTKAFQV +  ++YLQAQFWY+N
Sbjct  199  VLTKAFQVDKKTVDYLQAQFWYDN  222



>ref|NP_001268128.1| germin-like protein 5 [Vitis vinifera]
 gb|ABL60874.1| germin-like protein 5 [Vitis vinifera]
 emb|CBI39475.3| unnamed protein product [Vitis vinifera]
Length=207

 Score =   296 bits (757),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 150/211 (71%), Positives = 168/211 (80%), Gaps = 4/211 (2%)
 Frame = +2

Query  122  VALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFFFRGLNMPGNTS  301
            + L+SS A A DPSPLQD CVA++D  AAVFVNGK CKNP   VA DFFF+GLN+PGNT 
Sbjct  1    MELASSLASAFDPSPLQDTCVAIDDPKAAVFVNGKFCKNPNLTVAEDFFFQGLNIPGNTE  60

Query  302  NPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLYVGFV  481
            NPLG  VT VNV+ +PGLNTLGISLVRID+AP G NPPHTHPR TE++ VLEGTLYVGFV
Sbjct  61   NPLGFNVTTVNVDQIPGLNTLGISLVRIDYAPYGQNPPHTHPRGTEIITVLEGTLYVGFV  120

Query  482  LSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSSQNPGVITIANA  661
             SNP    +N L +K L  GDV+VFP GLIHFQFNVG  NA+A A LSSQNPGVITIANA
Sbjct  121  TSNP----ENRLISKLLNKGDVYVFPIGLIHFQFNVGHANAVAIAALSSQNPGVITIANA  176

Query  662  VFGSNPPINPQVLTKAFQVGQNVINYLQAQF  754
            VFGSNPPINP  L KAFQ+ + V+ YLQA F
Sbjct  177  VFGSNPPINPDFLAKAFQLDKKVVEYLQAHF  207



>ref|XP_010024919.1| PREDICTED: germin-like protein subfamily 1 member 13 [Eucalyptus 
grandis]
 ref|XP_010042113.1| PREDICTED: germin-like protein subfamily 1 member 13 [Eucalyptus 
grandis]
 gb|KCW61458.1| hypothetical protein EUGRSUZ_H04194 [Eucalyptus grandis]
Length=223

 Score =   296 bits (759),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 146/204 (72%), Positives = 163/204 (80%), Gaps = 3/204 (1%)
 Frame = +2

Query  155  DPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFFFRGLNMPGNTSNPLGSKVTPVN  334
            DPSPLQD CVA+ND  +AVFVNG+ CK+P Q  A+DF F G   PGNT+NPLGSKVTP  
Sbjct  22   DPSPLQDICVAINDPKSAVFVNGEFCKDPKQANADDFTFMGFRKPGNTANPLGSKVTPAT  81

Query  335  VNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLYVGFVLSNPPPGMKNP  514
            VN  PGLNTLGIS  RIDFAP GLNPPHTHPR TEVL+V+EGTL VGFV SN    + N 
Sbjct  82   VNEFPGLNTLGISAARIDFAPGGLNPPHTHPRGTEVLVVIEGTLLVGFVTSN---QLNNT  138

Query  515  LFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSSQNPGVITIANAVFGSNPPINPQ  694
            LFTK L  GDVFVFP GLIHFQ N GKT A+AFAGLSSQNPGVITIAN+VFG+ PPI+  
Sbjct  139  LFTKVLYKGDVFVFPIGLIHFQLNTGKTPALAFAGLSSQNPGVITIANSVFGAKPPISAD  198

Query  695  VLTKAFQVGQNVINYLQAQFWYNN  766
            VLTKAFQV +  ++YLQAQFWY+N
Sbjct  199  VLTKAFQVDKKTVDYLQAQFWYDN  222



>gb|EPS67173.1| hypothetical protein M569_07603 [Genlisea aurea]
Length=220

 Score =   296 bits (758),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 151/211 (72%), Positives = 169/211 (80%), Gaps = 4/211 (2%)
 Frame = +2

Query  122  VALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFFFRGLNMPGNTS  301
            +AL  +F  ASDP+ LQDFCVAV DS   VFVNGK CKNP  VVA+DF F GLN+PGNT+
Sbjct  14   IALLLAFTSASDPTQLQDFCVAVPDSANPVFVNGKFCKNPATVVADDFVFHGLNVPGNTT  73

Query  302  NPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLYVGFV  481
            N  GS VTPV V+ LPGLNTLG+++ RIDFAP+GLNPPH HPRA+E LLVLEG LYVGFV
Sbjct  74   NKEGSAVTPVFVSQLPGLNTLGVAMARIDFAPHGLNPPHVHPRASEALLVLEGNLYVGFV  133

Query  482  LSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSSQNPGVITIANA  661
             SNP     N LF KTL  GDVFVFP+GLIHFQ NVG TNA+A A L SQNPGVIT+ANA
Sbjct  134  TSNP----DNKLFAKTLCPGDVFVFPQGLIHFQLNVGSTNAVAIATLGSQNPGVITVANA  189

Query  662  VFGSNPPINPQVLTKAFQVGQNVINYLQAQF  754
            VFGS PPINP VL KAFQV ++VI+YLQAQF
Sbjct  190  VFGSQPPINPDVLVKAFQVDKSVISYLQAQF  220



>ref|XP_002276926.2| PREDICTED: uncharacterized protein LOC100251187, partial [Vitis 
vinifera]
Length=447

 Score =   304 bits (779),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 151/218 (69%), Positives = 171/218 (78%), Gaps = 4/218 (2%)
 Frame = +2

Query  113  ITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFFFRGLNMPG  292
            I ++A++ S A ASDPSPLQDFCVAVNDS AAVFV GK C++P     NDFFF GL +PG
Sbjct  231  IALLAMAFSLASASDPSPLQDFCVAVNDSNAAVFVKGKFCRDPKLATPNDFFFSGLRLPG  290

Query  293  NTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLYV  472
            NTSN LGS VTP NV  +PGLNTLG+SL R+D+AP GLNPPH HPRATE+L VLEGTLYV
Sbjct  291  NTSNKLGSMVTPANVAQIPGLNTLGVSLARVDYAPYGLNPPHIHPRATEILTVLEGTLYV  350

Query  473  GFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSSQNPGVITI  652
             FV SNP     N L +K L  GDVFVFP+GLIHFQ NVG TNA+A A LSSQNPGVITI
Sbjct  351  AFVTSNP----DNHLISKVLYKGDVFVFPQGLIHFQLNVGTTNAVAIASLSSQNPGVITI  406

Query  653  ANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQFWYNN  766
            ANAVFGS P I+  VLTKAFQV +NV+  LQ+QFW +N
Sbjct  407  ANAVFGSKPAISADVLTKAFQVDKNVVECLQSQFWTDN  444


 Score =   289 bits (739),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 145/209 (69%), Positives = 163/209 (78%), Gaps = 4/209 (2%)
 Frame = +2

Query  113  ITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFFFRGLNMPG  292
            I ++A + S A ASDPSPLQDFCVAVND+  AVFVNGK CK+P     NDFFF GL +PG
Sbjct  5    IVLLATAFSVASASDPSPLQDFCVAVNDTKDAVFVNGKFCKDPKLATPNDFFFSGLRLPG  64

Query  293  NTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLYV  472
            NTSN LGS VTP NV  +PGLNTLG+SL R+D+AP GLNPPH HPRATE+L VLEG LYV
Sbjct  65   NTSNKLGSMVTPANVAQIPGLNTLGVSLARVDYAPYGLNPPHIHPRATEILTVLEGALYV  124

Query  473  GFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSSQNPGVITI  652
            GFV SNP     N L +K L  GDVFVFP+GLIHFQ NVG TNA+A A LSSQNPGVITI
Sbjct  125  GFVTSNP----DNRLISKVLYKGDVFVFPQGLIHFQLNVGTTNAVAIASLSSQNPGVITI  180

Query  653  ANAVFGSNPPINPQVLTKAFQVGQNVINY  739
            ANAVFGS P I+  VLTKAFQV +NV+ +
Sbjct  181  ANAVFGSKPAISADVLTKAFQVDKNVVEF  209



>ref|XP_011034445.1| PREDICTED: germin-like protein subfamily 1 member 7 [Populus 
euphratica]
 ref|XP_011038441.1| PREDICTED: germin-like protein subfamily 1 member 7 [Populus 
euphratica]
Length=221

 Score =   296 bits (758),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 152/217 (70%), Positives = 171/217 (79%), Gaps = 2/217 (1%)
 Frame = +2

Query  104  VFTITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFFFRGLN  283
            V    ++AL+SSFA A DPSPLQDFCVAV D    VFVNGK CK+P  V A DFF  GLN
Sbjct  7    VLVFVLLALASSFASAFDPSPLQDFCVAV-DETDGVFVNGKFCKDPKDVTAKDFFSSGLN  65

Query  284  MPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGT  463
            +PG+TS  +GS VT VNV  +PGLNTLGISL RIDFAP GLNPPHTHPRATE+++V+EGT
Sbjct  66   IPGDTSGRVGSNVTAVNVEKIPGLNTLGISLARIDFAPYGLNPPHTHPRATEIIVVVEGT  125

Query  464  LYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSSQNPGV  643
            LYVGFV SN   G  N L TK L  GDVFVFP GLIHFQFN+G+T A+AFAGLSSQNPGV
Sbjct  126  LYVGFVTSNLANG-DNRLITKALKPGDVFVFPIGLIHFQFNMGQTKALAFAGLSSQNPGV  184

Query  644  ITIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQF  754
            ITIANAVFGS+PPINP VL KAFQ+ + V+ YLQ  F
Sbjct  185  ITIANAVFGSDPPINPDVLAKAFQLDKKVVEYLQKSF  221



>ref|XP_010042132.1| PREDICTED: germin-like protein subfamily 1 member 13 [Eucalyptus 
grandis]
Length=223

 Score =   296 bits (758),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 145/204 (71%), Positives = 163/204 (80%), Gaps = 3/204 (1%)
 Frame = +2

Query  155  DPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFFFRGLNMPGNTSNPLGSKVTPVN  334
            DPSPLQD CVA+ND  +AVFVNG+ CK+P Q  A+DF F G   PGNT+NPLGSKVTP  
Sbjct  22   DPSPLQDICVAINDPKSAVFVNGEFCKDPKQATADDFTFMGFRNPGNTANPLGSKVTPAT  81

Query  335  VNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLYVGFVLSNPPPGMKNP  514
            VN  PGLNTLGIS+ RIDFAP GLNPPHTHPR TEVL+V+EGTL VGFV SN    + N 
Sbjct  82   VNEFPGLNTLGISMARIDFAPGGLNPPHTHPRGTEVLVVIEGTLLVGFVTSN---QLNNT  138

Query  515  LFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSSQNPGVITIANAVFGSNPPINPQ  694
            LFTK L  GDVFVFP GLIHFQ N GKT A+AFA LSSQNPGVITIAN+VFG+ PPI+  
Sbjct  139  LFTKVLYKGDVFVFPIGLIHFQLNTGKTPALAFASLSSQNPGVITIANSVFGAKPPISAD  198

Query  695  VLTKAFQVGQNVINYLQAQFWYNN  766
            VLTKAFQV +  ++YLQAQFWY+N
Sbjct  199  VLTKAFQVDKKTVDYLQAQFWYDN  222



>ref|XP_010050157.1| PREDICTED: germin-like protein subfamily 1 member 13 [Eucalyptus 
grandis]
 gb|KCW89287.1| hypothetical protein EUGRSUZ_A01577 [Eucalyptus grandis]
Length=223

 Score =   296 bits (758),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 146/225 (65%), Positives = 173/225 (77%), Gaps = 3/225 (1%)
 Frame = +2

Query  92   IRFIVFTITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFFF  271
            ++ +  +  ++AL++  A A DPSPLQD CVA ND  + VFVNGK CK+P Q  A+DF F
Sbjct  1    MKCLPISFLILALATVTAFAYDPSPLQDICVATNDLNSGVFVNGKFCKDPKQATADDFLF  60

Query  272  RGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLV  451
             G   PGNT+NPLGSKVTP  V+  PGLNTLGIS+ R+DFAP GLNPPHTHPR TEVL+V
Sbjct  61   MGFRNPGNTTNPLGSKVTPAFVDQFPGLNTLGISMARLDFAPGGLNPPHTHPRGTEVLVV  120

Query  452  LEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSSQ  631
            +EGTL VGF+ SN    + N LFTK L  GDVFVFP GLIHFQ N G T A+AFAGLSSQ
Sbjct  121  VEGTLLVGFITSNQ---LNNTLFTKVLYKGDVFVFPIGLIHFQLNCGNTYALAFAGLSSQ  177

Query  632  NPGVITIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQFWYNN  766
            NPGVITIANAVFG+  PI+  VLTKAFQV + V++YL+AQFWY+N
Sbjct  178  NPGVITIANAVFGAKSPISADVLTKAFQVDKKVVDYLEAQFWYDN  222



>ref|NP_001240963.1| germin-like protein subfamily 1 member 7-like precursor [Glycine 
max]
 gb|ACG69487.1| germin-like protein 11 [Glycine max]
Length=232

 Score =   296 bits (758),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 154/230 (67%), Positives = 176/230 (77%), Gaps = 8/230 (3%)
 Frame = +2

Query  92   IRFIVFTITVVALSSSFAHASDPSPLQDFCVAVNDS----MAAVFVNGKICKNPMQVVAN  259
            ++   F + ++AL+SS A   DPSPLQDFCVA+ND+    +  VFVNGK CK+P    A+
Sbjct  1    MKVFYFFVVLLALASSVAFGYDPSPLQDFCVAINDTKTGGLYGVFVNGKFCKDPKFAYAD  60

Query  260  DFFFRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATE  439
            DFFF GL  PGNT+NP GSKVT V VN + GLNTLGISL RIDFAP GLNPPHTHPR TE
Sbjct  61   DFFFGGLG-PGNTANPQGSKVTAVTVNEILGLNTLGISLARIDFAPKGLNPPHTHPRGTE  119

Query  440  VLLVLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAG  619
            +L+VLEGTLYVGFV SN      N LFTK L  GDVFVFP GL+HFQ N+G  NA+A AG
Sbjct  120  ILVVLEGTLYVGFVASNQ---NDNRLFTKVLYKGDVFVFPIGLVHFQQNIGYGNAVAIAG  176

Query  620  LSSQNPGVITIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQFWYNNS  769
            LSSQNPGVITIANAVFGS PPI+ +VL KAFQV +NVI+YLQ QF YNN 
Sbjct  177  LSSQNPGVITIANAVFGSKPPISDEVLAKAFQVDKNVIDYLQKQFGYNNK  226



>ref|XP_010659615.1| PREDICTED: germin-like protein subfamily 1 member 14 [Vitis vinifera]
 emb|CBI39472.3| unnamed protein product [Vitis vinifera]
Length=220

 Score =   295 bits (756),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 148/221 (67%), Positives = 174/221 (79%), Gaps = 5/221 (2%)
 Frame = +2

Query  92   IRFIVFTITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFFF  271
            + F+V T+ +VAL SS A ASDPSPLQD CVA+++   AVFVNGK CK+P    A DFFF
Sbjct  5    VSFLV-TVALVALVSSLASASDPSPLQDTCVAIDEPKDAVFVNGKFCKDPKLTEAEDFFF  63

Query  272  RGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLV  451
             GL+ PGNTSNP+ S VT VNV  + GLNTLGIS+VRID+ P G NPPHTHPRATE+L V
Sbjct  64   SGLDKPGNTSNPVASNVTTVNVEQIKGLNTLGISMVRIDYEPYGQNPPHTHPRATEILTV  123

Query  452  LEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSSQ  631
            LEGTLYVGFV SN     ++   +K L  GDVFVFP GLIHFQFNVGKT A+A A LSSQ
Sbjct  124  LEGTLYVGFVTSN----TEDRFISKVLNKGDVFVFPIGLIHFQFNVGKTKAVAIAALSSQ  179

Query  632  NPGVITIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQF  754
            NPGVITIANAVFGS+PPINP VLT+AFQ+ + V++YLQ++F
Sbjct  180  NPGVITIANAVFGSDPPINPDVLTRAFQLDKKVVSYLQSRF  220



>gb|KHN14792.1| Germin-like protein subfamily 1 member 7 [Glycine soja]
Length=232

 Score =   296 bits (757),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 154/230 (67%), Positives = 176/230 (77%), Gaps = 8/230 (3%)
 Frame = +2

Query  92   IRFIVFTITVVALSSSFAHASDPSPLQDFCVAVNDSMAA----VFVNGKICKNPMQVVAN  259
            ++ +   + ++AL+SS A A DPSPLQDFCVA+ND+ A     VFVNGK CK+P    A+
Sbjct  1    MKVVYLFVVLMALASSVAFAYDPSPLQDFCVAINDTKAGGLYGVFVNGKFCKDPKFAYAD  60

Query  260  DFFFRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATE  439
            DFFF GL  PGNT+NP GSKVT V VN + GLNTLGISL RIDFAP GLNPPHTHPR TE
Sbjct  61   DFFFGGLG-PGNTANPQGSKVTAVTVNEILGLNTLGISLARIDFAPKGLNPPHTHPRGTE  119

Query  440  VLLVLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAG  619
            +L+VLEGTLYVGFV SN      N LFTK L  GDVFVFP GLIHFQ NVG  NA+A A 
Sbjct  120  ILVVLEGTLYVGFVASNQN---DNRLFTKVLYKGDVFVFPIGLIHFQQNVGYGNAVAIAA  176

Query  620  LSSQNPGVITIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQFWYNNS  769
            LSSQNPGVITIANAVFGS PPI+ +VL KAFQV +N+++YLQ QF YNN 
Sbjct  177  LSSQNPGVITIANAVFGSKPPISDEVLAKAFQVDKNIVDYLQKQFGYNNK  226



>ref|XP_002319672.1| hypothetical protein POPTR_0013s04850g [Populus trichocarpa]
 gb|EEE95595.1| hypothetical protein POPTR_0013s04850g [Populus trichocarpa]
Length=221

 Score =   295 bits (756),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 151/217 (70%), Positives = 170/217 (78%), Gaps = 2/217 (1%)
 Frame = +2

Query  104  VFTITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFFFRGLN  283
            V    ++AL+SSFA A DPSPLQDFCVAV D    VFVNGK CK+P  V   DFF  GLN
Sbjct  7    VLVFVLLALASSFASAFDPSPLQDFCVAV-DETDGVFVNGKFCKDPKDVTEKDFFSSGLN  65

Query  284  MPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGT  463
            +PG+TS  +GS VT VN+  +PGLNTLGIS  RIDFAP GLNPPHTHPRATE+++V+EGT
Sbjct  66   IPGDTSGRVGSNVTAVNIEKIPGLNTLGISFARIDFAPYGLNPPHTHPRATEIIVVVEGT  125

Query  464  LYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSSQNPGV  643
            LYVGFV SN   G  N L TK L  GDVFVFP GLIHFQFNVGKT A+AFAGLSSQNPGV
Sbjct  126  LYVGFVTSNLANG-DNRLITKALKPGDVFVFPIGLIHFQFNVGKTKALAFAGLSSQNPGV  184

Query  644  ITIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQF  754
            ITIANAVFGS+PPINP VL KAFQ+ + V++YLQ  F
Sbjct  185  ITIANAVFGSDPPINPDVLAKAFQLDKKVVDYLQKAF  221



>gb|KHN04965.1| Germin-like protein subfamily 1 member 7 [Glycine soja]
Length=232

 Score =   296 bits (757),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 154/230 (67%), Positives = 176/230 (77%), Gaps = 8/230 (3%)
 Frame = +2

Query  92   IRFIVFTITVVALSSSFAHASDPSPLQDFCVAVNDS----MAAVFVNGKICKNPMQVVAN  259
            ++   F + ++AL+SS A   DPSPLQDFCVA+ND+    +  VFVNGK CK+P    A+
Sbjct  1    MKVFYFFVVLLALASSVAFGYDPSPLQDFCVAINDTKTGGLYGVFVNGKFCKDPKFAYAD  60

Query  260  DFFFRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATE  439
            DFFF GL  PGNT+NP GSKVT V VN + GLNTLGISL RIDFAP GLNPPHTHPR TE
Sbjct  61   DFFFGGLG-PGNTANPQGSKVTAVTVNEILGLNTLGISLARIDFAPKGLNPPHTHPRGTE  119

Query  440  VLLVLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAG  619
            +L+VLEGTLYVGFV SN      N LFTK L  GDVFVFP GL+HFQ N+G  NA+A AG
Sbjct  120  ILVVLEGTLYVGFVASNQ---NDNRLFTKVLYKGDVFVFPIGLVHFQQNIGYGNALAIAG  176

Query  620  LSSQNPGVITIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQFWYNNS  769
            LSSQNPGVITIANAVFGS PPI+ +VL KAFQV +NVI+YLQ QF YNN 
Sbjct  177  LSSQNPGVITIANAVFGSKPPISDEVLAKAFQVDKNVIDYLQKQFGYNNK  226



>ref|XP_011099650.1| PREDICTED: germin-like protein subfamily 1 member 13 [Sesamum 
indicum]
Length=231

 Score =   295 bits (756),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 142/222 (64%), Positives = 174/222 (78%), Gaps = 1/222 (0%)
 Frame = +2

Query  104  VFTITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFFFRGLN  283
            V ++ ++ + SS A A DP PLQDFCVAVNDS AAVFVNGKICK+P  V ++DFF  GLN
Sbjct  9    VLSMAILVVGSSPADAYDPDPLQDFCVAVNDSKAAVFVNGKICKDPKTVTSDDFFISGLN  68

Query  284  MPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGT  463
             PGNTSNP GS+VT   V++LPGLNTLGIS+VRIDFAPNG+NPPH HPRA+E+L+VL+G 
Sbjct  69   KPGNTSNPFGSRVTHAFVDDLPGLNTLGISIVRIDFAPNGVNPPHEHPRASEILVVLKGK  128

Query  464  LYVGFVLSNPP-PGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSSQNPG  640
            LY GF+ +NPP P  KN LF K L  GD FVFP+GLIHFQ+NVGKT+A+A A L+SQNPG
Sbjct  129  LYAGFITTNPPNPNHKNKLFAKILKPGDAFVFPKGLIHFQYNVGKTSAVAIASLNSQNPG  188

Query  641  VITIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQFWYNN  766
            ++TI  AVFGS PP+   VL K+FQV + ++ YLQ+  W  N
Sbjct  189  IMTIPKAVFGSEPPVRADVLVKSFQVREKLVEYLQSLPWTGN  230



>ref|XP_007030176.1| Germin-like protein subfamily 1 member 18 [Theobroma cacao]
 gb|EOY10678.1| Germin-like protein subfamily 1 member 18 [Theobroma cacao]
Length=295

 Score =   298 bits (762),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 155/226 (69%), Positives = 177/226 (78%), Gaps = 12/226 (5%)
 Frame = +2

Query  101  IVFTITVVALSSSFAHASDPSPLQDFCVAVND-------SMAAVFVNGKICKNPMQVVAN  259
            I+  I+++ L+ SFA ASDPSPLQDFCVA+ D       S+  +FVNGK CK+P  V A 
Sbjct  40   ILVPISLLVLAFSFATASDPSPLQDFCVALRDAQNGAMFSLYFLFVNGKFCKDPKLVKAE  99

Query  260  DFFFRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAP-NGLNPPHTHPRAT  436
            D FF GLNMPGNTSN LGSK T VNV  +PGLNTLGISL RID+AP  GLNPPHTHPRA+
Sbjct  100  DLFFSGLNMPGNTSNQLGSKFTLVNVEQIPGLNTLGISLARIDYAPYGGLNPPHTHPRAS  159

Query  437  EVLLVLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFA  616
            E+L+V+EGTLYVGFV SNP     N L TK L  GDVFVFP GLIHFQFN+GKTNAIAFA
Sbjct  160  EILVVMEGTLYVGFVTSNP----NNHLITKVLYPGDVFVFPVGLIHFQFNIGKTNAIAFA  215

Query  617  GLSSQNPGVITIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQF  754
            GLSSQNPGVITIANAVFGS   INP VL+KAFQ+ +NV+ YLQ++ 
Sbjct  216  GLSSQNPGVITIANAVFGSKSRINPDVLSKAFQLDENVVRYLQSRL  261



>ref|XP_010024913.1| PREDICTED: germin-like protein subfamily 1 member 7 [Eucalyptus 
grandis]
 gb|KCW61440.1| hypothetical protein EUGRSUZ_H04170 [Eucalyptus grandis]
Length=221

 Score =   295 bits (755),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 152/225 (68%), Positives = 178/225 (79%), Gaps = 5/225 (2%)
 Frame = +2

Query  92   IRFIVFTITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFFF  271
            ++F+  ++ ++AL+++ A A DPSPLQDFCVA+ND    VFVNGK CK+  QV A+DF F
Sbjct  1    MKFLPTSLLILALATATAFAFDPSPLQDFCVAINDP--KVFVNGKFCKDQKQVTADDFLF  58

Query  272  RGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLV  451
            +G   PGNT+NPLGSKVTP  V+  PGLNTLGIS+ RIDFAP GLNPPHTHPR TEVL+V
Sbjct  59   KGFRYPGNTANPLGSKVTPAFVDQFPGLNTLGISMARIDFAPGGLNPPHTHPRGTEVLVV  118

Query  452  LEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSSQ  631
             EG L VGFV SN    + N LFTK L  GDVFVFP GLIHFQ N+GKT A+AFA LSSQ
Sbjct  119  TEGALLVGFVTSN---QLNNTLFTKVLYKGDVFVFPIGLIHFQLNIGKTPALAFAALSSQ  175

Query  632  NPGVITIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQFWYNN  766
            NPGVITIANAVFGS PPI+  VLTKAFQV + V++YLQAQFWY+N
Sbjct  176  NPGVITIANAVFGSKPPISADVLTKAFQVDRKVVDYLQAQFWYDN  220



>ref|XP_007030270.1| Germin-like protein subfamily 1 member 18 [Theobroma cacao]
 gb|EOY10772.1| Germin-like protein subfamily 1 member 18 [Theobroma cacao]
Length=329

 Score =   299 bits (765),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 156/233 (67%), Positives = 176/233 (76%), Gaps = 8/233 (3%)
 Frame = +2

Query  50   YNSDTLTQNIFDMAIRFIVFTITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKI  229
            YN +T    +  M    I+    ++AL SS A ASDPSPLQDFCVA+ND+   VFVNGK 
Sbjct  69   YNQETC---LTTMKGVQILVAFVLLALVSSLASASDPSPLQDFCVAINDAKNGVFVNGKF  125

Query  230  CKNPMQVVANDFFFRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAP-NGL  406
            CK+P    A+DFFF GLN  GNTSN LGSKVTPVNV  +PGLNTLGIS  R+D+AP  GL
Sbjct  126  CKDPKLANADDFFFSGLNKQGNTSNQLGSKVTPVNVEQIPGLNTLGISFARVDYAPYGGL  185

Query  407  NPPHTHPRATEVLLVLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFN  586
            NPPHTHPRATE+L+V+EGTLYVGFV SNP     N L TK L  GDVFVFP GLIHFQFN
Sbjct  186  NPPHTHPRATEILVVVEGTLYVGFVTSNP----DNRLITKVLYPGDVFVFPVGLIHFQFN  241

Query  587  VGKTNAIAFAGLSSQNPGVITIANAVFGSNPPINPQVLTKAFQVGQNVINYLQ  745
             G TNA+AFAGLSSQNPGVITIANAVFGSNP INP+VL KAFQ+ +N+    Q
Sbjct  242  KGNTNAVAFAGLSSQNPGVITIANAVFGSNPAINPEVLAKAFQLEKNIERMKQ  294



>ref|XP_010024914.1| PREDICTED: putative germin-like protein 2-1 [Eucalyptus grandis]
 gb|KCW61439.1| hypothetical protein EUGRSUZ_H04169 [Eucalyptus grandis]
Length=222

 Score =   295 bits (755),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 148/225 (66%), Positives = 177/225 (79%), Gaps = 4/225 (2%)
 Frame = +2

Query  92   IRFIVFTITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFFF  271
            ++F++ T  ++AL+SS A ASDPSPLQDFCVA+NDS +AV VNGK CK+P   VA+DF F
Sbjct  1    MKFLL-TFVLLALASSHAFASDPSPLQDFCVAINDSNSAVLVNGKFCKDPKLAVADDFSF  59

Query  272  RGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLV  451
                 PGNTSNPLGSKVT   V+  PGLNTLGI++ R+DFAP GLNPPH HPR TE+L+V
Sbjct  60   TKFRYPGNTSNPLGSKVTTAFVDQFPGLNTLGIAMARLDFAPYGLNPPHIHPRGTEMLVV  119

Query  452  LEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSSQ  631
            +EGTLYVGFV SN    + N L TK L  GDVFVFP+GLIHFQ N+G+ NA+AFA LSSQ
Sbjct  120  MEGTLYVGFVTSNQ---LNNTLLTKVLTKGDVFVFPQGLIHFQLNIGQANALAFAFLSSQ  176

Query  632  NPGVITIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQFWYNN  766
            NPG+ITIAN+VFGS P IN  VLTKAFQV   +IN+LQAQ W++N
Sbjct  177  NPGLITIANSVFGSKPLINVDVLTKAFQVDNKLINHLQAQNWFDN  221



>ref|XP_002319671.1| hypothetical protein POPTR_0013s04840g [Populus trichocarpa]
 gb|EEE95594.1| hypothetical protein POPTR_0013s04840g [Populus trichocarpa]
Length=221

 Score =   294 bits (753),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 149/217 (69%), Positives = 170/217 (78%), Gaps = 2/217 (1%)
 Frame = +2

Query  104  VFTITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFFFRGLN  283
            V    ++AL+SSFA A DPSPLQDFCVAV D    VFVNGK CK+P  V   DFF  GL+
Sbjct  7    VLVFVLLALASSFASAFDPSPLQDFCVAV-DETDGVFVNGKFCKDPKDVTEKDFFSSGLD  65

Query  284  MPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGT  463
            +PG+TS  +GS VT VN+  +PGLNTLGIS  RIDFAP GLNPPHTHPRATE+++V+EGT
Sbjct  66   IPGDTSGRVGSNVTAVNIEKIPGLNTLGISFARIDFAPYGLNPPHTHPRATEIIVVVEGT  125

Query  464  LYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSSQNPGV  643
            LYVGFV SN   G  N L TK L  GDVFVFP GLIHFQFNVGKT A+AFAGLSSQNPGV
Sbjct  126  LYVGFVTSNLANG-DNRLITKALKPGDVFVFPIGLIHFQFNVGKTKALAFAGLSSQNPGV  184

Query  644  ITIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQF  754
            ITIANAVFGS+PPINP VL KAFQ+ + +++YLQ  F
Sbjct  185  ITIANAVFGSDPPINPDVLAKAFQLDKKIVDYLQKAF  221



>ref|XP_010024917.1| PREDICTED: germin-like protein subfamily 1 member 7 [Eucalyptus 
grandis]
 gb|KCW61455.1| hypothetical protein EUGRSUZ_H04191 [Eucalyptus grandis]
Length=221

 Score =   294 bits (753),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 151/225 (67%), Positives = 177/225 (79%), Gaps = 5/225 (2%)
 Frame = +2

Query  92   IRFIVFTITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFFF  271
            ++F+  ++ ++AL+++ A A DPSPLQDFCVA+ND    VFVNGK CK+P QV A+DF F
Sbjct  1    MKFLPTSLLILALATATAFAFDPSPLQDFCVAINDP--EVFVNGKFCKDPKQVTADDFLF  58

Query  272  RGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLV  451
            +G   PGNT NPLGSKVTP  V+  PGLNTLGIS+ RIDFAP GLNPPHTHPR TE+L+V
Sbjct  59   KGFRYPGNTVNPLGSKVTPAFVDQFPGLNTLGISMARIDFAPGGLNPPHTHPRGTEILVV  118

Query  452  LEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSSQ  631
             EGTL VGFV SN    + N  FTK L  GDVFVFP GLIHFQ N+GKT  +AFA LSSQ
Sbjct  119  AEGTLLVGFVTSN---QLNNTFFTKVLYKGDVFVFPIGLIHFQLNIGKTPTLAFAALSSQ  175

Query  632  NPGVITIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQFWYNN  766
            NPGVITIANAVFGS PPI+  VLTKAFQV + V++YLQAQFWY+N
Sbjct  176  NPGVITIANAVFGSKPPISADVLTKAFQVDKKVVDYLQAQFWYDN  220



>emb|CBI36810.3| unnamed protein product [Vitis vinifera]
Length=305

 Score =   297 bits (760),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 150/226 (66%), Positives = 179/226 (79%), Gaps = 5/226 (2%)
 Frame = +2

Query  89   AIRFIVFTITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFF  268
             + F+V T+ ++AL SS A ASDP PLQD CVA+++   AVFVNGK CK+P   +A DFF
Sbjct  4    GVSFLV-TVALIALVSSLASASDPGPLQDTCVAIDEPNDAVFVNGKFCKDPKLTMAEDFF  62

Query  269  FRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLL  448
              GL+ PGNTSN +GS VT VNV+ + GLNTLGIS+VRID+ P G NPPHTHPRATE+L 
Sbjct  63   SPGLDKPGNTSNQVGSNVTTVNVDKIKGLNTLGISIVRIDYEPYGENPPHTHPRATEILT  122

Query  449  VLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSS  628
            VLEGTLYVGFV SNP    +N L +K L  GDVFVFP GLIHFQFNVG TNA+A AGL+S
Sbjct  123  VLEGTLYVGFVTSNP----ENRLISKVLNKGDVFVFPIGLIHFQFNVGHTNAVAIAGLNS  178

Query  629  QNPGVITIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQFWYNN  766
            QNPGVITIA AVFGSNPPINP VLT+AFQ+ +NV++YLQ++F  N+
Sbjct  179  QNPGVITIAKAVFGSNPPINPDVLTRAFQLDKNVVDYLQSRFSTNS  224


 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +2

Query  104  VFTITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGK  226
            + T+ ++AL SS A ASDPSPLQD CV +++   AVFVNGK
Sbjct  264  LITVALMALVSSLASASDPSPLQDTCVVIDEPKDAVFVNGK  304



>ref|XP_004489240.1| PREDICTED: germin-like protein subfamily 1 member 13-like [Cicer 
arietinum]
Length=220

 Score =   294 bits (752),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 157/227 (69%), Positives = 175/227 (77%), Gaps = 8/227 (4%)
 Frame = +2

Query  86   MAIRFIVFTITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDF  265
            M   +++FT + +ALSS  A A DPSPLQDFCVA+ D    VFVNGK CK+P     NDF
Sbjct  1    MKSIYLIFT-SFLALSSC-AFAFDPSPLQDFCVAIKDIKNGVFVNGKFCKDPKLATPNDF  58

Query  266  FFRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVL  445
            FF      GNTSNPLGSKVTPV VN + GLNTLGISL RIDFAP GLNPPHTHPRATE+L
Sbjct  59   FFSV--KEGNTSNPLGSKVTPVTVNEILGLNTLGISLARIDFAPKGLNPPHTHPRATEIL  116

Query  446  LVLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLS  625
            +VLEGTLYVGFV SNP    +N L TK L  GDVFVFP GLIHFQ NVG  NAIA AGLS
Sbjct  117  IVLEGTLYVGFVTSNP----QNRLITKVLNKGDVFVFPIGLIHFQLNVGYENAIAVAGLS  172

Query  626  SQNPGVITIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQFWYNN  766
            SQNPGV+TIANAVFGSNP I+ +VLTKAFQV  N+I+ LQ QFW++N
Sbjct  173  SQNPGVVTIANAVFGSNPKISSEVLTKAFQVDNNIIDNLQKQFWWDN  219



>ref|XP_008776811.1| PREDICTED: putative germin-like protein 2-1 isoform X2 [Phoenix 
dactylifera]
Length=206

 Score =   293 bits (750),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 153/206 (74%), Positives = 165/206 (80%), Gaps = 2/206 (1%)
 Frame = +2

Query  149  ASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFFFRGLNMPGNTSNPLGSKVTP  328
            ASDPS LQDFCVA   S  AV VNG +CK PM V A+DFFF GL+MP NTSN LGSKVT 
Sbjct  2    ASDPSQLQDFCVADLKSPNAVLVNGFVCKPPMHVTADDFFFSGLDMPDNTSNQLGSKVTL  61

Query  329  VNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLYVGFVLSNPPPGMK  508
            VNVN + GLNTLGISL RID+AP GLNPPHTHP+ATE+L VLEGTLYVGFV SN   G  
Sbjct  62   VNVNQIAGLNTLGISLARIDYAPYGLNPPHTHPQATEILTVLEGTLYVGFVTSNTNNG--  119

Query  509  NPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSSQNPGVITIANAVFGSNPPIN  688
            N LFTK L  GDVFVFPEGLIHFQFN G T+A+A A LSSQNPGVITIANAVFGSNPPI+
Sbjct  120  NLLFTKMLKKGDVFVFPEGLIHFQFNYGPTHAVAVAALSSQNPGVITIANAVFGSNPPIS  179

Query  689  PQVLTKAFQVGQNVINYLQAQFWYNN  766
              VL KAFQVG++ I YLQAQFW  N
Sbjct  180  DAVLAKAFQVGKDTIKYLQAQFWVAN  205



>gb|KCW61442.1| hypothetical protein EUGRSUZ_H04173, partial [Eucalyptus grandis]
Length=216

 Score =   293 bits (751),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 146/221 (66%), Positives = 173/221 (78%), Gaps = 5/221 (2%)
 Frame = +2

Query  92   IRFIVFTITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFFF  271
            ++F+  ++ ++AL+++  +A DPSPLQDFCVA+ND    VFVNGK CK+P QV A+DF F
Sbjct  1    MKFLPISLLILALATATTYAYDPSPLQDFCVAINDP--KVFVNGKFCKDPKQVTADDFLF  58

Query  272  RGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLV  451
            +G   PGNT NPLGSKVTP  V+   GLNTLGIS+ RIDFAP GLNPPHTHPR TE+L+V
Sbjct  59   KGFRYPGNTVNPLGSKVTPAFVDQFAGLNTLGISMARIDFAPGGLNPPHTHPRGTEILVV  118

Query  452  LEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSSQ  631
             EGTL VGFV SN    + N  FTK L  GDVFVFP GLIHFQ N+GKT A+AFA LSSQ
Sbjct  119  TEGTLLVGFVTSN---QLNNTFFTKVLYKGDVFVFPIGLIHFQLNIGKTPALAFAALSSQ  175

Query  632  NPGVITIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQF  754
            NPG+ITIANAVFGS PPI+  VLTKAFQV + V++YLQAQF
Sbjct  176  NPGLITIANAVFGSKPPISADVLTKAFQVDKKVVDYLQAQF  216



>ref|XP_006840195.1| hypothetical protein AMTR_s00089p00119070 [Amborella trichopoda]
 gb|ERN01870.1| hypothetical protein AMTR_s00089p00119070 [Amborella trichopoda]
Length=219

 Score =   293 bits (751),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 149/222 (67%), Positives = 174/222 (78%), Gaps = 6/222 (3%)
 Frame = +2

Query  101  IVFTITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFFFRGL  280
            ++F    + L++S   ASDPSPLQDFCVA  D+ + VFVNGK+CK+P    ANDFFF GL
Sbjct  3    LLFLAVFLYLTASHVSASDPSPLQDFCVA--DNYSKVFVNGKVCKDPKLATANDFFFAGL  60

Query  281  NMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEG  460
            + PGNTSNP+GSKVTPVNV  + GLNTLGISL RIDFAP G NPPHTHPRATE+L VLEG
Sbjct  61   DKPGNTSNPVGSKVTPVNVMQIAGLNTLGISLARIDFAPGGQNPPHTHPRATEILTVLEG  120

Query  461  TLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSSQNPG  640
            TLYVGFV SNP    +N L +K L  GDVFVFP GLIHFQ NVG +NA+A A LSSQNPG
Sbjct  121  TLYVGFVTSNP----ENRLISKILNKGDVFVFPVGLIHFQQNVGYSNAVAIAALSSQNPG  176

Query  641  VITIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQFWYNN  766
            VITIANAVFG+NPPI+  VL KAFQ+ + +++ LQA FW +N
Sbjct  177  VITIANAVFGANPPISDVVLAKAFQIDKQLVDKLQASFWMDN  218



>ref|XP_010027140.1| PREDICTED: uncharacterized protein LOC104417587 [Eucalyptus grandis]
Length=549

 Score =   305 bits (780),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 150/219 (68%), Positives = 174/219 (79%), Gaps = 3/219 (1%)
 Frame = +2

Query  110  TITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFFFRGLNMP  289
            ++ ++AL+++ A A DPSPLQD CVA+ND  +AVFVNG+ CK+P Q  A+DF F G+  P
Sbjct  333  SLLILALATTTAFAYDPSPLQDICVAINDPKSAVFVNGEFCKDPKQANADDFTFMGVRKP  392

Query  290  GNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLY  469
            GNT+NPLGSKVTP  VN  PGLNTLGIS  RIDFAP GLNPPHTHPR TEVL+V+EGTL 
Sbjct  393  GNTANPLGSKVTPATVNEFPGLNTLGISAARIDFAPGGLNPPHTHPRGTEVLVVIEGTLL  452

Query  470  VGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSSQNPGVIT  649
            VGFV SN    + N LFTK L  GDVFVFP GLIHFQ N GKT A+AFAGLSSQNPGVIT
Sbjct  453  VGFVTSN---QLNNTLFTKVLYKGDVFVFPIGLIHFQLNTGKTPALAFAGLSSQNPGVIT  509

Query  650  IANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQFWYNN  766
            IAN+VFG+ PPI+   LTKAFQV +  I+YLQAQFWY+N
Sbjct  510  IANSVFGAKPPISADALTKAFQVDKKTIDYLQAQFWYDN  548


 Score =   299 bits (765),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 153/235 (65%), Positives = 183/235 (78%), Gaps = 5/235 (2%)
 Frame = +2

Query  92   IRFIVFTITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFFF  271
            ++F++ T  ++AL+SS A ASDPSPLQDFCVA+NDS +AV VNGK CK+P   VA+DF F
Sbjct  2    MKFLL-TFVLLALASSHAFASDPSPLQDFCVAINDSNSAVLVNGKFCKDPKLAVADDFSF  60

Query  272  RGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLV  451
                 PGNTSNPLGSKVT   V+  PGLNTLGI++ R+DFAP GLNPPH HPR TE+L+V
Sbjct  61   TKFRYPGNTSNPLGSKVTTAFVDQFPGLNTLGITMARLDFAPYGLNPPHIHPRGTEMLVV  120

Query  452  LEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSSQ  631
            +EGTLYVGFV SN    + N LFTK L  GDVFVFP+GLIHFQ N+G+ NA+AFA LSSQ
Sbjct  121  VEGTLYVGFVTSN---QLNNTLFTKVLTKGDVFVFPQGLIHFQLNIGQANALAFAFLSSQ  177

Query  632  NPGVITIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQFWYNNS*GIGRSSAN  796
            NPG+ITIAN+VFGS P IN  VLTKAFQV   +INYLQAQ W++N   + R+SA 
Sbjct  178  NPGLITIANSVFGSKPLINVDVLTKAFQVDNKLINYLQAQNWFDNH-ALVRTSAE  231


 Score = 97.8 bits (242),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 58/96 (60%), Positives = 62/96 (65%), Gaps = 3/96 (3%)
 Frame = -3

Query  711  KALVRT*GLMGGFEPKTAFAMVITPGF*LLSPAKAIALVFPTLNWK*MRPSGNTNTSPAT  532
             ALVRT   MGGF+P TA AMVITPGF LL  AKA A VFP  +WK MRP GNTNTSP  
Sbjct  223  HALVRTSAEMGGFDPNTALAMVITPGFWLLRAAKASAGVFPMFSWKWMRPIGNTNTSPLY  282

Query  531  KVLVNRGFFMPGGGFESTNPT*RVPSKTSRTSVARG  424
              LV R  F      + T PT  VPS T+RTSV RG
Sbjct  283  NTLVKRVLF---NWLDVTKPTSSVPSVTTRTSVPRG  315



>ref|XP_006375870.1| germin-like protein 1 [Populus trichocarpa]
 gb|ERP53667.1| germin-like protein 1 [Populus trichocarpa]
Length=225

 Score =   294 bits (752),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 149/207 (72%), Positives = 164/207 (79%), Gaps = 5/207 (2%)
 Frame = +2

Query  152  SDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFFFRGLNMPGNTSNPLGSKVTPV  331
            SDPSPLQDFCVA+ND+   VFVNGK CK+P     NDFFF GLN+  NTSNP+GS VTP 
Sbjct  23   SDPSPLQDFCVAINDTKDGVFVNGKFCKDPKLATENDFFFPGLNIARNTSNPVGSVVTPA  82

Query  332  NVNNLPGLNTLGISLVRIDFAP-NGLNPPHTHPRATEVLLVLEGTLYVGFVLSNPPPGMK  508
            NV  +PGLNTLGISLVRID+AP  GLNPPHTHPRATE+L VLEGTLYVGFV SNP     
Sbjct  83   NVAQIPGLNTLGISLVRIDYAPYGGLNPPHTHPRATEILTVLEGTLYVGFVTSNP----D  138

Query  509  NPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSSQNPGVITIANAVFGSNPPIN  688
            N L TK L  GDVFVFP GLIHFQFNVGKT A A   LSSQNPGVITIANAVFGS PPI 
Sbjct  139  NRLITKVLHPGDVFVFPVGLIHFQFNVGKTKASAIGALSSQNPGVITIANAVFGSTPPIR  198

Query  689  PQVLTKAFQVGQNVINYLQAQFWYNNS  769
              VL KAFQV +N++++LQ QFWY+N+
Sbjct  199  SDVLAKAFQVDKNIVDFLQKQFWYDNN  225



>ref|XP_006840196.1| hypothetical protein AMTR_s00089p00119480 [Amborella trichopoda]
 gb|ERN01871.1| hypothetical protein AMTR_s00089p00119480 [Amborella trichopoda]
Length=219

 Score =   293 bits (751),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 152/220 (69%), Positives = 174/220 (79%), Gaps = 8/220 (4%)
 Frame = +2

Query  113  ITVVALS--SSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFFFRGLNM  286
            I  VALS  +S   ASDPSPLQDFCVA  D+ + VFVNGK+CK+PM V A DFF+ GL+ 
Sbjct  5    IVFVALSMIASLGLASDPSPLQDFCVA--DNYSKVFVNGKVCKDPMLVTAKDFFYDGLDK  62

Query  287  PGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTL  466
            PGNTSNPLGS VT VNV  + GLNTLGISLVRIDFAP G NPPHTHPRATE+L VLEGTL
Sbjct  63   PGNTSNPLGSMVTQVNVMQILGLNTLGISLVRIDFAPGGQNPPHTHPRATEILTVLEGTL  122

Query  467  YVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSSQNPGVI  646
            YVGFV SNP    +N L +KTL  GDVFVFP+GLIHFQ NVG  N++A AGLSSQNPGVI
Sbjct  123  YVGFVTSNP----ENRLISKTLNKGDVFVFPQGLIHFQQNVGYGNSVAIAGLSSQNPGVI  178

Query  647  TIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQFWYNN  766
            TIA AVFG+NPPI+  VL KAFQ+ + +++ LQA FW +N
Sbjct  179  TIAKAVFGANPPISDVVLAKAFQIDKQLVDKLQASFWMDN  218



>gb|KCW61456.1| hypothetical protein EUGRSUZ_H04192 [Eucalyptus grandis]
Length=223

 Score =   293 bits (751),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 145/204 (71%), Positives = 162/204 (79%), Gaps = 3/204 (1%)
 Frame = +2

Query  155  DPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFFFRGLNMPGNTSNPLGSKVTPVN  334
            DPSPLQD CVA+ND  +AVFVNG+ CK+P Q  A+DF F G   PGNT+NPLGSKVTP  
Sbjct  22   DPSPLQDICVAINDPKSAVFVNGEFCKDPKQANADDFTFMGFRKPGNTANPLGSKVTPAT  81

Query  335  VNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLYVGFVLSNPPPGMKNP  514
            VN  PGLNTLGIS  RIDFAP GLNPPHTHPR TEVL+V+EGTL VGFV SN    + N 
Sbjct  82   VNEFPGLNTLGISAARIDFAPGGLNPPHTHPRGTEVLVVIEGTLLVGFVTSN---QLNNT  138

Query  515  LFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSSQNPGVITIANAVFGSNPPINPQ  694
            LFTK L  GDVFVFP GLIHFQ N GKT A+AFAGLSSQNPGVITIAN+VFG+ PPI+  
Sbjct  139  LFTKVLYKGDVFVFPIGLIHFQLNTGKTPALAFAGLSSQNPGVITIANSVFGAKPPISAD  198

Query  695  VLTKAFQVGQNVINYLQAQFWYNN  766
            VLTKAFQV +  ++YL AQFWY+N
Sbjct  199  VLTKAFQVDKKTVDYLLAQFWYDN  222



>ref|XP_010024921.1| PREDICTED: germin-like protein subfamily 1 member 13 [Eucalyptus 
grandis]
 gb|KCW61460.1| hypothetical protein EUGRSUZ_H04196 [Eucalyptus grandis]
Length=223

 Score =   293 bits (750),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 144/204 (71%), Positives = 162/204 (79%), Gaps = 3/204 (1%)
 Frame = +2

Query  155  DPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFFFRGLNMPGNTSNPLGSKVTPVN  334
            DPSPLQD CVA+ND  +AVFVNG+ CK+P Q  A+DF F G   PGNT+NPLGSKVTP  
Sbjct  22   DPSPLQDICVAINDPKSAVFVNGEFCKDPKQANADDFTFMGFRKPGNTANPLGSKVTPAT  81

Query  335  VNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLYVGFVLSNPPPGMKNP  514
            V   PGLNTLGIS+ RIDFAP+GLNPPHTHPR TEVL+V+EGTL VGFV SN    + N 
Sbjct  82   VMEFPGLNTLGISMARIDFAPDGLNPPHTHPRGTEVLVVVEGTLLVGFVTSN---QLNNT  138

Query  515  LFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSSQNPGVITIANAVFGSNPPINPQ  694
            LFTK L  GDVFVFP GLIHFQ N GKT A+AFA LSSQNPGVITIAN+VFG+ PPI+  
Sbjct  139  LFTKVLYKGDVFVFPIGLIHFQLNTGKTPALAFAALSSQNPGVITIANSVFGAKPPISVD  198

Query  695  VLTKAFQVGQNVINYLQAQFWYNN  766
            VLTKAFQV +  + YLQAQFWY+N
Sbjct  199  VLTKAFQVDEKTVEYLQAQFWYDN  222



>gb|KCW80407.1| hypothetical protein EUGRSUZ_C01764 [Eucalyptus grandis]
Length=221

 Score =   293 bits (750),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 147/204 (72%), Positives = 163/204 (80%), Gaps = 5/204 (2%)
 Frame = +2

Query  155  DPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFFFRGLNMPGNTSNPLGSKVTPVN  334
            DPSPLQDFCVA+ND    VFVNGK CK+P QV A+DF F+G   PGNT+NPLGSKVTP  
Sbjct  22   DPSPLQDFCVAINDP--EVFVNGKFCKDPKQVTADDFLFKGFRYPGNTANPLGSKVTPAF  79

Query  335  VNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLYVGFVLSNPPPGMKNP  514
            V+  PGLNTLGIS+ RIDFA  GLNPPHTHPR TEVL+V EGTL V FV SN    + N 
Sbjct  80   VDQFPGLNTLGISMARIDFALGGLNPPHTHPRGTEVLVVTEGTLLVSFVTSN---QLNNT  136

Query  515  LFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSSQNPGVITIANAVFGSNPPINPQ  694
            LFTK L  GDVFVFP GLIHFQ N+GKT A+AFA LSSQNPGVITIANAVFGS PPI+  
Sbjct  137  LFTKVLYKGDVFVFPIGLIHFQLNIGKTPALAFAALSSQNPGVITIANAVFGSKPPISAD  196

Query  695  VLTKAFQVGQNVINYLQAQFWYNN  766
            VLTKAFQV + V++YLQAQFWY+N
Sbjct  197  VLTKAFQVDKKVVDYLQAQFWYDN  220



>ref|XP_010050166.1| PREDICTED: germin-like protein subfamily 1 member 7 [Eucalyptus 
grandis]
 gb|KCW89288.1| hypothetical protein EUGRSUZ_A01578 [Eucalyptus grandis]
Length=223

 Score =   293 bits (750),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 144/205 (70%), Positives = 164/205 (80%), Gaps = 3/205 (1%)
 Frame = +2

Query  155  DPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFFFRGLNMPGNTSNPLGSKVTPVN  334
            DPSPLQD CVA ND  + VFVNGK CK+P Q  A+DF F G   PGNT+NPLGSKVTP  
Sbjct  22   DPSPLQDICVATNDLNSGVFVNGKFCKDPKQATADDFLFMGFRNPGNTTNPLGSKVTPAF  81

Query  335  VNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLYVGFVLSNPPPGMKNP  514
            V+  PGLNTLGIS+ R+DFAP GLNPPHTHPR TEVL+V+EGTL VGFV SN    + N 
Sbjct  82   VDQFPGLNTLGISMARLDFAPGGLNPPHTHPRGTEVLVVVEGTLLVGFVTSNQ---LNNT  138

Query  515  LFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSSQNPGVITIANAVFGSNPPINPQ  694
            LFTK L  GDVFVFP GLIHFQ N+G T A+AFAGLSSQ+PGVITIANAVFG+ PPI+  
Sbjct  139  LFTKVLYKGDVFVFPIGLIHFQLNIGNTYALAFAGLSSQSPGVITIANAVFGAKPPISAD  198

Query  695  VLTKAFQVGQNVINYLQAQFWYNNS  769
            VLTKAFQV + V++YLQAQFWY+N+
Sbjct  199  VLTKAFQVDKKVVDYLQAQFWYDNN  223



>ref|XP_010054506.1| PREDICTED: uncharacterized protein LOC104442816 [Eucalyptus grandis]
Length=448

 Score =   300 bits (769),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 148/225 (66%), Positives = 177/225 (79%), Gaps = 5/225 (2%)
 Frame = +2

Query  92   IRFIVFTITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFFF  271
            ++F+  ++ ++AL+++ + A DPSPLQDFCVA+ND    VFVNGK CK+P QV A+DF F
Sbjct  228  MKFLPISLLILALATATSFAYDPSPLQDFCVAIND--PKVFVNGKFCKDPKQVTADDFLF  285

Query  272  RGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLV  451
            +G   PGNT NPLGSKVTP  V+ LPGLNTLGIS+ RIDFAP GLNPPHTHPR +E+L+V
Sbjct  286  KGFRYPGNTVNPLGSKVTPAFVDQLPGLNTLGISMARIDFAPGGLNPPHTHPRGSEILVV  345

Query  452  LEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSSQ  631
             EGTL VGFV SN    + N  FTK L  GDVFVFP GLIHFQ N+GKT A+AFA LSSQ
Sbjct  346  AEGTLLVGFVTSN---QLNNTFFTKVLYKGDVFVFPIGLIHFQLNIGKTPALAFAALSSQ  402

Query  632  NPGVITIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQFWYNN  766
            NPGVITIAN+VF S PPI+  VLTKAFQV + V++YLQ QFWY+N
Sbjct  403  NPGVITIANSVFRSKPPISADVLTKAFQVDKKVVDYLQVQFWYDN  447


 Score =   300 bits (767),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 153/226 (68%), Positives = 180/226 (80%), Gaps = 5/226 (2%)
 Frame = +2

Query  92   IRFIVFTITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFFF  271
            ++F+  ++ ++AL+++ A A DPSPLQDFCVA+ND    VFVNGK CK+P Q+ A+DF F
Sbjct  1    MKFLPTSLLILALATATAFAFDPSPLQDFCVAIND--PEVFVNGKFCKDPKQITADDFLF  58

Query  272  RGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLV  451
            +G   PGNT+NPLGSKVTP  V+  PGLNTLGIS+ RIDFAP GLNPPHTHPR TEVL+V
Sbjct  59   KGFRYPGNTANPLGSKVTPAFVDQFPGLNTLGISMARIDFAPGGLNPPHTHPRGTEVLVV  118

Query  452  LEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSSQ  631
             EGTL VGFV SN    + N LFTK L  GDVFVFP GLIHFQ N+GKT A+AFA LSSQ
Sbjct  119  TEGTLLVGFVTSN---QLNNTLFTKVLYKGDVFVFPIGLIHFQLNIGKTPALAFAALSSQ  175

Query  632  NPGVITIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQFWYNNS  769
            NPGVITIANAVFGS PPI+  VLTKAFQV + V++YLQAQFWY+N 
Sbjct  176  NPGVITIANAVFGSKPPISADVLTKAFQVDKKVVDYLQAQFWYDNK  221



>ref|XP_009385875.1| PREDICTED: putative germin-like protein 2-1 [Musa acuminata subsp. 
malaccensis]
Length=223

 Score =   293 bits (749),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 149/221 (67%), Positives = 165/221 (75%), Gaps = 4/221 (2%)
 Frame = +2

Query  104  VFTITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFFFRGLN  283
            +F I ++A+ SS A ASDPSPLQDFCVA  DS   V VNG +CK+P  V A DFFF GL+
Sbjct  5    IFLIALLAMVSSLAMASDPSPLQDFCVADKDS--KVLVNGFVCKDPKHVTAEDFFFMGLD  62

Query  284  MPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGT  463
              GNT N LGS VT VNVN L GLNTLGIS+VRID+ P GLNPPHTHPRATE+L V+EG 
Sbjct  63   KAGNTVNKLGSMVTAVNVNKLVGLNTLGISMVRIDYGPKGLNPPHTHPRATEILTVIEGQ  122

Query  464  LYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSSQNPGV  643
            L VGFV SN   G  N LFTK L  GDVFVFPEGLIHFQFN G T  IA   LSSQNPG 
Sbjct  123  LLVGFVTSNTDDG--NRLFTKMLKKGDVFVFPEGLIHFQFNPGHTKTIAIGALSSQNPGT  180

Query  644  ITIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQFWYNN  766
            ITIANAVFGS PPI+  VL KAFQV +  I++LQAQFW +N
Sbjct  181  ITIANAVFGSKPPISDDVLAKAFQVDKKTIDWLQAQFWTDN  221



>ref|XP_002319674.2| hypothetical protein POPTR_0013s04920g [Populus trichocarpa]
 gb|EEE95597.2| hypothetical protein POPTR_0013s04920g [Populus trichocarpa]
Length=225

 Score =   293 bits (749),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 149/207 (72%), Positives = 164/207 (79%), Gaps = 5/207 (2%)
 Frame = +2

Query  152  SDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFFFRGLNMPGNTSNPLGSKVTPV  331
            SDPSPLQDFCVA+ND+   VFVNGK CK+P     NDFFF GLN+  NTSNP+GS VTP 
Sbjct  23   SDPSPLQDFCVAINDTKDGVFVNGKFCKDPKLATENDFFFPGLNIARNTSNPVGSVVTPA  82

Query  332  NVNNLPGLNTLGISLVRIDFAP-NGLNPPHTHPRATEVLLVLEGTLYVGFVLSNPPPGMK  508
            NV  +PGLNTLGISLVRID+AP  GLNPPHTHPRATE+L VLEGTLYVGFV SNP     
Sbjct  83   NVAQIPGLNTLGISLVRIDYAPYGGLNPPHTHPRATEILTVLEGTLYVGFVTSNP----D  138

Query  509  NPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSSQNPGVITIANAVFGSNPPIN  688
            N L TK L  GDVFVFP GLIHFQFNVGKT A A   LSSQNPGVITIANAVFGS PPI 
Sbjct  139  NRLITKVLNPGDVFVFPIGLIHFQFNVGKTKASAIGALSSQNPGVITIANAVFGSTPPIR  198

Query  689  PQVLTKAFQVGQNVINYLQAQFWYNNS  769
              VL KAFQV +N++++LQ QFWY+N+
Sbjct  199  SDVLAKAFQVEKNIVDFLQKQFWYDNN  225



>ref|XP_008775104.1| PREDICTED: putative germin-like protein 2-1 [Phoenix dactylifera]
Length=222

 Score =   293 bits (749),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 152/211 (72%), Positives = 167/211 (79%), Gaps = 4/211 (2%)
 Frame = +2

Query  134  SSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFFFRGLNMPGNTSNPLG  313
            SS   ASDPS LQDFCVA  D  + + VNG +CK PM V A+DFFF GL+MPGNTSN LG
Sbjct  15   SSRVMASDPSQLQDFCVA--DLKSPILVNGFVCKPPMHVTADDFFFSGLDMPGNTSNQLG  72

Query  314  SKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLYVGFVLSNP  493
            SKVT VNVN + GLNTLGISL RID+ P GLNPPHTHPRATEVL VLEGTLY+GFV SN 
Sbjct  73   SKVTQVNVNQIAGLNTLGISLARIDYEPYGLNPPHTHPRATEVLTVLEGTLYLGFVTSNT  132

Query  494  PPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSSQNPGVITIANAVFGS  673
              G  N LFTK L  GDVFVFP+GLIHFQFN G T A+A + LSSQNPGVITIANAVFGS
Sbjct  133  NNG--NLLFTKMLKKGDVFVFPQGLIHFQFNYGPTPAVALSALSSQNPGVITIANAVFGS  190

Query  674  NPPINPQVLTKAFQVGQNVINYLQAQFWYNN  766
            NPPI+  VL KAFQVG++ I YLQAQFW +N
Sbjct  191  NPPISDAVLAKAFQVGKDTIKYLQAQFWVDN  221



>ref|XP_007030263.1| Germin-like protein subfamily 1 member 18 [Theobroma cacao]
 gb|EOY10765.1| Germin-like protein subfamily 1 member 18 [Theobroma cacao]
Length=252

 Score =   294 bits (752),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 146/206 (71%), Positives = 166/206 (81%), Gaps = 5/206 (2%)
 Frame = +2

Query  155  DPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFFFRGLNMPGNTSNPLGSKVTPVN  334
            DPSPLQD CVA+ND+   +FVNGK CK+P    A DFFF GLN+P NT+NP+GS VTPVN
Sbjct  51   DPSPLQDICVAINDTKTGIFVNGKFCKDPKLATAEDFFFSGLNVPRNTTNPVGSVVTPVN  110

Query  335  VNNLPGLNTLGISLVRIDFAP-NGLNPPHTHPRATEVLLVLEGTLYVGFVLSNPPPGMKN  511
            V+ + GLNTLGISLVRID+AP  G NPPH HPR TE+L+VLEGTLYVGFV SNP     N
Sbjct  111  VDQILGLNTLGISLVRIDYAPYGGQNPPHIHPRGTEILVVLEGTLYVGFVTSNP----DN  166

Query  512  PLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSSQNPGVITIANAVFGSNPPINP  691
             L +K L  GDVFVFP GLIHFQ NVGKTNA+AFAGLSSQNPGVITIANAVFGSNPPINP
Sbjct  167  RLISKVLYPGDVFVFPIGLIHFQQNVGKTNAVAFAGLSSQNPGVITIANAVFGSNPPINP  226

Query  692  QVLTKAFQVGQNVINYLQAQFWYNNS  769
             VLT+AFQ+   V+ YLQ++FW+ N 
Sbjct  227  DVLTRAFQLDNKVVKYLQSRFWWKNK  252



>ref|XP_010027136.1| PREDICTED: uncharacterized protein LOC104417584 [Eucalyptus grandis]
Length=492

 Score =   301 bits (772),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 148/225 (66%), Positives = 176/225 (78%), Gaps = 5/225 (2%)
 Frame = +2

Query  92   IRFIVFTITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFFF  271
            ++F+  ++ ++AL+++   A DPSPLQDFCVA+ND    VFVNGK CK+P QV A+DF F
Sbjct  272  MKFLPISLLILALATATTFAYDPSPLQDFCVAINDP--KVFVNGKFCKDPKQVTADDFLF  329

Query  272  RGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLV  451
            +G   PGNT+NPLGSKVTP  V+   GLNTLGIS+ R DFAP GLNPPHTHPR TE+L+V
Sbjct  330  KGFRYPGNTANPLGSKVTPAFVDQFAGLNTLGISMARTDFAPGGLNPPHTHPRGTEILVV  389

Query  452  LEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSSQ  631
             EGTL VGFV SN    + N  FTK L  GDVFVFP GLIHFQ N+GKT A+AFA LSSQ
Sbjct  390  TEGTLLVGFVTSNQ---LNNTFFTKVLYKGDVFVFPIGLIHFQLNIGKTPALAFAALSSQ  446

Query  632  NPGVITIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQFWYNN  766
            NPG+ITIANAVFGS PPI+  VLTKAFQV + V++YLQAQFWY+N
Sbjct  447  NPGLITIANAVFGSKPPISAGVLTKAFQVDKKVVDYLQAQFWYDN  491


 Score =   298 bits (764),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 147/222 (66%), Positives = 175/222 (79%), Gaps = 5/222 (2%)
 Frame = +2

Query  92   IRFIVFTITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFFF  271
            ++F+  ++ ++AL+++ + A DPSPLQDFCVA+ND    VFVNGK CK+P QV A+DF F
Sbjct  1    MKFLPISLLILALATATSFAYDPSPLQDFCVAINDP--KVFVNGKFCKDPKQVTADDFLF  58

Query  272  RGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLV  451
            +G   PGNT NPLGSKVTP  V+ LPGLNTLGIS+ RIDFAP GLNPPHTHPR +E+L+V
Sbjct  59   KGFRYPGNTVNPLGSKVTPAFVDQLPGLNTLGISMARIDFAPGGLNPPHTHPRGSEILVV  118

Query  452  LEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSSQ  631
             EGTL VGFV  N    + N  FTK L  GDVFVFP GLIHFQ N+GKT A+AFA LSSQ
Sbjct  119  AEGTLLVGFVTFNQ---LNNTFFTKVLYKGDVFVFPIGLIHFQLNIGKTPALAFAALSSQ  175

Query  632  NPGVITIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQFW  757
            NPGVITIAN+VFGS PPI+  VLTKAFQV + V++YLQAQFW
Sbjct  176  NPGVITIANSVFGSKPPISADVLTKAFQVDKKVVDYLQAQFW  217



>ref|XP_003618162.1| Germin-like protein subfamily 1 member [Medicago truncatula]
 gb|AES74380.1| germin family protein [Medicago truncatula]
 gb|AFK39197.1| unknown [Medicago truncatula]
Length=220

 Score =   292 bits (748),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 154/222 (69%), Positives = 172/222 (77%), Gaps = 7/222 (3%)
 Frame = +2

Query  101  IVFTITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFFFRGL  280
            I+F    +AL+S  A A DPSPLQDFCVA+ND+   VFVNGK CK+P     NDFFF   
Sbjct  5    ILFVTAFLALASC-AFAFDPSPLQDFCVAINDTKNGVFVNGKFCKDPKLATPNDFFFSV-  62

Query  281  NMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEG  460
               GNTSNPLGSKVTPV VN++ GLNTLGISL RIDFA  GLNPPHTHPRATE+L+VLEG
Sbjct  63   -KEGNTSNPLGSKVTPVTVNDILGLNTLGISLARIDFASRGLNPPHTHPRATEILIVLEG  121

Query  461  TLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSSQNPG  640
            TLYVGFV SNP    +N L TK L  GDVFVFP GLIHFQ NVG  NA+A AGLSSQNPG
Sbjct  122  TLYVGFVTSNP----ENRLITKVLNKGDVFVFPIGLIHFQLNVGYGNAVAIAGLSSQNPG  177

Query  641  VITIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQFWYNN  766
            VITIANAVFGSNP I+ +VLTKAFQV  N+++ LQ QFW +N
Sbjct  178  VITIANAVFGSNPKISSEVLTKAFQVDNNIVDNLQKQFWVDN  219



>ref|XP_004489241.1| PREDICTED: putative germin-like protein 2-1-like [Cicer arietinum]
Length=220

 Score =   292 bits (748),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 153/220 (70%), Positives = 170/220 (77%), Gaps = 7/220 (3%)
 Frame = +2

Query  107  FTITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFFFRGLNM  286
            F  T +AL+S  A A DPSPLQDFCVA+ND+   VFVNGK CK+P     NDFFF     
Sbjct  7    FVTTFMALASC-AFAFDPSPLQDFCVAINDTKTGVFVNGKFCKDPKLATPNDFFFS--IK  63

Query  287  PGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTL  466
             G+TSN LGSKVTPV VN + GLNTLGISL RIDFAP GLNPPHTHPRATE+L+VLEGTL
Sbjct  64   EGDTSNSLGSKVTPVTVNEILGLNTLGISLARIDFAPKGLNPPHTHPRATEILIVLEGTL  123

Query  467  YVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSSQNPGVI  646
            YVGFV SNP    +N L TK L  GDVFVFP GLIHFQ NVG  N +A AGLSSQNPGVI
Sbjct  124  YVGFVTSNP----ENRLITKVLNKGDVFVFPIGLIHFQLNVGYGNVVAIAGLSSQNPGVI  179

Query  647  TIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQFWYNN  766
            TIANAVFGSNP I+ QVLTKAFQV +N+++ LQ QFW +N
Sbjct  180  TIANAVFGSNPKISSQVLTKAFQVDKNIVDNLQKQFWLDN  219



>ref|XP_003536153.1| PREDICTED: germin-like protein subfamily 1 member 7-like [Glycine 
max]
 gb|ACG69482.1| germin-like protein 6 [Glycine max]
Length=232

 Score =   292 bits (748),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 152/230 (66%), Positives = 175/230 (76%), Gaps = 8/230 (3%)
 Frame = +2

Query  92   IRFIVFTITVVALSSSFAHASDPSPLQDFCVAVNDSMAA----VFVNGKICKNPMQVVAN  259
            ++ +   + ++AL+SS A A DPSPLQDFCVA+ND+ A     VFVNGK CK+P    A+
Sbjct  1    MKVVYLFVVLMALASSVAFAYDPSPLQDFCVAINDTKAGGLYGVFVNGKFCKDPKFAYAD  60

Query  260  DFFFRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATE  439
            DFFF GL  PG+T+N  GSKVT V VN + GLNTLGISL RIDFAP GLNPPHTHPR TE
Sbjct  61   DFFFGGLG-PGDTANAQGSKVTAVTVNEILGLNTLGISLARIDFAPKGLNPPHTHPRGTE  119

Query  440  VLLVLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAG  619
            +L+VLEGTLYVGFV SN      N LFTK L  GDVFVFP GLIHFQ NVG  NA+A A 
Sbjct  120  ILVVLEGTLYVGFVASNQN---DNRLFTKVLYKGDVFVFPIGLIHFQQNVGYGNAVAIAA  176

Query  620  LSSQNPGVITIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQFWYNNS  769
            LSSQNPGVITIANAVFGS PPI+ +VL KAFQV +N+++YLQ QF YNN 
Sbjct  177  LSSQNPGVITIANAVFGSKPPISDEVLAKAFQVDKNIVDYLQKQFGYNNK  226



>gb|KCW44232.1| hypothetical protein EUGRSUZ_L02342, partial [Eucalyptus grandis]
Length=218

 Score =   292 bits (747),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 149/220 (68%), Positives = 174/220 (79%), Gaps = 4/220 (2%)
 Frame = +2

Query  92   IRFIVFTITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFFF  271
            ++F++ T  ++AL+S  A ASDPSPLQDFCVAVND  +AVFVNGK CK+P  V+A+DF F
Sbjct  2    MKFLL-TFVLLALASCHAFASDPSPLQDFCVAVNDPNSAVFVNGKFCKDPKLVIADDFSF  60

Query  272  RGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLV  451
                 PG+TSNPLGSKVT   V+  PGLNTLGI+  R+DFAP GLNPPH HPR TE+LLV
Sbjct  61   TKFRYPGSTSNPLGSKVTTAFVDQFPGLNTLGIATARLDFAPYGLNPPHIHPRGTEMLLV  120

Query  452  LEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSSQ  631
            +EGTL+VGFV SN    + N LFTK L  GDVFVFP+GLIHFQ N+G+TNA+AFA LSSQ
Sbjct  121  VEGTLHVGFVTSNQ---LNNTLFTKVLTKGDVFVFPQGLIHFQLNIGQTNALAFAFLSSQ  177

Query  632  NPGVITIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQ  751
            NPG+ITIAN VFGS PPIN  VLTKAFQV   +INYLQAQ
Sbjct  178  NPGLITIANTVFGSKPPINVDVLTKAFQVDNKLINYLQAQ  217



>ref|XP_003618167.1| Germin-like protein [Medicago truncatula]
 gb|AES74385.1| germin family protein [Medicago truncatula]
Length=220

 Score =   292 bits (747),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 153/222 (69%), Positives = 173/222 (78%), Gaps = 7/222 (3%)
 Frame = +2

Query  104  VFTITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFFFRGLN  283
            +F    +AL+S  A A DPSPLQDFCVA+ND+   VFVNGK+CK+P     NDFFF    
Sbjct  6    LFVTAFLALASC-AFAFDPSPLQDFCVAINDTKNGVFVNGKVCKDPKLATPNDFFFSV--  62

Query  284  MPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGT  463
              GNTSNPLGSKVTPV VN++ GLNTLGISL RIDFA  GLNPPHTHPRATE+L+VLEGT
Sbjct  63   KEGNTSNPLGSKVTPVTVNDILGLNTLGISLARIDFASRGLNPPHTHPRATEILIVLEGT  122

Query  464  LYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSSQNPGV  643
            LYVGFV SNP    +N L TK L  GDVFVFP GLIHFQ NVG  NA+A AGLSSQNPGV
Sbjct  123  LYVGFVTSNP----ENRLITKVLNKGDVFVFPIGLIHFQLNVGYGNAVAIAGLSSQNPGV  178

Query  644  ITIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQFWYNNS  769
            ITIANAVFGSNP I+ +VLTKAFQV  N+++ LQ QFW +N+
Sbjct  179  ITIANAVFGSNPKISSEVLTKAFQVDNNIVDNLQKQFWVDNN  220



>ref|XP_003618164.1| Germin-like protein subfamily 1 member [Medicago truncatula]
 gb|AES74382.1| germin family protein [Medicago truncatula]
Length=220

 Score =   291 bits (746),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 154/227 (68%), Positives = 172/227 (76%), Gaps = 8/227 (4%)
 Frame = +2

Query  86   MAIRFIVFTITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDF  265
            M   ++ FT  +   S +FA   DPSPLQDFCVA+ND+   VFVNGK CKNP     NDF
Sbjct  1    MKSIYLFFTAFLALASCAFAF--DPSPLQDFCVAINDTKTGVFVNGKFCKNPKLATPNDF  58

Query  266  FFRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVL  445
            FF      GNTSNPLGSKVTPV VN++ GLNTLGISL RIDFA  GLNPPHTHPRATE+L
Sbjct  59   FFSV--KEGNTSNPLGSKVTPVTVNDILGLNTLGISLARIDFASRGLNPPHTHPRATEIL  116

Query  446  LVLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLS  625
            +VLEGTLYVGFV SNP    +N L TK L  GDVFVFP GLIHFQ NVG  NA+A AGLS
Sbjct  117  IVLEGTLYVGFVTSNP----ENRLITKVLNKGDVFVFPIGLIHFQLNVGYGNAVAIAGLS  172

Query  626  SQNPGVITIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQFWYNN  766
            SQNPGVITIANAVFGSNP I+ +VLTKAFQV  N+++ LQ QFW +N
Sbjct  173  SQNPGVITIANAVFGSNPKISSEVLTKAFQVDNNIVDNLQKQFWVDN  219



>ref|XP_010027145.1| PREDICTED: germin-like protein subfamily 1 member 7 [Eucalyptus 
grandis]
 gb|KCW61467.1| hypothetical protein EUGRSUZ_H04203 [Eucalyptus grandis]
Length=223

 Score =   291 bits (746),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 144/205 (70%), Positives = 164/205 (80%), Gaps = 3/205 (1%)
 Frame = +2

Query  155  DPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFFFRGLNMPGNTSNPLGSKVTPVN  334
            DPSPLQD CVA ND  + VFVNGK CK+P Q  A+DF F+G  +P NTSN LGSKVTP  
Sbjct  22   DPSPLQDICVATNDLNSGVFVNGKFCKDPNQATADDFLFKGFRIPRNTSNLLGSKVTPAF  81

Query  335  VNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLYVGFVLSNPPPGMKNP  514
            V+  PGLNTLGIS+ RIDFAP GLNPPHTHPR TEVL+V+EGTL VGFV SN    + N 
Sbjct  82   VDQFPGLNTLGISMARIDFAPGGLNPPHTHPRGTEVLVVVEGTLLVGFVTSNQ---LNNT  138

Query  515  LFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSSQNPGVITIANAVFGSNPPINPQ  694
            LFTK L  GDVFVFP GLIHFQ N+G T A+AFAGLSSQNPG+ITIANAVFG+ PPI+  
Sbjct  139  LFTKVLYKGDVFVFPIGLIHFQLNIGNTYALAFAGLSSQNPGLITIANAVFGAKPPISAD  198

Query  695  VLTKAFQVGQNVINYLQAQFWYNNS  769
            VLTKAFQV + V++YLQAQFWY+N+
Sbjct  199  VLTKAFQVDKKVVDYLQAQFWYDNN  223



>ref|XP_008778966.1| PREDICTED: putative germin-like protein 2-1 [Phoenix dactylifera]
Length=221

 Score =   291 bits (746),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 150/227 (66%), Positives = 172/227 (76%), Gaps = 8/227 (4%)
 Frame = +2

Query  86   MAIRFIVFTITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDF  265
            MA R ++  +  +AL SS A ASDPSPLQDFCVA  D  + VFVNG +CKNP  V A+DF
Sbjct  1    MASRILL--LAFLALVSSHAIASDPSPLQDFCVA--DKTSHVFVNGLVCKNPNDVKADDF  56

Query  266  FFRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVL  445
            FF GL+ PG+ +N LGS VT VNV  + GLNTLGISL RIDFAP GLNPPH HPRATE+L
Sbjct  57   FFSGLDRPGDAANKLGSNVTLVNVEKIAGLNTLGISLARIDFAPYGLNPPHIHPRATEIL  116

Query  446  LVLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLS  625
             VLEG+LYVGFV SNP     N LF K +  GDVFVFP+GLIHFQFN G  NA+A A LS
Sbjct  117  TVLEGSLYVGFVTSNP----DNRLFAKVINKGDVFVFPQGLIHFQFNYGTKNAVAIAALS  172

Query  626  SQNPGVITIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQFWYNN  766
            SQNPGVIT+ANAVFGS PPI+  VL KAFQV +  I++LQAQFW +N
Sbjct  173  SQNPGVITVANAVFGSKPPISRDVLAKAFQVDKKTIDWLQAQFWMDN  219



>ref|XP_006405658.1| hypothetical protein EUTSA_v10027918mg [Eutrema salsugineum]
 gb|ESQ47111.1| hypothetical protein EUTSA_v10027918mg [Eutrema salsugineum]
Length=221

 Score =   291 bits (745),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 145/212 (68%), Positives = 173/212 (82%), Gaps = 4/212 (2%)
 Frame = +2

Query  119  VVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFFFRGLNMPGNT  298
            ++AL +SFA A DPSPLQDFCVA++D +  VFVNG+ CK+P +VVA DFFF GLN+PGNT
Sbjct  12   ILALVTSFADAYDPSPLQDFCVAIDD-LNGVFVNGRFCKDPRRVVAKDFFFSGLNVPGNT  70

Query  299  SNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLYVGF  478
             N +GS VT VNV+ +PGLNT+GISLVRID+APNG NPPHTHPR TE+L+++EGTLYVGF
Sbjct  71   DNQVGSNVTTVNVDQIPGLNTMGISLVRIDYAPNGQNPPHTHPRGTEILVLIEGTLYVGF  130

Query  479  VLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSSQNPGVITIAN  658
            V SN      N LF K L  GDVFVFP G+IHFQ N+GK  A+AFAGLSSQNPGVITIAN
Sbjct  131  VSSNQD---DNRLFAKVLHPGDVFVFPIGMIHFQVNIGKVPAVAFAGLSSQNPGVITIAN  187

Query  659  AVFGSNPPINPQVLTKAFQVGQNVINYLQAQF  754
            AVFGSNPPI P+VL +AFQ+  N++  LQA+F
Sbjct  188  AVFGSNPPIYPEVLARAFQLDANIVKELQAKF  219



>ref|XP_010024923.1| PREDICTED: germin-like protein subfamily 1 member 7 [Eucalyptus 
grandis]
 gb|KCW61463.1| hypothetical protein EUGRSUZ_H04199 [Eucalyptus grandis]
Length=223

 Score =   291 bits (745),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 149/225 (66%), Positives = 176/225 (78%), Gaps = 3/225 (1%)
 Frame = +2

Query  92   IRFIVFTITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFFF  271
            ++F+  +  V+AL+++ A A DPSPLQD CVA ND  + VFVNGK CK+P Q  A+DF F
Sbjct  1    MKFLPISFLVLALATATAFAYDPSPLQDICVATNDLSSGVFVNGKFCKDPNQASADDFLF  60

Query  272  RGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLV  451
             G   PGNTSNPLGSKVT   V+  PGLNTLGIS+ R+DFAP GLNPPHTHPR TEVL+V
Sbjct  61   TGFRNPGNTSNPLGSKVTTAFVDQFPGLNTLGISMARLDFAPGGLNPPHTHPRGTEVLVV  120

Query  452  LEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSSQ  631
            +EGTL VGFV S+    + N LFTK L  GDVFVFP GLIHFQ N+G T A+AFAGLSSQ
Sbjct  121  VEGTLLVGFVTSDQ---LNNTLFTKVLYKGDVFVFPIGLIHFQLNIGNTYALAFAGLSSQ  177

Query  632  NPGVITIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQFWYNN  766
            NPG+ITIANAVFG+ PPI+  VLTKAFQV + V++YLQAQFWY+N
Sbjct  178  NPGLITIANAVFGAKPPISADVLTKAFQVDKKVVDYLQAQFWYDN  222



>ref|XP_002284343.2| PREDICTED: uncharacterized protein LOC100256308 [Vitis vinifera]
Length=477

 Score =   300 bits (767),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 150/222 (68%), Positives = 176/222 (79%), Gaps = 5/222 (2%)
 Frame = +2

Query  89   AIRFIVFTITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFF  268
             + F+V T+ +VAL SS A ASDPSPLQD CVA+++   AVFVNGK CK+P   VA DFF
Sbjct  261  GVSFLV-TVALVALVSSLASASDPSPLQDTCVAIDEPKDAVFVNGKFCKDPKLTVAEDFF  319

Query  269  FRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLL  448
            F GL+ PGNTSN + S VT VNV  + GLNTLGIS+VRID+ P G NPPHTHPRATE+L 
Sbjct  320  FSGLDKPGNTSNAVASNVTTVNVEQIKGLNTLGISMVRIDYEPYGQNPPHTHPRATEILT  379

Query  449  VLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSS  628
            VLEGTLYVGFV SN     +N L +K L  GDVFVFP GLIHFQFN+GKTNA+A A LSS
Sbjct  380  VLEGTLYVGFVTSN----TENRLISKVLNKGDVFVFPIGLIHFQFNIGKTNAVAIAALSS  435

Query  629  QNPGVITIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQF  754
            QNPGVITIANAVFGS+PPINP VLT+AFQ+ ++V+ YLQ++F
Sbjct  436  QNPGVITIANAVFGSDPPINPDVLTRAFQLDKSVVKYLQSRF  477


 Score =   296 bits (757),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 148/221 (67%), Positives = 174/221 (79%), Gaps = 5/221 (2%)
 Frame = +2

Query  89   AIRFIVFTITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFF  268
             + F+V T+ ++AL SS A ASDPSPLQD CVA+++   AVFVNGK CK+P   VA DFF
Sbjct  4    GVSFLV-TVVLMALVSSLASASDPSPLQDTCVAIDEPKDAVFVNGKFCKDPKLTVAEDFF  62

Query  269  FRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLL  448
            F GL+ PGNTSN + S VT VNV  + GLNTLGIS+VRID+ P G NPPHTHPRATE+L 
Sbjct  63   FSGLDKPGNTSNAVASNVTTVNVEQIKGLNTLGISMVRIDYEPYGQNPPHTHPRATEILT  122

Query  449  VLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSS  628
            VLEGTLYVGFV SN     +N L +K L  GDVFVFP GLIHFQFN+G TNA+A AGLSS
Sbjct  123  VLEGTLYVGFVTSN----TENRLISKVLNKGDVFVFPMGLIHFQFNIGHTNAVAIAGLSS  178

Query  629  QNPGVITIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQ  751
            QNPGVITIANAVFGS+P INP  LT+AFQ+ +NV+NYLQ++
Sbjct  179  QNPGVITIANAVFGSDPSINPDFLTRAFQLDKNVVNYLQSR  219



>ref|XP_011038438.1| PREDICTED: germin-like protein subfamily 1 member 13 [Populus 
euphratica]
Length=225

 Score =   291 bits (744),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 146/205 (71%), Positives = 162/205 (79%), Gaps = 5/205 (2%)
 Frame = +2

Query  155  DPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFFFRGLNMPGNTSNPLGSKVTPVN  334
            DPSPLQDFCVA+ND+   VFVNGK CK+P    ANDFFF GLN+  +TSNP+GS VT  N
Sbjct  24   DPSPLQDFCVAINDTKDGVFVNGKFCKDPKLATANDFFFSGLNIARDTSNPVGSVVTQAN  83

Query  335  VNNLPGLNTLGISLVRIDFAP-NGLNPPHTHPRATEVLLVLEGTLYVGFVLSNPPPGMKN  511
            V  +PGLNTLGIS+VRID+AP  GLNPPHTHPRATEV+ VLEGTLYVGFV SNP     N
Sbjct  84   VAQIPGLNTLGISVVRIDYAPYGGLNPPHTHPRATEVITVLEGTLYVGFVTSNP----DN  139

Query  512  PLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSSQNPGVITIANAVFGSNPPINP  691
             L TK L  GDVFVFP GLIHFQFNVGKT A A + LSSQNPGVITIANAVFGS PPI  
Sbjct  140  RLITKVLKPGDVFVFPFGLIHFQFNVGKTKASAISALSSQNPGVITIANAVFGSTPPIRS  199

Query  692  QVLTKAFQVGQNVINYLQAQFWYNN  766
             VL KAFQV + +++YLQ QFWY+N
Sbjct  200  DVLAKAFQVDKKIVDYLQKQFWYDN  224



>emb|CBI36791.3| unnamed protein product [Vitis vinifera]
Length=225

 Score =   291 bits (744),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 141/205 (69%), Positives = 170/205 (83%), Gaps = 4/205 (2%)
 Frame = +2

Query  155  DPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFFFRGLNMPGNTSNPLGSKVTPVN  334
            DPSPLQD CVA++D    VFVNGK CK+     A+DFF+ GL++PGN +NP+GS VTPVN
Sbjct  25   DPSPLQDICVAISDLKDGVFVNGKFCKDLKLASADDFFYYGLHIPGNITNPVGSMVTPVN  84

Query  335  VNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLYVGFVLSNPPPGMKNP  514
            V  +PGLNTLGIS+VRID+AP G NPPHTHPRATE+L+VLEGTL VGFV SN     +N 
Sbjct  85   VEQIPGLNTLGISMVRIDYAPYGQNPPHTHPRATEILVVLEGTLLVGFVTSN----NENR  140

Query  515  LFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSSQNPGVITIANAVFGSNPPINPQ  694
            L +K L  GDVFVFP GLIHFQFNVGKTNA+AFAGLSSQNPGVITIANAVFGS+PPI+P 
Sbjct  141  LISKVLYKGDVFVFPIGLIHFQFNVGKTNAVAFAGLSSQNPGVITIANAVFGSDPPIDPD  200

Query  695  VLTKAFQVGQNVINYLQAQFWYNNS  769
            VLT+AFQ+ ++V+  LQ++FW++N+
Sbjct  201  VLTRAFQLDEDVVKDLQSRFWWDNN  225



>gb|KCW61436.1| hypothetical protein EUGRSUZ_H04166, partial [Eucalyptus grandis]
Length=216

 Score =   290 bits (743),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 145/221 (66%), Positives = 172/221 (78%), Gaps = 5/221 (2%)
 Frame = +2

Query  92   IRFIVFTITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFFF  271
            ++F+  ++ ++AL+++   A DPSPLQDFCVA+ND    VFVNGK CK+P QV A+DF F
Sbjct  1    MKFLPISLLILALATATTFAYDPSPLQDFCVAINDP--KVFVNGKFCKDPKQVTADDFLF  58

Query  272  RGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLV  451
            +G   PGNT+NPLGSKVTP  V+   GLNTLGIS+ R DFAP GLNPPHTHPR TE+L+V
Sbjct  59   KGFRYPGNTANPLGSKVTPAFVDQFAGLNTLGISMARTDFAPGGLNPPHTHPRGTEILVV  118

Query  452  LEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSSQ  631
             EGTL VGFV SN    + N  FTK L  GDVFVFP GLIHFQ N+GKT A+AFA LSSQ
Sbjct  119  TEGTLLVGFVTSNQ---LNNTFFTKVLYKGDVFVFPIGLIHFQLNIGKTPALAFAALSSQ  175

Query  632  NPGVITIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQF  754
            NPG+ITIANAVFGS PPI+  VLTKAFQV + V++YLQAQF
Sbjct  176  NPGLITIANAVFGSKPPISAGVLTKAFQVDKKVVDYLQAQF  216



>gb|AFK48994.1| unknown [Lotus japonicus]
Length=223

 Score =   290 bits (743),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 150/225 (67%), Positives = 175/225 (78%), Gaps = 3/225 (1%)
 Frame = +2

Query  92   IRFIVFTITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFFF  271
            ++ + F +T++AL+SSFA A DPSPLQDFCV +ND    VFVNGK CK+P  V A DFF 
Sbjct  1    MKVVYFLVTILALASSFASAYDPSPLQDFCVGINDPKDGVFVNGKFCKDPALVKAEDFFK  60

Query  272  RGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLV  451
                 PG+TSNPLGSKVTPV V  L GLNTLGISL RIDFAP GLNPPHTHPRATE+L+V
Sbjct  61   H--VEPGSTSNPLGSKVTPVTVEQLFGLNTLGISLARIDFAPKGLNPPHTHPRATEILIV  118

Query  452  LEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSSQ  631
            LEGTLYVGFV SN   G  N LFTK L  G+VFVFP GLIHFQ NVG  NA+A AGLSSQ
Sbjct  119  LEGTLYVGFVTSNNANG-GNRLFTKVLNKGNVFVFPIGLIHFQLNVGSGNAVAIAGLSSQ  177

Query  632  NPGVITIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQFWYNN  766
            NPGVITIANA+F ++PPI+ +VLTKA QV +++I+ L  + WY+N
Sbjct  178  NPGVITIANALFKASPPISQEVLTKALQVDKSIIDNLLKKSWYDN  222



>emb|CBI36812.3| unnamed protein product [Vitis vinifera]
Length=447

 Score =   298 bits (763),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 150/222 (68%), Positives = 176/222 (79%), Gaps = 5/222 (2%)
 Frame = +2

Query  89   AIRFIVFTITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFF  268
             + F+V T+ +VAL SS A ASDPSPLQD CVA+++   AVFVNGK CK+P   VA DFF
Sbjct  231  GVSFLV-TVALVALVSSLASASDPSPLQDTCVAIDEPKDAVFVNGKFCKDPNLTVAEDFF  289

Query  269  FRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLL  448
            F GL+ PGNTSN + S VT VNV+ + GLNTLGIS+VRID+ P G NPPHTHPRATE+L 
Sbjct  290  FSGLDKPGNTSNAVASNVTTVNVDKIKGLNTLGISMVRIDYEPYGQNPPHTHPRATEILT  349

Query  449  VLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSS  628
            VLEGTLYVGFV SN     +N   +K L  GDVFVFP GLIHFQFNVGKT A+A AGLSS
Sbjct  350  VLEGTLYVGFVTSN----TENRFISKVLNKGDVFVFPIGLIHFQFNVGKTKAVAIAGLSS  405

Query  629  QNPGVITIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQF  754
            QNPGVITIANAVFGS+PPINP VLT+AFQ+ + V++YLQ++F
Sbjct  406  QNPGVITIANAVFGSDPPINPDVLTRAFQLDKKVVSYLQSRF  447


 Score =   286 bits (732),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 145/216 (67%), Positives = 170/216 (79%), Gaps = 5/216 (2%)
 Frame = +2

Query  89   AIRFIVFTITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFF  268
             + F+V T+ +VAL SS A ASDPSPLQD CVA++    AVFVNGK CK+P   VA DFF
Sbjct  4    GVSFLV-TVALVALVSSLASASDPSPLQDTCVAIDGPKEAVFVNGKFCKDPKLTVAEDFF  62

Query  269  FRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLL  448
            F GL+ PGNTSN + S VT VNV+ + GLNTLGIS+VRID+ P G NPPHTHPRATE+L 
Sbjct  63   FSGLDKPGNTSNAVASNVTTVNVDKIKGLNTLGISMVRIDYEPYGQNPPHTHPRATEILT  122

Query  449  VLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSS  628
            VLEGTLYVGFV SN     +N L +K L  GDVFVFP GLIHFQFN+GKTNA+A A LSS
Sbjct  123  VLEGTLYVGFVTSN----TENRLISKVLNKGDVFVFPIGLIHFQFNIGKTNAVAIAALSS  178

Query  629  QNPGVITIANAVFGSNPPINPQVLTKAFQVGQNVIN  736
            QNPGVITI NAVFGS+PPINP VLT+AFQ+ ++V++
Sbjct  179  QNPGVITITNAVFGSDPPINPDVLTRAFQLDKSVLS  214



>ref|XP_010066343.1| PREDICTED: germin-like protein subfamily 1 member 17 [Eucalyptus 
grandis]
 ref|XP_010066344.1| PREDICTED: germin-like protein subfamily 1 member 17 [Eucalyptus 
grandis]
 ref|XP_010066348.1| PREDICTED: germin-like protein subfamily 1 member 17 [Eucalyptus 
grandis]
 gb|KCW64220.1| hypothetical protein EUGRSUZ_G01870 [Eucalyptus grandis]
 gb|KCW64221.1| hypothetical protein EUGRSUZ_G01871 [Eucalyptus grandis]
 gb|KCW64224.1| hypothetical protein EUGRSUZ_G01874 [Eucalyptus grandis]
Length=222

 Score =   290 bits (743),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 147/211 (70%), Positives = 166/211 (79%), Gaps = 3/211 (1%)
 Frame = +2

Query  134  SSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFFFRGLNMPGNTSNPLG  313
            S  A ASDPSPLQDFCVAVND  +AVFVNGK CK+P  V+A+DF F     PG+TSNPLG
Sbjct  14   SCHAFASDPSPLQDFCVAVNDPNSAVFVNGKFCKDPKLVIADDFSFTKFRYPGSTSNPLG  73

Query  314  SKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLYVGFVLSNP  493
            SKVT   V+  PGLNTLGI+  R+DFAP GLNPPH HPR TE+LLV+EGTL+VGFV SN 
Sbjct  74   SKVTTAFVDQFPGLNTLGIATARLDFAPYGLNPPHIHPRGTEMLLVVEGTLHVGFVTSNQ  133

Query  494  PPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSSQNPGVITIANAVFGS  673
               + N LFTK L  GDVFVFP+GLIHFQ N+G+TNA+AFA LSSQNPG+ITIAN VFGS
Sbjct  134  ---LNNTLFTKVLTKGDVFVFPQGLIHFQLNIGQTNALAFAFLSSQNPGLITIANTVFGS  190

Query  674  NPPINPQVLTKAFQVGQNVINYLQAQFWYNN  766
             PPIN  VLTKAFQV   +INYLQAQ W+ N
Sbjct  191  KPPINVDVLTKAFQVDNKLINYLQAQNWFEN  221



>ref|XP_004290344.1| PREDICTED: germin-like protein subfamily 1 member 18-like [Fragaria 
vesca subsp. vesca]
Length=230

 Score =   290 bits (743),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 149/207 (72%), Positives = 164/207 (79%), Gaps = 5/207 (2%)
 Frame = +2

Query  149  ASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFFFRGLNMPGNTSNPLGSKVTP  328
            ASDPS LQDFCVA+ ++   VFVNGK CK+P  V  +DFFF GL MPGNTSN +GSKVTP
Sbjct  27   ASDPSSLQDFCVALKNT--DVFVNGKFCKDPKLVTEDDFFFSGLRMPGNTSNAVGSKVTP  84

Query  329  VNVNNLPGLNTLGISLVRIDFAPNG-LNPPHTHPRATEVLLVLEGTLYVGFVLSNPPPGM  505
             NV  + GLNTLGISL RID+APNG LNPPHTHPRA+E L+V+EGTLYVGFV SN   G 
Sbjct  85   ANVEQIAGLNTLGISLARIDYAPNGGLNPPHTHPRASEFLVVMEGTLYVGFVTSNTDNG-  143

Query  506  KNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSSQNPGVITIANAVFGSNPPI  685
             N LFTK L  GDVFVFP GLIHFQFN+GK  A+A AGLSSQNPG ITIANAVFGS PPI
Sbjct  144  -NKLFTKVLYPGDVFVFPVGLIHFQFNIGKVKAVAIAGLSSQNPGAITIANAVFGSKPPI  202

Query  686  NPQVLTKAFQVGQNVINYLQAQFWYNN  766
               VLTKAFQV  NV+ YLQ QFWY+N
Sbjct  203  KFDVLTKAFQVDNNVVQYLQNQFWYDN  229



>ref|XP_004513533.1| PREDICTED: germin-like protein subfamily 1 member 18-like [Cicer 
arietinum]
Length=221

 Score =   290 bits (742),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 150/225 (67%), Positives = 174/225 (77%), Gaps = 5/225 (2%)
 Frame = +2

Query  92   IRFIVFTITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFFF  271
            ++ + F  +++AL+SS A ASDPSPLQDFCVA+ D    VFVNGK CK+P+ V A DFF 
Sbjct  1    MKTLHFLESILALASSVAFASDPSPLQDFCVAIKDPKDGVFVNGKFCKDPILVNAEDFFK  60

Query  272  RGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLV  451
                 PGN SNPLGS+VTPV V+ L GLNTLGISL RIDFAPNGLNPPH HPR TE L+V
Sbjct  61   HV--EPGNASNPLGSQVTPVTVDQLFGLNTLGISLARIDFAPNGLNPPHIHPRGTEFLIV  118

Query  452  LEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSSQ  631
            +EGTLYVGFV SN      N LFTK L  GDVFVFP GLIHFQ NVG  NA+A AGLSSQ
Sbjct  119  VEGTLYVGFVTSNQD---NNRLFTKVLNKGDVFVFPIGLIHFQLNVGYGNAVAIAGLSSQ  175

Query  632  NPGVITIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQFWYNN  766
            NPGVITIANA+F SNPPI+ +VLTKA QV +++++YLQ Q WY+N
Sbjct  176  NPGVITIANALFKSNPPISDEVLTKALQVDKSIVDYLQKQSWYDN  220



>ref|XP_010024926.1| PREDICTED: germin-like protein subfamily 1 member 7 [Eucalyptus 
grandis]
 gb|KCW61466.1| hypothetical protein EUGRSUZ_H04202 [Eucalyptus grandis]
Length=223

 Score =   290 bits (742),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 149/226 (66%), Positives = 177/226 (78%), Gaps = 3/226 (1%)
 Frame = +2

Query  92   IRFIVFTITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFFF  271
            ++F+  +  V+AL+++ A A DPSPLQD CVA ND  + VFVNGK CK+P Q  A+DF F
Sbjct  1    MKFLPISFLVLALATATAFAYDPSPLQDICVATNDLNSGVFVNGKFCKDPNQASADDFLF  60

Query  272  RGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLV  451
             G   PGNTSNPLGSKVT   V+  PGLNTLGIS+ R+DFAP GLNPPHTHPR TEVL+V
Sbjct  61   TGFRNPGNTSNPLGSKVTTAFVDQFPGLNTLGISMARLDFAPGGLNPPHTHPRGTEVLVV  120

Query  452  LEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSSQ  631
            +EGTL VGFV S+    + N LFTK L  GDVFVFP GLIHFQ N+G T A+AFAGLSSQ
Sbjct  121  VEGTLLVGFVTSDQ---LNNTLFTKVLYKGDVFVFPIGLIHFQLNIGNTYALAFAGLSSQ  177

Query  632  NPGVITIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQFWYNNS  769
            NPG+ITIANAVFG+ PPI+  VLTKAFQV + V++YLQAQFWY+N+
Sbjct  178  NPGLITIANAVFGAKPPISADVLTKAFQVDKKVVDYLQAQFWYDNN  223



>ref|XP_003618165.1| Germin-like protein subfamily 1 member [Medicago truncatula]
 gb|AES74383.1| germin family protein [Medicago truncatula]
 gb|AFK46512.1| unknown [Medicago truncatula]
Length=220

 Score =   290 bits (742),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 153/222 (69%), Positives = 171/222 (77%), Gaps = 7/222 (3%)
 Frame = +2

Query  101  IVFTITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFFFRGL  280
            I+F    +AL+S  A A DPSPLQDFCVA+ND+   VFVNGK CK+P     NDFFF   
Sbjct  5    ILFVTAFLALASC-AFAFDPSPLQDFCVAINDTKNGVFVNGKFCKDPKLATPNDFFFSV-  62

Query  281  NMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEG  460
               GN SNPLGSKVTPV VN++ GLNTLGISL RIDFA  GLNPPHTHPRATE+L+VLEG
Sbjct  63   -KEGNISNPLGSKVTPVTVNDILGLNTLGISLARIDFASRGLNPPHTHPRATEILIVLEG  121

Query  461  TLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSSQNPG  640
            TLYVGFV SNP    +N L TK L  GDVFVFP GLIHFQ NVG  NA+A AGLSSQNPG
Sbjct  122  TLYVGFVTSNP----ENRLITKVLNKGDVFVFPIGLIHFQLNVGYGNAVAIAGLSSQNPG  177

Query  641  VITIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQFWYNN  766
            VITIANAVFGSNP I+ +VLTKAFQV  N+++ LQ QFW +N
Sbjct  178  VITIANAVFGSNPKISSEVLTKAFQVDNNIVDNLQKQFWVDN  219



>ref|XP_011034444.1| PREDICTED: germin-like protein subfamily 1 member 13 [Populus 
euphratica]
Length=225

 Score =   290 bits (742),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 145/205 (71%), Positives = 162/205 (79%), Gaps = 5/205 (2%)
 Frame = +2

Query  155  DPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFFFRGLNMPGNTSNPLGSKVTPVN  334
            DPSPLQDFCVA+ND+   VFVNGK CK+P    ANDFFF GLN+  +TSNP+GS VT  N
Sbjct  24   DPSPLQDFCVAINDTKDGVFVNGKFCKDPKLATANDFFFSGLNIARDTSNPVGSVVTQAN  83

Query  335  VNNLPGLNTLGISLVRIDFAP-NGLNPPHTHPRATEVLLVLEGTLYVGFVLSNPPPGMKN  511
            V  +PGLNTLGIS+VRID+AP  GLNPPHTHPRATEV+ VLEGTLYVGFV SNP     N
Sbjct  84   VAQIPGLNTLGISVVRIDYAPYGGLNPPHTHPRATEVITVLEGTLYVGFVTSNP----DN  139

Query  512  PLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSSQNPGVITIANAVFGSNPPINP  691
             L TK L  GDVFVFP GLIHFQFNVGKT A A + LSSQNPGVITIANAVFGS PPI  
Sbjct  140  RLITKVLKPGDVFVFPFGLIHFQFNVGKTKAAAMSALSSQNPGVITIANAVFGSTPPIRS  199

Query  692  QVLTKAFQVGQNVINYLQAQFWYNN  766
             VL KAFQ+ + +++YLQ QFWY+N
Sbjct  200  DVLAKAFQLDKKIVDYLQKQFWYDN  224



>ref|XP_008776810.1| PREDICTED: putative germin-like protein 2-1 isoform X1 [Phoenix 
dactylifera]
Length=203

 Score =   289 bits (740),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 151/206 (73%), Positives = 165/206 (80%), Gaps = 5/206 (2%)
 Frame = +2

Query  149  ASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFFFRGLNMPGNTSNPLGSKVTP  328
            ASDPS LQDFC+  +D   AV VNG +CK PM V A+DFFF GL+MP NTSN LGSKVT 
Sbjct  2    ASDPSQLQDFCLLPSD---AVLVNGFVCKPPMHVTADDFFFSGLDMPDNTSNQLGSKVTL  58

Query  329  VNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLYVGFVLSNPPPGMK  508
            VNVN + GLNTLGISL RID+AP GLNPPHTHP+ATE+L VLEGTLYVGFV SN   G  
Sbjct  59   VNVNQIAGLNTLGISLARIDYAPYGLNPPHTHPQATEILTVLEGTLYVGFVTSNTNNG--  116

Query  509  NPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSSQNPGVITIANAVFGSNPPIN  688
            N LFTK L  GDVFVFPEGLIHFQFN G T+A+A A LSSQNPGVITIANAVFGSNPPI+
Sbjct  117  NLLFTKMLKKGDVFVFPEGLIHFQFNYGPTHAVAVAALSSQNPGVITIANAVFGSNPPIS  176

Query  689  PQVLTKAFQVGQNVINYLQAQFWYNN  766
              VL KAFQVG++ I YLQAQFW  N
Sbjct  177  DAVLAKAFQVGKDTIKYLQAQFWVAN  202



>ref|XP_002276445.2| PREDICTED: uncharacterized protein LOC100254460 [Vitis vinifera]
Length=546

 Score =   301 bits (770),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 148/214 (69%), Positives = 170/214 (79%), Gaps = 4/214 (2%)
 Frame = +2

Query  113  ITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFFFRGLNMPG  292
            + ++A++ S A ASDPSPLQDFCVAVND+   VFVNGK C++P     NDFFF GL +PG
Sbjct  337  VVLLAMAFSVASASDPSPLQDFCVAVNDTNDTVFVNGKFCRDPKLATPNDFFFSGLRLPG  396

Query  293  NTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLYV  472
            NTSN LGS VTP NV  +PGLNTLG+SL R+D+AP GLNPPH HPRATE+L VLEGTLYV
Sbjct  397  NTSNKLGSMVTPANVAQIPGLNTLGVSLARVDYAPYGLNPPHIHPRATEILTVLEGTLYV  456

Query  473  GFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSSQNPGVITI  652
            GFV SNP    +N L +K L  GDVFVFP+GLIHFQ NVG TNA+A A LSSQNPGVITI
Sbjct  457  GFVTSNP----ENRLISKVLYKGDVFVFPQGLIHFQLNVGTTNAVAIASLSSQNPGVITI  512

Query  653  ANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQF  754
            A AVFGSNP I+  VLTKAFQV +NV+ YLQ+QF
Sbjct  513  AKAVFGSNPAISADVLTKAFQVDKNVVEYLQSQF  546


 Score =   295 bits (756),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 149/221 (67%), Positives = 171/221 (77%), Gaps = 4/221 (2%)
 Frame = +2

Query  113  ITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFFFRGLNMPG  292
            I ++A++ S A ASDPSPLQDFCVAVND+  +VFV+GK CK+P     N+FFF GL +PG
Sbjct  12   IVLLAVAFSVASASDPSPLQDFCVAVNDTNDSVFVSGKFCKDPKLATPNNFFFSGLRLPG  71

Query  293  NTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLYV  472
            NTSN LGS VTP NV  +PGLNTLG+SL R+D+A  GLNPPH HPRATE+L VLEGTLYV
Sbjct  72   NTSNKLGSMVTPANVEQIPGLNTLGVSLARVDYAAYGLNPPHIHPRATEILTVLEGTLYV  131

Query  473  GFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSSQNPGVITI  652
            GFV SNP     N L +K L  GDVFVFP+GLIHFQ NVG TNA+A A L SQN GVITI
Sbjct  132  GFVTSNP----DNSLISKVLYKGDVFVFPQGLIHFQLNVGTTNAVAIASLGSQNLGVITI  187

Query  653  ANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQFWYNNS*G  775
            ANAVFGS P I+  VLTKAFQV +NVIN LQ+QFW +N  G
Sbjct  188  ANAVFGSKPAISVDVLTKAFQVDKNVINNLQSQFWTDNHNG  228



>ref|XP_010024924.1| PREDICTED: germin-like protein subfamily 1 member 7 [Eucalyptus 
grandis]
 gb|KCW61464.1| hypothetical protein EUGRSUZ_H04200 [Eucalyptus grandis]
Length=223

 Score =   290 bits (741),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 148/226 (65%), Positives = 177/226 (78%), Gaps = 3/226 (1%)
 Frame = +2

Query  92   IRFIVFTITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFFF  271
            ++F+  +  V+AL+++ A A DPSPLQD CVA ND  + VFVNGK CK+P Q  A+DF F
Sbjct  1    MKFLPISFLVLALATATAFAYDPSPLQDICVATNDLNSGVFVNGKFCKDPNQASADDFLF  60

Query  272  RGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLV  451
             G   PGNTSNPLGSKVT   V+  PGLNTLGIS+ R+DFAP GLNPPHTHPR TE+L+V
Sbjct  61   TGFRNPGNTSNPLGSKVTTAFVDQFPGLNTLGISMARLDFAPGGLNPPHTHPRGTEILVV  120

Query  452  LEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSSQ  631
            +EGTL VGFV S+    + N LFTK L  GDVFVFP GLIHFQ N+G T A+AFAGLSSQ
Sbjct  121  VEGTLLVGFVTSDQ---LNNTLFTKVLYKGDVFVFPIGLIHFQLNIGNTYALAFAGLSSQ  177

Query  632  NPGVITIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQFWYNNS  769
            NPG+ITIANAVFG+ PPI+  VLTKAFQV + V++YLQAQFWY+N+
Sbjct  178  NPGLITIANAVFGAKPPISADVLTKAFQVDKKVVDYLQAQFWYDNN  223



>ref|XP_009402547.1| PREDICTED: putative germin-like protein 2-1 isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009402548.1| PREDICTED: putative germin-like protein 2-1 isoform X2 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009402549.1| PREDICTED: putative germin-like protein 2-1 isoform X3 [Musa 
acuminata subsp. malaccensis]
Length=221

 Score =   289 bits (740),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 147/221 (67%), Positives = 164/221 (74%), Gaps = 6/221 (3%)
 Frame = +2

Query  104  VFTITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFFFRGLN  283
            +  I ++A++SS A ASDPSPLQDFCVA  DS   V VNG +CK+P  V A DFFF GL+
Sbjct  5    ILLIALLAMASSLAMASDPSPLQDFCVADKDS--KVLVNGFVCKDPKHVTAEDFFFMGLD  62

Query  284  MPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGT  463
              GNT N LGS VT VNVN L GLNTLGIS+VRID+ P GLNPPHTHPRATE+L V+EG 
Sbjct  63   KAGNTVNKLGSMVTAVNVNKLIGLNTLGISMVRIDYGPKGLNPPHTHPRATEILTVIEGQ  122

Query  464  LYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSSQNPGV  643
            L VGFV SN      N LFTK L  GDVFVFPEGLIHFQFN G  N IA   LSSQNPG 
Sbjct  123  LLVGFVTSN----TDNRLFTKMLKKGDVFVFPEGLIHFQFNPGNCNTIAIGALSSQNPGT  178

Query  644  ITIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQFWYNN  766
            ITIANAVFGS PPI+  VL KAFQV +  I++LQAQFW +N
Sbjct  179  ITIANAVFGSKPPISDDVLAKAFQVDKKTIDWLQAQFWMDN  219



>ref|XP_011034442.1| PREDICTED: germin-like protein subfamily 1 member 13 [Populus 
euphratica]
Length=225

 Score =   289 bits (740),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 145/205 (71%), Positives = 161/205 (79%), Gaps = 5/205 (2%)
 Frame = +2

Query  155  DPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFFFRGLNMPGNTSNPLGSKVTPVN  334
            DPSPLQDFCVA+ND+   VFVNGK CK+P    ANDFFF GLN+  +TSNP+GS VT  N
Sbjct  24   DPSPLQDFCVAINDTKDGVFVNGKFCKDPKLATANDFFFSGLNIARDTSNPVGSVVTQAN  83

Query  335  VNNLPGLNTLGISLVRIDFAP-NGLNPPHTHPRATEVLLVLEGTLYVGFVLSNPPPGMKN  511
            V  +PGLNTLGIS+VRID+AP  GLNPPHTHPRATEV+ VLEGTLYVGFV SNP     N
Sbjct  84   VAQIPGLNTLGISVVRIDYAPYGGLNPPHTHPRATEVITVLEGTLYVGFVTSNP----DN  139

Query  512  PLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSSQNPGVITIANAVFGSNPPINP  691
             L TK L  GDVFVFP GLIHFQFNVGKT A A + LSSQNPGVITIANAVFGS PPI  
Sbjct  140  RLITKVLKPGDVFVFPFGLIHFQFNVGKTKAAAMSALSSQNPGVITIANAVFGSTPPIRS  199

Query  692  QVLTKAFQVGQNVINYLQAQFWYNN  766
             VL KAFQV + +++YLQ Q WY+N
Sbjct  200  DVLAKAFQVDKKIVDYLQKQLWYDN  224



>ref|XP_008808106.1| PREDICTED: putative germin-like protein 2-1 isoform X1 [Phoenix 
dactylifera]
Length=222

 Score =   289 bits (740),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 152/211 (72%), Positives = 165/211 (78%), Gaps = 4/211 (2%)
 Frame = +2

Query  134  SSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFFFRGLNMPGNTSNPLG  313
            SS   ASDPS LQDFCVA  D  + V VNG +CK PM V A+DFFF G +MPGNTSN LG
Sbjct  15   SSRVMASDPSQLQDFCVA--DLKSPVLVNGFVCKPPMHVTADDFFFSGHDMPGNTSNQLG  72

Query  314  SKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLYVGFVLSNP  493
            SKVT VNVN + GLNTLGISL RID+AP GLNPPHTHPRATE+L VLEGTLYVGFV +N 
Sbjct  73   SKVTQVNVNQIAGLNTLGISLARIDYAPYGLNPPHTHPRATEILTVLEGTLYVGFVTTNT  132

Query  494  PPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSSQNPGVITIANAVFGS  673
              G  N LFTK    GDVFVFPEGLIHFQFN G T A+A A LSSQNPGVITIANAVFGS
Sbjct  133  NNG--NLLFTKMFKKGDVFVFPEGLIHFQFNYGPTPAVAVAALSSQNPGVITIANAVFGS  190

Query  674  NPPINPQVLTKAFQVGQNVINYLQAQFWYNN  766
            NP I+  VL KAFQVG++ I YLQAQFW +N
Sbjct  191  NPLISDAVLAKAFQVGKDTIKYLQAQFWVDN  221



>gb|KDP23769.1| hypothetical protein JCGZ_23602 [Jatropha curcas]
Length=223

 Score =   289 bits (740),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 152/228 (67%), Positives = 176/228 (77%), Gaps = 6/228 (3%)
 Frame = +2

Query  86   MAIRFIVFTITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDF  265
            M     +F+ TV+AL+ SFA A DPSPLQDFCVAV +   A+FVNGK CK+P    ANDF
Sbjct  1    MKGTIFLFSFTVLALAFSFASAYDPSPLQDFCVAVEEPKNAIFVNGKFCKDPNLAKANDF  60

Query  266  FFRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAP-NGLNPPHTHPRATEV  442
             F GLN+PGNT+N +GS VT VNV+ LPGLNTLGISL R+D+AP  GLNPPH HPRATE+
Sbjct  61   SFSGLNIPGNTNNGVGSNVTLVNVDLLPGLNTLGISLARLDYAPYGGLNPPHIHPRATEI  120

Query  443  LLVLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGL  622
            L+VL+GTLYVGFV SNP     + LF K L  GDVFVFP GLIHFQ NV KT A+AFAGL
Sbjct  121  LVVLKGTLYVGFVTSNP-----SRLFAKVLYPGDVFVFPIGLIHFQLNVAKTEAVAFAGL  175

Query  623  SSQNPGVITIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQFWYNN  766
            SSQNPGVITIANA FGS+PPINP VL KAFQ+ ++V+ YLQ  F  +N
Sbjct  176  SSQNPGVITIANATFGSDPPINPDVLAKAFQLDEDVVAYLQKLFGGSN  223



>ref|XP_011034305.1| PREDICTED: germin-like protein subfamily 1 member 16 [Populus 
euphratica]
Length=228

 Score =   289 bits (740),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 147/206 (71%), Positives = 170/206 (83%), Gaps = 3/206 (1%)
 Frame = +2

Query  155  DPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFFFRGLNMPGNTSNPLGSKVTPVN  334
            DPSPLQDFCVA+ ++   VFVNGK CK+P QV   DFFF GLN+P +TS P+GS VT VN
Sbjct  24   DPSPLQDFCVAMKET-DGVFVNGKFCKDPEQVTEKDFFFSGLNVPRDTSGPVGSNVTAVN  82

Query  335  VNNLPGLNTLGISLVRIDFAPNG-LNPPHTHPRATEVLLVLEGTLYVGFVLSNPPPGMKN  511
            V  +PGLNTL ISLVRID+AP+G LNPPHTHPRATE+L+V+EGTLYVGFV SN P G  N
Sbjct  83   VAQIPGLNTLSISLVRIDYAPHGGLNPPHTHPRATEILVVVEGTLYVGFVTSNLPNG-DN  141

Query  512  PLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSSQNPGVITIANAVFGSNPPINP  691
             L TK L  GDVFVFP GL+HFQ NVGKTNA+AFA LSSQNPGVITIANAVFG++PPINP
Sbjct  142  RLITKVLNPGDVFVFPVGLVHFQLNVGKTNAVAFASLSSQNPGVITIANAVFGADPPINP  201

Query  692  QVLTKAFQVGQNVINYLQAQFWYNNS  769
             VLTKAFQV + +++YLQ QFW +N+
Sbjct  202  NVLTKAFQVDKKLVDYLQKQFWTDNN  227



>ref|XP_004291649.1| PREDICTED: germin-like protein subfamily 1 member 11-like [Fragaria 
vesca subsp. vesca]
Length=230

 Score =   289 bits (740),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 149/229 (65%), Positives = 172/229 (75%), Gaps = 9/229 (4%)
 Frame = +2

Query  95   RFIVFTITVVALSSSF-AHASDPSPLQDFCVAVNDSMAA---VFVNGKICKNPMQVVAND  262
              +  T+ + AL++     ASDPSPLQDFCVA+N +      VFVNGK CK+P    AND
Sbjct  5    HLLTATLAIFALATCLLVSASDPSPLQDFCVAINSAQFPQFPVFVNGKFCKDPKMATAND  64

Query  263  FFFRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNG-LNPPHTHPRATE  439
            FFF GL +P  T+N +GS VT  NV  +PGLNTLGISL RID+APNG LNPPHTHPRA+E
Sbjct  65   FFFAGLQIPKPTANAVGSTVTAANVEQIPGLNTLGISLARIDYAPNGGLNPPHTHPRASE  124

Query  440  VLLVLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAG  619
            VL+VLEGTLYVGFV SNP     N L +K L  GDVFVFP GLIHFQ N+G  NA+A A 
Sbjct  125  VLVVLEGTLYVGFVTSNP----DNKLISKVLNKGDVFVFPVGLIHFQLNIGPVNAVALAA  180

Query  620  LSSQNPGVITIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQFWYNN  766
            LSSQNPGVITIANAVFG+NPPINP VL+KAFQV + ++ YLQ QFWYNN
Sbjct  181  LSSQNPGVITIANAVFGANPPINPDVLSKAFQVDEKLVEYLQKQFWYNN  229



>ref|XP_008443754.1| PREDICTED: germin-like protein subfamily 1 member 17 [Cucumis 
melo]
Length=223

 Score =   289 bits (739),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 157/225 (70%), Positives = 173/225 (77%), Gaps = 15/225 (7%)
 Frame = +2

Query  110  TITVVALSSSF----------AHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVAN  259
            TI+V  LS++F          A A DPSPLQDFCVAV++  +AVFVNGK CKNP  V A 
Sbjct  2    TISVGFLSAAFLLVLQETIFVASAFDPSPLQDFCVAVDEPKSAVFVNGKFCKNPKFVRAE  61

Query  260  DFFFRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATE  439
            DF FRGLN+ GNT N  GS VT VNV+ LPGLNTLGISL RID+APNGLNPPHTHPRATE
Sbjct  62   DFLFRGLNIAGNTMNKQGSNVTLVNVDRLPGLNTLGISLARIDYAPNGLNPPHTHPRATE  121

Query  440  VLLVLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAG  619
            +L+V+EGTL VGFV SNP     N LFTK L  GDVFVFP GLIHFQFNVG   A+AFAG
Sbjct  122  ILVVVEGTLLVGFVTSNP-----NKLFTKVLNKGDVFVFPVGLIHFQFNVGHYPALAFAG  176

Query  620  LSSQNPGVITIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQF  754
            LSSQNPGVITIANAVFGS+PPI+  VLTKAFQV  NVI+ L  QF
Sbjct  177  LSSQNPGVITIANAVFGSDPPISIDVLTKAFQVDNNVIHALMKQF  221



>ref|XP_006375871.1| hypothetical protein POPTR_0013s04880g, partial [Populus trichocarpa]
 gb|ERP53668.1| hypothetical protein POPTR_0013s04880g, partial [Populus trichocarpa]
Length=221

 Score =   288 bits (738),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 149/207 (72%), Positives = 163/207 (79%), Gaps = 6/207 (3%)
 Frame = +2

Query  152  SDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFFFRGLNMPGNTSNPLGSKVTPV  331
            SDPSPLQDFCVA+ND+   VFVNGK CK+P     NDFFF GLN+  NTSNP+GS VTP 
Sbjct  20   SDPSPLQDFCVAINDT-KDVFVNGKFCKDPKLATENDFFFPGLNIARNTSNPVGSVVTPA  78

Query  332  NVNNLPGLNTLGISLVRIDFAP-NGLNPPHTHPRATEVLLVLEGTLYVGFVLSNPPPGMK  508
            NV  +PGLNTLGISLVRID+AP  GLNPPHTHPRATE+L VLEGTLYVGFV SNP     
Sbjct  79   NVAQIPGLNTLGISLVRIDYAPYGGLNPPHTHPRATEILTVLEGTLYVGFVTSNP----D  134

Query  509  NPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSSQNPGVITIANAVFGSNPPIN  688
            N L TK L  GDVFVFP GLIHFQFNVGKT A A   LSSQNPGVITI NAVFGS PPI 
Sbjct  135  NRLITKVLHPGDVFVFPVGLIHFQFNVGKTKASAIGALSSQNPGVITITNAVFGSTPPIR  194

Query  689  PQVLTKAFQVGQNVINYLQAQFWYNNS  769
              VL KAFQV +N+++YLQ QFWY+N+
Sbjct  195  SDVLAKAFQVDKNLVDYLQKQFWYDNN  221



>ref|XP_010027143.1| PREDICTED: uncharacterized protein LOC104417591 [Eucalyptus grandis]
Length=451

 Score =   296 bits (758),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 146/204 (72%), Positives = 163/204 (80%), Gaps = 3/204 (1%)
 Frame = +2

Query  155  DPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFFFRGLNMPGNTSNPLGSKVTPVN  334
            DPSPLQD CVA+ND  +AVFVNG+ CK+P Q  A+DF F G   PGNT+NPLGSKVTP  
Sbjct  250  DPSPLQDICVAINDPKSAVFVNGEFCKDPKQANADDFTFMGFRKPGNTANPLGSKVTPAT  309

Query  335  VNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLYVGFVLSNPPPGMKNP  514
            VN  PGLNTLGIS  RIDFAP GLNPPHTHPR TEVL+V+EGTL VGFV SN    + N 
Sbjct  310  VNEFPGLNTLGISAARIDFAPGGLNPPHTHPRGTEVLVVIEGTLLVGFVTSN---QLNNT  366

Query  515  LFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSSQNPGVITIANAVFGSNPPINPQ  694
            LFTK L  GDVFVFP GLIHFQ N GKT A+AFAGLSSQNPGVITIAN+VFG+ PPI+  
Sbjct  367  LFTKVLYKGDVFVFPIGLIHFQLNTGKTPALAFAGLSSQNPGVITIANSVFGTKPPISAD  426

Query  695  VLTKAFQVGQNVINYLQAQFWYNN  766
            VLTKAFQV +  ++YLQAQFWY+N
Sbjct  427  VLTKAFQVDKKTVDYLQAQFWYDN  450


 Score =   293 bits (750),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 145/204 (71%), Positives = 162/204 (79%), Gaps = 3/204 (1%)
 Frame = +2

Query  155  DPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFFFRGLNMPGNTSNPLGSKVTPVN  334
            DPSPLQD CVA+ND  +AVFVNG+ CK+P Q  A+DF F G   PGNT+NPLGSKVTP  
Sbjct  22   DPSPLQDICVAINDPKSAVFVNGEFCKDPKQANADDFTFMGFRKPGNTANPLGSKVTPAT  81

Query  335  VNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLYVGFVLSNPPPGMKNP  514
            VN  PGLNTLGIS  RIDFAP GLNPPHTHPR TEVL+V+EGTL VGFV SN    + N 
Sbjct  82   VNEFPGLNTLGISAARIDFAPGGLNPPHTHPRGTEVLVVIEGTLLVGFVTSN---QLNNT  138

Query  515  LFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSSQNPGVITIANAVFGSNPPINPQ  694
            LFTK L  GDVFVFP GLIHFQ N GKT A+AFAGLSSQNPGVITIAN+VFG+ PPI+  
Sbjct  139  LFTKVLYKGDVFVFPIGLIHFQLNTGKTPALAFAGLSSQNPGVITIANSVFGAKPPISAD  198

Query  695  VLTKAFQVGQNVINYLQAQFWYNN  766
            VLTKAFQV +  ++YL AQFWY+N
Sbjct  199  VLTKAFQVDKKTVDYLLAQFWYDN  222



>gb|AFK49577.1| unknown [Lotus japonicus]
Length=220

 Score =   288 bits (737),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 146/204 (72%), Positives = 162/204 (79%), Gaps = 6/204 (3%)
 Frame = +2

Query  155  DPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFFFRGLNMPGNTSNPLGSKVTPVN  334
            DPSPLQDFCVA+NDS + VFVNG  CK+P +   NDFFF      GNTSNPLGSKVTPV 
Sbjct  22   DPSPLQDFCVAINDSKSGVFVNGMFCKDPTRATPNDFFFS--VKEGNTSNPLGSKVTPVA  79

Query  335  VNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLYVGFVLSNPPPGMKNP  514
            V  +PGLNTLGISL RIDFA  GLNPPH+HPR TE+L+VLEGTLYVGFV SNP    +N 
Sbjct  80   VTEIPGLNTLGISLARIDFARKGLNPPHSHPRGTEILIVLEGTLYVGFVTSNP----ENR  135

Query  515  LFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSSQNPGVITIANAVFGSNPPINPQ  694
            L TK L  GDVFVFP GLIHFQ NVG  NA A AGLSSQNPGV TIANAVFGS+P I+ Q
Sbjct  136  LITKVLNKGDVFVFPIGLIHFQLNVGYGNAAAIAGLSSQNPGVTTIANAVFGSDPSISSQ  195

Query  695  VLTKAFQVGQNVINYLQAQFWYNN  766
            VLTKAFQV +NV++YLQ QFW++N
Sbjct  196  VLTKAFQVDKNVVDYLQKQFWWDN  219



>emb|CBI39477.3| unnamed protein product [Vitis vinifera]
Length=220

 Score =   288 bits (737),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 146/221 (66%), Positives = 172/221 (78%), Gaps = 5/221 (2%)
 Frame = +2

Query  92   IRFIVFTITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFFF  271
            + F+V   T + L+ S A+A DPSPLQD CVA++D  AAVFVNGK CK+P      DFFF
Sbjct  5    VHFLV-AATFMGLAFSLAYAYDPSPLQDTCVAIDDPKAAVFVNGKFCKDPKLATPEDFFF  63

Query  272  RGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLV  451
             GL++P NTSNP+GS VTPVNV  + GLNTLGIS+ R+D+AP GLNPPHTHPRATE+L+V
Sbjct  64   SGLHIPRNTSNPVGSTVTPVNVAQIAGLNTLGISMARVDYAPYGLNPPHTHPRATEILVV  123

Query  452  LEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSSQ  631
            L+GTLYVGFV SNP     N L +K L  GDVFVFP  LIHFQ NVG TNA+A A L SQ
Sbjct  124  LKGTLYVGFVTSNP----DNRLISKVLNKGDVFVFPISLIHFQLNVGHTNAVAIAALGSQ  179

Query  632  NPGVITIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQF  754
            NPGVITIANAVFGSNPPI+  VLTKAFQ+ +NV++YLQ+ F
Sbjct  180  NPGVITIANAVFGSNPPISADVLTKAFQLDKNVVDYLQSSF  220



>emb|CBI36814.3| unnamed protein product [Vitis vinifera]
Length=225

 Score =   288 bits (737),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 145/226 (64%), Positives = 176/226 (78%), Gaps = 5/226 (2%)
 Frame = +2

Query  89   AIRFIVFTITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFF  268
             + F+V T+ ++AL SS A ASDP PLQD CVA+++   AVFVNGK CK+P   +A DFF
Sbjct  4    GVSFLV-TVALIALVSSLASASDPGPLQDTCVAIDEPSDAVFVNGKFCKDPKLTMAEDFF  62

Query  269  FRGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLL  448
              GL+ PGNTSN + S VT VNV+ + GLNTLGIS+VRID+ P G NPPHTHPRA+E+L 
Sbjct  63   SSGLDKPGNTSNQVRSNVTTVNVDKIKGLNTLGISIVRIDYEPYGQNPPHTHPRASEILT  122

Query  449  VLEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSS  628
            VLEGTLYVGFV SNP    +N L +K L  GDVFVFP GLIHFQFNVG TNA+A AGL+S
Sbjct  123  VLEGTLYVGFVTSNP----ENRLISKVLNKGDVFVFPIGLIHFQFNVGHTNAVAIAGLNS  178

Query  629  QNPGVITIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQFWYNN  766
            QNPGVITIA AVFGSNPPIN  +LT+AFQ+ +NV++ LQ++F  +N
Sbjct  179  QNPGVITIAKAVFGSNPPINTDILTRAFQLDKNVVDDLQSRFSSDN  224



>gb|ACG69479.1| germin-like protein 3 [Glycine max]
 gb|KHN10834.1| Germin-like protein subfamily 1 member 7 [Glycine soja]
Length=221

 Score =   288 bits (737),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 147/225 (65%), Positives = 172/225 (76%), Gaps = 6/225 (3%)
 Frame = +2

Query  92   IRFIVFTITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFFF  271
            ++ + F + ++AL+S+   A DPSPLQDFCVA  +    VFVNGK CK+P  V A DFF 
Sbjct  1    MKVVYFLVAILALTSTVVSAYDPSPLQDFCVAAKEK-DGVFVNGKFCKDPKLVKAEDFFK  59

Query  272  RGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLV  451
                 P NT+NPLGS+VTPV V+ LPGLNTLGISL RID+AP GLNPPHTHPR TE+L+V
Sbjct  60   H--VEPANTANPLGSQVTPVFVDQLPGLNTLGISLARIDYAPKGLNPPHTHPRGTEILIV  117

Query  452  LEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSSQ  631
            LEGTLYVGFV SN      N LFTK L  GDVFVFP GLIHFQ NVG  NA+A AGLSSQ
Sbjct  118  LEGTLYVGFVTSNQD---GNRLFTKVLNKGDVFVFPIGLIHFQLNVGYGNAVAIAGLSSQ  174

Query  632  NPGVITIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQFWYNN  766
            NPG ITIANA+F +NPPI+P+VLTKAFQV ++ I+YLQ Q WY+N
Sbjct  175  NPGTITIANALFKANPPISPEVLTKAFQVDKSTIDYLQKQSWYDN  219



>ref|XP_011034443.1| PREDICTED: germin-like protein subfamily 1 member 13 [Populus 
euphratica]
Length=225

 Score =   288 bits (737),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 144/205 (70%), Positives = 161/205 (79%), Gaps = 5/205 (2%)
 Frame = +2

Query  155  DPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFFFRGLNMPGNTSNPLGSKVTPVN  334
            DPSPLQDFCVA+ND+   VFVNG+ CK+P    ANDFFF GLN+  +TSNP+GS VT  N
Sbjct  24   DPSPLQDFCVAINDTKDGVFVNGRFCKDPKLATANDFFFSGLNIARDTSNPVGSVVTQAN  83

Query  335  VNNLPGLNTLGISLVRIDFAP-NGLNPPHTHPRATEVLLVLEGTLYVGFVLSNPPPGMKN  511
            V  +PGLNTLGIS+VRID+AP  GLNPPHTHPRATEV+ VLEGTLYVGFV SNP     N
Sbjct  84   VAQIPGLNTLGISVVRIDYAPYGGLNPPHTHPRATEVITVLEGTLYVGFVTSNP----DN  139

Query  512  PLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSSQNPGVITIANAVFGSNPPINP  691
             L TK L  GDVFVFP GLIHFQFNVGKT A A + LSSQNPGVITIANAVFGS PPI  
Sbjct  140  RLITKVLKPGDVFVFPFGLIHFQFNVGKTKASAISALSSQNPGVITIANAVFGSTPPIRS  199

Query  692  QVLTKAFQVGQNVINYLQAQFWYNN  766
             VL KAFQV + +++YLQ Q WY+N
Sbjct  200  DVLAKAFQVDKKIVDYLQKQLWYDN  224



>ref|XP_004513532.1| PREDICTED: germin-like protein subfamily 1 member 7-like [Cicer 
arietinum]
Length=221

 Score =   288 bits (736),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 148/225 (66%), Positives = 173/225 (77%), Gaps = 5/225 (2%)
 Frame = +2

Query  92   IRFIVFTITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFFF  271
            ++ + F ++++AL+S  A A DPSPLQDFCVA+ D    VFVNGK CK+P+ V A DFF 
Sbjct  1    MKTLHFLVSILALASCVAFAYDPSPLQDFCVAIKDPKDGVFVNGKFCKDPILVNAEDFFK  60

Query  272  RGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLV  451
                 PGN SNPLGS+VTPV V+ L GLNTLGISL RIDFAP GLNPPH HPR TE L+V
Sbjct  61   HV--EPGNASNPLGSQVTPVTVDQLFGLNTLGISLARIDFAPKGLNPPHIHPRGTEFLIV  118

Query  452  LEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSSQ  631
            +EGTLYVGFV SN      N LF+K L  GDVFVFP GLIHFQ NVG  NA+A AGLSSQ
Sbjct  119  VEGTLYVGFVTSNQD---NNRLFSKVLNKGDVFVFPIGLIHFQLNVGYGNAVAIAGLSSQ  175

Query  632  NPGVITIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQFWYNN  766
            NPGVITIANA+F SNPPI+ +VLTKAFQV +++I+YLQ Q WY+N
Sbjct  176  NPGVITIANALFKSNPPISDEVLTKAFQVDKSIIDYLQKQSWYDN  220



>ref|XP_010050174.1| PREDICTED: germin-like protein subfamily 1 member 7 [Eucalyptus 
grandis]
 gb|KCW89289.1| hypothetical protein EUGRSUZ_A01579 [Eucalyptus grandis]
Length=223

 Score =   288 bits (736),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 147/226 (65%), Positives = 176/226 (78%), Gaps = 3/226 (1%)
 Frame = +2

Query  92   IRFIVFTITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFFF  271
            ++++  ++ ++AL+++ A A DPSPLQD CVA ND  + VFVNGK CK+P Q  A+DF F
Sbjct  1    MKYLPISLLILALATATAFAYDPSPLQDICVATNDPNSGVFVNGKFCKDPKQASADDFLF  60

Query  272  RGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLV  451
             GL  PGNT+NPLGSKVT   V+  PGLNTLGIS+ R+DFAP GLNPPHTHPR TEVL+V
Sbjct  61   MGLRNPGNTANPLGSKVTQAFVDQFPGLNTLGISMARLDFAPGGLNPPHTHPRGTEVLVV  120

Query  452  LEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSSQ  631
            +EG L VGFV SN    + N LFTK L  GDVFVFP GLIHFQ N G TNA+AFAGLSSQ
Sbjct  121  VEGMLLVGFVTSNQ---LNNTLFTKVLYKGDVFVFPIGLIHFQLNTGNTNALAFAGLSSQ  177

Query  632  NPGVITIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQFWYNNS  769
            NPGVITIANAVFG+  PI+  VLTKAFQV +  ++YLQAQFWY+N+
Sbjct  178  NPGVITIANAVFGAKLPISTDVLTKAFQVDKKEVDYLQAQFWYDNN  223



>ref|XP_006375874.1| germin-like protein 1, partial [Populus trichocarpa]
 gb|ERP53671.1| germin-like protein 1, partial [Populus trichocarpa]
Length=199

 Score =   286 bits (733),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 146/203 (72%), Positives = 160/203 (79%), Gaps = 5/203 (2%)
 Frame = +2

Query  164  PLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFFFRGLNMPGNTSNPLGSKVTPVNVNN  343
            PLQDFCVA+ND+   VFVNGK CK+P     NDFFF GLN+  NTSNP+GS VTP NV  
Sbjct  1    PLQDFCVAINDTKDGVFVNGKFCKDPKLATENDFFFPGLNIARNTSNPVGSVVTPANVAQ  60

Query  344  LPGLNTLGISLVRIDFAP-NGLNPPHTHPRATEVLLVLEGTLYVGFVLSNPPPGMKNPLF  520
            +PGLNTLGISLVRID+AP  GLNPPHTHPRATE+L VLEGTLYVGFV SNP     N L 
Sbjct  61   IPGLNTLGISLVRIDYAPYGGLNPPHTHPRATEILTVLEGTLYVGFVTSNP----DNRLI  116

Query  521  TKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSSQNPGVITIANAVFGSNPPINPQVL  700
            TK L AGDVFVFP GLIHFQFNVGKT A A   LSSQNPGVITI NAVFGS PPI   VL
Sbjct  117  TKVLNAGDVFVFPVGLIHFQFNVGKTKASAIGALSSQNPGVITITNAVFGSTPPIRSDVL  176

Query  701  TKAFQVGQNVINYLQAQFWYNNS  769
             KAFQV +N+++YLQ QFWY+N+
Sbjct  177  AKAFQVDKNLVDYLQKQFWYDNN  199



>ref|XP_003604729.1| Germin-like protein subfamily 1 member [Medicago truncatula]
 ref|XP_003614210.1| Germin-like protein subfamily 1 member [Medicago truncatula]
 ref|XP_003614212.1| Germin-like protein subfamily 1 member [Medicago truncatula]
 gb|AES86926.1| germin family protein [Medicago truncatula]
 gb|AES97168.1| germin family protein [Medicago truncatula]
 gb|AES97170.1| germin family protein [Medicago truncatula]
Length=221

 Score =   287 bits (735),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 146/225 (65%), Positives = 171/225 (76%), Gaps = 5/225 (2%)
 Frame = +2

Query  92   IRFIVFTITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFFF  271
            ++ I F ++++AL+SS A A DPSPLQDFCVA+ D    VFVNGK CK+P  V A DFF 
Sbjct  1    MKIIYFLVSILALASSLAFAYDPSPLQDFCVAIKDPKDGVFVNGKFCKDPALVKAEDFFK  60

Query  272  RGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLV  451
                  GN SN LGS+VTPV V+ L GLNTLGISL R+DFAP GLNPPH HPR TE+L+V
Sbjct  61   H--VEAGNASNALGSQVTPVTVDQLFGLNTLGISLARVDFAPKGLNPPHIHPRGTEILIV  118

Query  452  LEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSSQ  631
            LEGTLYVGFV SN      N LFTK L  GDVFVFP GLIHFQ NVG  NA+A AGLSSQ
Sbjct  119  LEGTLYVGFVTSNQD---NNRLFTKVLNKGDVFVFPIGLIHFQLNVGYGNAVAIAGLSSQ  175

Query  632  NPGVITIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQFWYNN  766
            NPGVIT+ANA+F S+P I+ +VLTKAFQV +++I+YLQ Q WY+N
Sbjct  176  NPGVITVANALFKSDPLISDEVLTKAFQVDKSIIDYLQKQSWYDN  220



>ref|XP_003604731.1| Germin-like protein subfamily 1 member [Medicago truncatula]
 gb|AES86928.1| germin family protein [Medicago truncatula]
Length=221

 Score =   287 bits (735),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 146/225 (65%), Positives = 171/225 (76%), Gaps = 5/225 (2%)
 Frame = +2

Query  92   IRFIVFTITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFFF  271
            ++ I F ++++AL+SS A A DPSPLQDFCVA+ D    VFVNGK CK+P  V A DFF 
Sbjct  1    MKIIYFLVSILALASSLAFAYDPSPLQDFCVAIKDPKDGVFVNGKFCKDPALVKAEDFFE  60

Query  272  RGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLV  451
                  GN SN LGS+VTPV V+ L GLNTLGISL R+DFAP GLNPPH HPR TE+L+V
Sbjct  61   H--VEAGNASNALGSQVTPVTVDQLFGLNTLGISLARVDFAPKGLNPPHIHPRGTEILIV  118

Query  452  LEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSSQ  631
            LEGTLYVGFV SN      N LFTK L  GDVFVFP GLIHFQ NVG  NA+A AGLSSQ
Sbjct  119  LEGTLYVGFVTSNQD---NNRLFTKVLNKGDVFVFPIGLIHFQLNVGYGNAVAIAGLSSQ  175

Query  632  NPGVITIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQFWYNN  766
            NPGVIT+ANA+F S+P I+ +VLTKAFQV +++I+YLQ Q WY+N
Sbjct  176  NPGVITVANALFKSDPLISDEVLTKAFQVDKSIIDYLQKQSWYDN  220



>emb|CDY15957.1| BnaA04g11540D [Brassica napus]
Length=223

 Score =   287 bits (735),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 144/219 (66%), Positives = 176/219 (80%), Gaps = 4/219 (2%)
 Frame = +2

Query  98   FIVFTITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFFFRG  277
             I+  I ++AL  SFA A DPSPLQDFCVA++D +  VFVNG+ CK+PM+V A DFFF G
Sbjct  7    LILIPIAILALVISFAEAYDPSPLQDFCVAIDD-LNGVFVNGRFCKDPMRVNAEDFFFSG  65

Query  278  LNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLE  457
            LN+PGNTSN +GS VT VNV+ +PGLNT+GISLVRID+AP+G NPPHTHPR +E+L++++
Sbjct  66   LNVPGNTSNQVGSNVTTVNVDQIPGLNTMGISLVRIDYAPHGQNPPHTHPRGSEILVLIK  125

Query  458  GTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSSQNP  637
            GTLYVGFV SN      N LF K L  GDVFVFP G+IHFQ N+GK  A+AFAGLSSQN 
Sbjct  126  GTLYVGFVSSNQD---NNRLFAKVLHPGDVFVFPIGMIHFQVNIGKVPAVAFAGLSSQNA  182

Query  638  GVITIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQF  754
            GVITIANAVFGSNPPI P+VL +AFQ+ +N++  LQA+F
Sbjct  183  GVITIANAVFGSNPPIYPEVLARAFQLDENIVKELQAKF  221



>ref|XP_009129904.1| PREDICTED: germin-like protein subfamily 1 member 16 [Brassica 
rapa]
 emb|CDY05545.1| BnaA02g31460D [Brassica napus]
Length=223

 Score =   287 bits (735),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 144/219 (66%), Positives = 176/219 (80%), Gaps = 4/219 (2%)
 Frame = +2

Query  98   FIVFTITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFFFRG  277
             I+  I ++AL  SFA A DPSPLQDFCVA++D +  VFVNG+ CK+PM+V A DFFF G
Sbjct  7    LILIPIAILALVISFAEAYDPSPLQDFCVAIDD-LNGVFVNGRFCKDPMRVNAEDFFFSG  65

Query  278  LNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLE  457
            LN+PGNTSN +GS VT VNV+ +PGLNT+GISLVRID+AP+G NPPHTHPR +E+L++++
Sbjct  66   LNVPGNTSNQVGSNVTTVNVDQIPGLNTMGISLVRIDYAPHGQNPPHTHPRGSEILVLIK  125

Query  458  GTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSSQNP  637
            GTLYVGFV SN      N LF K L  GDVFVFP G+IHFQ N+GK  A+AFAGLSSQN 
Sbjct  126  GTLYVGFVSSNQD---NNRLFAKVLHPGDVFVFPIGMIHFQVNIGKVPAVAFAGLSSQNA  182

Query  638  GVITIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQF  754
            GVITIANAVFGSNPPI P+VL +AFQ+ +N++  LQA+F
Sbjct  183  GVITIANAVFGSNPPIYPEVLARAFQLDENIVKELQAKF  221



>ref|NP_001236994.1| uncharacterized protein LOC100527249 precursor [Glycine max]
 gb|ACU16305.1| unknown [Glycine max]
Length=221

 Score =   287 bits (735),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 146/225 (65%), Positives = 172/225 (76%), Gaps = 6/225 (3%)
 Frame = +2

Query  92   IRFIVFTITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFFF  271
            ++ + F + ++AL+S+   A DPSPLQDFCVA  +    VFVNGK CK+P  V A DFF 
Sbjct  1    MKVVYFLVAILALTSTVVSAYDPSPLQDFCVAAKEK-DGVFVNGKFCKDPKLVKAEDFFK  59

Query  272  RGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLV  451
                 P NT+NPLGS+VTPV V+ LPGLNTLGISL RID+AP GLNPPHTHPR TE+L+V
Sbjct  60   H--VEPANTANPLGSQVTPVFVDQLPGLNTLGISLARIDYAPKGLNPPHTHPRGTEILIV  117

Query  452  LEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSSQ  631
            LEGTLYVGFV SN      N LFTK L  GDVFVFP GL+HFQ NVG  NA+A AGLSSQ
Sbjct  118  LEGTLYVGFVTSNQD---GNRLFTKVLNKGDVFVFPIGLVHFQLNVGYGNAVAIAGLSSQ  174

Query  632  NPGVITIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQFWYNN  766
            NPG ITIANA+F +NPPI+P+VLTKAFQV ++ I+YLQ Q WY+N
Sbjct  175  NPGTITIANALFKANPPISPEVLTKAFQVDKSTIDYLQKQSWYDN  219



>ref|NP_001268198.1| germin-like protein 3 precursor [Vitis vinifera]
 gb|AAQ63185.2| germin-like protein 3 [Vitis vinifera]
Length=225

 Score =   287 bits (735),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 139/204 (68%), Positives = 167/204 (82%), Gaps = 4/204 (2%)
 Frame = +2

Query  155  DPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFFFRGLNMPGNTSNPLGSKVTPVN  334
            DPSPLQD CVA++D    VFVNGK CK+     A+DFF+ GL++PGN +NP+GS VTPVN
Sbjct  25   DPSPLQDICVAISDPKDGVFVNGKFCKDLKLASADDFFYYGLHIPGNITNPVGSMVTPVN  84

Query  335  VNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLVLEGTLYVGFVLSNPPPGMKNP  514
            V  +PGLNTLGIS+VRID+AP G NPPHTHPRATE+L+VLEGTL VGFV SN     +N 
Sbjct  85   VEQIPGLNTLGISMVRIDYAPYGQNPPHTHPRATEILVVLEGTLLVGFVTSN----NENR  140

Query  515  LFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSSQNPGVITIANAVFGSNPPINPQ  694
            L +K L  GDVFVFP GLIHFQFNVGK  A+AFAGLSSQNPGVITIANAVFGS+PPI+P 
Sbjct  141  LISKVLYKGDVFVFPIGLIHFQFNVGKAKAVAFAGLSSQNPGVITIANAVFGSDPPIDPD  200

Query  695  VLTKAFQVGQNVINYLQAQFWYNN  766
            VLT+AFQ+ ++V+  LQ++FW++N
Sbjct  201  VLTRAFQLDEDVVKDLQSRFWWDN  224



>ref|NP_187246.1| germin-like protein subfamily 1 member 7 [Arabidopsis thaliana]
 sp|Q9SFF9.1|GL17_ARATH RecName: Full=Germin-like protein subfamily 1 member 7; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAF23221.1|AC013454_8 germin-like protein [Arabidopsis thaliana]
 gb|AAF26097.1|AC012393_23 germin-like protein [Arabidopsis thaliana]
 dbj|BAF01026.1| germin-like protein [Arabidopsis thaliana]
 gb|AEE74322.1| germin-like protein subfamily 1 member 7 [Arabidopsis thaliana]
Length=229

 Score =   287 bits (734),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 146/224 (65%), Positives = 174/224 (78%), Gaps = 4/224 (2%)
 Frame = +2

Query  92   IRFIVFTITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFFF  271
            +RF+V    ++AL+SSF    DPSPLQDFCVAV+D+ + VFVNGK CK+P  V A DFF 
Sbjct  5    LRFLVAKAILLALASSFVSCYDPSPLQDFCVAVDDA-SGVFVNGKFCKDPKYVKAEDFFT  63

Query  272  RGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLV  451
             GLN+ GNT N +GS VT VNV+ +PGLNTLG+SLVRIDFAP G NPPHTHPRATE+L+V
Sbjct  64   SGLNIAGNTINRVGSNVTNVNVDKIPGLNTLGVSLVRIDFAPGGQNPPHTHPRATEILVV  123

Query  452  LEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSSQ  631
            +EGTL VGFV SN      N LF+K L  GDVFVFP G+IHFQ NVG+TNA+AFAGL SQ
Sbjct  124  VEGTLLVGFVTSNQD---NNRLFSKVLYPGDVFVFPIGMIHFQVNVGRTNAVAFAGLGSQ  180

Query  632  NPGVITIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQFWYN  763
            NPG ITIA+AVFGS P I P++L KAFQ+  NV+ YL+A+F  N
Sbjct  181  NPGTITIADAVFGSKPSIMPEILAKAFQLDVNVVKYLEARFSSN  224



>gb|KCW64218.1| hypothetical protein EUGRSUZ_G01868, partial [Eucalyptus grandis]
 gb|KCW64219.1| hypothetical protein EUGRSUZ_G01869, partial [Eucalyptus grandis]
 gb|KCW64222.1| hypothetical protein EUGRSUZ_G01872, partial [Eucalyptus grandis]
 gb|KCW64223.1| hypothetical protein EUGRSUZ_G01873, partial [Eucalyptus grandis]
Length=216

 Score =   286 bits (732),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 148/221 (67%), Positives = 174/221 (79%), Gaps = 5/221 (2%)
 Frame = +2

Query  92   IRFIVFTITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFFF  271
            ++F+  ++ ++AL+++ A A DPSPLQDFCVA+ND    VFVNGK CK+P QV A DF F
Sbjct  1    MKFLPISLLILALATATAFAYDPSPLQDFCVAINDP--KVFVNGKFCKDPKQVTAEDFLF  58

Query  272  RGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLV  451
            +G   PGNT+NPLGSKVTP  V+  PG+NTLGIS+ RIDFAP GLNPPHTHPR TE+L+V
Sbjct  59   KGFRYPGNTANPLGSKVTPAFVDQFPGINTLGISMARIDFAPGGLNPPHTHPRGTEILVV  118

Query  452  LEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSSQ  631
             EGTL VGFV SN    + N  FTK L  GDVFVFP GLIHFQ N+GKT A+AFA LSSQ
Sbjct  119  AEGTLLVGFVTSN---QLNNTFFTKVLYKGDVFVFPIGLIHFQLNIGKTPALAFAALSSQ  175

Query  632  NPGVITIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQF  754
            NPGVITIANAVFGS PPI+  VLTKAFQV + V++YLQAQF
Sbjct  176  NPGVITIANAVFGSKPPISADVLTKAFQVDKKVVDYLQAQF  216



>gb|KCW44233.1| hypothetical protein EUGRSUZ_L02343 [Eucalyptus grandis]
Length=231

 Score =   287 bits (734),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 149/221 (67%), Positives = 174/221 (79%), Gaps = 5/221 (2%)
 Frame = +2

Query  92   IRFIVFTITVVALSSSFAHASDPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFFF  271
            ++F+  ++ ++AL+++ A A DPSPLQDFCVA+ND    VFVNGK CK+P QV A DF F
Sbjct  1    MKFLPISLLILALATATAFAYDPSPLQDFCVAINDP--KVFVNGKFCKDPKQVTAEDFLF  58

Query  272  RGLNMPGNTSNPLGSKVTPVNVNNLPGLNTLGISLVRIDFAPNGLNPPHTHPRATEVLLV  451
            +G   PGNT+NPLGSKVTP  V+  PGLNTLGIS+ RIDFAP GLNPPHTHPR TE+L+V
Sbjct  59   KGFRYPGNTANPLGSKVTPAFVDQFPGLNTLGISMARIDFAPGGLNPPHTHPRGTEILVV  118

Query  452  LEGTLYVGFVLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSSQ  631
             EGTL VGFV SN    + N  FTK L  GDVFVFP GLIHFQ N+GKT A+AFA LSSQ
Sbjct  119  AEGTLLVGFVTSN---QLNNTFFTKVLYKGDVFVFPIGLIHFQLNIGKTPALAFAALSSQ  175

Query  632  NPGVITIANAVFGSNPPINPQVLTKAFQVGQNVINYLQAQF  754
            NPGVITIANAVFGS PPI+  VLTKAFQV + V++YLQAQF
Sbjct  176  NPGVITIANAVFGSKPPISADVLTKAFQVDKKVVDYLQAQF  216



>ref|XP_011038439.1| PREDICTED: germin-like protein subfamily 1 member 13 [Populus 
euphratica]
Length=236

 Score =   287 bits (734),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 149/216 (69%), Positives = 163/216 (75%), Gaps = 16/216 (7%)
 Frame = +2

Query  155  DPSPLQDFCVAVNDSMAAVFVNGKICKNPMQVVANDFFFRGLNMPG-----------NTS  301
            DPSPLQDFCVA+ND+   VFVNGK CK+P    ANDFFF GLN+             NTS
Sbjct  24   DPSPLQDFCVAINDTKDGVFVNGKFCKDPKLATANDFFFSGLNIARDTSNPVGSVARNTS  83

Query  302  NPLGSKVTPVNVNNLPGLNTLGISLVRIDFAP-NGLNPPHTHPRATEVLLVLEGTLYVGF  478
            NP+GS VTP NV  +PGLNTLGISLVRID+AP  GLNPPHTHPRATEV+ VLEGTLYVGF
Sbjct  84   NPVGSVVTPANVAQIPGLNTLGISLVRIDYAPYGGLNPPHTHPRATEVITVLEGTLYVGF  143

Query  479  VLSNPPPGMKNPLFTKTLVAGDVFVFPEGLIHFQFNVGKTNAIAFAGLSSQNPGVITIAN  658
            V SNP     N L TK L  GDVFVFP GLIHFQFNVGKT A A + LSSQNPGVITIAN
Sbjct  144  VTSNP----DNRLITKVLKPGDVFVFPFGLIHFQFNVGKTKASAISALSSQNPGVITIAN  199

Query  659  AVFGSNPPINPQVLTKAFQVGQNVINYLQAQFWYNN  766
            AVFGS PPI   VL KAFQV + +++YLQ QFWY+N
Sbjct  200  AVFGSTPPIRSDVLAKAFQVDKKIVDYLQKQFWYDN  235



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2071794642481