BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c24316_g1_i4 len=594 path=[663:0-212 876:213-400 1064:401-410
1074:411-425 36:426-457 430:458-466 2557:467-483 313:484-522
352:523-563 393:564-564 201:565-569 398:570-577 406:578-578
407:579-593]

Length=594
                                                                      Score     E

ref|XP_009049257.1|  hypothetical protein LOTGIDRAFT_113213           56.2    3e-06   
ref|XP_002648102.1|  Hypothetical protein CBG24130                    49.7    7e-04   Caenorhabditis briggsae



>ref|XP_009049257.1| hypothetical protein LOTGIDRAFT_113213, partial [Lottia gigantea]
 gb|ESP00066.1| hypothetical protein LOTGIDRAFT_113213, partial [Lottia gigantea]
Length=285

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 51/92 (55%), Gaps = 0/92 (0%)
 Frame = -3

Query  592  RFQSLRSRKFQSPRYLKSPNLKYSRFQSLMCRKFHSPRCLKSPNLKYQRFQSLRCLRFQN  413
            +F S++  KF S + +K  ++K  +F S+   KFHS +C+K  ++K  +F S++C++F +
Sbjct  7    KFHSIKGVKFHSIKCVKFHSIKGVKFHSIKGLKFHSIKCVKFHSIKGVKFHSIKCVKFHS  66

Query  412  QSYPHSQSLRCRRSQNLSSLHFPSQSSQRTHD  317
                   S++C +  ++  L F S    + H 
Sbjct  67   IKGLKFHSIKCVKFHSIKGLKFHSIKGVKFHS  98


 Score = 52.8 bits (125),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 26/92 (28%), Positives = 50/92 (54%), Gaps = 0/92 (0%)
 Frame = -3

Query  592  RFQSLRSRKFQSPRYLKSPNLKYSRFQSLMCRKFHSPRCLKSPNLKYQRFQSLRCLRFQN  413
            +F S++  KF S + +K  ++K  +F S+ C KFHS + LK  ++K  +F S++ L+F +
Sbjct  31   KFHSIKGLKFHSIKCVKFHSIKGVKFHSIKCVKFHSIKGLKFHSIKCVKFHSIKGLKFHS  90

Query  412  QSYPHSQSLRCRRSQNLSSLHFPSQSSQRTHD  317
                   S++C +  ++  + F S    + H 
Sbjct  91   IKGVKFHSIKCVKFHSIKGVKFHSIKGVKFHS  122


 Score = 52.4 bits (124),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 25/92 (27%), Positives = 50/92 (54%), Gaps = 0/92 (0%)
 Frame = -3

Query  592  RFQSLRSRKFQSPRYLKSPNLKYSRFQSLMCRKFHSPRCLKSPNLKYQRFQSLRCLRFQN  413
            +F S++  KF S + +K  ++K  +F S+ C KFHS + LK  ++K  +F S++C++F +
Sbjct  47   KFHSIKGVKFHSIKCVKFHSIKGLKFHSIKCVKFHSIKGLKFHSIKGVKFHSIKCVKFHS  106

Query  412  QSYPHSQSLRCRRSQNLSSLHFPSQSSQRTHD  317
                   S++  +  ++  + F S    + H 
Sbjct  107  IKGVKFHSIKGVKFHSIKGVKFHSIKGLKFHS  138



>ref|XP_002648102.1| Hypothetical protein CBG24130 [Caenorhabditis briggsae]
 emb|CAP20810.1| Protein CBG24130 [Caenorhabditis briggsae]
Length=994

 Score = 49.7 bits (117),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 32/76 (42%), Positives = 44/76 (58%), Gaps = 0/76 (0%)
 Frame = -3

Query  589  FQSLRSRKFQSPRYLKSPNLKYSRFQSLMCRKFHSPRCLKSPNLKYQRFQSLRCLRFQNQ  410
            FQ+LR  + Q+ R  +S NL+ S FQ+    +F + R  +S NL+    Q+LR L  QN 
Sbjct  54   FQNLRISESQNFRISESQNLRISEFQNFRISEFQNFRISESQNLRISESQNLRILESQNL  113

Query  409  SYPHSQSLRCRRSQNL  362
              P SQ+LR   SQNL
Sbjct  114  RIPESQNLRISESQNL  129



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 717231537738