BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c24304_g5_i2 len=1188 path=[8963:0-35 8999:36-91 9055:92-111
504:112-135 16881:136-151 544:152-231 624:232-264 16471:265-310
703:311-420 15078:421-468 15532:469-469 15126:470-572 964:573-632
12065:633-1187]

Length=1188
                                                                      Score     E

ref|XP_009774388.1|  PREDICTED: GDSL esterase/lipase At1g28580-like     231   2e-106   
ref|XP_009607101.1|  PREDICTED: GDSL esterase/lipase At1g28580-like     226   1e-104   
ref|XP_004248464.1|  PREDICTED: GDSL esterase/lipase At1g28610-li...    221   2e-104   
ref|XP_010327054.1|  PREDICTED: GDSL esterase/lipase At2g27360-li...    202   5e-99    
ref|XP_004234096.1|  PREDICTED: GDSL esterase/lipase At1g28590-like     174   3e-80    
ref|XP_006367776.1|  PREDICTED: GDSL esterase/lipase At1g28590-like     167   3e-78    
ref|XP_008225208.1|  PREDICTED: GDSL esterase/lipase At1g28590-like     173   5e-76    
emb|CBI30663.3|  unnamed protein product                                183   6e-76    
ref|XP_011027711.1|  PREDICTED: GDSL esterase/lipase At1g28580-like     158   2e-75    
ref|XP_002267261.1|  PREDICTED: GDSL esterase/lipase At1g28580          182   3e-75    Vitis vinifera
ref|XP_002305753.2|  hypothetical protein POPTR_0004s05350g             155   1e-74    Populus trichocarpa [western balsam poplar]
ref|XP_007212863.1|  hypothetical protein PRUPE_ppa021567mg             167   5e-74    
emb|CDP21061.1|  unnamed protein product                                158   5e-73    
emb|CDO96753.1|  unnamed protein product                                160   1e-72    
ref|XP_008225217.1|  PREDICTED: uncharacterized protein LOC103324878    154   3e-72    
emb|CDO99485.1|  unnamed protein product                                150   1e-71    
ref|XP_010277742.1|  PREDICTED: GDSL esterase/lipase At1g28610-like     170   2e-71    
emb|CDX94634.1|  BnaC07g10240D                                          160   3e-71    
ref|XP_002893538.1|  predicted protein                                  155   3e-71    
ref|XP_003542989.1|  PREDICTED: GDSL esterase/lipase At1g28600          167   4e-71    
gb|KHN08454.1|  GDSL esterase/lipase                                    167   6e-71    
emb|CDY15655.1|  BnaA07g08260D                                          162   7e-71    
ref|XP_009102892.1|  PREDICTED: GDSL esterase/lipase At1g28570-like     160   7e-71    
ref|XP_009415143.1|  PREDICTED: GDSL esterase/lipase At1g28590-li...    154   1e-70    
ref|XP_007212730.1|  hypothetical protein PRUPE_ppa019092mg             153   1e-70    
ref|XP_006415636.1|  hypothetical protein EUTSA_v10006895mg             152   2e-70    
ref|NP_973932.1|  GDSL esterase/lipase                                  157   3e-70    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009352954.1|  PREDICTED: uncharacterized protein LOC103944252    150   3e-70    
ref|XP_010501635.1|  PREDICTED: uncharacterized protein LOC104778925    156   6e-70    
gb|AAF24548.2|AC007508_11  F1K23.17                                     148   6e-70    Arabidopsis thaliana [mouse-ear cress]
emb|CDO96754.1|  unnamed protein product                                164   7e-70    
ref|XP_007020866.1|  GDSL-like Lipase/Acylhydrolase superfamily p...    159   7e-70    
ref|NP_174181.1|  GDSL esterase/lipase                                  148   7e-70    Arabidopsis thaliana [mouse-ear cress]
gb|KFK44742.1|  hypothetical protein AALP_AA1G297000                    154   8e-70    
emb|CDO96752.1|  unnamed protein product                                148   1e-69    
gb|KFK44741.1|  hypothetical protein AALP_AA1G296900                    156   1e-69    
ref|NP_174179.3|  GDSL esterase/lipase                                  146   1e-69    Arabidopsis thaliana [mouse-ear cress]
emb|CDO96749.1|  unnamed protein product                                150   2e-69    
ref|XP_009113646.1|  PREDICTED: GDSL esterase/lipase At1g28580-like     158   3e-69    
emb|CDY30822.1|  BnaC05g21980D                                          157   5e-69    
ref|XP_010422034.1|  PREDICTED: GDSL esterase/lipase At1g31550-li...    157   5e-69    
ref|XP_010478238.1|  PREDICTED: GDSL esterase/lipase At1g28600-like     155   6e-69    
emb|CDY30819.1|  BnaC05g21950D                                          158   7e-69    
emb|CDY43309.1|  BnaC03g58810D                                          152   9e-69    
ref|XP_010499588.1|  PREDICTED: GDSL esterase/lipase At1g28580-like     150   1e-68    
ref|XP_003593737.1|  GDSL esterase/lipase                               157   1e-68    
ref|XP_010435654.1|  PREDICTED: GDSL esterase/lipase At1g31550-like     158   2e-68    
ref|XP_002893537.1|  hypothetical protein ARALYDRAFT_473078             146   2e-68    
ref|XP_003542992.1|  PREDICTED: GDSL esterase/lipase At1g28580-like     160   2e-68    
ref|XP_010540488.1|  PREDICTED: GDSL esterase/lipase At1g28610-li...    158   2e-68    
emb|CDX90163.1|  BnaA08g18210D                                          150   3e-68    
ref|XP_010462954.1|  PREDICTED: uncharacterized protein LOC104743592    144   3e-68    
ref|XP_010478237.1|  PREDICTED: GDSL esterase/lipase At1g28580-like     146   4e-68    
ref|NP_174182.1|  GDSL esterase/lipase                                  148   5e-68    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010501634.1|  PREDICTED: uncharacterized protein LOC104778924    152   5e-68    
gb|AAM65183.1|  lipase, putative                                        148   5e-68    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004291631.1|  PREDICTED: GDSL esterase/lipase At1g28580-like     144   5e-68    
ref|XP_004968625.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     150   8e-68    
gb|AFK42362.1|  unknown                                                 154   9e-68    
ref|XP_009393075.1|  PREDICTED: GDSL esterase/lipase At1g28580-like     166   1e-67    
ref|XP_009109699.1|  PREDICTED: GDSL esterase/lipase At1g28670-like     152   1e-67    
ref|XP_003593742.1|  GDSL esterase/lipase                               155   1e-67    
ref|XP_003565548.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     150   2e-67    
ref|NP_174180.1|  GDSL esterase/lipase                                  146   2e-67    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006415637.1|  hypothetical protein EUTSA_v10009438mg             146   2e-67    
emb|CDY63998.1|  BnaA07g36520D                                          155   2e-67    
emb|CDY64716.1|  BnaCnng44670D                                          155   2e-67    
ref|XP_004485880.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     150   2e-67    
ref|NP_174186.1|  GDSL esterase/lipase                                  151   3e-67    Arabidopsis thaliana [mouse-ear cress]
dbj|BAF02148.1|  putative lipase                                        151   3e-67    Arabidopsis thaliana [mouse-ear cress]
gb|AAX62802.1|  lipase 2                                                155   4e-67    Brassica napus [oilseed rape]
ref|XP_009102890.1|  PREDICTED: GDSL esterase/lipase At1g28670-like     155   4e-67    
ref|NP_001057786.1|  Os06g0531900                                       147   4e-67    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010460659.1|  PREDICTED: GDSL esterase/lipase At1g28670-like     148   5e-67    
ref|XP_010460657.1|  PREDICTED: GDSL esterase/lipase At1g28580-li...    148   5e-67    
ref|XP_010499396.1|  PREDICTED: GDSL esterase/lipase At1g28580-like     147   6e-67    
ref|NP_001241470.1|  uncharacterized protein LOC100816865               159   6e-67    
ref|XP_010480702.1|  PREDICTED: uncharacterized protein LOC104759479    145   6e-67    
ref|XP_004965533.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     144   7e-67    
ref|XP_007148063.1|  hypothetical protein PHAVU_006G177400g             148   7e-67    
gb|EAZ01210.1|  hypothetical protein OsI_23235                          147   7e-67    Oryza sativa Indica Group [Indian rice]
ref|XP_010455496.1|  PREDICTED: GDSL esterase/lipase At1g31550-li...    152   7e-67    
gb|EAZ37226.1|  hypothetical protein OsJ_21564                          147   8e-67    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006656143.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     146   9e-67    
ref|NP_001042396.1|  Os01g0215700                                       152   1e-66    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001149156.1|  esterase precursor                                 149   1e-66    Zea mays [maize]
dbj|BAA94228.1|  putative esterase                                      152   1e-66    Oryza sativa Japonica Group [Japonica rice]
gb|EEE54111.1|  hypothetical protein OsJ_00875                          152   1e-66    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010912640.1|  PREDICTED: GDSL esterase/lipase At1g28650-li...    143   1e-66    
gb|ACF85857.1|  unknown                                                 142   1e-66    Zea mays [maize]
ref|XP_004485879.1|  PREDICTED: GDSL esterase/lipase At2g27360-like     151   2e-66    
ref|XP_002893540.1|  predicted protein                                  152   2e-66    
ref|XP_002457137.1|  hypothetical protein SORBIDRAFT_03g001850          149   2e-66    Sorghum bicolor [broomcorn]
ref|NP_001150078.1|  esterase                                           142   2e-66    Zea mays [maize]
ref|NP_180304.1|  GDSL esterase/lipase                                  154   2e-66    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010478243.1|  PREDICTED: GDSL esterase/lipase At1g28650          152   2e-66    
dbj|BAD44668.1|  putative lipase                                        154   2e-66    Arabidopsis thaliana [mouse-ear cress]
ref|XP_003546024.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     154   3e-66    
dbj|BAJ86481.1|  predicted protein                                      147   3e-66    
ref|XP_009102895.1|  PREDICTED: GDSL esterase/lipase At1g28570-like     142   3e-66    
ref|XP_010499397.1|  PREDICTED: GDSL esterase/lipase At1g28670          148   4e-66    
ref|XP_010912671.1|  PREDICTED: GDSL esterase/lipase At1g31550-like     152   5e-66    
ref|XP_009352806.1|  PREDICTED: GDSL esterase/lipase At1g28600-like     147   5e-66    
ref|XP_003542991.1|  PREDICTED: GDSL esterase/lipase At1g28600-li...    156   8e-66    
ref|XP_010478242.1|  PREDICTED: GDSL esterase/lipase At1g28670-like     144   8e-66    
gb|AFW80395.1|  esterase                                                149   9e-66    
ref|XP_002891138.1|  carboxylic ester hydrolase/ lipase                 154   9e-66    
ref|XP_010912598.1|  PREDICTED: GDSL esterase/lipase At1g28650-li...    155   1e-65    
ref|XP_006415633.1|  hypothetical protein EUTSA_v10007853mg             145   1e-65    
gb|KDP21068.1|  hypothetical protein JCGZ_21539                         145   1e-65    
ref|XP_008785390.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     145   1e-65    
ref|XP_010912577.1|  PREDICTED: GDSL esterase/lipase At1g28580-like     148   1e-65    
ref|XP_010460655.1|  PREDICTED: GDSL esterase/lipase At1g28610-like     146   2e-65    
ref|NP_001242505.1|  uncharacterized protein LOC100815771 precursor     149   2e-65    
ref|XP_009113642.1|  PREDICTED: GDSL esterase/lipase At2g27360-li...    149   2e-65    
ref|XP_002438501.1|  hypothetical protein SORBIDRAFT_10g020950          141   2e-65    Sorghum bicolor [broomcorn]
ref|XP_002267222.2|  PREDICTED: GDSL esterase/lipase At5g45910          149   2e-65    Vitis vinifera
ref|XP_004485878.1|  PREDICTED: GDSL esterase/lipase At1g28590-like     149   3e-65    
ref|XP_010455497.1|  PREDICTED: GDSL esterase/lipase At1g31550-li...    147   4e-65    
emb|CDO96750.1|  unnamed protein product                                140   4e-65    
emb|CDY15658.1|  BnaA07g08290D                                          142   6e-65    
ref|XP_008812183.1|  PREDICTED: GDSL esterase/lipase At1g31550-like     152   8e-65    
gb|AAX59709.1|  lipase 1                                                142   8e-65    Brassica napus [oilseed rape]
ref|XP_008777734.1|  PREDICTED: GDSL esterase/lipase At1g28570-like     142   9e-65    
ref|XP_007148066.1|  hypothetical protein PHAVU_006G177700g             147   1e-64    
ref|XP_006643908.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     146   1e-64    
ref|XP_011096449.1|  PREDICTED: uncharacterized protein LOC105175645    149   1e-64    
emb|CDX94632.1|  BnaC07g10260D                                          142   2e-64    
ref|XP_010478903.1|  PREDICTED: GDSL esterase/lipase At1g31550          145   2e-64    
ref|XP_008777735.1|  PREDICTED: GDSL esterase/lipase At1g28580-like     150   2e-64    
ref|XP_003546023.2|  PREDICTED: GDSL esterase/lipase At1g31550-like     148   3e-64    
ref|XP_010460658.1|  PREDICTED: GDSL esterase/lipase At1g28580-li...    148   3e-64    
ref|XP_009765841.1|  PREDICTED: GDSL esterase/lipase At1g28610-like     140   3e-64    
ref|XP_010460979.1|  PREDICTED: GDSL esterase/lipase At1g31550-like     147   4e-64    
ref|XP_010277743.1|  PREDICTED: GDSL esterase/lipase At1g28570-like     139   4e-64    
gb|AAF24544.2|AC007508_7  F1K23.13                                      141   5e-64    Arabidopsis thaliana [mouse-ear cress]
ref|NP_174188.1|  lipase ARAB-1                                         144   5e-64    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006828268.1|  hypothetical protein AMTR_s00023p00212280          139   5e-64    
emb|CDX94633.1|  BnaC07g10250D                                          149   6e-64    
gb|EPS71267.1|  hypothetical protein M569_03493                         139   7e-64    
ref|XP_008225209.1|  PREDICTED: GDSL esterase/lipase At5g45910          142   7e-64    
ref|XP_010478618.1|  PREDICTED: GDSL esterase/lipase At1g31550-like     150   7e-64    
ref|XP_010912632.1|  PREDICTED: GDSL esterase/lipase At1g28650-li...    143   8e-64    
ref|XP_006467672.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     147   8e-64    
gb|KHG23842.1|  hypothetical protein F383_29871                         137   8e-64    
emb|CDY43308.1|  BnaC03g58800D                                          146   9e-64    
ref|XP_009601721.1|  PREDICTED: GDSL esterase/lipase At1g28600-like     140   9e-64    
ref|XP_006449476.1|  hypothetical protein CICLE_v10015707mg             147   1e-63    
ref|XP_010462953.1|  PREDICTED: GDSL esterase/lipase At1g28580-like     139   1e-63    
ref|XP_009347996.1|  PREDICTED: GDSL esterase/lipase At1g28580-like     148   1e-63    
ref|XP_002879083.1|  predicted protein                                  151   2e-63    
ref|XP_008785157.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     137   2e-63    
gb|KDO77809.1|  hypothetical protein CISIN_1g018031mg                   145   3e-63    
ref|XP_008812189.1|  PREDICTED: GDSL esterase/lipase At1g28570-like     148   4e-63    
ref|XP_010925696.1|  PREDICTED: GDSL esterase/lipase At5g45910-li...    135   5e-63    
ref|XP_010461021.1|  PREDICTED: GDSL esterase/lipase At1g31550-like     151   5e-63    
ref|XP_009109700.1|  PREDICTED: GDSL esterase/lipase At1g28670-li...    147   5e-63    
ref|XP_009113643.1|  PREDICTED: GDSL esterase/lipase At2g27360-li...    149   5e-63    
emb|CDX90162.1|  BnaA08g18220D                                          147   6e-63    
ref|XP_009407319.1|  PREDICTED: GDSL esterase/lipase At1g28650-like     145   8e-63    
ref|XP_003593736.1|  GDSL esterase/lipase                               144   8e-63    
ref|NP_001031122.1|  GDSL esterase/lipase                               144   9e-63    Arabidopsis thaliana [mouse-ear cress]
emb|CDY15657.1|  BnaA07g08280D                                          147   1e-62    
dbj|BAD95190.1|  hypothetical protein                                   144   1e-62    Arabidopsis thaliana [mouse-ear cress]
emb|CDO96755.1|  unnamed protein product                                139   1e-62    
ref|XP_009102894.1|  PREDICTED: GDSL esterase/lipase At1g28580-like     147   1e-62    
ref|XP_011027710.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     145   2e-62    
ref|XP_004296391.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     136   2e-62    
ref|NP_174185.2|  GDSL esterase/lipase                                  143   3e-62    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009352808.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     145   3e-62    
ref|XP_009109701.1|  PREDICTED: GDSL esterase/lipase At1g28670-li...    144   5e-62    
sp|P0C8Z7.1|GDL91_ARATH  RecName: Full=GDSL esterase/lipase At1g2...    143   8e-62    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010912659.1|  PREDICTED: GDSL esterase/lipase At1g28650-like     145   8e-62    
ref|XP_010912608.1|  PREDICTED: GDSL esterase/lipase At1g28570-li...    142   9e-62    
ref|XP_010478236.1|  PREDICTED: GDSL esterase/lipase At1g28610-like     137   1e-61    
ref|XP_008383648.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     142   3e-61    
ref|XP_010912585.1|  PREDICTED: GDSL esterase/lipase At1g31550-like     145   7e-61    
ref|XP_009109702.1|  PREDICTED: GDSL esterase/lipase At1g28670-li...    147   1e-60    
ref|XP_010540487.1|  PREDICTED: GDSL esterase/lipase At1g28570-like     134   1e-60    
ref|XP_010422035.1|  PREDICTED: GDSL esterase/lipase At1g31550-li...    157   1e-60    
ref|XP_008777731.1|  PREDICTED: GDSL esterase/lipase At1g31550-like     141   1e-60    
ref|XP_007020872.1|  SGNH hydrolase-type esterase superfamily pro...    146   1e-60    
ref|NP_174440.2|  GDSL esterase/lipase                                  137   2e-60    Arabidopsis thaliana [mouse-ear cress]
ref|XP_007025434.1|  GDSL-like Lipase/Acylhydrolase superfamily p...    134   2e-60    
ref|XP_010041184.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     133   2e-60    
ref|XP_010499708.1|  PREDICTED: GDSL esterase/lipase At1g31550-li...    134   2e-60    
gb|KCW44566.1|  hypothetical protein EUGRSUZ_L01923                     133   3e-60    
ref|XP_006362447.1|  PREDICTED: GDSL esterase/lipase At1g28600-like     130   7e-60    
ref|XP_008785278.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     132   8e-60    
ref|XP_008439761.1|  PREDICTED: GDSL esterase/lipase At1g28570-like     149   9e-60    
ref|XP_011096421.1|  PREDICTED: GDSL esterase/lipase At5g45910          129   1e-59    
gb|AAG60153.1|AC074360_18  lipase, putative                             144   1e-59    Arabidopsis thaliana [mouse-ear cress]
ref|XP_003593744.1|  GDSL esterase/lipase                               147   1e-59    
ref|XP_004233850.1|  PREDICTED: GDSL esterase/lipase At1g28580-li...    129   1e-59    
ref|XP_002439448.1|  hypothetical protein SORBIDRAFT_09g006570          130   2e-59    Sorghum bicolor [broomcorn]
ref|XP_010052214.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     131   2e-59    
ref|XP_010540489.1|  PREDICTED: GDSL esterase/lipase At1g28580-li...    157   2e-59    
ref|XP_004964803.1|  PREDICTED: GDSL esterase/lipase At5g45910-li...    129   3e-59    
ref|XP_006844513.1|  hypothetical protein AMTR_s00016p00145970          134   3e-59    
gb|KHG30334.1|  hypothetical protein F383_10781                         139   4e-59    
gb|EYU28060.1|  hypothetical protein MIMGU_mgv1a008085mg                132   4e-59    
ref|XP_008783975.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     129   5e-59    
ref|XP_010052216.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     130   1e-58    
gb|EAY96951.1|  hypothetical protein OsI_18870                          130   1e-58    Oryza sativa Indica Group [Indian rice]
gb|AAS91011.1|  putative lipase                                         130   1e-58    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001054912.2|  Os05g0209600                                       129   1e-58    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010925693.1|  PREDICTED: GDSL esterase/lipase At5g45910-li...    130   1e-58    
ref|XP_002305752.2|  GDSL-motif lipase/hydrolase family protein         138   1e-58    Populus trichocarpa [western balsam poplar]
ref|XP_010052212.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     129   1e-58    
ref|XP_010041182.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     129   1e-58    
ref|XP_010915608.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     130   2e-58    
ref|XP_004509605.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     136   3e-58    
ref|XP_009401628.1|  PREDICTED: GDSL esterase/lipase At1g28570-like     142   3e-58    
ref|XP_004248142.1|  PREDICTED: GDSL esterase/lipase At1g28610          137   3e-58    
ref|XP_006415634.1|  hypothetical protein EUTSA_v10009717mg             145   3e-58    
ref|NP_001042399.1|  Os01g0216400                                       127   4e-58    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010915606.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     129   5e-58    
dbj|BAJ97605.1|  predicted protein                                      127   5e-58    
ref|XP_006654152.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     127   7e-58    
ref|XP_010925692.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     136   7e-58    
ref|XP_006844517.1|  hypothetical protein AMTR_s00016p00148320          126   8e-58    
ref|XP_008783909.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     133   1e-57    
ref|XP_010915607.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     126   1e-57    
ref|NP_199403.1|  GDSL esterase/lipase                                  130   1e-57    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009397450.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     128   2e-57    
gb|EAZ11035.1|  hypothetical protein OsJ_00879                          127   2e-57    Oryza sativa Japonica Group [Japonica rice]
ref|XP_008783908.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     129   2e-57    
ref|XP_003568743.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     127   2e-57    
ref|XP_010052211.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     132   2e-57    
ref|NP_564314.1|  GDSL esterase/lipase                                  129   3e-57    Arabidopsis thaliana [mouse-ear cress]
ref|NP_001172233.1|  Os01g0216900                                       125   3e-57    
ref|XP_003564307.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     128   3e-57    
ref|XP_010912648.1|  PREDICTED: sinapine esterase-like isoform X3       143   4e-57    
ref|XP_002455947.1|  hypothetical protein SORBIDRAFT_03g027770          135   4e-57    Sorghum bicolor [broomcorn]
gb|KCW44565.1|  hypothetical protein EUGRSUZ_L01922                     125   4e-57    
ref|XP_006828273.1|  hypothetical protein AMTR_s00023p00217880          129   5e-57    
ref|XP_004964802.1|  PREDICTED: GDSL esterase/lipase At5g45910-li...    127   5e-57    
ref|XP_009414900.1|  PREDICTED: GDSL esterase/lipase At1g28570-like     142   6e-57    
gb|KCW76148.1|  hypothetical protein EUGRSUZ_D00525                     126   7e-57    
gb|AAM62801.1|  GDSL-motif lipase/hydrolase-like protein                130   7e-57    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009416172.1|  PREDICTED: GDSL esterase/lipase At1g28570-like     139   8e-57    
ref|XP_002457140.1|  hypothetical protein SORBIDRAFT_03g001880          126   8e-57    Sorghum bicolor [broomcorn]
ref|XP_004960619.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     128   9e-57    
ref|XP_004952371.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     133   1e-56    
ref|XP_010915609.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     127   1e-56    
ref|XP_004971762.1|  PREDICTED: GDSL esterase/lipase At1g28600-like     130   1e-56    
ref|NP_849723.1|  GDSL esterase/lipase                                  127   2e-56    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002453668.1|  hypothetical protein SORBIDRAFT_04g010100          135   2e-56    Sorghum bicolor [broomcorn]
ref|XP_009413940.1|  PREDICTED: uncharacterized protein LOC103995136    126   2e-56    
ref|XP_004968628.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     131   2e-56    
ref|XP_003569350.1|  PREDICTED: GDSL esterase/lipase At2g27360-like     131   2e-56    
ref|XP_010480704.1|  PREDICTED: GDSL esterase/lipase At1g28590-like     142   2e-56    
ref|XP_003565496.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     126   2e-56    
ref|XP_003565527.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     126   2e-56    
dbj|BAJ90990.1|  predicted protein                                      128   3e-56    
ref|XP_004516453.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     138   3e-56    
ref|XP_009409411.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     124   4e-56    
emb|CDM83418.1|  unnamed protein product                                130   5e-56    
ref|XP_004516452.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     138   6e-56    
ref|XP_008655072.1|  PREDICTED: LOC100284848 isoform X1                 129   7e-56    
ref|XP_004965532.1|  PREDICTED: GDSL esterase/lipase At5g45910-li...    135   7e-56    
ref|XP_011096420.1|  PREDICTED: LOW QUALITY PROTEIN: GDSL esteras...    135   7e-56    
ref|XP_010054333.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     124   8e-56    
ref|XP_003563800.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     135   8e-56    
gb|KCW76155.1|  hypothetical protein EUGRSUZ_D00534                     124   8e-56    
ref|NP_001151215.1|  LOC100284848 precursor                             128   1e-55    Zea mays [maize]
ref|NP_001149136.1|  alpha-L-fucosidase 2 precursor                     139   1e-55    Zea mays [maize]
ref|NP_001141565.1|  uncharacterized protein LOC100273681               130   1e-55    Zea mays [maize]
gb|ACL53525.1|  unknown                                                 139   1e-55    Zea mays [maize]
gb|ACF83155.1|  unknown                                                 128   1e-55    Zea mays [maize]
ref|XP_004515399.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     133   1e-55    
ref|XP_004510075.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     138   2e-55    
dbj|BAJ90380.1|  predicted protein                                      128   3e-55    
gb|EEC80750.1|  hypothetical protein OsI_23233                          131   3e-55    Oryza sativa Indica Group [Indian rice]
gb|ABL11233.1|  UCW116, putative lipase                                 128   3e-55    Hordeum vulgare subsp. vulgare [barley]
ref|XP_004968624.1|  PREDICTED: GDSL esterase/lipase At1g31550-like     127   3e-55    
ref|XP_004971763.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     123   4e-55    
ref|XP_009411654.1|  PREDICTED: GDSL esterase/lipase At1g28600-like     140   4e-55    
gb|EAZ12674.1|  hypothetical protein OsJ_02589                          129   4e-55    Oryza sativa Japonica Group [Japonica rice]
ref|XP_004134931.1|  PREDICTED: GDSL esterase/lipase At1g28570-like     142   4e-55    
dbj|BAK06902.1|  predicted protein                                      139   5e-55    
ref|XP_002438500.1|  hypothetical protein SORBIDRAFT_10g020940          130   5e-55    
ref|XP_009421256.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     133   5e-55    
gb|ACG38031.1|  alpha-L-fucosidase 2 precursor                          130   7e-55    
ref|XP_003564303.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     127   9e-55    
dbj|BAJ97312.1|  predicted protein                                      127   1e-54    
ref|XP_002457133.1|  hypothetical protein SORBIDRAFT_03g001810          122   1e-54    
ref|XP_002863442.1|  GDSL-motif lipase/hydrolase family protein         123   1e-54    
ref|XP_008658948.1|  PREDICTED: uncharacterized protein LOC100501...    130   1e-54    
ref|NP_001140937.1|  hypothetical protein                               135   1e-54    
ref|XP_006656659.1|  PREDICTED: GDSL esterase/lipase At1g28590-like     127   1e-54    
ref|XP_009784633.1|  PREDICTED: GDSL esterase/lipase At5g45910          131   2e-54    
ref|NP_001057785.1|  Os06g0531600                                       131   2e-54    
ref|XP_010068248.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     125   2e-54    
ref|XP_009608031.1|  PREDICTED: GDSL esterase/lipase At5g45910 is...    129   2e-54    
ref|XP_004134933.1|  PREDICTED: GDSL esterase/lipase At1g28570-like     134   3e-54    
ref|XP_010068245.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     122   3e-54    
gb|EEE65121.1|  hypothetical protein OsJ_20187                          127   3e-54    
ref|NP_001042398.1|  Os01g0216300                                       126   3e-54    
ref|XP_008439763.1|  PREDICTED: GDSL esterase/lipase At1g28570-like     133   3e-54    
ref|XP_006367777.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     132   3e-54    
gb|KCW63207.1|  hypothetical protein EUGRSUZ_G00824                     122   4e-54    
ref|NP_001132224.1|  alpha-L-fucosidase 2 precursor                     127   4e-54    
ref|XP_004155631.1|  PREDICTED: LOW QUALITY PROTEIN: GDSL esteras...    139   5e-54    
gb|EEC71081.1|  hypothetical protein OsI_02841                          129   5e-54    
ref|XP_004964800.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     129   5e-54    
gb|KCW63215.1|  hypothetical protein EUGRSUZ_G00835                     123   5e-54    
gb|ABK24921.1|  unknown                                                 123   6e-54    
ref|XP_006645636.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     125   6e-54    
gb|KEH34273.1|  GDSL-like lipase/acylhydrolase                          134   7e-54    
ref|XP_002457134.1|  hypothetical protein SORBIDRAFT_03g001820          122   8e-54    
ref|XP_002437861.1|  hypothetical protein SORBIDRAFT_10g003930          129   8e-54    
gb|ACG28261.1|  alpha-L-fucosidase 2 precursor                          127   8e-54    
dbj|BAK05007.1|  predicted protein                                      120   9e-54    
ref|XP_008654982.1|  PREDICTED: alpha-L-fucosidase 2 isoform X1         139   1e-53    
gb|EMT08653.1|  GDSL esterase/lipase                                    122   1e-53    
ref|NP_001168581.1|  hypothetical protein precursor                     130   1e-53    
ref|XP_004971765.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     128   2e-53    
ref|XP_010495736.1|  PREDICTED: GDSL esterase/lipase At5g45910          120   2e-53    
gb|EMT30557.1|  GDSL esterase/lipase                                    129   2e-53    
ref|XP_004491864.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     135   2e-53    
ref|XP_006853138.1|  hypothetical protein AMTR_s00038p00165200          127   2e-53    
gb|EMT19408.1|  GDSL esterase/lipase                                    144   2e-53    
ref|NP_001242867.1|  uncharacterized protein LOC100794616 precursor     128   3e-53    
ref|XP_004234095.1|  PREDICTED: GDSL esterase/lipase At5g45910          130   3e-53    
ref|XP_009409412.1|  PREDICTED: GDSL esterase/lipase At1g28600-like     119   3e-53    
gb|AFW76565.1|  hypothetical protein ZEAMMB73_187768                    127   3e-53    
gb|KFK31510.1|  hypothetical protein AALP_AA6G122100                    122   3e-53    
ref|XP_010445802.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     121   3e-53    
dbj|BAD73016.1|  putative esterase                                      126   3e-53    
ref|NP_001132231.1|  uncharacterized protein LOC100193666 precursor     127   4e-53    
ref|XP_004971993.1|  PREDICTED: GDSL esterase/lipase At1g28590-like     129   4e-53    
gb|AFW85778.1|  hypothetical protein ZEAMMB73_678347                    130   4e-53    
ref|XP_009380501.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     119   4e-53    
dbj|BAJ86670.1|  predicted protein                                      129   6e-53    
ref|NP_973931.1|  GDSL esterase/lipase                                  146   6e-53    
gb|KEH38722.1|  GDSL-like lipase/acylhydrolase                          127   8e-53    
ref|XP_004966744.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     133   8e-53    
gb|KHG11244.1|  hypothetical protein F383_11796                         122   8e-53    
ref|XP_003560692.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     136   9e-53    
ref|XP_007025435.1|  GDSL-like Lipase/Acylhydrolase superfamily p...    155   9e-53    
gb|KHN08453.1|  GDSL esterase/lipase                                    149   9e-53    
gb|KEH33577.1|  GDSL-like lipase/acylhydrolase                          130   9e-53    
ref|XP_008673536.1|  PREDICTED: GDSL esterase/lipase At5g45910 is...    124   1e-52    
gb|KHN31271.1|  GDSL esterase/lipase                                    127   1e-52    
gb|KEH17248.1|  GDSL-like lipase/acylhydrolase                          127   1e-52    
ref|XP_009140758.1|  PREDICTED: GDSL esterase/lipase At5g45910          120   1e-52    
ref|XP_008806794.1|  PREDICTED: GDSL esterase/lipase At1g28580-like     121   2e-52    
dbj|BAD61220.1|  lanatoside 15'-O-acetylesterase-like                   120   2e-52    
tpg|DAA52848.1|  TPA: hypothetical protein ZEAMMB73_895572              123   2e-52    
ref|NP_001056855.1|  Os06g0156600                                       127   2e-52    
ref|XP_006643905.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     122   3e-52    
ref|XP_009413843.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     119   3e-52    
dbj|BAJ99647.1|  predicted protein                                      119   4e-52    
ref|XP_004968623.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     119   4e-52    
gb|KEH17251.1|  GDSL-like lipase/acylhydrolase                          125   5e-52    
ref|NP_001142390.1|  Zea nodulation homolog1 precursor                  129   6e-52    
ref|XP_006603997.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     119   7e-52    
ref|XP_008783973.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     120   7e-52    
ref|XP_003559896.2|  PREDICTED: GDSL esterase/lipase At1g28600-like     132   7e-52    
ref|XP_007214461.1|  hypothetical protein PRUPE_ppa023988mg             127   8e-52    
dbj|BAK01569.1|  predicted protein                                      129   9e-52    
ref|XP_006656658.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     127   9e-52    
ref|XP_010241274.1|  PREDICTED: acetylajmalan esterase-like             117   9e-52    
ref|XP_002436507.1|  hypothetical protein SORBIDRAFT_10g003900          123   1e-51    
gb|KEH38721.1|  GDSL-like lipase/acylhydrolase                          124   1e-51    
ref|XP_003537084.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     117   1e-51    
ref|XP_010918533.1|  PREDICTED: GDSL esterase/lipase At5g03980-li...    117   1e-51    
ref|XP_010918532.1|  PREDICTED: GDSL esterase/lipase At5g03980-li...    117   2e-51    
ref|NP_001042390.1|  Os01g0214600                                       122   2e-51    
ref|XP_010918534.1|  PREDICTED: GDSL esterase/lipase At5g03980-li...    117   2e-51    
ref|XP_004968644.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     127   2e-51    
ref|NP_001152399.1|  alpha-L-fucosidase 2 precursor                     127   2e-51    
gb|ACN30561.1|  unknown                                                 127   3e-51    
ref|XP_007138118.1|  hypothetical protein PHAVU_009G181700g             121   3e-51    
gb|EMT15617.1|  GDSL esterase/lipase                                    121   3e-51    
ref|XP_004968622.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     130   3e-51    
ref|XP_008777733.1|  PREDICTED: GDSL esterase/lipase At1g28600-like     115   4e-51    
ref|XP_010915610.1|  PREDICTED: GDSL esterase/lipase At5g45910-li...    118   4e-51    
ref|XP_003569458.1|  PREDICTED: GDSL esterase/lipase At1g28600-like     122   7e-51    
ref|XP_004965531.1|  PREDICTED: GDSL esterase/lipase At5g45910-li...    118   9e-51    
ref|XP_006643906.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     128   1e-50    
ref|NP_001050175.1|  Os03g0365800                                       121   1e-50    
ref|NP_001031103.1|  GDSL esterase/lipase                               138   1e-50    
gb|EMT23216.1|  GDSL esterase/lipase                                    118   1e-50    
gb|EEE59101.1|  hypothetical protein OsJ_10956                          121   1e-50    
gb|EMT22154.1|  GDSL esterase/lipase                                    125   1e-50    
emb|CAN64953.1|  hypothetical protein VITISV_042282                     130   2e-50    
emb|CDM83549.1|  unnamed protein product                                123   4e-50    
gb|KEH36573.1|  GDSL-like lipase/acylhydrolase                          131   4e-50    
ref|XP_003635688.1|  GDSL esterase/lipase                               119   4e-50    
gb|EEC70166.1|  hypothetical protein OsI_00887                          120   4e-50    
ref|XP_006644439.1|  PREDICTED: GDSL esterase/lipase At1g28600-like     121   5e-50    
ref|NP_001042391.1|  Os01g0214800                                       127   5e-50    
gb|EMT23758.1|  GDSL esterase/lipase                                    119   6e-50    
gb|AFW86785.1|  hypothetical protein ZEAMMB73_041304                    139   6e-50    
gb|EAY90131.1|  hypothetical protein OsI_11697                          117   6e-50    
ref|XP_008364168.1|  PREDICTED: GDSL esterase/lipase At1g28570-like     133   7e-50    
ref|XP_009411652.1|  PREDICTED: GDSL esterase/lipase At1g28570-like     126   8e-50    
ref|XP_004957689.1|  PREDICTED: GDSL esterase/lipase At1g28580-like     117   1e-49    
ref|XP_003600821.1|  GDSL esterase/lipase                               124   1e-49    
dbj|BAJ90120.1|  predicted protein                                      118   1e-49    
ref|NP_001056856.1|  Os06g0156700                                       114   1e-49    
gb|KHN34101.1|  GDSL esterase/lipase                                    117   1e-49    
ref|XP_006651412.1|  PREDICTED: GDSL esterase/lipase At1g31550-like     130   1e-49    
emb|CDY48195.1|  BnaA04g15590D                                          120   1e-49    
ref|XP_003635692.1|  GDSL esterase/lipase                               117   2e-49    
gb|AES71072.2|  GDSL-like lipase/acylhydrolase                          123   2e-49    
gb|KHN34100.1|  GDSL esterase/lipase                                    119   2e-49    
ref|XP_009411653.1|  PREDICTED: GDSL esterase/lipase At1g28570-like     127   2e-49    
ref|XP_007213171.1|  hypothetical protein PRUPE_ppa026981mg             117   3e-49    
ref|XP_010925697.1|  PREDICTED: GDSL esterase/lipase At1g28570-li...    136   3e-49    
ref|XP_006646093.1|  PREDICTED: GDSL esterase/lipase At1g28600-like     129   3e-49    
emb|CDM83832.1|  unnamed protein product                                125   4e-49    
ref|XP_004251965.1|  PREDICTED: GDSL esterase/lipase At5g03980-like     127   4e-49    
ref|XP_004958488.1|  PREDICTED: GDSL esterase/lipase At1g28600-like     123   5e-49    
ref|XP_006658887.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     118   5e-49    
ref|NP_001149094.1|  LOC100282715 precursor                             123   5e-49    
ref|XP_008812188.1|  PREDICTED: GDSL esterase/lipase At1g28570-like     119   6e-49    
dbj|BAD68794.1|  lipase-like                                            118   7e-49    
gb|KEH34272.1|  GDSL-like lipase/acylhydrolase                          134   7e-49    
ref|XP_002439451.1|  hypothetical protein SORBIDRAFT_09g006600          125   7e-49    
emb|CDX77066.1|  BnaC04g38610D                                          119   7e-49    
gb|EAY90132.1|  hypothetical protein OsI_11698                          125   8e-49    
gb|EAY73024.1|  hypothetical protein OsI_00896                          119   8e-49    
ref|XP_009390675.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     117   9e-49    
ref|XP_009421257.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     119   9e-49    
dbj|BAK05242.1|  predicted protein                                      112   9e-49    
gb|EAZ27028.1|  hypothetical protein OsJ_10957                          127   1e-48    
ref|XP_003638491.1|  GDSL esterase/lipase                               118   1e-48    
ref|NP_001130974.1|  uncharacterized protein LOC100192079               122   1e-48    
gb|EMT33597.1|  GDSL esterase/lipase                                    121   1e-48    
ref|XP_010925698.1|  PREDICTED: GDSL esterase/lipase At1g28570-li...    136   2e-48    
ref|XP_002457139.1|  hypothetical protein SORBIDRAFT_03g001870          126   2e-48    
ref|NP_001151338.1|  LOC100284971 precursor                             122   2e-48    
ref|XP_009615529.1|  PREDICTED: GDSL esterase/lipase At5g03980-like     118   2e-48    
ref|XP_004969326.1|  PREDICTED: GDSL esterase/lipase At1g28600-like     122   2e-48    
ref|NP_001042397.1|  Os01g0216000                                       118   2e-48    
ref|XP_009608032.1|  PREDICTED: GDSL esterase/lipase At5g45910 is...    130   2e-48    
ref|XP_011096137.1|  PREDICTED: acetylajmalan esterase-like             117   2e-48    
ref|XP_002454932.1|  hypothetical protein SORBIDRAFT_03g001650          125   2e-48    
ref|XP_006361073.1|  PREDICTED: GDSL esterase/lipase At2g27360-like     177   3e-48    
gb|EMT03967.1|  GDSL esterase/lipase                                    119   3e-48    
gb|EEC80045.1|  hypothetical protein OsI_21742                          114   3e-48    
ref|XP_002451875.1|  hypothetical protein SORBIDRAFT_04g009090          117   3e-48    
ref|XP_009782266.1|  PREDICTED: acetylajmalan esterase-like             124   3e-48    
gb|EMT00808.1|  GDSL esterase/lipase                                    117   4e-48    
emb|CDM81086.1|  unnamed protein product                                116   4e-48    
ref|XP_006645637.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     124   5e-48    
ref|XP_002456052.1|  hypothetical protein SORBIDRAFT_03g029580          124   5e-48    
ref|XP_003565495.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     128   6e-48    
dbj|BAJ98970.1|  predicted protein                                      120   6e-48    
ref|XP_004961580.1|  PREDICTED: GDSL esterase/lipase At5g45910-li...    120   6e-48    
gb|EAY99508.1|  hypothetical protein OsI_21478                          114   6e-48    
ref|XP_006651411.1|  PREDICTED: GDSL esterase/lipase At1g28600-like     112   6e-48    
gb|EAY98628.1|  hypothetical protein OsI_20553                          112   6e-48    
ref|XP_008655208.1|  PREDICTED: uncharacterized protein LOC100382...    120   7e-48    
ref|XP_004967474.1|  PREDICTED: GDSL esterase/lipase At1g31550-li...    111   7e-48    
dbj|BAH01022.1|  unnamed protein product                                112   7e-48    
ref|XP_009589774.1|  PREDICTED: acetylajmalan esterase {ECO:00003...    121   7e-48    
ref|XP_006654615.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     112   8e-48    
dbj|BAK07356.1|  predicted protein                                      125   9e-48    
ref|XP_006655809.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     127   1e-47    
ref|XP_010915611.1|  PREDICTED: GDSL esterase/lipase At1g28600-li...    118   1e-47    
ref|XP_003572041.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     119   1e-47    
emb|CAG27610.1|  esterase                                               110   1e-47    
gb|KDO77812.1|  hypothetical protein CISIN_1g018031mg                   145   1e-47    
ref|XP_004971499.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     114   1e-47    
ref|XP_006645634.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     113   1e-47    
ref|XP_003565533.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     124   2e-47    
ref|XP_008673524.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     126   2e-47    
ref|XP_010557579.1|  PREDICTED: GDSL esterase/lipase At5g03980          114   2e-47    
dbj|BAD69424.1|  putative lipase                                        128   2e-47    
gb|EAY98626.1|  hypothetical protein OsI_20551                          113   2e-47    
ref|XP_003577537.1|  PREDICTED: acetylajmalan esterase                  127   2e-47    
ref|NP_001056858.1|  Os06g0157000                                       127   2e-47    
ref|XP_004977297.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     122   3e-47    
ref|XP_006643907.1|  PREDICTED: GDSL esterase/lipase At1g28590-like     112   3e-47    
ref|XP_004968627.1|  PREDICTED: GDSL esterase/lipase At5g45910-li...    119   4e-47    
ref|XP_003564306.1|  PREDICTED: GDSL esterase/lipase At5g45910-like     112   4e-47    
gb|EAY98625.1|  hypothetical protein OsI_20550                          109   4e-47    
ref|XP_007138099.1|  hypothetical protein PHAVU_009G1802000g            120   4e-47    
ref|XP_004984286.1|  PREDICTED: GDSL esterase/lipase At1g28600-like     120   4e-47    
ref|NP_001055986.1|  Os05g0506600                                       113   4e-47    
gb|EAZ11025.1|  hypothetical protein OsJ_00869                          127   5e-47    
emb|CDY63997.1|  BnaA07g36510D                                          117   5e-47    
gb|KEH33412.1|  GDSL-like lipase/acylhydrolase                          121   5e-47    
ref|XP_006644440.1|  PREDICTED: GDSL esterase/lipase At1g28600-like     124   6e-47    
gb|EAY75181.1|  hypothetical protein OsI_03071                          119   6e-47    
ref|NP_001043721.1|  Os01g0649900                                       115   6e-47    
ref|NP_001132319.1|  uncharacterized protein LOC100193761 precursor     117   6e-47    
gb|AFW71084.1|  esterase                                                117   7e-47    
ref|NP_001140980.1|  esterase precursor                                 114   7e-47    
ref|XP_010251328.1|  PREDICTED: GDSL esterase/lipase At5g03980-like     114   8e-47    
dbj|BAJ86410.1|  predicted protein                                      127   9e-47    
gb|AES71053.2|  GDSL-like lipase/acylhydrolase                          122   9e-47    
gb|ACN28025.1|  unknown                                                 116   9e-47    
dbj|BAA94236.1|  putative esterase                                      110   1e-46    
dbj|BAJ85333.1|  predicted protein                                      124   1e-46    
ref|NP_001042393.2|  Os01g0215000                                       110   1e-46    



>ref|XP_009774388.1| PREDICTED: GDSL esterase/lipase At1g28580-like [Nicotiana sylvestris]
Length=385

 Score =   231 bits (588),  Expect(2) = 2e-106, Method: Compositional matrix adjust.
 Identities = 132/198 (67%), Positives = 155/198 (78%), Gaps = 3/198 (2%)
 Frame = +1

Query  472   KNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVEDYDD  651
             KNI +I PIIP V H IA GAH+L+ELGA+T+MVPSVLPLGCA+SYLTYY S N EDYD+
Sbjct  188   KNINEILPIIPSVVHTIASGAHELVELGAKTIMVPSVLPLGCASSYLTYYQSWNEEDYDE  247

Query  652   LGCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGFSggal  831
             LGCLIW N  AS+HNQLLQ EL+ LRE HP+ NIIY D +NAAMQ+Y  P+  GF  G L
Sbjct  248   LGCLIWPNHFASHHNQLLQRELHRLREIHPHVNIIYADYYNAAMQLYRSPSKYGFLKGGL  307

Query  832   raccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDGSYTYP  1011
               CCGGGG YNFNP   CGD  ATSC DP+ Y+NWDGYHLTEAAY+ MTKSLL+G +T P
Sbjct  308   VTCCGGGGPYNFNPFAPCGDYPATSCEDPNQYINWDGYHLTEAAYRWMTKSLLEGPFTNP  367

Query  1012  SMNALCPTD---AQVAQL  1056
              +N++CP D   AQV+Q+
Sbjct  368   PINSVCPFDINEAQVSQI  385


 Score =   184 bits (468),  Expect(2) = 2e-106, Method: Compositional matrix adjust.
 Identities = 91/157 (58%), Positives = 118/157 (75%), Gaps = 8/157 (5%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            SL+D GN + L   G   +   P     PYG+T+F+ PTGRCSDGR+++D+IA++YGL +
Sbjct  40   SLTDAGNLVHLYPPGRKPHMYFP-----PYGKTYFNRPTGRCSDGRLLIDLIAQYYGLPL  94

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQDMI  362
            PPPS  +K    G N++ G+NFAVVGSRA+ A+FY+K  IYDTVTNVSM DQL  F+ M+
Sbjct  95   PPPSREAK---DGGNMQSGINFAVVGSRAMDAKFYEKRGIYDTVTNVSMWDQLDWFKQML  151

Query  363  PSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
            P LC++PS C   LE+SLF+LGEFGGNDYTH+LLSGK
Sbjct  152  PYLCHNPSGCSKFLESSLFLLGEFGGNDYTHALLSGK  188



>ref|XP_009607101.1| PREDICTED: GDSL esterase/lipase At1g28580-like [Nicotiana tomentosiformis]
Length=398

 Score =   226 bits (577),  Expect(2) = 1e-104, Method: Compositional matrix adjust.
 Identities = 126/195 (65%), Positives = 149/195 (76%), Gaps = 0/195 (0%)
 Frame = +1

Query  472   KNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVEDYDD  651
             KNI +I PIIP V H I  GAH+L+ELGA+T+MVPSVLPLGC +SYLTYY S N EDYD+
Sbjct  191   KNINEILPIIPSVVHTIVSGAHELVELGAKTIMVPSVLPLGCTSSYLTYYQSWNEEDYDE  250

Query  652   LGCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGFSggal  831
             LGCLIW N  A++HNQLLQ EL+ LRE +P+ NIIY D +NAAMQ+Y  P+  GF  G L
Sbjct  251   LGCLIWPNHFATHHNQLLQRELHRLREINPHVNIIYADYYNAAMQLYRAPSKYGFLKGGL  310

Query  832   raccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDGSYTYP  1011
               CCG GG YNFNP  QCG+  ATSC DP+ Y+NWDGYHLTEAAYK MTKSLL+G +T P
Sbjct  311   VTCCGAGGPYNFNPFAQCGNYPATSCEDPNQYINWDGYHLTEAAYKWMTKSLLEGPFTNP  370

Query  1012  SMNALCPTDAQVAQL  1056
              +N+ CP D   AQ+
Sbjct  371   PINSFCPFDISEAQV  385


 Score =   182 bits (463),  Expect(2) = 1e-104, Method: Compositional matrix adjust.
 Identities = 90/157 (57%), Positives = 115/157 (73%), Gaps = 8/157 (5%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            SL+D GN + L   G   +   P     PYG+T+F+ PTGRCSDGR+++D+IA++YGL +
Sbjct  43   SLTDAGNLVHLYPPGRKPHMYFP-----PYGKTYFNRPTGRCSDGRLLIDLIAQYYGLPL  97

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQDMI  362
            PPPS   K    G N++ G+NFAVVGSRA+ A+FY+K  IYD VTNVSM DQL  F+ M+
Sbjct  98   PPPS---KEARDGGNMQSGINFAVVGSRAMDAKFYEKRGIYDKVTNVSMWDQLDWFKQML  154

Query  363  PSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
            P LC++PS C   LE SLF+LGEFGGNDYTH+LLSGK
Sbjct  155  PYLCHNPSGCSKFLERSLFLLGEFGGNDYTHALLSGK  191



>ref|XP_004248464.1| PREDICTED: GDSL esterase/lipase At1g28610-like isoform X1 [Solanum 
lycopersicum]
Length=378

 Score =   221 bits (563),  Expect(2) = 2e-104, Method: Compositional matrix adjust.
 Identities = 125/199 (63%), Positives = 152/199 (76%), Gaps = 3/199 (2%)
 Frame = +1

Query  469   EKNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVEDYD  648
              K + DI PIIP+VA +IA GAH+L+ELGART++VPSVLPLGC++SYLT + S N EDYD
Sbjct  180   HKTLNDILPIIPLVAQSIASGAHELVELGARTIIVPSVLPLGCSSSYLTNFESLNEEDYD  239

Query  649   DLGCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGFSgga  828
             +LGCLIW N++ASYHN+LLQ+EL+ LRE HP+ NIIY D +NA+M+IY  P   GF    
Sbjct  240   ELGCLIWPNELASYHNELLQKELHRLRELHPHVNIIYADYYNASMKIYRAPRKYGFLKSV  299

Query  829   lraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDGSYTY  1008
             L ACCGGGG YNFN   QCG   ATSC DP  YVNWDGYH +EAAYK +TKSLL+G ++Y
Sbjct  300   LVACCGGGGPYNFNVSAQCGTSQATSCEDPKQYVNWDGYHFSEAAYKWITKSLLEGLFSY  359

Query  1009  PSMNALCPTD---AQVAQL  1056
             P M  LC  D   AQV+Q+
Sbjct  360   PPMKNLCLFDVVEAQVSQI  378


 Score =   187 bits (474),  Expect(2) = 2e-104, Method: Compositional matrix adjust.
 Identities = 91/157 (58%), Positives = 115/157 (73%), Gaps = 11/157 (7%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            SL+DTGN +    +G       P     PYGET+FHHPTGRCSDGR+++D+IA+HYGL +
Sbjct  36   SLTDTGNLVHFYPNG-----NKPHMYFPPYGETYFHHPTGRCSDGRLLIDLIAQHYGLPL  90

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQDMI  362
            PPPSL  +      N + G NFAVVGSR + A+FY+K+ IYD VTNVSM DQL+ F+ M+
Sbjct  91   PPPSLDRR------NAQNGTNFAVVGSRVMDAQFYEKMGIYDIVTNVSMWDQLNWFKQML  144

Query  363  PSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
            P LC++ S CK  LE+SLF+LGEFGGNDYTH+LLS K
Sbjct  145  PHLCHNSSGCKEFLESSLFLLGEFGGNDYTHALLSHK  181



>ref|XP_010327054.1| PREDICTED: GDSL esterase/lipase At2g27360-like isoform X2 [Solanum 
lycopersicum]
Length=356

 Score =   202 bits (515),  Expect(2) = 5e-99, Method: Compositional matrix adjust.
 Identities = 111/199 (56%), Positives = 138/199 (69%), Gaps = 25/199 (13%)
 Frame = +1

Query  469   EKNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVEDYD  648
              K + DI PIIP+VA +IA GAH+L+ELGART++VPSVLPLGC++SYLT + S N EDYD
Sbjct  180   HKTLNDILPIIPLVAQSIASGAHELVELGARTIIVPSVLPLGCSSSYLTNFESLNEEDYD  239

Query  649   DLGCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGFSgga  828
             +LGCLIW N++ASYHN+LLQ+EL+ LRE HP+ NIIY D +NA+M+IY  P         
Sbjct  240   ELGCLIWPNELASYHNELLQKELHRLRELHPHVNIIYADYYNASMKIYRAPRKYA-----  294

Query  829   lraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDGSYTY  1008
                              QCG   ATSC DP  YVNWDGYH +EAAYK +TKSLL+G ++Y
Sbjct  295   -----------------QCGTSQATSCEDPKQYVNWDGYHFSEAAYKWITKSLLEGLFSY  337

Query  1009  PSMNALCPTD---AQVAQL  1056
             P M  LC  D   AQV+Q+
Sbjct  338   PPMKNLCLFDVVEAQVSQI  356


 Score =   187 bits (475),  Expect(2) = 5e-99, Method: Compositional matrix adjust.
 Identities = 91/157 (58%), Positives = 115/157 (73%), Gaps = 11/157 (7%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            SL+DTGN +    +G       P     PYGET+FHHPTGRCSDGR+++D+IA+HYGL +
Sbjct  36   SLTDTGNLVHFYPNG-----NKPHMYFPPYGETYFHHPTGRCSDGRLLIDLIAQHYGLPL  90

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQDMI  362
            PPPSL  +      N + G NFAVVGSR + A+FY+K+ IYD VTNVSM DQL+ F+ M+
Sbjct  91   PPPSLDRR------NAQNGTNFAVVGSRVMDAQFYEKMGIYDIVTNVSMWDQLNWFKQML  144

Query  363  PSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
            P LC++ S CK  LE+SLF+LGEFGGNDYTH+LLS K
Sbjct  145  PHLCHNSSGCKEFLESSLFLLGEFGGNDYTHALLSHK  181



>ref|XP_004234096.1| PREDICTED: GDSL esterase/lipase At1g28590-like [Solanum lycopersicum]
Length=380

 Score =   174 bits (441),  Expect(2) = 3e-80, Method: Compositional matrix adjust.
 Identities = 98/188 (52%), Positives = 133/188 (71%), Gaps = 2/188 (1%)
 Frame = +1

Query  460   FSREKNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVE  639
             FS+ K+  +++  +P V  AI +  ++LIELGA+T++VP  LP+GC+ASYLT + + N +
Sbjct  183   FSQGKSGEEVKSFVPAVISAIGQAINELIELGAQTLIVPGNLPIGCSASYLTIFKNSNKK  242

Query  640   DYDD-LGCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGF  816
             DYD+  GC+IW+N+ A YHNQLLQ+E++ LRE HP+ANIIY D +NAAMQIY  P   GF
Sbjct  243   DYDNSTGCIIWLNEFAEYHNQLLQQEIHKLREIHPHANIIYADYYNAAMQIYRSPKKFGF  302

Query  817   SggalraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDG  996
             +   +  C GGG  YN++ +  CG   +  C  PS+YV+WDG HLTEAAYKL+ K LL G
Sbjct  303   TSTIVACCGGGGV-YNYDSNRPCGSPSSNYCDTPSSYVSWDGVHLTEAAYKLIAKGLLQG  361

Query  997   SYTYPSMN  1020
              YT P MN
Sbjct  362   PYTIPQMN  369


 Score =   153 bits (387),  Expect(2) = 3e-80, Method: Compositional matrix adjust.
 Identities = 79/158 (50%), Positives = 102/158 (65%), Gaps = 6/158 (4%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            SL+DTGN I L+       + I + SVLPYGETFFHHPTGR SDGR+++D IAE  G  +
Sbjct  35   SLADTGNLIRLSKS-----NKIVASSVLPYGETFFHHPTGRFSDGRLVIDFIAEGMGFPL  89

Query  183  PPPSLSS-KAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQDM  359
             PP +   K  +   N  +GVNFAV G+ A+   + +K  I +  TNVS+  QL  F+ M
Sbjct  90   VPPYVGVMKNMSSSKNSIRGVNFAVAGATAVDISYLEKRGIKNPATNVSLGTQLEWFKQM  149

Query  360  IPSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
            +P LC+SP+ CK  LENSLF++GE GGNDY H    GK
Sbjct  150  LPILCDSPTSCKEYLENSLFLMGEIGGNDYNHPFSQGK  187



>ref|XP_006367776.1| PREDICTED: GDSL esterase/lipase At1g28590-like [Solanum tuberosum]
Length=383

 Score =   167 bits (423),  Expect(2) = 3e-78, Method: Compositional matrix adjust.
 Identities = 99/192 (52%), Positives = 131/192 (68%), Gaps = 3/192 (2%)
 Frame = +1

Query  460   FSREKNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVE  639
             FS+ K+  D++  +P V  AI    ++LIELGA+T++VP  LP+GC+ASYLT + + N +
Sbjct  186   FSQGKSGEDVQSFVPAVISAIGLAINELIELGAQTLIVPGNLPIGCSASYLTIFKNSNKK  245

Query  640   DYDD-LGCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGF  816
             +YDD  GC+ W+N  A YHNQLLQ+E++ LRE HP+ANIIY D +NAAMQIY  P   GF
Sbjct  246   EYDDSTGCINWLNDFAEYHNQLLQQEIHKLREIHPHANIIYADYYNAAMQIYKSPKKFGF  305

Query  817   SggalraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDG  996
             +   +  C GGG  YN++    CG   +  C  PS+YV+WDG HLTEAAYKL+ + LL G
Sbjct  306   TSTIVACCGGGG-PYNYDSKRPCGSPSSNYCDTPSSYVSWDGVHLTEAAYKLIAEGLLQG  364

Query  997   SYTYPSM-NALC  1029
              YT P M N LC
Sbjct  365   PYTIPQMNNGLC  376


 Score =   154 bits (388),  Expect(2) = 3e-78, Method: Compositional matrix adjust.
 Identities = 79/158 (50%), Positives = 102/158 (65%), Gaps = 6/158 (4%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            SL+DTGN I L+       + I + SVLPYGETFFHHPTGR SDGR+++D IAE  G  +
Sbjct  38   SLADTGNLIRLSKS-----NKIVASSVLPYGETFFHHPTGRFSDGRLVIDFIAEGMGFPL  92

Query  183  PPPSLSS-KAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQDM  359
             PP +   K  +   N  +GVNFAV G+ A+   + +K  I +  TNVS+  QL  F+ M
Sbjct  93   VPPYVGVMKNMSSSKNSMRGVNFAVAGATAVDISYLEKRGIKNPATNVSLGTQLEWFKQM  152

Query  360  IPSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
            +P LC+SP+ CK  LENSLF++GE GGNDY H    GK
Sbjct  153  LPILCDSPTSCKEFLENSLFLMGEIGGNDYNHPFSQGK  190



>ref|XP_008225208.1| PREDICTED: GDSL esterase/lipase At1g28590-like [Prunus mume]
Length=380

 Score =   173 bits (438),  Expect(2) = 5e-76, Method: Compositional matrix adjust.
 Identities = 95/187 (51%), Positives = 129/187 (69%), Gaps = 1/187 (1%)
 Frame = +1

Query  472   KNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVEDYD-  648
             K+I  +R  +P+V  AIA   ++LIELGA T++VP   P+GC  SYL+ + S +   YD 
Sbjct  190   KSIELVRSYLPLVIEAIASTINELIELGAATILVPGNNPIGCLPSYLSKFESSDKSQYDA  249

Query  649   DLGCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGFSgga  828
               GCL W+N+ A YHN+ LQ EL+ +R  HP   I+Y D +NA +Q+Y  P   GF+G  
Sbjct  250   STGCLKWLNEFAQYHNEQLQIELSRIRRLHPQVTIVYADYYNALLQLYQSPRQFGFTGET  309

Query  829   lraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDGSYTY  1008
              +ACCGGGG YNFN  +QCG+ GAT C +PS ++NWDG H TEAAY+LMTK+LL G+YT+
Sbjct  310   SKACCGGGGPYNFNSSVQCGNAGATVCENPSQFINWDGMHCTEAAYRLMTKALLQGNYTF  369

Query  1009  PSMNALC  1029
             P + +LC
Sbjct  370   PRLASLC  376


 Score =   140 bits (353),  Expect(2) = 5e-76, Method: Compositional matrix adjust.
 Identities = 76/158 (48%), Positives = 95/158 (60%), Gaps = 7/158 (4%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            SL+DTGN  + + +  L Y   P      YGET+FHHPTGRCSDGR+I+D IA+  GL +
Sbjct  39   SLTDTGNLYNSSPNRSLHYFQPP------YGETYFHHPTGRCSDGRLIIDFIAQFLGLPL  92

Query  183  PPPSLSSKAQTG-GNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQDM  359
             PP L S   T    N   GVNFAV+G+  L A F   +EI+   TN S+  QL  F+ M
Sbjct  93   VPPFLQSLNSTQPVQNFEAGVNFAVIGATGLDASFLATMEIHSPSTNNSLRIQLEWFKQM  152

Query  360  IPSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
            +PSLCN+  DCK  L  SL ++G  G NDY   LL GK
Sbjct  153  LPSLCNTSLDCKKFLSTSLILMGSIGCNDYNDGLLGGK  190



>emb|CBI30663.3| unnamed protein product [Vitis vinifera]
Length=1124

 Score =   183 bits (465),  Expect(2) = 6e-76, Method: Compositional matrix adjust.
 Identities = 107/191 (56%), Positives = 138/191 (72%), Gaps = 1/191 (1%)
 Frame = +1

Query  460   FSREKNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVE  639
             F + +++ +IR  +P V HAIA    +LIELGA T+MVP  LP GC+ASYLT + +PN+E
Sbjct  171   FFQGRSLEEIRTYVPPVIHAIASAITELIELGAVTLMVPGKLPTGCSASYLTLFKTPNIE  230

Query  640   DYDDL-GCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGF  816
             DYD + GCL W+N+ A YHN+ L+ ELN +RE +P+ NIIY D +NAAM+IY  P   GF
Sbjct  231   DYDPVTGCLNWLNEFAEYHNEQLKTELNRIRELYPHTNIIYADYYNAAMRIYRSPNKFGF  290

Query  817   SggalraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDG  996
               GAL ACCGGGG YN+N  ++CG+  ATSC DPS YV+WDG HLTEAAYK +   LL+ 
Sbjct  291   KRGALTACCGGGGPYNYNSSVECGNLPATSCDDPSLYVSWDGLHLTEAAYKWIANGLLEE  350

Query  997   SYTYPSMNALC  1029
              YT+P +NA C
Sbjct  351   PYTFPPLNASC  361


 Score =   129 bits (325),  Expect(2) = 6e-76, Method: Compositional matrix adjust.
 Identities = 72/157 (46%), Positives = 96/157 (61%), Gaps = 11/157 (7%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            SL+DTGN + L S        +P  +  PYGETFFH PTGRCSDGR+I+D IA   GL +
Sbjct  30   SLTDTGNLL-LASPA----HNLPHFAKPPYGETFFHRPTGRCSDGRLIIDFIAGFLGLPL  84

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQDMI  362
              P L +       + RQ VNFA+VG+ AL  EF+Q   I+   TN+S+  QL  F+D +
Sbjct  85   IHPYLET------TDPRQSVNFAIVGATALDDEFFQARNIHIPYTNISLGIQLGWFKDKL  138

Query  363  PSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
             SLC + S+C  L  +SLF++GE GGNDY +    G+
Sbjct  139  LSLCPTFSNCNELFNSSLFLMGEIGGNDYGYPFFQGR  175


 Score =   144 bits (363),  Expect(2) = 6e-64, Method: Compositional matrix adjust.
 Identities = 87/174 (50%), Positives = 116/174 (67%), Gaps = 1/174 (1%)
 Frame = +1

Query  475  NITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVEDYDDL  654
            +I  ++ ++P+V  AI + A  LIE GA T+MVP   P+GC+A YLT + SPN  DYD+ 
Sbjct  530  SIKQVQALVPLVVEAITKAASMLIEEGAVTLMVPGNFPIGCSAVYLTIFRSPNKADYDEN  589

Query  655  -GCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGFSggal  831
             GCL   N  A YHN  L+  L+ L  ++P+A IIY D +NAAM ++  P + GF  GAL
Sbjct  590  NGCLKAFNAFAQYHNTHLKLALDKLGLKYPHAKIIYADYYNAAMPLFQAPRSFGFYNGAL  649

Query  832  raccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLD  993
            RACCGGGG YNFN   +CG  G+ +C DPS+Y NWDG HLTE AYK++   L++
Sbjct  650  RACCGGGGPYNFNNSARCGHIGSKACNDPSSYANWDGIHLTEGAYKIIATCLIN  703


 Score =   129 bits (323),  Expect(2) = 6e-64, Method: Compositional matrix adjust.
 Identities = 70/157 (45%), Positives = 94/157 (60%), Gaps = 10/157 (6%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            SL+DTGN++     G L +   P    LPYGETFF H TGRCSDGR+I+D IAE +G+  
Sbjct  381  SLADTGNFLL---SGALAF---PVIRELPYGETFFRHATGRCSDGRLIVDFIAEAFGIPY  434

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTV-TNVSMNDQLHAFQDM  359
             PP LS      G + R GVNFAV G+ AL  EF+   ++   + TN S++ QL  F+ +
Sbjct  435  LPPYLSLGK---GKSFRHGVNFAVAGATALDPEFFYHQKLGRILWTNNSLSVQLGWFKKL  491

Query  360  IPSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSG  470
             PS+C +   C N    S+F++GE GGNDY +    G
Sbjct  492  KPSICTTKKGCDNFFRKSIFLVGEIGGNDYNYPFFVG  528



>ref|XP_011027711.1| PREDICTED: GDSL esterase/lipase At1g28580-like [Populus euphratica]
Length=380

 Score =   158 bits (399),  Expect(2) = 2e-75, Method: Compositional matrix adjust.
 Identities = 88/191 (46%), Positives = 127/191 (66%), Gaps = 1/191 (1%)
 Frame = +1

Query  460   FSREKNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVE  639
             F    N   I+ ++P V + I     +LI+LGA T++VP  LP+GC+ SYLT +   + +
Sbjct  183   FFEGINFETIQDLVPYVINTIGLAIKELIQLGAITILVPGNLPIGCSPSYLTLFEGSDKK  242

Query  640   DYDDL-GCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGF  816
             DYD   GCL W+N+ A  HN+ L +EL  +++ HP+A IIY D +NAAM  Y  P   GF
Sbjct  243   DYDHFTGCLKWLNKFAQEHNEQLMKELKRIQKLHPHAKIIYADYYNAAMPFYHSPNRFGF  302

Query  817   SggalraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDG  996
             +GG L++CCG GG YN+N  + CG+   ++C DP+++VNWDG H TEA YKL+ +S+++G
Sbjct  303   TGGVLKSCCGWGGMYNYNSLVNCGNPLVSACDDPTSFVNWDGIHYTEATYKLIFESIIEG  362

Query  997   SYTYPSMNALC  1029
             SY+YPS  A C
Sbjct  363   SYSYPSFKAFC  373


 Score =   153 bits (387),  Expect(2) = 2e-75, Method: Compositional matrix adjust.
 Identities = 79/156 (51%), Positives = 102/156 (65%), Gaps = 8/156 (5%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            SL+DTGN  +L+       D +P  S LPYGETFFHHPTGRCSDGR+++D IAE+ GL  
Sbjct  39   SLADTGNSRNLSPP-----DNLPHFSFLPYGETFFHHPTGRCSDGRLVIDFIAEYLGLPF  93

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQDMI  362
             PP      ++       GVNFAV G+ AL A F Q+  +   VTN+S+  QL  F++++
Sbjct  94   VPPYFGGSMESFK---EAGVNFAVAGATALDAAFLQEKGLTKLVTNISLVVQLGLFKELL  150

Query  363  PSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSG  470
            PSLC++PSDCK LL +SL +LGE GGNDY H    G
Sbjct  151  PSLCSTPSDCKKLLGDSLILLGEIGGNDYNHPFFEG  186



>ref|XP_002267261.1| PREDICTED: GDSL esterase/lipase At1g28580 [Vitis vinifera]
Length=375

 Score =   182 bits (462),  Expect(2) = 3e-75, Method: Compositional matrix adjust.
 Identities = 107/191 (56%), Positives = 138/191 (72%), Gaps = 1/191 (1%)
 Frame = +1

Query  460   FSREKNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVE  639
             F + +++ +IR  +P V HAIA    +LIELGA T+MVP  LP GC+ASYLT + +PN+E
Sbjct  171   FFQGRSLEEIRTYVPPVIHAIASAITELIELGAVTLMVPGKLPTGCSASYLTLFKTPNIE  230

Query  640   DYDDL-GCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGF  816
             DYD + GCL W+N+ A YHN+ L+ ELN +RE +P+ NIIY D +NAAM+IY  P   GF
Sbjct  231   DYDPVTGCLNWLNEFAEYHNEQLKTELNRIRELYPHTNIIYADYYNAAMRIYRSPNKFGF  290

Query  817   SggalraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDG  996
               GAL ACCGGGG YN+N  ++CG+  ATSC DPS YV+WDG HLTEAAYK +   LL+ 
Sbjct  291   KRGALTACCGGGGPYNYNSSVECGNLPATSCDDPSLYVSWDGLHLTEAAYKWIANGLLEE  350

Query  997   SYTYPSMNALC  1029
              YT+P +NA C
Sbjct  351   PYTFPPLNASC  361


 Score =   129 bits (323),  Expect(2) = 3e-75, Method: Compositional matrix adjust.
 Identities = 72/157 (46%), Positives = 96/157 (61%), Gaps = 11/157 (7%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            SL+DTGN + L S        +P  +  PYGETFFH PTGRCSDGR+I+D IA   GL +
Sbjct  30   SLTDTGNLL-LASPA----HNLPHFAKPPYGETFFHRPTGRCSDGRLIIDFIAGFLGLPL  84

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQDMI  362
              P L +       + RQ VNFA+VG+ AL  EF+Q   I+   TN+S+  QL  F+D +
Sbjct  85   IHPYLET------TDPRQSVNFAIVGATALDDEFFQARNIHIPYTNISLGIQLGWFKDKL  138

Query  363  PSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
             SLC + S+C  L  +SLF++GE GGNDY +    G+
Sbjct  139  LSLCPTFSNCNELFNSSLFLMGEIGGNDYGYPFFQGR  175



>ref|XP_002305753.2| hypothetical protein POPTR_0004s05350g [Populus trichocarpa]
 gb|EEE86264.2| hypothetical protein POPTR_0004s05350g [Populus trichocarpa]
Length=424

 Score =   155 bits (393),  Expect(2) = 1e-74, Method: Compositional matrix adjust.
 Identities = 88/191 (46%), Positives = 127/191 (66%), Gaps = 1/191 (1%)
 Frame = +1

Query  460   FSREKNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVE  639
             F    N   I+ ++P V + I     +LI+LGA T++VP  LP+GC+ SYLT +   + +
Sbjct  227   FFEGINFETIQDLVPYVINTIGLAIKELIQLGAITILVPGNLPIGCSPSYLTLFEGSDKK  286

Query  640   DYDDL-GCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGF  816
             DYD L GCL W+N+ A  HN+ L +EL  +++ HP+A IIY D +NAAM  Y  P   GF
Sbjct  287   DYDHLTGCLNWLNKFAQEHNEQLIKELKRIQKLHPHAKIIYADYYNAAMPFYHSPNRFGF  346

Query  817   SggalraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDG  996
             +GG L++CCG GG YN+N  ++CG+   + C DP+++VNWDG H TEA YKL+ +S+++G
Sbjct  347   TGGVLKSCCGWGGMYNYNSLVKCGNPLVSVCDDPTSFVNWDGIHYTEATYKLIFESIIEG  406

Query  997   SYTYPSMNALC  1029
             S +YPS  A C
Sbjct  407   SNSYPSFKAFC  417


 Score =   153 bits (387),  Expect(2) = 1e-74, Method: Compositional matrix adjust.
 Identities = 79/156 (51%), Positives = 101/156 (65%), Gaps = 8/156 (5%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            SL+DTGN  +L+       D +P  S LPYGETFFHHPTGRCSDGR+++D IAE+ GL  
Sbjct  83   SLADTGNSRNLSPP-----DNLPHYSFLPYGETFFHHPTGRCSDGRLVIDFIAEYLGLPF  137

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQDMI  362
             PP      ++       GVNFAV G+ AL A F Q+  +   VTN+S+  QL  F++++
Sbjct  138  VPPYFGGSMESFK---EAGVNFAVAGATALDAAFLQEKGLAKLVTNISLVVQLGLFKELL  194

Query  363  PSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSG  470
            PSLC++PSDCK LL  SL +LGE GGNDY H    G
Sbjct  195  PSLCSTPSDCKKLLGESLILLGEIGGNDYNHPFFEG  230



>ref|XP_007212863.1| hypothetical protein PRUPE_ppa021567mg [Prunus persica]
 gb|EMJ14062.1| hypothetical protein PRUPE_ppa021567mg [Prunus persica]
Length=393

 Score =   167 bits (424),  Expect(2) = 5e-74, Method: Compositional matrix adjust.
 Identities = 96/200 (48%), Positives = 130/200 (65%), Gaps = 14/200 (7%)
 Frame = +1

Query  472   KNITDIRPIIPIVAHAIA-------------EGAHKLIELGARTVMVPSVLPLGCAASYL  612
             K+I  +R  +P+V  AIA              G  +LIELGA T++VP   P+GC  +YL
Sbjct  190   KSIELVRSYLPLVIEAIASTINSFFLNFLWLHGLQELIELGAATILVPGNNPIGCLPAYL  249

Query  613   TYYPSPNVEDYD-DLGCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQI  789
             + + + +   YD   GCL W+N+ A YHN+ LQ EL+ +R  HP   I+Y D +NA +Q+
Sbjct  250   SKFETSDKNQYDPSTGCLKWLNEFAQYHNEQLQIELSRIRRLHPQVTIVYADYYNALLQL  309

Query  790   YDGPANLGFSggalraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYK  969
             Y  P   GF+G   +ACCGGGG YNFNP LQCG+ GAT C +PS ++NWDG H TEAAY+
Sbjct  310   YQSPHQFGFTGETSKACCGGGGPYNFNPSLQCGNAGATVCENPSQFINWDGMHSTEAAYR  369

Query  970   LMTKSLLDGSYTYPSMNALC  1029
             LMTK+LL G+YT+P + +LC
Sbjct  370   LMTKALLQGNYTFPRLASLC  389


 Score =   139 bits (350),  Expect(2) = 5e-74, Method: Compositional matrix adjust.
 Identities = 74/158 (47%), Positives = 95/158 (60%), Gaps = 7/158 (4%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            SL+DTGN  + + +  L Y   P      YGET+FHHPTGRCSDGR+I+D IA+  GL +
Sbjct  39   SLTDTGNLYNSSPNRSLHYFQPP------YGETYFHHPTGRCSDGRLIIDFIAQFLGLPL  92

Query  183  PPPSLSS-KAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQDM  359
             PP L +  +     N   GVNFAV+G+  L A F   +EI+   TN S+  QL  F+ M
Sbjct  93   VPPFLQNLNSNQSVQNFEAGVNFAVIGATGLDASFLATMEIHSPSTNNSLRIQLEWFKQM  152

Query  360  IPSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
            +PSLCN+  DCK  L  SL ++G  G NDY   LL GK
Sbjct  153  LPSLCNTSLDCKKFLSTSLILMGSIGCNDYNDGLLGGK  190



>emb|CDP21061.1| unnamed protein product [Coffea canephora]
Length=394

 Score =   158 bits (399),  Expect(2) = 5e-73, Method: Compositional matrix adjust.
 Identities = 96/186 (52%), Positives = 128/186 (69%), Gaps = 1/186 (1%)
 Frame = +1

Query  475   NITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVEDYDD-  651
              I  I+  +P V   I+    ++I+LGA T++VP   P+GC+A YLTY+   N +DYD  
Sbjct  196   KIDQIKSFVPAVISEISSAIEEVIKLGAVTLIVPGNFPIGCSAVYLTYFQGSNQQDYDKA  255

Query  652   LGCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGFSggal  831
              GC+ W+N  + YHN+LLQ+ELN +R+ HP+A IIY D +NAAM++Y  P   GF GGAL
Sbjct  256   TGCINWLNDFSKYHNRLLQKELNRIRKLHPHATIIYADYYNAAMRLYRSPNKYGFRGGAL  315

Query  832   raccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDGSYTYP  1011
             +ACCGGGG YN+N  ++CG   ATSC DPS YV WDG HLTEAAY+L+   LL G ++ P
Sbjct  316   KACCGGGGPYNYNSSVECGYPPATSCDDPSLYVCWDGLHLTEAAYQLIAGGLLQGPFSTP  375

Query  1012  SMNALC  1029
              MN +C
Sbjct  376   PMNTIC  381


 Score =   145 bits (366),  Expect(2) = 5e-73, Method: Compositional matrix adjust.
 Identities = 70/158 (44%), Positives = 104/158 (66%), Gaps = 6/158 (4%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            S++DTGN + L       +  +P     PYGE+FFH PTGR S+GR+++D  AE +GL +
Sbjct  45   SIADTGNLLRLCPSNYPPHFSLP-----PYGESFFHRPTGRFSNGRLVIDFFAESFGLPL  99

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQDMI  362
             PP L+ +    G + RQGVNFAV G+ AL + F+++  + + +TNVS+  QL  F+D++
Sbjct  100  IPPYLAGE-DARGRDFRQGVNFAVAGATALDSSFFRERGVRNPLTNVSLGTQLRWFKDVM  158

Query  363  PSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSGKK  476
            PS C++ SDC+  L  SL ++GE GGNDY H+L+ G K
Sbjct  159  PSFCSNSSDCREFLRTSLVLMGEIGGNDYNHALVQGIK  196



>emb|CDO96753.1| unnamed protein product [Coffea canephora]
Length=404

 Score =   160 bits (405),  Expect(2) = 1e-72, Method: Compositional matrix adjust.
 Identities = 93/187 (50%), Positives = 125/187 (67%), Gaps = 1/187 (1%)
 Frame = +1

Query  475   NITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVEDYD-D  651
              I ++   +P+V   I+    +LI+LGA T++VP  LP+GC++SYLTY+ S N  DYD +
Sbjct  208   KIKEVESFVPLVVQTISSAIQELIDLGAETLVVPGNLPIGCSSSYLTYFQSSNKHDYDME  267

Query  652   LGCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGFSggal  831
              GC+ W+N+ A YHN+LL  E+N +RE +P+A I+Y D +NAAM +Y  P   GF  GAL
Sbjct  268   TGCIKWLNEFAKYHNKLLLTEINRIRELNPHALIVYADYYNAAMTLYRSPQKYGFKAGAL  327

Query  832   raccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDGSYTYP  1011
             +ACCG GG YN+N    CG   ATSC DPS YV WDG HLTEAAY+ + + LL G Y+  
Sbjct  328   KACCGAGGPYNYNASAPCGYPPATSCDDPSLYVAWDGLHLTEAAYRFIARRLLQGPYSGL  387

Query  1012  SMNALCP  1032
              +N  CP
Sbjct  388   RINRFCP  394


 Score =   142 bits (357),  Expect(2) = 1e-72, Method: Compositional matrix adjust.
 Identities = 73/164 (45%), Positives = 102/164 (62%), Gaps = 6/164 (4%)
 Frame = +3

Query  3    SLSDTGNYISL------TSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAE  164
            SL+DTGN + L      +S      +  P   + PYGETFFHHPTGRCSDGR+++D IAE
Sbjct  45   SLADTGNLLRLDRLSSSSSSSSSSSNTPPHFFLPPYGETFFHHPTGRCSDGRLVIDFIAE  104

Query  165  HYGLAIPPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLH  344
              G  +  P  + K   G ++  +G NFAV+G+ A+    +++  I++  TNVS+  QL 
Sbjct  105  SLGFPLIRPYFAGKDIRGRSDFIKGSNFAVIGATAIDDSVFRERGIHNPFTNVSLGTQLG  164

Query  345  AFQDMIPSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSGKK  476
             F++M+ S C   SDCK LLE+SL ++GE GGNDY H+L  G K
Sbjct  165  WFKEMLASFCKESSDCKELLESSLVLMGEIGGNDYNHALFQGLK  208



>ref|XP_008225217.1| PREDICTED: uncharacterized protein LOC103324878 [Prunus mume]
Length=885

 Score =   154 bits (389),  Expect(2) = 3e-72, Method: Compositional matrix adjust.
 Identities = 87/187 (47%), Positives = 122/187 (65%), Gaps = 1/187 (1%)
 Frame = +1

Query  472   KNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVEDYD-  648
             K+I  ++  +P+V   IA   ++LIELGA T++VP   P+GC  +YLT Y S +   YD 
Sbjct  695   KSIEKVQAYVPLVIETIASTINELIELGAATLLVPGNFPIGCLPAYLTKYESSDKNQYDP  754

Query  649   DLGCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGFSgga  828
               GCL W+N+ + YHN  LQ EL+ +R  HP   IIY D +NA +Q+Y  P   GF G  
Sbjct  755   STGCLNWLNKFSGYHNDQLQIELSRIRRLHPQVTIIYADYYNAMLQLYQSPDQFGFIGET  814

Query  829   lraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDGSYTY  1008
              +ACCGGGG YN+N    CGD GA+ C +P+ +++WDG H TEAAY+ +TK++L G+YT 
Sbjct  815   SKACCGGGGPYNYNASALCGDAGASVCENPAQFISWDGLHSTEAAYRWITKAILQGNYTV  874

Query  1009  PSMNALC  1029
             P ++ LC
Sbjct  875   PRVSTLC  881


 Score =   146 bits (369),  Expect(2) = 3e-72, Method: Compositional matrix adjust.
 Identities = 78/162 (48%), Positives = 104/162 (64%), Gaps = 15/162 (9%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSV----LPYGETFFHHPTGRCSDGRVILDIIAEHY  170
            SL+DTGN           Y+  P+ S+     PYG+T+FHHPTGRCSDGR+++D IAE  
Sbjct  544  SLTDTGNL----------YNSYPNKSLNFFHPPYGQTYFHHPTGRCSDGRLVIDFIAEFL  593

Query  171  GLAIPPPSLSSK-AQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHA  347
            GL + PP L S+ +     N   GVNFAVVG+ AL A F +++      TN S++ QL  
Sbjct  594  GLPLVPPYLESQDSNQSVQNFEAGVNFAVVGATALDAAFLEEMGDSTAFTNNSLSIQLEW  653

Query  348  FQDMIPSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
            F+ M+PSLCN+ SDC  LL  SL ++GE GGNDY ++LL+GK
Sbjct  654  FKQMLPSLCNTSSDCNKLLSTSLILMGEIGGNDYNNALLAGK  695


 Score =   138 bits (347),  Expect(2) = 3e-63, Method: Compositional matrix adjust.
 Identities = 77/162 (48%), Positives = 103/162 (64%), Gaps = 16/162 (10%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSV----LPYGETFFHHPTGRCSDGRVILDIIAEHY  170
            SL+DTGN+          Y+  P+ S+     PYG+T+FHHPTGRCSDGR+++D IAE  
Sbjct  43   SLTDTGNF----------YNSYPNKSLNFFHPPYGQTYFHHPTGRCSDGRLVIDFIAEFL  92

Query  171  GLAIPPPSLSSK-AQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHA  347
            GL + PP L S+ +     N   GVNFAV G+ AL A F +++      TN S++ QL  
Sbjct  93   GLPLVPPYLESQNSNQSVQNFEAGVNFAVAGATALDAAFLEEMGDSTPYTN-SLSIQLEW  151

Query  348  FQDMIPSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
            F+ M+PSLCN+ SD K LL  SL ++GE GGNDY + LL+GK
Sbjct  152  FKQMLPSLCNTSSDRKKLLSTSLILMGEIGGNDYNNPLLAGK  193


 Score =   132 bits (333),  Expect(2) = 3e-63, Method: Compositional matrix adjust.
 Identities = 78/166 (47%), Positives = 106/166 (64%), Gaps = 1/166 (1%)
 Frame = +1

Query  472  KNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVEDYD-  648
            K+I  ++  +P+V   IA   ++LIELGA T++VP   P+GC  +YLT Y S +   YD 
Sbjct  193  KSIEKVQAYVPLVIETIASTINELIELGAATLLVPGNFPIGCLPAYLTKYESSDKNQYDP  252

Query  649  DLGCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGFSgga  828
              GCL W+N+ + YHN  LQ EL+ +R  HP   IIY D +NA +Q+Y  P   GF G  
Sbjct  253  STGCLNWLNKFSGYHNDQLQIELSRIRRLHPQVTIIYADYYNAMLQLYQSPDQFGFIGET  312

Query  829  lraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAY  966
             +ACCGGGG YN+N    CGD GA+ C +P+ +++WDG H TEAAY
Sbjct  313  SKACCGGGGPYNYNTSALCGDAGASVCENPAQFISWDGLHSTEAAY  358



>emb|CDO99485.1| unnamed protein product [Coffea canephora]
Length=399

 Score =   150 bits (379),  Expect(2) = 1e-71, Method: Compositional matrix adjust.
 Identities = 93/192 (48%), Positives = 127/192 (66%), Gaps = 2/192 (1%)
 Frame = +1

Query  460   FSREKNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVE  639
             F + K++ + + ++P+V  A     ++LI+LG   +MV  +LP GC+ + LTY+ S N E
Sbjct  191   FLQGKSLEETKSLVPLVISATGSAINELIDLGVVNIMVNGLLPDGCSPAMLTYFKSSNKE  250

Query  640   DYDD-LGCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGF  816
             DYD   GCL W+N  ++YHN+LLQEELN +R  HP A I+Y D FN  MQ++  P   GF
Sbjct  251   DYDTATGCLSWLNDFSNYHNELLQEELNGVRANHPDALILYADYFNPLMQLFRSPEQNGF  310

Query  817   SggalraccggggQ-YNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLD  993
              G +L ACCG GG  YN+N   QCG+  +T+C  PS Y++WDG HLTEAAY+ M K LL+
Sbjct  311   GGRSLMACCGDGGPPYNYNFSAQCGEPASTACAWPSLYISWDGIHLTEAAYRFMAKGLLE  370

Query  994   GSYTYPSMNALC  1029
             G YT P +N LC
Sbjct  371   GPYTTPRINPLC  382


 Score =   148 bits (374),  Expect(2) = 1e-71, Method: Compositional matrix adjust.
 Identities = 76/157 (48%), Positives = 101/157 (64%), Gaps = 2/157 (1%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            SL+DTGNY ++         G   C + PYGET+FHHPTGRCSDGR+I+D IAE+YGL  
Sbjct  41   SLADTGNYATIYPPIFHLSKGTLYCGLPPYGETYFHHPTGRCSDGRLIIDFIAEYYGLPP  100

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQDMI  362
             PP L        +  + G+NFAV G+ AL   FY +  I  T+ N+SM+ QL  F+ ++
Sbjct  101  VPPYLRGANHRSNSRFQAGLNFAVAGATALDVPFYGEKGISSTLGNISMSTQLRWFKGLL  160

Query  363  PSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
            PSLCNS S C  + ++SLF++G FGGNDY  + L GK
Sbjct  161  PSLCNS-SSCSEVFKSSLFLMG-FGGNDYGKAFLQGK  195



>ref|XP_010277742.1| PREDICTED: GDSL esterase/lipase At1g28610-like [Nelumbo nucifera]
Length=391

 Score =   170 bits (431),  Expect(2) = 2e-71, Method: Compositional matrix adjust.
 Identities = 98/197 (50%), Positives = 136/197 (69%), Gaps = 1/197 (1%)
 Frame = +1

Query  460   FSREKNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVE  639
             F   K+  DIRP++P+V +A+      LIE GA T++VP  LP+GC+A+YLT + SPN +
Sbjct  186   FFEGKSFHDIRPLVPLVINAVTSTVQMLIEQGAVTLLVPGNLPIGCSAAYLTQFQSPNKD  245

Query  640   DYD-DLGCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGF  816
             DYD + GCL W+N+ A   N  L +EL+ +RE +P+A IIY D +NAAM+IY  P+  GF
Sbjct  246   DYDPETGCLKWLNEFAQKFNDHLVKELDGMRELYPHATIIYADYYNAAMRIYRSPSQYGF  305

Query  817   SggalraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDG  996
             + GAL ACCGGGG YN++    CGD G+ +C DPS+YV+WDG HLTEAAY+L+ + L+ G
Sbjct  306   TNGALTACCGGGGPYNYDRTAMCGDAGSRTCEDPSSYVSWDGIHLTEAAYRLIAEGLIRG  365

Query  997   SYTYPSMNALCPTDAQV  1047
              Y  PS+   C +  Q+
Sbjct  366   PYAVPSIKHSCASLPQI  382


 Score =   128 bits (321),  Expect(2) = 2e-71, Method: Compositional matrix adjust.
 Identities = 66/157 (42%), Positives = 97/157 (62%), Gaps = 6/157 (4%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            SL+DTGN + L +     Y  I   S +PYGET+FH PTGR S+GR+++D IA+  GL  
Sbjct  40   SLADTGNLLILQAQEHKPYSRI---SRVPYGETYFHRPTGRSSNGRLVIDFIAQSLGLPF  96

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQDMI  362
             PP L    +     ++QG+NFAVVG+ AL   F ++  I++  +N S+  Q   F+ ++
Sbjct  97   IPPFLQ---RNNSQPVQQGLNFAVVGATALDDSFLRERGIFNPDSNNSLGIQFQWFKQVL  153

Query  363  PSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
            PSLC+  ++C+ LL  SL + GE GGND+ H+   GK
Sbjct  154  PSLCDPSTNCRELLARSLVLAGEIGGNDFNHAFFEGK  190



>emb|CDX94634.1| BnaC07g10240D [Brassica napus]
Length=398

 Score =   160 bits (404),  Expect(2) = 3e-71, Method: Compositional matrix adjust.
 Identities = 91/187 (49%), Positives = 122/187 (65%), Gaps = 1/187 (1%)
 Frame = +1

Query  472   KNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVEDYDD  651
             K I +IR ++P+V   I+    +LI +G RT +VP   PLGC+ +YLT Y + N+E+YD 
Sbjct  192   KPIEEIRELVPLVITTISSAITELIGMGGRTFLVPGNFPLGCSVAYLTLYQTSNMEEYDP  251

Query  652   L-GCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGFSgga  828
             + GCL W+N+ A Y N+ LQ EL+ LR+ +P+ NIIY D +NA  +++  PA  GF    
Sbjct  252   VTGCLKWLNKFAEYFNEQLQAELDRLRKLYPHVNIIYADYYNALARLFQEPAKYGFMNRP  311

Query  829   lraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDGSYTY  1008
             L ACCG GGQYN+ P  +CG EG   C DPS YVNWDG H+TEAAY+L+ + LL G Y  
Sbjct  312   LPACCGFGGQYNYTPGKKCGFEGVDYCKDPSKYVNWDGVHMTEAAYRLIAEGLLKGPYVI  371

Query  1009  PSMNALC  1029
             P  N  C
Sbjct  372   PPFNWSC  378


 Score =   137 bits (345),  Expect(2) = 3e-71, Method: Compositional matrix adjust.
 Identities = 68/157 (43%), Positives = 104/157 (66%), Gaps = 9/157 (6%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            S++DTGN + L+       + +P  +  PYGETFF+H TGR S+GR+I+D IAE+ GL +
Sbjct  45   SIADTGNLLGLSDP-----NDLPHVAFPPYGETFFNHSTGRFSNGRLIIDFIAEYLGLPL  99

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQDMI  362
             PP   S+      N  +GVNFAV G+ AL   F ++  I+   TNVS+  QL +F+ ++
Sbjct  100  VPPFYGSQNA----NFEKGVNFAVGGATALERSFLEERGIHFAYTNVSLGVQLQSFKGLL  155

Query  363  PSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
            P+LC+SPS+C++++EN+L ++GE GGND  ++   GK
Sbjct  156  PNLCDSPSECRDMIENALILMGEVGGNDLNYAFFVGK  192



>ref|XP_002893538.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69797.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=808

 Score =   155 bits (392),  Expect(2) = 3e-71, Method: Compositional matrix adjust.
 Identities = 89/189 (47%), Positives = 123/189 (65%), Gaps = 1/189 (1%)
 Frame = +1

Query  466   REKNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVEDY  645
             + K I ++  ++P V  AI+    +L+ +G RT +VP   PLGC+A+YLT Y + N E+Y
Sbjct  607   QRKAIEEVEELVPFVVSAISLAIKELVCMGGRTFLVPGNFPLGCSAAYLTLYQTSNKEEY  666

Query  646   DDL-GCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGFSg  822
             D L GCL W+N  + Y+N+ LQ+ELN L+E +P+ NIIY D +NA ++++  PA  GF  
Sbjct  667   DPLTGCLTWLNVFSEYYNEQLQKELNRLKELYPHVNIIYADYYNALLRLFPEPAKFGFMN  726

Query  823   galraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDGSY  1002
               L ACCG GG YNFN   +CG  G   C DPS YVNWDG H+TEAAY+ +++ LL G Y
Sbjct  727   RPLPACCGLGGSYNFNFSRRCGSVGVEYCNDPSKYVNWDGIHMTEAAYRWISEGLLKGPY  786

Query  1003  TYPSMNALC  1029
               P+ N  C
Sbjct  787   AIPTFNWSC  795


 Score =   142 bits (357),  Expect(2) = 3e-71, Method: Compositional matrix adjust.
 Identities = 70/157 (45%), Positives = 103/157 (66%), Gaps = 9/157 (6%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            S++DTGN + L+       + +P+ +  PYGETFFHHPTGR SDGR+I+D IAE  G  +
Sbjct  462  SIADTGNLLGLSDP-----NNLPASAFPPYGETFFHHPTGRYSDGRLIIDFIAEFLGFPL  516

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQDMI  362
              P    +      N  +GVNFAV G+ AL   F ++  I+  +TNVS++ QL +F++ +
Sbjct  517  VHPFYGCQ----NANFEKGVNFAVAGATALDTSFLEEGGIHSDITNVSLSVQLRSFKESL  572

Query  363  PSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
            P+LC SPSDC++++EN+L ++GE GGNDY  +L   K
Sbjct  573  PNLCGSPSDCRDMIENALILMGEIGGNDYNFALFQRK  609


 Score =   155 bits (391),  Expect(2) = 3e-69, Method: Compositional matrix adjust.
 Identities = 87/191 (46%), Positives = 117/191 (61%), Gaps = 1/191 (1%)
 Frame = +1

Query  460   FSREKNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVE  639
             F   K I +++ ++P V   I+    +LI +GA+T +VP   P+GC+  YLT Y + N E
Sbjct  180   FFERKPIKEVKELVPFVIATISSAITELIGMGAKTFLVPGEFPIGCSVVYLTLYQTSNKE  239

Query  640   DYDDL-GCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGF  816
             +YD L GCL W+N+   YH+Q L+ ELN LR+ +P+ NIIY D +NA ++++  PA  GF
Sbjct  240   EYDPLTGCLKWLNKFGEYHSQQLKTELNRLRKLNPHVNIIYADYYNALLRLFKEPAKFGF  299

Query  817   SggalraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDG  996
                 L ACCG GGQYNFN   +CG  G  SC DPS YV WDG H+TE AYK +   +L G
Sbjct  300   MDRPLHACCGIGGQYNFNFTRKCGSVGVESCKDPSKYVGWDGVHMTEGAYKWIADGILKG  359

Query  997   SYTYPSMNALC  1029
              Y  P     C
Sbjct  360   PYAIPPFGRSC  370


 Score =   135 bits (341),  Expect(2) = 3e-69, Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 94/157 (60%), Gaps = 10/157 (6%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            S++DTGN + L++   L     P     PYGETFFHHPTGR  DGR+I+D IAE  GL  
Sbjct  38   SIADTGNLVGLSNRNNLPVTAFP-----PYGETFFHHPTGRSCDGRIIMDFIAEFVGLPY  92

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQDMI  362
             PP   SK      N  +GVNFAV G+ AL + F  K  I+   TNVS+  QL +F+  +
Sbjct  93   VPPYFGSK----NGNFDKGVNFAVAGATALESSFLMKRGIHPH-TNVSLGVQLKSFKKSL  147

Query  363  PSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
            P LC SPSDC++ + N+L ++GE GGNDY       K
Sbjct  148  PDLCGSPSDCRDKIGNALILMGEIGGNDYNFPFFERK  184



>ref|XP_003542989.1| PREDICTED: GDSL esterase/lipase At1g28600 [Glycine max]
Length=400

 Score =   167 bits (424),  Expect(2) = 4e-71, Method: Compositional matrix adjust.
 Identities = 99/190 (52%), Positives = 119/190 (63%), Gaps = 0/190 (0%)
 Frame = +1

Query  460   FSREKNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVE  639
              S      D+   IP V   I     +LI+LGA T MVP  LPLGC  +YLT + + + E
Sbjct  192   LSETTAFGDLVTYIPQVISVITSAIRELIDLGAVTFMVPGSLPLGCNPAYLTIFATIDKE  251

Query  640   DYDDLGCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGFS  819
             +YD  GCL W+N    YHN+LLQ E+N LR  +P  NIIY D FNAA++ Y+ P   GF 
Sbjct  252   EYDQAGCLKWLNTFYEYHNELLQIEINRLRVLYPLTNIIYADYFNAALEFYNSPEQFGFG  311

Query  820   ggalraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDGS  999
             G  L+ CCGGGG YN+N    CGD G  +C DPS YV+WDGYHLTEAAY+ MTK LLDG 
Sbjct  312   GNVLKVCCGGGGPYNYNETAMCGDAGVVACDDPSQYVSWDGYHLTEAAYRWMTKGLLDGP  371

Query  1000  YTYPSMNALC  1029
             YT P  N  C
Sbjct  372   YTIPKFNVSC  381


 Score =   129 bits (325),  Expect(2) = 4e-71, Method: Compositional matrix adjust.
 Identities = 72/155 (46%), Positives = 93/155 (60%), Gaps = 8/155 (5%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            SL+DTGN   ++          P C + PYG+T FH P GRCSDGR+ILD +AE  GL  
Sbjct  44   SLTDTGNLYFISPRQS------PDCLLPPYGQTHFHRPNGRCSDGRLILDFLAESLGLPY  97

Query  183  PPPSLSSK-AQTGGNNIRQGVNFAVVGSRALPAEFYQ-KLEIYDTVTNVSMNDQLHAFQD  356
              P L  K       NI QGVNFAV G+ AL   F++ K    D   N S+  QL  F++
Sbjct  98   VKPYLGFKNGAVKRGNIEQGVNFAVAGATALDRGFFEEKGFAVDVTANFSLGVQLDWFKE  157

Query  357  MIPSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSL  461
            ++PSLCNS S CK ++ +SLF++GE GGNDY + L
Sbjct  158  LLPSLCNSSSSCKKVIGSSLFIVGEIGGNDYGYPL  192



>gb|KHN08454.1| GDSL esterase/lipase [Glycine soja]
Length=709

 Score =   167 bits (423),  Expect(2) = 6e-71, Method: Compositional matrix adjust.
 Identities = 99/190 (52%), Positives = 119/190 (63%), Gaps = 0/190 (0%)
 Frame = +1

Query  460   FSREKNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVE  639
              S      D+   IP V   I     +LI+LGA T MVP  LPLGC  +YLT + + + E
Sbjct  501   LSETTAFGDLVTYIPQVISVITSAIRELIDLGAVTFMVPGSLPLGCNPAYLTIFATIDKE  560

Query  640   DYDDLGCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGFS  819
             +YD  GCL W+N    YHN+LLQ E+N LR  +P  NIIY D FNAA++ Y+ P   GF 
Sbjct  561   EYDQAGCLKWLNTFYEYHNELLQIEINRLRVLYPLTNIIYADYFNAALEFYNSPEQFGFG  620

Query  820   ggalraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDGS  999
             G  L+ CCGGGG YN+N    CGD G  +C DPS YV+WDGYHLTEAAY+ MTK LLDG 
Sbjct  621   GNVLKVCCGGGGPYNYNETAMCGDAGVVACDDPSQYVSWDGYHLTEAAYRWMTKGLLDGP  680

Query  1000  YTYPSMNALC  1029
             YT P  N  C
Sbjct  681   YTIPKFNVSC  690


 Score =   129 bits (324),  Expect(2) = 6e-71, Method: Compositional matrix adjust.
 Identities = 72/155 (46%), Positives = 93/155 (60%), Gaps = 8/155 (5%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            SL+DTGN   ++          P C + PYG+T FH P GRCSDGR+ILD +AE  GL  
Sbjct  353  SLTDTGNLYFISPRQS------PDCLLPPYGQTHFHRPNGRCSDGRLILDFLAESLGLPY  406

Query  183  PPPSLSSK-AQTGGNNIRQGVNFAVVGSRALPAEFYQ-KLEIYDTVTNVSMNDQLHAFQD  356
              P L  K       NI QGVNFAV G+ AL   F++ K    D   N S+  QL  F++
Sbjct  407  VKPYLGFKNGAVKRGNIEQGVNFAVAGATALDRGFFEEKGFAVDVTANFSLGVQLDWFKE  466

Query  357  MIPSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSL  461
            ++PSLCNS S CK ++ +SLF++GE GGNDY + L
Sbjct  467  LLPSLCNSSSSCKKVIGSSLFIVGEIGGNDYGYPL  501


 Score =   141 bits (356),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 79/175 (45%), Positives = 115/175 (66%), Gaps = 2/175 (1%)
 Frame = +1

Query  466  REKNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVEDY  645
            ++++I +++  +P V  AI    ++LI LGART++VP  +PLGC+ +YLT Y + +   Y
Sbjct  182  QQRSIAEVKTFVPYVIKAITSAVNELIGLGARTLIVPGNIPLGCSITYLTIYETMDKNQY  241

Query  646  DDLGCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGFSgg  825
            D  GCL W+N+ A Y+NQ LQ EL+ L+  H +ANIIY D +NA + +Y  P   GF+  
Sbjct  242  DQYGCLKWLNKFAEYYNQKLQSELHRLQGLHSHANIIYADYYNAILSLYRDPTMFGFT--  299

Query  826  alraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLL  990
             L+ CCG GG YN+N    CGD G  +C DPS ++ WDG HLTEAAY+++ +  L
Sbjct  300  NLKTCCGMGGPYNYNASADCGDPGVNACDDPSKHIGWDGVHLTEAAYRIIAQDSL  354


 Score =   123 bits (308),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 68/160 (43%), Positives = 96/160 (60%), Gaps = 17/160 (11%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIP---SCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYG  173
            S +DTGN         L +   P    C   PYG+TFFH  TGRCSDGR+I+D IAE  G
Sbjct  39   SFADTGN---------LYFSSHPPSHHCFFPPYGQTFFHRVTGRCSDGRLIIDFIAESLG  89

Query  174  LAIPPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQ  353
            L +  P L  K +    N+  G NFAV+G+ AL   F+++  I    T+ S+  QL+ F+
Sbjct  90   LPLLKPYLGMKKK----NVVGGANFAVIGATALDLSFFEERGI-SIPTHYSLTVQLNWFK  144

Query  354  DMIPSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
            +++PSLCNS +DC  ++ NSLF++GE GGND+ + L   +
Sbjct  145  ELLPSLCNSSADCHEVVGNSLFLMGEIGGNDFNYLLFQQR  184



>emb|CDY15655.1| BnaA07g08260D [Brassica napus]
Length=393

 Score =   162 bits (409),  Expect(2) = 7e-71, Method: Compositional matrix adjust.
 Identities = 94/191 (49%), Positives = 123/191 (64%), Gaps = 1/191 (1%)
 Frame = +1

Query  460   FSREKNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVE  639
             F   K I +I+ +IP+V   I+    +LI +G RT +VP   PLGC+ +YLT Y + NVE
Sbjct  182   FFVGKPIEEIKELIPLVITTISSAITELIGMGGRTFLVPGNFPLGCSVAYLTLYQTSNVE  241

Query  640   DYDDL-GCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGF  816
             +YD + GCL W+N+ A Y N+ LQ EL+ LR+ +P+ NIIY D +NA  +I+  PA  GF
Sbjct  242   EYDPVTGCLKWLNKFAEYFNEQLQAELDRLRKMYPHVNIIYADYYNALSRIFQEPAKFGF  301

Query  817   SggalraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDG  996
                 L ACCG GGQYN+ P  +CG EG   C DPS YVNWDG H+TEAAY+L+ + LL G
Sbjct  302   MNRPLPACCGLGGQYNYTPGKKCGFEGVEYCDDPSKYVNWDGVHMTEAAYRLIAEGLLKG  361

Query  997   SYTYPSMNALC  1029
              Y  P  N  C
Sbjct  362   PYVIPPFNWSC  372


 Score =   134 bits (338),  Expect(2) = 7e-71, Method: Compositional matrix adjust.
 Identities = 67/157 (43%), Positives = 104/157 (66%), Gaps = 9/157 (6%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            S++DTGN + L+       + +P  +  PYGETFF+H TGR S+GR+I+D IAE+ GL +
Sbjct  39   SIADTGNLLGLSDP-----NDLPHVAFPPYGETFFNHSTGRFSNGRLIIDFIAEYLGLPL  93

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQDMI  362
             PP   S+      N  +GVNFAV G+ AL   F ++  I+   TNVS+  QL +F+ ++
Sbjct  94   VPPFYGSQNA----NFDKGVNFAVGGATALERSFLEERGIHFAYTNVSLGVQLQSFKGLL  149

Query  363  PSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
            P+LC+SPS+C++++E++L ++GE GGND  ++   GK
Sbjct  150  PNLCDSPSECRDMIEDALILMGEVGGNDLNYAFFVGK  186



>ref|XP_009102892.1| PREDICTED: GDSL esterase/lipase At1g28570-like [Brassica rapa]
Length=395

 Score =   160 bits (406),  Expect(2) = 7e-71, Method: Compositional matrix adjust.
 Identities = 93/191 (49%), Positives = 123/191 (64%), Gaps = 1/191 (1%)
 Frame = +1

Query  460   FSREKNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVE  639
             F   K I +I+ +IP+V   I+    +LI +G RT +VP   PLGC+ +YLT Y + N+E
Sbjct  182   FFVGKPIEEIKELIPLVITTISSAITELIGMGGRTFLVPGNFPLGCSVAYLTLYQTSNME  241

Query  640   DYDDL-GCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGF  816
             +YD + GCL W+N+ A Y N+ LQ EL+ LR+ +P+ NIIY D +NA  +I+  PA  GF
Sbjct  242   EYDPVTGCLKWLNKFAEYFNEQLQAELDRLRKLYPHVNIIYADYYNALSRIFQEPAKFGF  301

Query  817   SggalraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDG  996
                 L ACCG GGQYN+ P  +CG EG   C DPS YVNWDG H+TEAAY+L+ + LL G
Sbjct  302   MNRPLPACCGLGGQYNYTPGKKCGFEGVEYCDDPSKYVNWDGVHMTEAAYRLIAEGLLKG  361

Query  997   SYTYPSMNALC  1029
              Y  P  N  C
Sbjct  362   PYVIPPFNWSC  372


 Score =   135 bits (341),  Expect(2) = 7e-71, Method: Compositional matrix adjust.
 Identities = 67/157 (43%), Positives = 105/157 (67%), Gaps = 9/157 (6%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            S++DTGN + L+       + +P  +  PYGETFF+H TGR S+GR+I+D IAE+ GL +
Sbjct  39   SIADTGNLLGLSDP-----NDLPHVAFPPYGETFFNHSTGRFSNGRLIIDFIAEYLGLPL  93

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQDMI  362
             PP   S+      N  +GVNFAV G+ AL   F ++  I+   TNVS+  QL +F++++
Sbjct  94   VPPFYGSQNA----NFDKGVNFAVGGATALERSFLEERGIHFAYTNVSLGVQLQSFKNLL  149

Query  363  PSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
            P+LC+SPS+C++++E++L ++GE GGND  ++   GK
Sbjct  150  PNLCDSPSECRDMIEDALILMGEVGGNDLNYAFFVGK  186



>ref|XP_009415143.1| PREDICTED: GDSL esterase/lipase At1g28590-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=384

 Score =   154 bits (390),  Expect(2) = 1e-70, Method: Compositional matrix adjust.
 Identities = 84/191 (44%), Positives = 117/191 (61%), Gaps = 1/191 (1%)
 Frame = +1

Query  460   FSREKNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVE  639
              S+ +++ +    +P+V   I+ G +KLIELGAR ++VP + PLGC   YLT Y S   E
Sbjct  177   LSQGRSLQETESFVPLVVDTISSGINKLIELGARALLVPGITPLGCNTVYLTTYRSDRAE  236

Query  640   DYDDLGCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGFS  819
             DYD +GC+ W+N+ + YHN  L +E+  L+  HP A IIY D + A M I+  P   G  
Sbjct  237   DYDAIGCIRWLNEFSQYHNGHLHDEVRRLQALHPEAVIIYADYYGAMMNIFSDPERFGIE  296

Query  820   ggalraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDGS  999
                  ACCGGGG YN+N    CG EG T C D STY++WDG H+TEA Y++++  LL G 
Sbjct  297   -ERFLACCGGGGPYNYNSSRPCGSEGQTVCDDTSTYLHWDGLHMTEATYRIVSVGLLQGP  355

Query  1000  YTYPSMNALCP  1032
             +  P++   CP
Sbjct  356   FAVPAIATTCP  366


 Score =   141 bits (355),  Expect(2) = 1e-70, Method: Compositional matrix adjust.
 Identities = 75/157 (48%), Positives = 101/157 (64%), Gaps = 9/157 (6%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            SL+DTGN I +      Q  G P     PYG T+FH PTGR SDGR+I+D IAE  GL +
Sbjct  34   SLADTGNLIRVPGHADCQ-AGRP-----PYGMTYFHSPTGRFSDGRLIVDYIAEAMGLPL  87

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQDMI  362
             PP L +     G  +R+GVNFAV G+ A+  EF+Q+  I    TN S+  Q+  FQ ++
Sbjct  88   LPPYLEAWR---GGRLRKGVNFAVAGATAMDNEFFQEKGITTGSTNCSLRFQIRWFQQLL  144

Query  363  PSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
            PSLC SP+DC+++L+N+LF++GE GGNDY   L  G+
Sbjct  145  PSLCASPTDCEDMLQNTLFLMGEIGGNDYNFPLSQGR  181



>ref|XP_007212730.1| hypothetical protein PRUPE_ppa019092mg [Prunus persica]
 gb|EMJ13929.1| hypothetical protein PRUPE_ppa019092mg [Prunus persica]
Length=377

 Score =   153 bits (386),  Expect(2) = 1e-70, Method: Compositional matrix adjust.
 Identities = 85/187 (45%), Positives = 122/187 (65%), Gaps = 1/187 (1%)
 Frame = +1

Query  472   KNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVEDYD-  648
             K+I  ++  +P+V   IA   ++LIELGA T++VP   P+GC  +YLT Y S +   YD 
Sbjct  187   KSIEKVQAYVPLVIETIASTINELIELGAATLLVPGNFPIGCLPAYLTKYESSDKNQYDP  246

Query  649   DLGCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGFSgga  828
               GCL W+N+ + YHN  LQ  L+ +R  HP   IIY D +NA +Q+Y  P   GF G  
Sbjct  247   STGCLNWLNKFSGYHNDQLQIALSRIRRLHPQVTIIYADYYNAMLQLYQSPDQFGFIGET  306

Query  829   lraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDGSYTY  1008
              +ACCGGGG YN+N    CGD GA++C +P+ +++WDG H TEAA++ +TK++L G+YT 
Sbjct  307   SKACCGGGGPYNYNASALCGDAGASACENPAQFISWDGLHSTEAAHRWITKAILQGNYTV  366

Query  1009  PSMNALC  1029
             P ++ LC
Sbjct  367   PRVSTLC  373


 Score =   142 bits (359),  Expect(2) = 1e-70, Method: Compositional matrix adjust.
 Identities = 68/130 (52%), Positives = 90/130 (69%), Gaps = 1/130 (1%)
 Frame = +3

Query  87   PYGETFFHHPTGRCSDGRVILDIIAEHYGLAIPPPSLSSKAQTGG-NNIRQGVNFAVVGS  263
            PYGET+FHHPTGRCSDGR+++D IAE  GL + PP L S++      N   GVNFAV G+
Sbjct  58   PYGETYFHHPTGRCSDGRLVIDFIAEFLGLPLVPPYLESQSSNQSVQNFEAGVNFAVAGA  117

Query  264  RALPAEFYQKLEIYDTVTNVSMNDQLHAFQDMIPSLCNSPSDCKNLLENSLFVLGEFGGN  443
             AL A F +++    + TN S++ QL  F+ M+PSLCN+ SDC  +L  SL ++GE GGN
Sbjct  118  TALDAAFLEEMGDSVSCTNDSLSIQLEWFKQMLPSLCNTSSDCNKVLSTSLILMGEIGGN  177

Query  444  DYTHSLLSGK  473
            DY  +LL+GK
Sbjct  178  DYNDALLAGK  187



>ref|XP_006415636.1| hypothetical protein EUTSA_v10006895mg [Eutrema salsugineum]
 gb|ESQ33989.1| hypothetical protein EUTSA_v10006895mg [Eutrema salsugineum]
Length=753

 Score =   152 bits (383),  Expect(2) = 2e-70, Method: Compositional matrix adjust.
 Identities = 86/191 (45%), Positives = 120/191 (63%), Gaps = 1/191 (1%)
 Frame = +1

Query  460   FSREKNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVE  639
             F   K I +I+ ++P V  +I+    +LI +G RT +VP   PLGC+ +YLT Y + N+E
Sbjct  548   FFLGKPIQEIKELVPFVISSISSAIKELINMGGRTFLVPGDFPLGCSVAYLTIYQTSNME  607

Query  640   DYD-DLGCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGF  816
             +YD   GCL W+N+   Y+N+ LQ ELN L++ +P+ NIIY D +NA  +++  PA  GF
Sbjct  608   EYDPKTGCLKWLNKFGEYYNKQLQAELNKLQKLYPHVNIIYADYYNAVSRLFQEPAKFGF  667

Query  817   SggalraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDG  996
                 L ACCG GG YNF    +CG +G   C DP+ YVNWDG HLTE+AY+L+ + LL G
Sbjct  668   MNRPLPACCGLGGSYNFTFGRKCGFQGVECCNDPTKYVNWDGVHLTESAYRLIAEGLLKG  727

Query  997   SYTYPSMNALC  1029
              Y  P  +  C
Sbjct  728   PYAIPPFDWSC  738


 Score =   143 bits (360),  Expect(2) = 2e-70, Method: Compositional matrix adjust.
 Identities = 72/157 (46%), Positives = 102/157 (65%), Gaps = 9/157 (6%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            S++DTGN + L+    L +   P     PYGETFFHHPTGR S+GR+++D IAE  GL +
Sbjct  405  SIADTGNLVGLSDPNDLPHVAFP-----PYGETFFHHPTGRFSNGRLVIDFIAEFLGLPL  459

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQDMI  362
             PP   S+      N  +GVNFAV G+ AL   F ++  I+   TNVS+  QL +F+D +
Sbjct  460  VPPFYGSQNA----NFEKGVNFAVGGATALERSFLEERGIHFAYTNVSLGVQLRSFKDSL  515

Query  363  PSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
            P+LC S SDC++++EN+L ++GE GGNDY ++   GK
Sbjct  516  PNLCGSSSDCRDMMENALILMGEIGGNDYNYAFFLGK  552


 Score =   157 bits (398),  Expect(2) = 1e-68, Method: Compositional matrix adjust.
 Identities = 87/191 (46%), Positives = 122/191 (64%), Gaps = 1/191 (1%)
 Frame = +1

Query  460   FSREKNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVE  639
             F   K I +I+ ++P+V + I+    +L+++G +T +VP   PLGC+  YLT Y +PN E
Sbjct  189   FFGRKTIEEIKELVPLVINTISSAITELVDMGGKTFLVPGNFPLGCSVIYLTLYQTPNKE  248

Query  640   DYDDL-GCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGF  816
             DYD L GCL W+N+ + YHN+ LQ ELN LR+ +P+ NIIY D +NA +++   PA  G 
Sbjct  249   DYDPLTGCLTWLNEFSEYHNEKLQTELNRLRKLYPHVNIIYGDYYNALLRLIQEPAKFGL  308

Query  817   SggalraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDG  996
                 L  CCG GG YNF   ++CG +G   C DPS YVNWDG H+TE AY+L+ + LL G
Sbjct  309   MSRPLPVCCGSGGTYNFTFGVKCGSKGVGYCDDPSKYVNWDGVHMTETAYRLIAEGLLKG  368

Query  997   SYTYPSMNALC  1029
              Y+ P  +  C
Sbjct  369   PYSIPPFDWSC  379


 Score =   131 bits (329),  Expect(2) = 1e-68, Method: Compositional matrix adjust.
 Identities = 68/157 (43%), Positives = 96/157 (61%), Gaps = 9/157 (6%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            S++DTGN I L+S   L     P     PYGETFFHHPTGR SDGR+++D IAE  G   
Sbjct  46   SIADTGNLIGLSSPNQLPESAFP-----PYGETFFHHPTGRFSDGRLVIDFIAEFLGFPH  100

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQDMI  362
             PP   SK      N  +GVNFAV  + AL + F ++  I+    N+S+  Q+ +F++ +
Sbjct  101  VPPFYGSK----NGNFEKGVNFAVGAATALESSFLEERGIHCPYGNISLGVQIQSFKESL  156

Query  363  PSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
             +LC SPSDC++++ N+L ++GE GGNDY +     K
Sbjct  157  LNLCGSPSDCRDMIGNALILMGEIGGNDYNYPFFGRK  193



>ref|NP_973932.1| GDSL esterase/lipase [Arabidopsis thaliana]
 sp|Q9SHP6.2|GDL10_ARATH RecName: Full=GDSL esterase/lipase At1g28610; AltName: Full=Extracellular 
lipase At1g28610; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAG22835.1|AC007508_11 F1K23.16 [Arabidopsis thaliana]
 gb|AEE31002.1| GDSL esterase/lipase [Arabidopsis thaliana]
Length=383

 Score =   157 bits (396),  Expect(2) = 3e-70, Method: Compositional matrix adjust.
 Identities = 88/184 (48%), Positives = 120/184 (65%), Gaps = 1/184 (1%)
 Frame = +1

Query  481   TDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVEDYDDL-G  657
             ++++ ++P+V   I+    +L+++G RT +VP   PLGC+A+YLT Y + N E+YD L G
Sbjct  187   SEVKELVPLVITKISSAIVELVDMGGRTFLVPGNFPLGCSATYLTLYQTSNKEEYDPLTG  246

Query  658   CLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGFSggalra  837
             CL W+N  + Y+N+ LQ ELN L + +P+ NIIY D FNA +++Y  P+  GF    L A
Sbjct  247   CLTWLNDFSEYYNEKLQAELNRLSKLYPHVNIIYGDYFNALLRLYQEPSKFGFMDRPLPA  306

Query  838   ccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDGSYTYPSM  1017
             CCG GG YNF    +CG  G   C DPS YVNWDG H+TEAAYK +   LL G YT PS 
Sbjct  307   CCGLGGPYNFTLSKKCGSVGVKYCSDPSKYVNWDGVHMTEAAYKWIADGLLKGPYTIPSF  366

Query  1018  NALC  1029
             + LC
Sbjct  367   HWLC  370


 Score =   137 bits (344),  Expect(2) = 3e-70, Method: Compositional matrix adjust.
 Identities = 67/157 (43%), Positives = 97/157 (62%), Gaps = 9/157 (6%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            S++DTGN + L+       + +P  + LPYGETFFHHPTGR  +GR+I+D IAE  GL  
Sbjct  38   SITDTGNLVGLSDR-----NHLPVTAFLPYGETFFHHPTGRSCNGRIIIDFIAEFLGLPH  92

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQDMI  362
             PP   SK      N  +GVNFAV G+ AL     +K  IY   +N+S+  QL  F++ +
Sbjct  93   VPPFYGSK----NGNFEKGVNFAVAGATALETSILEKRGIYYPHSNISLGIQLKTFKESL  148

Query  363  PSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
            P+LC SP+DC++++ N+  ++GE GGND+  +    K
Sbjct  149  PNLCGSPTDCRDMIGNAFIIMGEIGGNDFNFAFFVNK  185



>ref|XP_009352954.1| PREDICTED: uncharacterized protein LOC103944252 [Pyrus x bretschneideri]
Length=1005

 Score =   150 bits (379),  Expect(2) = 3e-70, Method: Compositional matrix adjust.
 Identities = 77/157 (49%), Positives = 103/157 (66%), Gaps = 7/157 (4%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            S+SDTGN  + + +    +         PYGET+FHHPTGRCSDGR+++D IAE  GL +
Sbjct  491  SVSDTGNLYNSSPNKSFNF------FFPPYGETYFHHPTGRCSDGRLVIDFIAESMGLPL  544

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQDMI  362
              P L S  QT  +NI  GVNFAVVG+ AL   F +++ +Y+ +TN S+  QL  FQ+M+
Sbjct  545  VQPYLESHNQTA-DNIEGGVNFAVVGAAALDTAFLEEMAVYNEITNDSLRIQLDWFQEML  603

Query  363  PSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
              LCN+ SDC  LL  SL ++GE GGNDY ++L SGK
Sbjct  604  SLLCNTSSDCNKLLSGSLVLMGEIGGNDYYNALFSGK  640


 Score =   144 bits (362),  Expect(2) = 3e-70, Method: Compositional matrix adjust.
 Identities = 82/197 (42%), Positives = 124/197 (63%), Gaps = 2/197 (1%)
 Frame = +1

Query  472   KNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVEDYD-  648
             K+   +   +P V  AIA   ++LI LGA T++VP V P GC  ++LT Y + + ++YD 
Sbjct  640   KSTEQVEKYVPFVIEAIASAINELIALGASTLLVPGVFPFGCVPAFLTRYQTSDEDEYDP  699

Query  649   DLGCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGFSgga  828
               GCL W+N+   YHN+LLQ EL  ++  HP+ NIIY D +NA ++++  P   GF+G  
Sbjct  700   STGCLNWLNKFTEYHNELLQIELRRIQSLHPHVNIIYADYYNAMLELHQSPDQFGFTGET  759

Query  829   lraccggggQYNFNPDLQCGD-EGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDGSYT  1005
              +ACCGGGG YN+N    CG  E    C +P+ +++WDG H TEAAY+ + K LL+ +YT
Sbjct  760   TKACCGGGGPYNYNSSALCGTPEANVLCENPAQFISWDGLHSTEAAYRWIAKGLLNRNYT  819

Query  1006  YPSMNALCPTDAQVAQL  1056
              P ++ALC +    +++
Sbjct  820   VPQISALCVSQLMYSEI  836


 Score =   147 bits (371),  Expect(2) = 1e-67, Method: Compositional matrix adjust.
 Identities = 77/157 (49%), Positives = 104/157 (66%), Gaps = 7/157 (4%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            S++DTGN  + + +  L +         PYGET+FH P GRCSDGR+I+D IAE+ GL +
Sbjct  31   SIADTGNLYNSSPNKSLDF------FFPPYGETYFHRPVGRCSDGRLIIDFIAEYMGLPL  84

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQDMI  362
              P L S  QT  +NI  GVNFAVVGS AL   F +++ +Y+ +TN S+  QL  FQ+M+
Sbjct  85   VQPYLESHNQTV-HNIEGGVNFAVVGSTALDTAFLEEMGVYNDITNNSLRIQLDWFQEML  143

Query  363  PSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
              LCN+ SDC  LL +SL ++GE GGNDY ++LL GK
Sbjct  144  SFLCNTSSDCNKLLSSSLVLMGEIGGNDYNNALLGGK  180


 Score =   138 bits (348),  Expect(2) = 1e-67, Method: Compositional matrix adjust.
 Identities = 85/184 (46%), Positives = 118/184 (64%), Gaps = 7/184 (4%)
 Frame = +1

Query  472   KNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVEDYDD  651
             K+I  +   +P+V  AIA   ++LI  GA T++VP   P+GC  +YLT     N  +YD 
Sbjct  180   KSIEKVEKYVPLVIEAIASTINELIAFGASTLVVPGNFPIGCIPAYLT-----NESEYDP  234

Query  652   L-GCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGFSgga  828
             L GCL W+N+ + YHN+LLQ EL+ +R  HPY NIIY D +NA +Q+Y  P   GF+G  
Sbjct  235   LTGCLNWLNKFSEYHNELLQRELSRIRILHPYVNIIYADYYNAMLQLYQSPDQFGFTGET  294

Query  829   lraccggggQYNFNPDLQCGD-EGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDGSYT  1005
              +ACCGGGG YN+N    CG  E    C +P+ +++WDG H TEAAY+ + K LL+G+YT
Sbjct  295   TKACCGGGGPYNYNSSALCGSPEANVLCENPAQFISWDGVHSTEAAYRWIAKGLLNGNYT  354

Query  1006  YPSM  1017
              P +
Sbjct  355   VPQI  358


 Score = 67.4 bits (163),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/46 (61%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = +1

Query  859  YNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDG  996
            YNFN   +CG  G+T+C DPS+YVNWDG HLTEAAY+ + K L+ G
Sbjct  375  YNFNNSARCGHIGSTACKDPSSYVNWDGIHLTEAAYRYIAKGLIHG  420



>ref|XP_010501635.1| PREDICTED: uncharacterized protein LOC104778925 [Camelina sativa]
Length=815

 Score =   156 bits (395),  Expect(2) = 6e-70, Method: Compositional matrix adjust.
 Identities = 87/189 (46%), Positives = 119/189 (63%), Gaps = 1/189 (1%)
 Frame = +1

Query  466   REKNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVEDY  645
             + K I +++ ++P+V   I+    +L+ +G RT +VP   PLGC+A+YLT Y + N E Y
Sbjct  188   QRKAIEEVKELVPLVIATISSAITELVRMGGRTFLVPGNFPLGCSAAYLTLYQTSNKEKY  247

Query  646   DDL-GCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGFSg  822
             D L GCL W+N    YH++ LQ ELN L+  +P  NIIY D +NA +++Y  P   GF  
Sbjct  248   DPLTGCLTWLNDFGKYHSEQLQTELNRLKNLNPNVNIIYADYYNALLRLYQEPTKFGFIK  307

Query  823   galraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDGSY  1002
               L ACCG GG YNFN   +CG  G  SC DPS +VNWDG H+TEAAY+ +++ LL+G Y
Sbjct  308   RPLPACCGLGGLYNFNFTRKCGSLGVESCIDPSEFVNWDGIHMTEAAYRWISEGLLNGPY  367

Query  1003  TYPSMNALC  1029
               P  N  C
Sbjct  368   AIPPFNWSC  376


 Score =   137 bits (344),  Expect(2) = 6e-70, Method: Compositional matrix adjust.
 Identities = 68/157 (43%), Positives = 100/157 (64%), Gaps = 9/157 (6%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            S++DTGN +SL          +P  +  PYG++F +HPTGR SDGR+I+D IAE  GL +
Sbjct  43   SIADTGNLLSLADP-----SDLPGSAFPPYGKSFLNHPTGRFSDGRLIIDFIAEFLGLPL  97

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQDMI  362
             PP   S+  +      +GVNFAV G+ AL   F ++  I+ + TN S+  QL +F++ +
Sbjct  98   VPPFYRSQHAS----FEKGVNFAVAGATALEPSFLERRGIHSSTTNFSLGVQLRSFKESL  153

Query  363  PSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
            P LC SPSDC++++EN+L ++GE GGNDY  +L   K
Sbjct  154  PCLCASPSDCRDMIENALILMGEIGGNDYNFALFQRK  190


 Score =   147 bits (371),  Expect(2) = 2e-68, Method: Compositional matrix adjust.
 Identities = 84/191 (44%), Positives = 114/191 (60%), Gaps = 1/191 (1%)
 Frame = +1

Query  460   FSREKNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVE  639
             F   K+  + + ++P+V   I+    +LI +G RT +VP   P GC+  YLT Y   NVE
Sbjct  596   FFVNKSTEETKELVPLVIRTISSAITELISMGGRTFLVPGGFPTGCSVVYLTLYQKSNVE  655

Query  640   DYDDL-GCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGF  816
             +YD L GCL W+N+    H + L+ ELN L++ +P+ NIIY D +NA ++IY  PA  GF
Sbjct  656   EYDPLTGCLTWLNKFGKNHGEQLRVELNRLQKLYPHVNIIYADYYNALLRIYQDPAKFGF  715

Query  817   SggalraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDG  996
                 L ACCG GG +NF    +CG     SC DPS YV WDG HLTEAAY+L+ + +L G
Sbjct  716   MDRPLSACCGVGGPHNFTAGNKCGTVVVESCDDPSKYVAWDGVHLTEAAYRLIAEGILKG  775

Query  997   SYTYPSMNALC  1029
              Y  P  +  C
Sbjct  776   PYAVPPFDWFC  786


 Score =   140 bits (353),  Expect(2) = 2e-68, Method: Compositional matrix adjust.
 Identities = 70/157 (45%), Positives = 101/157 (64%), Gaps = 9/157 (6%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            S++DTGN + L+    L +   P     PYGETFFHHPTGR S+GR+I+D +AE  GL +
Sbjct  453  SIADTGNLLGLSDPNELPHVAFP-----PYGETFFHHPTGRFSNGRLIIDFLAEFLGLPL  507

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQDMI  362
             PP   S+      N  +GVNFAV G+ AL   F ++  I+   TNVS+  QL +F++ +
Sbjct  508  VPPFYGSQHA----NFEKGVNFAVGGATALERSFLEERGIHFPYTNVSLGVQLSSFKESL  563

Query  363  PSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
            P LC +PSDC++++EN+L ++GE GGNDY ++    K
Sbjct  564  PKLCGAPSDCRDMIENALILMGEIGGNDYNYAFFVNK  600



>gb|AAF24548.2|AC007508_11 F1K23.17 [Arabidopsis thaliana]
Length=823

 Score =   148 bits (374),  Expect(2) = 6e-70, Method: Compositional matrix adjust.
 Identities = 72/157 (46%), Positives = 105/157 (67%), Gaps = 9/157 (6%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            S++DTGN + L+       + +P+ +  PYGETFFHHPTGR SDGR+I+D IAE  G  +
Sbjct  463  SIADTGNLLGLSDP-----NDLPASAFPPYGETFFHHPTGRYSDGRLIIDFIAEFLGFPL  517

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQDMI  362
             PP    +      N ++GVNFAV G+ AL   F ++  I+ T+TNVS++ QL +F + +
Sbjct  518  VPPFYGCQ----NANFKKGVNFAVAGATALEPSFLEERGIHSTITNVSLSVQLRSFTESL  573

Query  363  PSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
            P+LC SPSDC++++EN+L ++GE GGNDY  +L   K
Sbjct  574  PNLCGSPSDCRDMIENALILMGEIGGNDYNFALFQRK  610


 Score =   145 bits (365),  Expect(2) = 6e-70, Method: Compositional matrix adjust.
 Identities = 86/189 (46%), Positives = 120/189 (63%), Gaps = 1/189 (1%)
 Frame = +1

Query  466   REKNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVEDY  645
             + K + ++  ++P V   I+    +L+ +G RT +VP   P+G +ASYLT Y + N E+Y
Sbjct  608   QRKPVKEVEELVPFVIATISSAITELVCMGGRTFLVPGNFPIGYSASYLTLYKTSNKEEY  667

Query  646   DDL-GCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGFSg  822
             D L GCL W+N  + Y+N+ LQEELN LR+ +P+ NIIY D +NA ++++  PA  GF  
Sbjct  668   DPLTGCLKWLNDFSEYYNKQLQEELNGLRKLYPHVNIIYADYYNALLRLFQEPAKFGFMN  727

Query  823   galraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDGSY  1002
               L ACCG GG YNFN   +CG  G   C DPS YVN+DG H+TEAAY+L+++ LL G Y
Sbjct  728   RPLPACCGVGGSYNFNFSRRCGSVGVEYCDDPSQYVNYDGIHMTEAAYRLISEGLLKGPY  787

Query  1003  TYPSMNALC  1029
               P     C
Sbjct  788   AIPPFKWSC  796


 Score =   148 bits (373),  Expect(2) = 7e-68, Method: Compositional matrix adjust.
 Identities = 81/191 (42%), Positives = 116/191 (61%), Gaps = 1/191 (1%)
 Frame = +1

Query  460   FSREKNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVE  639
             F   K + ++  ++P V  +I+    +LI +G +T +VP   P+GC+  YLT Y + N +
Sbjct  180   FFNRKPVKEVEELVPFVIASISSTITELIGMGGKTFLVPGEFPIGCSVVYLTLYKTSNKD  239

Query  640   DYD-DLGCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGF  816
             +YD   GCL W+N+   YH++ L+ ELN LR+ +P+ NIIY D +N+ ++I+  PA  GF
Sbjct  240   EYDPSTGCLKWLNKFGEYHSEKLKVELNRLRKLYPHVNIIYADYYNSLLRIFKEPAKFGF  299

Query  817   SggalraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDG  996
                   ACCG GG YNFN   +CG  G  SC DPS YV WDG H+TEAAYK +   +L+G
Sbjct  300   MERPFPACCGIGGPYNFNFTRKCGSVGVKSCKDPSKYVGWDGVHMTEAAYKWIADGILNG  359

Query  997   SYTYPSMNALC  1029
              Y  P  +  C
Sbjct  360   PYANPPFDRSC  370


 Score =   138 bits (347),  Expect(2) = 7e-68, Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 97/157 (62%), Gaps = 10/157 (6%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            S++DTGN + L+    L     P     PYGETFFHHPTGR  DGR+I+D IAE  GL  
Sbjct  38   SIADTGNLVGLSDRNQLPVTAFP-----PYGETFFHHPTGRSCDGRIIMDFIAEFVGLPY  92

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQDMI  362
             PP   SK +    N  +GVNFAV G+ AL + F +K  I    TNVS+  QL +F+  +
Sbjct  93   VPPYFGSKNR----NFDKGVNFAVAGATALKSSFLKKRGI-QPHTNVSLGVQLKSFKKSL  147

Query  363  PSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
            P+LC SPSDC++++ N+L ++GE GGNDY     + K
Sbjct  148  PNLCGSPSDCRDMIGNALILMGEIGGNDYNFPFFNRK  184



>emb|CDO96754.1| unnamed protein product [Coffea canephora]
Length=398

 Score =   164 bits (416),  Expect(2) = 7e-70, Method: Compositional matrix adjust.
 Identities = 94/189 (50%), Positives = 131/189 (69%), Gaps = 1/189 (1%)
 Frame = +1

Query  466   REKNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVEDY  645
             + +NI +++  +P+V   I+    +LIELGA T++VP   P+GC+ASYLTYY S   +DY
Sbjct  196   QGRNIEEVQSFVPLVVQTISSAIQELIELGAVTLVVPGNFPIGCSASYLTYYQSSKKQDY  255

Query  646   D-DLGCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGFSg  822
             D D GC+ W+N  A YHNQ+LQ E+N +RE +P+A IIY D +NAAM++Y  P   GF G
Sbjct  256   DTDTGCIKWLNNFAKYHNQVLQSEINRIRELNPHATIIYADYYNAAMRLYRFPNKYGFKG  315

Query  823   galraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDGSY  1002
               L+ACCG GG YN+N  + CG + A SC DP  YV+WDG HLTEAAY+ + + LL+G +
Sbjct  316   EVLKACCGAGGPYNYNSTVPCGYQPAASCDDPPLYVSWDGLHLTEAAYRWIARGLLEGPF  375

Query  1003  TYPSMNALC  1029
             + P +N +C
Sbjct  376   STPPINTVC  384


 Score =   128 bits (322),  Expect(2) = 7e-70, Method: Compositional matrix adjust.
 Identities = 72/157 (46%), Positives = 100/157 (64%), Gaps = 2/157 (1%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            SL+DTGN   L  D        P   + PYGET+FHHPTGRCSDGR+++D IAE  GL +
Sbjct  44   SLADTGNLFHL--DSPSSSSDAPHFFLPPYGETYFHHPTGRCSDGRLVVDFIAESLGLPL  101

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQDMI  362
             PP L+ K  +G  +  +GVNFAVVG+ AL   F+++  I +  TN S+  +L  F D+ 
Sbjct  102  LPPYLARKDTSGSLDFLEGVNFAVVGATALDGSFFRERGIDNPATNASLATELGWFIDIF  161

Query  363  PSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
              +C+   DCK+ L++SL ++GE GGNDY + LL G+
Sbjct  162  FYICHVIPDCKDFLQSSLVLMGEIGGNDYNYPLLQGR  198



>ref|XP_007020866.1| GDSL-like Lipase/Acylhydrolase superfamily protein, putative 
[Theobroma cacao]
 gb|EOY12391.1| GDSL-like Lipase/Acylhydrolase superfamily protein, putative 
[Theobroma cacao]
Length=789

 Score =   159 bits (401),  Expect(2) = 7e-70, Method: Compositional matrix adjust.
 Identities = 92/192 (48%), Positives = 129/192 (67%), Gaps = 3/192 (2%)
 Frame = +1

Query  460   FSREKNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVE  639
             F   KN  +IR  +P+V H I+   ++LIELGA T +VP  LP+GC+ +YLTY+   +  
Sbjct  220   FEEGKNPEEIREFVPLVVHTISSAINELIELGAVTFLVPGNLPIGCSPAYLTYFQGSDKG  279

Query  640   DYDDL-GCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGF  816
             +YD L GCL W+NQ + YHN+LLQ+EL+ +RE HP+ NIIY D +N AM+ Y  P   GF
Sbjct  280   EYDPLTGCLTWLNQFSEYHNELLQQELDQIRELHPHVNIIYADYYNIAMRFYHFPDQFGF  339

Query  817   SggalraccggggQYNFNPDLQCGDEG-ATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLD  993
             +   + ACCG G  YN++  + CGD    TSC DPS+YV+WDG H TEA Y+ ++K++L 
Sbjct  340   T-KTIVACCGKGVPYNYSSSMACGDPPLRTSCDDPSSYVSWDGVHFTEATYRWISKAVLK  398

Query  994   GSYTYPSMNALC  1029
               +T P +N+LC
Sbjct  399   ELFTIPYINSLC  410


 Score =   134 bits (337),  Expect(2) = 7e-70, Method: Compositional matrix adjust.
 Identities = 67/130 (52%), Positives = 88/130 (68%), Gaps = 3/130 (2%)
 Frame = +3

Query  87   PYGETFFHHPTGRCSDGRVILDIIAEHYGLAIPPPSLSSKAQTGG-NNIRQGVNFAVVGS  263
            PYG TFFH PTGRCSDGR+++D +AE  GL   PP      Q G   N ++GVNFAVVG+
Sbjct  97   PYGRTFFHSPTGRCSDGRLVIDFVAEGLGLPFLPPYFG--VQNGRPKNFQKGVNFAVVGA  154

Query  264  RALPAEFYQKLEIYDTVTNVSMNDQLHAFQDMIPSLCNSPSDCKNLLENSLFVLGEFGGN  443
             AL   F+++  I +  TNVS+  +L  F++++PSLC+S SDCK LL  SL V+GE GGN
Sbjct  155  TALDDAFFKERGIKNPFTNVSLGVELGLFKEVLPSLCSSSSDCKELLRESLIVMGEIGGN  214

Query  444  DYTHSLLSGK  473
            DY ++   GK
Sbjct  215  DYNYAFEEGK  224


 Score =   147 bits (370),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 95/193 (49%), Positives = 125/193 (65%), Gaps = 4/193 (2%)
 Frame = +1

Query  460   FSREKNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVE  639
             F   K+  + R ++P+V   IA   H+LIELGA T +VP  LP+GC  SYLT Y   + E
Sbjct  584   FEEGKSNEETRELVPLVIDTIASAIHELIELGAVTFLVPGNLPIGCLPSYLTNYQGSDEE  643

Query  640   DYDDL-GCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGF  816
             +YD L GCL W+NQ + YHNQLLQEEL  ++E HP+ NI Y D ++AA++ Y  P   GF
Sbjct  644   EYDPLTGCLTWLNQFSEYHNQLLQEELARIQEIHPHVNIFYADYYSAAIRFYLSPKQFGF  703

Query  817   Sggalrac-cggggQYNFNPDLQCGDEGATS-CPDPSTYVNWDGYHLTEAAYKLMTKSLL  990
                  R   CGGGG YNFN    CG    TS C DPS+YV+WDG H TEAA +L+++++L
Sbjct  704   RKETQRKACCGGGGPYNFNLSAVCGYPLVTSCCDDPSSYVSWDGIHYTEAANRLLSRAIL  763

Query  991   DGSYT-YPSMNAL  1026
             DG +T +P  N+L
Sbjct  764   DGLHTNFPISNSL  776


 Score =   121 bits (304),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 70/146 (48%), Positives = 95/146 (65%), Gaps = 2/146 (1%)
 Frame = +3

Query  39   SDGVL-QYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAIPPPSLSSKAQT  215
            + GVL +   +P  +  PYG TFFHHPTGRCSDGR+++D IAE +GL   PP    +   
Sbjct  444  TRGVLFESSKLPQSAFPPYGRTFFHHPTGRCSDGRLVIDFIAEDFGLPFLPPYFGGE-NG  502

Query  216  GGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQDMIPSLCNSPSDCK  395
              NN ++GVNFAV G+ AL  E  ++  I +  TNV++  +L  F+D++ SLC+S SDC+
Sbjct  503  RPNNFQKGVNFAVEGATALDDEILKERGITNPNTNVTLGVELGFFRDVLSSLCSSSSDCR  562

Query  396  NLLENSLFVLGEFGGNDYTHSLLSGK  473
             LL NSL V+GE GGNDY  +   GK
Sbjct  563  KLLINSLIVMGEIGGNDYNFAFEEGK  588



>ref|NP_174181.1| GDSL esterase/lipase [Arabidopsis thaliana]
 sp|Q8RXT9.2|GDL8_ARATH RecName: Full=GDSL esterase/lipase At1g28590; AltName: Full=Extracellular 
lipase At1g28590; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AEE30998.1| GDSL esterase/lipase [Arabidopsis thaliana]
Length=403

 Score =   148 bits (374),  Expect(2) = 7e-70, Method: Compositional matrix adjust.
 Identities = 72/157 (46%), Positives = 105/157 (67%), Gaps = 9/157 (6%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            S++DTGN + L+       + +P+ +  PYGETFFHHPTGR SDGR+I+D IAE  G  +
Sbjct  43   SIADTGNLLGLSDP-----NDLPASAFPPYGETFFHHPTGRYSDGRLIIDFIAEFLGFPL  97

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQDMI  362
             PP    +      N ++GVNFAV G+ AL   F ++  I+ T+TNVS++ QL +F + +
Sbjct  98   VPPFYGCQ----NANFKKGVNFAVAGATALEPSFLEERGIHSTITNVSLSVQLRSFTESL  153

Query  363  PSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
            P+LC SPSDC++++EN+L ++GE GGNDY  +L   K
Sbjct  154  PNLCGSPSDCRDMIENALILMGEIGGNDYNFALFQRK  190


 Score =   144 bits (364),  Expect(2) = 7e-70, Method: Compositional matrix adjust.
 Identities = 86/189 (46%), Positives = 120/189 (63%), Gaps = 1/189 (1%)
 Frame = +1

Query  466   REKNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVEDY  645
             + K + ++  ++P V   I+    +L+ +G RT +VP   P+G +ASYLT Y + N E+Y
Sbjct  188   QRKPVKEVEELVPFVIATISSAITELVCMGGRTFLVPGNFPIGYSASYLTLYKTSNKEEY  247

Query  646   DDL-GCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGFSg  822
             D L GCL W+N  + Y+N+ LQEELN LR+ +P+ NIIY D +NA ++++  PA  GF  
Sbjct  248   DPLTGCLKWLNDFSEYYNKQLQEELNGLRKLYPHVNIIYADYYNALLRLFQEPAKFGFMN  307

Query  823   galraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDGSY  1002
               L ACCG GG YNFN   +CG  G   C DPS YVN+DG H+TEAAY+L+++ LL G Y
Sbjct  308   RPLPACCGVGGSYNFNFSRRCGSVGVEYCDDPSQYVNYDGIHMTEAAYRLISEGLLKGPY  367

Query  1003  TYPSMNALC  1029
               P     C
Sbjct  368   AIPPFKWSC  376



>gb|KFK44742.1| hypothetical protein AALP_AA1G297000 [Arabis alpina]
Length=1372

 Score =   154 bits (388),  Expect(2) = 8e-70, Method: Compositional matrix adjust.
 Identities = 86/191 (45%), Positives = 119/191 (62%), Gaps = 1/191 (1%)
 Frame = +1

Query  460   FSREKNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVE  639
             F   K+I +I+ ++P+V   I+    +LI +G RT +VP   P+GC+ +YLT Y + N +
Sbjct  183   FFVRKSIEEIKELVPLVITTISSAITELIGMGGRTFLVPGNFPIGCSVAYLTLYQTSNKK  242

Query  640   DYDDL-GCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGF  816
             +YD L GCL W+N+   YH + LQ ELN L++ +P+ NIIY D +N  ++I+  PA  GF
Sbjct  243   EYDPLTGCLAWLNEFGEYHGEQLQVELNRLQKLYPHVNIIYADYYNPMLRIFQEPAKFGF  302

Query  817   SggalraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDG  996
                 L ACCG GG YN+   +QCG E    C DPS YVNWDG HLTEAAY+ +   LL+G
Sbjct  303   ISRPLPACCGVGGLYNYTVGMQCGTEVVECCNDPSKYVNWDGVHLTEAAYRWLADGLLNG  362

Query  997   SYTYPSMNALC  1029
              Y  P  +  C
Sbjct  363   PYAIPPFDWSC  373


 Score =   139 bits (350),  Expect(2) = 8e-70, Method: Compositional matrix adjust.
 Identities = 68/157 (43%), Positives = 101/157 (64%), Gaps = 9/157 (6%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            S++DTGN + L+       + +P  +  PYGETFFHHPTGR S+GR+++D +AE  GL +
Sbjct  40   SIADTGNLVGLSDP-----NDLPHVAFPPYGETFFHHPTGRFSNGRLVIDFMAEFLGLPL  94

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQDMI  362
             PP   S       N  +GVNFAV G+ AL   F ++  I+   TNVS+  QL +F++ +
Sbjct  95   VPPFYGSH----NANFEKGVNFAVGGATALEQSFLEEKGIHFPYTNVSLGVQLKSFKESL  150

Query  363  PSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
            P +C SPSDC++++EN+L ++GE GGNDY ++    K
Sbjct  151  PKICGSPSDCRDMIENALILMGEIGGNDYNYAFFVRK  187


 Score =   124 bits (310),  Expect(2) = 7e-31, Method: Compositional matrix adjust.
 Identities = 60/136 (44%), Positives = 87/136 (64%), Gaps = 4/136 (3%)
 Frame = +3

Query  66   IPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAIPPPSLSSKAQTGGNNIRQGVN  245
            +P  +  PYGETFFH+PTGR S+GR+I+D IAE  GL   PP   S+      +  +GVN
Sbjct  385  LPPAAFPPYGETFFHNPTGRFSNGRLIIDFIAEFLGLPYVPPCFGSQ----NGSFEKGVN  440

Query  246  FAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQDMIPSLCNSPSDCKNLLENSLFVL  425
            FAV G+ AL   F +   I+   TNVS+  QL +F++ + +LC SP+DC+ ++ N+L ++
Sbjct  441  FAVAGATALEQAFLESKGIHYAYTNVSLGVQLKSFKESLLNLCGSPADCREMIGNALIIV  500

Query  426  GEFGGNDYTHSLLSGK  473
            G  GGNDY ++   GK
Sbjct  501  GGIGGNDYNYASFVGK  516


 Score = 38.9 bits (89),  Expect(2) = 7e-31, Method: Compositional matrix adjust.
 Identities = 15/41 (37%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +1

Query  472  KNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLG  594
            K+I + + ++P+V   I+    +LI +G RT++VPS  P+G
Sbjct  516  KSIEETKELVPLVISTISSTITELISMGGRTILVPSDFPIG  556


 Score = 66.6 bits (161),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 37/57 (65%), Gaps = 0/57 (0%)
 Frame = +1

Query  859   YNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDGSYTYPSMNALC  1029
             YN+N   QCG +G   C DPS YV+WDG HLTE+ Y+ +   LL+G YT P+ +  C
Sbjct  1297  YNYNSVRQCGTKGVDCCLDPSKYVHWDGSHLTESTYRWIAMGLLEGPYTIPAFDWSC  1353



>emb|CDO96752.1| unnamed protein product [Coffea canephora]
Length=385

 Score =   148 bits (374),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 90/192 (47%), Positives = 125/192 (65%), Gaps = 4/192 (2%)
 Frame = +1

Query  466   REKNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVE--  639
             + ++I +++  +P V  AI+     +I LGA   +VP  LPLGC A+YLTY+ + N +  
Sbjct  181   QGRSIEEVKTFVPAVVGAISSAITDMIRLGAANFIVPGNLPLGCLAAYLTYFQNSNRDYD  240

Query  640   -DYDDL-GCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLG  813
              DYD+  GC+ W+N  A +HN++LQ ELN +RE HP+  IIY D +N+A++ Y  P   G
Sbjct  241   YDYDEAPGCINWLNDFAKHHNEVLQIELNRIRELHPHVTIIYADYYNSAIRFYRWPKEFG  300

Query  814   FSggalraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLD  993
             F+GG L ACCG GG YNF+  + CGD   T C DPS YV WDG HLTEAA +L+ K L +
Sbjct  301   FTGGTLSACCGAGGPYNFDSSVGCGDPPTTGCADPSAYVCWDGLHLTEAANRLIVKGLFE  360

Query  994   GSYTYPSMNALC  1029
             GSY+ P +  +C
Sbjct  361   GSYSAPPIKLIC  372


 Score =   144 bits (363),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 71/157 (45%), Positives = 104/157 (66%), Gaps = 6/157 (4%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            SLSD GN +  +S   + + G P     P GET+F  PTGRC DGR+I+D+IA+++GL I
Sbjct  33   SLSDNGNLLGFSSPKTI-HQGRP-----PNGETYFGQPTGRCCDGRLIVDMIAQNFGLPI  86

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQDMI  362
            PPP +S +      +   GVNFAV G++AL   F+ +  I ++VTN ++  QL  F+D++
Sbjct  87   PPPYVSIRNAKSSRDFYAGVNFAVAGAKALDPSFFDERGISESVTNFTLRVQLDWFRDLL  146

Query  363  PSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
            PSLC + ++C   L++SL V+GE GGNDY H+LL G+
Sbjct  147  PSLCGTKANCMQYLQSSLTVMGEIGGNDYNHALLQGR  183



>gb|KFK44741.1| hypothetical protein AALP_AA1G296900 [Arabis alpina]
Length=390

 Score =   156 bits (394),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 86/187 (46%), Positives = 122/187 (65%), Gaps = 1/187 (1%)
 Frame = +1

Query  472   KNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVEDYDD  651
             + I +I+ ++P+V   I+    +L+E+G RT +VP   PLGC+ +YLT Y + N  +YD 
Sbjct  187   QTIEEIKELVPLVVSTISSAITELVEMGGRTFLVPGDFPLGCSVAYLTLYQTSNRVEYDP  246

Query  652   L-GCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGFSgga  828
             L GCL W+N+ + YHN+ LQ EL+ LR  +P+  IIY D +NA ++I++ PA  G     
Sbjct  247   LTGCLTWLNEFSEYHNEHLQAELDKLRNLYPHVTIIYGDYYNALLRIFEDPAKFGLMNRP  306

Query  829   lraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDGSYTY  1008
             L ACCG GG YNFN  ++CG  G+  C DPS YVNWDG HLTEAAY+ +++ LL G Y  
Sbjct  307   LPACCGLGGPYNFNFSIKCGTRGSEYCSDPSKYVNWDGVHLTEAAYRWISEGLLKGPYAI  366

Query  1009  PSMNALC  1029
             P ++  C
Sbjct  367   PHLDMSC  373


 Score =   136 bits (342),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 69/151 (46%), Positives = 100/151 (66%), Gaps = 9/151 (6%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            SL+DTGN I L++      + +P  +  PYGETFFH+P+GR SDGR+++D IAE  GL  
Sbjct  40   SLADTGNLIGLSTP-----NDLPESAFPPYGETFFHYPSGRFSDGRLVIDFIAEFLGLPH  94

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQDMI  362
             PP   S++     N  +GVNFAV G+ AL     +K  I+ T  N+S+  QL +F++M+
Sbjct  95   VPPFYGSQS----GNFEKGVNFAVGGATALECSILEKRGIHCTHGNISLGVQLQSFKEML  150

Query  363  PSLCNSPSDCKNLLENSLFVLGEFGGNDYTH  455
            P LC SPSDC++++ N+L ++GE GGNDY +
Sbjct  151  PKLCASPSDCRDMIGNALILMGEIGGNDYNY  181



>ref|NP_174179.3| GDSL esterase/lipase [Arabidopsis thaliana]
 sp|Q9FXJ1.1|GDL6_ARATH RecName: Full=GDSL esterase/lipase At1g28570; AltName: Full=Extracellular 
lipase At1g28570; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAG22837.1|AC007508_14 F1K23.19 [Arabidopsis thaliana]
 gb|AEE30994.1| GDSL esterase/lipase [Arabidopsis thaliana]
Length=389

 Score =   146 bits (369),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 104/157 (66%), Gaps = 9/157 (6%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            S++DTGN ++L+         +P  + LPYGETFFHHPTGR S+GR+I+D IAE  G  +
Sbjct  41   SIADTGNLLALSDP-----TNLPKVAFLPYGETFFHHPTGRFSNGRLIIDFIAEFLGFPL  95

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQDMI  362
             PP   S+      N  +GVNFAV G+ AL   F ++  I+   TNVS+  QL +F++ +
Sbjct  96   VPPFYGSQ----NANFEKGVNFAVGGATALERSFLEERGIHFPYTNVSLAVQLSSFKESL  151

Query  363  PSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
            P+LC SPSDC++++ENSL ++GE GGNDY ++   GK
Sbjct  152  PNLCVSPSDCRDMIENSLILMGEIGGNDYNYAFFVGK  188


 Score =   145 bits (367),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 80/187 (43%), Positives = 118/187 (63%), Gaps = 1/187 (1%)
 Frame = +1

Query  472   KNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVEDYDD  651
             KNI +I+ ++P+V   I+    +LI +G +T +VP   PLGC+ +YL+ Y + N+E+YD 
Sbjct  188   KNIEEIKELVPLVIETISSAITELIGMGGKTFLVPGEFPLGCSVAYLSLYQTSNIEEYDP  247

Query  652   L-GCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGFSgga  828
             L GCL W+N+ + YH++ LQ ELN L++ +P+ NIIY D +N  +++   PA  GF    
Sbjct  248   LTGCLKWLNKFSEYHDEQLQAELNRLQKLYPHVNIIYADYYNTLLRLAQEPAKFGFISRP  307

Query  829   lraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDGSYTY  1008
             L ACC  GG +NF    + G +    C DPS YV+WDG H+TEAAY+LM + +L G Y  
Sbjct  308   LPACCALGGPFNFTLGRKRGTQVPECCDDPSKYVSWDGVHMTEAAYRLMAEGILKGPYAI  367

Query  1009  PSMNALC  1029
             P  +  C
Sbjct  368   PPFDWSC  374



>emb|CDO96749.1| unnamed protein product [Coffea canephora]
Length=397

 Score =   150 bits (380),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 77/157 (49%), Positives = 102/157 (65%), Gaps = 2/157 (1%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            SLSD GNYI +          +P  +  PYGET+FHHPTGR SDGR I+D +AE+YGL +
Sbjct  38   SLSDAGNYIHIYQQMFPGTHKLPRYASPPYGETYFHHPTGRTSDGRTIIDFMAEYYGLPL  97

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQDMI  362
             PP +    Q+  +N   G+NFAVVG+ AL   FY++  I+ T +N+SM  QL  F+ ++
Sbjct  98   IPPYIRGVNQS-SSNFGAGINFAVVGAPALDVGFYEERRIHFTTSNISMRTQLSWFKGVL  156

Query  363  PSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
            PSLC S S C+ L  +SL V+G FGGNDY HS L G+
Sbjct  157  PSLCRS-SSCRELFNSSLIVMGPFGGNDYGHSFLQGR  192


 Score =   140 bits (353),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 82/192 (43%), Positives = 121/192 (63%), Gaps = 2/192 (1%)
 Frame = +1

Query  460   FSREKNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVE  639
             F + +++ + + ++P+V +AI+    +LI LG + +MVP +LP GC    LT +     E
Sbjct  188   FLQGRSLEETKTLVPLVINAISISIQELINLGVKNIMVPGMLPDGCLPISLTMFKGYKKE  247

Query  640   DYDDL-GCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGF  816
             DYD + GCLIW+N  + YHN+LLQ EL  +R+RH  A ++Y + ++A MQ+Y  P   GF
Sbjct  248   DYDRITGCLIWLNDFSKYHNELLQAELTRIRQRHRNAVVMYANYYDALMQLYLSPEQYGF  307

Query  817   Sgg-alraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLD  993
              G      C  GG  YN++ D  CGD  + +C  PS Y++WDG H TEAAY+ +TKSLL+
Sbjct  308   GGEPLTACCGAGGIPYNYDSDAVCGDPPSRACAQPSLYISWDGAHCTEAAYRFITKSLLE  367

Query  994   GSYTYPSMNALC  1029
             G YT P +N+ C
Sbjct  368   GPYTAPHINSSC  379



>ref|XP_009113646.1| PREDICTED: GDSL esterase/lipase At1g28580-like [Brassica rapa]
 emb|CDY34093.1| BnaA09g27190D [Brassica napus]
Length=397

 Score =   158 bits (400),  Expect(2) = 3e-69, Method: Compositional matrix adjust.
 Identities = 88/188 (47%), Positives = 126/188 (67%), Gaps = 1/188 (1%)
 Frame = +1

Query  472   KNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVEDYDD  651
             K+I +I+ ++P+V   I+    +L+ +G RT+MVP+ LP+GC  S+LT Y + N E+Y+ 
Sbjct  191   KSIEEIKELVPLVISTISSVITELVHMGGRTIMVPTDLPIGCWTSFLTQYQTSNQEEYNP  250

Query  652   L-GCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGFSgga  828
             L GCL W+N+   +HN+ LQEELN L++ +P+  I+Y D +NA + I+  PA  GF    
Sbjct  251   LTGCLNWLNEFVEHHNKELQEELNRLQKLYPHVTILYADYYNALLHIFQEPARFGFVNRP  310

Query  829   lraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDGSYTY  1008
             L ACCG GG YNFN   QCG +G   C DPS YV+WDG+HLTE+AY+ +   LL+G YT 
Sbjct  311   LSACCGTGGPYNFNNGSQCGTKGVDCCTDPSKYVHWDGFHLTESAYRWVAMGLLEGPYTL  370

Query  1009  PSMNALCP  1032
             P+ +  CP
Sbjct  371   PAFDWSCP  378


 Score =   132 bits (333),  Expect(2) = 3e-69, Method: Compositional matrix adjust.
 Identities = 68/157 (43%), Positives = 99/157 (63%), Gaps = 9/157 (6%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            S++DTGN + L+       + +P  +  PYGETFFH PTGR S+GR+I+D IAE   L  
Sbjct  44   SITDTGNLLHLS-----DLNNLPQSAFPPYGETFFHVPTGRFSNGRLIIDFIAEFLRLPY  98

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQDMI  362
             PP   S  ++     ++GVNFAV G+ AL   F +   I+   TNVS+  QL +F+  +
Sbjct  99   VPPYFGSPNES----FQKGVNFAVAGATALERSFLESRGIHYAYTNVSLGVQLKSFKKSL  154

Query  363  PSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
            P++C SPSDC+ ++ ++L ++GE GGNDY + LL GK
Sbjct  155  PNICGSPSDCREMIGDALIIVGEIGGNDYNYGLLVGK  191



>emb|CDY30822.1| BnaC05g21980D [Brassica napus]
Length=401

 Score =   157 bits (398),  Expect(2) = 5e-69, Method: Compositional matrix adjust.
 Identities = 86/186 (46%), Positives = 117/186 (63%), Gaps = 0/186 (0%)
 Frame = +1

Query  472   KNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVEDYDD  651
             K I ++R  +P+V   I+    +LI +G RT +VP   P+GC+ +YLT Y + N E+YD 
Sbjct  196   KTIEEVREFVPLVISTISSAITELIGMGGRTFLVPGEFPIGCSVTYLTLYQTSNKEEYDP  255

Query  652   LGCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGFSggal  831
              GCL W+N+ A YH+  LQ ELN LRE +P+ NIIY D +NA ++++  P N GF    L
Sbjct  256   SGCLKWLNKFAKYHSDQLQAELNKLRELYPHVNIIYADYYNALLRLFQEPGNFGFIDRPL  315

Query  832   raccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDGSYTYP  1011
              ACCG GG YNF    +CG +G  SC DPS Y+ WDG H+TEA Y+LM + +L G Y  P
Sbjct  316   HACCGFGGPYNFTFGRKCGFKGVESCSDPSKYICWDGVHMTEATYRLMAEGILKGPYAIP  375

Query  1012  SMNALC  1029
               +  C
Sbjct  376   PFDWSC  381


 Score =   132 bits (333),  Expect(2) = 5e-69, Method: Compositional matrix adjust.
 Identities = 70/161 (43%), Positives = 99/161 (61%), Gaps = 13/161 (8%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDII----AEHY  170
            S++DTGN + L+    L +   P     PYGETFF HPTGR S+GR+I+D I    AE  
Sbjct  45   SIADTGNLLGLSDPNHLPHVAFP-----PYGETFFQHPTGRFSNGRLIIDFIVRFTAEFL  99

Query  171  GLAIPPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAF  350
            G  + PP   S+      +  +GVNFAV G+ AL   F ++  I+ + TNVS+  QL +F
Sbjct  100  GFPLVPPFYGSQ----NAHFEKGVNFAVGGATALERSFLEERGIHFSYTNVSLGVQLKSF  155

Query  351  QDMIPSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
            +D +P LC SPSDC+ +++N+L ++GE GGNDY +    GK
Sbjct  156  KDALPKLCGSPSDCREMIKNALILMGEIGGNDYNYVFFVGK  196



>ref|XP_010422034.1| PREDICTED: GDSL esterase/lipase At1g31550-like isoform X1 [Camelina 
sativa]
Length=396

 Score =   157 bits (396),  Expect(2) = 5e-69, Method: Compositional matrix adjust.
 Identities = 85/192 (44%), Positives = 116/192 (60%), Gaps = 0/192 (0%)
 Frame = +1

Query  460   FSREKNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVE  639
             F   + I +++ ++P+V   I+    +LI +G +T +VP   P+GC+ +YLT Y + N+E
Sbjct  187   FFERRLINEVKELVPLVISTISSAITELISMGGKTFLVPGEFPIGCSVAYLTLYQTSNIE  246

Query  640   DYDDLGCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGFS  819
             +YD  GCL W+N+   YH++ LQ EL  LR+ +P+ NIIY D +NA +++   P   GF 
Sbjct  247   EYDPFGCLKWLNKFGEYHDEQLQAELKRLRKLNPHVNIIYADYYNALLRLNQEPTKYGFI  306

Query  820   ggalraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDGS  999
                L ACCG G  YNFN    CG  G  SC DPS YV WDG H+TEAAYK +   LL G 
Sbjct  307   NKPLSACCGVGEPYNFNFSTCCGSFGVDSCNDPSMYVAWDGIHMTEAAYKFIADGLLKGP  366

Query  1000  YTYPSMNALCPT  1035
             YT P  N  C T
Sbjct  367   YTSPPFNWTCLT  378


 Score =   133 bits (334),  Expect(2) = 5e-69, Method: Compositional matrix adjust.
 Identities = 70/149 (47%), Positives = 94/149 (63%), Gaps = 10/149 (7%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            S++DTGN + L+    L  +G P     PYGETFFHHPTGR SDGR+I+D IAE  GL  
Sbjct  45   SIADTGNLLGLSDRNNLSLNGFP-----PYGETFFHHPTGRSSDGRLIIDFIAEFLGLPY  99

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQDMI  362
              P   SK      N ++GVNFAV  + AL A F ++   Y    N+S+  Q+  F++ +
Sbjct  100  VTPYFGSK----NGNFQKGVNFAVGSATALEASFLEE-RGYHCSHNISLGVQVKVFKESL  154

Query  363  PSLCNSPSDCKNLLENSLFVLGEFGGNDY  449
            P+LC  PSDCKN++ N+L ++GE GGNDY
Sbjct  155  PNLCGLPSDCKNMIGNALILMGEIGGNDY  183



>ref|XP_010478238.1| PREDICTED: GDSL esterase/lipase At1g28600-like [Camelina sativa]
Length=415

 Score =   155 bits (391),  Expect(2) = 6e-69, Method: Compositional matrix adjust.
 Identities = 85/191 (45%), Positives = 116/191 (61%), Gaps = 1/191 (1%)
 Frame = +1

Query  460   FSREKNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVE  639
             F + K + ++  ++P+V + I+    +LI +G RT +VP   P+GC+  YLT Y + N E
Sbjct  195   FFQRKPVKEVEELVPLVINTISSAVTELIAMGGRTFLVPGNFPIGCSVIYLTLYQTSNKE  254

Query  640   DYDDL-GCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGF  816
             +YD L GCL W+N    YH + L  ELN LR+ +P+ NIIY D +NA ++++  PA  GF
Sbjct  255   EYDPLTGCLKWLNNFGEYHEEQLHAELNRLRKLNPHVNIIYADYYNALLRLFQEPAKFGF  314

Query  817   SggalraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDG  996
                   ACCG GG YNF+ +  CG  G  SC DPS YV WDG H+TEAAYKL+   +L G
Sbjct  315   GNRPFPACCGIGGPYNFSLNRNCGSVGVKSCNDPSKYVGWDGIHMTEAAYKLIADGILQG  374

Query  997   SYTYPSMNALC  1029
              Y  P  N  C
Sbjct  375   PYAIPPFNWSC  385


 Score =   135 bits (339),  Expect(2) = 6e-69, Method: Compositional matrix adjust.
 Identities = 65/157 (41%), Positives = 99/157 (63%), Gaps = 9/157 (6%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            S++DTGN ++L+      ++ +P  +  PYGETFFHHPTGR  DGR+I+D IAE  GL  
Sbjct  52   SIADTGNLVALS-----DHNHLPGPAFPPYGETFFHHPTGRSCDGRIIIDFIAEFLGLPY  106

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQDMI  362
             PP   SK      N  +GVNFA+  + AL +  +++   +   +N+S+  QL +F++ +
Sbjct  107  VPPYFGSK----NGNFEKGVNFAIASATALESSIFEERGFHIPYSNISLGVQLKSFKESL  162

Query  363  PSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
            P+LC SPSDC++++ N+L ++GE GGNDY       K
Sbjct  163  PNLCGSPSDCRDMIGNALILMGEIGGNDYNFPFFQRK  199



>emb|CDY30819.1| BnaC05g21950D [Brassica napus]
Length=397

 Score =   158 bits (399),  Expect(2) = 7e-69, Method: Compositional matrix adjust.
 Identities = 88/188 (47%), Positives = 126/188 (67%), Gaps = 1/188 (1%)
 Frame = +1

Query  472   KNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVEDYDD  651
             K+I +I+ ++P+V   I+    +L+ +G RT+MVP+ LP+GC  S+LT Y + N E+Y+ 
Sbjct  191   KSIEEIKELVPLVISTISSVITELVHMGGRTIMVPTDLPIGCWTSFLTQYQTSNQEEYNP  250

Query  652   L-GCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGFSgga  828
             L GCL W+N+   +HN+ LQEELN L++ +P+  I+Y D +NA + I+  PA  GF    
Sbjct  251   LTGCLNWLNEFVEHHNKELQEELNRLQKLYPHVTILYADYYNALLHIFQEPARFGFMNRP  310

Query  829   lraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDGSYTY  1008
             L ACCG GG YNFN   QCG +G   C DPS YV+WDG+HLTE+AY+ +   LL+G YT 
Sbjct  311   LSACCGTGGPYNFNNGSQCGTKGVDCCTDPSKYVHWDGFHLTESAYRWVAMGLLEGPYTL  370

Query  1009  PSMNALCP  1032
             P+ +  CP
Sbjct  371   PAFDWSCP  378


 Score =   131 bits (330),  Expect(2) = 7e-69, Method: Compositional matrix adjust.
 Identities = 67/157 (43%), Positives = 98/157 (62%), Gaps = 9/157 (6%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            S++DTGN + L+       + +P  +  PYGETFFH PTGR S+GR+I+D IAE   L  
Sbjct  44   SITDTGNLLHLSEP-----NNLPQSAFPPYGETFFHVPTGRFSNGRLIIDFIAEFLRLPY  98

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQDMI  362
             PP   S       + ++G+NFAV G+ AL   F +   I+   TNVS+  QL +F+  +
Sbjct  99   VPPYFGSP----NGSFQKGINFAVAGATALEQSFLESRGIHYAYTNVSLGVQLKSFKQSL  154

Query  363  PSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
            P++C SPSDC+ ++ ++L ++GE GGNDY + LL GK
Sbjct  155  PNICGSPSDCREMIGDALIIVGEIGGNDYNYGLLVGK  191



>emb|CDY43309.1| BnaC03g58810D [Brassica napus]
Length=390

 Score =   152 bits (383),  Expect(2) = 9e-69, Method: Compositional matrix adjust.
 Identities = 82/199 (41%), Positives = 121/199 (61%), Gaps = 1/199 (1%)
 Frame = +1

Query  460   FSREKNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVE  639
             F   K + +I+ ++P++   I+     L++LG +T +VP   P+GC+ASYLT + +   E
Sbjct  186   FFEGKTVNEIKELVPLIIKTISSAIVDLVDLGGKTFLVPGNFPIGCSASYLTLFHNAKEE  245

Query  640   DYDDL-GCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGF  816
             ++D   GC+ W+N+   YHN  L+ EL  L++ +P+ NIIY D +N+    +  PA  GF
Sbjct  246   EHDPFTGCIPWLNEFGEYHNDQLKTELKRLQKLYPHVNIIYADYYNSIYTFFQEPAKYGF  305

Query  817   SggalraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDG  996
                 L ACCG GG+YNF  + +CG  G   C +PS YVNWDGYHLTEAAY+ +   LL+G
Sbjct  306   KNRPLAACCGVGGKYNFTVNEECGYRGVNYCQNPSEYVNWDGYHLTEAAYRKIAHGLLNG  365

Query  997   SYTYPSMNALCPTDAQVAQ  1053
              Y  P+ +  CP  A V +
Sbjct  366   PYATPAFDWSCPGSASVDK  384


 Score =   137 bits (345),  Expect(2) = 9e-69, Method: Compositional matrix adjust.
 Identities = 73/158 (46%), Positives = 100/158 (63%), Gaps = 10/158 (6%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            S++DTGNY+ L+       + +P  + LPYGETFFH P+GR SDGR+I+D IAE  GL  
Sbjct  42   SIADTGNYLRLS-----DVNHLPQAAFLPYGETFFHPPSGRYSDGRLIIDFIAEFLGLPY  96

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQDMI  362
             PP   S+  +    I QG+NFAV G+ AL   F  +  I    TNVS+N QL+ F+ ++
Sbjct  97   VPPYFGSQNVS----IEQGINFAVYGATALDRAFLMEKGIESDFTNVSLNVQLNTFKQVL  152

Query  363  PSLCNSPS-DCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
            P+LC S S DC+ +L +SL ++GE GGNDY +    GK
Sbjct  153  PNLCASSSRDCREMLGDSLILMGEIGGNDYNYPFFEGK  190



>ref|XP_010499588.1| PREDICTED: GDSL esterase/lipase At1g28580-like [Camelina sativa]
Length=395

 Score =   150 bits (378),  Expect(2) = 1e-68, Method: Compositional matrix adjust.
 Identities = 87/187 (47%), Positives = 117/187 (63%), Gaps = 1/187 (1%)
 Frame = +1

Query  472   KNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVEDYDD  651
             K+I +++ +IP+V  AI+    +LI +G RT +VP   PLGC+A YLT Y + N+E YD 
Sbjct  193   KSIEEVKELIPMVITAISSSITELIGMGGRTFLVPGDFPLGCSAIYLTSYQTSNMEAYDP  252

Query  652   L-GCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGFSgga  828
             L GCL W+N+    H+  LQ ELN L++ +P+ NIIY D +NA ++IY  P   GF    
Sbjct  253   LTGCLTWLNKFGENHDAQLQAELNRLQKLYPHVNIIYADYYNALLRIYQEPTKFGFMNRP  312

Query  829   lraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDGSYTY  1008
             L ACCG GG YNF    QCG +    C DPS YV WDG H+TEAAY L+++ +L G Y  
Sbjct  313   LSACCGVGGPYNFTSFWQCGADVVEGCSDPSKYVTWDGVHMTEAAYSLISEGILKGPYAA  372

Query  1009  PSMNALC  1029
             P  +  C
Sbjct  373   PPFDWSC  379


 Score =   139 bits (350),  Expect(2) = 1e-68, Method: Compositional matrix adjust.
 Identities = 71/157 (45%), Positives = 100/157 (64%), Gaps = 9/157 (6%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            S +DTGN + L+    L +   P     PYGETFFHHPTGR S+GRVI+D +AE   L +
Sbjct  46   SHADTGNLLGLSDPNNLPHFAFP-----PYGETFFHHPTGRFSNGRVIIDFMAEFLDLPL  100

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQDMI  362
             PP   S+      N ++GVNFAV G+ AL   F +   I+   TN+S+  QL +F++ +
Sbjct  101  VPPFYGSQ----NANFKKGVNFAVAGATALERSFLEGRGIHFPYTNISLGVQLSSFKESL  156

Query  363  PSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
            P LC SPSDC++++EN+L ++GE GG DY ++ L GK
Sbjct  157  PKLCGSPSDCRDMIENALILMGEIGGTDYNYAFLVGK  193



>ref|XP_003593737.1| GDSL esterase/lipase [Medicago truncatula]
 gb|AES63988.1| GDSL-like lipase/acylhydrolase [Medicago truncatula]
Length=375

 Score =   157 bits (398),  Expect(2) = 1e-68, Method: Compositional matrix adjust.
 Identities = 91/182 (50%), Positives = 120/182 (66%), Gaps = 0/182 (0%)
 Frame = +1

Query  484   DIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVEDYDDLGCL  663
             D+   +P V   I     +LI LGA T++VP  LPLGC  +YLT + + + E+YD  GCL
Sbjct  190   DLITYVPRVVSVITSSIRELINLGAVTILVPGSLPLGCNPAYLTMFATKDEEEYDQAGCL  249

Query  664   IWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGFSggalracc  843
              W+N+   YHN+LLQ EL+ LR  +P+ NIIY D FNAA+Q+Y  P   GF G A + CC
Sbjct  250   KWLNKFFEYHNELLQTELHKLRVLYPFTNIIYADYFNAALQLYKSPEQYGFDGNAFKVCC  309

Query  844   ggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDGSYTYPSMNA  1023
             GGGG YN+N    CG+    +C DPS YV+WDGYHLTEAA++ MT++LL+G YT P  + 
Sbjct  310   GGGGPYNYNDSALCGNSEVIACDDPSKYVSWDGYHLTEAAHRWMTEALLEGPYTIPKFSF  369

Query  1024  LC  1029
              C
Sbjct  370   SC  371


 Score =   131 bits (329),  Expect(2) = 1e-68, Method: Compositional matrix adjust.
 Identities = 72/155 (46%), Positives = 94/155 (61%), Gaps = 10/155 (6%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            SL+DTGN   ++          P C + PYG+T FHHP GRCSDGR+I+D IAE + L  
Sbjct  38   SLTDTGNLYFISQPQS------PDCLLPPYGKTHFHHPNGRCSDGRLIVDFIAEFFRLPY  91

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVT-NVSMNDQLHAFQDM  359
              P L       G NI  GVNFAV G+ AL   F+++ E    VT N S+  QL  F+++
Sbjct  92   LKPYL---GFINGGNIEHGVNFAVAGATALDRSFFEEKEFVVEVTANYSLIVQLDGFKEL  148

Query  360  IPSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLL  464
            +PS+CNS S CK +L +SLF++GE GGNDY   L 
Sbjct  149  LPSICNSTSSCKGVLHSSLFIVGEIGGNDYGFPLF  183



>ref|XP_010435654.1| PREDICTED: GDSL esterase/lipase At1g31550-like [Camelina sativa]
Length=396

 Score =   158 bits (399),  Expect(2) = 2e-68, Method: Compositional matrix adjust.
 Identities = 85/190 (45%), Positives = 115/190 (61%), Gaps = 0/190 (0%)
 Frame = +1

Query  460   FSREKNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVE  639
             F + + + +++ ++P+V   I+    +LI +G RT +VP   P+GC+ +YLT Y + N+E
Sbjct  187   FFQRRPVDEVKELVPLVISTISSAITELISMGGRTFLVPGEFPIGCSVAYLTLYQTSNME  246

Query  640   DYDDLGCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGFS  819
             +YD  GCL W+N+   YH++ LQ EL  LR  +P+ NIIY D +NA +++   P   GF 
Sbjct  247   EYDSFGCLKWLNKFGEYHDEQLQAELKRLRNLNPHVNIIYADYYNALLRLNQEPTKYGFI  306

Query  820   ggalraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDGS  999
                L ACCG G  YNFN    CG  G  SC DPS YV WDG H+TEAAYKLM   LL G 
Sbjct  307   DKPLSACCGVGEPYNFNFSTCCGSFGVDSCNDPSKYVAWDGIHMTEAAYKLMADGLLKGP  366

Query  1000  YTYPSMNALC  1029
             Y  P  N  C
Sbjct  367   YASPPFNWTC  376


 Score =   130 bits (327),  Expect(2) = 2e-68, Method: Compositional matrix adjust.
 Identities = 69/149 (46%), Positives = 93/149 (62%), Gaps = 10/149 (7%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            S++DTGN + L+    L  +G P     PYGETFFHHPTGR SDGR+I+D IAE  GL  
Sbjct  45   SIADTGNLLGLSDRNNLSLNGFP-----PYGETFFHHPTGRSSDGRLIIDFIAEFLGLPY  99

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQDMI  362
              P   SK      N ++GVNFAV  + AL   F ++   Y    N+S+  Q+  F++ +
Sbjct  100  VTPYFGSK----NGNFQKGVNFAVGSATALEVSFLEE-RGYHCPHNISLGVQVKIFKESL  154

Query  363  PSLCNSPSDCKNLLENSLFVLGEFGGNDY  449
            P+LC  PSDCKN++ N+L ++GE GGNDY
Sbjct  155  PNLCGLPSDCKNMIGNALILMGEIGGNDY  183



>ref|XP_002893537.1| hypothetical protein ARALYDRAFT_473078 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69796.1| hypothetical protein ARALYDRAFT_473078 [Arabidopsis lyrata subsp. 
lyrata]
Length=390

 Score =   146 bits (369),  Expect(2) = 2e-68, Method: Compositional matrix adjust.
 Identities = 82/191 (43%), Positives = 117/191 (61%), Gaps = 1/191 (1%)
 Frame = +1

Query  460   FSREKNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVE  639
             F  +K+I +I+ + P+V   I+    +LI +G RT +VP   P+GC+  YLT + + N+E
Sbjct  187   FFVDKSIEEIKELTPLVITTISSAITELISMGGRTFLVPGEFPVGCSVFYLTSHQTSNME  246

Query  640   DYDDL-GCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGF  816
             +YD L GCL W+N     H + L+ EL  L++ +P+ N+IY D +NA +++Y  PA  GF
Sbjct  247   EYDPLTGCLKWLNNFGENHGEQLRAELKRLQKLYPHVNVIYADYYNALLRLYQEPAKFGF  306

Query  817   SggalraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDG  996
                 L ACCG GG YN+    +CG +   SC DPS YV WDG HLTEAAY+LM + +L G
Sbjct  307   MNRPLSACCGSGGPYNYTVGRKCGTDIVESCNDPSKYVAWDGVHLTEAAYRLMAEGILKG  366

Query  997   SYTYPSMNALC  1029
              Y  P  +  C
Sbjct  367   PYAIPPFDWSC  377


 Score =   141 bits (356),  Expect(2) = 2e-68, Method: Compositional matrix adjust.
 Identities = 72/157 (46%), Positives = 102/157 (65%), Gaps = 9/157 (6%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            S++DTGN + L+    L +   P     PYGETFFHHPTGR S+GR+I+D IAE  GL +
Sbjct  44   SIADTGNLLGLSDPNDLPHMAFP-----PYGETFFHHPTGRFSNGRLIIDFIAEFLGLPL  98

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQDMI  362
             PP   S+      N  +GVNFAV G+ AL   F ++  I+   TNVS+  QL +F++ +
Sbjct  99   VPPFYGSQ----NANFDKGVNFAVGGATALERSFLEERGIHFPYTNVSLGVQLQSFKESL  154

Query  363  PSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
            PS+C SPSDC++++EN+L ++GE GGNDY ++    K
Sbjct  155  PSICGSPSDCRDMIENALILMGEIGGNDYNYAFFVDK  191



>ref|XP_003542992.1| PREDICTED: GDSL esterase/lipase At1g28580-like [Glycine max]
Length=376

 Score =   160 bits (405),  Expect(2) = 2e-68, Method: Compositional matrix adjust.
 Identities = 90/190 (47%), Positives = 122/190 (64%), Gaps = 2/190 (1%)
 Frame = +1

Query  460   FSREKNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVE  639
             F ++K+I +I+  +P V +AIA   ++LI LGART+MVP  LP+GC+  YLT Y + +  
Sbjct  178   FFQQKSIAEIKSYVPYVINAIASAINELIGLGARTLMVPGNLPIGCSVIYLTIYETIDKT  237

Query  640   DYDDLGCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGFS  819
              YD  GCL W+N+   Y+N  LQ EL+ LR  HP ANIIY D +NAA+ +Y  P   GF+
Sbjct  238   QYDQFGCLKWLNEFGEYYNHKLQSELDKLRVFHPRANIIYADYYNAALPLYRDPTKFGFT  297

Query  820   ggalraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDGS  999
                L+ CCG GG YNFN    CG+    +C DPS ++ WDG HLTEAAY+ + K L+ G 
Sbjct  298   --DLKICCGMGGPYNFNKLTNCGNPSVIACDDPSKHIGWDGVHLTEAAYRFIAKGLIKGP  355

Query  1000  YTYPSMNALC  1029
             Y+ P  + LC
Sbjct  356   YSLPQFSTLC  365


 Score =   127 bits (320),  Expect(2) = 2e-68, Method: Compositional matrix adjust.
 Identities = 69/158 (44%), Positives = 97/158 (61%), Gaps = 15/158 (9%)
 Frame = +3

Query  3    SLSDTGN-YISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLA  179
            SL+DTGN Y+S        +     C   PYG+TFFHH +GRCSDGR+I+D IAE  GL 
Sbjct  39   SLADTGNLYLS-------SHPPTDHCFFPPYGQTFFHHVSGRCSDGRLIIDFIAESLGLP  91

Query  180  IPPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQDM  359
            +  P        GG N+ +G NFAV+G+ AL   F+Q   I    TN S+  QL+ F+++
Sbjct  92   LVKPYF------GGWNVEEGANFAVIGATALDYSFFQDRGI-SIPTNYSLTIQLNWFKEL  144

Query  360  IPSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
            + +LCNS ++C  ++ENSLF++GE GGND+ +     K
Sbjct  145  LTALCNSSTNCHEIVENSLFLMGEIGGNDFNYLFFQQK  182



>ref|XP_010540488.1| PREDICTED: GDSL esterase/lipase At1g28610-like isoform X1 [Tarenaya 
hassleriana]
Length=393

 Score =   158 bits (399),  Expect(2) = 2e-68, Method: Compositional matrix adjust.
 Identities = 87/191 (46%), Positives = 125/191 (65%), Gaps = 2/191 (1%)
 Frame = +1

Query  460   FSREKNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVE  639
             F   KN+ +IR ++P+V + I+    +L+++G RT +VP   P+GC+A+YLT Y + N+E
Sbjct  186   FFAGKNVDEIREMVPLVINVISSAIRELVDMGGRTFLVPGNFPIGCSAAYLTMYQTENME  245

Query  640   DYDDL-GCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGF  816
              YD L GCL W+N+ A +HN+ LQ ELN LR+ +P+ NI+Y D +N  ++++  P   GF
Sbjct  246   KYDPLTGCLKWLNEFAEHHNERLQIELNRLRKLYPHVNIVYADYYNVVLRLFQDPIEFGF  305

Query  817   SggalraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDG  996
                 L  CCG GG YN++P   CGD G   C +PS YVNWDG+HLTE AY+ + K LL G
Sbjct  306   MNRPLSVCCGAGGPYNYSPSRLCGD-GVPYCDNPSKYVNWDGFHLTEHAYRWIAKGLLKG  364

Query  997   SYTYPSMNALC  1029
              Y  P+ N+ C
Sbjct  365   PYADPAFNSYC  375


 Score =   130 bits (326),  Expect(2) = 2e-68, Method: Compositional matrix adjust.
 Identities = 68/157 (43%), Positives = 96/157 (61%), Gaps = 9/157 (6%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            S++DTGN + L+    L +  +P     PYGETFFH PTGR SDGR+I+D IAE   L  
Sbjct  43   SIADTGNLLILSDPNHLPHFALP-----PYGETFFHFPTGRHSDGRLIIDFIAESLDLPF  97

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQDMI  362
             PP   S+ ++      +G+NFAV G+ AL     +   +   +TNVS+  QL+ F++++
Sbjct  98   VPPYFGSRNRS----FLKGINFAVAGATALDISCLKGKGVPSDITNVSLGVQLNIFKEIL  153

Query  363  PSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
            PSLC+ PSDC   L  SL ++GE GGNDY +   +GK
Sbjct  154  PSLCSPPSDCSEFLSRSLILMGEIGGNDYNYPFFAGK  190



>emb|CDX90163.1| BnaA08g18210D [Brassica napus]
Length=390

 Score =   150 bits (380),  Expect(2) = 3e-68, Method: Compositional matrix adjust.
 Identities = 83/199 (42%), Positives = 122/199 (61%), Gaps = 1/199 (1%)
 Frame = +1

Query  460   FSREKNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVE  639
             F   K+I +I+ ++P++   I+     L++LG +T +VP   P+GC+ASYLT + +   E
Sbjct  186   FFEGKSINEIKELVPLIIKTISSAIVDLVDLGGKTFLVPGNFPIGCSASYLTLFHNAKEE  245

Query  640   DYDDL-GCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGF  816
             ++D   GC+ W+N+   YHN+ L+ EL  L++ +P+ NIIY D +N+    +  PA  GF
Sbjct  246   EHDPFTGCIPWLNEFGEYHNEQLKTELKRLQKLYPHVNIIYADYYNSIHTFFQEPAKYGF  305

Query  817   SggalraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDG  996
                 L ACCG GG+YNF  + +CG  G   C +PS YVNWDGYHLTEAAY  +   LL+G
Sbjct  306   KNRPLAACCGVGGKYNFTVNEECGYGGVNYCQNPSEYVNWDGYHLTEAAYHKIAHGLLNG  365

Query  997   SYTYPSMNALCPTDAQVAQ  1053
              Y  P+ +  CP  A V +
Sbjct  366   PYATPAFDWSCPGSASVDK  384


 Score =   137 bits (344),  Expect(2) = 3e-68, Method: Compositional matrix adjust.
 Identities = 73/158 (46%), Positives = 99/158 (63%), Gaps = 10/158 (6%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            S++DTGNY+ L+       + +P  + LPYGETFFH P+GR SDGR+I+D IAE  GL  
Sbjct  42   SIADTGNYLRLS-----DVNHLPQAAFLPYGETFFHPPSGRYSDGRLIIDFIAEFLGLPY  96

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQDMI  362
             PP   S+  +      QG+NFAV G+ AL   F  +  I    TNVS+N QL+ F+ ++
Sbjct  97   VPPYFGSQNVS----FEQGINFAVYGATALDRAFLMEKGIESDFTNVSLNVQLNTFKQVL  152

Query  363  PSLCNSPS-DCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
            PSLC S S DC+ +L +SL ++GE GGNDY +    GK
Sbjct  153  PSLCASSSRDCREMLGDSLILMGEIGGNDYNYPFFEGK  190



>ref|XP_010462954.1| PREDICTED: uncharacterized protein LOC104743592 [Camelina sativa]
Length=799

 Score =   144 bits (363),  Expect(2) = 3e-68, Method: Compositional matrix adjust.
 Identities = 86/191 (45%), Positives = 115/191 (60%), Gaps = 2/191 (1%)
 Frame = +1

Query  460   FSREKNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVE  639
             F   K+  +   ++P+V   I+  A  LI +G RT +VP   P GC+  YLT Y   NV+
Sbjct  594   FFVNKSTEETNELVPLVIRTISS-AITLISMGGRTFLVPGGFPTGCSVVYLTLYQKSNVD  652

Query  640   DYDDL-GCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGF  816
             +YD L GCL W+N+    H + L+ ELN L++ +P+ NIIY D +NA ++IY  PA  GF
Sbjct  653   EYDPLTGCLTWLNKYGENHGEQLRVELNRLQKLYPHVNIIYADYYNALLRIYQDPAKFGF  712

Query  817   SggalraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDG  996
                 L ACCG GG YNF    +CG +   SC DPS YV WDG HLTEAAY+LM + +L+G
Sbjct  713   MKRPLSACCGVGGPYNFTAGKKCGTDVVDSCNDPSKYVAWDGVHLTEAAYRLMAEGILNG  772

Query  997   SYTYPSMNALC  1029
              Y  P  +  C
Sbjct  773   PYAVPPFDWSC  783


 Score =   143 bits (361),  Expect(2) = 3e-68, Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 102/157 (65%), Gaps = 9/157 (6%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            SL+DTGN + L+    L +   P     PYGETFFHHPTGR S+GR+I+D IAE  GL +
Sbjct  451  SLADTGNLLGLSDPNELPHVAFP-----PYGETFFHHPTGRFSNGRLIIDFIAEFLGLPL  505

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQDMI  362
             PP   S+      N  +GVNFAV G+ AL   F ++  I+   TNVS+  QL +F++ +
Sbjct  506  VPPFYGSQKA----NFEKGVNFAVGGATALERSFLEERGIHFPYTNVSLGVQLTSFKESL  561

Query  363  PSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
            P+LC SPSDC++++EN+L ++GE GGNDY ++    K
Sbjct  562  PNLCGSPSDCRDMIENALILMGEIGGNDYNYAFFVNK  598


 Score =   155 bits (392),  Expect(2) = 2e-64, Method: Compositional matrix adjust.
 Identities = 88/189 (47%), Positives = 118/189 (62%), Gaps = 1/189 (1%)
 Frame = +1

Query  466   REKNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVEDY  645
             + K I +++ ++P V   I+    +L+ +G RT +VP   PLGC+A+YLT Y + N E+Y
Sbjct  188   QRKAIEEVKELVPRVIATISSATTELVRMGGRTFLVPGNFPLGCSAAYLTLYQTSNKEEY  247

Query  646   DDL-GCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGFSg  822
             D L GCL W+N    YH++ LQ ELN L+  +P  NIIY D +NA + +Y  P   GF  
Sbjct  248   DPLTGCLTWLNDFGKYHSEQLQTELNRLKNLYPNVNIIYADYYNALLCLYQEPTKFGFIK  307

Query  823   galraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDGSY  1002
               L ACCG GG YNFN   +CG  G  SC DPS YVNWDG H+TEAAY+ +++ LL+G Y
Sbjct  308   RPLPACCGLGGLYNFNFTRKCGSLGVESCNDPSKYVNWDGIHMTEAAYRWISEGLLNGPY  367

Query  1003  TYPSMNALC  1029
               P  N  C
Sbjct  368   AIPPFNWSC  376


 Score =   119 bits (298),  Expect(2) = 2e-64, Method: Compositional matrix adjust.
 Identities = 64/157 (41%), Positives = 96/157 (61%), Gaps = 9/157 (6%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            S++DT N +SL+       + +P  +  PYGE+F +HPTGR SDGR+I+D IAE   L +
Sbjct  43   SIADTENLLSLSDP-----NDLPGSAFPPYGESFLNHPTGRFSDGRLIIDFIAEFLDLPL  97

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQDMI  362
             PP   S+  +      +GVNFAV G+ AL   F ++  I+ + TN S+  QL +F++ +
Sbjct  98   VPPFYGSQHAS----FEKGVNFAVAGATALEPSFLERRGIHSSTTNFSLGVQLRSFKESL  153

Query  363  PSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
              L  S SDC +++EN+L ++GE GGNDY  +L   K
Sbjct  154  HCLRVSLSDCIDMIENALILMGEIGGNDYNFALFQRK  190



>ref|XP_010478237.1| PREDICTED: GDSL esterase/lipase At1g28580-like [Camelina sativa]
Length=415

 Score =   146 bits (369),  Expect(2) = 4e-68, Method: Compositional matrix adjust.
 Identities = 86/191 (45%), Positives = 114/191 (60%), Gaps = 1/191 (1%)
 Frame = +1

Query  460   FSREKNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVE  639
             F   K+I +I+ +IP+V   I+    +LI +G RT++VP   PLGC+A+YLT Y     E
Sbjct  205   FFVNKSIEEIKELIPLVITTISSAITELIGMGGRTILVPGDFPLGCSATYLTLYQKSKKE  264

Query  640   DYD-DLGCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGF  816
              YD   GCL W+N+    H+  L+ ELN L++ +P+ NIIY D +NA ++IY  P N GF
Sbjct  265   AYDPSTGCLTWLNKFGENHDVQLRAELNRLQKLYPHVNIIYADYYNALLRIYQEPENFGF  324

Query  817   SggalraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDG  996
                 L ACCG GG YNF    QCG +    C  PS YV WDG H+TEAAY L+ + +L G
Sbjct  325   MNRPLSACCGVGGPYNFTSFWQCGTDVVEGCNYPSKYVAWDGVHMTEAAYSLIAEGILKG  384

Query  997   SYTYPSMNALC  1029
              Y  P  N  C
Sbjct  385   PYAVPPFNWSC  395


 Score =   140 bits (354),  Expect(2) = 4e-68, Method: Compositional matrix adjust.
 Identities = 71/157 (45%), Positives = 100/157 (64%), Gaps = 9/157 (6%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            S++DTGN + L+    L +   P     PYGETFFHHPTGR S+GR+I+D IA+  GL +
Sbjct  62   SIADTGNLLGLSDPNELPHVAFP-----PYGETFFHHPTGRFSNGRLIIDFIADFLGLPL  116

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQDMI  362
             PP   S+      N  +GVNFAV G+ AL   F +K  I    TNVS+  Q+ +F++ +
Sbjct  117  VPPFYGSQ----NANFEKGVNFAVAGATALERSFLEKKGILFPHTNVSLGVQISSFKESL  172

Query  363  PSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
            P LC SPSDC++++EN+L ++GE GGNDY ++    K
Sbjct  173  PKLCGSPSDCRDMIENALILMGEIGGNDYNYAFFVNK  209



>ref|NP_174182.1| GDSL esterase/lipase [Arabidopsis thaliana]
 sp|Q94F40.1|GDL9_ARATH RecName: Full=GDSL esterase/lipase At1g28600; AltName: Full=Extracellular 
lipase At1g28600; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAK60329.1|AF385739_1 At1g28600/F1K23_6 [Arabidopsis thaliana]
 gb|AAM91505.1| At1g28600/F1K23_6 [Arabidopsis thaliana]
 gb|AEE30999.1| GDSL esterase/lipase [Arabidopsis thaliana]
Length=393

 Score =   148 bits (374),  Expect(2) = 5e-68, Method: Compositional matrix adjust.
 Identities = 81/191 (42%), Positives = 116/191 (61%), Gaps = 1/191 (1%)
 Frame = +1

Query  460   FSREKNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVE  639
             F   K + ++  ++P V  +I+    +LI +G +T +VP   P+GC+  YLT Y + N +
Sbjct  180   FFNRKPVKEVEELVPFVIASISSTITELIGMGGKTFLVPGEFPIGCSVVYLTLYKTSNKD  239

Query  640   DYD-DLGCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGF  816
             +YD   GCL W+N+   YH++ L+ ELN LR+ +P+ NIIY D +N+ ++I+  PA  GF
Sbjct  240   EYDPSTGCLKWLNKFGEYHSEKLKVELNRLRKLYPHVNIIYADYYNSLLRIFKEPAKFGF  299

Query  817   SggalraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDG  996
                   ACCG GG YNFN   +CG  G  SC DPS YV WDG H+TEAAYK +   +L+G
Sbjct  300   MERPFPACCGIGGPYNFNFTRKCGSVGVKSCKDPSKYVGWDGVHMTEAAYKWIADGILNG  359

Query  997   SYTYPSMNALC  1029
              Y  P  +  C
Sbjct  360   PYANPPFDRSC  370


 Score =   138 bits (348),  Expect(2) = 5e-68, Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 97/157 (62%), Gaps = 10/157 (6%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            S++DTGN + L+    L     P     PYGETFFHHPTGR  DGR+I+D IAE  GL  
Sbjct  38   SIADTGNLVGLSDRNQLPVTAFP-----PYGETFFHHPTGRSCDGRIIMDFIAEFVGLPY  92

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQDMI  362
             PP   SK +    N  +GVNFAV G+ AL + F +K  I    TNVS+  QL +F+  +
Sbjct  93   VPPYFGSKNR----NFDKGVNFAVAGATALKSSFLKKRGI-QPHTNVSLGVQLKSFKKSL  147

Query  363  PSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
            P+LC SPSDC++++ N+L ++GE GGNDY     + K
Sbjct  148  PNLCGSPSDCRDMIGNALILMGEIGGNDYNFPFFNRK  184



>ref|XP_010501634.1| PREDICTED: uncharacterized protein LOC104778924 [Camelina sativa]
Length=818

 Score =   152 bits (385),  Expect(2) = 5e-68, Method: Compositional matrix adjust.
 Identities = 89/191 (47%), Positives = 120/191 (63%), Gaps = 1/191 (1%)
 Frame = +1

Query  460   FSREKNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVE  639
             F  +K+I +I+ +IP+V   I+    +LI++G RT +VP   PLGC+A YLT Y + N+E
Sbjct  184   FFVKKSIEEIKALIPLVITTISSAITELIDMGGRTFLVPGDFPLGCSAIYLTSYQTSNME  243

Query  640   DYDDL-GCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGF  816
              YD L GCL W+N+    HN+ LQ ELN L + +P+ NIIY D +NA ++IY  P+  GF
Sbjct  244   AYDPLTGCLTWLNKFGENHNKQLQAELNRLLKLYPHVNIIYADYYNALLRIYQEPSKFGF  303

Query  817   SggalraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDG  996
                 L ACCG GG YNF    QCG +    C DPS YV WDG H+TEAAY L+++ +L G
Sbjct  304   MNRPLSACCGVGGPYNFTSFWQCGADVVEGCSDPSKYVTWDGVHMTEAAYSLISEGILKG  363

Query  997   SYTYPSMNALC  1029
              Y  P  +  C
Sbjct  364   PYAVPPFDWSC  374


 Score =   134 bits (336),  Expect(2) = 5e-68, Method: Compositional matrix adjust.
 Identities = 70/157 (45%), Positives = 96/157 (61%), Gaps = 9/157 (6%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            S++DTGN + L+    L +   P     PYGETFFHHPTGR S+GRVI+D IAE   L +
Sbjct  41   SIADTGNLLGLSDPNNLPHFAFP-----PYGETFFHHPTGRFSNGRVIIDFIAEFLDLPL  95

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQDMI  362
             PP   S+         +GVNFAV G+ AL   F +   I+   TN+S+  QL +F+  +
Sbjct  96   VPPFYGSQNAY----FEKGVNFAVAGATALERSFLEARGIHFPYTNISLGVQLSSFKASL  151

Query  363  PSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
              LC SPSDCK+++EN+L ++GE GGNDY ++    K
Sbjct  152  TKLCGSPSDCKDMIENALILMGEIGGNDYNYAFFVKK  188


 Score =   149 bits (375),  Expect(2) = 2e-65, Method: Compositional matrix adjust.
 Identities = 81/191 (42%), Positives = 118/191 (62%), Gaps = 1/191 (1%)
 Frame = +1

Query  460   FSREKNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVE  639
             F   K++ +++ +IP+V   I+    +LI +G +T +VP   P+GC  +YLT Y + N+E
Sbjct  608   FFVGKSLQEVKELIPLVITTISSAITELISMGGKTFLVPGQFPMGCLVAYLTLYQTSNIE  667

Query  640   DYDDL-GCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGF  816
             +YD L GCL W+N+    H+  L+ ELN +++ +P+ NIIY D +NA ++ Y  PA  GF
Sbjct  668   EYDPLTGCLTWLNKFGENHDAQLRAELNRIQKLYPHVNIIYVDYYNALLRFYQEPAKFGF  727

Query  817   SggalraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDG  996
                 L ACCG GG YN+    QCG +    C DPS YV WDG H+TEAAY+LM++ +L G
Sbjct  728   MDRPLPACCGVGGPYNYTSVTQCGTDVVEGCSDPSKYVAWDGVHMTEAAYRLMSEGILKG  787

Query  997   SYTYPSMNALC  1029
              Y  P  +  C
Sbjct  788   PYAVPLFDWSC  798


 Score =   129 bits (325),  Expect(2) = 2e-65, Method: Compositional matrix adjust.
 Identities = 69/157 (44%), Positives = 96/157 (61%), Gaps = 9/157 (6%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            S++DTGN++ L+    L +   P     PYGETFFHH TGR S+GR+I+D IAE   L +
Sbjct  465  SVADTGNFLGLSDRNNLPHFAFP-----PYGETFFHHATGRFSNGRLIIDFIAEFLSLPL  519

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQDMI  362
             PP   S+      N  +GVNFAV G+ AL   F ++  I    TNVS+  QL +F+  +
Sbjct  520  VPPFYGSQ----NANFEKGVNFAVAGATALEHSFLEERGIDFFNTNVSLAVQLSSFKASL  575

Query  363  PSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
            P+ C SPSDC +++EN+L ++GE G NDY +    GK
Sbjct  576  PNFCGSPSDCTDMMENALILMGEIGLNDYFYLFFVGK  612



>gb|AAM65183.1| lipase, putative [Arabidopsis thaliana]
Length=393

 Score =   148 bits (373),  Expect(2) = 5e-68, Method: Compositional matrix adjust.
 Identities = 81/191 (42%), Positives = 116/191 (61%), Gaps = 1/191 (1%)
 Frame = +1

Query  460   FSREKNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVE  639
             F   K + ++  ++P V  +I+    +LI +G +T +VP   P+GC+  YLT Y + N +
Sbjct  180   FFNRKPVKEVEELVPFVIASISSTITELIGMGGKTFLVPGEFPIGCSVVYLTLYKTSNKD  239

Query  640   DYD-DLGCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGF  816
             +YD   GCL W+N+   YH++ L+ ELN LR+ +P+ NIIY D +N+ ++I+  PA  GF
Sbjct  240   EYDPTTGCLKWLNKFGEYHSEKLKAELNRLRKLYPHVNIIYADYYNSLLRIFKEPAKFGF  299

Query  817   SggalraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDG  996
                   ACCG GG YNFN   +CG  G  SC DPS YV WDG H+TEAAYK +   +L+G
Sbjct  300   MDRPFPACCGIGGPYNFNFTRKCGSVGVKSCKDPSKYVGWDGVHMTEAAYKWIADGILNG  359

Query  997   SYTYPSMNALC  1029
              Y  P  +  C
Sbjct  360   PYANPPFDRSC  370


 Score =   139 bits (349),  Expect(2) = 5e-68, Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 97/157 (62%), Gaps = 10/157 (6%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            S++DTGN + L+    L     P     PYGETFFHHPTGR  DGR+I+D IAE  GL  
Sbjct  38   SIADTGNLVGLSDRNQLPVTAFP-----PYGETFFHHPTGRSCDGRIIMDFIAEFVGLPY  92

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQDMI  362
             PP   SK +    N  +GVNFAV G+ AL + F +K  I    TNVS+  QL +F+  +
Sbjct  93   VPPYFGSKNR----NFDKGVNFAVAGATALKSSFLKKRGI-QPHTNVSLRVQLKSFKKSL  147

Query  363  PSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
            P+LC SPSDC++++ N+L ++GE GGNDY     + K
Sbjct  148  PNLCGSPSDCRDMIGNALILMGEIGGNDYNFPFFNRK  184



>ref|XP_004291631.1| PREDICTED: GDSL esterase/lipase At1g28580-like [Fragaria vesca 
subsp. vesca]
Length=389

 Score =   144 bits (362),  Expect(2) = 5e-68, Method: Compositional matrix adjust.
 Identities = 84/188 (45%), Positives = 117/188 (62%), Gaps = 1/188 (1%)
 Frame = +1

Query  472   KNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVEDYDD  651
             KNI  ++  +P+V   I+   ++LIELGA T++VP   P+GC   YLT + + +   Y+ 
Sbjct  193   KNIEQVQTYVPLVITEISSAINELIELGAVTLVVPGNFPIGCLPIYLTKFQTSDKGQYNS  252

Query  652   -LGCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGFSgga  828
               GCL W+N+ A YHN  LQ EL+ ++  HP  NIIY D +NA M  Y  P   GF GG 
Sbjct  253   STGCLNWLNKFAEYHNDQLQIELSRIQRLHPNINIIYADYYNAVMHFYHSPDQFGFIGGT  312

Query  829   lraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDGSYTY  1008
             ++ACCGGGG YN+N   QCG   A++C +P+ ++NWDG H TEAAY+ + K L  G Y  
Sbjct  313   VKACCGGGGPYNYNSSAQCGSIEASACENPAEFINWDGIHFTEAAYRWIVKVLFKGKYNV  372

Query  1009  PSMNALCP  1032
             P ++ L P
Sbjct  373   PGISRLVP  380


 Score =   142 bits (359),  Expect(2) = 5e-68, Method: Compositional matrix adjust.
 Identities = 76/158 (48%), Positives = 101/158 (64%), Gaps = 8/158 (5%)
 Frame = +3

Query  3    SLSDTGN-YISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLA  179
            S++DTGN YIS  +     +   P     PYGET+FHHPTGRCSDGR+I+D IAE  GL 
Sbjct  43   SITDTGNLYISSKNSSFHFF--FP-----PYGETYFHHPTGRCSDGRLIIDFIAEFLGLP  95

Query  180  IPPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQDM  359
               P    K+     NI  GVNFAV+G+ A+ AEF   +   +  TN S+  QLH F+++
Sbjct  96   YVRPYTEVKSNASPQNIEGGVNFAVIGATAMDAEFLAAMGDENDYTNSSLGTQLHWFKEL  155

Query  360  IPSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
            +PSLCN+ S+C  LL +SL ++GE G NDY  +LL+GK
Sbjct  156  LPSLCNTSSNCNKLLSSSLVLVGEIGSNDYNDALLAGK  193



>ref|XP_004968625.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Setaria italica]
Length=374

 Score =   150 bits (378),  Expect(2) = 8e-68, Method: Compositional matrix adjust.
 Identities = 87/186 (47%), Positives = 117/186 (63%), Gaps = 0/186 (0%)
 Frame = +1

Query  460   FSREKNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVE  639
             F + K + D +  +P VA A+ +   +LI+ GA  ++VP  LP+GC+++YLT +P  N  
Sbjct  188   FFKGKTLDDAKTYVPTVAGAVTDATERLIKAGATHLVVPGNLPMGCSSAYLTLHPGRNGS  247

Query  640   DYDDLGCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGFS  819
             DYD  GCL   N  A +HN +LQ++L  LR ++P A I+Y D + AAM     P   GF+
Sbjct  248   DYDAAGCLKTYNDFAQHHNAVLQQKLQALRAKYPQARIMYADYYGAAMSFAKNPKQFGFT  307

Query  820   ggalraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDGS  999
              G LR CCGGGG YNFNP   CG  G++ C DPS Y NWDG HLTEAAY  +  S+L+G 
Sbjct  308   QGPLRTCCGGGGPYNFNPKASCGVRGSSVCTDPSAYANWDGVHLTEAAYHAIANSILNGP  367

Query  1000  YTYPSM  1017
             YT P +
Sbjct  368   YTSPRL  373


 Score =   136 bits (342),  Expect(2) = 8e-68, Method: Compositional matrix adjust.
 Identities = 72/161 (45%), Positives = 104/161 (65%), Gaps = 17/161 (11%)
 Frame = +3

Query  3    SLSDTGNYI---SLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYG  173
            SL+DTGN +    L++  V +Y         PYG T+FH PTGRCSDGR+++D +A+ +G
Sbjct  45   SLTDTGNLLVSSPLSNHIVGRY---------PYGITYFHRPTGRCSDGRLVVDFLAQAFG  95

Query  174  LAIPPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTV-TNVSMNDQLHAF  350
            L + PP L SK    G ++R+GVNFAV G+ A+   F+Q++   D + TN+S++ QL  F
Sbjct  96   LPLLPPYLQSK----GKDLRRGVNFAVGGATAMDPPFFQEIGASDKLWTNLSLSVQLGWF  151

Query  351  QDMIPSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
            + + PSLC+SP  CK     SLF++GE GGNDY ++   GK
Sbjct  152  EQLKPSLCSSPKKCKEYFSKSLFLVGEIGGNDYNYAFFKGK  192



>gb|AFK42362.1| unknown [Medicago truncatula]
Length=375

 Score =   154 bits (390),  Expect(2) = 9e-68, Method: Compositional matrix adjust.
 Identities = 90/182 (49%), Positives = 119/182 (65%), Gaps = 0/182 (0%)
 Frame = +1

Query  484   DIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVEDYDDLGCL  663
             D+   +P V   I     +LI LGA T++VP  LPLGC  +YLT + + + E+YD  GCL
Sbjct  190   DLITYVPRVVSVITSSIRELINLGAVTILVPGSLPLGCNPAYLTMFATKDEEEYDQAGCL  249

Query  664   IWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGFSggalracc  843
              W+N+   Y N+LLQ EL+ LR  +P+ NIIY D FNAA+Q+Y  P   GF G A + CC
Sbjct  250   KWLNKFFEYRNELLQTELHKLRVLYPFTNIIYADYFNAALQLYKSPEQYGFDGNAFKVCC  309

Query  844   ggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDGSYTYPSMNA  1023
             GGGG YN+N    CG+    +C DPS YV+WDGYHLTEAA++ MT++LL+G YT P  + 
Sbjct  310   GGGGPYNYNDSALCGNSEVIACDDPSKYVSWDGYHLTEAAHRWMTEALLEGPYTIPKFSF  369

Query  1024  LC  1029
              C
Sbjct  370   SC  371


 Score =   131 bits (329),  Expect(2) = 9e-68, Method: Compositional matrix adjust.
 Identities = 72/155 (46%), Positives = 94/155 (61%), Gaps = 10/155 (6%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            SL+DTGN   ++          P C + PYG+T FHHP GRCSDGR+I+D IAE + L  
Sbjct  38   SLTDTGNLYFISQPQS------PDCLLPPYGKTHFHHPNGRCSDGRLIVDFIAEFFRLPY  91

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVT-NVSMNDQLHAFQDM  359
              P L       G NI  GVNFAV G+ AL   F+++ E    VT N S+  QL  F+++
Sbjct  92   LKPYL---GFINGGNIEHGVNFAVAGATALDRSFFEEKEFVVEVTANYSLIVQLDGFKEL  148

Query  360  IPSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLL  464
            +PS+CNS S CK +L +SLF++GE GGNDY   L 
Sbjct  149  LPSICNSTSSCKGVLHSSLFIVGEIGGNDYGFPLF  183



>ref|XP_009393075.1| PREDICTED: GDSL esterase/lipase At1g28580-like [Musa acuminata 
subsp. malaccensis]
Length=410

 Score =   166 bits (421),  Expect(2) = 1e-67, Method: Compositional matrix adjust.
 Identities = 91/192 (47%), Positives = 124/192 (65%), Gaps = 1/192 (1%)
 Frame = +1

Query  460   FSREKNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVE  639
             F   +++ +I+  +P V   I+    +LIELGART++VP + PLGC ++YLTYY +   E
Sbjct  204   FMEGRSLREIKSFVPRVVSTISSAIDELIELGARTLLVPGITPLGCNSAYLTYYRTHQAE  263

Query  640   DYDDL-GCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGF  816
             DYD   GCL W+N+ + YHN  LQ EL  L++ HP+A IIY D + A+M I+  P   GF
Sbjct  264   DYDSTTGCLKWLNEFSMYHNGRLQAELRRLQQLHPHATIIYADYYGASMSIFSNPNAFGF  323

Query  817   SggalraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDG  996
                 L ACCGGGG YN+N   QCG EG+T C DPS YV+WDG H+TEA Y+ +   LL G
Sbjct  324   GEEPLVACCGGGGPYNYNFSRQCGSEGSTVCGDPSRYVHWDGLHMTEATYRSIASGLLHG  383

Query  997   SYTYPSMNALCP  1032
              +  P++ + CP
Sbjct  384   PFAAPAIGSTCP  395


 Score =   119 bits (298),  Expect(2) = 1e-67, Method: Compositional matrix adjust.
 Identities = 73/158 (46%), Positives = 103/158 (65%), Gaps = 11/158 (7%)
 Frame = +3

Query  3    SLSDTGNYI-SLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLA  179
            SL+DTGN + +L  DG     G P     PYG T+FH PTGR SDGR+I+D IA+  GL 
Sbjct  61   SLADTGNLLHTLGRDGTRI--GRP-----PYGMTYFHRPTGRFSDGRLIVDFIAQAMGLP  113

Query  180  IPPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQDM  359
            + PP L    +T G ++R+GVNFAV G+ A+   F++K  I+   TNVS+ DQ+H F+ +
Sbjct  114  LLPPYLE---ETTGGDMRKGVNFAVGGATAMENGFFRKRGIHIKFTNVSLGDQIHWFRQL  170

Query  360  IPSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
            +PSLC+S S C+++L  SL ++G  GGNDY    + G+
Sbjct  171  LPSLCSSSSACEDMLHKSLVLMGAIGGNDYNDPFMEGR  208



>ref|XP_009109699.1| PREDICTED: GDSL esterase/lipase At1g28670-like [Brassica rapa]
Length=390

 Score =   152 bits (384),  Expect(2) = 1e-67, Method: Compositional matrix adjust.
 Identities = 83/199 (42%), Positives = 122/199 (61%), Gaps = 1/199 (1%)
 Frame = +1

Query  460   FSREKNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVE  639
             F   K+I  I+ ++P++   I+     L++LG++T +VP   P+GC+ASYLT + +   E
Sbjct  186   FFEGKSINGIKELVPLIIKTISSAIVDLVDLGSKTFLVPGNFPIGCSASYLTLFQNAKEE  245

Query  640   DYDDL-GCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGF  816
             ++D   GC+ W+N+   YHN  L+ EL  L++ +P+ NIIY D +N+    +  PA  GF
Sbjct  246   EHDPFTGCIPWLNEFGEYHNDQLKNELKRLQKLYPHVNIIYADYYNSIHTFFQEPAKYGF  305

Query  817   SggalraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDG  996
                 L ACCG GG+YNF  + +CG  G   C +PS YVNWDGYHLTEAAY+ +   LL+G
Sbjct  306   KNRPLAACCGVGGKYNFTVNEECGYRGVNYCQNPSEYVNWDGYHLTEAAYRKIAHGLLNG  365

Query  997   SYTYPSMNALCPTDAQVAQ  1053
              Y  P+ +  CP  A V +
Sbjct  366   PYATPAFDWSCPGSASVDK  384


 Score =   133 bits (335),  Expect(2) = 1e-67, Method: Compositional matrix adjust.
 Identities = 71/158 (45%), Positives = 98/158 (62%), Gaps = 10/158 (6%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            S++DTGNY+ L+       + +P  + LPYGETFF  P+GR SDGR+I+D IAE  GL  
Sbjct  42   SIADTGNYLRLS-----DVNHLPQAAFLPYGETFFQPPSGRYSDGRLIIDFIAEFLGLPY  96

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQDMI  362
             PP   S+  +      QG+NFAV G+ AL   F  +  I    TNVS+N QL+ F+ ++
Sbjct  97   VPPYFGSQNVS----FEQGINFAVYGATALDRAFLMEKGIESDFTNVSLNVQLNTFKQIL  152

Query  363  PSLCNSPS-DCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
            P+LC S S DC+ +L +SL ++GE GGNDY +    GK
Sbjct  153  PNLCASTSRDCREMLGDSLILMGEIGGNDYNYPFFEGK  190



>ref|XP_003593742.1| GDSL esterase/lipase [Medicago truncatula]
 gb|AES63993.1| GDSL-like lipase/acylhydrolase [Medicago truncatula]
Length=374

 Score =   155 bits (392),  Expect(2) = 1e-67, Method: Compositional matrix adjust.
 Identities = 87/181 (48%), Positives = 119/181 (66%), Gaps = 0/181 (0%)
 Frame = +1

Query  475   NITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVEDYDDL  654
             +IT +R  +P+V   IA+   +LI  GA  ++VP  LP+GC A YLT + S N+ DYD+ 
Sbjct  186   DITHLRDTVPLVVQTIAKAIDELIAEGAVELLVPGNLPVGCNAVYLTLFSSKNISDYDEN  245

Query  655   GCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGFSggalr  834
             GCL   N +A+YHN  L   L  LR ++P+A I+Y D F AAM+ +  P   GF+ GAL 
Sbjct  246   GCLKAFNGLANYHNMQLNFALQTLRTKNPHARIMYADYFGAAMRFFHSPRQYGFTNGALS  305

Query  835   accggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDGSYTYPS  1014
              CCGGGG+YNFN   +CG +G+  C DPSTY NWDG HLTEAAY+ + K L++G ++ P 
Sbjct  306   VCCGGGGRYNFNDSAECGSKGSKVCADPSTYTNWDGIHLTEAAYRHIAKGLINGPFSIPP  365

Query  1015  M  1017
             +
Sbjct  366   L  366


 Score =   130 bits (326),  Expect(2) = 1e-67, Method: Compositional matrix adjust.
 Identities = 71/156 (46%), Positives = 93/156 (60%), Gaps = 8/156 (5%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            SLSDTGN+++  ++        P+    PYGETFF + TGRCSDGR+++D IAE YGL  
Sbjct  38   SLSDTGNFLATGANL------FPAVGHPPYGETFFRNATGRCSDGRLVIDFIAEAYGLPY  91

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQDMI  362
              P L  K       IR GVNFAV G+ AL  EF+ K       TN S+N QL  F+ + 
Sbjct  92   LQPYL--KVIKSNQIIRNGVNFAVAGATALGVEFFNKEMGKLLWTNHSLNIQLGWFKKLK  149

Query  363  PSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSG  470
            PS C +  DC +  + SLFV+GE GGNDY ++  +G
Sbjct  150  PSFCTTKQDCDSYFKRSLFVVGEIGGNDYNYAAFAG  185



>ref|XP_003565548.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Brachypodium 
distachyon]
Length=373

 Score =   150 bits (378),  Expect(2) = 2e-67, Method: Compositional matrix adjust.
 Identities = 86/186 (46%), Positives = 117/186 (63%), Gaps = 0/186 (0%)
 Frame = +1

Query  460   FSREKNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVE  639
             F + K++ D +  +P VA AI +   +LI+ GA  ++VP  LP+GC+++YLT +P  N  
Sbjct  187   FFKGKSLDDAKSYVPTVATAIIDATERLIKGGAMHLVVPGNLPMGCSSAYLTLHPGKNSS  246

Query  640   DYDDLGCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGFS  819
             DYD +GCL   N+ A  HN ++Q++L  LR ++P A I+Y D + AAM     P   GF 
Sbjct  247   DYDSVGCLKTYNEFAQRHNAMVQQKLQGLRRKYPQARIMYADYYGAAMSFAKNPKQFGFK  306

Query  820   ggalraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDGS  999
              G L+ CCGGGG YNFNP   CG  G++ C DPS Y NWDG HLTEAAY  +  S+L G 
Sbjct  307   HGPLKTCCGGGGPYNFNPKTSCGVRGSSVCEDPSAYANWDGVHLTEAAYHAIADSILHGP  366

Query  1000  YTYPSM  1017
             YT P +
Sbjct  367   YTSPRL  372


 Score =   135 bits (339),  Expect(2) = 2e-67, Method: Compositional matrix adjust.
 Identities = 71/158 (45%), Positives = 100/158 (63%), Gaps = 11/158 (7%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            SL+DTGN   L     L +  +      PYG T+FH PTGRCSDGR+++D +A+ +GL +
Sbjct  44   SLTDTGN---LLVSSPLSFTIV---GRFPYGMTYFHRPTGRCSDGRLVVDFLAQAFGLPL  97

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTV-TNVSMNDQLHAFQDM  359
              P L SK    G ++RQGVNFAV G+ A+   F++ +   D + TN+S++ QL  F+ +
Sbjct  98   LQPYLQSK----GKDLRQGVNFAVGGATAMGPPFFEGIGASDKLWTNLSLSVQLDWFEKL  153

Query  360  IPSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
             PSLCNSP +CK     SLF++GE GGNDY ++   GK
Sbjct  154  KPSLCNSPKNCKEYFSKSLFLVGEIGGNDYNYAFFKGK  191



>ref|NP_174180.1| GDSL esterase/lipase [Arabidopsis thaliana]
 sp|Q9FXJ2.1|GDL7_ARATH RecName: Full=GDSL esterase/lipase At1g28580; AltName: Full=Extracellular 
lipase At1g28580; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAG22836.1|AC007508_13 F1K23.18 [Arabidopsis thaliana]
 gb|AAK32776.1|AF361608_1 At1g28580/F1K23_7 [Arabidopsis thaliana]
 gb|AAK76488.1| putative lipase [Arabidopsis thaliana]
 gb|AAL69539.1| At1g28580/F1K23_7 [Arabidopsis thaliana]
 gb|AAL85126.1| putative lipase [Arabidopsis thaliana]
 gb|AEE30996.1| GDSL esterase/lipase [Arabidopsis thaliana]
Length=390

 Score =   146 bits (368),  Expect(2) = 2e-67, Method: Compositional matrix adjust.
 Identities = 83/191 (43%), Positives = 118/191 (62%), Gaps = 1/191 (1%)
 Frame = +1

Query  460   FSREKNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVE  639
             F  +K I +I+ ++P+V   I+    +LI +G RT +VP   P+GC+  YLT + + N+E
Sbjct  187   FFVDKGIEEIKELMPLVITTISSAITELIGMGGRTFLVPGEFPVGCSVLYLTSHQTSNME  246

Query  640   DYDDL-GCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGF  816
             +YD L GCL W+N+    H + L+ ELN L++ +P+ NIIY D +NA   +Y  PA  GF
Sbjct  247   EYDPLTGCLKWLNKFGENHGEQLRAELNRLQKLYPHVNIIYADYYNALFHLYQEPAKFGF  306

Query  817   SggalraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDG  996
                 L ACCG GG YN+    +CG +   SC DPS YV WDG H+TEAAY+LM + +L+G
Sbjct  307   MNRPLSACCGAGGPYNYTVGRKCGTDIVESCDDPSKYVAWDGVHMTEAAYRLMAEGILNG  366

Query  997   SYTYPSMNALC  1029
              Y  P  +  C
Sbjct  367   PYAIPPFDWSC  377


 Score =   138 bits (348),  Expect(2) = 2e-67, Method: Compositional matrix adjust.
 Identities = 71/157 (45%), Positives = 100/157 (64%), Gaps = 9/157 (6%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            S++DTGN + L+    L +   P     PYGE FFHHPTGR S+GR+I+D IAE  GL +
Sbjct  44   SIADTGNLLGLSDPKDLPHMAFP-----PYGENFFHHPTGRFSNGRLIIDFIAEFLGLPL  98

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQDMI  362
             PP   S       N  +GVNFAV G+ AL   F +   I+   TNVS+  QL++F++ +
Sbjct  99   VPPFYGSHNA----NFEKGVNFAVGGATALERSFLEDRGIHFPYTNVSLGVQLNSFKESL  154

Query  363  PSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
            PS+C SPSDC++++EN+L ++GE GGNDY ++    K
Sbjct  155  PSICGSPSDCRDMIENALILMGEIGGNDYNYAFFVDK  191



>ref|XP_006415637.1| hypothetical protein EUTSA_v10009438mg, partial [Eutrema salsugineum]
 gb|ESQ33990.1| hypothetical protein EUTSA_v10009438mg, partial [Eutrema salsugineum]
Length=387

 Score =   146 bits (369),  Expect(2) = 2e-67, Method: Compositional matrix adjust.
 Identities = 83/187 (44%), Positives = 117/187 (63%), Gaps = 1/187 (1%)
 Frame = +1

Query  472   KNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVEDYDD  651
             K+I +++ ++P+V   I+    +LI +G RT++VPS  P+GC  S+LT Y + N E+YD 
Sbjct  191   KSIVEMKELVPLVISTISSVVTELISMGGRTILVPSDFPIGCWPSFLTQYQTSNQEEYDP  250

Query  652   L-GCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGFSgga  828
             L GCL W+N+    HN+ LQ ELN L+  +P   I+Y D  NA +  +  P   GF    
Sbjct  251   LTGCLKWLNEFIERHNEELQAELNRLQRLNPRVTILYADYHNALLHTFQEPTRFGFMNRP  310

Query  829   lraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDGSYTY  1008
             L ACCG GG Y FN   QCG +G   C DPS YV+WDG+HLTE+AY+ +   LL+G+YT 
Sbjct  311   LSACCGSGGPYKFNSVRQCGTKGVDCCVDPSKYVHWDGFHLTESAYRWIALGLLEGNYTV  370

Query  1009  PSMNALC  1029
             P+ +  C
Sbjct  371   PAFDWSC  377


 Score =   138 bits (347),  Expect(2) = 2e-67, Method: Compositional matrix adjust.
 Identities = 70/157 (45%), Positives = 99/157 (63%), Gaps = 9/157 (6%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            S++DTGN + L+       + +P  +  PYGETFFH PTGR S+GR+I+D IAE  GL  
Sbjct  44   SITDTGNLLGLSDA-----NDLPQAAFPPYGETFFHVPTGRFSNGRLIIDFIAEFLGLPY  98

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQDMI  362
             PP   S+      +  +GVNFAV G+ AL   F +   I+   TNVS+  QL +F++ +
Sbjct  99   VPPYFGSQ----NGSFEKGVNFAVAGATALERVFLESRGIHYAYTNVSLRVQLQSFKESL  154

Query  363  PSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
            P+LC SPSDC+ ++ N+L ++GE GGNDY +  L GK
Sbjct  155  PNLCGSPSDCREMIGNALVIVGEIGGNDYNYGFLVGK  191



>emb|CDY63998.1| BnaA07g36520D [Brassica napus]
Length=389

 Score =   155 bits (393),  Expect(2) = 2e-67, Method: Compositional matrix adjust.
 Identities = 87/197 (44%), Positives = 124/197 (63%), Gaps = 1/197 (1%)
 Frame = +1

Query  460   FSREKNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVE  639
             F  +K+I +I+ + P++  AI++    LI+LG +T +VP   P GC+A+YLT + +   E
Sbjct  185   FFEDKSINEIKELTPLIIKAISDAIVDLIDLGGKTFLVPGSFPAGCSAAYLTLFQTAKEE  244

Query  640   DYDDL-GCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGF  816
             DYD L GCL W+N    +H++ L+ E+  LR+R+P+ NIIY D +N+  ++Y  P   GF
Sbjct  245   DYDPLTGCLPWLNDFGKHHDEQLKTEIKRLRKRYPHVNIIYADYYNSLYRLYQEPTKYGF  304

Query  817   SggalraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDG  996
                 L ACCG GGQYNF    +CG EG   C +PS Y+NWDGYHLTEAA++ M   +L+G
Sbjct  305   KNRPLAACCGVGGQYNFTIGEECGYEGVGYCQNPSEYINWDGYHLTEAAHQKMAHGILNG  364

Query  997   SYTYPSMNALCPTDAQV  1047
              Y  P+ N  C   A V
Sbjct  365   PYAAPAFNWSCLDAASV  381


 Score =   129 bits (323),  Expect(2) = 2e-67, Method: Compositional matrix adjust.
 Identities = 71/158 (45%), Positives = 97/158 (61%), Gaps = 10/158 (6%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            S++DTGNY+ L+       +  P  + LPYGETFF  PTGR SDGR+I+D IAE  GL  
Sbjct  41   SIADTGNYLHLS-----DVNHPPQAAFLPYGETFFSVPTGRNSDGRLIIDFIAEFLGLPY  95

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQDMI  362
             PP   S+  +      QGVNFAV G+ AL   F+ +  I    TNVS++ QL+ F+ ++
Sbjct  96   VPPYFGSQNVS----FEQGVNFAVYGATALDRAFFIEKGIVSDFTNVSLSVQLNTFKQIL  151

Query  363  PSLCNSPS-DCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
            P+LC S S DC+ +L +SL ++GE GGNDY +     K
Sbjct  152  PTLCASSSRDCREMLGDSLILMGEIGGNDYNYPFFEDK  189



>emb|CDY64716.1| BnaCnng44670D [Brassica napus]
Length=389

 Score =   155 bits (391),  Expect(2) = 2e-67, Method: Compositional matrix adjust.
 Identities = 85/197 (43%), Positives = 124/197 (63%), Gaps = 1/197 (1%)
 Frame = +1

Query  460   FSREKNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVE  639
             F  +K+I +I+ + P++  AI++    LI+LG +T +VP   P+GC+A+YLT + +   +
Sbjct  185   FFEDKSINEIKELTPLIIKAISDAIVDLIDLGGKTFLVPGSFPVGCSAAYLTLFQTAKEK  244

Query  640   DYDDL-GCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGF  816
             DYD L GCL W+N    +H++ L+ E+  LR+ +P+ NIIY D +N+  ++Y  P   GF
Sbjct  245   DYDPLTGCLPWLNDFGKHHDEQLKTEIRRLRKLYPHVNIIYADYYNSLYRLYQKPTKYGF  304

Query  817   SggalraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDG  996
                 L ACCG GGQYNF    +CG EG   C +PS Y+NWDGYHLTEAA++ M   +L+G
Sbjct  305   KNRPLAACCGVGGQYNFTIGEECGYEGVGYCQNPSEYINWDGYHLTEAAHQKMAHGILNG  364

Query  997   SYTYPSMNALCPTDAQV  1047
              Y  P+ N  C   A V
Sbjct  365   PYATPAFNWSCLDAASV  381


 Score =   129 bits (325),  Expect(2) = 2e-67, Method: Compositional matrix adjust.
 Identities = 72/158 (46%), Positives = 96/158 (61%), Gaps = 10/158 (6%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            S++DTGNY+ L        +  P  + LPYGETFF  PTGR SDGR+I+D IAE  GL  
Sbjct  41   SIADTGNYLHL-----FDVNHPPQAAFLPYGETFFSVPTGRNSDGRLIIDFIAEFLGLPY  95

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQDMI  362
             PP   S+  +      QGVNFAV G+ AL   F  +  I    TNVS++ QL+ F+ ++
Sbjct  96   VPPYFGSQNVS----FEQGVNFAVYGATALDRAFLIEKGIVSDFTNVSLSVQLNTFKQIL  151

Query  363  PSLCNSPS-DCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
            P+LC S S DC+ +LE+SL ++GE GGNDY +     K
Sbjct  152  PTLCASSSHDCRKVLEDSLILMGELGGNDYNYPFFEDK  189



>ref|XP_004485880.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Cicer arietinum]
Length=375

 Score =   150 bits (379),  Expect(2) = 2e-67, Method: Compositional matrix adjust.
 Identities = 87/182 (48%), Positives = 120/182 (66%), Gaps = 0/182 (0%)
 Frame = +1

Query  475   NITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVEDYDDL  654
             NI+D++  +P+V   I +   +LI  GA  ++VP  LP+GC+A YLT + S N+EDYD  
Sbjct  187   NISDLQATVPLVVEEITKTITELIAEGAVELLVPGNLPIGCSAVYLTLFRSKNIEDYDKN  246

Query  655   GCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGFSggalr  834
             GCL   N  A YHN+ L   L  LR+++P+A IIY + F AA + +  P + GF+ GA R
Sbjct  247   GCLKAFNGFAKYHNKQLNLALETLRQKNPHARIIYANYFGAANRFFHAPRHYGFTNGASR  306

Query  835   accggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDGSYTYPS  1014
             ACCGGGG YNFN   +CG   + +C DP+TY NWDG HLTEAAY+ + K L++G +T P 
Sbjct  307   ACCGGGGPYNFNNSARCGHSNSKACADPTTYANWDGIHLTEAAYRHIAKGLIEGPFTNPP  366

Query  1015  MN  1020
             +N
Sbjct  367   LN  368


 Score =   134 bits (337),  Expect(2) = 2e-67, Method: Compositional matrix adjust.
 Identities = 75/157 (48%), Positives = 95/157 (61%), Gaps = 9/157 (6%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            SLSDTGN+  L S  +L     P    LPYGETFF H TGRCSDGR+++D IAE YGL  
Sbjct  38   SLSDTGNF--LASGAIL----FPVIGKLPYGETFFQHATGRCSDGRLVIDFIAEAYGLPY  91

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTV-TNVSMNDQLHAFQDM  359
              P L  K       I  GVNFAV G+ AL  EF+ +  +   + TN S+N QL  F+ +
Sbjct  92   LQPYL--KVTKDHQKIYNGVNFAVAGATALDVEFFIQEGLAKLLWTNDSLNIQLGWFKKL  149

Query  360  IPSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSG  470
             PSLC +  DC +  + SLFV+GE GGNDY ++  +G
Sbjct  150  KPSLCTTKQDCDSYFKKSLFVVGEIGGNDYNYAAFAG  186



>ref|NP_174186.1| GDSL esterase/lipase [Arabidopsis thaliana]
 sp|Q3E7I6.1|GDL11_ARATH RecName: Full=GDSL esterase/lipase At1g28650; AltName: Full=Extracellular 
lipase At1g28650; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AEE31009.1| GDSL esterase/lipase [Arabidopsis thaliana]
Length=385

 Score =   151 bits (382),  Expect(2) = 3e-67, Method: Compositional matrix adjust.
 Identities = 81/190 (43%), Positives = 120/190 (63%), Gaps = 0/190 (0%)
 Frame = +1

Query  460   FSREKNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVE  639
             F   K+I +I+ ++P++  AI+     LI+LG +T +VP   P+GC+ +YLT + +  VE
Sbjct  188   FFEGKSINEIKELVPLIIKAISSAIVDLIDLGGKTFLVPGNFPIGCSTAYLTLFQTATVE  247

Query  640   DYDDLGCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGFS  819
                  GC+ W+N+   +HN+ L+ EL  L++ +P+ NIIY D +N+   ++  PA  GF 
Sbjct  248   HDPFTGCIPWLNKFGEHHNEQLKIELKQLQKLYPHVNIIYADYYNSLYGLFQEPAKYGFK  307

Query  820   ggalraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDGS  999
                L ACCG GGQYNF    +CG+ G + C +PS YVNWDGYHLTEA Y+ M + LL+G 
Sbjct  308   NRPLAACCGVGGQYNFTIGKECGENGVSYCQNPSEYVNWDGYHLTEATYQKMAQGLLNGR  367

Query  1000  YTYPSMNALC  1029
             YT P+ +  C
Sbjct  368   YTTPAFDWSC  377


 Score =   132 bits (332),  Expect(2) = 3e-67, Method: Compositional matrix adjust.
 Identities = 68/158 (43%), Positives = 100/158 (63%), Gaps = 10/158 (6%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            S++DTGNY+ L++      + +P  + LPYGE+FFH P+GR SDGR+++D IAE  GL  
Sbjct  44   SIADTGNYVHLSN-----VNNLPQAAFLPYGESFFHPPSGRYSDGRLVIDFIAEFLGLPY  98

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQDMI  362
             PP   S+  +      QG+NFAV G+ AL   F  K  I    TN+S++ QL+ F+ ++
Sbjct  99   VPPYFGSQNVS----FNQGINFAVYGATALDRAFLVKQGIKSDFTNISLSVQLNTFKQIL  154

Query  363  PSLCNSPS-DCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
            P+LC S + DC+ +L +SL ++GE GGNDY +    GK
Sbjct  155  PNLCASSTRDCREMLGDSLILMGEIGGNDYNYPFFEGK  192



>dbj|BAF02148.1| putative lipase [Arabidopsis thaliana]
Length=353

 Score =   151 bits (382),  Expect(2) = 3e-67, Method: Compositional matrix adjust.
 Identities = 81/190 (43%), Positives = 120/190 (63%), Gaps = 0/190 (0%)
 Frame = +1

Query  460   FSREKNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVE  639
             F   K+I +I+ ++P++  AI+     LI+LG +T +VP   P+GC+ +YLT + +  VE
Sbjct  156   FFEGKSINEIKELVPLIIKAISSAIVDLIDLGGKTFLVPGNFPIGCSTAYLTLFQTATVE  215

Query  640   DYDDLGCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGFS  819
                  GC+ W+N+   +HN+ L+ EL  L++ +P+ NIIY D +N+   ++  PA  GF 
Sbjct  216   HDPFTGCIPWLNKFGEHHNEQLKIELKQLQKLYPHVNIIYADYYNSLYGLFQEPAKYGFK  275

Query  820   ggalraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDGS  999
                L ACCG GGQYNF    +CG+ G + C +PS YVNWDGYHLTEA Y+ M + LL+G 
Sbjct  276   NRPLAACCGVGGQYNFTIGKECGENGVSYCQNPSEYVNWDGYHLTEATYQKMAQGLLNGR  335

Query  1000  YTYPSMNALC  1029
             YT P+ +  C
Sbjct  336   YTTPAFDWSC  345


 Score =   132 bits (333),  Expect(2) = 3e-67, Method: Compositional matrix adjust.
 Identities = 68/158 (43%), Positives = 100/158 (63%), Gaps = 10/158 (6%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            S++DTGNY+ L++      + +P  + LPYGE+FFH P+GR SDGR+++D IAE  GL  
Sbjct  12   SIADTGNYVHLSN-----VNNLPQAAFLPYGESFFHPPSGRYSDGRLVIDFIAEFLGLPY  66

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQDMI  362
             PP   S+  +      QG+NFAV G+ AL   F  K  I    TN+S++ QL+ F+ ++
Sbjct  67   VPPYFGSQNVS----FNQGINFAVYGATALDRAFLVKQGIKSDFTNISLSVQLNTFKQIL  122

Query  363  PSLCNSPS-DCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
            P+LC S + DC+ +L +SL ++GE GGNDY +    GK
Sbjct  123  PNLCASSTRDCREMLGDSLILMGEIGGNDYNYPFFEGK  160



>gb|AAX62802.1| lipase 2 [Brassica napus]
Length=389

 Score =   155 bits (391),  Expect(2) = 4e-67, Method: Compositional matrix adjust.
 Identities = 87/197 (44%), Positives = 124/197 (63%), Gaps = 1/197 (1%)
 Frame = +1

Query  460   FSREKNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVE  639
             F  +K+I +I+ + P++  AI++    LI+LG +T +VP   P GC+A+YLT + +   E
Sbjct  185   FFEDKSINEIKELTPLIIKAISDAIVDLIDLGGKTFLVPGSFPGGCSAAYLTLFQTAKEE  244

Query  640   DYDDL-GCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGF  816
             DYD L GCL W+N    +H++ L+ E+  LR+R+P+ NIIY D +N+  ++Y  P   GF
Sbjct  245   DYDPLTGCLPWLNDFGKHHDEQLKTEIKRLRKRYPHVNIIYADYYNSLYRLYQEPTKYGF  304

Query  817   SggalraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDG  996
                 L ACCG GGQYNF    +CG EG   C +PS Y+NWDGYHLTEAA++ M   +L+G
Sbjct  305   KNRPLAACCGVGGQYNFTIGEECGYEGVGYCQNPSEYINWDGYHLTEAAHQKMAHGILNG  364

Query  997   SYTYPSMNALCPTDAQV  1047
              Y  P+ N  C   A V
Sbjct  365   PYAAPAFNWSCLDAASV  381


 Score =   129 bits (323),  Expect(2) = 4e-67, Method: Compositional matrix adjust.
 Identities = 71/158 (45%), Positives = 97/158 (61%), Gaps = 10/158 (6%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            S++DTGNY+ L+       +  P  + LPYGETFF  PTGR SDGR+I+D IAE  GL  
Sbjct  41   SIADTGNYLHLS-----DVNHPPQAAFLPYGETFFSVPTGRNSDGRLIIDFIAEFLGLPY  95

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQDMI  362
             PP   S+  +      QGVNFAV G+ AL   F+ +  I    TNVS++ QL+ F+ ++
Sbjct  96   VPPYFGSQNVS----FEQGVNFAVYGATALDRAFFIEKGIVSDFTNVSLSVQLNTFKQIL  151

Query  363  PSLCNSPS-DCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
            P+LC S S DC+ +L +SL ++GE GGNDY +     K
Sbjct  152  PTLCASSSRDCREMLGDSLILMGEIGGNDYNYPFFEDK  189



>ref|XP_009102890.1| PREDICTED: GDSL esterase/lipase At1g28670-like [Brassica rapa]
Length=389

 Score =   155 bits (391),  Expect(2) = 4e-67, Method: Compositional matrix adjust.
 Identities = 86/197 (44%), Positives = 124/197 (63%), Gaps = 1/197 (1%)
 Frame = +1

Query  460   FSREKNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVE  639
             F  +K+I +I+ + P++  AI++    LI+LG +T +VP   P GC+A+YLT + +   E
Sbjct  185   FFEDKSINEIKELTPLIIKAISDAIVDLIDLGGKTFLVPGSFPAGCSAAYLTLFQTAKEE  244

Query  640   DYDDL-GCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGF  816
             DYD L GCL W+N    +H++ L+ E+  LR+R+P+ N+IY D +N+  ++Y  P   GF
Sbjct  245   DYDPLTGCLPWLNDFGKHHDEQLKTEIKRLRKRYPHVNVIYADYYNSLYRLYQEPTKYGF  304

Query  817   SggalraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDG  996
                 L ACCG GGQYNF    +CG EG   C +PS Y+NWDGYHLTEAA++ M   +L+G
Sbjct  305   KNRPLAACCGVGGQYNFTIGEECGYEGVGYCQNPSEYINWDGYHLTEAAHQKMAHGILNG  364

Query  997   SYTYPSMNALCPTDAQV  1047
              Y  P+ N  C   A V
Sbjct  365   PYAAPAFNWSCLDAASV  381


 Score =   129 bits (323),  Expect(2) = 4e-67, Method: Compositional matrix adjust.
 Identities = 71/158 (45%), Positives = 97/158 (61%), Gaps = 10/158 (6%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            S++DTGNY+ L+       +  P  + LPYGETFF  PTGR SDGR+I+D IAE  GL  
Sbjct  41   SIADTGNYLHLS-----DVNHPPQAAFLPYGETFFSVPTGRNSDGRLIIDFIAEFLGLPY  95

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQDMI  362
             PP   S+  +      QGVNFAV G+ AL   F+ +  I    TNVS++ QL+ F+ ++
Sbjct  96   VPPYFGSQNVS----FEQGVNFAVYGATALDRAFFIEKGIVSDFTNVSLSVQLNTFKQIL  151

Query  363  PSLCNSPS-DCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
            P+LC S S DC+ +L +SL ++GE GGNDY +     K
Sbjct  152  PTLCASSSRDCREMLGDSLILMGEIGGNDYNYPFFEDK  189



>ref|NP_001057786.1| Os06g0531900 [Oryza sativa Japonica Group]
 dbj|BAD54230.1| putative lipase [Oryza sativa Japonica Group]
 dbj|BAF19700.1| Os06g0531900 [Oryza sativa Japonica Group]
 dbj|BAG87915.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG90659.1| unnamed protein product [Oryza sativa Japonica Group]
Length=395

 Score =   147 bits (372),  Expect(2) = 4e-67, Method: Compositional matrix adjust.
 Identities = 81/180 (45%), Positives = 117/180 (65%), Gaps = 2/180 (1%)
 Frame = +1

Query  478   ITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVEDYD-DL  654
              ++++  +P+VA AIA G  KLIELGA+ ++VP VLP+GC   YLT Y + +  DY+   
Sbjct  212   FSEVKTYVPLVAKAIANGVEKLIELGAKDLLVPGVLPIGCFPLYLTLYNTSSKADYNART  271

Query  655   GCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGFSggalr  834
             GCL   N++A +HN+ L+++L+ L++++P   I+Y D F AAMQ    P N GFS     
Sbjct  272   GCLRRYNRLAFHHNRELKQQLDELQKKYPETKIMYGDYFKAAMQFVVSPGNFGFSSTMQA  331

Query  835   a-ccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDGSYTYP  1011
                 GG G YNFN   +CG+EGA+ C +PS+YV+WDG H+TEAAY+ +    L+G Y  P
Sbjct  332   CCGAGGQGNYNFNLKKKCGEEGASVCSNPSSYVSWDGIHMTEAAYRYVANGWLNGPYAEP  391


 Score =   136 bits (342),  Expect(2) = 4e-67, Method: Compositional matrix adjust.
 Identities = 75/160 (47%), Positives = 99/160 (62%), Gaps = 18/160 (11%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIP---SCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYG  173
            SLSD GN I+         DGIP   + +  PYG TFF  PTGRCS+GR+++D +AEH+G
Sbjct  64   SLSDAGNLIA---------DGIPKSLTTARAPYGMTFFGRPTGRCSNGRLVVDFLAEHFG  114

Query  174  LAIPPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNV-SMNDQLHAF  350
            L +PP   +SKA   G +  +G NFA+ G+ AL   F+++  I   + N  S+N Q+   
Sbjct  115  LPLPP---ASKAH--GADFSKGANFAITGATALEYSFFKQHGIDQRIWNTGSINTQIGWL  169

Query  351  QDMIPSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSG  470
            QDM PSLC S  +CK+    SLFV+GEFGGNDY   L SG
Sbjct  170  QDMKPSLCKSDQECKDYFGKSLFVVGEFGGNDYNAPLFSG  209



>ref|XP_010460659.1| PREDICTED: GDSL esterase/lipase At1g28670-like [Camelina sativa]
Length=389

 Score =   148 bits (374),  Expect(2) = 5e-67, Method: Compositional matrix adjust.
 Identities = 81/199 (41%), Positives = 121/199 (61%), Gaps = 2/199 (1%)
 Frame = +1

Query  460   FSREKNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVE  639
             F   K+I +I+ ++P++  AI+     L++LG +T +VP   P GC+A+YLT + +   +
Sbjct  186   FFEGKSINEIKELVPLIIKAISSAIVDLVDLGGKTFLVPGGFPAGCSAAYLTLFQTVAEQ  245

Query  640   DYDDL-GCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGF  816
             D+D L GC+ W+N+   +HN+ L+ EL  L++ +P+ NIIY D  N+  + +  PA  GF
Sbjct  246   DHDPLTGCIPWLNEFGEHHNEQLKTELKRLQKLYPHVNIIYADYHNSLYRFFQEPAKYGF  305

Query  817   SggalraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDG  996
                    C  GG QYNF  D +CG EG   C +PS +VNWDGYHLTEA Y+ M +SLL+G
Sbjct  306   KNPLAACCGVGG-QYNFTIDKECGYEGVGYCQNPSEHVNWDGYHLTEATYQKMAQSLLNG  364

Query  997   SYTYPSMNALCPTDAQVAQ  1053
              Y  P+ +  C     VA+
Sbjct  365   PYATPAFDWSCLDSDSVAK  383


 Score =   135 bits (339),  Expect(2) = 5e-67, Method: Compositional matrix adjust.
 Identities = 72/158 (46%), Positives = 99/158 (63%), Gaps = 10/158 (6%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            S++DTGNY+ L+       + +P  + LPYGE+FFH PTGR SDGR+I+D IAE  GL  
Sbjct  42   SIADTGNYLHLS-----DINHLPQTAFLPYGESFFHPPTGRASDGRLIIDFIAEFLGLPY  96

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQDMI  362
             PP   S+  +      QG+NFAV G+ AL   F     I    TNVS++ QL+ F+ ++
Sbjct  97   VPPYFGSQNVS----FEQGINFAVYGATALDRAFLVGKGIETDFTNVSLSVQLNTFKQIL  152

Query  363  PSLCNSPS-DCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
            P+LC S S DC+ +LE+SL ++GE GGNDY +    GK
Sbjct  153  PNLCASSSLDCREMLEDSLILMGEIGGNDYNYPFFEGK  190



>ref|XP_010460657.1| PREDICTED: GDSL esterase/lipase At1g28580-like isoform X1 [Camelina 
sativa]
Length=397

 Score =   148 bits (374),  Expect(2) = 5e-67, Method: Compositional matrix adjust.
 Identities = 81/191 (42%), Positives = 118/191 (62%), Gaps = 1/191 (1%)
 Frame = +1

Query  460   FSREKNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVE  639
             F   K+I +++ +IP+V   ++    +LI +G +T +VP   P+GC  +YLT Y + N+E
Sbjct  187   FFVGKSIQEVKELIPLVITTVSSAITELIGMGGKTFLVPGQFPMGCLVAYLTLYQTSNIE  246

Query  640   DYDDL-GCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGF  816
             +YD L GCL W+N+    H+  L+ ELN +++ +P+ NIIY D +NA ++ Y  PA  GF
Sbjct  247   EYDPLTGCLTWLNKFGENHDSQLRAELNRIQKLYPHVNIIYADYYNALLRFYQEPAKFGF  306

Query  817   SggalraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDG  996
                 L ACCG GG YN+    QCG +    C DPS YV WDG H+TEAAY+LM++ +L G
Sbjct  307   MDRPLCACCGVGGPYNYTSVSQCGTDVVEGCSDPSKYVAWDGVHMTEAAYRLMSEGILKG  366

Query  997   SYTYPSMNALC  1029
              Y  P  +  C
Sbjct  367   PYAVPPFDWSC  377


 Score =   135 bits (339),  Expect(2) = 5e-67, Method: Compositional matrix adjust.
 Identities = 72/157 (46%), Positives = 99/157 (63%), Gaps = 9/157 (6%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            S++DTGN++ L+    L +   P     PYGETFFHHPTGR S+GRVI+D IAE   L +
Sbjct  44   SIADTGNFLGLSDPNNLPHFAFP-----PYGETFFHHPTGRFSNGRVIIDFIAEFLSLPL  98

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQDMI  362
             PP   S+      N  +GVNFAV G+ AL   F ++  I    TNVS+  QL +F++ +
Sbjct  99   VPPFYGSQ----NANFEKGVNFAVGGATALEHSFLEERGIDFFNTNVSLAVQLSSFKESL  154

Query  363  PSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
            P+LC SPSDC +++EN+L ++GE G NDY +    GK
Sbjct  155  PNLCGSPSDCTDMMENALILMGEIGLNDYFYLFFVGK  191



>ref|XP_010499396.1| PREDICTED: GDSL esterase/lipase At1g28580-like [Camelina sativa]
Length=397

 Score =   147 bits (370),  Expect(2) = 6e-67, Method: Compositional matrix adjust.
 Identities = 86/191 (45%), Positives = 115/191 (60%), Gaps = 1/191 (1%)
 Frame = +1

Query  460   FSREKNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVE  639
             F   K+I +I+ +IP+V   I+    +LI +G RT +VP   PLGC+A+YLT Y + NVE
Sbjct  187   FFVNKSIEEIKELIPLVITTISSAITELIGMGGRTFLVPGDFPLGCSATYLTLYQTSNVE  246

Query  640   DYDDL-GCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGF  816
              YD   GCL W+N+    H++ LQ EL  L++ +P+ NIIY D + A ++IY  P   GF
Sbjct  247   AYDPWTGCLTWLNKFGENHDEQLQAELKKLQKLYPHVNIIYADYYKALLRIYQEPEKFGF  306

Query  817   SggalraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDG  996
                 L ACCG GG YNF    QCG +    C  PS YV WDG H+TEAAY L+ + +L G
Sbjct  307   MNRPLSACCGVGGPYNFTSFWQCGTDVVEGCNYPSKYVAWDGVHMTEAAYSLIAEGILKG  366

Query  997   SYTYPSMNALC  1029
             +Y  P  N  C
Sbjct  367   AYAVPPFNWSC  377


 Score =   136 bits (343),  Expect(2) = 6e-67, Method: Compositional matrix adjust.
 Identities = 69/157 (44%), Positives = 98/157 (62%), Gaps = 9/157 (6%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            S++DTGN + L+    L +   P     PYGETFFH PTGR S+GR+I+D IAE  GL +
Sbjct  44   SIADTGNLLGLSGPNELPHVAFP-----PYGETFFHRPTGRFSNGRLIIDFIAEFLGLPL  98

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQDMI  362
             PP   S+      N  +GVNFAV G+ AL     ++  I+   TN+S+  QL +F+  +
Sbjct  99   VPPFYGSQ----NANFEKGVNFAVAGATALERSLLEERGIHFPYTNISLGVQLSSFKASL  154

Query  363  PSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
            P LC SPSDC++++EN+L ++GE GGNDY ++    K
Sbjct  155  PKLCGSPSDCRDMIENALILMGEIGGNDYNYAFFVNK  191



>ref|NP_001241470.1| uncharacterized protein LOC100816865 [Glycine max]
 gb|ACU18909.1| unknown [Glycine max]
 gb|KHN18922.1| GDSL esterase/lipase [Glycine soja]
Length=386

 Score =   159 bits (401),  Expect(2) = 6e-67, Method: Compositional matrix adjust.
 Identities = 89/190 (47%), Positives = 123/190 (65%), Gaps = 2/190 (1%)
 Frame = +1

Query  460   FSREKNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVE  639
             FS  K+I +++  +P V +AI+   ++LI LGART++VP   P+GC+ASYLT Y +    
Sbjct  188   FSIRKSIVEVKTYVPYVINAISSAINELIGLGARTLIVPGNFPIGCSASYLTIYETEYKN  247

Query  640   DYDDLGCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGFS  819
              YD  GCL W+N+ A Y+N  LQ EL+ LR  +P ANIIY D FNAA+  Y  P   GF+
Sbjct  248   QYDQFGCLKWLNKFAEYYNNELQSELDKLRRLYPRANIIYADYFNAALLFYRDPTKFGFT  307

Query  820   ggalraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDGS  999
                L+ CCG GG YN+N    CG+ G ++C DPS ++ WD  HLTEAAY+++ + L+ G 
Sbjct  308   --GLKVCCGMGGPYNYNTSADCGNPGVSACDDPSKHIGWDSVHLTEAAYRIVAEGLIKGP  365

Query  1000  YTYPSMNALC  1029
             Y  P +N LC
Sbjct  366   YCLPQINTLC  375


 Score =   124 bits (312),  Expect(2) = 6e-67, Method: Compositional matrix adjust.
 Identities = 69/152 (45%), Positives = 93/152 (61%), Gaps = 9/152 (6%)
 Frame = +3

Query  3    SLSDTGN-YISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLA  179
            SL+DTGN Y S        Y     C   PYGETFFHH TGRCSDGR+I+D IAE  G+ 
Sbjct  43   SLADTGNLYFS-------PYPPTNHCLFPPYGETFFHHVTGRCSDGRLIIDFIAESLGIP  95

Query  180  IPPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQDM  359
               P L  K     +    G NFAV+G+ AL   F+++  +    TN S++ QL+ F+++
Sbjct  96   RVKPYLGIKNIGRWSVEEGGANFAVIGATALDFSFFEERGV-PVKTNYSLSAQLNWFKEL  154

Query  360  IPSLCNSPSDCKNLLENSLFVLGEFGGNDYTH  455
            +P+LCNS + C  +L NSLF++GE GGND+ H
Sbjct  155  LPTLCNSSTGCHEVLRNSLFLVGEIGGNDFNH  186



>ref|XP_010480702.1| PREDICTED: uncharacterized protein LOC104759479 [Camelina sativa]
Length=826

 Score =   145 bits (365),  Expect(2) = 6e-67, Method: Compositional matrix adjust.
 Identities = 81/191 (42%), Positives = 116/191 (61%), Gaps = 1/191 (1%)
 Frame = +1

Query  460   FSREKNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVE  639
             F   K+I +++ +IP+V   ++    +LI +G +T +VP   P+GC  +YLT Y + N E
Sbjct  186   FFVGKSIQEVKELIPLVITTVSSAITELIGMGGKTFLVPGEFPMGCLVAYLTLYQTSNKE  245

Query  640   DYDDL-GCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGF  816
             +YD L GCL W+N+    H+  L+ ELN L++ +P+ NIIY D +NA ++ Y  PA  GF
Sbjct  246   EYDPLTGCLTWLNKFGENHDGQLRAELNRLQKLYPHVNIIYADYYNALLRFYQEPAKFGF  305

Query  817   SggalraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDG  996
                 L ACCG GG YN+    QCG +    C DPS YV WDG H+TEAAY+L++  +L G
Sbjct  306   MDRPLSACCGVGGPYNYTSVTQCGTDVVEGCSDPSKYVAWDGVHMTEAAYRLISDGILKG  365

Query  997   SYTYPSMNALC  1029
              Y  P  +  C
Sbjct  366   PYAVPPFDWSC  376


 Score =   138 bits (347),  Expect(2) = 6e-67, Method: Compositional matrix adjust.
 Identities = 72/157 (46%), Positives = 101/157 (64%), Gaps = 9/157 (6%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            S+SDTGN++ L+       + +P  + LPYGETFFHHPTGR S+GR+I+D IAE   L +
Sbjct  43   SVSDTGNFLGLSDP-----NNLPHFAFLPYGETFFHHPTGRFSNGRLIIDFIAEFLSLPL  97

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQDMI  362
             PP   S+      N  +GVNFAV G+ AL   F ++  I    TNVS+  QL +F++ +
Sbjct  98   VPPFYGSQNA----NFEKGVNFAVAGATALEHSFLEERGIDFFNTNVSLAVQLSSFKESL  153

Query  363  PSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
            P+LC SPSDC +++EN+L ++GE G NDY +    GK
Sbjct  154  PNLCGSPSDCTDMMENALILMGEIGLNDYFYLFFVGK  190


 Score =   141 bits (355),  Expect(2) = 6e-66, Method: Compositional matrix adjust.
 Identities = 84/197 (43%), Positives = 118/197 (60%), Gaps = 1/197 (1%)
 Frame = +1

Query  460   FSREKNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVE  639
             F  EK+I +++ ++P+V   I+    +LI +G +T +VP   P+GC+  YLT Y + N+E
Sbjct  614   FFVEKSIEEVKELVPLVIRTISSAITELIGMGGKTFLVPGEFPMGCSVVYLTIYHTANME  673

Query  640   DYDDL-GCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGF  816
             +YD L GCL  +N+   YHN+ LQ ELN L++ +P  NIIY D +N    I+  PA  GF
Sbjct  674   EYDPLTGCLKLLNKFGEYHNEQLQVELNRLQKLYPRVNIIYADYYNVLSSIFQEPAKFGF  733

Query  817   SggalraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDG  996
                 L ACCG GG YN     +CG +    C DPS YV WDG HLTEAAY L+ + +L G
Sbjct  734   INRPLSACCGFGGPYNDTVGKKCGTDVVEGCSDPSKYVAWDGVHLTEAAYSLIAEGILSG  793

Query  997   SYTYPSMNALCPTDAQV  1047
              YT P  +  C +  ++
Sbjct  794   PYTIPPFDWSCLSSRKI  810


 Score =   139 bits (349),  Expect(2) = 6e-66, Method: Compositional matrix adjust.
 Identities = 71/157 (45%), Positives = 101/157 (64%), Gaps = 9/157 (6%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            S +DTGN + L+       +  P  ++ PYGETFFHHPTGR S+GR+I+D IAE  GL +
Sbjct  471  STADTGNLLGLSDP-----NDHPQVALPPYGETFFHHPTGRFSNGRLIIDFIAEFLGLPL  525

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQDMI  362
             PP   S+      N  +GVNFAV G+ AL   F ++  I+   TNVS+  QL +F++ +
Sbjct  526  VPPFYGSQNA----NFEKGVNFAVGGATALKRSFLEERGIHFPYTNVSLGVQLSSFKESL  581

Query  363  PSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
            P LC SPSDC++++EN+L ++GE GGNDY ++    K
Sbjct  582  PKLCGSPSDCRDMIENALILMGEIGGNDYNYAFFVEK  618



>ref|XP_004965533.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Setaria italica]
Length=400

 Score =   144 bits (363),  Expect(2) = 7e-67, Method: Compositional matrix adjust.
 Identities = 81/180 (45%), Positives = 114/180 (63%), Gaps = 2/180 (1%)
 Frame = +1

Query  478   ITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVEDYD-DL  654
              +D++  +P+VA AIA G  KLIELGA  ++VP VLP+GC   YLT Y +    DY+   
Sbjct  216   FSDVKTYVPLVAKAIANGVEKLIELGATDLLVPGVLPIGCFPLYLTLYNTSRKSDYNART  275

Query  655   GCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGFSggalr  834
             GCL   N++A +HN+ L+++L+ L++++P   I+Y D F AAMQ    P   GFS     
Sbjct  276   GCLRRYNRLAYHHNRELKQQLDELQKKYPVTKIMYGDYFKAAMQFVVNPGKFGFSTALQA  335

Query  835   a-ccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDGSYTYP  1011
                 GG G YNFN   +CG++GA+ C +PS+YV+WDG H+TEAAYK +    L+G Y  P
Sbjct  336   CCGAGGQGNYNFNLKKKCGEQGASVCSNPSSYVSWDGIHMTEAAYKKVADGWLNGPYAEP  395


 Score =   139 bits (349),  Expect(2) = 7e-67, Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 95/157 (61%), Gaps = 12/157 (8%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            SLSD GN I   +   L      + +  PYG TFF  PTGRCS+GR+++D +AEH+GL +
Sbjct  68   SLSDAGNLIVNGTPKAL------TTARPPYGMTFFRKPTGRCSNGRLVVDFLAEHFGLPL  121

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNV-SMNDQLHAFQDM  359
            PPPS     Q  G + R+G NFA+ G+ AL   F++   I   + N  S+N Q+   Q+M
Sbjct  122  PPPS-----QAQGKDFRKGANFAITGATALEYSFFKAHGIDQRIWNTGSINTQIGWLQNM  176

Query  360  IPSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSG  470
             PSLC S  DCK+    SLFV+GEFGGNDY   L SG
Sbjct  177  KPSLCKSEKDCKDYFSKSLFVVGEFGGNDYNAPLFSG  213



>ref|XP_007148063.1| hypothetical protein PHAVU_006G177400g, partial [Phaseolus vulgaris]
 gb|ESW20057.1| hypothetical protein PHAVU_006G177400g, partial [Phaseolus vulgaris]
Length=370

 Score =   148 bits (374),  Expect(2) = 7e-67, Method: Compositional matrix adjust.
 Identities = 89/182 (49%), Positives = 119/182 (65%), Gaps = 0/182 (0%)
 Frame = +1

Query  475   NITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVEDYDDL  654
             NIT ++  +P V   I    ++LI  GAR ++VP  LP+GC+A YLT Y S N EDYD  
Sbjct  182   NITQLQATVPPVVETITTAINELIAEGARELLVPGNLPIGCSALYLTLYGSGNKEDYDGD  241

Query  655   GCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGFSggalr  834
             GCL   N  A YHN+ L+  L  LR+++P+A I+Y D ++ A + +  P + GFS GALR
Sbjct  242   GCLKGFNDFAEYHNKELKLALKTLRQKNPHARILYADYYDVAKRFFHAPGHYGFSSGALR  301

Query  835   accggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDGSYTYPS  1014
             ACCGGGG YNFN   +CG  G+  C DPST+ NWDG HLTEAAY+ + K L+ G ++YP 
Sbjct  302   ACCGGGGAYNFNMSARCGHIGSKVCADPSTHANWDGIHLTEAAYRYIAKGLIYGPFSYPP  361

Query  1015  MN  1020
             + 
Sbjct  362   LK  363


 Score =   134 bits (338),  Expect(2) = 7e-67, Method: Compositional matrix adjust.
 Identities = 75/157 (48%), Positives = 100/157 (64%), Gaps = 10/157 (6%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            SLSDTGN+++    G L Y   P     PYGETFF+  TGRCSDGR+++D IAE Y L  
Sbjct  34   SLSDTGNFLA---SGALSY---PVIGKFPYGETFFNRSTGRCSDGRLVIDFIAEAYELPY  87

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTV-TNVSMNDQLHAFQDM  359
             PP L   A T   NI  GVNFAV G+ AL A+F+ +  +   + TN S+N QL  F+ +
Sbjct  88   LPPYL---ALTKDQNIHLGVNFAVAGATALDAKFFIEAGLGRFLWTNSSLNVQLGWFKKL  144

Query  360  IPSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSG  470
             PSLC++  DC +  E SLF++GE GGNDY ++ ++G
Sbjct  145  KPSLCSTKQDCGSYFERSLFLVGEIGGNDYNYAAIAG  181



>gb|EAZ01210.1| hypothetical protein OsI_23235 [Oryza sativa Indica Group]
Length=379

 Score =   147 bits (371),  Expect(2) = 7e-67, Method: Compositional matrix adjust.
 Identities = 81/180 (45%), Positives = 117/180 (65%), Gaps = 2/180 (1%)
 Frame = +1

Query  478   ITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVEDYD-DL  654
              ++++  +P+VA AIA G  KLIELGA+ ++VP VLP+GC   YLT Y + +  DY+   
Sbjct  196   FSEVKTYVPLVAKAIANGVEKLIELGAKDLLVPGVLPIGCFPLYLTLYNTSSKADYNART  255

Query  655   GCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGFSggalr  834
             GCL   N++A +HN+ L+++L+ L++++P   I+Y D F AAMQ    P N GFS     
Sbjct  256   GCLRRYNRLAFHHNRELKQQLDELQKKYPETKIMYGDYFKAAMQFVVSPGNFGFSSAMQA  315

Query  835   a-ccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDGSYTYP  1011
                 GG G YNFN   +CG+EGA+ C +PS+YV+WDG H+TEAAY+ +    L+G Y  P
Sbjct  316   CCGAGGQGNYNFNLKKKCGEEGASVCSNPSSYVSWDGIHMTEAAYRYVANGWLNGPYAEP  375


 Score =   135 bits (341),  Expect(2) = 7e-67, Method: Compositional matrix adjust.
 Identities = 75/160 (47%), Positives = 99/160 (62%), Gaps = 18/160 (11%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIP---SCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYG  173
            SLSD GN I+         DGIP   + +  PYG TFF  PTGRCS+GR+++D +AEH+G
Sbjct  48   SLSDAGNLIA---------DGIPKSLTTARAPYGMTFFGRPTGRCSNGRLVVDFLAEHFG  98

Query  174  LAIPPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNV-SMNDQLHAF  350
            L +PP   +SKA   G +  +G NFA+ G+ AL   F+++  I   + N  S+N Q+   
Sbjct  99   LPLPP---ASKAH--GADFSKGANFAITGATALEYSFFKQHGIDQRIWNTGSINTQIGWL  153

Query  351  QDMIPSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSG  470
            QDM PSLC S  +CK+    SLFV+GEFGGNDY   L SG
Sbjct  154  QDMKPSLCKSDQECKDYFGKSLFVVGEFGGNDYNAPLFSG  193



>ref|XP_010455496.1| PREDICTED: GDSL esterase/lipase At1g31550-like isoform X1 [Camelina 
sativa]
Length=396

 Score =   152 bits (385),  Expect(2) = 7e-67, Method: Compositional matrix adjust.
 Identities = 83/190 (44%), Positives = 114/190 (60%), Gaps = 0/190 (0%)
 Frame = +1

Query  460   FSREKNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVE  639
             F + + I +++ ++P+V   I+    +LI +G RT +VP   P+GC+ +YLT Y + N+E
Sbjct  187   FFQRRPIDEVKELVPLVISTISSAITELISMGGRTFLVPGEFPIGCSVAYLTLYQTSNME  246

Query  640   DYDDLGCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGFS  819
             +YD  GCL W+N+   YH++ L+ EL  LR+ + + NIIY D +NA + +   P   GF 
Sbjct  247   EYDPFGCLKWLNKFGEYHDEQLEAELKRLRKLNHHVNIIYADYYNALLGLNQEPTKYGFI  306

Query  820   ggalraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDGS  999
                L ACCG G  YNFN    CG  G  SC DPS YV WDG H+TEAAYK M   +L G 
Sbjct  307   NKPLSACCGVGEPYNFNFSTCCGSFGVDSCNDPSKYVAWDGIHMTEAAYKFMADGILKGP  366

Query  1000  YTYPSMNALC  1029
             YT P  N  C
Sbjct  367   YTSPPFNWTC  376


 Score =   130 bits (326),  Expect(2) = 7e-67, Method: Compositional matrix adjust.
 Identities = 69/149 (46%), Positives = 94/149 (63%), Gaps = 10/149 (7%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            S++DTGN + L+    L  +G P     PYGETFFHHPTGR SDGR+I+D IAE  GL  
Sbjct  45   SIADTGNLLCLSDRNNLSLNGFP-----PYGETFFHHPTGRSSDGRLIIDFIAEFLGLPY  99

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQDMI  362
              P   SK      N ++GVNFAV  + AL A F ++   Y    N+S+  Q+  F++ +
Sbjct  100  VTPYFGSK----NGNFQKGVNFAVGSATALEASFLEE-RGYHCPHNISLGVQVKVFKESL  154

Query  363  PSLCNSPSDCKNLLENSLFVLGEFGGNDY  449
            P+LC  PSDCKN++ N+L ++GE GGND+
Sbjct  155  PNLCGLPSDCKNMIGNALILMGEIGGNDH  183



>gb|EAZ37226.1| hypothetical protein OsJ_21564 [Oryza sativa Japonica Group]
Length=379

 Score =   147 bits (370),  Expect(2) = 8e-67, Method: Compositional matrix adjust.
 Identities = 81/180 (45%), Positives = 117/180 (65%), Gaps = 2/180 (1%)
 Frame = +1

Query  478   ITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVEDYD-DL  654
              ++++  +P+VA AIA G  KLIELGA+ ++VP VLP+GC   YLT Y + +  DY+   
Sbjct  196   FSEVKTYVPLVAKAIANGVEKLIELGAKDLLVPGVLPIGCFPLYLTLYNTSSKADYNART  255

Query  655   GCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGFSggalr  834
             GCL   N++A +HN+ L+++L+ L++++P   I+Y D F AAMQ    P N GFS     
Sbjct  256   GCLRRYNRLAFHHNRELKQQLDELQKKYPETKIMYGDYFKAAMQFVVSPGNFGFSSTMQA  315

Query  835   a-ccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDGSYTYP  1011
                 GG G YNFN   +CG+EGA+ C +PS+YV+WDG H+TEAAY+ +    L+G Y  P
Sbjct  316   CCGAGGQGNYNFNLKKKCGEEGASVCSNPSSYVSWDGIHMTEAAYRYVANGWLNGPYAEP  375


 Score =   135 bits (341),  Expect(2) = 8e-67, Method: Compositional matrix adjust.
 Identities = 75/160 (47%), Positives = 99/160 (62%), Gaps = 18/160 (11%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIP---SCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYG  173
            SLSD GN I+         DGIP   + +  PYG TFF  PTGRCS+GR+++D +AEH+G
Sbjct  48   SLSDAGNLIA---------DGIPKSLTTARAPYGMTFFGRPTGRCSNGRLVVDFLAEHFG  98

Query  174  LAIPPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNV-SMNDQLHAF  350
            L +PP   +SKA   G +  +G NFA+ G+ AL   F+++  I   + N  S+N Q+   
Sbjct  99   LPLPP---ASKAH--GADFSKGANFAITGATALEYSFFKQHGIDQRIWNTGSINTQIGWL  153

Query  351  QDMIPSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSG  470
            QDM PSLC S  +CK+    SLFV+GEFGGNDY   L SG
Sbjct  154  QDMKPSLCKSDQECKDYFGKSLFVVGEFGGNDYNAPLFSG  193



>ref|XP_006656143.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Oryza brachyantha]
Length=403

 Score =   146 bits (369),  Expect(2) = 9e-67, Method: Compositional matrix adjust.
 Identities = 81/180 (45%), Positives = 117/180 (65%), Gaps = 2/180 (1%)
 Frame = +1

Query  478   ITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVEDYD-DL  654
              ++++  +P+VA AIA G  KLIELGA+ ++VP VLP+GC   YLT Y + N  DY+   
Sbjct  220   FSEVKTYVPLVAKAIANGVEKLIELGAKDMVVPGVLPIGCFPLYLTLYNTSNKADYNART  279

Query  655   GCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGFSggalr  834
             GCL   N++A +HN+ L+++L+ L++++P   I+Y D F AAMQ    P N GFS     
Sbjct  280   GCLRRYNRLAFHHNRELKQQLDELQKKYPETKIMYGDYFKAAMQFVVSPGNFGFSSAMQA  339

Query  835   a-ccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDGSYTYP  1011
                 GG G YNFN   +CG++GA+ C +PS+YV+WDG H+TEAAY+ +    L+G Y  P
Sbjct  340   CCGAGGEGNYNFNLKKKCGEDGASVCSNPSSYVSWDGIHMTEAAYRYVANGWLNGPYAEP  399


 Score =   136 bits (342),  Expect(2) = 9e-67, Method: Compositional matrix adjust.
 Identities = 75/160 (47%), Positives = 100/160 (63%), Gaps = 18/160 (11%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIP---SCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYG  173
            SLSD GN I+         DG+P   + +  PYG TFF  PTGRCS+GR+++D +AEH+G
Sbjct  72   SLSDAGNLIA---------DGVPKALTTARPPYGMTFFGRPTGRCSNGRLVVDFLAEHFG  122

Query  174  LAIPPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNV-SMNDQLHAF  350
            L +PP   +SKA   G +  +G NFA+ G+ AL   F+++  I   + N  S+N Q+   
Sbjct  123  LPLPP---ASKAH--GKDFSKGANFAITGATALEYSFFKQHGIDQRIWNTGSINTQIGWL  177

Query  351  QDMIPSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSG  470
            QDM PSLC S S+CK+    SLFV+GEFGGNDY   L SG
Sbjct  178  QDMKPSLCKSESECKDYFGKSLFVVGEFGGNDYNAPLFSG  217



>ref|NP_001042396.1| Os01g0215700 [Oryza sativa Japonica Group]
 dbj|BAF04310.1| Os01g0215700 [Oryza sativa Japonica Group]
 dbj|BAG87737.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG86888.1| unnamed protein product [Oryza sativa Japonica Group]
Length=378

 Score =   152 bits (383),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 90/186 (48%), Positives = 119/186 (64%), Gaps = 0/186 (0%)
 Frame = +1

Query  460   FSREKNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVE  639
             F + K++ D +  +P VA A+A+   +LI+ GA  ++VP  LP+GC+++YLT +PS N  
Sbjct  192   FFKGKSLDDAKSYVPTVAGAVADATERLIKAGAVHLVVPGNLPIGCSSAYLTLHPSSNRS  251

Query  640   DYDDLGCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGFS  819
             DYD  GCL   N  A +HN +LQ++L LLR  +P A I+Y D + AAM     P   GF 
Sbjct  252   DYDSTGCLKTYNDFAQHHNAVLQDKLRLLRRSYPEARIMYADYYGAAMSFAQNPKQFGFR  311

Query  820   ggalraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDGS  999
              GALR CCGGGG YNFNP   CG  G++ C DPS Y NWDG HLTEA Y  +  S+L+G 
Sbjct  312   HGALRTCCGGGGPYNFNPKASCGVRGSSVCTDPSAYANWDGVHLTEAGYHAIANSILNGP  371

Query  1000  YTYPSM  1017
             YT P +
Sbjct  372   YTSPRL  377


 Score =   130 bits (327),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 69/161 (43%), Positives = 101/161 (63%), Gaps = 18/161 (11%)
 Frame = +3

Query  3    SLSDTGNYIS---LTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYG  173
            SL+DTGN +    L+   V +Y         PYG T+FH PTGRCSDGR+++D +A+ +G
Sbjct  50   SLTDTGNLVVSSPLSFSIVGKY---------PYGMTYFHRPTGRCSDGRLVVDFLAQAFG  100

Query  174  LAIPPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTV-TNVSMNDQLHAF  350
            L +  P LS      G ++ +GVNFAV G+ A+   F++++   D + TN+S++ QL  F
Sbjct  101  LPLLQPYLSR-----GEDVTRGVNFAVGGATAMDPPFFEEIGASDKLWTNLSLSVQLGWF  155

Query  351  QDMIPSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
            + + PSLC+SP DCK     SLF++GE GGNDY ++   GK
Sbjct  156  EQLKPSLCSSPKDCKEFFSKSLFLVGEIGGNDYNYAFFKGK  196



>ref|NP_001149156.1| esterase precursor [Zea mays]
 gb|ACG34406.1| esterase precursor [Zea mays]
Length=370

 Score =   149 bits (376),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 87/186 (47%), Positives = 116/186 (62%), Gaps = 0/186 (0%)
 Frame = +1

Query  460   FSREKNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVE  639
             F + K + D +  +P VA A+ +   +LI+ GA  ++VP  LP+GC+++YLT +P  N  
Sbjct  184   FFKGKTLDDAKTYVPTVAAAVTDATERLIKAGATHLVVPGNLPMGCSSAYLTLHPGRNGS  243

Query  640   DYDDLGCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGFS  819
             DYD  GCL   N  A +HN +LQ +L  LR ++P A I+Y D + AAM     P   GF+
Sbjct  244   DYDAAGCLRTYNDFAQHHNAVLQRKLRALRAKYPQARIMYADYYGAAMSFAKNPKQFGFT  303

Query  820   ggalraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDGS  999
              G LR CCGGGG YNFNP   CG  G++ C DPS Y NWDG HLTEAAY  +  S+L+G 
Sbjct  304   QGPLRTCCGGGGPYNFNPKASCGVRGSSVCADPSAYANWDGVHLTEAAYHAIADSILNGP  363

Query  1000  YTYPSM  1017
             YT P +
Sbjct  364   YTSPRL  369


 Score =   133 bits (334),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 70/161 (43%), Positives = 104/161 (65%), Gaps = 17/161 (11%)
 Frame = +3

Query  3    SLSDTGNYI---SLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYG  173
            SL+DTGN +    L++  V +Y         PYG T+FH PTGRCSDGR+++D +A+ +G
Sbjct  41   SLTDTGNLLVSSPLSNHIVGRY---------PYGITYFHRPTGRCSDGRLVVDFLAQAFG  91

Query  174  LAIPPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTV-TNVSMNDQLHAF  350
            L +  P L S+    G ++R+GVNFAV G+ A+   F+Q++   D + TN+S++ QL  F
Sbjct  92   LPLLQPYLQSR----GKDLRRGVNFAVGGATAMDPPFFQEIGASDKLWTNLSLSVQLGWF  147

Query  351  QDMIPSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
            + + PSLC+SP +CK     SLF++GE GGNDY ++   GK
Sbjct  148  EQLKPSLCSSPKECKEYFSKSLFLVGEIGGNDYNYAFFKGK  188



>dbj|BAA94228.1| putative esterase [Oryza sativa Japonica Group]
 gb|EAY73022.1| hypothetical protein OsI_00894 [Oryza sativa Indica Group]
Length=374

 Score =   152 bits (383),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 90/186 (48%), Positives = 119/186 (64%), Gaps = 0/186 (0%)
 Frame = +1

Query  460   FSREKNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVE  639
             F + K++ D +  +P VA A+A+   +LI+ GA  ++VP  LP+GC+++YLT +PS N  
Sbjct  188   FFKGKSLDDAKSYVPTVAGAVADATERLIKAGAVHLVVPGNLPIGCSSAYLTLHPSSNRS  247

Query  640   DYDDLGCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGFS  819
             DYD  GCL   N  A +HN +LQ++L LLR  +P A I+Y D + AAM     P   GF 
Sbjct  248   DYDSTGCLKTYNDFAQHHNAVLQDKLRLLRRSYPEARIMYADYYGAAMSFAQNPKQFGFR  307

Query  820   ggalraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDGS  999
              GALR CCGGGG YNFNP   CG  G++ C DPS Y NWDG HLTEA Y  +  S+L+G 
Sbjct  308   HGALRTCCGGGGPYNFNPKASCGVRGSSVCTDPSAYANWDGVHLTEAGYHAIANSILNGP  367

Query  1000  YTYPSM  1017
             YT P +
Sbjct  368   YTSPRL  373


 Score =   130 bits (327),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 69/161 (43%), Positives = 101/161 (63%), Gaps = 18/161 (11%)
 Frame = +3

Query  3    SLSDTGNYIS---LTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYG  173
            SL+DTGN +    L+   V +Y         PYG T+FH PTGRCSDGR+++D +A+ +G
Sbjct  46   SLTDTGNLVVSSPLSFSIVGKY---------PYGMTYFHRPTGRCSDGRLVVDFLAQAFG  96

Query  174  LAIPPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTV-TNVSMNDQLHAF  350
            L +  P LS      G ++ +GVNFAV G+ A+   F++++   D + TN+S++ QL  F
Sbjct  97   LPLLQPYLSR-----GEDVTRGVNFAVGGATAMDPPFFEEIGASDKLWTNLSLSVQLGWF  151

Query  351  QDMIPSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
            + + PSLC+SP DCK     SLF++GE GGNDY ++   GK
Sbjct  152  EQLKPSLCSSPKDCKEFFSKSLFLVGEIGGNDYNYAFFKGK  192



>gb|EEE54111.1| hypothetical protein OsJ_00875 [Oryza sativa Japonica Group]
Length=374

 Score =   152 bits (383),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 90/186 (48%), Positives = 119/186 (64%), Gaps = 0/186 (0%)
 Frame = +1

Query  460   FSREKNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVE  639
             F + K++ D +  +P VA A+A+   +LI+ GA  ++VP  LP+GC+++YLT +PS N  
Sbjct  188   FFKGKSLDDAKSYVPTVAGAVADATERLIKAGAVHLVVPGNLPIGCSSAYLTLHPSSNRS  247

Query  640   DYDDLGCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGFS  819
             DYD  GCL   N  A +HN +LQ++L LLR  +P A I+Y D + AAM     P   GF 
Sbjct  248   DYDSTGCLKTYNDFAQHHNAVLQDKLRLLRRSYPEARIMYADYYGAAMSFAQNPKQFGFR  307

Query  820   ggalraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDGS  999
              GALR CCGGGG YNFNP   CG  G++ C DPS Y NWDG HLTEA Y  +  S+L+G 
Sbjct  308   HGALRTCCGGGGPYNFNPKASCGVRGSSVCTDPSAYANWDGVHLTEAGYHAIANSILNGP  367

Query  1000  YTYPSM  1017
             YT P +
Sbjct  368   YTSPRL  373


 Score =   130 bits (327),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 69/161 (43%), Positives = 101/161 (63%), Gaps = 18/161 (11%)
 Frame = +3

Query  3    SLSDTGNYIS---LTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYG  173
            SL+DTGN +    L+   V +Y         PYG T+FH PTGRCSDGR+++D +A+ +G
Sbjct  46   SLTDTGNLVVSSPLSFSIVGKY---------PYGMTYFHRPTGRCSDGRLVVDFLAQAFG  96

Query  174  LAIPPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTV-TNVSMNDQLHAF  350
            L +  P LS      G ++ +GVNFAV G+ A+   F++++   D + TN+S++ QL  F
Sbjct  97   LPLLQPYLSR-----GEDVTRGVNFAVGGATAMDPPFFEEIGASDKLWTNLSLSVQLGWF  151

Query  351  QDMIPSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
            + + PSLC+SP DCK     SLF++GE GGNDY ++   GK
Sbjct  152  EQLKPSLCSSPKDCKEFFSKSLFLVGEIGGNDYNYAFFKGK  192



>ref|XP_010912640.1| PREDICTED: GDSL esterase/lipase At1g28650-like isoform X2 [Elaeis 
guineensis]
Length=386

 Score =   143 bits (361),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 91/205 (44%), Positives = 126/205 (61%), Gaps = 3/205 (1%)
 Frame = +1

Query  460   FSREKNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVE  639
             F + K + +IR  +P +  AI+   + LI+LGA+T++VP   P+GC + YL  + S   E
Sbjct  184   FFQGKTVDEIRTFVPSIISAISSAINALIQLGAKTLVVPGNFPIGCVSWYLQAFQSRRKE  243

Query  640   DYD-DLGCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGF  816
             DYD   GC+ W+N+ A YHN+LL +EL+ L++ HP+  IIY D + A + I+  P   GF
Sbjct  244   DYDSQTGCIKWLNEFAEYHNRLLVDELDHLQQLHPHVTIIYADYYKALLNIFRSPTQFGF  303

Query  817   SggalraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDG  996
                 L ACCGGGG YN +  + CG   AT C DPSTYV WDG HLTEAAY+ + + LL+G
Sbjct  304   KKAPLAACCGGGGPYNIS--VPCGGRAATVCNDPSTYVCWDGMHLTEAAYRTIAQGLLEG  361

Query  997   SYTYPSMNALCPTDAQVAQL*LRMV  1071
              +T P +   CP   Q A   LR +
Sbjct  362   PHTAPPITQACPHIEQSAAHSLRPI  386


 Score =   138 bits (348),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 73/159 (46%), Positives = 102/159 (64%), Gaps = 13/159 (8%)
 Frame = +3

Query  3    SLSDTGNYI--SLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGL  176
            SL+DTGN++  S  S G +        + LPYGET+FH PTGR SDGR+I+D IA+  G+
Sbjct  41   SLADTGNFLYSSNNSPGAI--------ARLPYGETYFHRPTGRFSDGRLIIDFIAQDIGI  92

Query  177  AIPPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQD  356
             + PP L      G +  RQGVNFAV G+ AL  +F+++  +  + T  S+  Q+  F+ 
Sbjct  93   PLVPPYLEGP---GDHGFRQGVNFAVAGATALDNDFFREKGLDISWTEYSLGTQIEWFKQ  149

Query  357  MIPSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
            ++PSLC+S SDCK +L +SLF++GE GGNDY H    GK
Sbjct  150  LLPSLCSSGSDCKGILSSSLFLMGEIGGNDYNHPFFQGK  188



>gb|ACF85857.1| unknown [Zea mays]
 gb|AFW86784.1| esterase [Zea mays]
Length=397

 Score =   142 bits (358),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 79/180 (44%), Positives = 115/180 (64%), Gaps = 2/180 (1%)
 Frame = +1

Query  478   ITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVEDYD-DL  654
              +D++  +P+VA AIA G  KLIELGA  ++VP VLP+GC   YLT Y + +  DY+   
Sbjct  213   FSDVKTYVPLVAKAIANGVEKLIELGATDLLVPGVLPIGCFPLYLTLYNTSSKADYNART  272

Query  655   GCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGFSggalr  834
             GCL   N++A +HN+ L+++L+ L++++P   I+Y D F AA+Q    P   GFS     
Sbjct  273   GCLRRYNRLAFHHNRELKQQLDELQKKYPKTKIMYGDYFKAALQFVVNPGKFGFSTALQA  332

Query  835   a-ccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDGSYTYP  1011
                 GG G YNFN   +CG++GA+ C +PS+YV+WDG H+TEAAY+ +    L+G Y  P
Sbjct  333   CCGAGGQGNYNFNLKKKCGEQGASVCSNPSSYVSWDGIHMTEAAYRKVANGWLNGPYAQP  392


 Score =   139 bits (351),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 95/157 (61%), Gaps = 12/157 (8%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            SLSD GN I   +   L      + +  PYG TFF  PTGRCS+GR+++D +AEH+GL +
Sbjct  65   SLSDAGNLIVNGTPKAL------TTARPPYGMTFFRKPTGRCSNGRLVVDFLAEHFGLPL  118

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNV-SMNDQLHAFQDM  359
            PPPS     Q  G + ++G NFA+ G+ AL   F++   I   + N  S+N Q+   QDM
Sbjct  119  PPPS-----QAKGKDFKKGANFAITGATALEYSFFKAHGIDQRIWNTGSINTQIGWLQDM  173

Query  360  IPSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSG  470
             PSLC S  DCK+    SLFV+GEFGGNDY   L SG
Sbjct  174  KPSLCKSEQDCKDYFSKSLFVVGEFGGNDYNAPLFSG  210



>ref|XP_004485879.1| PREDICTED: GDSL esterase/lipase At2g27360-like [Cicer arietinum]
Length=383

 Score =   151 bits (382),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 94/184 (51%), Positives = 114/184 (62%), Gaps = 0/184 (0%)
 Frame = +1

Query  484   DIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVEDYDDLGCL  663
             D+   +P V   I      LI+LGA T++VP  LPLGC  + LT + + N E+YD  GCL
Sbjct  187   DLITYVPQVISVITSAIKDLIDLGAVTILVPGSLPLGCNPALLTKFATINEEEYDQAGCL  246

Query  664   IWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGFSggalracc  843
               +N    YHN+LLQ ELN LR  +P+ NIIY D FNAA+Q Y  P   GF   AL+ CC
Sbjct  247   KLLNMFFEYHNELLQFELNRLRVLYPFTNIIYADYFNAALQFYKSPEQFGFERNALQVCC  306

Query  844   ggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDGSYTYPSMNA  1023
             GGGG YNFN    CG+    +C D S YV+WDGYHLTEAAY+ M  SLLDG YT P  + 
Sbjct  307   GGGGPYNFNDTALCGNLEVIACDDTSKYVSWDGYHLTEAAYRWMAMSLLDGQYTIPKFSL  366

Query  1024  LCPT  1035
              C T
Sbjct  367   SCLT  370


 Score =   130 bits (326),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 71/157 (45%), Positives = 99/157 (63%), Gaps = 9/157 (6%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            SL+DTGN ++  S  +      P C + P+G+T FHHP GRCSDGR+I+D IAE  GL+ 
Sbjct  30   SLTDTGN-LNFISPPL-----SPDCMLPPFGQTHFHHPNGRCSDGRLIIDFIAESLGLSY  83

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFY-QKLEIYDTVTNVSMNDQLHAFQDM  359
              P L  K      NI  GVNFA+ G+ AL   F+ +K  + D  TN S+  Q+  F+++
Sbjct  84   VKPYLGFKNGEVTGNIENGVNFAIAGATALDLSFFEEKGFVVDATTNYSLRFQIDWFKEL  143

Query  360  IPSLCNSPSD--CKNLLENSLFVLGEFGGNDYTHSLL  464
            +PS+CNS S   CK++L +SLF++GE GGNDY+  L 
Sbjct  144  LPSICNSSSTEGCKDVLHSSLFIVGEIGGNDYSFPLF  180



>ref|XP_002893540.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69799.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=1392

 Score =   152 bits (385),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 82/190 (43%), Positives = 121/190 (64%), Gaps = 0/190 (0%)
 Frame = +1

Query  460   FSREKNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVE  639
             F   K+I +I+ ++P++  AI+     LI+LG +T +VP   P+GC+A+YLT + +  VE
Sbjct  839   FFEGKSINEIKELVPLIIKAISSAIMNLIDLGGKTFLVPGNFPIGCSAAYLTLFQTAIVE  898

Query  640   DYDDLGCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGFS  819
                  GC+ W+N+   +HN+ L+ EL  L++ +P+ NIIY D +N+  + +  PA  GF 
Sbjct  899   HDPFTGCIPWLNKFGEHHNEQLKIELKQLQKLYPHVNIIYADYYNSLYRFFQEPAKYGFK  958

Query  820   ggalraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDGS  999
                L ACCG GGQYNF    +CG+ G + C +PS YVNWDGYHLTEA Y+ M + LL+G 
Sbjct  959   NRPLAACCGVGGQYNFTIGKECGENGVSYCQNPSEYVNWDGYHLTEATYQKMAQDLLNGP  1018

Query  1000  YTYPSMNALC  1029
             YT P+ +  C
Sbjct  1019  YTTPAFDWSC  1028


 Score =   129 bits (324),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 67/158 (42%), Positives = 98/158 (62%), Gaps = 10/158 (6%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            S++DTGNY+ L++        +P  + LPYGE+FFH P+GR SDGR+++D IAE  GL  
Sbjct  695  SIADTGNYLRLSN-----VKNLPQAAFLPYGESFFHPPSGRYSDGRLVIDFIAEFLGLPY  749

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQDMI  362
             PP   S+  +      QG+N AV G+ AL   F  K  I    TN+S++ QL+ F+ ++
Sbjct  750  VPPYFGSQNVS----FNQGINLAVYGATALDRAFLVKQGIKSDFTNISLSVQLNTFKQIL  805

Query  363  PSLCNSPS-DCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
            P+LC S + DC+ +L +SL ++GE GGNDY +    GK
Sbjct  806  PNLCASSTRDCREMLGDSLILMGEIGGNDYNYPFFEGK  843


 Score =   151 bits (382),  Expect(2) = 2e-65, Method: Compositional matrix adjust.
 Identities = 86/197 (44%), Positives = 120/197 (61%), Gaps = 1/197 (1%)
 Frame = +1

Query  460   FSREKNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVE  639
             F   K+I +I+ ++P++  AI+     LI LG +T +VP   P GC+A+YLT + +   +
Sbjct  186   FFEGKSINEIKELVPLIIKAISSAIVDLIALGGKTFLVPGGFPAGCSAAYLTLFQTVAEK  245

Query  640   DYDDL-GCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGF  816
             D+D   GC+ W+N+   +HN+ L+ EL  L++ +P+ NIIY D  N   + Y  PA  GF
Sbjct  246   DHDPFTGCIPWLNEFGEHHNKQLKTELERLQKLYPHVNIIYADYHNTLYRFYQEPAKYGF  305

Query  817   SggalraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDG  996
                 L ACCG GGQYNF    +CG EG + C +PS YVNWDGYHLTEAAYK M + +L+G
Sbjct  306   KKRPLAACCGVGGQYNFTIGKECGYEGVSYCQNPSEYVNWDGYHLTEAAYKKMAEGILNG  365

Query  997   SYTYPSMNALCPTDAQV  1047
              Y  PS +  C     V
Sbjct  366   PYAIPSFDWSCLGSGSV  382


 Score =   127 bits (318),  Expect(2) = 2e-65, Method: Compositional matrix adjust.
 Identities = 69/158 (44%), Positives = 96/158 (61%), Gaps = 10/158 (6%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            S++DTGNY+ L+       + +P  + LPYGE+FFH P+GR SDGR+I+D IAE  GL  
Sbjct  42   SIADTGNYLHLS-----DVNHLPQTAFLPYGESFFHLPSGRASDGRLIIDFIAEFLGLPY  96

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQDMI  362
              P   S+  +      QG+NFAV G+ AL   F     I    TNVS++ QL  F+ ++
Sbjct  97   VMPYFGSQNVS----FEQGINFAVYGATALDRAFLVGKGIESDFTNVSLSVQLDIFKQIL  152

Query  363  PSLCNSPS-DCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
            P+LC S + DCK +L +SL ++GE GGNDY +    GK
Sbjct  153  PNLCASSTRDCKEILGDSLILMGEIGGNDYNYPFFEGK  190


 Score =   143 bits (361),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 83/191 (43%), Positives = 116/191 (61%), Gaps = 1/191 (1%)
 Frame = +1

Query  460   FSREKNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVE  639
             F   K+I +I+ ++P+V  AI+     LI+LG +T +VP   PLGC  +YLT + +   E
Sbjct  1188  FFEGKSINEIKELVPLVIKAISSAIVDLIDLGGKTFLVPGNFPLGCYPAYLTLFQTTAEE  1247

Query  640   DYD-DLGCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGF  816
             DYD   GCL W+N+   +HN+ L+ EL  L+E + + NIIY D +N+   +Y  P   GF
Sbjct  1248  DYDPSTGCLRWLNEFVEHHNEELKTELKRLQELYDHVNIIYADYYNSLFLLYQEPVKYGF  1307

Query  817   SggalraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDG  996
                 L ACCG GGQYNF    +CG    + C +PS YVNWDGYHLTEA ++ M + LL+G
Sbjct  1308  RNRPLAACCGIGGQYNFTISEECGHREVSYCQNPSEYVNWDGYHLTEATHQKMAQVLLNG  1367

Query  997   SYTYPSMNALC  1029
              Y  P+ +  C
Sbjct  1368  PYATPAFDWSC  1378


 Score =   121 bits (303),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 68/158 (43%), Positives = 96/158 (61%), Gaps = 10/158 (6%)
 Frame = +3

Query  3     SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
             S +DTGNY+ L+       + +P  + LPYGETFFH P+GR SDGR+I+D IAE  GL  
Sbjct  1044  SSADTGNYLHLS-----DVNHLPQSAFLPYGETFFHPPSGRYSDGRLIIDFIAEFLGLPY  1098

Query  183   PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQDMI  362
              P    S+  +      QG+NFAV G+ AL   F  +  I    TNVS++ Q++ F+ ++
Sbjct  1099  VPYYFGSQNVS----FDQGINFAVYGATALDRAFLVEKGIEFDFTNVSLSVQINNFKQIL  1154

Query  363   PSLCNSPS-DCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
             P+LC S S DC+ +L +SL ++GE G NDY +    GK
Sbjct  1155  PNLCTSSSRDCREMLGDSLILMGEIGVNDYNYPFFEGK  1192


 Score =   125 bits (314),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 67/158 (42%), Positives = 97/158 (61%), Gaps = 10/158 (6%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            S++DTGNY+ L+       + +P  +  PYGE+FFH P+GR SDGR+I+D IAE  GL  
Sbjct  424  SIADTGNYLHLS-----DVNHLPQTAFFPYGESFFHPPSGRASDGRLIIDFIAEFLGLPY  478

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQDMI  362
             PP   S+  +      QG+NFAV G+ AL   ++    I    TNVS++ QL  F+ ++
Sbjct  479  VPPYFGSQNVS----FEQGINFAVYGATALDRAYFVAKGIECDFTNVSLSVQLDIFKQIL  534

Query  363  PSLCNSPS-DCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
            P+LC S S DC+ +L +SL ++GE GGND+ +    GK
Sbjct  535  PNLCASSSRDCREMLGDSLILMGEIGGNDFFYPSFEGK  572



>ref|XP_002457137.1| hypothetical protein SORBIDRAFT_03g001850 [Sorghum bicolor]
 gb|EES02257.1| hypothetical protein SORBIDRAFT_03g001850 [Sorghum bicolor]
Length=379

 Score =   149 bits (376),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 87/186 (47%), Positives = 116/186 (62%), Gaps = 0/186 (0%)
 Frame = +1

Query  460   FSREKNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVE  639
             F + K + D +  +P VA A+ +   +LI+ GA  ++VP  LP+GC+++YLT +P  N  
Sbjct  193   FFKGKTLDDAKTYVPTVAAAVTDATERLIKAGATHLVVPGNLPIGCSSAYLTLHPGRNSS  252

Query  640   DYDDLGCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGFS  819
             DYD  GCL   N  A +HN +LQ+ L  LR ++P A I+Y D + AAM     P   GF+
Sbjct  253   DYDAAGCLKTYNDFAQHHNAVLQQNLRALRVKYPQARIMYADYYGAAMSFAKNPKQFGFT  312

Query  820   ggalraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDGS  999
              G LR CCGGGG YNFNP   CG  G++ C DPS Y NWDG HLTEAAY  +  S+L+G 
Sbjct  313   EGPLRTCCGGGGPYNFNPKASCGVRGSSVCTDPSAYANWDGVHLTEAAYHAIADSILNGP  372

Query  1000  YTYPSM  1017
             YT P +
Sbjct  373   YTSPRL  378


 Score =   132 bits (333),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 70/161 (43%), Positives = 103/161 (64%), Gaps = 17/161 (11%)
 Frame = +3

Query  3    SLSDTGNYI---SLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYG  173
            SL+DTGN +    L++  V +Y         PYG T+FH PTGRCSDGR+++D +A+ +G
Sbjct  50   SLTDTGNLLVSSPLSNHIVGRY---------PYGMTYFHRPTGRCSDGRLVVDFLAQAFG  100

Query  174  LAIPPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTV-TNVSMNDQLHAF  350
            L +  P L S+    G ++R+GVNFAV G+ A+   F+Q++   D + TN+S++ QL  F
Sbjct  101  LPLLQPYLQSR----GKDLRRGVNFAVGGATAMDPPFFQEIGASDKLWTNLSLSVQLGWF  156

Query  351  QDMIPSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
            + + PSLC+SP  CK     SLF++GE GGNDY ++   GK
Sbjct  157  EQLKPSLCSSPKKCKEYFSKSLFLVGEIGGNDYNYAFFKGK  197



>ref|NP_001150078.1| esterase [Zea mays]
 gb|ACG37721.1| esterase precursor [Zea mays]
Length=397

 Score =   142 bits (358),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 79/180 (44%), Positives = 115/180 (64%), Gaps = 2/180 (1%)
 Frame = +1

Query  478   ITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVEDYD-DL  654
              +D++  +P+VA AIA G  KLIELGA  ++VP VLP+GC   YLT Y + +  DY+   
Sbjct  213   FSDVKTYVPLVAKAIANGVEKLIELGATDLLVPGVLPIGCFPLYLTLYNTSSKADYNART  272

Query  655   GCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGFSggalr  834
             GCL   N++A +HN+ L+++L+ L++++P   I+Y D F AA+Q    P   GFS     
Sbjct  273   GCLRRYNRLAFHHNRELKQQLDELQKKYPKTKIMYGDYFKAALQFVVNPGKFGFSTALQA  332

Query  835   a-ccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDGSYTYP  1011
                 GG G YNFN   +CG++GA+ C +PS+YV+WDG H+TEAAY+ +    L+G Y  P
Sbjct  333   CCGAGGQGNYNFNLKKKCGEQGASVCSNPSSYVSWDGIHMTEAAYRKVADGWLNGPYAQP  392


 Score =   139 bits (351),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 95/157 (61%), Gaps = 12/157 (8%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            SLSD GN I   +   L      + +  PYG TFF  PTGRCS+GR+++D +AEH+GL +
Sbjct  65   SLSDAGNLIVNGTPKAL------TTARPPYGMTFFRKPTGRCSNGRLVVDFLAEHFGLPL  118

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNV-SMNDQLHAFQDM  359
            PPPS     Q  G + ++G NFA+ G+ AL   F++   I   + N  S+N Q+   QDM
Sbjct  119  PPPS-----QAKGKDFKKGANFAITGATALEYSFFKAHGIDQRIWNTGSINTQIGWLQDM  173

Query  360  IPSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSG  470
             PSLC S  DCK+    SLFV+GEFGGNDY   L SG
Sbjct  174  KPSLCKSEQDCKDYFSKSLFVVGEFGGNDYNAPLFSG  210



>ref|NP_180304.1| GDSL esterase/lipase [Arabidopsis thaliana]
 sp|Q9ZQI3.1|GDL40_ARATH RecName: Full=GDSL esterase/lipase At2g27360; AltName: Full=Extracellular 
lipase At2g27360; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAD41994.1| putative lipase [Arabidopsis thaliana]
 gb|AAM15186.1| putative lipase [Arabidopsis thaliana]
 gb|AEC07985.1| GDSL esterase/lipase [Arabidopsis thaliana]
Length=394

 Score =   154 bits (390),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 85/188 (45%), Positives = 120/188 (64%), Gaps = 1/188 (1%)
 Frame = +1

Query  469   EKNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVEDYD  648
              KNI +++ ++P+V   I+    +L+++GART +VP   PLGC+ +YLT Y +PN E+Y+
Sbjct  187   RKNIEEVKELVPLVITTISSAISELVDMGARTFLVPGNFPLGCSVAYLTLYETPNKEEYN  246

Query  649   DL-GCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGFSgg  825
              L GCL W+N  + YHN+ LQ EL  LR  +P+ NIIY D +N  +++   P+  G    
Sbjct  247   PLTGCLTWLNDFSVYHNEQLQAELKRLRNLYPHVNIIYGDYYNTLLRLMQEPSKFGLMDR  306

Query  826   alraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDGSYT  1005
              L ACCG GG YNF   ++CG +G   C DPS YVNWDG H+TEAAYK +++ +L G Y 
Sbjct  307   PLPACCGLGGPYNFTFSIKCGSKGVEYCSDPSKYVNWDGIHMTEAAYKWISEGVLTGPYA  366

Query  1006  YPSMNALC  1029
              P  N  C
Sbjct  367   IPPFNWSC  374


 Score =   127 bits (318),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 67/158 (42%), Positives = 99/158 (63%), Gaps = 10/158 (6%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            S++DTGN + L+S      + +P  +  PYGETFFHHP+GR SDGR+I+D IAE  G+  
Sbjct  40   SITDTGNLLGLSSP-----NDLPESAFPPYGETFFHHPSGRFSDGRLIIDFIAEFLGIPH  94

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQDMI  362
             PP   SK      N  +GVNFAV G+ AL     ++   + + +N+S+ +QL +F++ +
Sbjct  95   VPPFYGSK----NGNFEKGVNFAVGGATALECSVLEEKGTHCSQSNISLGNQLKSFKESL  150

Query  363  PSLCNSPS-DCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
            P LC S S DC++++EN+  ++GE GGNDY   L   K
Sbjct  151  PYLCGSSSPDCRDMIENAFILIGEIGGNDYNFPLFDRK  188



>ref|XP_010478243.1| PREDICTED: GDSL esterase/lipase At1g28650 [Camelina sativa]
Length=367

 Score =   152 bits (383),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 82/190 (43%), Positives = 119/190 (63%), Gaps = 0/190 (0%)
 Frame = +1

Query  460   FSREKNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVE  639
             F   K+I +I+ ++P+V   I+     LI+LG +T +VP   P+GC+ +YLT + +  VE
Sbjct  174   FFGRKSINEIKKLVPLVIKVISAAIVDLIDLGGKTFLVPGNFPIGCSTAYLTLFQTAKVE  233

Query  640   DYDDLGCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGFS  819
                  GC+ W+N+ A +HN+ L+ EL  L+  +P+ NIIY D +N+  + +  PA  GF 
Sbjct  234   HDPFTGCIPWLNKFAEHHNEQLKTELKRLQNLYPHVNIIYADYYNSLYRFFQEPAKYGFR  293

Query  820   ggalraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDGS  999
                L ACCG GGQYNF    +CGD+  + C +PS YVNWDGYHLTEA Y+ M + LL+G 
Sbjct  294   NRPLAACCGVGGQYNFTIGKECGDKRVSYCQNPSVYVNWDGYHLTEATYRKMAQGLLNGP  353

Query  1000  YTYPSMNALC  1029
             YT P+ +  C
Sbjct  354   YTSPAFDWSC  363


 Score =   129 bits (325),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 70/158 (44%), Positives = 97/158 (61%), Gaps = 10/158 (6%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            S++DTGNY+ L+         +P  + LPYG++FFH P+GR SDGR+I+D IAE  GL  
Sbjct  30   SIADTGNYLRLS-----DVKNLPPVAFLPYGKSFFHPPSGRASDGRLIIDFIAEFLGLPY  84

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQDMI  362
             PP   S+  +      QG+NFAV G+ AL   F  K  I    TN+S++ QL+ F+ ++
Sbjct  85   VPPYFRSQNVS----FNQGINFAVYGATALDHAFLVKQGIKSDFTNISLSVQLNTFKQVL  140

Query  363  PSLCNSPSD-CKNLLENSLFVLGEFGGNDYTHSLLSGK  473
            PSLC S S  CK +LE+SL ++GE GGNDY +     K
Sbjct  141  PSLCASSSHVCKVMLEDSLILMGEIGGNDYNYPFFGRK  178



>dbj|BAD44668.1| putative lipase [Arabidopsis thaliana]
Length=390

 Score =   154 bits (390),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 85/188 (45%), Positives = 120/188 (64%), Gaps = 1/188 (1%)
 Frame = +1

Query  469   EKNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVEDYD  648
              KNI +++ ++P+V   I+    +L+++GART +VP   PLGC+ +YLT Y +PN E+Y+
Sbjct  183   RKNIEEVKELVPLVITTISSAISELVDMGARTFLVPGNFPLGCSVAYLTLYETPNKEEYN  242

Query  649   DL-GCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGFSgg  825
              L GCL W+N  + YHN+ LQ EL  LR  +P+ NIIY D +N  +++   P+  G    
Sbjct  243   PLTGCLTWLNDFSVYHNEQLQAELKRLRNLYPHVNIIYGDYYNTLLRLMQEPSKFGLMDR  302

Query  826   alraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDGSYT  1005
              L ACCG GG YNF   ++CG +G   C DPS YVNWDG H+TEAAYK +++ +L G Y 
Sbjct  303   PLPACCGLGGPYNFTFSIKCGSKGVEYCSDPSKYVNWDGIHMTEAAYKWISEGVLTGPYA  362

Query  1006  YPSMNALC  1029
              P  N  C
Sbjct  363   IPPFNWSC  370


 Score =   126 bits (317),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 67/158 (42%), Positives = 99/158 (63%), Gaps = 10/158 (6%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            S++DTGN + L+S      + +P  +  PYGETFFHHP+GR SDGR+I+D IAE  G+  
Sbjct  36   SITDTGNLLGLSSP-----NDLPESAFPPYGETFFHHPSGRFSDGRLIIDFIAEFLGIPH  90

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQDMI  362
             PP   SK      N  +GVNFAV G+ AL     ++   + + +N+S+ +QL +F++ +
Sbjct  91   VPPFYGSK----NGNFEKGVNFAVGGATALECSVLEEKGTHCSQSNISLGNQLKSFKESL  146

Query  363  PSLCNSPS-DCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
            P LC S S DC++++EN+  ++GE GGNDY   L   K
Sbjct  147  PYLCGSSSPDCRDMIENAFILIGEIGGNDYNFPLFDRK  184



>ref|XP_003546024.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Glycine max]
 gb|KHN18920.1| GDSL esterase/lipase [Glycine soja]
Length=374

 Score =   154 bits (388),  Expect(2) = 3e-66, Method: Compositional matrix adjust.
 Identities = 90/182 (49%), Positives = 121/182 (66%), Gaps = 0/182 (0%)
 Frame = +1

Query  475   NITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVEDYDDL  654
             NIT ++  +P V  AI    ++LI  GAR ++VP   P+GC+A YLT + S N EDYDD 
Sbjct  186   NITQLQATVPPVVEAITAAINELIAEGARELLVPGNFPIGCSALYLTLFRSENKEDYDDS  245

Query  655   GCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGFSggalr  834
             GCL   N  A YHN+ L+  L  LR+++P+A I+Y D + AA + +  P + GF+ GALR
Sbjct  246   GCLKTFNGFAEYHNKELKLALETLRKKNPHARILYADYYGAAKRFFHAPGHHGFTNGALR  305

Query  835   accggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDGSYTYPS  1014
             ACCGGGG YNFN   +CG  G+ +C DPSTY NWDG HLTEAAY+ + K L+ G ++YP 
Sbjct  306   ACCGGGGPYNFNISARCGHTGSKACADPSTYANWDGIHLTEAAYRYIAKGLIYGPFSYPP  365

Query  1015  MN  1020
             + 
Sbjct  366   LK  367


 Score =   127 bits (319),  Expect(2) = 3e-66, Method: Compositional matrix adjust.
 Identities = 71/157 (45%), Positives = 99/157 (63%), Gaps = 10/157 (6%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            SLSDTGN+  L S  +L     P     PYG+TFF   TGRCSDGR+++D IAE Y L  
Sbjct  38   SLSDTGNF--LASGAIL----FPVIGKPPYGQTFFKRATGRCSDGRLMIDFIAEAYELPY  91

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTV-TNVSMNDQLHAFQDM  359
             PP L   A T   +I++GVNFAV G+ AL A+F+ +  +   + TN S++ QL  F+ +
Sbjct  92   LPPYL---ALTKDKDIQRGVNFAVAGATALDAKFFIEAGLAKYLWTNNSLSIQLGWFKKL  148

Query  360  IPSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSG  470
             PSLC +  DC +  + SLF++GE GGNDY ++ ++G
Sbjct  149  KPSLCTTKQDCDSYFKRSLFLVGEIGGNDYNYAAIAG  185



>dbj|BAJ86481.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=382

 Score =   147 bits (370),  Expect(2) = 3e-66, Method: Compositional matrix adjust.
 Identities = 84/184 (46%), Positives = 116/184 (63%), Gaps = 0/184 (0%)
 Frame = +1

Query  466   REKNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVEDY  645
             + K + D +  +P V+ AI +   +LI+ GA  ++VP  LP+GC+++YLT +P  N  DY
Sbjct  198   KGKTLDDAKSYVPTVSSAIIDATERLIKGGAMHLVVPGNLPMGCSSAYLTLHPGRNSSDY  257

Query  646   DDLGCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGFSgg  825
             D +GCL   N+ A  HN ++Q++L +LR ++P A I+Y D + AAM     P   GF  G
Sbjct  258   DSVGCLKTYNEFAQRHNAMVQQKLQVLRLKYPKARIMYADYYGAAMSFAKNPKQFGFKQG  317

Query  826   alraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDGSYT  1005
              L+ CCGGGG YNFNP   CG  G++ C DPS Y NWDG HLTEAAY  +  S+L G YT
Sbjct  318   PLKTCCGGGGPYNFNPTASCGVRGSSVCADPSAYANWDGVHLTEAAYHAIADSILHGPYT  377

Query  1006  YPSM  1017
              P +
Sbjct  378   SPRL  381


 Score =   134 bits (336),  Expect(2) = 3e-66, Method: Compositional matrix adjust.
 Identities = 71/158 (45%), Positives = 100/158 (63%), Gaps = 12/158 (8%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            SL+DTGN   L     L ++ +      PYG T+FH PTGRCSDGR+++D +A+ +GL +
Sbjct  54   SLTDTGN---LLVSSPLSFNIV---GRFPYGMTYFHRPTGRCSDGRLVVDFLAQAFGLPL  107

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTV-TNVSMNDQLHAFQDM  359
              P LS      G ++RQGVNFAV G+ A+   F+Q +   D + TN+S++ QL  F  +
Sbjct  108  LQPYLSR-----GKDVRQGVNFAVGGATAMDPPFFQGIGASDKLWTNLSLSVQLDWFDKL  162

Query  360  IPSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
             PSLC+SP +CK     SLF++GE GGNDY ++L  GK
Sbjct  163  KPSLCSSPKNCKKYFSRSLFLVGEIGGNDYNYALFKGK  200



>ref|XP_009102895.1| PREDICTED: GDSL esterase/lipase At1g28570-like [Brassica rapa]
Length=382

 Score =   142 bits (358),  Expect(2) = 3e-66, Method: Compositional matrix adjust.
 Identities = 71/157 (45%), Positives = 102/157 (65%), Gaps = 9/157 (6%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            S++DTGN + L+       + +P  +  PYGETFFHHPTGR S+GR+I+D IAE  G  +
Sbjct  45   SIADTGNLLGLSDP-----NNLPKVAFPPYGETFFHHPTGRFSNGRLIIDFIAEFLGFPL  99

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQDMI  362
             PP   S+      N  +GVNFAV G+ AL     ++  I+   TNVS+  QL +F+D +
Sbjct  100  VPPFYGSQ----NANFEKGVNFAVGGATALEPSVLEERGIHFAYTNVSLGVQLQSFKDSL  155

Query  363  PSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
            P+LC SP+DC++++EN+L ++GE GGNDY + L  GK
Sbjct  156  PNLCGSPTDCRDMIENALILMGEIGGNDYNYPLFLGK  192


 Score =   138 bits (348),  Expect(2) = 3e-66, Method: Compositional matrix adjust.
 Identities = 75/186 (40%), Positives = 103/186 (55%), Gaps = 12/186 (6%)
 Frame = +1

Query  472   KNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVEDYDD  651
             K I +IR ++P+V   I+    +LI +G RT +VP   P+GCA  YLT Y +PN E YD 
Sbjct  192   KPIEEIRELVPLVITTISSAITELISMGGRTFLVPGEFPIGCAVIYLTLYKTPNKEAYDS  251

Query  652   LGCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGFSggal  831
              GCL W+N+ A YH+  LQ ELN LR+ +P+ NIIY D +NA +++   P   GF     
Sbjct  252   SGCLKWLNEFAVYHDDQLQAELNKLRKLYPHVNIIYADYYNALLRLSQEPTKFGF-----  306

Query  832   raccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDGSYTYP  1011
                               G++G   C DPS YV+WD  H+TEAAY+ M + +L G Y  P
Sbjct  307   -------IDRRLPACCGFGEKGMECCSDPSKYVSWDSVHMTEAAYRFMAEGVLKGPYAIP  359

Query  1012  SMNALC  1029
               +  C
Sbjct  360   PFDWSC  365



>ref|XP_010499397.1| PREDICTED: GDSL esterase/lipase At1g28670 [Camelina sativa]
Length=389

 Score =   148 bits (374),  Expect(2) = 4e-66, Method: Compositional matrix adjust.
 Identities = 81/199 (41%), Positives = 121/199 (61%), Gaps = 2/199 (1%)
 Frame = +1

Query  460   FSREKNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVE  639
             F   K+I +I+ ++P++  AI+     L++LG +T +VP   P GC+A+YLT + +   +
Sbjct  186   FFEGKSINEIKELVPLIIKAISSAIVDLVDLGGKTFLVPGGFPAGCSAAYLTLFQTVAEQ  245

Query  640   DYDDL-GCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGF  816
             D+D L GC+ W+N+   +HN+ L+ EL  L++ +P+ NIIY D  N+  + +  PA  GF
Sbjct  246   DHDPLTGCIPWLNEFGEHHNEQLKTELKRLQKLYPHVNIIYADYHNSLYRFFQEPAKYGF  305

Query  817   SggalraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDG  996
                    C  GG QYNF  D +CG EG   C +PS +VNWDGYHLTEA Y+ M +SLL+G
Sbjct  306   KNPLAACCGVGG-QYNFTIDKECGYEGVGYCQNPSEHVNWDGYHLTEATYQKMAQSLLNG  364

Query  997   SYTYPSMNALCPTDAQVAQ  1053
              Y  P+ +  C     VA+
Sbjct  365   PYATPAFDWSCLDSDSVAK  383


 Score =   132 bits (331),  Expect(2) = 4e-66, Method: Compositional matrix adjust.
 Identities = 70/158 (44%), Positives = 98/158 (62%), Gaps = 10/158 (6%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            S++DTGNY+ L+       + +P  + LPYGE+FFH PTGR SDGR+I+D IAE  GL  
Sbjct  42   SIADTGNYLHLS-----DVNHLPQTAFLPYGESFFHPPTGRASDGRLIIDFIAEFLGLPY  96

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQDMI  362
             PP   S+  +       G+NFAV G+ AL   F     I    +NVS++ QL+ F+ ++
Sbjct  97   VPPYFGSQNVS----FEHGINFAVYGATALDRAFLVGKGIETDFSNVSLSVQLNTFKQIL  152

Query  363  PSLCNSPS-DCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
            P+LC S S DC+ +LE+SL ++GE GGNDY +    GK
Sbjct  153  PNLCASSSRDCREMLEDSLILMGEIGGNDYNYPFFEGK  190



>ref|XP_010912671.1| PREDICTED: GDSL esterase/lipase At1g31550-like [Elaeis guineensis]
Length=436

 Score =   152 bits (385),  Expect(2) = 5e-66, Method: Compositional matrix adjust.
 Identities = 87/195 (45%), Positives = 122/195 (63%), Gaps = 0/195 (0%)
 Frame = +1

Query  460   FSREKNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVE  639
             F + + + ++   +P V  AI+     LIELGART++VP   P+GC ++YLT + S   E
Sbjct  225   FLQARALDEVISYVPPVMDAISSAITALIELGARTLVVPGNFPIGCNSAYLTVFHSNRSE  284

Query  640   DYDDLGCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGFS  819
             DYD  GC+ W+N+ + YHN  L+  L  +R+R+P+A +IY D ++AAM ++  P   GF 
Sbjct  285   DYDAFGCIKWLNKFSRYHNNQLRVVLKRIRQRNPHATVIYADYYSAAMSMFRSPQLSGFR  344

Query  820   ggalraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDGS  999
                L ACCGGGG YNFN  LQCG+ G+  C DPS+YV WDG H+TEAAY+ +   LL+G 
Sbjct  345   SSPLPACCGGGGPYNFNSFLQCGNPGSNVCADPSSYVTWDGMHMTEAAYRKIATGLLEGP  404

Query  1000  YTYPSMNALCPTDAQ  1044
                P +   CP   Q
Sbjct  405   NAVPPILNTCPRTKQ  419


 Score =   127 bits (320),  Expect(2) = 5e-66, Method: Compositional matrix adjust.
 Identities = 68/159 (43%), Positives = 99/159 (62%), Gaps = 13/159 (8%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSV--LPYGETFFHHPTGRCSDGRVILDIIAEHYGL  176
            SL+DTGN        +L+Y G  +  V  LPYGET+F  PTGR  DGR+++D IA+  GL
Sbjct  82   SLADTGN--------LLRYLGKKNIDVGRLPYGETYFRRPTGRFCDGRLVVDFIAQAMGL  133

Query  177  AIPPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQD  356
             + PP L   A+  G+  RQG NFAV G+ A+   F+ +  ++   +N S+  Q+  F+ 
Sbjct  134  PLLPPYL---ARRSGHGFRQGANFAVAGATAIENGFFMEKGLHVPWSNNSLGIQIEWFRQ  190

Query  357  MIPSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
            ++PSLC+S SDC  + +NSLF++GE GGNDY +  L  +
Sbjct  191  LLPSLCSSDSDCNVMFQNSLFLVGEIGGNDYNYPFLQAR  229



>ref|XP_009352806.1| PREDICTED: GDSL esterase/lipase At1g28600-like [Pyrus x bretschneideri]
Length=373

 Score =   147 bits (370),  Expect(2) = 5e-66, Method: Compositional matrix adjust.
 Identities = 81/182 (45%), Positives = 120/182 (66%), Gaps = 1/182 (1%)
 Frame = +1

Query  487   IRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVEDYD-DLGCL  663
             +   +P V  A+A   ++LI+ GA T++VP   P+GC ++YLT Y   +  +YD   GCL
Sbjct  188   VETYVPFVIEAMASAINELIQHGASTLLVPGNFPIGCTSAYLTLYEGSDESEYDPSTGCL  247

Query  664   IWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGFSggalracc  843
              W+N+ + YHN+LL+ +L+ +R  HP+ NIIY D++NA +Q+Y  P   GF+    RACC
Sbjct  248   TWLNKFSEYHNELLKTKLSQIRSLHPHVNIIYGDVYNAELQLYQSPEQFGFTENTSRACC  307

Query  844   ggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDGSYTYPSMNA  1023
             GGGG YN+N    CG  GA++C +P+  +NWDG H TEAA + +TK+LL+G YT P ++ 
Sbjct  308   GGGGTYNYNLSAPCGLRGASACANPAKSINWDGRHTTEAANQWITKALLNGIYTIPHIST  367

Query  1024  LC  1029
              C
Sbjct  368   SC  369


 Score =   133 bits (335),  Expect(2) = 5e-66, Method: Compositional matrix adjust.
 Identities = 71/158 (45%), Positives = 96/158 (61%), Gaps = 4/158 (3%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            SL+DTGN   +  D +  + G       PYGET+FHHPTGRC DGR+I+D+IAE   L +
Sbjct  29   SLADTGN---IYVDALDHHKGPYHFFFPPYGETYFHHPTGRCCDGRLIIDLIAESMRLPL  85

Query  183  PPPSLSS-KAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQDM  359
              P L          N+ +GVNFAVVG+ AL  +F   +  YD  TN S+  Q+  F+ M
Sbjct  86   IRPYLEVLNVNETMRNLEEGVNFAVVGATALDTDFLDPMGRYDVFTNFSLRIQVDWFKGM  145

Query  360  IPSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
            +  LCN+ SDC+N+L +SL V+G  GGNDY   L +G+
Sbjct  146  LSPLCNTSSDCRNVLSSSLIVMGPIGGNDYNCPLFAGE  183



>ref|XP_003542991.1| PREDICTED: GDSL esterase/lipase At1g28600-like isoform X1 [Glycine 
max]
 ref|XP_006594559.1| PREDICTED: GDSL esterase/lipase At1g28600-like isoform X2 [Glycine 
max]
 ref|XP_006594560.1| PREDICTED: GDSL esterase/lipase At1g28600-like isoform X3 [Glycine 
max]
Length=378

 Score =   156 bits (395),  Expect(2) = 8e-66, Method: Compositional matrix adjust.
 Identities = 85/188 (45%), Positives = 122/188 (65%), Gaps = 2/188 (1%)
 Frame = +1

Query  466   REKNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVEDY  645
             ++++I +++  +P V  AI    ++LI LGART++VP  +PLGC+ +YLT Y + +   Y
Sbjct  182   QQRSIAEVKTFVPYVIKAITSAVNELIGLGARTLIVPGNIPLGCSITYLTIYETMDKNQY  241

Query  646   DDLGCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGFSgg  825
             D  GCL W+N+ A Y+NQ LQ EL+ L+  H +ANIIY D +NA + +Y  P   GF+  
Sbjct  242   DQYGCLKWLNKFAEYYNQKLQSELHRLQGLHSHANIIYADYYNAILSLYRDPTMFGFT--  299

Query  826   alraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDGSYT  1005
              L+ CCG GG YN+N    CGD G  +C DPS ++ WDG HLTEAAY+++ + L+ G Y 
Sbjct  300   NLKTCCGMGGPYNYNASADCGDPGVNACDDPSKHIGWDGVHLTEAAYRIIAQGLIKGPYC  359

Query  1006  YPSMNALC  1029
              P  N LC
Sbjct  360   LPRFNTLC  367


 Score =   123 bits (308),  Expect(2) = 8e-66, Method: Compositional matrix adjust.
 Identities = 68/160 (43%), Positives = 96/160 (60%), Gaps = 17/160 (11%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIP---SCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYG  173
            S +DTGN         L +   P    C   PYG+TFFH  TGRCSDGR+I+D IAE  G
Sbjct  39   SFADTGN---------LYFSSHPPSHHCFFPPYGQTFFHRVTGRCSDGRLIIDFIAESLG  89

Query  174  LAIPPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQ  353
            L +  P L  K +    N+  G NFAV+G+ AL   F+++  I    T+ S+  QL+ F+
Sbjct  90   LPLLKPYLGMKKK----NVVGGANFAVIGATALDLSFFEERGI-SIPTHYSLTVQLNWFK  144

Query  354  DMIPSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
            +++PSLCNS +DC  ++ NSLF++GE GGND+ + L   +
Sbjct  145  ELLPSLCNSSADCHEVVGNSLFLMGEIGGNDFNYLLFQQR  184



>ref|XP_010478242.1| PREDICTED: GDSL esterase/lipase At1g28670-like [Camelina sativa]
Length=389

 Score =   144 bits (364),  Expect(2) = 8e-66, Method: Compositional matrix adjust.
 Identities = 80/199 (40%), Positives = 119/199 (60%), Gaps = 2/199 (1%)
 Frame = +1

Query  460   FSREKNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVE  639
             F   K+I + + ++P++  AI+     LI+LG +T +VP   P GC+A+YLT + +   +
Sbjct  186   FFEGKSINETKELVPLIIKAISSAIVDLIDLGGKTFLVPGGFPAGCSAAYLTLFQTVAEQ  245

Query  640   DYDDL-GCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGF  816
             ++D L GC+ W+N+   +HN+ L+ EL  L++ +P+ NIIY D  N+  + +  PA  GF
Sbjct  246   EHDPLTGCIPWLNEFGEHHNEQLKTELKRLQKLYPHVNIIYADYHNSLYRFFQEPAKYGF  305

Query  817   SggalraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDG  996
                    C  GG QYNF  D +CG EG   C +PS +VNWDGYHLTEA Y+ M  SLL+G
Sbjct  306   KNPLAACCGVGG-QYNFTIDKECGYEGVGYCQNPSEHVNWDGYHLTEATYQKMAHSLLNG  364

Query  997   SYTYPSMNALCPTDAQVAQ  1053
              Y  P+ +  C     VA+
Sbjct  365   PYATPAFDWSCLDSDSVAK  383


 Score =   134 bits (338),  Expect(2) = 8e-66, Method: Compositional matrix adjust.
 Identities = 72/158 (46%), Positives = 98/158 (62%), Gaps = 10/158 (6%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            S++DTGNY+ L+       + +P  + LPYGE+FFH PTGR SDGR+I+D IAE  GL  
Sbjct  42   SIADTGNYLHLS-----DVNHLPQTAFLPYGESFFHPPTGRASDGRLIIDFIAEFLGLPY  96

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQDMI  362
             PP   S+  +      QG+NFAV G+ AL   F     I    TNVS++ QL+ F+ ++
Sbjct  97   VPPYFGSQNVS----FEQGINFAVYGATALDRAFLVGKGIETDFTNVSLSVQLNTFKQIL  152

Query  363  PSLCNSPS-DCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
            P+LC S S DC+ +LE SL ++GE GGNDY +    GK
Sbjct  153  PNLCASSSRDCREILEESLILMGEIGGNDYNYPFFEGK  190



>gb|AFW80395.1| esterase [Zea mays]
Length=367

 Score =   149 bits (377),  Expect(2) = 9e-66, Method: Compositional matrix adjust.
 Identities = 87/186 (47%), Positives = 116/186 (62%), Gaps = 0/186 (0%)
 Frame = +1

Query  460   FSREKNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVE  639
             F + K + D +  +P VA A+ +   +LI+ GA  ++VP  LP+GC+++YLT +P  N  
Sbjct  181   FFKGKTLDDAKTYVPTVAAAVTDATERLIKAGATHLVVPGNLPMGCSSAYLTLHPGRNGS  240

Query  640   DYDDLGCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGFS  819
             DYD  GCL   N  A +HN +LQ +L  LR ++P A I+Y D + AAM     P   GF+
Sbjct  241   DYDAAGCLRTYNDFAQHHNAVLQRKLRALRAKYPQARIMYADYYGAAMSFAKNPKQFGFT  300

Query  820   ggalraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDGS  999
              G LR CCGGGG YNFNP   CG  G++ C DPS Y NWDG HLTEAAY  +  S+L+G 
Sbjct  301   QGPLRTCCGGGGPYNFNPKASCGVRGSSVCADPSAYANWDGVHLTEAAYHAIADSILNGP  360

Query  1000  YTYPSM  1017
             YT P +
Sbjct  361   YTSPRL  366


 Score =   129 bits (325),  Expect(2) = 9e-66, Method: Compositional matrix adjust.
 Identities = 69/161 (43%), Positives = 103/161 (64%), Gaps = 17/161 (11%)
 Frame = +3

Query  3    SLSDTGNYI---SLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYG  173
            SL+DTGN +    L++  V +Y         PYG T+FH  TGRCSDGR+++D +A+ +G
Sbjct  38   SLTDTGNLLVSSPLSNHIVGRY---------PYGITYFHRSTGRCSDGRLVVDFLAQAFG  88

Query  174  LAIPPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTV-TNVSMNDQLHAF  350
            L +  P L S+    G ++R+GVNFAV G+ A+   F+Q++   D + TN+S++ QL  F
Sbjct  89   LPLLQPYLQSR----GKDLRRGVNFAVGGATAMDPPFFQEIGASDKLWTNLSLSVQLGWF  144

Query  351  QDMIPSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
            + + PSLC+SP +CK     SLF++GE GGNDY ++   GK
Sbjct  145  EQLKPSLCSSPKECKEYFSKSLFLVGEIGGNDYNYAFFKGK  185



>ref|XP_002891138.1| carboxylic ester hydrolase/ lipase [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH67397.1| carboxylic ester hydrolase/ lipase [Arabidopsis lyrata subsp. 
lyrata]
Length=394

 Score =   154 bits (388),  Expect(2) = 9e-66, Method: Compositional matrix adjust.
 Identities = 86/191 (45%), Positives = 119/191 (62%), Gaps = 1/191 (1%)
 Frame = +1

Query  460   FSREKNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVE  639
             F   + + +++ ++P+V   I+    +LI +G RT +VP   PLGC+ ++LT Y + NVE
Sbjct  185   FFELRPLDEVKELVPLVISTISSAITELIGMGGRTFLVPGGFPLGCSVAFLTLYQTSNVE  244

Query  640   DYDDL-GCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGF  816
             +YD L GCLIW+N+   YH++ L+EEL  LR+ +P+ NIIY D +NA++++   P   GF
Sbjct  245   EYDPLTGCLIWLNKFGEYHSEQLKEELKRLRQLNPHVNIIYADYYNASLRLGQEPTKYGF  304

Query  817   SggalraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDG  996
                 L ACCG G  YNFN    CG  G  SC DPS YV WDG H+TEAA+K M   LL+G
Sbjct  305   INRHLSACCGVGRPYNFNFSRSCGSVGVESCNDPSKYVAWDGLHMTEAAHKSMADGLLNG  364

Query  997   SYTYPSMNALC  1029
              Y  P  N  C
Sbjct  365   PYAIPPFNWSC  375


 Score =   125 bits (314),  Expect(2) = 9e-66, Method: Compositional matrix adjust.
 Identities = 66/149 (44%), Positives = 95/149 (64%), Gaps = 10/149 (7%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            S++DTGN +SL+     +Y+ +P  +  PYGETFFHHPTGR SDGR+I+D IAE  GL  
Sbjct  43   SIADTGNLLSLSD----RYN-LPMSAFPPYGETFFHHPTGRFSDGRLIIDFIAEFLGLPY  97

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQDMI  362
             PP   S       N  +GVNFAV  + AL + F ++   Y    N+S+  QL +F++ +
Sbjct  98   VPPYFGSI----NGNFEKGVNFAVASATALESSFLEE-RGYHCPHNISLGIQLKSFKESL  152

Query  363  PSLCNSPSDCKNLLENSLFVLGEFGGNDY  449
            P++C  PSDC+ ++ N+L ++GE G NDY
Sbjct  153  PNICGLPSDCREMIGNALILMGEIGANDY  181



>ref|XP_010912598.1| PREDICTED: GDSL esterase/lipase At1g28650-like isoform X1 [Elaeis 
guineensis]
Length=410

 Score =   155 bits (391),  Expect(2) = 1e-65, Method: Compositional matrix adjust.
 Identities = 93/198 (47%), Positives = 119/198 (60%), Gaps = 4/198 (2%)
 Frame = +1

Query  460   FSREKNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVE  639
             F+  +   +IR  IP +   I+     LI+LGA+T++VP + P GC   YLT+  S  VE
Sbjct  197   FNEGRTADEIRTFIPNIIEVISSVIDDLIKLGAKTLVVPGIFPSGCVPVYLTWMQSEIVE  256

Query  640   DYD-DLGCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGF  816
             DYD D GC+ WVN+ ++YHNQLLQ EL+ +R  HP+  IIY D + A M ++  P   GF
Sbjct  257   DYDPDTGCIKWVNEFSAYHNQLLQNELDRIRRLHPHVTIIYADYYEALMSVFRSPEKFGF  316

Query  817   SggalraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDG  996
                    C GGG     N  +QCGD G T C DPS YV+WDG HLTEAAY+ +   LL G
Sbjct  317   EKPFDACCGGGGPN---NCAIQCGDPGFTVCSDPSKYVSWDGSHLTEAAYRAIALGLLQG  373

Query  997   SYTYPSMNALCPTDAQVA  1050
             SYT PSM+  CP   Q A
Sbjct  374   SYTTPSMSRACPHIEQYA  391


 Score =   124 bits (311),  Expect(2) = 1e-65, Method: Compositional matrix adjust.
 Identities = 68/157 (43%), Positives = 97/157 (62%), Gaps = 9/157 (6%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            SL+DTGN +    D     D  P    LPYGET+FH+ TGR SDGR+I+D IA+  GL +
Sbjct  54   SLADTGNLLHYLGD-----DAGPFAH-LPYGETYFHNATGRFSDGRLIIDFIAQSLGLPL  107

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQDMI  362
             PP L   A T   + R G NFAV G+ AL  +F++   +  T +  S+  Q + F+ ++
Sbjct  108  VPPYL---AGTNAQDFRYGANFAVAGATALDNDFFRAKGLNVTWSEYSLVVQFNWFKQLL  164

Query  363  PSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
            PSLC++ SDCK ++ NSLF++GE G ND+ +S   G+
Sbjct  165  PSLCSTDSDCKGIISNSLFLVGEIGWNDHGYSFNEGR  201



>ref|XP_006415633.1| hypothetical protein EUTSA_v10007853mg [Eutrema salsugineum]
 gb|ESQ33986.1| hypothetical protein EUTSA_v10007853mg [Eutrema salsugineum]
Length=392

 Score =   145 bits (365),  Expect(2) = 1e-65, Method: Compositional matrix adjust.
 Identities = 81/197 (41%), Positives = 121/197 (61%), Gaps = 1/197 (1%)
 Frame = +1

Query  460   FSREKNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVE  639
             F   K+I +++ ++P+V  AI+     LI+LG +T +VP   PLGC+ +YLT + +   E
Sbjct  188   FFEGKSINELKDLVPLVIKAISSAIVDLIDLGGKTFLVPGNFPLGCSPAYLTLFKTVEEE  247

Query  640   DYDDL-GCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGF  816
             ++D   GC+ W+N+   +HN+ L+ EL  L++ +P+ NIIY D +N+    +  PA  GF
Sbjct  248   EHDPFTGCITWLNEFGQHHNEQLKTELKRLQKLYPHVNIIYADYYNSMYPFFQEPARYGF  307

Query  817   SggalraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDG  996
                 L ACCG GG YNF  + +CG EG + C +PS YVNWDGYHLTEA ++ +   LL+G
Sbjct  308   KNRPLGACCGVGGNYNFTINEECGYEGVSYCQNPSEYVNWDGYHLTEATHQKIAHGLLNG  367

Query  997   SYTYPSMNALCPTDAQV  1047
              Y  P+ +  C   A V
Sbjct  368   PYATPAFDWSCIGSASV  384


 Score =   134 bits (337),  Expect(2) = 1e-65, Method: Compositional matrix adjust.
 Identities = 73/158 (46%), Positives = 99/158 (63%), Gaps = 9/158 (6%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            S++DTGNYI L+SD     +  P  + LPYGETFF  P+GR SDGR+I+D IAE  GL  
Sbjct  43   SIADTGNYIHLSSD----VNHPPQAAFLPYGETFFRSPSGRYSDGRLIIDFIAEFLGLPY  98

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQDMI  362
             PP   S+  +      +G+NFAV G+ AL   F     I    TNVS++ QL+ F+ ++
Sbjct  99   VPPYFGSQNVS----FEKGINFAVYGATALDRAFLLAKGIESDFTNVSLSVQLNIFKQIL  154

Query  363  PSLCNSPS-DCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
            P+LC S S DC+ +LE+SL ++GE GGNDY +    GK
Sbjct  155  PNLCASSSRDCREILEDSLILMGEIGGNDYNYPFFEGK  192



>gb|KDP21068.1| hypothetical protein JCGZ_21539 [Jatropha curcas]
Length=367

 Score =   145 bits (367),  Expect(2) = 1e-65, Method: Compositional matrix adjust.
 Identities = 87/184 (47%), Positives = 115/184 (63%), Gaps = 0/184 (0%)
 Frame = +1

Query  475   NITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVEDYDDL  654
             +I  +R  +P+V  AI +    LIE GA  +MVP  LP+GC+A YLT + SPN  DYD  
Sbjct  182   SIKQLRASVPLVVGAITKAITVLIEEGAVELMVPGNLPIGCSAVYLTLFQSPNKADYDKN  241

Query  655   GCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGFSggalr  834
             GCL   N  + YHN  L+  L  LR ++P A IIY D + AA + Y  P + GF  G L 
Sbjct  242   GCLKAYNSFSKYHNNQLKGALETLRNKYPNARIIYADYYGAAKRFYHSPKHYGFYNGVLT  301

Query  835   accggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDGSYTYPS  1014
             ACCGGGG YNFN   +CG  G+ +C +PSTY NWDG HLTEAAY+++   L++GS++ P 
Sbjct  302   ACCGGGGSYNFNNFARCGHVGSKACVNPSTYANWDGIHLTEAAYRIIAMGLINGSFSTPP  361

Query  1015  MNAL  1026
             +   
Sbjct  362   LTKF  365


 Score =   133 bits (334),  Expect(2) = 1e-65, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 96/157 (61%), Gaps = 10/157 (6%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            SLSDTGN++     G L +   P    LPYGET+F HPTGRCSDGR+++D IAE  GL  
Sbjct  33   SLSDTGNFLL---SGALAF---PVIGKLPYGETYFRHPTGRCSDGRLVVDFIAEASGLPH  86

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTV-TNVSMNDQLHAFQDM  359
             PP L       G N R GVNFAV G+ AL +EF+   +I   + TN S++ QL  F+++
Sbjct  87   LPPYLGLGK---GQNFRDGVNFAVAGATALSSEFFYDKKIGQVLWTNDSLSIQLGWFKEL  143

Query  360  IPSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSG  470
              SLC +  +C N  + SLFV+GE GGNDY +    G
Sbjct  144  KTSLCTTKQECDNYFKKSLFVVGEIGGNDYNYPFFVG  180



>ref|XP_008785390.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Phoenix dactylifera]
Length=364

 Score =   145 bits (367),  Expect(2) = 1e-65, Method: Compositional matrix adjust.
 Identities = 85/183 (46%), Positives = 114/183 (62%), Gaps = 1/183 (1%)
 Frame = +1

Query  472   KNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVEDYD-  648
             K+  +++P +P V  AI      LI+ GA  ++VP +LP GC+++YLT + SPN EDYD 
Sbjct  182   KSPKEVKPYVPKVIGAIVAAIESLIKNGAVNLLVPGILPFGCSSAYLTVFNSPNREDYDP  241

Query  649   DLGCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGFSgga  828
               GCL W+N  A YHN LL+  L+ LR ++P A I+Y D + A+  I   P + GF    
Sbjct  242   RTGCLRWLNGFAKYHNALLRRALDELRRKYPRARIMYADYYGASNPISRSPQHFGFGRNI  301

Query  829   lraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDGSYTY  1008
               ACCGG G YNF+P   CG   +T C  PS+YVNWDG+HLTEAAY  +   LL+G YT 
Sbjct  302   FVACCGGDGPYNFSPLALCGQPSSTVCSHPSSYVNWDGFHLTEAAYHFIATGLLEGPYTT  361

Query  1009  PSM  1017
             P +
Sbjct  362   PPL  364


 Score =   133 bits (334),  Expect(2) = 1e-65, Method: Compositional matrix adjust.
 Identities = 74/160 (46%), Positives = 97/160 (61%), Gaps = 13/160 (8%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            SL+DTGN +      +      P+   LPYG TFF HPTGRC DGR+I+D IA  +GL +
Sbjct  34   SLADTGNAL------IYSKSSSPAFGRLPYGMTFFRHPTGRCCDGRLIVDFIATAFGLPL  87

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYD--TVTNVSMNDQLHAFQD  356
             PP L+      G NI+QGVNFAV G+ AL    +Q L   D   +TN+S++ QL  F+ 
Sbjct  88   LPPYLAH-----GQNIQQGVNFAVAGAAALDPAVFQGLLGGDGFPLTNLSLSTQLRWFER  142

Query  357  MIPSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSGKK  476
            + PSLCN+ + C +    SLFV+GE GGNDY +  L G K
Sbjct  143  LKPSLCNTATACADHFSKSLFVVGEIGGNDYNYFFLLGGK  182



>ref|XP_010912577.1| PREDICTED: GDSL esterase/lipase At1g28580-like [Elaeis guineensis]
Length=393

 Score =   148 bits (374),  Expect(2) = 1e-65, Method: Compositional matrix adjust.
 Identities = 85/191 (45%), Positives = 121/191 (63%), Gaps = 1/191 (1%)
 Frame = +1

Query  460   FSREKNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVE  639
             F +   I +IR ++P + H I+     LI+LGA+T++VP ++P GC + YLT + S   E
Sbjct  199   FVQGMTIEEIRKLVPDIIHVISSAITDLIQLGAKTLVVPGIVPSGCVSLYLTVFQSQKGE  258

Query  640   DYD-DLGCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGF  816
             DYD   GC+ W N+ +  HN+L+ EEL+ LR  HP+A II+ + ++A M I+  P   GF
Sbjct  259   DYDPRTGCIKWANEFSEEHNRLISEELDRLRRLHPHATIIHANYYDALMSIFRSPQQFGF  318

Query  817   SggalraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDG  996
                 L ACCGG G YN N  L+CGD   T C DP+ +V WDG HLTEAAY+++++ LL+G
Sbjct  319   KKSPLDACCGGDGPYNMNISLRCGDPKTTVCRDPAKFVFWDGTHLTEAAYEVISRGLLEG  378

Query  997   SYTYPSMNALC  1029
              Y  PS+   C
Sbjct  379   PYATPSIIQTC  389


 Score =   130 bits (326),  Expect(2) = 1e-65, Method: Compositional matrix adjust.
 Identities = 71/158 (45%), Positives = 95/158 (60%), Gaps = 13/158 (8%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSV--LPYGETFFHHPTGRCSDGRVILDIIAEHYGL  176
            SL+DTGN+        L Y G  S  V  LPYGET+FH  TGR SDGR+I+D IA+  GL
Sbjct  56   SLADTGNF--------LHYSGNNSGPVAQLPYGETYFHRATGRFSDGRLIIDFIAQAMGL  107

Query  177  AIPPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQD  356
             + PP L+ K      + R G NFAV G+ AL  +FY+   +       S+  Q+  F+ 
Sbjct  108  PLVPPYLAGKHS---QDFRHGANFAVAGATALDNDFYRAKGLKVVWPEYSLGIQIKWFKQ  164

Query  357  MIPSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSG  470
            ++PSLC+S SDCK+ + NSLF++GE G NDY H  + G
Sbjct  165  LLPSLCSSDSDCKSFMSNSLFLVGEIGWNDYNHPFVQG  202



>ref|XP_010460655.1| PREDICTED: GDSL esterase/lipase At1g28610-like [Camelina sativa]
Length=414

 Score =   146 bits (369),  Expect(2) = 2e-65, Method: Compositional matrix adjust.
 Identities = 84/189 (44%), Positives = 124/189 (66%), Gaps = 2/189 (1%)
 Frame = +1

Query  472   KNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVEDYDD  651
             K + +++ ++P+V  +I+    +L+++G +T+MVP+  P+GC  ++LT Y   N E+YD 
Sbjct  192   KTVEELKELVPLVISSISFMITELVKMGGKTIMVPADFPIGCWTAFLTEYRISNNEEYDP  251

Query  652   L-GCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGF-Sgg  825
             L GCL W+N+   YHN+ LQEELN +++ +P+  IIY D +NA ++I+  PA  GF SG 
Sbjct  252   LTGCLKWLNEFIEYHNKELQEELNRVQKIYPHVTIIYADYYNALLRIFQEPAKFGFTSGR  311

Query  826   alraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDGSYT  1005
              L A CG GG YNFN    CG +   SC DPS YV+WDG+HLTE+AY+ +    L G YT
Sbjct  312   PLSAFCGTGGPYNFNSMSWCGTKKVDSCSDPSKYVHWDGFHLTESAYRWIAMGFLKGPYT  371

Query  1006  YPSMNALCP  1032
              P+ +  CP
Sbjct  372   IPAYDWSCP  380


 Score =   132 bits (331),  Expect(2) = 2e-65, Method: Compositional matrix adjust.
 Identities = 67/157 (43%), Positives = 95/157 (61%), Gaps = 9/157 (6%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            S++DTGN + L+       D +P  +  PYGETFFH PTGR S+GR+I+D IAE  GL  
Sbjct  45   SITDTGNLLGLSDA-----DNLPHSAFPPYGETFFHFPTGRFSNGRLIIDFIAEFLGLPY  99

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQDMI  362
             PP   S+  +      +GVNFAV G+ AL     +   IY   TNVS+  Q   F++ +
Sbjct  100  LPPFYGSQNAS----FEKGVNFAVAGATALDQTVLESRGIYYDYTNVSLGVQFKNFKESL  155

Query  363  PSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
            P++C SP+DC+ ++  +L ++GE GGNDY +  L GK
Sbjct  156  PNICGSPADCREMIGTALLIVGEIGGNDYNYGFLVGK  192



>ref|NP_001242505.1| uncharacterized protein LOC100815771 precursor [Glycine max]
 gb|ACU18018.1| unknown [Glycine max]
Length=375

 Score =   149 bits (376),  Expect(2) = 2e-65, Method: Compositional matrix adjust.
 Identities = 87/182 (48%), Positives = 120/182 (66%), Gaps = 0/182 (0%)
 Frame = +1

Query  475   NITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVEDYDDL  654
             N+T ++  +P V  AI    + LI  GAR ++VP   P+GC+A YLT + S N EDYD+ 
Sbjct  187   NVTQLQSTVPPVVEAITMAINGLIAEGARELLVPGNFPIGCSALYLTLFRSENKEDYDES  246

Query  655   GCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGFSggalr  834
             GCL   N  A YHN+ L+  L  LR+++P+A I+Y D + AA + +  P + GF+ GALR
Sbjct  247   GCLKTFNGFAEYHNRELKLALETLRKKNPHARILYADYYGAAKRFFHAPGHHGFTNGALR  306

Query  835   accggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDGSYTYPS  1014
             ACCGGGG +NFN   +CG  G+ +C DPSTY NWDG HLTEAAY+ + K L+ G ++YP 
Sbjct  307   ACCGGGGPFNFNISARCGHTGSKACADPSTYANWDGIHLTEAAYRYIAKGLIYGPFSYPP  366

Query  1015  MN  1020
             + 
Sbjct  367   LK  368


 Score =   129 bits (323),  Expect(2) = 2e-65, Method: Compositional matrix adjust.
 Identities = 72/157 (46%), Positives = 98/157 (62%), Gaps = 10/157 (6%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            SLSDTGN+  L S  +L     P    LPYG+TFF   TGRCSDGR+++D IAE Y L  
Sbjct  39   SLSDTGNF--LASGAIL----FPVIGKLPYGQTFFKRATGRCSDGRLMIDFIAEAYDLPY  92

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTV-TNVSMNDQLHAFQDM  359
             PP     A T    I++GVNFAV G+ AL A+F+ +  +   + TN S+N QL  F+ +
Sbjct  93   LPPY---PALTKDQYIQRGVNFAVAGATALDAKFFIEAGLAKYLWTNNSLNIQLGWFKKL  149

Query  360  IPSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSG  470
             PSLC +  DC +  + SLF++GE GGNDY ++ ++G
Sbjct  150  KPSLCTTKQDCDSYFKRSLFLVGEIGGNDYNYAAIAG  186



>ref|XP_009113642.1| PREDICTED: GDSL esterase/lipase At2g27360-like isoform X1 [Brassica 
rapa]
 emb|CDY34089.1| BnaA09g27150D [Brassica napus]
Length=389

 Score =   149 bits (377),  Expect(2) = 2e-65, Method: Compositional matrix adjust.
 Identities = 85/191 (45%), Positives = 119/191 (62%), Gaps = 1/191 (1%)
 Frame = +1

Query  460   FSREKNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVE  639
             F   KNI +++ ++P+V   I+    +L+++G +T +VP   PLGC+  YLT Y + N E
Sbjct  186   FFGHKNIEEVKELVPLVISTISSTITELVDMGGKTFLVPGDFPLGCSVIYLTLYQTSNKE  245

Query  640   DYD-DLGCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGF  816
              YD   GCL W+N+ + YHN+ LQ ELN LR+ +PY NIIY D +NA +++   PA  G 
Sbjct  246   AYDPQTGCLTWLNEFSEYHNEQLQAELNRLRKLYPYVNIIYGDYYNALLRLIQEPAKFGL  305

Query  817   SggalraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDG  996
                 L  CCG GG+YN+   ++CG +G   C DPS YVNWDG H+TEAAYK + + LL G
Sbjct  306   MNNPLPVCCGLGGRYNYTFGVKCGLKGVECCNDPSKYVNWDGIHMTEAAYKWIAEGLLKG  365

Query  997   SYTYPSMNALC  1029
              Y  P  +  C
Sbjct  366   PYATPPFDWSC  376


 Score =   128 bits (322),  Expect(2) = 2e-65, Method: Compositional matrix adjust.
 Identities = 71/157 (45%), Positives = 96/157 (61%), Gaps = 9/157 (6%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            S++DTGN I+L++      + +P  + LPYGETFFHHPTGR SDGR+I+D IAE  GL  
Sbjct  43   SITDTGNLIALSTP-----NELPESAFLPYGETFFHHPTGRYSDGRLIIDFIAEVLGLPH  97

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQDMI  362
             PP   SK      N  +GVNFAV G+ AL     ++  I     N S+  QL  F++ +
Sbjct  98   VPPFYGSK----NGNFEKGVNFAVGGATALECSVLEERGISCPPKNKSLGVQLTNFKESL  153

Query  363  PSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
             SLC SPSDC +++ N+L ++GE GGNDY +     K
Sbjct  154  RSLCGSPSDCIDMIGNALILIGEIGGNDYNYPFFGHK  190



>ref|XP_002438501.1| hypothetical protein SORBIDRAFT_10g020950 [Sorghum bicolor]
 gb|EER89868.1| hypothetical protein SORBIDRAFT_10g020950 [Sorghum bicolor]
Length=399

 Score =   141 bits (355),  Expect(2) = 2e-65, Method: Compositional matrix adjust.
 Identities = 80/181 (44%), Positives = 114/181 (63%), Gaps = 2/181 (1%)
 Frame = +1

Query  475   NITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVEDYD-D  651
               ++I+  +P+V  AIA G  KLIELGA  ++VP VLP+GC   YLT Y + +  DY+  
Sbjct  214   KFSEIKTYVPLVTKAIANGVEKLIELGATDLLVPGVLPIGCFPLYLTLYNTSSKSDYNAR  273

Query  652   LGCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGFSggal  831
              GCL   N++A +HN+ L+++L+ L++++P   I+Y D F AAMQ    P   GFS    
Sbjct  274   TGCLRRYNRLAFHHNRELKQQLDELQKKYPKTKIMYGDYFKAAMQFVVYPGKFGFSTALQ  333

Query  832   ra-ccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDGSYTY  1008
                  GG G YNFN   +CG++GA+ C +PS+YV+WDG H+TEAAYK +    L+G Y  
Sbjct  334   ACCGAGGQGNYNFNLKKKCGEQGASVCSNPSSYVSWDGIHMTEAAYKKVADGWLNGPYAE  393

Query  1009  P  1011
             P
Sbjct  394   P  394


 Score =   137 bits (344),  Expect(2) = 2e-65, Method: Compositional matrix adjust.
 Identities = 73/159 (46%), Positives = 95/159 (60%), Gaps = 12/159 (8%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            SLSD GN I   +   L      + +  PYG TFF  PTGRCS+GR+++D +AEH+GL +
Sbjct  67   SLSDAGNLIVNGTPKAL------TTARPPYGMTFFRKPTGRCSNGRLVVDFLAEHFGLPL  120

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNV-SMNDQLHAFQDM  359
            P PS     Q  G + ++G NFA+ G+ AL   F++   I   + N  S+N Q+   QDM
Sbjct  121  PQPS-----QAKGKDFKKGANFAITGATALEYSFFKAHGIDQRIWNTGSINTQIGWLQDM  175

Query  360  IPSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSGKK  476
             PSLC S  DCK+    SLFV+GEFGGNDY   L SG K
Sbjct  176  KPSLCKSDQDCKDYFSKSLFVVGEFGGNDYNAPLFSGVK  214



>ref|XP_002267222.2| PREDICTED: GDSL esterase/lipase At5g45910 [Vitis vinifera]
Length=364

 Score =   149 bits (375),  Expect(2) = 2e-65, Method: Compositional matrix adjust.
 Identities = 89/180 (49%), Positives = 120/180 (67%), Gaps = 1/180 (1%)
 Frame = +1

Query  475   NITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVEDYDDL  654
             +I  ++ ++P+V  AI + A  LIE GA T+MVP   P+GC+A YLT + SPN  DYD+ 
Sbjct  184   SIKQVQALVPLVVEAITKAASMLIEEGAVTLMVPGNFPIGCSAVYLTIFRSPNKADYDEN  243

Query  655   -GCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGFSggal  831
              GCL   N  A YHN  L+  L+ L  ++P+A IIY D +NAAM ++  P + GF  GAL
Sbjct  244   NGCLKAFNAFAQYHNTHLKLALDKLGLKYPHAKIIYADYYNAAMPLFQAPRSFGFYNGAL  303

Query  832   raccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDGSYTYP  1011
             RACCGGGG YNFN   +CG  G+ +C DPS+Y NWDG HLTE AYK++   L++ S++ P
Sbjct  304   RACCGGGGPYNFNNSARCGHIGSKACNDPSSYANWDGIHLTEGAYKIIATCLINVSFSSP  363


 Score =   129 bits (324),  Expect(2) = 2e-65, Method: Compositional matrix adjust.
 Identities = 70/157 (45%), Positives = 94/157 (60%), Gaps = 10/157 (6%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            SL+DTGN++     G L +   P    LPYGETFF H TGRCSDGR+I+D IAE +G+  
Sbjct  35   SLADTGNFLL---SGALAF---PVIRELPYGETFFRHATGRCSDGRLIVDFIAEAFGIPY  88

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTV-TNVSMNDQLHAFQDM  359
             PP LS      G + R GVNFAV G+ AL  EF+   ++   + TN S++ QL  F+ +
Sbjct  89   LPPYLSLGK---GKSFRHGVNFAVAGATALDPEFFYHQKLGRILWTNNSLSVQLGWFKKL  145

Query  360  IPSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSG  470
             PS+C +   C N    S+F++GE GGNDY +    G
Sbjct  146  KPSICTTKKGCDNFFRKSIFLVGEIGGNDYNYPFFVG  182



>ref|XP_004485878.1| PREDICTED: GDSL esterase/lipase At1g28590-like [Cicer arietinum]
Length=390

 Score =   149 bits (375),  Expect(2) = 3e-65, Method: Compositional matrix adjust.
 Identities = 89/187 (48%), Positives = 120/187 (64%), Gaps = 2/187 (1%)
 Frame = +1

Query  469   EKNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVEDYD  648
             +K+I++++  +P V +AI    ++LI LGART++VP   PLGC A YLT Y + +   YD
Sbjct  193   QKSISEVKTYVPHVINAITSAINELIYLGARTLIVPGNFPLGCNAIYLTKYEAKDKNQYD  252

Query  649   DLGCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGFSgga  828
               GCL W+N  A ++NQ LQ E++ LR  HP ANIIY D +NA + +Y  P   GF+   
Sbjct  253   SAGCLKWLNAFAEFYNQKLQYEIHRLRGIHPDANIIYADYYNAVLPLYHYPTKYGFT--G  310

Query  829   lraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDGSYTY  1008
             L+ACCG GG YN+N    CGD    +C DPS Y+ WDG HLTEAAYKL+   L++G Y  
Sbjct  311   LKACCGIGGPYNYNTSKACGDPDVIACEDPSQYIGWDGIHLTEAAYKLIADGLINGPYCV  370

Query  1009  PSMNALC  1029
             P  + LC
Sbjct  371   PQFSNLC  377


 Score =   129 bits (323),  Expect(2) = 3e-65, Method: Compositional matrix adjust.
 Identities = 75/164 (46%), Positives = 102/164 (62%), Gaps = 18/164 (11%)
 Frame = +3

Query  3    SLSDTGN-YISLTSDGVLQYDGIPS--CSVLPYGETFFHHPTGRCSDGRVILDIIAEHYG  173
            SL+DTGN Y S            PS  C   PYGET+FHHP+ RCSDGR+ILD I E  G
Sbjct  42   SLADTGNLYFSYQQ---------PSQHCFSPPYGETYFHHPSARCSDGRLILDFICESLG  92

Query  174  LAIPPPSLSSKAQTGGNNIR---QGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLH  344
            +    P L  K   GG   R   +GVNFAV+G+ AL   F+++  I++  TN S+  QL+
Sbjct  93   VPTVKPYLGIK--NGGLEDRSANEGVNFAVIGATALDVSFFEERGIHNVETNYSLTVQLN  150

Query  345  AFQDMIPSLCN-SPSDCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
             F++++P+LCN S ++C  +LENSLF++GE GGND+ + L   K
Sbjct  151  WFKELLPALCNHSSTNCHEVLENSLFLVGEIGGNDFNYPLFIQK  194



>ref|XP_010455497.1| PREDICTED: GDSL esterase/lipase At1g31550-like isoform X2 [Camelina 
sativa]
Length=383

 Score =   147 bits (370),  Expect(2) = 4e-65, Method: Compositional matrix adjust.
 Identities = 76/190 (40%), Positives = 107/190 (56%), Gaps = 13/190 (7%)
 Frame = +1

Query  460   FSREKNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVE  639
             F + + I +++ ++P+V   I+    +LI +G RT +VP   P+GC+ +YLT Y + N+E
Sbjct  187   FFQRRPIDEVKELVPLVISTISSAITELISMGGRTFLVPGEFPIGCSVAYLTLYQTSNME  246

Query  640   DYDDLGCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGFS  819
             +YD  GCL W+N+   YH++ L+ EL  LR+ + + NIIY D +NA + +   P   G  
Sbjct  247   EYDPFGCLKWLNKFGEYHDEQLEAELKRLRKLNHHVNIIYADYYNALLGLNQEPTKYG--  304

Query  820   ggalraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDGS  999
                          YNFN    CG  G  SC DPS YV WDG H+TEAAYK M   +L G 
Sbjct  305   -----------EPYNFNFSTCCGSFGVDSCNDPSKYVAWDGIHMTEAAYKFMADGILKGP  353

Query  1000  YTYPSMNALC  1029
             YT P  N  C
Sbjct  354   YTSPPFNWTC  363


 Score =   130 bits (327),  Expect(2) = 4e-65, Method: Compositional matrix adjust.
 Identities = 69/149 (46%), Positives = 94/149 (63%), Gaps = 10/149 (7%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            S++DTGN + L+    L  +G P     PYGETFFHHPTGR SDGR+I+D IAE  GL  
Sbjct  45   SIADTGNLLCLSDRNNLSLNGFP-----PYGETFFHHPTGRSSDGRLIIDFIAEFLGLPY  99

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQDMI  362
              P   SK      N ++GVNFAV  + AL A F ++   Y    N+S+  Q+  F++ +
Sbjct  100  VTPYFGSK----NGNFQKGVNFAVGSATALEASFLEE-RGYHCPHNISLGVQVKVFKESL  154

Query  363  PSLCNSPSDCKNLLENSLFVLGEFGGNDY  449
            P+LC  PSDCKN++ N+L ++GE GGND+
Sbjct  155  PNLCGLPSDCKNMIGNALILMGEIGGNDH  183



>emb|CDO96750.1| unnamed protein product [Coffea canephora]
Length=386

 Score =   140 bits (353),  Expect(2) = 4e-65, Method: Compositional matrix adjust.
 Identities = 92/181 (51%), Positives = 120/181 (66%), Gaps = 6/181 (3%)
 Frame = +1

Query  484   DIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVEDYD-DLGC  660
             +++P +P V   IA    +LI+LGA T++VP   P+GC ASYLTY+ S +  DYD D GC
Sbjct  199   EVKPYVPGVVREIASAIEELIKLGAVTLVVPGNFPIGCLASYLTYFQSSSQHDYDTDTGC  258

Query  661   LIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGFSggalrac  840
             + W+N +A YHN+LLQ+ELN +R+  P+A IIY D +NAAM++Y  P   GF G ALRAC
Sbjct  259   INWLNDLAKYHNRLLQKELNRIRKLLPHATIIYADYYNAAMRLYRSPNKYGFRGEALRAC  318

Query  841   cggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKL-----MTKSLLDGSYT  1005
             CG GG YN N  + CG   AT C DPS YV WDG HLTEAAY+       ++++   SY 
Sbjct  319   CGTGGPYNCNTSIPCGYLPATPCKDPSLYVTWDGLHLTEAAYQFGSSGHTSRTIFYSSYQ  378

Query  1006  Y  1008
             Y
Sbjct  379   Y  379


 Score =   137 bits (344),  Expect(2) = 4e-65, Method: Compositional matrix adjust.
 Identities = 76/160 (48%), Positives = 100/160 (63%), Gaps = 10/160 (6%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            SL+DTGN + L        D    C   PYGETFF HPTGRC DGR+I+D IAE +GL +
Sbjct  45   SLTDTGNLVQL-----FPPDNPTHCYRPPYGETFFKHPTGRCCDGRLIIDFIAESFGLPL  99

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQDMI  362
             P  L     T   + RQGVNFAV G+ AL   F+ ++ + D  TNVS+  QL  F+D++
Sbjct  100  VPAYLWRDEST---DFRQGVNFAVSGATALNNSFFLEMGLQDLSTNVSLGTQLRWFKDIL  156

Query  363  PSLCNS-PSDC-KNLLENSLFVLGEFGGNDYTHSLLSGKK  476
            PSLC+S  SDC +  L++S  ++GE GG+DY  +LL G K
Sbjct  157  PSLCSSNSSDCSREFLQSSFVLMGEIGGDDYNAALLGGIK  196



>emb|CDY15658.1| BnaA07g08290D [Brassica napus]
Length=386

 Score =   142 bits (357),  Expect(2) = 6e-65, Method: Compositional matrix adjust.
 Identities = 71/157 (45%), Positives = 102/157 (65%), Gaps = 9/157 (6%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            S++DTGN + L+       + +P  +  PYGETFFHHPTGR S+GR+I+D IAE  G  +
Sbjct  45   SIADTGNLLGLSDP-----NNLPKVAFPPYGETFFHHPTGRFSNGRLIIDFIAEFLGFPL  99

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQDMI  362
             PP   S+      N  +GVNFAV G+ AL     ++  I+   TNVS+  QL +F+D +
Sbjct  100  VPPFYGSQ----NANFEKGVNFAVGGATALEPSVLEERGIHFAYTNVSLGVQLQSFKDSL  155

Query  363  PSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
            P+LC SP+DC++++EN+L ++GE GGNDY + L  GK
Sbjct  156  PNLCGSPTDCRDVIENALILMGEIGGNDYNYPLFLGK  192


 Score =   134 bits (338),  Expect(2) = 6e-65, Method: Compositional matrix adjust.
 Identities = 74/186 (40%), Positives = 102/186 (55%), Gaps = 12/186 (6%)
 Frame = +1

Query  472   KNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVEDYDD  651
             K I +IR ++P+V   I+    +LI +G RT +VP   P+GCA  YLT Y + N E YD 
Sbjct  192   KPIEEIRELVPLVITTISSAMTELIGMGGRTFLVPGEFPIGCAVIYLTLYKTSNKEAYDS  251

Query  652   LGCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGFSggal  831
              GCL W+N+ A YH+  LQ ELN LR+ +P+ NIIY D +NA +++   P   GF     
Sbjct  252   SGCLKWLNEFAVYHDDQLQAELNKLRKLYPHVNIIYADYYNALLRLSQEPTKFGF-----  306

Query  832   raccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDGSYTYP  1011
                               G++G   C DPS YV+WD  H+TEAAY+ M + +L G Y  P
Sbjct  307   -------IDRRLPACCGFGEKGMECCSDPSKYVSWDSVHMTEAAYRFMAEGVLKGPYAIP  359

Query  1012  SMNALC  1029
               +  C
Sbjct  360   PFDWSC  365



>ref|XP_008812183.1| PREDICTED: GDSL esterase/lipase At1g31550-like [Phoenix dactylifera]
Length=395

 Score =   152 bits (384),  Expect(2) = 8e-65, Method: Compositional matrix adjust.
 Identities = 86/195 (44%), Positives = 123/195 (63%), Gaps = 0/195 (0%)
 Frame = +1

Query  460   FSREKNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVE  639
             F + +++ +I   +P V  AI+     LIELGART++VP   P+GC ++YLT + S   E
Sbjct  185   FLQARSLDEIVSYVPRVMDAISSAITALIELGARTLVVPGNFPIGCNSAYLTVFRSNRSE  244

Query  640   DYDDLGCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGFS  819
             DYD +GC+ W+N+ + +HN  L+  LN +R R+P+A +IY D ++AAM ++  P   GF 
Sbjct  245   DYDAIGCIKWLNKFSRFHNNRLRVVLNRVRLRNPHATVIYADYYSAAMSLFSSPEPSGFR  304

Query  820   ggalraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDGS  999
                L ACCGGGG YN+N  LQCG+ G+  C DPS Y+ WDG H+TEAAY+ +   LL G 
Sbjct  305   ISPLPACCGGGGPYNYNSSLQCGNSGSNICADPSIYITWDGMHMTEAAYRKIAIGLLKGP  364

Query  1000  YTYPSMNALCPTDAQ  1044
                P++   CP   Q
Sbjct  365   NAVPAILNTCPQTNQ  379


 Score =   124 bits (310),  Expect(2) = 8e-65, Method: Compositional matrix adjust.
 Identities = 63/157 (40%), Positives = 93/157 (59%), Gaps = 9/157 (6%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            SL+DTGN +       +          LPYGET+F  PTGR SDGR+++D +A+  GL +
Sbjct  42   SLADTGNLLHDVGKNNIH------VGRLPYGETYFRRPTGRFSDGRLVVDFLAQAMGLPL  95

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQDMI  362
             PP L+   + G    R+G NFAV G+ A+   F+ +  I    +N S+  Q+  F+ ++
Sbjct  96   LPPYLAGPGRKG---FRRGANFAVAGATAIENGFFTEKGIQVLWSNNSLGSQIEWFRQLL  152

Query  363  PSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
            PSLC+S SDC ++  NSLF++GE GGNDY +  L  +
Sbjct  153  PSLCSSDSDCNDMFRNSLFLVGEIGGNDYNYPFLQAR  189



>gb|AAX59709.1| lipase 1 [Brassica napus]
Length=373

 Score =   142 bits (358),  Expect(2) = 8e-65, Method: Compositional matrix adjust.
 Identities = 71/157 (45%), Positives = 102/157 (65%), Gaps = 9/157 (6%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            S++DTGN + L+       + +P  +  PYGETFFHHPTGR S+GR+I+D IAE  G  +
Sbjct  36   SIADTGNLLGLSDP-----NNLPKVAFPPYGETFFHHPTGRFSNGRLIIDFIAEFLGFPL  90

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQDMI  362
             PP   S+      N  +GVNFAV G+ AL     ++  I+   TNVS+  QL +F+D +
Sbjct  91   VPPFYGSQ----NANFEKGVNFAVGGATALEPSVLEERGIHFAYTNVSLGVQLQSFKDSL  146

Query  363  PSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
            P+LC SP+DC++++EN+L ++GE GGNDY + L  GK
Sbjct  147  PNLCGSPTDCRHMIENALILMGEIGGNDYNYPLFLGK  183


 Score =   134 bits (336),  Expect(2) = 8e-65, Method: Compositional matrix adjust.
 Identities = 80/186 (43%), Positives = 106/186 (57%), Gaps = 12/186 (6%)
 Frame = +1

Query  472   KNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVEDYDD  651
             K I +IR ++P+V   I     +LI +G RT +VP   P+GCA  YLT Y +PN E YD 
Sbjct  183   KPIEEIRELVPLVITTIPSAITELIGMGGRTFLVPGEFPIGCAVIYLTLYKTPNKEAYDS  242

Query  652   LGCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGFSggal  831
              GCL W+N+ A YH+  LQ ELN LR  +P+ NIIY D +NA +++   P   GF   AL
Sbjct  243   SGCLKWLNEFAVYHDDQLQAELNKLRRLYPHVNIIYADYYNALLRLSQEPTKFGFIDRAL  302

Query  832   raccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDGSYTYP  1011
              ACCG             G++G   C  PS YV+WD  H+TEAAY+ M + +L G Y  P
Sbjct  303   PACCGF------------GEKGMECCSGPSKYVSWDSVHMTEAAYRFMAEGVLKGPYAIP  350

Query  1012  SMNALC  1029
               +  C
Sbjct  351   PFDWSC  356



>ref|XP_008777734.1| PREDICTED: GDSL esterase/lipase At1g28570-like [Phoenix dactylifera]
Length=387

 Score =   142 bits (359),  Expect(2) = 9e-65, Method: Compositional matrix adjust.
 Identities = 87/191 (46%), Positives = 116/191 (61%), Gaps = 1/191 (1%)
 Frame = +1

Query  460   FSREKNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVE  639
             F + +   +IR  IP +   I+     LI+LGA+T +VP + P GC ++YLT + S + E
Sbjct  197   FEQGRTTDEIRTFIPNIVEVISSVIDDLIKLGAKTFVVPGIFPSGCVSTYLTAFQSEDAE  256

Query  640   DYD-DLGCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGF  816
             DYD D GC+ WVN+ ++YHN LLQ EL+ LR  HP+  IIY D + A M I+  P   GF
Sbjct  257   DYDPDTGCIRWVNEFSAYHNHLLQNELDRLRRLHPHVTIIYADYYEALMSIFHSPQKFGF  316

Query  817   SggalraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDG  996
                 L ACCGGGG YN N  L CG    T C DPS +V WDG HLT+AA +++ + LL+G
Sbjct  317   KKAPLDACCGGGGPYNVNFSLLCGAPMTTVCRDPSMFVFWDGTHLTDAASEIVARGLLEG  376

Query  997   SYTYPSMNALC  1029
              Y  P +   C
Sbjct  377   PYADPPIIQTC  387


 Score =   133 bits (334),  Expect(2) = 9e-65, Method: Compositional matrix adjust.
 Identities = 69/157 (44%), Positives = 98/157 (62%), Gaps = 9/157 (6%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            SL+DTGN +    D         + + LPYGET+FHH TGR SDGR+I+D IA+  GL +
Sbjct  54   SLADTGNLLHYLGDDA------GALAQLPYGETYFHHATGRLSDGRLIIDFIAQASGLPL  107

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQDMI  362
             PP L   A T   + R G NFAV G+ AL  +F++   +  T T  S+  Q + F+ ++
Sbjct  108  VPPYL---AGTSAQDFRYGANFAVAGATALDNDFFRAKGLNVTWTEYSLGVQFNWFKQLL  164

Query  363  PSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
            PSLC++ SDCK ++ NSLF++GE G ND++HS   G+
Sbjct  165  PSLCSTDSDCKGIMSNSLFLVGEIGWNDHSHSFEQGR  201



>ref|XP_007148066.1| hypothetical protein PHAVU_006G177700g [Phaseolus vulgaris]
 gb|ESW20060.1| hypothetical protein PHAVU_006G177700g [Phaseolus vulgaris]
Length=369

 Score =   147 bits (370),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 83/186 (45%), Positives = 123/186 (66%), Gaps = 2/186 (1%)
 Frame = +1

Query  460   FSREKNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVE  639
             F  + +I +++  +P V +AIA   H+L+ +GART+++P  LP+GC+  YLT Y + +  
Sbjct  186   FFEQNSIAEVKTYVPYVINAIASAIHELVGVGARTLIIPGNLPIGCSVIYLTIYETKDEN  245

Query  640   DYDDLGCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGFS  819
             +YD  GCL W+N+ A Y+N  LQ EL+ L+  + +ANII+ D +NAA+ +Y  P   GFS
Sbjct  246   EYDQSGCLKWLNEFAEYYNHELQSELHKLQALYSHANIIFADYYNAALPLYRDPTKFGFS  305

Query  820   ggalraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDGS  999
                L+ACCG GG YNFN  ++CGD     C DPS Y+ WDG HLTEAA KL+ ++++  S
Sbjct  306   --GLKACCGMGGPYNFNASVKCGDPRVIPCDDPSKYIGWDGIHLTEAANKLIAQAVIKWS  363

Query  1000  YTYPSM  1017
             Y+  S+
Sbjct  364   YSSSSI  369


 Score =   129 bits (323),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 69/154 (45%), Positives = 96/154 (62%), Gaps = 20/154 (13%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPS---CSVLPYGETFFHHPTGRCSDGRVILDIIAEHYG  173
            S +DTGN+          Y   PS   C   PYG+TFFHH +GRCSDGR+I+D IAE  G
Sbjct  48   SFADTGNW----------YLASPSPQHCFFPPYGQTFFHHVSGRCSDGRLIIDFIAESLG  97

Query  174  LAIPPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQ  353
            L +  P L  K      N ++G NFAVVG+ AL   F+++  +    TN S+  QL+ F+
Sbjct  98   LPLVKPYLGKK------NGKEGANFAVVGATALDPSFFEERGV-SIPTNYSLTQQLNWFK  150

Query  354  DMIPSLCNSPSDCKNLLENSLFVLGEFGGNDYTH  455
            +++PSLCNS +DC+ +  NSLF++GE GGND+ +
Sbjct  151  ELLPSLCNSFTDCREVFGNSLFLMGEIGGNDFNY  184



>ref|XP_006643908.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Oryza brachyantha]
Length=377

 Score =   146 bits (369),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 88/186 (47%), Positives = 117/186 (63%), Gaps = 0/186 (0%)
 Frame = +1

Query  460   FSREKNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVE  639
             F + K++ D +  +P VA A+A+   +LI+ GA  ++    LP+GC+++YLT +PS N  
Sbjct  191   FFKGKSLDDAKSYVPTVAGAVADATERLIKAGALHLVGRGTLPIGCSSAYLTLHPSGNKS  250

Query  640   DYDDLGCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGFS  819
             DYD  GCL   N  A +HN +LQ++L LLR  +P A I+Y D + AAM     P   GF 
Sbjct  251   DYDATGCLKTYNDFAQHHNAVLQDKLQLLRRSYPEARIMYADYYGAAMSFAQNPKQFGFR  310

Query  820   ggalraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDGS  999
              GALR CCGGGG YNFNP   CG  G++ C DPS Y NWDG HLTEA Y  +  S+L+G 
Sbjct  311   HGALRTCCGGGGPYNFNPKASCGVRGSSVCTDPSAYANWDGVHLTEAGYHAIANSILNGP  370

Query  1000  YTYPSM  1017
             YT P +
Sbjct  371   YTSPRL  376


 Score =   129 bits (324),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 69/161 (43%), Positives = 101/161 (63%), Gaps = 18/161 (11%)
 Frame = +3

Query  3    SLSDTGNYIS---LTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYG  173
            SL+DTGN +    L+   V +Y         PYG T+FH PTGR SDGR+++D +A+ +G
Sbjct  49   SLTDTGNLVVSSPLSFSIVGKY---------PYGMTYFHRPTGRSSDGRLVVDFLAQAFG  99

Query  174  LAIPPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTV-TNVSMNDQLHAF  350
            L +  P LS      G ++R+GVNFAV G+ A+   F++++   D + TN+S++ QL  F
Sbjct  100  LPLLQPYLSR-----GKDVRRGVNFAVGGATAMDPPFFEEIGASDKLWTNLSLSVQLGWF  154

Query  351  QDMIPSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
            + + PSLC+SP DCK     SLF++GE GGNDY ++   GK
Sbjct  155  EQLKPSLCSSPKDCKEFFSKSLFLVGEIGGNDYNYAFFKGK  195



>ref|XP_011096449.1| PREDICTED: uncharacterized protein LOC105175645 [Sesamum indicum]
Length=1007

 Score =   149 bits (377),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 92/184 (50%), Positives = 122/184 (66%), Gaps = 1/184 (1%)
 Frame = +1

Query  484   DIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVEDYD-DLGC  660
             ++R  +P V + I     +LI LGA T+MVP   P+GC+++YLTY+ S N +DY+   GC
Sbjct  590   EVRSFVPHVVNIIGSAITELINLGAVTLMVPGNFPIGCSSAYLTYFLSENQDDYEPATGC  649

Query  661   LIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGFSggalrac  840
             + W+N+ A YHN LL++EL  +RE HP+  IIY D +NA M +Y  P   GF+GGAL AC
Sbjct  650   IKWLNRFAQYHNDLLKKELARIRELHPHTTIIYADYYNAVMDLYRSPIEHGFAGGALGAC  709

Query  841   cggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDGSYTYPSMN  1020
             CGGGG YN N  + CG   + +C DPS YVNWDG H TEAAYK +   LL G YT P ++
Sbjct  710   CGGGGPYNCNLTVHCGYPPSNTCDDPSLYVNWDGMHFTEAAYKWIALGLLKGPYTTPPLS  769

Query  1021  ALCP  1032
              +CP
Sbjct  770   TVCP  773


 Score =   125 bits (315),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 71/162 (44%), Positives = 93/162 (57%), Gaps = 9/162 (6%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLP-YGETFFHHPTGRCSDGRVILDIIAEHYGLA  179
            S++DTGN   L+ +      G P    LP YGETFF+HPTGRCSDGR+I+D IAE + L 
Sbjct  431  SIADTGNAPYLSPES-----GRPPFYTLPPYGETFFNHPTGRCSDGRLIIDFIAEEFELP  485

Query  180  IPPPSLS--SKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQ  353
               P L           + R G NFAVVG+ AL   F+ +  +   + NVS+  QL  F 
Sbjct  486  FVAPFLQGGRNGNVNSTSFRDGANFAVVGATALEDSFFDERGVTVPLANVSLVAQLRWFN  545

Query  354  DMIPSLC-NSPSDCKNLLENSLFVLGEFGGNDYTHSLLSGKK  476
              +  +C  + SDCK  +E SL ++GE GGNDY H+LL G K
Sbjct  546  QFLSKICPTTSSDCKGFIETSLVLVGEIGGNDYNHALLGGIK  587


 Score =   122 bits (305),  Expect(2) = 8e-52, Method: Compositional matrix adjust.
 Identities = 79/190 (42%), Positives = 116/190 (61%), Gaps = 5/190 (3%)
 Frame = +1

Query  487   IRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVE-DYD-DLGC  660
             IR ++P V + +     +LI+LGA T++VP  L LGC   YLT Y + + E DYD   GC
Sbjct  188   IRSLVPTVVNYMGSIIEELIKLGAETMLVPGNLALGCLPLYLTQYKTSSTENDYDPKTGC  247

Query  661   LIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGFSggalrac  840
             L W+N+++ YHN+LLQ+EL  +R  HP  +IIY D +NA ++ Y  P   GF+  ++   
Sbjct  248   LNWLNELSIYHNELLQKELFRIRHLHPRISIIYADYYNATIRFYLSPDQFGFTKESVLRA  307

Query  841   c-ggggQYNFNPDLQCGDE--GATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDGSYTYP  1011
             C GGGG YN++P   CG +   A  C +PS + +WDG H TEAA + + +  +   YT+P
Sbjct  308   CCGGGGPYNYDPLTACGIDRPAANCCENPSLFASWDGIHFTEAANRWIAQGFIRQHYTHP  367

Query  1012  SMNALCPTDA  1041
              +  LCP+ A
Sbjct  368   PIKTLCPSVA  377


 Score =   110 bits (276),  Expect(2) = 8e-52, Method: Compositional matrix adjust.
 Identities = 65/157 (41%), Positives = 89/157 (57%), Gaps = 10/157 (6%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            SL+DTGN + L+       +  P C   PYG TFFH  TGR SDGR+++D IAE  GL +
Sbjct  34   SLADTGNLLLLSPP-----NNPPLCGRPPYGRTFFHRTTGRYSDGRLVIDFIAESLGLPL  88

Query  183  PPPSLSSK-AQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQDM  359
              P  + K A   G +  +GVNFAV G+ AL   F+ K  I + VTN S+  QL  F+  
Sbjct  89   VEPYAAWKIAAEKGGSFSKGVNFAVAGATALDTMFFDKRGIQNLVTNASLGIQLDWFKQF  148

Query  360  IPSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSG  470
            +  +     D +  L++SL V+GE GGNDY + +  G
Sbjct  149  LARI----PDGRKFLKSSLIVMGEIGGNDYNYPIQQG  181



>emb|CDX94632.1| BnaC07g10260D [Brassica napus]
Length=382

 Score =   142 bits (359),  Expect(2) = 2e-64, Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 100/157 (64%), Gaps = 9/157 (6%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            S++DTGN + L+       + +P  +  PYGETFFHHPTGR S+GR+I+D IAE  G  +
Sbjct  45   SIADTGNLLGLSDP-----NDLPKVAFPPYGETFFHHPTGRFSNGRLIIDFIAEFLGFPL  99

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQDMI  362
             PP   S+      N  QGVNFAV G+ AL     Q+  I    TNVS+  QL +F+D  
Sbjct  100  VPPFYGSQ----NANFEQGVNFAVGGATALEPSILQERGINFAYTNVSLGVQLKSFKDSF  155

Query  363  PSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
            P+LC SP+DC++++EN+L ++GE GGNDY + L  GK
Sbjct  156  PNLCGSPTDCRDMIENALILMGEIGGNDYNYPLFLGK  192


 Score =   132 bits (332),  Expect(2) = 2e-64, Method: Compositional matrix adjust.
 Identities = 79/186 (42%), Positives = 105/186 (56%), Gaps = 12/186 (6%)
 Frame = +1

Query  472   KNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVEDYDD  651
             K I +IR ++P+V   I+    +LI +G RT +VP   PLGC+  YLT Y + N E YD 
Sbjct  192   KPIEEIRELVPLVITTISSAITELIGMGGRTFLVPGEFPLGCSVIYLTLYKTSNKEAYDS  251

Query  652   LGCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGFSggal  831
              GCL W+N+ A YH+  LQ ELN LR+ +P+ NIIY D +NA +++   P   GF    L
Sbjct  252   SGCLKWLNEFAVYHDDQLQAELNKLRKLYPHVNIIYADYYNALLRLSQEPTKFGFIDKRL  311

Query  832   raccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDGSYTYP  1011
              ACCG             G +G   C DPS YV+WD  H+TEAAY+ M + +L G Y  P
Sbjct  312   PACCGF------------GGQGMECCSDPSKYVSWDSVHMTEAAYRCMAEGVLKGPYAIP  359

Query  1012  SMNALC  1029
                  C
Sbjct  360   PFEWSC  365



>ref|XP_010478903.1| PREDICTED: GDSL esterase/lipase At1g31550 [Camelina sativa]
Length=395

 Score =   145 bits (366),  Expect(2) = 2e-64, Method: Compositional matrix adjust.
 Identities = 85/191 (45%), Positives = 115/191 (60%), Gaps = 1/191 (1%)
 Frame = +1

Query  460   FSREKNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVE  639
             F   +   +++ ++P V   I+    +LI +G RT +VP   P+GC+ ++LT Y + N+E
Sbjct  186   FFESRPFDEVKELVPFVISTISSAITELIGMGGRTFLVPGGFPIGCSVAFLTLYQTSNME  245

Query  640   DYDDL-GCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGF  816
             +YD L GCL W N+   YH++ LQ ELN LR+ +P+ NIIY D +NA++ +   PA   F
Sbjct  246   EYDPLTGCLKWPNKFGEYHSEQLQVELNRLRKLNPHVNIIYADYYNASLSLGQEPAKYRF  305

Query  817   SggalraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDG  996
               G L ACCG G  YNF+    CG  G  SC DPS YV WDG H+TEAA+KLM   LL G
Sbjct  306   INGTLSACCGVGRPYNFSFSQSCGSAGVKSCNDPSKYVAWDGIHMTEAAHKLMADGLLKG  365

Query  997   SYTYPSMNALC  1029
              Y  P  N  C
Sbjct  366   PYATPPFNWSC  376


 Score =   129 bits (325),  Expect(2) = 2e-64, Method: Compositional matrix adjust.
 Identities = 67/157 (43%), Positives = 93/157 (59%), Gaps = 10/157 (6%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            S++DTGN + L+    L     P     PYGETFFHHPTGR SDGR+I+D IAE  GL  
Sbjct  44   SIADTGNLLGLSDQNNLPMSAFP-----PYGETFFHHPTGRYSDGRLIIDFIAEFLGLPY  98

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQDMI  362
             PP   SK +    N  +GVNFAV  + AL + F ++   Y    N+S+  QL  F++ +
Sbjct  99   VPPYFGSKNE----NFEKGVNFAVASATALESSFLEE-RGYHCPHNISLGVQLKIFKESL  153

Query  363  PSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
            P+LC  PSDC++++ N+L ++GE G NDY       +
Sbjct  154  PNLCGLPSDCRDMIGNALILMGEIGANDYNFPFFESR  190



>ref|XP_008777735.1| PREDICTED: GDSL esterase/lipase At1g28580-like, partial [Phoenix 
dactylifera]
Length=396

 Score =   150 bits (380),  Expect(2) = 2e-64, Method: Compositional matrix adjust.
 Identities = 89/191 (47%), Positives = 120/191 (63%), Gaps = 1/191 (1%)
 Frame = +1

Query  460   FSREKNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVE  639
             F +   I +IR  +P + H I+     LIELGA+TV+VP ++P GC + YLT + S   E
Sbjct  202   FVQGMTIDEIRTFVPDIIHIISSAITDLIELGAKTVVVPGIVPSGCVSLYLTVFQSQKRE  261

Query  640   DYD-DLGCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGF  816
             DYD   GC+ W N+ + +H +LL EEL+ LR  HP+A II+ + ++A M I+  P   GF
Sbjct  262   DYDPQTGCIKWANEFSEHHGRLLSEELDRLRRLHPHAIIIHANYYDALMSIFRSPQQFGF  321

Query  817   SggalraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDG  996
                 L ACCGG G YN N  L+CGD   T C DPS YV WDG HLTEAAY+++++ LL+G
Sbjct  322   KKSPLDACCGGDGPYNLNISLRCGDPMTTVCHDPSKYVFWDGTHLTEAAYEVISRGLLEG  381

Query  997   SYTYPSMNALC  1029
              Y  PS+   C
Sbjct  382   PYATPSIIQTC  392


 Score =   124 bits (311),  Expect(2) = 2e-64, Method: Compositional matrix adjust.
 Identities = 68/158 (43%), Positives = 94/158 (59%), Gaps = 13/158 (8%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVL--PYGETFFHHPTGRCSDGRVILDIIAEHYGL  176
            SL+DTGN+        L Y G  S  V   PYGET+FH  TGR S+GR+++D IA+  GL
Sbjct  59   SLADTGNF--------LHYSGNNSGPVAHHPYGETYFHRATGRFSNGRLVVDFIAQAMGL  110

Query  177  AIPPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQD  356
             + PP L+ K      + R G NFAV G+ AL  +F++   +       S+  Q+  F+ 
Sbjct  111  PLVPPYLAGK---NSQDFRHGANFAVAGATALDNDFFRAKGLNVAWPEYSLGAQIKWFKQ  167

Query  357  MIPSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSG  470
            ++PSLC+S SDCK L+ NSLF++GE G NDY H  + G
Sbjct  168  LLPSLCSSDSDCKGLMSNSLFLMGEIGWNDYNHPFVQG  205



>ref|XP_003546023.2| PREDICTED: GDSL esterase/lipase At1g31550-like [Glycine max]
Length=391

 Score =   148 bits (374),  Expect(2) = 3e-64, Method: Compositional matrix adjust.
 Identities = 84/190 (44%), Positives = 119/190 (63%), Gaps = 2/190 (1%)
 Frame = +1

Query  460   FSREKNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVE  639
             F  ++++ +++  +P V  AI    ++LI LGART++VP  LPLGC+ +YLT Y + +  
Sbjct  193   FFLQRSVAEVKTYVPYVIRAITSAVNELIGLGARTLIVPGNLPLGCSINYLTIYETMDKN  252

Query  640   DYDDLGCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGFS  819
              YD  GCL W+N+ A Y+NQ LQ EL+ LR  H +ANIIY D +NA + +Y      GF+
Sbjct  253   QYDQYGCLKWLNEFAEYYNQKLQSELDRLRGLHSHANIIYADYYNATLPLYHNTTMFGFT  312

Query  820   ggalraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDGS  999
                L+ CCG GG YN+N    CGD GA +C DPS ++ WD  H TEAAY+++ + L+ G 
Sbjct  313   --NLKTCCGMGGPYNYNAAADCGDPGAIACDDPSKHIGWDSVHFTEAAYRIIAEGLIKGP  370

Query  1000  YTYPSMNALC  1029
             Y  P  N  C
Sbjct  371   YCLPQFNTFC  380


 Score =   126 bits (316),  Expect(2) = 3e-64, Method: Compositional matrix adjust.
 Identities = 67/154 (44%), Positives = 98/154 (64%), Gaps = 8/154 (5%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            S +DTGN + L+S     +     C   PYGET+FH  TGRCSDGR+I+D IAE  GL +
Sbjct  49   SFADTGN-LYLSSHPPTHH-----CFFPPYGETYFHRVTGRCSDGRLIIDFIAESLGLPL  102

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQDMI  362
              P    K + GG ++ +G NFAV+G+ AL   F+++  I    TN S+  QL+ F++++
Sbjct  103  VKPYFGIK-KFGGWSVEEGANFAVIGATALDFSFFEERGI-SIPTNYSLTMQLNWFKELL  160

Query  363  PSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLL  464
            P+LCNS +DC  ++ NSLF++GE GGND+ +   
Sbjct  161  PALCNSSTDCHEVVGNSLFLMGEIGGNDFNYPFF  194



>ref|XP_010460658.1| PREDICTED: GDSL esterase/lipase At1g28580-like isoform X2 [Camelina 
sativa]
Length=394

 Score =   148 bits (374),  Expect(2) = 3e-64, Method: Compositional matrix adjust.
 Identities = 81/191 (42%), Positives = 118/191 (62%), Gaps = 1/191 (1%)
 Frame = +1

Query  460   FSREKNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVE  639
             F   K+I +++ +IP+V   ++    +LI +G +T +VP   P+GC  +YLT Y + N+E
Sbjct  184   FFVGKSIQEVKELIPLVITTVSSAITELIGMGGKTFLVPGQFPMGCLVAYLTLYQTSNIE  243

Query  640   DYDDL-GCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGF  816
             +YD L GCL W+N+    H+  L+ ELN +++ +P+ NIIY D +NA ++ Y  PA  GF
Sbjct  244   EYDPLTGCLTWLNKFGENHDSQLRAELNRIQKLYPHVNIIYADYYNALLRFYQEPAKFGF  303

Query  817   SggalraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDG  996
                 L ACCG GG YN+    QCG +    C DPS YV WDG H+TEAAY+LM++ +L G
Sbjct  304   MDRPLCACCGVGGPYNYTSVSQCGTDVVEGCSDPSKYVAWDGVHMTEAAYRLMSEGILKG  363

Query  997   SYTYPSMNALC  1029
              Y  P  +  C
Sbjct  364   PYAVPPFDWSC  374


 Score =   125 bits (315),  Expect(2) = 3e-64, Method: Compositional matrix adjust.
 Identities = 71/157 (45%), Positives = 97/157 (62%), Gaps = 12/157 (8%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            S++DTGN++ L+    L +   P     PYGETFFHHPTGR S+GRVI+D IAE   L +
Sbjct  44   SIADTGNFLGLSDPNNLPHFAFP-----PYGETFFHHPTGRFSNGRVIIDFIAEFLSLPL  98

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQDMI  362
             PP   S+      N  +GVNFAV G+ AL   F ++  I    TNVS+  QL +F++ +
Sbjct  99   VPPFYGSQ----NANFEKGVNFAVGGATALEHSFLEERGIDFFNTNVSLAVQLSSFKESL  154

Query  363  PSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
            P+LC SPSD   ++EN+L ++GE G NDY +    GK
Sbjct  155  PNLCGSPSD---MMENALILMGEIGLNDYFYLFFVGK  188



>ref|XP_009765841.1| PREDICTED: GDSL esterase/lipase At1g28610-like [Nicotiana sylvestris]
Length=388

 Score =   140 bits (353),  Expect(2) = 3e-64, Method: Compositional matrix adjust.
 Identities = 90/193 (47%), Positives = 123/193 (64%), Gaps = 2/193 (1%)
 Frame = +1

Query  484   DIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVEDYD-DLGC  660
             ++   +P V + I+    +LIELGA T++VP  LP+GC+ +YLT +   N E YD   GC
Sbjct  194   EVESYVPAVINTISSAIQELIELGASTLVVPGELPIGCSTAYLTKFTHSNKEHYDPKTGC  253

Query  661   LIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGFSggalrac  840
             + W+N  + ++N+LLQ+EL+LLRE HP   IIY D +NAAMQ Y  P + GF  GAL AC
Sbjct  254   INWLNHFSQHYNELLQKELHLLRELHPSVTIIYADYYNAAMQFYVSPTSHGFRKGALDAC  313

Query  841   cggggQYNFNPDLQCGDEGATS-CPDPSTYVNWDGYHLTEAAYKLMTKSLLDGSYTYPSM  1017
             CG GG YNF     CGD  A + C D S Y +WDG H TEAAYK + + LL+G++T+P +
Sbjct  314   CGAGGPYNFKFSAVCGDPPARNICSDTSQYASWDGMHFTEAAYKWIARGLLEGTFTFPPL  373

Query  1018  NALCPTDAQVAQL  1056
               +C  +  V Q 
Sbjct  374   AKICTFNPNVNQF  386


 Score =   134 bits (336),  Expect(2) = 3e-64, Method: Compositional matrix adjust.
 Identities = 76/156 (49%), Positives = 100/156 (64%), Gaps = 13/156 (8%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDG-IPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLA  179
            SL+DTGN + L+     QY   +P  +V PYGETFFHHPTGR SDGR+++D IAE  GL 
Sbjct  43   SLADTGNKLHLS-----QYKTHLPHFAVRPYGETFFHHPTGRFSDGRLVIDFIAESLGLP  97

Query  180  IPPPSLSSKAQTGGNNIRQGVNFAVVGSRALP-AEFYQKLEIYDTVTNVSMNDQLHAFQD  356
            + PP L  K +    N +QGVNFAV G+ AL  A  ++K    D   NVS+  QL  F++
Sbjct  98   LVPPYLGGKDE----NFKQGVNFAVGGATALDYAYLFEKGVRPD--NNVSLGTQLSWFKE  151

Query  357  MIPSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLL  464
            M+ SLC  PS+CK  L+ SL ++GE GGND+ +  L
Sbjct  152  MLSSLCKFPSECKEFLQKSLILVGEIGGNDFNYGFL  187



>ref|XP_010460979.1| PREDICTED: GDSL esterase/lipase At1g31550-like [Camelina sativa]
Length=387

 Score =   147 bits (371),  Expect(2) = 4e-64, Method: Compositional matrix adjust.
 Identities = 85/191 (45%), Positives = 114/191 (60%), Gaps = 1/191 (1%)
 Frame = +1

Query  460   FSREKNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVE  639
             F   +   +++ ++P V   I+    +LI +G RT +VP   P+GC+ +YLT Y + N+E
Sbjct  178   FFESRPFDEVKELVPFVISTISSAITELIGMGGRTFLVPGGFPIGCSVAYLTLYQTSNME  237

Query  640   DYDDL-GCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGF  816
             +YD L GCL W N+   YH++ LQ E+  LR+ +P+ NIIY D +NA++ +   PA   F
Sbjct  238   EYDPLTGCLKWPNKFGEYHSEQLQVEIKRLRKLNPHVNIIYADYYNASLSLGQEPAKYRF  297

Query  817   SggalraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDG  996
               G L ACCG G  YNF+    CG  G  SC DPS YV WDG H+TEAAYKLM   LL G
Sbjct  298   INGTLSACCGVGRPYNFSFSQSCGSVGVESCNDPSKYVAWDGIHMTEAAYKLMADGLLKG  357

Query  997   SYTYPSMNALC  1029
              Y  P  N  C
Sbjct  358   PYATPPFNWSC  368


 Score =   126 bits (317),  Expect(2) = 4e-64, Method: Compositional matrix adjust.
 Identities = 66/157 (42%), Positives = 92/157 (59%), Gaps = 10/157 (6%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            S++DTGN + L+    L     P     PYGETFFHHPTGR SDGR+I+D IAE  GL  
Sbjct  36   SIADTGNLLGLSDRNNLPMSAFP-----PYGETFFHHPTGRYSDGRLIIDFIAEFLGLPY  90

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQDMI  362
             PP    K +    N  +GVNFAV  + AL + F ++   Y    N+S+  QL  F++ +
Sbjct  91   VPPYFGFKNR----NFEKGVNFAVASATALESSFLEE-RGYHCPHNISLGVQLKIFKESL  145

Query  363  PSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
            P+LC  PSDC++++ N+L ++GE G NDY       +
Sbjct  146  PNLCGLPSDCRDMIGNALILMGEIGANDYNFPFFESR  182



>ref|XP_010277743.1| PREDICTED: GDSL esterase/lipase At1g28570-like [Nelumbo nucifera]
Length=390

 Score =   139 bits (350),  Expect(2) = 4e-64, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 100/157 (64%), Gaps = 8/157 (5%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            SL DTGN + L      Q++        PYG T+FHHPTGRCSDGR+I+D IAE+ GL  
Sbjct  41   SLIDTGNLLRL------QHNNASFECWFPYGITYFHHPTGRCSDGRLIIDFIAEYLGLPF  94

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQDMI  362
             PP LS    +GG + R GVNFAV G+ AL   F +    +D+  N S+  QL  F++++
Sbjct  95   VPPYLSRG--SGGQDFRHGVNFAVGGATALDYNFNEHGGTHDSRINNSLAIQLRWFKELL  152

Query  363  PSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
            PSLC+S S C++L   SLF++GE GGNDY+ +L  G+
Sbjct  153  PSLCDSDSKCRDLFSRSLFIVGEIGGNDYSLALNRGR  189


 Score =   134 bits (337),  Expect(2) = 4e-64, Method: Compositional matrix adjust.
 Identities = 81/190 (43%), Positives = 117/190 (62%), Gaps = 3/190 (2%)
 Frame = +1

Query  460   FSREKNITDIRPIIPIVAHAIAEGAHKLI-ELGARTVMVPSVLPLGCAASYLTYYPSPNV  636
              +R +++ +I+ ++P V + I+      I E GA T++VP  LP GC   +LT + SPN 
Sbjct  185   LNRGRSLEEIKSLVPRVINNISSAIQMFIQENGAVTLLVPGHLPYGCFPVFLTDFKSPNE  244

Query  637   EDYD-DLGCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLG  813
             EDY+ + GCL W+NQ++ ++N LLQEE++ LR  HP+  IIY D++NA   I+  P   G
Sbjct  245   EDYESETGCLRWLNQLSEFNNHLLQEEIHRLRHLHPHVTIIYADLYNAVKAIFRSPDKFG  304

Query  814   FSggalraccggggQ-YNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLL  990
             F  GAL   C GG   YN+N  + CG  GA  C DPS Y +WDG H+TEA Y+++   L+
Sbjct  305   FRKGALLLTCCGGEGPYNYNKSVHCGVRGAKVCQDPSQYGSWDGTHMTEAVYRVIATGLM  364

Query  991   DGSYTYPSMN  1020
             +G Y  P  N
Sbjct  365   EGPYAIPPFN  374



>gb|AAF24544.2|AC007508_7 F1K23.13 [Arabidopsis thaliana]
Length=1411

 Score =   141 bits (356),  Expect(2) = 5e-64, Method: Compositional matrix adjust.
 Identities = 76/178 (43%), Positives = 113/178 (63%), Gaps = 0/178 (0%)
 Frame = +1

Query  460   FSREKNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVE  639
             F   K+I +I+ ++P++  AI+     LI+LG +T +VP   P+GC+ +YLT + +  VE
Sbjct  836   FFEGKSINEIKELVPLIIKAISSAIVDLIDLGGKTFLVPGNFPIGCSTAYLTLFQTATVE  895

Query  640   DYDDLGCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGFS  819
                  GC+ W+N+   +HN+ L+ EL  L++ +P+ NIIY D +N+   ++  PA  GF 
Sbjct  896   HDPFTGCIPWLNKFGEHHNEQLKIELKQLQKLYPHVNIIYADYYNSLYGLFQEPAKYGFK  955

Query  820   ggalraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLD  993
                L ACCG GGQYNF    +CG+ G + C +PS YVNWDGYHLTEA Y+ M + LL+
Sbjct  956   NRPLAACCGVGGQYNFTIGKECGENGVSYCQNPSEYVNWDGYHLTEATYQKMAQGLLN  1013


 Score =   132 bits (332),  Expect(2) = 5e-64, Method: Compositional matrix adjust.
 Identities = 68/158 (43%), Positives = 100/158 (63%), Gaps = 10/158 (6%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            S++DTGNY+ L++      + +P  + LPYGE+FFH P+GR SDGR+++D IAE  GL  
Sbjct  692  SIADTGNYVHLSN-----VNNLPQAAFLPYGESFFHPPSGRYSDGRLVIDFIAEFLGLPY  746

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQDMI  362
             PP   S+  +      QG+NFAV G+ AL   F  K  I    TN+S++ QL+ F+ ++
Sbjct  747  VPPYFGSQNVS----FNQGINFAVYGATALDRAFLVKQGIKSDFTNISLSVQLNTFKQIL  802

Query  363  PSLCNSPS-DCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
            P+LC S + DC+ +L +SL ++GE GGNDY +    GK
Sbjct  803  PNLCASSTRDCREMLGDSLILMGEIGGNDYNYPFFEGK  840


 Score =   144 bits (364),  Expect(2) = 6e-64, Method: Compositional matrix adjust.
 Identities = 83/191 (43%), Positives = 119/191 (62%), Gaps = 1/191 (1%)
 Frame = +1

Query  460   FSREKNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVE  639
             F   K+I +I+ ++P++  AI+     LI+LG +T +VP   P GC+A+YLT + +   +
Sbjct  186   FFEGKSINEIKELVPLIVKAISSAIVDLIDLGGKTFLVPGGFPTGCSAAYLTLFQTVAEK  245

Query  640   DYDDL-GCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGF  816
             D D L GC   +N+   +HN+ L+ EL  L++ +P+ NIIY D  N+  + Y  PA  GF
Sbjct  246   DQDPLTGCYPLLNEFGEHHNEQLKTELKRLQKFYPHVNIIYADYHNSLYRFYQEPAKYGF  305

Query  817   SggalraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDG  996
                 L ACCG GG+YNF    +CG EG   C +PS YVNWDGYHLTEAAY+ MT+ +L+G
Sbjct  306   KNKPLAACCGVGGKYNFTIGKECGYEGVNYCQNPSEYVNWDGYHLTEAAYQKMTEGILNG  365

Query  997   SYTYPSMNALC  1029
              Y  P+ +  C
Sbjct  366   PYATPAFDWSC  376


 Score =   128 bits (322),  Expect(2) = 6e-64, Method: Compositional matrix adjust.
 Identities = 69/158 (44%), Positives = 97/158 (61%), Gaps = 10/158 (6%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            S++DTGNY+ L+       + +P  + LPYGE+FFH P+GR S+GR+I+D IAE  GL  
Sbjct  42   SIADTGNYLHLS-----DVNHLPQSAFLPYGESFFHPPSGRASNGRLIIDFIAEFLGLPY  96

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQDMI  362
             PP   S+  +      QG+NFAV G+ AL   F     I    TNVS++ QL  F+ ++
Sbjct  97   VPPYFGSQNVS----FEQGINFAVYGATALDRAFLLGKGIESDFTNVSLSVQLDTFKQIL  152

Query  363  PSLCNSPS-DCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
            P+LC S + DCK +L +SL ++GE GGNDY +    GK
Sbjct  153  PNLCASSTRDCKEMLGDSLILMGEIGGNDYNYPFFEGK  190


 Score =   143 bits (361),  Expect(2) = 9e-62, Method: Compositional matrix adjust.
 Identities = 82/197 (42%), Positives = 119/197 (60%), Gaps = 1/197 (1%)
 Frame = +1

Query  460   FSREKNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVE  639
             F   K+I +I+ ++P+V  AI+     LI+LG +T +VP   PLGC  +YLT + +   E
Sbjct  1207  FFEGKSINEIKQLVPLVIKAISSAIVDLIDLGGKTFLVPGNFPLGCYPAYLTLFQTAAEE  1266

Query  640   DYDDL-GCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGF  816
             D+D   GC+  +N+   YHN+ L+ EL  L+E + + NIIY D +N+  ++Y  P   GF
Sbjct  1267  DHDPFTGCIPRLNEFGEYHNEQLKTELKRLQELYDHVNIIYADYYNSLFRLYQEPVKYGF  1326

Query  817   SggalraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDG  996
                 L ACCG GGQYNF    +CG  G + C +PS YVNWDGYHLTEA ++ M + +L+G
Sbjct  1327  KNRPLAACCGVGGQYNFTIGKECGHRGVSCCQNPSEYVNWDGYHLTEATHQKMAQVILNG  1386

Query  997   SYTYPSMNALCPTDAQV  1047
             +Y  P+ +  C     V
Sbjct  1387  TYASPAFDWSCSGSESV  1403


 Score =   122 bits (307),  Expect(2) = 9e-62, Method: Compositional matrix adjust.
 Identities = 68/158 (43%), Positives = 96/158 (61%), Gaps = 10/158 (6%)
 Frame = +3

Query  3     SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
             S++DTGNY+ L+       + +P  + LPYGE+FFH P+GR SDGR+I+D IAE  GL  
Sbjct  1063  SIADTGNYLHLS-----DVNHLPQSAFLPYGESFFHPPSGRYSDGRLIIDFIAEFLGLPY  1117

Query  183   PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQDMI  362
              P    S+  +      QG+NFAV G+ AL   F     I    TNVS++ QL+ F+ ++
Sbjct  1118  VPSYFGSQNVS----FDQGINFAVYGATALDRVFLVGKGIESDFTNVSLSVQLNIFKQIL  1173

Query  363   PSLCNSPS-DCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
             P+LC S S DC+ +L +SL ++GE G NDY +    GK
Sbjct  1174  PNLCTSSSRDCREMLGDSLILMGEIGVNDYNYPFFEGK  1211


 Score =   120 bits (302),  Expect(2) = 3e-52, Method: Compositional matrix adjust.
 Identities = 73/160 (46%), Positives = 100/160 (63%), Gaps = 1/160 (1%)
 Frame = +1

Query  553   GARTVMVPSVLPLGCAASYLTYYPSPNVEDYDDL-GCLIWVNQMASYHnqllqeelnllr  729
             G +T +VP   P GC+A+ LT Y +   EDYD L GC+  +N++  + N+ L+ EL  L+
Sbjct  514   GGKTFLVPGGFPAGCSAACLTQYQNATEEDYDPLTGCIPRLNELGEHDNEQLKTELKRLQ  573

Query  730   erHPYANIIYTDIFNAAMQIYDGPANLGFSggalraccggggQYNFNPDLQCGDEGATSC  909
             + +P  NIIY D  N+  + Y  PA  GF    L ACCG GG+YNF    +CG EG + C
Sbjct  574   KLYPDVNIIYADYHNSLYRFYQEPAKYGFKNKPLAACCGVGGKYNFTIGKECGYEGVSYC  633

Query  910   PDPSTYVNWDGYHLTEAAYKLMTKSLLDGSYTYPSMNALC  1029
              +PS YVNWDGYHLTEAAY+ M + +L+G Y  P+ +  C
Sbjct  634   QNPSEYVNWDGYHLTEAAYQKMAEGILNGPYATPAFDWSC  673


 Score =   113 bits (283),  Expect(2) = 3e-52, Method: Compositional matrix adjust.
 Identities = 62/145 (43%), Positives = 87/145 (60%), Gaps = 10/145 (7%)
 Frame = +3

Query  9    SDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAIPP  188
            SDTGN + L+       + +P  +  PYGE+FFH P+GR SDGR+I+D IAE  GL   P
Sbjct  379  SDTGNILHLS-----DVNHLPQTAFFPYGESFFHPPSGRASDGRLIIDFIAEFLGLPYVP  433

Query  189  PSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQDMIPS  368
            P   S+  +      QG+NFAV G+ AL   ++    I    TNVS+  QL  F+ ++P+
Sbjct  434  PYFGSQNVS----FEQGINFAVYGATALDRAYFVAKGIESDFTNVSLGVQLDIFKQILPN  489

Query  369  LCNSPS-DCKNLLENSLFVLGEFGG  440
            LC S S DC+ +L +SL ++GE GG
Sbjct  490  LCASSSRDCREMLGDSLILMGEIGG  514



>ref|NP_174188.1| lipase ARAB-1 [Arabidopsis thaliana]
 sp|Q38894.1|GDL13_ARATH RecName: Full=GDSL esterase/lipase At1g28670; AltName: Full=Extracellular 
lipase At1g28670; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAA93262.1| lipase [Arabidopsis thaliana]
 dbj|BAC43359.1| putative lipase [Arabidopsis thaliana]
 gb|AEE31012.1| lipase ARAB-1 [Arabidopsis thaliana]
Length=384

 Score =   144 bits (364),  Expect(2) = 5e-64, Method: Compositional matrix adjust.
 Identities = 83/191 (43%), Positives = 119/191 (62%), Gaps = 1/191 (1%)
 Frame = +1

Query  460   FSREKNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVE  639
             F   K+I +I+ ++P++  AI+     LI+LG +T +VP   P GC+A+YLT + +   +
Sbjct  186   FFEGKSINEIKELVPLIVKAISSAIVDLIDLGGKTFLVPGGFPTGCSAAYLTLFQTVAEK  245

Query  640   DYDDL-GCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGF  816
             D D L GC   +N+   +HN+ L+ EL  L++ +P+ NIIY D  N+  + Y  PA  GF
Sbjct  246   DQDPLTGCYPLLNEFGEHHNEQLKTELKRLQKFYPHVNIIYADYHNSLYRFYQEPAKYGF  305

Query  817   SggalraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDG  996
                 L ACCG GG+YNF    +CG EG   C +PS YVNWDGYHLTEAAY+ MT+ +L+G
Sbjct  306   KNKPLAACCGVGGKYNFTIGKECGYEGVNYCQNPSEYVNWDGYHLTEAAYQKMTEGILNG  365

Query  997   SYTYPSMNALC  1029
              Y  P+ +  C
Sbjct  366   PYATPAFDWSC  376


 Score =   129 bits (323),  Expect(2) = 5e-64, Method: Compositional matrix adjust.
 Identities = 69/158 (44%), Positives = 97/158 (61%), Gaps = 10/158 (6%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            S++DTGNY+ L+       + +P  + LPYGE+FFH P+GR S+GR+I+D IAE  GL  
Sbjct  42   SIADTGNYLHLS-----DVNHLPQSAFLPYGESFFHPPSGRASNGRLIIDFIAEFLGLPY  96

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQDMI  362
             PP   S+  +      QG+NFAV G+ AL   F     I    TNVS++ QL  F+ ++
Sbjct  97   VPPYFGSQNVS----FEQGINFAVYGATALDRAFLLGKGIESDFTNVSLSVQLDTFKQIL  152

Query  363  PSLCNSPS-DCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
            P+LC S + DCK +L +SL ++GE GGNDY +    GK
Sbjct  153  PNLCASSTRDCKEMLGDSLILMGEIGGNDYNYPFFEGK  190



>ref|XP_006828268.1| hypothetical protein AMTR_s00023p00212280 [Amborella trichopoda]
 gb|ERM95684.1| hypothetical protein AMTR_s00023p00212280 [Amborella trichopoda]
Length=377

 Score =   139 bits (349),  Expect(2) = 5e-64, Method: Compositional matrix adjust.
 Identities = 81/186 (44%), Positives = 117/186 (63%), Gaps = 2/186 (1%)
 Frame = +1

Query  460   FSREKNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVE  639
             F + K+I  ++  +P V +AI   A  LI +GA+T++VP  LP+GC+AS LT + + +  
Sbjct  187   FIQGKSIEQVKSYVPDVINAIMNAASVLIRIGAKTLVVPGNLPVGCSASILTGFLTTDKN  246

Query  640   DYDDL-GCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGF  816
             +YD   GCLI  N+ A YHN  L + +  +RER P+ NIIY D +NAA++    P   GF
Sbjct  247   EYDPRNGCLIRFNEFAQYHNSKLHKAIQAMRERFPHINIIYADYYNAAIRFVQTPEMFGF  306

Query  817   SggalraccggggQ-YNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLD  993
                 +   C GGG  YNFN   +CG  GA +C +P+ YVNWDG HLTEAAY+ + K++L+
Sbjct  307   RKETVLRACCGGGGPYNFNITDRCGHPGAHACANPARYVNWDGIHLTEAAYEFIAKAMLN  366

Query  994   GSYTYP  1011
             G + +P
Sbjct  367   GEFMHP  372


 Score =   134 bits (338),  Expect(2) = 5e-64, Method: Compositional matrix adjust.
 Identities = 71/157 (45%), Positives = 100/157 (64%), Gaps = 8/157 (5%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            SL+DTGN + L+          P     P+GETFFH PTGRCSDGR+++D +AE +GL +
Sbjct  43   SLADTGNLL-LSGHSPFIRIAHP-----PFGETFFHKPTGRCSDGRLVVDFVAEAFGLPL  96

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQDMI  362
             PP LS     G  + R+GVNFAV G+ AL + ++ K  I    TN S+N QL  F  ++
Sbjct  97   LPPYLSK--LKGPADFRKGVNFAVAGATALNSSYFTKKNIGFLWTNSSLNVQLGWFYHLL  154

Query  363  PSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
            PSLC + + CK+ L+ S+F++GE GGNDY ++ + GK
Sbjct  155  PSLCRTDAACKSYLKKSVFLVGEIGGNDYNYAFIQGK  191



>emb|CDX94633.1| BnaC07g10250D [Brassica napus]
Length=396

 Score =   149 bits (375),  Expect(2) = 6e-64, Method: Compositional matrix adjust.
 Identities = 78/157 (50%), Positives = 101/157 (64%), Gaps = 9/157 (6%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            S +DTGN I L+       D +P+ +  PYGETFFHHPTGR S+GR+I+D IAE  GL  
Sbjct  44   STADTGNLIGLSDP-----DDLPAAAFPPYGETFFHHPTGRFSNGRLIIDFIAEFLGLPF  98

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQDMI  362
             PP   S+      N  +GVNFAV G+ AL   F  +  I    TNVS+  QL +F+D +
Sbjct  99   VPPFYGSQ----NANFEKGVNFAVGGATALEHSFLVERGIDLAFTNVSLGIQLQSFKDAM  154

Query  363  PSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
            PSLC SPSDC+N++EN+L ++GE GGNDY + L  GK
Sbjct  155  PSLCGSPSDCRNMIENALILMGEIGGNDYNYPLFLGK  191


 Score =   124 bits (311),  Expect(2) = 6e-64, Method: Compositional matrix adjust.
 Identities = 67/188 (36%), Positives = 100/188 (53%), Gaps = 2/188 (1%)
 Frame = +1

Query  472   KNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVEDYDD  651
             K   +IR ++P+V   I+    +LI +G +T +VP   PLGC+ +YL  Y + N E+YD 
Sbjct  191   KPTEEIRELVPLVVSTISSAITELISMGGKTFLVPGQFPLGCSTTYLQSYNTSNAEEYDS  250

Query  652   LGCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGFSggal  831
              GCL W+N+        L  EL  L++ +P+ NIIY D +N  ++    PA  GF     
Sbjct  251   TGCLKWLNEFGKNQGDQLLVELKKLQKLYPHVNIIYADYYNILLRFIQEPAKYGFLSKPS  310

Query  832   raccggggQYNFNPDL--QCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDGSYT  1005
                   G + +++       G +G   C DPS YV+WD  H+TEAAY+LM + +L G Y 
Sbjct  311   PLPPCCGTRGSYSSLFGKTFGLKGLKCCNDPSKYVDWDSAHMTEAAYRLMAEGVLKGPYA  370

Query  1006  YPSMNALC  1029
              P  +  C
Sbjct  371   IPPFDWSC  378



>gb|EPS71267.1| hypothetical protein M569_03493 [Genlisea aurea]
Length=402

 Score =   139 bits (351),  Expect(2) = 7e-64, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 97/157 (62%), Gaps = 8/157 (5%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            SL+DTGN+I   S   +++   P  + LPYG TFFH PTGRCSDGR++LD IAE YGL  
Sbjct  63   SLADTGNFI--VSGSAVKF---PVIAKLPYGMTFFHRPTGRCSDGRLVLDFIAEAYGLPY  117

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEI-YDTVTNVSMNDQLHAFQDM  359
             PP L+ K   G  N R G NFAV G+ A+ A+F+   ++ +   TN S++ QL  F  +
Sbjct  118  VPPYLAGKNDVG--NFRHGANFAVAGATAMDAKFFVDRKLGFLLWTNNSLSVQLEWFNSL  175

Query  360  IPSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSG  470
              SLC +  DC N  + SLFV+GE GGNDY +    G
Sbjct  176  KSSLCTTKKDCINYFKKSLFVVGEIGGNDYNYPFFVG  212


 Score =   133 bits (335),  Expect(2) = 7e-64, Method: Compositional matrix adjust.
 Identities = 83/193 (43%), Positives = 117/193 (61%), Gaps = 1/193 (1%)
 Frame = +1

Query  460   FSREKNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVE  639
             F    ++++++  +P+V   I +    LIE GAR  +V   LP+GC++ YLT + + +  
Sbjct  209   FFVGSSVSELKSTVPLVVGTITKAITTLIEGGAREFLVAGNLPIGCSSVYLTIFQTGDRS  268

Query  640   DYDDLGCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGFS  819
              YD  GCL   N+ A +HN  L+  L  LR +HP ANI Y D ++AA   +  P   GF 
Sbjct  269   AYDGNGCLRAHNEFARFHNSRLRLALEGLRVKHPQANISYADYYSAAHAFFHSPKRYGFE  328

Query  820   ggalraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDGS  999
             GGAL ACCGGGG YNFN   +CG  G+T+C DP  + NWDG HLTE+AY+ +   LL G+
Sbjct  329   GGALVACCGGGGPYNFNNTARCGHAGSTACSDPRRFENWDGIHLTESAYRQIAGGLLRGT  388

Query  1000  YTYPSMNALCPTD  1038
             + YP + A  PT+
Sbjct  389   FAYPPL-AFPPTN  400



>ref|XP_008225209.1| PREDICTED: GDSL esterase/lipase At5g45910 [Prunus mume]
Length=362

 Score =   142 bits (357),  Expect(2) = 7e-64, Method: Compositional matrix adjust.
 Identities = 88/180 (49%), Positives = 111/180 (62%), Gaps = 1/180 (1%)
 Frame = +1

Query  475   NITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVEDYDDL  654
             NI  ++  +P V  AI +    LIE GA  ++VP  LP+GC+A YLT + SPN   YD  
Sbjct  182   NIKQLKASVPFVVEAITQATSALIEEGAVELVVPGNLPIGCSAVYLTLFRSPNEAVYDKR  241

Query  655   -GCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGFSggal  831
              GCL   N  + YHN  L+  L  LR ++P+A IIY D + AAM  Y  P + GF  G L
Sbjct  242   NGCLKAFNGFSKYHNSELKRALGALRLKYPHARIIYADYYGAAMPFYHAPQHYGFKSGTL  301

Query  832   raccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDGSYTYP  1011
             RACCGGGG YNFN   +CG  G+T+C DPS+Y NWDG HLTEAAY  + K L+ G +  P
Sbjct  302   RACCGGGGPYNFNNSARCGHIGSTACKDPSSYANWDGIHLTEAAYGHIAKGLIHGRFATP  361


 Score =   130 bits (328),  Expect(2) = 7e-64, Method: Compositional matrix adjust.
 Identities = 70/157 (45%), Positives = 98/157 (62%), Gaps = 10/157 (6%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            SLSDTGN++     G L +   P    LPYGETFF   TGRCSDGR+++D IAE  GL  
Sbjct  33   SLSDTGNFLL---SGALAF---PVIGKLPYGETFFQRATGRCSDGRLVVDFIAEALGLPH  86

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTV-TNVSMNDQLHAFQDM  359
             PP L   A + G +++ GVNFAV G+ AL  +F+ + +I   + TN S++ QL  F+ +
Sbjct  87   LPPYL---ALSKGQDVKHGVNFAVAGATALDPQFFYQRKIGSVLWTNDSLSTQLGWFKKL  143

Query  360  IPSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSG  470
             PSLC +  +C N  + +LF++GE GGNDY ++   G
Sbjct  144  KPSLCTTKQECDNYFKKALFLVGEIGGNDYNYAFFVG  180



>ref|XP_010478618.1| PREDICTED: GDSL esterase/lipase At1g31550-like [Camelina sativa]
Length=396

 Score =   150 bits (379),  Expect(2) = 7e-64, Method: Compositional matrix adjust.
 Identities = 82/190 (43%), Positives = 117/190 (62%), Gaps = 0/190 (0%)
 Frame = +1

Query  460   FSREKNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVE  639
             F + +   +++ ++P+V   I+    +LI +G RT +VP   P GC+ +YLT Y + N+ 
Sbjct  187   FFKRRPFHEVKELVPLVISTISSAITELIGMGGRTFLVPGEFPKGCSVAYLTLYQTSNLA  246

Query  640   DYDDLGCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGFS  819
             +YD LGCL W+N+ + YH++ LQ EL  LR+ +P+ NII+ D +N  +++   P+  GF+
Sbjct  247   EYDSLGCLKWLNKFSEYHDEQLQAELKRLRKLNPHVNIIFADYYNTLLRLNQEPSKYGFT  306

Query  820   ggalraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDGS  999
                L ACCG GG YNFN + +CG     SC DPS YV WDG H+TEAAYK M   LL G 
Sbjct  307   KEPLYACCGVGGPYNFNFNTKCGSVEVESCNDPSKYVAWDGIHMTEAAYKSMADGLLKGP  366

Query  1000  YTYPSMNALC  1029
             Y  P  N  C
Sbjct  367   YATPPFNWSC  376


 Score =   122 bits (307),  Expect(2) = 7e-64, Method: Compositional matrix adjust.
 Identities = 67/150 (45%), Positives = 89/150 (59%), Gaps = 11/150 (7%)
 Frame = +3

Query  3    SLSDTGNYISLTSD-GVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLA  179
            S+ DTGN + L+ D   L   G P     PYGETFFH PTGR SDGR+I+D IAE  GL 
Sbjct  44   SIGDTGNLLGLSDDPNNLALSGYP-----PYGETFFHQPTGRFSDGRLIIDFIAEFLGLP  98

Query  180  IPPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQDM  359
              PP   SK      N  +GVNFAV  + AL   F  +   Y    N+S+  QL  F++ 
Sbjct  99   YVPPYFGSK----NGNFEKGVNFAVASATALECSFLAE-RGYHCRNNISLGVQLKIFKES  153

Query  360  IPSLCNSPSDCKNLLENSLFVLGEFGGNDY  449
            +P+LC  PSDC++++ N+L ++G+ G NDY
Sbjct  154  LPNLCGLPSDCRDMIGNALILMGDIGANDY  183



>ref|XP_010912632.1| PREDICTED: GDSL esterase/lipase At1g28650-like isoform X1 [Elaeis 
guineensis]
Length=398

 Score =   143 bits (361),  Expect(2) = 8e-64, Method: Compositional matrix adjust.
 Identities = 91/205 (44%), Positives = 126/205 (61%), Gaps = 3/205 (1%)
 Frame = +1

Query  460   FSREKNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVE  639
             F + K + +IR  +P +  AI+   + LI+LGA+T++VP   P+GC + YL  + S   E
Sbjct  196   FFQGKTVDEIRTFVPSIISAISSAINALIQLGAKTLVVPGNFPIGCVSWYLQAFQSRRKE  255

Query  640   DYD-DLGCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGF  816
             DYD   GC+ W+N+ A YHN+LL +EL+ L++ HP+  IIY D + A + I+  P   GF
Sbjct  256   DYDSQTGCIKWLNEFAEYHNRLLVDELDHLQQLHPHVTIIYADYYKALLNIFRSPTQFGF  315

Query  817   SggalraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDG  996
                 L ACCGGGG YN +  + CG   AT C DPSTYV WDG HLTEAAY+ + + LL+G
Sbjct  316   KKAPLAACCGGGGPYNIS--VPCGGRAATVCNDPSTYVCWDGMHLTEAAYRTIAQGLLEG  373

Query  997   SYTYPSMNALCPTDAQVAQL*LRMV  1071
              +T P +   CP   Q A   LR +
Sbjct  374   PHTAPPITQACPHIEQSAAHSLRPI  398


 Score =   129 bits (325),  Expect(2) = 8e-64, Method: Compositional matrix adjust.
 Identities = 73/171 (43%), Positives = 102/171 (60%), Gaps = 25/171 (15%)
 Frame = +3

Query  3    SLSDTGNYI--SLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGL  176
            SL+DTGN++  S  S G +        + LPYGET+FH PTGR SDGR+I+D IA+  G+
Sbjct  41   SLADTGNFLYSSNNSPGAI--------ARLPYGETYFHRPTGRFSDGRLIIDFIAQDIGI  92

Query  177  AIPPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQD  356
             + PP L      G +  RQGVNFAV G+ AL  +F+++  +  + T  S+  Q+  F+ 
Sbjct  93   PLVPPYLEGP---GDHGFRQGVNFAVAGATALDNDFFREKGLDISWTEYSLGTQIEWFKQ  149

Query  357  MIPSLCNSPS------------DCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
            ++PSLC+S S            DCK +L +SLF++GE GGNDY H    GK
Sbjct  150  LLPSLCSSGSGYPFTHVMFTMVDCKGILSSSLFLMGEIGGNDYNHPFFQGK  200



>ref|XP_006467672.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Citrus sinensis]
Length=362

 Score =   147 bits (370),  Expect(2) = 8e-64, Method: Compositional matrix adjust.
 Identities = 88/182 (48%), Positives = 120/182 (66%), Gaps = 0/182 (0%)
 Frame = +1

Query  472   KNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVEDYDD  651
             ++I  +R  +P+V  AI      LIE GA  ++VP   P+GC+A YLT + S N  DYD 
Sbjct  180   ESINQLRASVPLVVKAITNATRLLIEEGAVELVVPGNFPIGCSAVYLTLFQSLNEMDYDR  239

Query  652   LGCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGFSggal  831
              GCL   N  A YHN +L+ EL+ LR+++P+ANIIY D + AAM+ Y  P + GFS GA+
Sbjct  240   NGCLKAPNAFARYHNTMLKAELHKLRQKYPHANIIYADYYGAAMRFYHAPGHYGFSNGAV  299

Query  832   raccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDGSYTYP  1011
             +ACCGGGG YNFN   +CG  G+ +C +PST+ NWDG HLTEAAY+ +   L+ G +  P
Sbjct  300   KACCGGGGPYNFNNSARCGHTGSRACENPSTHANWDGIHLTEAAYRHVANGLIHGPFATP  359

Query  1012  SM  1017
             S+
Sbjct  360   SL  361


 Score =   126 bits (316),  Expect(2) = 8e-64, Method: Compositional matrix adjust.
 Identities = 68/158 (43%), Positives = 96/158 (61%), Gaps = 10/158 (6%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            SLSDTGN++     G L +   P    LPYGETFF H TGRCSDGR+++D +AE + L  
Sbjct  32   SLSDTGNFLV---SGALAF---PVIGKLPYGETFFRHATGRCSDGRLVIDFMAEAFRLPY  85

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTV-TNVSMNDQLHAFQDM  359
             PP L+ K    G N + GVNFAV G+ AL +  + K +I   + TN S++ Q+  F+ +
Sbjct  86   LPPYLALKE---GQNFKHGVNFAVAGATALRSAIFYKQKIGSRLWTNDSLSVQIDWFKKL  142

Query  360  IPSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
              S+C++  DC+   + SLF +GE GGNDY +    G+
Sbjct  143  KSSICSTRKDCETYFKKSLFFVGEIGGNDYNYRAFVGE  180



>gb|KHG23842.1| hypothetical protein F383_29871 [Gossypium arboreum]
Length=379

 Score =   137 bits (346),  Expect(2) = 8e-64, Method: Compositional matrix adjust.
 Identities = 67/153 (44%), Positives = 104/153 (68%), Gaps = 4/153 (3%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            SL+DTGN + ++   +L+ + +P  +  P G TFFHHP+GR  DGR+++D +AE  G+  
Sbjct  43   SLTDTGNLLEIS---LLESNKLPPSAFPPNGRTFFHHPSGRRCDGRLVIDFLAEALGIPF  99

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQDMI  362
              PS ++K        ++G+NFAV G+ AL + F Q+  IY+  TN+S+ D+L++F+ ++
Sbjct  100  LQPSYTTKVGRL-QKFQKGMNFAVAGATALNSSFLQENGIYNRSTNISLGDELNSFKHLL  158

Query  363  PSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSL  461
            PSLC+S +DCK LL NSL V+G  GGNDY+H+ 
Sbjct  159  PSLCSSSADCKKLLRNSLIVMGVIGGNDYSHAF  191


 Score =   135 bits (339),  Expect(2) = 8e-64, Method: Compositional matrix adjust.
 Identities = 81/178 (46%), Positives = 104/178 (58%), Gaps = 3/178 (2%)
 Frame = +1

Query  466  REKNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVEDY  645
            REKN    R  +P+V H IA   H+LIELGA T +VP   P+GC+   LT Y   N + Y
Sbjct  192  REKNNEAARKFVPLVVHTIASAIHELIELGAMTFLVPGNFPIGCSPELLTNYQGSNKDKY  251

Query  646  DDL-GCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGFSg  822
            D L GCL W+NQ + +HN+LL+ EL  LR RHP  NI+Y D +N AM+ Y  P   GF  
Sbjct  252  DPLTGCLTWLNQFSQHHNELLRTELEKLRNRHPDINIVYADYYNIAMRFYHSPKQFGFKE  311

Query  823  galraccggggQYNFNPDLQCG-DEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLD  993
                 C  GG  YN+N    CG     +SC DPS+Y++WDG H TEAA K +   + +
Sbjct  312  TLKACCGIGGL-YNYNSSRSCGYPPLKSSCNDPSSYISWDGIHYTEAANKWLANVVFE  368



>emb|CDY43308.1| BnaC03g58800D [Brassica napus]
Length=399

 Score =   146 bits (369),  Expect(2) = 9e-64, Method: Compositional matrix adjust.
 Identities = 83/197 (42%), Positives = 118/197 (60%), Gaps = 1/197 (1%)
 Frame = +1

Query  460   FSREKNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVE  639
             F + K+I D+  ++P+V  AI+     LI+LG +T +VP   P GC  +YLT + +   +
Sbjct  186   FFQGKSINDVEELVPLVIKAISSALVDLIDLGGKTFVVPGSFPYGCFPAYLTLFQTSKEK  245

Query  640   DYDDL-GCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGF  816
             +YD   GCL W+N++   H++ L+ EL  LR+ +P+ NIIY D +N+  + +  PA  GF
Sbjct  246   EYDTFTGCLSWLNELGKNHDEQLKTELKRLRKLYPHVNIIYADYYNSMYRFFQEPAKYGF  305

Query  817   SggalraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDG  996
                 L ACCG GGQYNF    +CG +G   C +PS YVNWDGYHLTEA ++ M   LL G
Sbjct  306   KERPLGACCGVGGQYNFTIGEECGYQGVGYCKNPSEYVNWDGYHLTEATHQKMAHGLLKG  365

Query  997   SYTYPSMNALCPTDAQV  1047
              Y  P+ +  C   A V
Sbjct  366   PYATPAFDWSCLGSASV  382


 Score =   126 bits (316),  Expect(2) = 9e-64, Method: Compositional matrix adjust.
 Identities = 69/157 (44%), Positives = 95/157 (61%), Gaps = 11/157 (7%)
 Frame = +3

Query  9    SDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAIPP  188
            +DTGNY+ L+       +  P  +  PYGETFFH PTGR SDGR+I+D IAE   L   P
Sbjct  43   ADTGNYLHLS-----DVNHPPQAAFPPYGETFFHAPTGRNSDGRLIIDFIAEFLRLPYVP  97

Query  189  PSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQDMIPS  368
            P   S+  +     +QG+NFAV G+ AL   F  +  I    TNVS++ QL+ F+ ++PS
Sbjct  98   PYFGSQNVS----FKQGINFAVYGATALDRTFLMEKGIESDFTNVSLSVQLNIFKKILPS  153

Query  369  LC--NSPSDCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
            LC  +SP DCK +L +SL ++G+ G NDY +    GK
Sbjct  154  LCASSSPHDCKEMLGDSLILMGDIGANDYDYMFFQGK  190



>ref|XP_009601721.1| PREDICTED: GDSL esterase/lipase At1g28600-like [Nicotiana tomentosiformis]
Length=389

 Score =   140 bits (352),  Expect(2) = 9e-64, Method: Compositional matrix adjust.
 Identities = 91/191 (48%), Positives = 127/191 (66%), Gaps = 3/191 (2%)
 Frame = +1

Query  484   DIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVEDYD-DLGC  660
             ++   +P V + I+    +LIELGA T++VP  LP+GC+ +YLT +   + E+YD   GC
Sbjct  194   EVESYVPAVINTISSAIQELIELGASTLVVPGDLPIGCSTAYLTKFMHSDKENYDPKTGC  253

Query  661   LIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGFSggalrac  840
             + W+N  A ++N+LLQ+EL+LLR+ HP A IIY D +NAAMQ Y  P + GF+ GAL AC
Sbjct  254   INWLNHFAQHYNELLQKELHLLRKLHPSATIIYADYYNAAMQFYVSPMSHGFTKGALDAC  313

Query  841   cggggQYNFNPDLQCGDEGATS-CPDPSTYVNWDGYHLTEAAYKLMTKSLLDGSYTYPSM  1017
             CG GG YNF     CGD  A + C D S Y +WDG H TEAAYK + + LL+G++T+P +
Sbjct  314   CGAGGPYNFKFSAVCGDPPARNICSDTSLYASWDGMHFTEAAYKWIARGLLEGTFTFPPL  373

Query  1018  NALC-PTDAQV  1047
               +C P +A V
Sbjct  374   AKICTPFNANV  384


 Score =   132 bits (333),  Expect(2) = 9e-64, Method: Compositional matrix adjust.
 Identities = 71/154 (46%), Positives = 97/154 (63%), Gaps = 9/154 (6%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            SL+DTGN + L+ +  L    +P  +V PYGETFFH PTGR SDGR+++D IAE  GL +
Sbjct  43   SLADTGNRLHLSQNKTL----LPHFAVRPYGETFFHRPTGRFSDGRIVIDFIAESLGLPL  98

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQDMI  362
             PP L  K +      +QGVNFAV G+ AL   +  +  +     NVS+  QL  F++M+
Sbjct  99   VPPYLGGKDE----RFKQGVNFAVGGATALDYAYLLEKGV-TPGNNVSLGTQLIWFKEML  153

Query  363  PSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLL  464
             SLC  PS+CK  L+NSL ++GE GGND+ +  L
Sbjct  154  SSLCKFPSECKEFLQNSLILVGEIGGNDFNYGFL  187



>ref|XP_006449476.1| hypothetical protein CICLE_v10015707mg [Citrus clementina]
 gb|ESR62716.1| hypothetical protein CICLE_v10015707mg [Citrus clementina]
Length=362

 Score =   147 bits (370),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 87/181 (48%), Positives = 119/181 (66%), Gaps = 0/181 (0%)
 Frame = +1

Query  475   NITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVEDYDDL  654
             +I  +R  +P+V  AI      LIE GA  ++VP   P+GC+A YLT + S N  DYD  
Sbjct  181   SINQLRASVPLVVKAITNATRLLIEEGAVELVVPGNFPIGCSAVYLTLFQSLNEMDYDQN  240

Query  655   GCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGFSggalr  834
             GCL   N  A YHN +L+ +L+ LR+++P+ANIIY D + AAM+ Y  P + GFS GA++
Sbjct  241   GCLKAPNAFARYHNTMLKAQLHKLRQKYPHANIIYADYYGAAMRFYHAPGHYGFSNGAVK  300

Query  835   accggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDGSYTYPS  1014
             ACCGGGG YNFN   +CG  G+ +C +PST+ NWDG HLTEAAY+ +   L+ G +  PS
Sbjct  301   ACCGGGGPYNFNNSARCGHTGSRACENPSTHANWDGIHLTEAAYRHVANGLIHGPFATPS  360

Query  1015  M  1017
             +
Sbjct  361   L  361


 Score =   125 bits (315),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 68/157 (43%), Positives = 95/157 (61%), Gaps = 10/157 (6%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            SLSDTGN++     G L +   P    LPYGETFF H TGRCSDGR+++D +AE + L  
Sbjct  32   SLSDTGNFLV---SGALAF---PVIGKLPYGETFFRHATGRCSDGRLVIDFMAEAFRLPY  85

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTV-TNVSMNDQLHAFQDM  359
             PP L+ K    G N + GVNFAV G+ AL +  + K +I   + TN S++ Q+  F+ +
Sbjct  86   LPPYLALKE---GQNFKHGVNFAVAGATALRSAIFYKQKIGSRLWTNDSLSVQIDWFKKL  142

Query  360  IPSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSG  470
              S+C++  DC+   + SLF +GE GGNDY +    G
Sbjct  143  KSSICSTRKDCETYFKKSLFFVGEIGGNDYNYRAFVG  179



>ref|XP_010462953.1| PREDICTED: GDSL esterase/lipase At1g28580-like [Camelina sativa]
Length=370

 Score =   139 bits (349),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 81/197 (41%), Positives = 115/197 (58%), Gaps = 1/197 (1%)
 Frame = +1

Query  460   FSREKNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVE  639
             F   K+  +   ++P+V   I+    +LI +G +  +VP   P+GC+  Y T Y + N+E
Sbjct  161   FFVNKSTEETNELVPLVIRTISSAITELIGMGGKAFLVPGEFPMGCSVVYWTIYQTTNME  220

Query  640   DYDDL-GCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGF  816
             +YD L GCL W+N+   YHN+ LQ ELN L++ +P+ NIIY D +N    I+  PA  GF
Sbjct  221   EYDPLTGCLKWLNKFGEYHNEQLQVELNRLQKLYPHVNIIYADYYNVLSSIFQEPAKFGF  280

Query  817   SggalraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDG  996
                 L ACCG GG YN+    +CG +    C DPS YV WDG HLTEAAY L+ + +L G
Sbjct  281   INRPLSACCGFGGPYNYTVGKKCGTDVVEGCSDPSKYVAWDGVHLTEAAYSLIAEGILSG  340

Query  997   SYTYPSMNALCPTDAQV  1047
              YT P  +  C +  ++
Sbjct  341   PYTIPPFDWSCLSSRKI  357


 Score =   133 bits (334),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 69/157 (44%), Positives = 101/157 (64%), Gaps = 11/157 (7%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            S++DTGN + L+       +  P  ++LPYGETFFHHPTGR S+GR+I+D I     L++
Sbjct  20   SIADTGNLLGLSDP-----NDHPQVALLPYGETFFHHPTGRFSNGRLIIDFIVLR--LSL  72

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQDMI  362
             PP   S+      N  +GVNFAV G+ AL   F ++  I+   TNVS+  QL +F++ +
Sbjct  73   VPPFYGSQNA----NFEKGVNFAVGGATALERSFLEERGIHFPCTNVSLGVQLSSFKESL  128

Query  363  PSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
            P LC SPSDC++++EN+L ++GE GGNDY ++    K
Sbjct  129  PKLCGSPSDCRDMIENALILMGEIGGNDYNYAFFVNK  165



>ref|XP_009347996.1| PREDICTED: GDSL esterase/lipase At1g28580-like [Pyrus x bretschneideri]
Length=376

 Score =   148 bits (373),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 88/187 (47%), Positives = 122/187 (65%), Gaps = 1/187 (1%)
 Frame = +1

Query  472   KNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVEDYD-  648
             K+I  ++  +P+V   I    ++LIELGA T++VP  +P+GC   YLT Y   +  DYD 
Sbjct  186   KSIEQVQEYVPLVIEEIGLSINELIELGAATLLVPGNVPIGCLPIYLTNYEGSDKSDYDP  245

Query  649   DLGCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGFSgga  828
               GCL W+N+   Y+N+ LQ ELN +R  HP+ NIIY D +NA M +Y  P   GF GG 
Sbjct  246   STGCLNWLNKFVEYYNEQLQTELNRIRSLHPHVNIIYADYYNAMMYLYHSPEQFGFIGGT  305

Query  829   lraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDGSYTY  1008
              +ACCGGGG YN+N   QCG   A++C +P  +++WDG H TEAAYK +T +LL G+YT 
Sbjct  306   PKACCGGGGTYNYNSSAQCGMRQASACQNPEEFISWDGIHFTEAAYKWITNALLKGNYTD  365

Query  1009  PSMNALC  1029
             P +++LC
Sbjct  366   PCISSLC  372


 Score =   124 bits (310),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 68/157 (43%), Positives = 95/157 (61%), Gaps = 8/157 (5%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            SL+DTGN + ++S     +   P     PYG T+FH PTGRCSDGR+++D IAE+ GL +
Sbjct  38   SLADTGN-LKISSPNETIHFFFP-----PYGMTYFHLPTGRCSDGRLVIDFIAEYLGLPL  91

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQDMI  362
              P L S+      N   GVNFAV G+ AL A F +++   +  TN S+  Q+  F++++
Sbjct  92   VRPYLESQKSI--QNFEGGVNFAVAGATALDATFLEEMGDSNPRTNNSLGIQMDWFKEIL  149

Query  363  PSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
            P  CN  S+C   L  SL ++GE GGNDY  +LL GK
Sbjct  150  PYFCNISSNCSEFLSGSLILMGEIGGNDYNDALLGGK  186



>ref|XP_002879083.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH55342.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=392

 Score =   151 bits (381),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 87/191 (46%), Positives = 123/191 (64%), Gaps = 2/191 (1%)
 Frame = +1

Query  460   FSREKNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVE  639
             F R KNI +++ ++P+V   I+    +L+++GART +VP   PLGC+ +YLT Y + N E
Sbjct  185   FDR-KNIEEVKELVPLVITTISSVISELVDMGARTFLVPGNFPLGCSVAYLTLYETSNEE  243

Query  640   DYDDL-GCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGF  816
             +Y+ L GCL W+N  + YHN+ LQ ELN LR+ +P+ NIIY D +N  +++   P+  G 
Sbjct  244   EYNPLTGCLTWLNDFSVYHNEQLQAELNRLRKLYPHVNIIYGDYYNTLLRLVQEPSKFGL  303

Query  817   SggalraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDG  996
                 L ACCG GG YNF   +QCG +G   C DPS YVNWDG H+TEAAYK +++ +L G
Sbjct  304   MDRPLPACCGVGGPYNFTFSIQCGSKGVEYCSDPSKYVNWDGIHMTEAAYKCISEGILKG  363

Query  997   SYTYPSMNALC  1029
              Y  P  +  C
Sbjct  364   PYAIPPFDWSC  374


 Score =   120 bits (301),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 65/158 (41%), Positives = 97/158 (61%), Gaps = 10/158 (6%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            S++DTGN + L+S      + +P  +  PYGETFFH+P+GR SDGR+I+D IAE  G+  
Sbjct  40   SITDTGNLLGLSSP-----NDLPESAFPPYGETFFHYPSGRFSDGRLIIDFIAEFLGIPH  94

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQDMI  362
             PP   SK      N  +GVNFAV G+ AL     ++     + +N+S+ +QL +F++ +
Sbjct  95   VPPFYGSK----NGNFEKGVNFAVGGATALECSVLEERGTQCSQSNISLGNQLKSFKESL  150

Query  363  PSLCNSPS-DCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
            P LC S S DC++++ N+  ++GE GGNDY   L   K
Sbjct  151  PYLCGSSSVDCRDMIGNAFILIGEIGGNDYNFPLFDRK  188



>ref|XP_008785157.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Phoenix dactylifera]
Length=360

 Score =   137 bits (346),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 85/180 (47%), Positives = 114/180 (63%), Gaps = 0/180 (0%)
 Frame = +1

Query  472   KNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVEDYDD  651
             K++ ++R   P +   +A+G  +LI  GA  ++VP +LP+GC   YL  Y S + +DYD 
Sbjct  177   KSMAEVRANTPTIVDGLAKGVERLISNGAVDLVVPGILPIGCFPLYLQLYKSTSKDDYDQ  236

Query  652   LGCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGFSggal  831
              GCL   N +A YHNQLL+ +L  L++R+P   +IY D +NAAMQ    P   GFS GAL
Sbjct  237   FGCLKKYNNVAFYHNQLLKIKLQQLQQRYPGTRVIYGDFYNAAMQFVTNPQKYGFSNGAL  296

Query  832   raccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDGSYTYP  1011
             +ACCGGGG YN N D +CG +G+  C DPSTY +WDG H TEAA + +   LL G Y  P
Sbjct  297   KACCGGGGPYNVNLDYRCGQKGSNVCNDPSTYASWDGIHFTEAANRYVANGLLRGPYANP  356


 Score =   133 bits (335),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 73/158 (46%), Positives = 93/158 (59%), Gaps = 13/158 (8%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            SLSD GN I       L        S  PYG TFFH PTGRCSDGR+ +D IAE  GL +
Sbjct  32   SLSDAGNLIVKNPSVYLT-------SKWPYGMTFFHKPTGRCSDGRLFIDFIAEAVGLPL  84

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTV-TNVSMNDQLHAFQDM  359
            PPPSL S     G + ++G NFA  G   L   F+Q+  +  ++ T  ++N Q+  F+ M
Sbjct  85   PPPSLKS-----GEDFQKGANFATTGGTVLEYSFFQRRGLTKSIFTTDNLNTQISWFEQM  139

Query  360  IPSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
             PSLC++   CK+ +  SLFV+GEFGGNDY   L SGK
Sbjct  140  KPSLCSTTQGCKDYVGKSLFVVGEFGGNDYNAFLFSGK  177



>gb|KDO77809.1| hypothetical protein CISIN_1g018031mg [Citrus sinensis]
Length=362

 Score =   145 bits (367),  Expect(2) = 3e-63, Method: Compositional matrix adjust.
 Identities = 87/182 (48%), Positives = 120/182 (66%), Gaps = 0/182 (0%)
 Frame = +1

Query  472   KNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVEDYDD  651
             ++I  +R  +P+V  AI      LIE GA  ++VP   P+GC+A YLT + S N  DYD 
Sbjct  180   ESINQLRASVPLVVKAITNATRLLIEEGAVELVVPGNFPIGCSAVYLTLFQSLNEMDYDR  239

Query  652   LGCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGFSggal  831
              GCL   N  A YHN +L+ EL+ LR+++P+ANIIY D + AAM+ Y  P + GFS GA+
Sbjct  240   NGCLKAPNAFARYHNTMLKAELHKLRQKYPHANIIYADYYGAAMRFYHAPGHYGFSNGAV  299

Query  832   raccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDGSYTYP  1011
             +ACCGGGG YNFN   +CG  G+ +C +PST+ NWDG HLTE+AY+ +   L+ G +  P
Sbjct  300   KACCGGGGPYNFNNSARCGHTGSRACENPSTHANWDGIHLTESAYRHVANGLIHGPFATP  359

Query  1012  SM  1017
             S+
Sbjct  360   SL  361


 Score =   125 bits (314),  Expect(2) = 3e-63, Method: Compositional matrix adjust.
 Identities = 68/158 (43%), Positives = 96/158 (61%), Gaps = 10/158 (6%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            SLSDTGN++     G L +   P    LPYGETFF H TGRCSDGR+++D +AE + L  
Sbjct  32   SLSDTGNFLV---SGALAF---PVIGKLPYGETFFRHATGRCSDGRLVIDFMAEAFRLPY  85

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTV-TNVSMNDQLHAFQDM  359
             PP L+ K    G N + GVNFAV G+ AL +  + K +I   + TN S++ Q+  F+ +
Sbjct  86   LPPYLALKE---GQNFKHGVNFAVAGATALRSVIFYKQKIGSRLWTNDSLSVQIDWFKKL  142

Query  360  IPSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
              S+C++  DC+   + SLF +GE GGNDY +    G+
Sbjct  143  KSSICSTRKDCETYFKKSLFFVGEIGGNDYNYRAFVGE  180



>ref|XP_008812189.1| PREDICTED: GDSL esterase/lipase At1g28570-like [Phoenix dactylifera]
Length=386

 Score =   148 bits (373),  Expect(2) = 4e-63, Method: Compositional matrix adjust.
 Identities = 90/198 (45%), Positives = 124/198 (63%), Gaps = 3/198 (2%)
 Frame = +1

Query  460   FSREKNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVE  639
             F + K + +IR  +P +  AI+   + LI+LGA+T++VP   P+GC + YL  + S   E
Sbjct  184   FFQGKTVDEIRTFVPRIISAISSAINVLIQLGAKTLVVPGNFPIGCVSWYLQIFQSQRKE  243

Query  640   DYD-DLGCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGF  816
             DYD   GC+ W+N+ +++HN+LL +EL+ LR+ HP+A IIY D + A + I+  P   GF
Sbjct  244   DYDSQTGCIKWLNEFSAHHNRLLLDELDRLRQLHPHATIIYADYYKALLHIFRSPTQFGF  303

Query  817   SggalraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDG  996
                 L ACCGGGG YN    + CGD  AT C DPS YV+WDG HLTEAAYK + + LL+G
Sbjct  304   KKAPLAACCGGGGPYN--ASVACGDRAATVCNDPSRYVSWDGMHLTEAAYKTIAQGLLEG  361

Query  997   SYTYPSMNALCPTDAQVA  1050
               T P +   CP   Q A
Sbjct  362   PDTTPPITQACPHIEQSA  379


 Score =   122 bits (306),  Expect(2) = 4e-63, Method: Compositional matrix adjust.
 Identities = 72/157 (46%), Positives = 101/157 (64%), Gaps = 9/157 (6%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            SL+DTGN +   S+         + + LPYGET+FH PTGR SDGR+I+D IA+  G+ +
Sbjct  41   SLADTGNLLYSPSNNA------GAIARLPYGETYFHRPTGRFSDGRLIIDFIAQGIGIPL  94

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQDMI  362
             PP L   A  G +  RQG NFAV G+ AL  +F+++  ++ + T  S+  Q+  F+ ++
Sbjct  95   VPPYL---AGPGDHGFRQGANFAVGGATALGNDFFREKGLHVSWTEYSLGTQIEWFKQLL  151

Query  363  PSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
            PSLC+S SDCK +L NSLF++GE GGNDY H    GK
Sbjct  152  PSLCSSSSDCKGILSNSLFLVGEIGGNDYNHPFFQGK  188



>ref|XP_010925696.1| PREDICTED: GDSL esterase/lipase At5g45910-like isoform X1 [Elaeis 
guineensis]
Length=377

 Score =   135 bits (340),  Expect(2) = 5e-63, Method: Compositional matrix adjust.
 Identities = 74/160 (46%), Positives = 96/160 (60%), Gaps = 14/160 (9%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            SL+DTGN        ++     P    LPYG T+F HPTGRCSDGR+I+D +A  +GL  
Sbjct  44   SLADTGN-------ALIHSKSNPVFGRLPYGMTYFMHPTGRCSDGRLIVDFLASAFGLPF  96

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDT--VTNVSMNDQLHAFQD  356
             PP L+      G NIRQGVNFAVVG+ AL   F+Q L        TN+S++ QL  F++
Sbjct  97   LPPYLAH-----GQNIRQGVNFAVVGATALDPAFFQGLLADGAFPFTNLSLSTQLRWFEE  151

Query  357  MIPSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSGKK  476
            + PSLCN+ + C      SLF++GE GGNDY +  L G K
Sbjct  152  LKPSLCNTTTACAGYFSKSLFLVGEIGGNDYNYFFLLGGK  191


 Score =   135 bits (339),  Expect(2) = 5e-63, Method: Compositional matrix adjust.
 Identities = 79/184 (43%), Positives = 111/184 (60%), Gaps = 2/184 (1%)
 Frame = +1

Query  472   KNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVEDYD-  648
             K++ +++  +P V  AI   + +LI+ GA  ++VP  LP GC++ YLT + SPN E+YD 
Sbjct  191   KSLEEVKSYVPKVVGAIVAASERLIKNGAVNLLVPGNLPFGCSSVYLTVFNSPNKEEYDP  250

Query  649   DLGCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGFSgga  828
               GCL W+N  A YH+ LL+  L+ LR ++P A I+Y D + A++QI   P   GF    
Sbjct  251   TTGCLKWLNAFAKYHDALLRRALDELRRKYPRARIMYADYYGASIQIGRSPQRFGFDDVL  310

Query  829   lraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDGSYTY  1008
             +  C G G  YNF+P   CG  G++ C   S+  NWDG HLTEAAY  +  SLLDG YT 
Sbjct  311   IACCGGDG-PYNFSPLAFCGQPGSSVCSCLSSRANWDGLHLTEAAYHFIATSLLDGPYTS  369

Query  1009  PSMN  1020
             P + 
Sbjct  370   PPLR  373



>ref|XP_010461021.1| PREDICTED: GDSL esterase/lipase At1g31550-like [Camelina sativa]
Length=396

 Score =   151 bits (381),  Expect(2) = 5e-63, Method: Compositional matrix adjust.
 Identities = 83/190 (44%), Positives = 115/190 (61%), Gaps = 0/190 (0%)
 Frame = +1

Query  460   FSREKNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVE  639
             F   +   +++ ++P+V   I+    +LI +G RT +VP   P GC+ +YLT Y + N+E
Sbjct  187   FFEHRPFDEVKELVPLVISTISSAITELIGMGGRTFLVPGEFPKGCSVAYLTLYQTSNLE  246

Query  640   DYDDLGCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGFS  819
             +YD  GCL W+N+ A YH++ LQ EL  LR+ +P+ NII+ D +N  +++   P+  GF 
Sbjct  247   EYDSFGCLKWLNKFAEYHDEQLQAELKRLRKLNPHVNIIFADYYNTLLRLNQEPSKYGFI  306

Query  820   ggalraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDGS  999
                L ACCG GG YNFN    CG+ G  SC DPS YV WDG H+TEAAYK M   LL G 
Sbjct  307   KEPLSACCGVGGTYNFNLSTGCGNVGVESCNDPSKYVAWDGIHMTEAAYKSMADGLLKGP  366

Query  1000  YTYPSMNALC  1029
             Y  P  +  C
Sbjct  367   YATPPFSWSC  376


 Score =   119 bits (298),  Expect(2) = 5e-63, Method: Compositional matrix adjust.
 Identities = 66/150 (44%), Positives = 88/150 (59%), Gaps = 11/150 (7%)
 Frame = +3

Query  3    SLSDTGNYISLTSD-GVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLA  179
            S+ DTGN + L+ D   L   G P     PYGETFFH PTGR SDGR+I+D I E  GL 
Sbjct  44   SIGDTGNLLGLSDDPNNLALSGYP-----PYGETFFHQPTGRFSDGRLIIDFITEFLGLP  98

Query  180  IPPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQDM  359
              PP   SK  T      +GVNFAV  + AL + F  +   Y    N+S+  QL  F++ 
Sbjct  99   YVPPYFGSKNGT----FEKGVNFAVASATALDSSFLAE-RGYHCRHNISLGVQLKIFKES  153

Query  360  IPSLCNSPSDCKNLLENSLFVLGEFGGNDY  449
            +P LC  PSDC++++ N+L ++G+ G NDY
Sbjct  154  LPDLCGLPSDCRDMIGNALILMGDIGANDY  183



>ref|XP_009109700.1| PREDICTED: GDSL esterase/lipase At1g28670-like isoform X1 [Brassica 
rapa]
Length=390

 Score =   147 bits (372),  Expect(2) = 5e-63, Method: Compositional matrix adjust.
 Identities = 84/197 (43%), Positives = 119/197 (60%), Gaps = 1/197 (1%)
 Frame = +1

Query  460   FSREKNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVE  639
             F + K+I ++  ++P+V  AI+     LI LG +T +VP   P GC  +YLT + +   E
Sbjct  186   FFQGKSINEVEELVPLVIKAISSAIVDLINLGGKTFLVPGTFPYGCFPAYLTLFQTAKEE  245

Query  640   DYDDL-GCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGF  816
             +YD L GCL W+N++   H++ L+ EL  LR+ +P+ NIIY D +N+  + +  PA  GF
Sbjct  246   EYDPLTGCLSWLNELGKNHDEHLKTELKRLRKIYPHVNIIYADYYNSMYRFFQEPAKYGF  305

Query  817   SggalraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDG  996
                 L ACCG GGQYNF    +CG +G   C +PS YVNWDGYHLTEA ++ M   LL+G
Sbjct  306   KERPLGACCGVGGQYNFTFGEECGCQGVGYCKNPSEYVNWDGYHLTEATHQKMAHGLLNG  365

Query  997   SYTYPSMNALCPTDAQV  1047
              Y  P+ +  C   A V
Sbjct  366   PYASPAFDWSCLGSASV  382


 Score =   122 bits (306),  Expect(2) = 5e-63, Method: Compositional matrix adjust.
 Identities = 69/157 (44%), Positives = 93/157 (59%), Gaps = 11/157 (7%)
 Frame = +3

Query  9    SDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAIPP  188
            +DTGNY+ L+       +  P  +  PYGETFFH PTGR SDGR+I+D IAE  GL   P
Sbjct  43   ADTGNYLHLS-----DVNHPPQAAFPPYGETFFHTPTGRNSDGRLIIDFIAEFLGLPYVP  97

Query  189  PSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQDMIPS  368
            P   S+  +     +QG+NFAV G+ AL      +  I    TNVS++ QL+ F+  +PS
Sbjct  98   PYFGSQNVS----FKQGINFAVYGATALDCALLIEKGIGSDFTNVSLSVQLNIFKQTLPS  153

Query  369  LCNSPS--DCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
            LC S S  DCK +L +SL ++G+ G NDY +    GK
Sbjct  154  LCASSSSHDCKEMLGDSLILMGDIGANDYDYMFFQGK  190



>ref|XP_009113643.1| PREDICTED: GDSL esterase/lipase At2g27360-like isoform X2 [Brassica 
rapa]
Length=386

 Score =   149 bits (377),  Expect(2) = 5e-63, Method: Compositional matrix adjust.
 Identities = 85/191 (45%), Positives = 119/191 (62%), Gaps = 1/191 (1%)
 Frame = +1

Query  460   FSREKNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVE  639
             F   KNI +++ ++P+V   I+    +L+++G +T +VP   PLGC+  YLT Y + N E
Sbjct  183   FFGHKNIEEVKELVPLVISTISSTITELVDMGGKTFLVPGDFPLGCSVIYLTLYQTSNKE  242

Query  640   DYD-DLGCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGF  816
              YD   GCL W+N+ + YHN+ LQ ELN LR+ +PY NIIY D +NA +++   PA  G 
Sbjct  243   AYDPQTGCLTWLNEFSEYHNEQLQAELNRLRKLYPYVNIIYGDYYNALLRLIQEPAKFGL  302

Query  817   SggalraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDG  996
                 L  CCG GG+YN+   ++CG +G   C DPS YVNWDG H+TEAAYK + + LL G
Sbjct  303   MNNPLPVCCGLGGRYNYTFGVKCGLKGVECCNDPSKYVNWDGIHMTEAAYKWIAEGLLKG  362

Query  997   SYTYPSMNALC  1029
              Y  P  +  C
Sbjct  363   PYATPPFDWSC  373


 Score =   120 bits (301),  Expect(2) = 5e-63, Method: Compositional matrix adjust.
 Identities = 70/157 (45%), Positives = 94/157 (60%), Gaps = 12/157 (8%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            S++DTGN I+L++      + +P  + LPYGETFFHHPTGR SDGR+I+D IAE  GL  
Sbjct  43   SITDTGNLIALSTP-----NELPESAFLPYGETFFHHPTGRYSDGRLIIDFIAEVLGLPH  97

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQDMI  362
             PP   SK      N  +GVNFAV G+ AL     ++  I     N S+  QL  F++ +
Sbjct  98   VPPFYGSK----NGNFEKGVNFAVGGATALECSVLEERGISCPPKNKSLGVQLTNFKESL  153

Query  363  PSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
             SLC SPSD   ++ N+L ++GE GGNDY +     K
Sbjct  154  RSLCGSPSD---MIGNALILIGEIGGNDYNYPFFGHK  187



>emb|CDX90162.1| BnaA08g18220D [Brassica napus]
Length=390

 Score =   147 bits (372),  Expect(2) = 6e-63, Method: Compositional matrix adjust.
 Identities = 84/197 (43%), Positives = 119/197 (60%), Gaps = 1/197 (1%)
 Frame = +1

Query  460   FSREKNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVE  639
             F + K+I ++  ++P+V  AI+     LI LG +T +VP   P GC  +YLT + +   E
Sbjct  186   FFQGKSINEVEELVPLVIKAISSVIVDLINLGGKTFLVPGTFPYGCFPAYLTLFQTAKEE  245

Query  640   DYDDL-GCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGF  816
             +YD L GCL W+N++   H++ L+ EL  LR+ +P+ NIIY D +N+  + +  PA  GF
Sbjct  246   EYDPLTGCLSWLNELGKNHDEHLKTELKRLRKIYPHVNIIYADYYNSMYRFFQEPAKYGF  305

Query  817   SggalraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDG  996
                 L ACCG GGQYNF    +CG +G   C +PS YVNWDGYHLTEA ++ M   LL+G
Sbjct  306   KERPLGACCGVGGQYNFTIGEECGGQGVGYCKNPSEYVNWDGYHLTEATHQKMAHGLLNG  365

Query  997   SYTYPSMNALCPTDAQV  1047
              Y  P+ +  C   A V
Sbjct  366   PYATPAFDWSCLGSASV  382


 Score =   122 bits (306),  Expect(2) = 6e-63, Method: Compositional matrix adjust.
 Identities = 69/157 (44%), Positives = 92/157 (59%), Gaps = 11/157 (7%)
 Frame = +3

Query  9    SDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAIPP  188
            +DTGNY+ L+       +  P  +  PYGETFFH PTGR SDGR+I+D IAE  GL   P
Sbjct  43   ADTGNYLHLS-----DVNHPPQAAFPPYGETFFHAPTGRNSDGRLIIDFIAEFLGLPYVP  97

Query  189  PSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQDMIPS  368
            P   S+  +     +QG+NFAV G+ AL      +  I    TNVS++ QL  F+ + PS
Sbjct  98   PYFGSQNVS----FKQGINFAVYGATALDCALLIEKGIGSDFTNVSLSVQLSIFKQIFPS  153

Query  369  LCNSPS--DCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
            LC S S  DCK +L +SL ++G+ G NDY +    GK
Sbjct  154  LCASSSSHDCKEMLGDSLILMGDIGANDYDYMFFQGK  190



>ref|XP_009407319.1| PREDICTED: GDSL esterase/lipase At1g28650-like [Musa acuminata 
subsp. malaccensis]
Length=398

 Score =   145 bits (365),  Expect(2) = 8e-63, Method: Compositional matrix adjust.
 Identities = 89/193 (46%), Positives = 123/193 (64%), Gaps = 3/193 (2%)
 Frame = +1

Query  460   FSREKNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVE  639
             F + + + +I+  +P V  AI     +LI+LGART++VP   P+GC A YLT + S   E
Sbjct  192   FFQGRGVDEIKTFVPGVVSAIGSAIEELIKLGARTMIVPGNFPIGCVAVYLTMFQSDRRE  251

Query  640   DYDD-LGCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGF  816
             DY+   GC+ W+NQ + YHN+ L +EL  LR R+P A IIY + + AAM I+  P   GF
Sbjct  252   DYESGTGCIEWLNQFSMYHNRHLLDELTQLRRRYPQATIIYANYYEAAMAIFRSPQEYGF  311

Query  817   SggalraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDG  996
                 L ACCGGGG YN+N   +CG + A  C  PS+ ++WDG HLTEAAY+++ + LL G
Sbjct  312   GKFPLAACCGGGGPYNYNHSTKCGKD-AGVCSSPSSQISWDGIHLTEAAYRVIARGLL-G  369

Query  997   SYTYPSMNALCPT  1035
              YT PS++  CPT
Sbjct  370   PYTIPSLSRSCPT  382


 Score =   124 bits (311),  Expect(2) = 8e-63, Method: Compositional matrix adjust.
 Identities = 71/158 (45%), Positives = 97/158 (61%), Gaps = 14/158 (9%)
 Frame = +3

Query  3    SLSDTGNYI-SLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLA  179
            SL+DTGN + S   D V ++         PYGETFFHHPTGR SDGRV+LD IA+  GL 
Sbjct  52   SLADTGNRLHSHRFDPVGRF---------PYGETFFHHPTGRYSDGRVMLDFIAQAIGLP  102

Query  180  IPPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQDM  359
            +  P L+      G + R G NFAV G+ AL  EF++   +  + TN S++ QL  F+ +
Sbjct  103  MVQPYLAGTHD--GEDFRYGANFAVGGATALDNEFFRSKGMEVSWTNDSLSVQLEWFKHL  160

Query  360  IPSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
            +PSLC   ++C +L+  SLF +GE GGNDY H+   G+
Sbjct  161  LPSLC--ATNCSDLMSESLFSVGEIGGNDYNHAFFQGR  196



>ref|XP_003593736.1| GDSL esterase/lipase [Medicago truncatula]
 gb|AES63987.1| GDSL-like lipase/acylhydrolase [Medicago truncatula]
Length=399

 Score =   144 bits (362),  Expect(2) = 8e-63, Method: Compositional matrix adjust.
 Identities = 84/191 (44%), Positives = 117/191 (61%), Gaps = 3/191 (2%)
 Frame = +1

Query  469   EKNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVEDYD  648
              ++I +I+  +P V  AI    ++LI+LGART+M+P   PLGC   YLT Y + +   YD
Sbjct  203   RRSIVEIKTYVPHVISAITSAINELIDLGARTLMIPGNFPLGCNVIYLTKYETTDKSQYD  262

Query  649   DLGCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGFSgga  828
               GCL W+N+ A ++NQ LQ EL+ LR  HP+A IIY D +NA + +Y  P   GF+   
Sbjct  263   SAGCLKWLNEFAEFYNQELQYELHRLRRIHPHATIIYADYYNALLPLYQNPTKFGFT--G  320

Query  829   lraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDGSYTY  1008
             L+ CCG GG YNF     CG  G  +C DPS Y+ WDG HLTEAAY+L+   +++G  + 
Sbjct  321   LKNCCGMGGSYNFGSG-SCGKPGVFACDDPSQYIGWDGVHLTEAAYRLIADGIINGPCSV  379

Query  1009  PSMNALCPTDA  1041
             P  + LC  + 
Sbjct  380   PQFSNLCSVNV  390


 Score =   125 bits (315),  Expect(2) = 8e-63, Method: Compositional matrix adjust.
 Identities = 68/157 (43%), Positives = 100/157 (64%), Gaps = 12/157 (8%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPS--CSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGL  176
            S++DTGN + L+S         PS  C   PYG+T+FHHP+GRCSDGR+I+D IAE  G+
Sbjct  54   SIADTGN-LYLSSQP-------PSDHCFFPPYGQTYFHHPSGRCSDGRLIIDFIAESLGI  105

Query  177  AIPPPSLSSK-AQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQ  353
             +  P L  K      N+ ++G NFAV+G+ AL   F+++  +    TN S+  QL+ F+
Sbjct  106  PMVKPYLGIKNGVLEDNSAKEGANFAVIGATALDVSFFEERGV-GFSTNYSLTVQLNWFK  164

Query  354  DMIPSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLL  464
            +++PSLCNS  +C  +  NSLF++GE GGND+ + L 
Sbjct  165  ELLPSLCNSSKNCHEVFANSLFLMGEIGGNDFNYPLF  201



>ref|NP_001031122.1| GDSL esterase/lipase [Arabidopsis thaliana]
 sp|Q9C857.1|GDL16_ARATH RecName: Full=GDSL esterase/lipase At1g31550; AltName: Full=Extracellular 
lipase At1g31550; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAG51269.1|AC027135_10 unknown protein [Arabidopsis thaliana]
 gb|AEE31372.1| GDSL esterase/lipase [Arabidopsis thaliana]
Length=394

 Score =   144 bits (364),  Expect(2) = 9e-63, Method: Compositional matrix adjust.
 Identities = 83/191 (43%), Positives = 121/191 (63%), Gaps = 1/191 (1%)
 Frame = +1

Query  460   FSREKNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVE  639
             F + + + +++ ++P+V   I+    +LI +G RT +VP   PLGC+ ++LT + + N+E
Sbjct  185   FFQLRPLDEVKELVPLVISTISSAITELIGMGGRTFLVPGGFPLGCSVAFLTLHQTSNME  244

Query  640   DYDDL-GCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGF  816
             +YD L GCL W+N+   YH++ LQEELN LR+ +P+ NIIY D +NA++++   P+  GF
Sbjct  245   EYDPLTGCLKWLNKFGEYHSEQLQEELNRLRKLNPHVNIIYADYYNASLRLGREPSKYGF  304

Query  817   SggalraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDG  996
                 L ACCG GG YNFN    CG  G  +C DPS YV WDG H+TEAA+K M   L+ G
Sbjct  305   INRHLSACCGVGGPYNFNLSRSCGSVGVEACSDPSKYVAWDGLHMTEAAHKSMADGLVKG  364

Query  997   SYTYPSMNALC  1029
              Y  P  +  C
Sbjct  365   PYAIPPFDWSC  375


 Score =   124 bits (312),  Expect(2) = 9e-63, Method: Compositional matrix adjust.
 Identities = 67/149 (45%), Positives = 94/149 (63%), Gaps = 10/149 (7%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            S++DTGN + L+      ++ +P  +  PYGETFFHHPTGR SDGR+I+D IAE  GL  
Sbjct  43   SIADTGNLLGLS-----DHNNLPMSAFPPYGETFFHHPTGRFSDGRLIIDFIAEFLGLPY  97

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQDMI  362
             PP   S   T G N  +GVNFAV  + AL + F ++ + Y    N S+  QL  F+  +
Sbjct  98   VPPYFGS---TNG-NFEKGVNFAVASATALESSFLEE-KGYHCPHNFSLGVQLKIFKQSL  152

Query  363  PSLCNSPSDCKNLLENSLFVLGEFGGNDY  449
            P+LC  PSDC++++ N+L ++GE G NDY
Sbjct  153  PNLCGLPSDCRDMIGNALILMGEIGANDY  181



>emb|CDY15657.1| BnaA07g08280D [Brassica napus]
Length=397

 Score =   147 bits (371),  Expect(2) = 1e-62, Method: Compositional matrix adjust.
 Identities = 77/157 (49%), Positives = 100/157 (64%), Gaps = 9/157 (6%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            S +DTGN I L+       D +P+ +  PYGETFFHHPTGR S+GR+I+D IAE  GL  
Sbjct  45   STADTGNLIGLSDP-----DDLPAAAFPPYGETFFHHPTGRFSNGRLIIDFIAEFLGLPF  99

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQDMI  362
             PP   S+      N  +GVNFAV G+ AL   F  +  I    TNVS+  QL  F+D +
Sbjct  100  VPPFYGSQ----NANFEKGVNFAVGGATALEHSFLVERGINLAFTNVSLGVQLQTFKDAL  155

Query  363  PSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
            PSLC SPSDC++++EN+L ++GE GGNDY + L  GK
Sbjct  156  PSLCGSPSDCRDMIENALILMGEIGGNDYNYPLFLGK  192


 Score =   122 bits (305),  Expect(2) = 1e-62, Method: Compositional matrix adjust.
 Identities = 69/188 (37%), Positives = 100/188 (53%), Gaps = 2/188 (1%)
 Frame = +1

Query  472   KNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVEDYDD  651
             K I ++R ++P+V   I+    +LI +G +T +VP   PLGC+ +YL  Y + N E+YD 
Sbjct  192   KPIQEVRELVPLVVTTISSAITELISMGGKTFLVPGQFPLGCSTTYLQSYKTSNAEEYDS  251

Query  652   LGCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGFSggal  831
              GCL W+N+        L  EL  L++ +P+  IIY D +N  ++    PA  GF     
Sbjct  252   TGCLKWLNEFGKNQGDQLLVELKKLQKLYPHVYIIYADYYNILLRFIQEPAKYGFLSKPS  311

Query  832   racc--ggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDGSYT  1005
                   G GG Y+       G +G   C DPS YV+WD  H+TEAAY+LM + +L G Y 
Sbjct  312   PLPPCCGTGGSYSSVFGRTFGLKGLKCCNDPSKYVDWDSAHMTEAAYRLMAEGVLKGPYA  371

Query  1006  YPSMNALC  1029
              P  +  C
Sbjct  372   IPPFDWSC  379



>dbj|BAD95190.1| hypothetical protein [Arabidopsis thaliana]
Length=394

 Score =   144 bits (364),  Expect(2) = 1e-62, Method: Compositional matrix adjust.
 Identities = 83/191 (43%), Positives = 121/191 (63%), Gaps = 1/191 (1%)
 Frame = +1

Query  460   FSREKNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVE  639
             F + + + +++ ++P+V   I+    +LI +G RT +VP   PLGC+ ++LT + + N+E
Sbjct  185   FFQLRPLDEVKELVPLVISTISSAITELIGMGGRTFLVPGGFPLGCSVAFLTLHQTSNME  244

Query  640   DYDDL-GCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGF  816
             +YD L GCL W+N+   YH++ LQEELN LR+ +P+ NIIY D +NA++++   P+  GF
Sbjct  245   EYDPLTGCLKWLNKFGEYHSEQLQEELNRLRKLNPHVNIIYADYYNASLRLGREPSKYGF  304

Query  817   SggalraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDG  996
                 L ACCG GG YNFN    CG  G  +C DPS YV WDG H+TEAA+K M   L+ G
Sbjct  305   INRHLSACCGVGGPYNFNLSRSCGSVGVEACSDPSKYVAWDGLHMTEAAHKSMADGLVKG  364

Query  997   SYTYPSMNALC  1029
              Y  P  +  C
Sbjct  365   PYAIPPFDWSC  375


 Score =   124 bits (312),  Expect(2) = 1e-62, Method: Compositional matrix adjust.
 Identities = 67/149 (45%), Positives = 94/149 (63%), Gaps = 10/149 (7%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            S++DTGN + L+      ++ +P  +  PYGETFFHHPTGR SDGR+I+D IAE  GL  
Sbjct  43   SIADTGNLLGLS-----DHNNLPMSAFPPYGETFFHHPTGRFSDGRLIIDFIAEFLGLPY  97

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQDMI  362
             PP   S   T G N  +GVNFAV  + AL + F ++ + Y    N S+  QL  F+  +
Sbjct  98   VPPYFGS---TNG-NFERGVNFAVASATALESSFLEE-KGYHCPHNFSLGVQLKIFKQSL  152

Query  363  PSLCNSPSDCKNLLENSLFVLGEFGGNDY  449
            P+LC  PSDC++++ N+L ++GE G NDY
Sbjct  153  PNLCGLPSDCRDMIGNALILMGEIGANDY  181



>emb|CDO96755.1| unnamed protein product [Coffea canephora]
Length=376

 Score =   139 bits (350),  Expect(2) = 1e-62, Method: Compositional matrix adjust.
 Identities = 83/185 (45%), Positives = 114/185 (62%), Gaps = 2/185 (1%)
 Frame = +1

Query  478   ITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVEDYDDLG  657
             I  ++  +P+V  AIA     LI+ GA  ++VP   P+GC+A YLT + +PN   YD+ G
Sbjct  189   IKQVKATVPVVVEAIAATISALIDEGAVELVVPGNFPIGCSAVYLTLFETPNKAAYDEHG  248

Query  658   CLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGFSggalra  837
             CL   N  A YHN  L+  L  LR+++P A IIY D + AA +    P + GFS   L A
Sbjct  249   CLKVYNAFAKYHNAQLRLGLEKLRQKYPQAKIIYADYYGAAKRFVHSPKHYGFSKDRLVA  308

Query  838   ccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDGSYTYPSM  1017
             CCGGGG YNFN   +CG  G+T+C  PS + NWDG HLTEAAY+ +   L++G ++ PS+
Sbjct  309   CCGGGGPYNFNNSARCGHTGSTTCTSPSAHANWDGIHLTEAAYRYVAMGLINGPFSSPSL  368

Query  1018  NALCP  1032
             +  CP
Sbjct  369   S--CP  371


 Score =   130 bits (326),  Expect(2) = 1e-62, Method: Compositional matrix adjust.
 Identities = 71/157 (45%), Positives = 99/157 (63%), Gaps = 10/157 (6%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            SL+DTGN++     G L +   P    LPYGETFFHH TGRCSDGR+++D  A+ YGL  
Sbjct  39   SLADTGNFLR---TGALAF---PVIERLPYGETFFHHATGRCSDGRLVVDFFADAYGLPY  92

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTV-TNVSMNDQLHAFQDM  359
              P L+  A+ G  N + GVNFAV G+ AL  EF+   ++   + TN S++ QL  F+ +
Sbjct  93   LKPYLAV-ARDG--NFQHGVNFAVAGATALDPEFFYHQKLGPILWTNDSLSVQLGWFKKV  149

Query  360  IPSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSG  470
              +LC++P +CKN  + SLF++GE GGNDY +    G
Sbjct  150  KSTLCSTPQECKNFFKKSLFLVGEIGGNDYNYPFFIG  186



>ref|XP_009102894.1| PREDICTED: GDSL esterase/lipase At1g28580-like [Brassica rapa]
Length=397

 Score =   147 bits (370),  Expect(2) = 1e-62, Method: Compositional matrix adjust.
 Identities = 77/157 (49%), Positives = 101/157 (64%), Gaps = 9/157 (6%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            S +DTGN I L+       D +P+ +  PYGETFFHHPTGR S+GR+I+D IAE  GL  
Sbjct  45   STADTGNLIGLSDP-----DDLPAAAFPPYGETFFHHPTGRFSNGRLIIDFIAEFLGLPF  99

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQDMI  362
             PP   S+      N  +GVNFAV G+ AL   F  +  I    TNVS+  QL +F+D +
Sbjct  100  VPPFYGSQ----NANFEKGVNFAVGGATALEHSFLVERGINLDFTNVSLGVQLQSFKDAL  155

Query  363  PSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
            PSLC SPSDC++++EN+L ++GE GGNDY + L  GK
Sbjct  156  PSLCGSPSDCRDMIENALILMGEIGGNDYNYPLFLGK  192


 Score =   122 bits (305),  Expect(2) = 1e-62, Method: Compositional matrix adjust.
 Identities = 72/188 (38%), Positives = 103/188 (55%), Gaps = 2/188 (1%)
 Frame = +1

Query  472   KNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVEDYDD  651
             K I ++R ++P+V   I+    +LI +G +T +VP   PLGC+ +YL  Y + N E+YD 
Sbjct  192   KPIQEVRELVPLVVTTISSAITELISMGGKTFLVPGQFPLGCSTTYLQSYKTSNAEEYDS  251

Query  652   LGCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGF--Sgg  825
              GCL W+N+        L  EL  L++ +P+  IIY D +N  ++    PA  GF     
Sbjct  252   TGCLKWLNEFGKNQGDQLLVELKKLQKLYPHVYIIYADYYNILLRFIQEPAKYGFLSKPS  311

Query  826   alraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDGSYT  1005
              L  CCG GG Y+       G +G   C DPS YV+WD  H+TEAAY+LM + +L G Y 
Sbjct  312   PLPPCCGTGGSYSSVFGRTFGLKGLKCCNDPSKYVDWDSAHMTEAAYRLMAEGVLKGPYA  371

Query  1006  YPSMNALC  1029
              P  +  C
Sbjct  372   IPPFDWSC  379



>ref|XP_011027710.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Populus euphratica]
Length=373

 Score =   145 bits (367),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 86/182 (47%), Positives = 118/182 (65%), Gaps = 0/182 (0%)
 Frame = +1

Query  475   NITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVEDYDDL  654
             +I  +R  +P+V  AIA+    LIE GA  ++VP  LP+GC+A YLT + SPN  +YD  
Sbjct  188   SIKQLRASVPLVVEAIAKATSFLIEEGAVELLVPGNLPIGCSAVYLTLFGSPNRTEYDRN  247

Query  655   GCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGFSggalr  834
             GCL   N  + YHN  L+  L +LR+++P+A IIY D + AA + Y  P   GF+GG L 
Sbjct  248   GCLKACNAFSKYHNNQLKTALQMLRQKYPHARIIYADYYGAAKRFYHAPQRHGFTGGTLT  307

Query  835   accggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDGSYTYPS  1014
             ACCGGGG YNFN   +CG  G+ +C +PS++ NWDG HLTEAAY+ +   L+ GS+T P 
Sbjct  308   ACCGGGGPYNFNNSARCGHMGSRTCSNPSSHANWDGIHLTEAAYRYIAMGLVSGSFTTPP  367

Query  1015  MN  1020
             + 
Sbjct  368   LR  369


 Score =   122 bits (306),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 71/159 (45%), Positives = 97/159 (61%), Gaps = 13/159 (8%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            SLSDTGN++     G L +   P  + LPYGETFF H TGRCSDGR+++D I+E  GL  
Sbjct  38   SLSDTGNFLL---SGALAF---PVIAKLPYGETFFRHATGRCSDGRLVVDFISEASGLPH  91

Query  183  PPPSLSSKAQTGGNNIR--QGVNFAVVGSRALPAEFYQKLEIYDTV-TNVSMNDQLHAFQ  353
             PP L+     G + +    GVNFAV G+ AL A+F+    I   + TN S++ QL  F+
Sbjct  92   LPPYLA----LGKDQLHSFHGVNFAVAGATALDAKFFYDQRIGKIMWTNDSLSVQLGWFK  147

Query  354  DMIPSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSG  470
             +  SLC S  +C N  + SLF++GE GGNDY ++  +G
Sbjct  148  QLKSSLCISKQECDNYFKKSLFLVGEIGGNDYNYAYFAG  186



>ref|XP_004296391.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Fragaria vesca 
subsp. vesca]
Length=366

 Score =   136 bits (342),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 82/185 (44%), Positives = 112/185 (61%), Gaps = 1/185 (1%)
 Frame = +1

Query  460   FSREKNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVE  639
             F    +I  ++ ++P+V  AI      LIE GA  ++VP  LP+GC A YLT+  SPN  
Sbjct  181   FFAGGSIKQLKALVPLVVDAITMATSVLIEEGAVELVVPGNLPIGCLAVYLTFNGSPNKA  240

Query  640   DYDDL-GCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGF  816
              YD   GCL   N  A YHN+ L+  L  + +++P+A IIY D + A+M  +  P + GF
Sbjct  241   YYDKRNGCLKAFNAFAKYHNKELKRALGTVEQKYPHARIIYADYYGASMPFFHAPQHYGF  300

Query  817   SggalraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDG  996
             + G+L  CCGGGG YNFN   +CG  G+  C DPS+Y NWDG HLT+AAY  + K L+ G
Sbjct  301   TSGSLDVCCGGGGPYNFNNSARCGQIGSKVCKDPSSYANWDGIHLTQAAYSHIAKGLIHG  360

Query  997   SYTYP  1011
              +T P
Sbjct  361   KFTIP  365


 Score =   132 bits (331),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 74/159 (47%), Positives = 99/159 (62%), Gaps = 11/159 (7%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            SLSDTGN+  L SD +         + LPYGETFFHH TGR SDGR+I+D IAE   L  
Sbjct  34   SLSDTGNF--LLSDPLAS----QVIAKLPYGETFFHHATGRSSDGRLIVDFIAEACELPH  87

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKL---EIYDTVTNVSMNDQLHAFQ  353
             PP L+ K   GG N  +GVNFAV G+  L  EF  KL   ++   +TN S++ QL  F+
Sbjct  88   LPPYLALK--KGGQNFYRGVNFAVAGATVLAPEFLSKLLRGKVGAMLTNYSLSAQLGWFK  145

Query  354  DMIPSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSG  470
            ++ PSLCN+  +C++    +LF++GE GGNDY +   +G
Sbjct  146  ELKPSLCNTKQECESYFNKALFLVGEIGGNDYNYGFFAG  184



>ref|NP_174185.2| GDSL esterase/lipase [Arabidopsis thaliana]
 gb|AEE31008.1| GDSL esterase/lipase [Arabidopsis thaliana]
Length=389

 Score =   143 bits (361),  Expect(2) = 3e-62, Method: Compositional matrix adjust.
 Identities = 82/199 (41%), Positives = 120/199 (60%), Gaps = 1/199 (1%)
 Frame = +1

Query  460   FSREKNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVE  639
             F   K+I +I+ ++P+V  AI+     LI+LG +T +VP   PLGC  +YLT + +   E
Sbjct  185   FFEGKSINEIKQLVPLVIKAISSAIVDLIDLGGKTFLVPGNFPLGCYPAYLTLFQTAAEE  244

Query  640   DYDDL-GCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGF  816
             D+D   GC+  +N+   YHN+ L+ EL  L+E + + NIIY D +N+  ++Y  P   GF
Sbjct  245   DHDPFTGCIPRLNEFGEYHNEQLKTELKRLQELYDHVNIIYADYYNSLFRLYQEPVKYGF  304

Query  817   SggalraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDG  996
                 L ACCG GGQYNF    +CG  G + C +PS YVNWDGYHLTEA ++ M + +L+G
Sbjct  305   KNRPLAACCGVGGQYNFTIGKECGHRGVSCCQNPSEYVNWDGYHLTEATHQKMAQVILNG  364

Query  997   SYTYPSMNALCPTDAQVAQ  1053
             +Y  P+ +  C     V +
Sbjct  365   TYASPAFDWSCSGSESVDK  383


 Score =   124 bits (312),  Expect(2) = 3e-62, Method: Compositional matrix adjust.
 Identities = 67/157 (43%), Positives = 95/157 (61%), Gaps = 9/157 (6%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            S++DTGNY+ L+       + +P  + LPYGE+FFH P+GR SDGR+I+D IAE  GL  
Sbjct  42   SIADTGNYLHLS-----DVNHLPQSAFLPYGESFFHPPSGRYSDGRLIIDFIAEFLGLPY  96

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQDMI  362
             P    S+  +      QG+NFAV G+ AL   F     I    TNVS++ QL+ F+ ++
Sbjct  97   VPSYFGSQNVS----FDQGINFAVYGATALDRVFLVGKGIESDFTNVSLSVQLNIFKQIL  152

Query  363  PSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
            P+LC S S C+ +L +SL ++GE G NDY +    GK
Sbjct  153  PNLCTSSSHCREMLGDSLILMGEIGVNDYNYPFFEGK  189



>ref|XP_009352808.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Pyrus x bretschneideri]
Length=367

 Score =   145 bits (366),  Expect(2) = 3e-62, Method: Compositional matrix adjust.
 Identities = 88/180 (49%), Positives = 114/180 (63%), Gaps = 1/180 (1%)
 Frame = +1

Query  475   NITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVEDYDDL  654
             NI  ++  +P V  AI      LIE GA  ++VP  LP+GC+A YLT + +PN   YD  
Sbjct  187   NIKQLKASVPYVVGAITNATSALIEEGAVELLVPGNLPIGCSAVYLTLFQTPNRSYYDKR  246

Query  655   -GCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGFSggal  831
              GCL   N  + YHN  L+  L  LR+++P+ NIIY D + AAM  +  P + GF  G L
Sbjct  247   NGCLKAFNTFSKYHNSELKRALATLRQKYPHVNIIYADYYGAAMPFFHAPQHYGFKSGTL  306

Query  832   raccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDGSYTYP  1011
             RACCGGGG YNFN   +CG  G+T+C DPS+YVNWDG HLTEAAY+ + K L+ G +T P
Sbjct  307   RACCGGGGPYNFNNSARCGHIGSTACKDPSSYVNWDGIHLTEAAYRYIAKGLIHGQFTKP  366


 Score =   122 bits (306),  Expect(2) = 3e-62, Method: Compositional matrix adjust.
 Identities = 71/157 (45%), Positives = 97/157 (62%), Gaps = 10/157 (6%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            SLSDTGN++     G L +   P    LPYGETFF H TGRCSDGR+++D I E +GL +
Sbjct  38   SLSDTGNFLL---SGALAF---PVIGKLPYGETFFQHATGRCSDGRLVVDFIVEAFGLPL  91

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRAL-PAEFYQKLEIYDTVTNVSMNDQLHAFQDM  359
             PP L+        +I+ GVNFAV G+ AL P  FYQ+       TN S++ QL  F+ +
Sbjct  92   LPPYLALNKT---QDIQHGVNFAVAGATALDPEFFYQRKIGLAMWTNDSLSTQLGWFKKL  148

Query  360  IPSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSG  470
             PSLC++  +C N  + +LF++GE GGNDY ++   G
Sbjct  149  KPSLCSTKQECDNYFKKTLFLVGEIGGNDYNYAFFVG  185



>ref|XP_009109701.1| PREDICTED: GDSL esterase/lipase At1g28670-like isoform X2 [Brassica 
rapa]
Length=387

 Score =   144 bits (363),  Expect(2) = 5e-62, Method: Compositional matrix adjust.
 Identities = 84/197 (43%), Positives = 119/197 (60%), Gaps = 4/197 (2%)
 Frame = +1

Query  460   FSREKNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVE  639
             F + K+I ++  ++P+V  AI+     LI LG +T +VP   P GC  +YLT + +   E
Sbjct  186   FFQGKSINEVEELVPLVIKAISS---DLINLGGKTFLVPGTFPYGCFPAYLTLFQTAKEE  242

Query  640   DYDDL-GCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGF  816
             +YD L GCL W+N++   H++ L+ EL  LR+ +P+ NIIY D +N+  + +  PA  GF
Sbjct  243   EYDPLTGCLSWLNELGKNHDEHLKTELKRLRKIYPHVNIIYADYYNSMYRFFQEPAKYGF  302

Query  817   SggalraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDG  996
                 L ACCG GGQYNF    +CG +G   C +PS YVNWDGYHLTEA ++ M   LL+G
Sbjct  303   KERPLGACCGVGGQYNFTFGEECGCQGVGYCKNPSEYVNWDGYHLTEATHQKMAHGLLNG  362

Query  997   SYTYPSMNALCPTDAQV  1047
              Y  P+ +  C   A V
Sbjct  363   PYASPAFDWSCLGSASV  379


 Score =   122 bits (307),  Expect(2) = 5e-62, Method: Compositional matrix adjust.
 Identities = 69/157 (44%), Positives = 93/157 (59%), Gaps = 11/157 (7%)
 Frame = +3

Query  9    SDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAIPP  188
            +DTGNY+ L+       +  P  +  PYGETFFH PTGR SDGR+I+D IAE  GL   P
Sbjct  43   ADTGNYLHLS-----DVNHPPQAAFPPYGETFFHTPTGRNSDGRLIIDFIAEFLGLPYVP  97

Query  189  PSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQDMIPS  368
            P   S+  +     +QG+NFAV G+ AL      +  I    TNVS++ QL+ F+  +PS
Sbjct  98   PYFGSQNVS----FKQGINFAVYGATALDCALLIEKGIGSDFTNVSLSVQLNIFKQTLPS  153

Query  369  LCNSPS--DCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
            LC S S  DCK +L +SL ++G+ G NDY +    GK
Sbjct  154  LCASSSSHDCKEMLGDSLILMGDIGANDYDYMFFQGK  190



>sp|P0C8Z7.1|GDL91_ARATH RecName: Full=GDSL esterase/lipase At1g28640; AltName: Full=Extracellular 
lipase At1g28640; Flags: Precursor [Arabidopsis 
thaliana]
Length=390

 Score =   143 bits (361),  Expect(2) = 8e-62, Method: Compositional matrix adjust.
 Identities = 82/199 (41%), Positives = 120/199 (60%), Gaps = 1/199 (1%)
 Frame = +1

Query  460   FSREKNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVE  639
             F   K+I +I+ ++P+V  AI+     LI+LG +T +VP   PLGC  +YLT + +   E
Sbjct  186   FFEGKSINEIKQLVPLVIKAISSAIVDLIDLGGKTFLVPGNFPLGCYPAYLTLFQTAAEE  245

Query  640   DYDDL-GCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGF  816
             D+D   GC+  +N+   YHN+ L+ EL  L+E + + NIIY D +N+  ++Y  P   GF
Sbjct  246   DHDPFTGCIPRLNEFGEYHNEQLKTELKRLQELYDHVNIIYADYYNSLFRLYQEPVKYGF  305

Query  817   SggalraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDG  996
                 L ACCG GGQYNF    +CG  G + C +PS YVNWDGYHLTEA ++ M + +L+G
Sbjct  306   KNRPLAACCGVGGQYNFTIGKECGHRGVSCCQNPSEYVNWDGYHLTEATHQKMAQVILNG  365

Query  997   SYTYPSMNALCPTDAQVAQ  1053
             +Y  P+ +  C     V +
Sbjct  366   TYASPAFDWSCSGSESVDK  384


 Score =   122 bits (307),  Expect(2) = 8e-62, Method: Compositional matrix adjust.
 Identities = 68/158 (43%), Positives = 96/158 (61%), Gaps = 10/158 (6%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            S++DTGNY+ L+       + +P  + LPYGE+FFH P+GR SDGR+I+D IAE  GL  
Sbjct  42   SIADTGNYLHLS-----DVNHLPQSAFLPYGESFFHPPSGRYSDGRLIIDFIAEFLGLPY  96

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQDMI  362
             P    S+  +      QG+NFAV G+ AL   F     I    TNVS++ QL+ F+ ++
Sbjct  97   VPSYFGSQNVS----FDQGINFAVYGATALDRVFLVGKGIESDFTNVSLSVQLNIFKQIL  152

Query  363  PSLCNSPS-DCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
            P+LC S S DC+ +L +SL ++GE G NDY +    GK
Sbjct  153  PNLCTSSSRDCREMLGDSLILMGEIGVNDYNYPFFEGK  190



>ref|XP_010912659.1| PREDICTED: GDSL esterase/lipase At1g28650-like [Elaeis guineensis]
Length=387

 Score =   145 bits (365),  Expect(2) = 8e-62, Method: Compositional matrix adjust.
 Identities = 89/198 (45%), Positives = 120/198 (61%), Gaps = 3/198 (2%)
 Frame = +1

Query  460   FSREKNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVE  639
             F + + + +IR  +P V  AI+   + LI+LGA+T++VP   P+GC + YL  + S   E
Sbjct  184   FFQGRTVDEIRTFVPSVISAISSAINVLIQLGAKTMVVPGNFPIGCVSRYLQTFQSQRKE  243

Query  640   DYD-DLGCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGF  816
             DYD + GC+ W+N+ A YHN+LL +EL+ LR+ HP+  IIY D + A + I+  P   GF
Sbjct  244   DYDSETGCIKWLNEFAEYHNRLLVDELDHLRQLHPHVTIIYADYYEALLHIFRFPTQFGF  303

Query  817   SggalraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDG  996
                 L ACCG GG YN    + CGD  AT C DPS YV WDG HLTEAAY  + + LL+G
Sbjct  304   KEPPLAACCGAGGPYNVF--VACGDRAATVCNDPSKYVCWDGIHLTEAAYGTIAQGLLEG  361

Query  997   SYTYPSMNALCPTDAQVA  1050
             SY  P +   C    Q A
Sbjct  362   SYATPPITQACAHIRQSA  379


 Score =   121 bits (303),  Expect(2) = 8e-62, Method: Compositional matrix adjust.
 Identities = 69/157 (44%), Positives = 101/157 (64%), Gaps = 9/157 (6%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            SL+DTGN++  + D         + + LPYGET+FH PTGR +DGR+I+D IA+  G+ +
Sbjct  41   SLADTGNFLYSSRDNPR------AIARLPYGETYFHRPTGRYTDGRLIIDFIAQDIGIPL  94

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQDMI  362
             PP L      G +  RQGVNFAV G+ AL  +F+++  +  + T  S+  Q+  F+ ++
Sbjct  95   VPPYLEGP---GDHGFRQGVNFAVAGATALDNDFFREKGLDISWTEYSLGTQIEWFKQLL  151

Query  363  PSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
            PSLC+S SDCK +L +SLF++GE GGNDY H    G+
Sbjct  152  PSLCSSSSDCKGILSSSLFLMGEIGGNDYNHPFFQGR  188



>ref|XP_010912608.1| PREDICTED: GDSL esterase/lipase At1g28570-like isoform X2 [Elaeis 
guineensis]
Length=405

 Score =   142 bits (357),  Expect(2) = 9e-62, Method: Compositional matrix adjust.
 Identities = 90/201 (45%), Positives = 121/201 (60%), Gaps = 2/201 (1%)
 Frame = +1

Query  460   FSREKNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVE  639
             F+  +   +IR  IP +   I+     LI+LGA+T++VP + P GC   YLT+  S  VE
Sbjct  197   FNEGRTADEIRTFIPNIIEVISSVIDDLIKLGAKTLVVPGIFPSGCVPVYLTWMQSEIVE  256

Query  640   DYD-DLGCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGF  816
             DYD D GC+ WVN+ ++YHNQLLQ EL+ +R  HP+  IIY D + A M ++  P   GF
Sbjct  257   DYDPDTGCIKWVNEFSAYHNQLLQNELDRIRRLHPHVTIIYADYYEALMSVFRSPEKFGF  316

Query  817   SggalraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDG  996
                 L ACCGGGG YN N  L CG   AT C DPS +V WD  H TEAA +++ + LL+G
Sbjct  317   KKAPLDACCGGGGPYNVNFSLPCGGPMATVCKDPSKFVFWDDAHPTEAATEIVARGLLEG  376

Query  997   SYTYPSMNALC-PTDAQVAQL  1056
              Y YP +   C   ++  +QL
Sbjct  377   PYAYPPILQACSKVESDASQL  397


 Score =   124 bits (310),  Expect(2) = 9e-62, Method: Compositional matrix adjust.
 Identities = 68/157 (43%), Positives = 97/157 (62%), Gaps = 9/157 (6%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            SL+DTGN +    D     D  P    LPYGET+FH+ TGR SDGR+I+D IA+  GL +
Sbjct  54   SLADTGNLLHYLGD-----DAGPFAH-LPYGETYFHNATGRFSDGRLIIDFIAQSLGLPL  107

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQDMI  362
             PP L   A T   + R G NFAV G+ AL  +F++   +  T +  S+  Q + F+ ++
Sbjct  108  VPPYL---AGTNAQDFRYGANFAVAGATALDNDFFRAKGLNVTWSEYSLVVQFNWFKQLL  164

Query  363  PSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
            PSLC++ SDCK ++ NSLF++GE G ND+ +S   G+
Sbjct  165  PSLCSTDSDCKGIISNSLFLVGEIGWNDHGYSFNEGR  201



>ref|XP_010478236.1| PREDICTED: GDSL esterase/lipase At1g28610-like [Camelina sativa]
Length=400

 Score =   137 bits (344),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 76/189 (40%), Positives = 121/189 (64%), Gaps = 2/189 (1%)
 Frame = +1

Query  472   KNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVEDYDD  651
             K + +++ ++P+V  +++     L+ +G +T+MVP+  P+GC +++LT Y   N E+YD 
Sbjct  192   KTVEELKELVPLVISSMSSVITDLVNMGGKTIMVPADFPIGCWSAFLTEYWISNKEEYDP  251

Query  652   L-GCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGFSgga  828
             L GCL  +N+   YHN+ LQEE+N +++ +P+  I+Y D +NA ++I+  PA  GF+ G 
Sbjct  252   LTGCLKSLNEFIEYHNKELQEEINRVQKLYPHVTILYADYYNALLRIFLEPAKFGFTSGR  311

Query  829   lraccggggQ-YNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDGSYT  1005
               + C G G+ YNFN    CG +   SC DPS YV+WDG+HLTE+AY+ +    L G YT
Sbjct  312   PLSACCGTGEPYNFNSMSWCGTKNVDSCIDPSKYVHWDGFHLTESAYRWIAMGFLKGPYT  371

Query  1006  YPSMNALCP  1032
              P+ +  CP
Sbjct  372   IPAYDWSCP  380


 Score =   129 bits (323),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 68/157 (43%), Positives = 96/157 (61%), Gaps = 9/157 (6%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            S++DTGN ++L+       D  P  +  PYGETFFH PTGR S+GR+I+D IAE  GL  
Sbjct  45   SITDTGNLLALSDA-----DNPPHSAFPPYGETFFHFPTGRYSNGRLIIDFIAEFLGLPY  99

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQDMI  362
             PP   S+  + G    +GVNFAV G+ AL     +   IY   TNVS+  Q   F++ +
Sbjct  100  LPPFHGSQNASFG----KGVNFAVAGATALEQSVLESRGIYYHYTNVSLGVQFKNFKESL  155

Query  363  PSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
            P++C S +DC+ ++ N+L ++GE GGNDY +  L GK
Sbjct  156  PNICGSLADCREMIGNALLIVGEIGGNDYNYGFLVGK  192



>ref|XP_008383648.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Malus domestica]
 ref|XP_008349210.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Malus domestica]
Length=367

 Score =   142 bits (357),  Expect(2) = 3e-61, Method: Compositional matrix adjust.
 Identities = 86/180 (48%), Positives = 114/180 (63%), Gaps = 1/180 (1%)
 Frame = +1

Query  475   NITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVEDYDDL  654
             N+  ++  +P V  AI      LIE GA  ++VP  LP+GC+A YLT + + N   YD  
Sbjct  187   NMEQLKASVPYVVGAITNATSALIEEGAVELLVPGNLPIGCSAVYLTLFQTTNRAYYDKR  246

Query  655   -GCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGFSggal  831
              GCL   N  + YHN  L+  L  LR+++P+ANIIY D + AAM  +  P + GF  G L
Sbjct  247   NGCLKAFNAFSKYHNSELKRALATLRQKYPHANIIYADYYGAAMPFFHAPQHYGFKSGTL  306

Query  832   raccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDGSYTYP  1011
             RACCGGGG YNFN   +CG  G+T+C DPS+YVNWDG HLTEAAY+ + + L+ G +T P
Sbjct  307   RACCGGGGXYNFNNSARCGHIGSTACKDPSSYVNWDGIHLTEAAYRYIAEGLIHGQFTKP  366


 Score =   122 bits (306),  Expect(2) = 3e-61, Method: Compositional matrix adjust.
 Identities = 70/158 (44%), Positives = 98/158 (62%), Gaps = 12/158 (8%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYG-LA  179
            SLSDTGN++     G L +   P    LPYGETFF H TGRCSDGR+++D I E +G   
Sbjct  38   SLSDTGNFLL---SGALAF---PVIGKLPYGETFFQHATGRCSDGRLVVDFIVEAFGLPL  91

Query  180  IPPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTV-TNVSMNDQLHAFQD  356
            +PP    +K Q    +I+ GVNFAV G+ AL  EF+ + +I   + TN S++ QL  F+ 
Sbjct  92   LPPYLALNKTQ----DIQHGVNFAVAGATALDPEFFYQRKIGPVMWTNDSLSTQLGWFKK  147

Query  357  MIPSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSG  470
            + PSLC +  +C N  + +LF++GE GGNDY ++   G
Sbjct  148  LKPSLCXTKQECDNYFKKTLFLVGEIGGNDYNYAFFVG  185



>ref|XP_010912585.1| PREDICTED: GDSL esterase/lipase At1g31550-like [Elaeis guineensis]
Length=396

 Score =   145 bits (365),  Expect(2) = 7e-61, Method: Compositional matrix adjust.
 Identities = 88/201 (44%), Positives = 121/201 (60%), Gaps = 3/201 (1%)
 Frame = +1

Query  460   FSREKNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVE  639
             F++ + + +IR  +P V +      + LIELGA+T++VP + PLGC ++YLT + S   E
Sbjct  193   FAQFRTLDEIRTYVPSVINITGWAINSLIELGAKTLVVPGIFPLGCVSAYLTIHQSQRKE  252

Query  640   DYD-DLGCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGF  816
             DYD   GC+  +N+ + YHN LL+ E++ LR  HPY  IIY D + AAM IY  P   G 
Sbjct  253   DYDPQTGCIKRLNEFSEYHNNLLKAEVDRLRGLHPYTTIIYADYYEAAMDIYRHPLKYGI  312

Query  817   SggalraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDG  996
                    C GGG +YNFN  + CG  G T C DPS +V WDG HLT+A YK++ + LL+G
Sbjct  313   DAPLAACCGGGG-RYNFNLAVMCGAPGGTVCSDPSKHVCWDGMHLTDAVYKIIARGLLEG  371

Query  997   SY-TYPSMNALCPTDAQVAQL  1056
             SY T P   A    +  V+QL
Sbjct  372   SYATAPIAQACLQLERGVSQL  392


 Score =   117 bits (294),  Expect(2) = 7e-61, Method: Compositional matrix adjust.
 Identities = 63/151 (42%), Positives = 89/151 (59%), Gaps = 9/151 (6%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            S++DTGNY+      V   +     +  PYG T+F  PTGR SDGRVI+D IA+  G+  
Sbjct  50   SIADTGNYL------VALGEKAGPVAHPPYGNTYFRRPTGRFSDGRVIIDFIAQAMGMPP  103

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQDMI  362
             PP L   A+T   ++R GVNFAV G  AL  EF++   +  T    S+  Q+  F++++
Sbjct  104  VPPYL---ARTSNQDLRNGVNFAVAGVTALDGEFFKAKGMALTWPQYSLGTQIQWFKELL  160

Query  363  PSLCNSPSDCKNLLENSLFVLGEFGGNDYTH  455
            PS C+  SDC++ L  SL ++GE GGNDY  
Sbjct  161  PSFCSYKSDCESFLSKSLVLMGEIGGNDYNQ  191



>ref|XP_009109702.1| PREDICTED: GDSL esterase/lipase At1g28670-like isoform X3 [Brassica 
rapa]
Length=387

 Score =   147 bits (372),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 84/197 (43%), Positives = 119/197 (60%), Gaps = 1/197 (1%)
 Frame = +1

Query  460   FSREKNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVE  639
             F + K+I ++  ++P+V  AI+     LI LG +T +VP   P GC  +YLT + +   E
Sbjct  183   FFQGKSINEVEELVPLVIKAISSAIVDLINLGGKTFLVPGTFPYGCFPAYLTLFQTAKEE  242

Query  640   DYDDL-GCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGF  816
             +YD L GCL W+N++   H++ L+ EL  LR+ +P+ NIIY D +N+  + +  PA  GF
Sbjct  243   EYDPLTGCLSWLNELGKNHDEHLKTELKRLRKIYPHVNIIYADYYNSMYRFFQEPAKYGF  302

Query  817   SggalraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDG  996
                 L ACCG GGQYNF    +CG +G   C +PS YVNWDGYHLTEA ++ M   LL+G
Sbjct  303   KERPLGACCGVGGQYNFTFGEECGCQGVGYCKNPSEYVNWDGYHLTEATHQKMAHGLLNG  362

Query  997   SYTYPSMNALCPTDAQV  1047
              Y  P+ +  C   A V
Sbjct  363   PYASPAFDWSCLGSASV  379


 Score =   114 bits (286),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 66/155 (43%), Positives = 90/155 (58%), Gaps = 10/155 (6%)
 Frame = +3

Query  9    SDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAIPP  188
            +DTGNY+ L+       +  P  +  PYGETFFH PTGR SDGR+I+D IAE  GL   P
Sbjct  43   ADTGNYLHLS-----DVNHPPQAAFPPYGETFFHTPTGRNSDGRLIIDFIAEFLGLPYVP  97

Query  189  PSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQDMIPS  368
            P   S+  +     +QG+NFAV G+ AL      +  I    TNVS++ QL+ F+  +PS
Sbjct  98   PYFGSQNVS----FKQGINFAVYGATALDCALLIEKGIGSDFTNVSLSVQLNIFKQTLPS  153

Query  369  LCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
            LC S S    +L +SL ++G+ G NDY +    GK
Sbjct  154  LCASSSS-HEMLGDSLILMGDIGANDYDYMFFQGK  187



>ref|XP_010540487.1| PREDICTED: GDSL esterase/lipase At1g28570-like [Tarenaya hassleriana]
Length=402

 Score =   134 bits (336),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 81/191 (42%), Positives = 117/191 (61%), Gaps = 2/191 (1%)
 Frame = +1

Query  460   FSREKNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVE  639
             F   K+I  +R ++P V  AI+    +LI++G RT +VP   P+GC+ +YLT + + N E
Sbjct  195   FFTHKSIQVVRELVPPVVDAISSAIVELIDMGGRTFLVPGDFPIGCSTAYLTVFQTGNTE  254

Query  640   DYDDL-GCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGF  816
             +YD L GCL W+N+ A YHN+ LQ EL+ LR+ +P+ NI+Y D ++   + +  P+  GF
Sbjct  255   EYDPLTGCLTWLNEFAEYHNEQLQTELDRLRKLYPHVNIVYGDYYSVVSRFHAQPSKYGF  314

Query  817   SggalraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDG  996
                 L ACCG GG YNF    QCG  G   C DPS YV +DG H+TEA+Y  + + LLDG
Sbjct  315   GKMHLAACCGEGGPYNFTLGKQCG-SGVPCCSDPSEYVYFDGVHMTEASYGRIAEHLLDG  373

Query  997   SYTYPSMNALC  1029
                  +++  C
Sbjct  374   IRANSALDQCC  384


 Score =   128 bits (322),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 68/157 (43%), Positives = 96/157 (61%), Gaps = 7/157 (4%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            S++DTGN +SL+     +   +P  +  PYGETFFH PTGR SDGR+++D IA+  GL +
Sbjct  50   SIADTGNLLSLS-----EPSHVPQVAFPPYGETFFHRPTGRFSDGRLVIDFIADSMGLPL  104

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQDMI  362
              P   S+   G  +  +GVNFAV G+ AL     +   I+   TNVS+  QL  F++++
Sbjct  105  VRPYFGSR--NGNGSFERGVNFAVGGATALDNSVLEGRGIHFDHTNVSLGVQLTVFKEIL  162

Query  363  PSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
            PSLC   SDC   L NSL ++GE GGNDY ++  + K
Sbjct  163  PSLCRPSSDCSEFLNNSLILMGEIGGNDYNYAFFTHK  199



>ref|XP_010422035.1| PREDICTED: GDSL esterase/lipase At1g31550-like isoform X2 [Camelina 
sativa]
Length=382

 Score =   157 bits (396),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 85/192 (44%), Positives = 116/192 (60%), Gaps = 0/192 (0%)
 Frame = +1

Query  460   FSREKNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVE  639
             F   + I +++ ++P+V   I+    +LI +G +T +VP   P+GC+ +YLT Y + N+E
Sbjct  173   FFERRLINEVKELVPLVISTISSAITELISMGGKTFLVPGEFPIGCSVAYLTLYQTSNIE  232

Query  640   DYDDLGCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGFS  819
             +YD  GCL W+N+   YH++ LQ EL  LR+ +P+ NIIY D +NA +++   P   GF 
Sbjct  233   EYDPFGCLKWLNKFGEYHDEQLQAELKRLRKLNPHVNIIYADYYNALLRLNQEPTKYGFI  292

Query  820   ggalraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDGS  999
                L ACCG G  YNFN    CG  G  SC DPS YV WDG H+TEAAYK +   LL G 
Sbjct  293   NKPLSACCGVGEPYNFNFSTCCGSFGVDSCNDPSMYVAWDGIHMTEAAYKFIADGLLKGP  352

Query  1000  YTYPSMNALCPT  1035
             YT P  N  C T
Sbjct  353   YTSPPFNWTCLT  364


 Score =   105 bits (262),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 63/149 (42%), Positives = 82/149 (55%), Gaps = 24/149 (16%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            S++DTGN + L+    L  +G P     PYGETFFHHPTGR SDGR+I+D IAE  GL  
Sbjct  45   SIADTGNLLGLSDRNNLSLNGFP-----PYGETFFHHPTGRSSDGRLIIDFIAEFLGLPY  99

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQDMI  362
              P   SK      N ++GVNFAV  + AL A F ++   Y    N+S+  Q+  F++ +
Sbjct  100  VTPYFGSK----NGNFQKGVNFAVGSATALEASFLEE-RGYHCSHNISLGVQVKVFKESL  154

Query  363  PSLCNSPSDCKNLLENSLFVLGEFGGNDY  449
            P+LC  PS              E GGNDY
Sbjct  155  PNLCGLPS--------------EIGGNDY  169



>ref|XP_008777731.1| PREDICTED: GDSL esterase/lipase At1g31550-like [Phoenix dactylifera]
Length=396

 Score =   141 bits (356),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 86/191 (45%), Positives = 115/191 (60%), Gaps = 2/191 (1%)
 Frame = +1

Query  460   FSREKNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVE  639
             F++ K I +IR  +P V +  +   + LIELGA+T++VP + PLGC ++YLT + S   E
Sbjct  193   FAQLKAIDEIRTYVPSVVNITSWAINSLIELGAKTLVVPGIFPLGCVSAYLTVHQSGRRE  252

Query  640   DYD-DLGCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGF  816
             DYD   GC+ W+N+ + YHN LLQ EL+ LR  HP   IIY + ++AAM IY  P   GF
Sbjct  253   DYDPQTGCIKWLNEFSEYHNSLLQTELDRLRRLHPRITIIYANYYDAAMDIYRHPLKYGF  312

Query  817   SggalraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDG  996
                    C GGG  YNFN    CG    T C DPS +V WDG HLT+AAY+++ + LL G
Sbjct  313   DAPLAACCGGGG-PYNFNLTAMCGAREDTVCSDPSKHVCWDGMHLTDAAYEIIARGLLQG  371

Query  997   SYTYPSMNALC  1029
             SY    +   C
Sbjct  372   SYASAPITQAC  382


 Score =   120 bits (301),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 65/151 (43%), Positives = 91/151 (60%), Gaps = 9/151 (6%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            S++DTGNY+    +      G P     PYG+T+F  PTGR SDGRVI+D IA+  GL +
Sbjct  50   SIADTGNYLVDFGEKAGPV-GHP-----PYGKTYFRRPTGRFSDGRVIIDFIAQAMGLPL  103

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQDMI  362
             PP L    +T   ++R GVNFAV G  AL  +F++   +  T    S+  Q+  F+ ++
Sbjct  104  VPPYL---VRTSKQDLRYGVNFAVAGVTALDGKFFRDKGMALTWPQYSLATQIQWFKKLL  160

Query  363  PSLCNSPSDCKNLLENSLFVLGEFGGNDYTH  455
            PSLC+S SDC++    SL ++GE GGNDY H
Sbjct  161  PSLCSSKSDCESFFSKSLVLMGEIGGNDYNH  191



>ref|XP_007020872.1| SGNH hydrolase-type esterase superfamily protein, putative [Theobroma 
cacao]
 gb|EOY12397.1| SGNH hydrolase-type esterase superfamily protein, putative [Theobroma 
cacao]
Length=344

 Score =   146 bits (369),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 94/196 (48%), Positives = 126/196 (64%), Gaps = 4/196 (2%)
 Frame = +1

Query  460   FSREKNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVE  639
             F   K+  + R ++P+V   IA   H+LIELGA T +VP  LP GC  S LT +   + E
Sbjct  139   FEEGKSNEETRELVPLVIDTIASAIHELIELGAVTFLVPGNLPFGCFPSCLTNFEGSDEE  198

Query  640   DYDDL-GCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGF  816
             +YD L GCL W+NQ + YHNQLLQEEL  ++E HP+ NI+Y D ++AA++ Y  P   GF
Sbjct  199   EYDPLTGCLTWLNQFSEYHNQLLQEELARIQEIHPHVNIVYADYYSAAIRFYLSPKQFGF  258

Query  817   Sggalrac-cggggQYNFNPDLQCGDEGATS-CPDPSTYVNWDGYHLTEAAYKLMTKSLL  990
                 L    CGGGG YNFN    CG    TS C DPS+YV+WDG H TEAA +L+++++L
Sbjct  259   RKETLTKACCGGGGPYNFNLSAICGYPLVTSCCDDPSSYVSWDGIHYTEAANRLLSRAIL  318

Query  991   DGSYT-YPSMNALCPT  1035
             DG +T +P  N+LC +
Sbjct  319   DGLHTNFPISNSLCQS  334


 Score =   115 bits (289),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 65/142 (46%), Positives = 89/142 (63%), Gaps = 1/142 (1%)
 Frame = +3

Query  48   VLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAIPPPSLSSKAQTGGNN  227
            V Q+  +P  +  PYG TFFH PTGR SDGR+++D IAE + L   PP    +     NN
Sbjct  3    VSQHSELPQSAFPPYGRTFFHQPTGRFSDGRLVIDFIAEDFRLPFLPPYFGGE-NGRSNN  61

Query  228  IRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQDMIPSLCNSPSDCKNLLE  407
             ++GVN AV G+ AL  E  ++  I +  TNV++  +L  F+D++ SLC+S SDC+ LL 
Sbjct  62   FQKGVNLAVAGATALDDEILKERGITNPATNVTLGVELGFFRDVLSSLCSSSSDCRKLLS  121

Query  408  NSLFVLGEFGGNDYTHSLLSGK  473
            NSL V+GE GGNDY  +   GK
Sbjct  122  NSLIVMGEIGGNDYNFAFEEGK  143



>ref|NP_174440.2| GDSL esterase/lipase [Arabidopsis thaliana]
 gb|AAT99799.1| At1g31550 [Arabidopsis thaliana]
 gb|AAU45217.1| At1g31550 [Arabidopsis thaliana]
 gb|AEE31371.1| GDSL esterase/lipase [Arabidopsis thaliana]
Length=391

 Score =   137 bits (344),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 82/191 (43%), Positives = 119/191 (62%), Gaps = 4/191 (2%)
 Frame = +1

Query  460   FSREKNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVE  639
             F + + + +++ ++P+V   I+    +LI +G RT +VP   PLGC+ ++LT + + N+E
Sbjct  185   FFQLRPLDEVKELVPLVISTISSAITELIGMGGRTFLVPGGFPLGCSVAFLTLHQTSNME  244

Query  640   DYDDL-GCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGF  816
             +YD L GCL W+N+   YH++ LQEELN LR+ +P+ NIIY D +NA++++   P    F
Sbjct  245   EYDPLTGCLKWLNKFGEYHSEQLQEELNRLRKLNPHVNIIYADYYNASLRLGREPR---F  301

Query  817   SggalraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDG  996
                 L ACCG GG YNFN    CG  G  +C DPS YV WDG H+TEAA+K M   L+ G
Sbjct  302   INRHLSACCGVGGPYNFNLSRSCGSVGVEACSDPSKYVAWDGLHMTEAAHKSMADGLVKG  361

Query  997   SYTYPSMNALC  1029
              Y  P  +  C
Sbjct  362   PYAIPPFDWSC  372


 Score =   124 bits (312),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 67/149 (45%), Positives = 94/149 (63%), Gaps = 10/149 (7%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            S++DTGN + L+      ++ +P  +  PYGETFFHHPTGR SDGR+I+D IAE  GL  
Sbjct  43   SIADTGNLLGLS-----DHNNLPMSAFPPYGETFFHHPTGRFSDGRLIIDFIAEFLGLPY  97

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQDMI  362
             PP   S   T G N  +GVNFAV  + AL + F ++ + Y    N S+  QL  F+  +
Sbjct  98   VPPYFGS---TNG-NFEKGVNFAVASATALESSFLEE-KGYHCPHNFSLGVQLKIFKQSL  152

Query  363  PSLCNSPSDCKNLLENSLFVLGEFGGNDY  449
            P+LC  PSDC++++ N+L ++GE G NDY
Sbjct  153  PNLCGLPSDCRDMIGNALILMGEIGANDY  181



>ref|XP_007025434.1| GDSL-like Lipase/Acylhydrolase superfamily protein [Theobroma 
cacao]
 gb|EOY28056.1| GDSL-like Lipase/Acylhydrolase superfamily protein [Theobroma 
cacao]
Length=369

 Score =   134 bits (338),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 85/180 (47%), Positives = 113/180 (63%), Gaps = 0/180 (0%)
 Frame = +1

Query  478   ITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVEDYDDLG  657
             I  ++  +P+V   I      LIE GA  +MVP  LP+GC+A YLT + SPN  DYD  G
Sbjct  185   IKQLQATVPLVVGVITNATSALIEEGAVELMVPGNLPIGCSAVYLTLFQSPNKADYDRHG  244

Query  658   CLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGFSggalra  837
             CL   N  A YHN  L++ L +LR+++P+  IIY D + AAM+    P + GF GG LRA
Sbjct  245   CLKEFNAFARYHNDQLKQALTMLRQKYPHVRIIYADYYGAAMRFVHTPLHHGFYGGILRA  304

Query  838   ccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDGSYTYPSM  1017
             CCGGGG YNFN   +CG  G+  C +PS Y  WDG HLTEAAY+ +  +L++GS + P +
Sbjct  305   CCGGGGPYNFNNSARCGHTGSEVCQNPSLYSQWDGIHLTEAAYRYIALALINGSSSTPPL  364


 Score =   127 bits (318),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 72/157 (46%), Positives = 94/157 (60%), Gaps = 10/157 (6%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            SLSDTGN++     G L +   P    LPYGETFF H TGRCSDGR+I+D IAE + L  
Sbjct  35   SLSDTGNFLL---SGALAF---PVIGRLPYGETFFQHATGRCSDGRLIIDFIAEAFSLPY  88

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTV-TNVSMNDQLHAFQDM  359
             PP L   A T G +   GVNFA  G+ AL AEF+ +  I   + TN S+N QL  F+ +
Sbjct  89   LPPYL---AVTEGQSSEHGVNFAFAGATALDAEFFYERNIGSILWTNNSLNVQLGWFRKL  145

Query  360  IPSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSG  470
              +LC++   C +    SLF++GE GGNDY ++   G
Sbjct  146  KSTLCSNKQACDDFFGKSLFLVGEIGGNDYNYAFFLG  182



>ref|XP_010041184.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Eucalyptus grandis]
Length=367

 Score =   133 bits (335),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 100/157 (64%), Gaps = 10/157 (6%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            SLSDTGN++     G L + GI +   LPYGETFFHHPTGRCS+GR+++D IAE +GL  
Sbjct  36   SLSDTGNFLL---SGALAFPGIKN---LPYGETFFHHPTGRCSNGRLMIDFIAEVFGLPF  89

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTV-TNVSMNDQLHAFQDM  359
             PP L   A   G  +R GVNFAVVG+ AL   F+   +I   + TN S++ QL  F+++
Sbjct  90   LPPYL---AVAKGPPVRTGVNFAVVGATALDPSFFYAQKIGPLLWTNDSLSVQLGWFKNL  146

Query  360  IPSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSG  470
              SLC +  +C +  + SLF++GE GGNDY    + G
Sbjct  147  KKSLCTTKQECDDYFKKSLFLVGEMGGNDYIFPFIFG  183


 Score =   128 bits (321),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 84/181 (46%), Positives = 114/181 (63%), Gaps = 0/181 (0%)
 Frame = +1

Query  475   NITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVEDYDDL  654
             ++  +R  +P V  AIA     LIE GA  ++VP   P+GC+A +LT   SPN   YD  
Sbjct  185   SVKQLRAWVPQVVGAIARAIRILIEEGAVDMVVPGQFPVGCSAVFLTLLHSPNKSAYDPS  244

Query  655   GCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGFSggalr  834
             GCL   N    YH+  L++EL  LRE + +A I+Y D + A++ +Y  P + GF GGALR
Sbjct  245   GCLKAYNAFFEYHDNYLKQELQKLREEYSHARIMYADYYGASIPLYRTPKHYGFYGGALR  304

Query  835   accggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDGSYTYPS  1014
             ACCGGGG YN+N    CG+ G+T+C DPS +V+WDG HLTEAAY  ++K L  G +T P 
Sbjct  305   ACCGGGGPYNYNNSASCGNPGSTACEDPSAFVDWDGIHLTEAAYHFVSKRLFYGGFTSPP  364

Query  1015  M  1017
             +
Sbjct  365   L  365



>ref|XP_010499708.1| PREDICTED: GDSL esterase/lipase At1g31550-like isoform X2 [Camelina 
sativa]
Length=379

 Score =   134 bits (336),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 80/166 (48%), Positives = 103/166 (62%), Gaps = 1/166 (1%)
 Frame = +1

Query  535   HKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVEDYDDL-GCLIWVNQMASYHnqllqe  711
              +LI +G RT +VP   P+GC+ +YLT Y + N+E+YD L GCL W N+   YH++ LQ 
Sbjct  195   EELIGMGGRTFLVPGGFPIGCSVAYLTLYQTSNMEEYDPLTGCLKWPNKFGEYHSEQLQV  254

Query  712   elnllrerHPYANIIYTDIFNAAMQIYDGPANLGFSggalraccggggQYNFNPDLQCGD  891
             EL  LR+ +P+ NIIY D +NA++ +   PA   F  G L ACCG G  YNF+    CG 
Sbjct  255   ELKRLRKLNPHVNIIYADYYNASLSLGQEPAKYRFINGTLSACCGVGKPYNFSFSQSCGS  314

Query  892   EGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDGSYTYPSMNALC  1029
              G  SC +PS YV WDG H+TEAA+KLM   LL G Y  P  N  C
Sbjct  315   VGVESCNNPSKYVAWDGIHMTEAAHKLMADGLLKGPYATPPFNWSC  360


 Score =   127 bits (320),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 66/157 (42%), Positives = 92/157 (59%), Gaps = 10/157 (6%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            S++DTGN + L+    L     P     PYGETFFHHPTGR SDG +I+D IAE  GL  
Sbjct  45   SIADTGNLLGLSDRNNLPMSAFP-----PYGETFFHHPTGRFSDGHLIIDFIAEFLGLPY  99

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQDMI  362
             PP   SK +    N  +GVNFAV  + AL + F ++   Y    N+S+  QL  F++ +
Sbjct  100  VPPYFGSKNE----NFEKGVNFAVASATALESSFLEE-RGYHCPHNISLGVQLKIFKESL  154

Query  363  PSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
            P+LC  PSDC++++ N+L ++GE G NDY       +
Sbjct  155  PNLCGLPSDCRDMIRNALILMGEIGANDYNFPFFESR  191



>gb|KCW44566.1| hypothetical protein EUGRSUZ_L01923 [Eucalyptus grandis]
Length=364

 Score =   133 bits (334),  Expect(2) = 3e-60, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 100/157 (64%), Gaps = 10/157 (6%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            SLSDTGN++     G L + GI +   LPYGETFFHHPTGRCS+GR+++D IAE +GL  
Sbjct  33   SLSDTGNFLL---SGALAFPGIKN---LPYGETFFHHPTGRCSNGRLMIDFIAEVFGLPF  86

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTV-TNVSMNDQLHAFQDM  359
             PP L   A   G  +R GVNFAVVG+ AL   F+   +I   + TN S++ QL  F+++
Sbjct  87   LPPYL---AVAKGPPVRTGVNFAVVGATALDPSFFYAQKIGPLLWTNDSLSVQLGWFKNL  143

Query  360  IPSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSG  470
              SLC +  +C +  + SLF++GE GGNDY    + G
Sbjct  144  KKSLCTTKQECDDYFKKSLFLVGEMGGNDYIFPFIFG  180


 Score =   128 bits (321),  Expect(2) = 3e-60, Method: Compositional matrix adjust.
 Identities = 84/181 (46%), Positives = 114/181 (63%), Gaps = 0/181 (0%)
 Frame = +1

Query  475   NITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVEDYDDL  654
             ++  +R  +P V  AIA     LIE GA  ++VP   P+GC+A +LT   SPN   YD  
Sbjct  182   SVKQLRAWVPQVVGAIARAIRILIEEGAVDMVVPGQFPVGCSAVFLTLLHSPNKSAYDPS  241

Query  655   GCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGFSggalr  834
             GCL   N    YH+  L++EL  LRE + +A I+Y D + A++ +Y  P + GF GGALR
Sbjct  242   GCLKAYNAFFEYHDNYLKQELQKLREEYSHARIMYADYYGASIPLYRTPKHYGFYGGALR  301

Query  835   accggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDGSYTYPS  1014
             ACCGGGG YN+N    CG+ G+T+C DPS +V+WDG HLTEAAY  ++K L  G +T P 
Sbjct  302   ACCGGGGPYNYNNSASCGNPGSTACEDPSAFVDWDGIHLTEAAYHFVSKRLFYGGFTSPP  361

Query  1015  M  1017
             +
Sbjct  362   L  362



>ref|XP_006362447.1| PREDICTED: GDSL esterase/lipase At1g28600-like [Solanum tuberosum]
Length=400

 Score =   130 bits (326),  Expect(2) = 7e-60, Method: Compositional matrix adjust.
 Identities = 72/156 (46%), Positives = 98/156 (63%), Gaps = 8/156 (5%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPS-CSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLA  179
            SL+DTGN + +T + +      PS  S+ PYGETFFHHPTGR SDGR+++D IAE +GL 
Sbjct  38   SLADTGNKLHITLNKI-----PPSHFSLPPYGETFFHHPTGRFSDGRLVIDFIAESFGLP  92

Query  180  IPPPSLSSKAQTGG-NNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQD  356
            + P  L  K +       RQGVNFAV G+ AL + +     +  +  NVS+  QL  F+D
Sbjct  93   LVPAYLEGKDERNYIVKFRQGVNFAVGGATALDSAYLLDKGV-TSSNNVSLGTQLDWFKD  151

Query  357  MIPSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLL  464
            M+ S C  PS+CK  L+NSL ++GE GGND+ +  L
Sbjct  152  MMSSFCKFPSECKEFLQNSLILMGEIGGNDFNYGFL  187


 Score =   129 bits (325),  Expect(2) = 7e-60, Method: Compositional matrix adjust.
 Identities = 86/184 (47%), Positives = 116/184 (63%), Gaps = 2/184 (1%)
 Frame = +1

Query  484   DIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVEDYD-DLGC  660
             ++   +P V   ++    +LIELGA T++VP  LP+GC+ +YLT Y   +   YD   GC
Sbjct  194   EVESYVPAVIKTLSSAIQELIELGASTLLVPGDLPIGCSTAYLTKYMHSDKGQYDPKTGC  253

Query  661   LIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGFSggalrac  840
             L W+N  +  +N+LLQ+EL+LLR+ +P A IIY D +NAAMQ Y  P + GF  GAL AC
Sbjct  254   LNWLNNFSQQYNELLQKELHLLRDLYPAATIIYADYYNAAMQFYASPKSHGFRKGALVAC  313

Query  841   cggggQYNFNPDLQCGDEGATS-CPDPSTYVNWDGYHLTEAAYKLMTKSLLDGSYTYPSM  1017
             CG GG YNF     CGD  A + C D S Y +WDG H TEAAYK +   LL G++T+P +
Sbjct  314   CGAGGPYNFMFSTICGDPAARNICSDTSVYASWDGMHFTEAAYKWIATGLLKGTFTFPPL  373

Query  1018  NALC  1029
               +C
Sbjct  374   PKIC  377



>ref|XP_008785278.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Phoenix dactylifera]
Length=377

 Score =   132 bits (331),  Expect(2) = 8e-60, Method: Compositional matrix adjust.
 Identities = 70/158 (44%), Positives = 95/158 (60%), Gaps = 12/158 (8%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            SL+DTGN++    + +L      S +  PYG TFF  PTGRCSDGR+++D I E +GL +
Sbjct  33   SLADTGNHLVDGPNPIL------STTHPPYGMTFFRRPTGRCSDGRLVIDFITEAFGLPL  86

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTV-TNVSMNDQLHAFQDM  359
             PPS     +    +  QG NFA+ G  A+   ++ K  +  TV  N S+NDQ+  FQDM
Sbjct  87   LPPS-----KAHNTDFHQGANFAITGGTAMSFGYFHKKGLESTVWVNGSLNDQIDWFQDM  141

Query  360  IPSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
             PSLC+S ++CK      LFV+GEFGGNDY     +GK
Sbjct  142  KPSLCSSAAECKEYFSRCLFVVGEFGGNDYNAFFFAGK  179


 Score =   127 bits (319),  Expect(2) = 8e-60, Method: Compositional matrix adjust.
 Identities = 80/190 (42%), Positives = 111/190 (58%), Gaps = 1/190 (1%)
 Frame = +1

Query  460   FSREKNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVE  639
             F   K +  +   +PI+   IAEG  +LI  GA  ++VP V P+GC   YL  Y S + E
Sbjct  175   FFAGKGLKQVISNVPIIVRGIAEGVERLINHGAVDLVVPGVFPIGCFPLYLKLYGSRHEE  234

Query  640   DYDDL-GCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGF  816
             DY    GC+   N +A YHN+ L+ EL  L++++P   I+Y D + AA++    P N GF
Sbjct  235   DYGRRSGCMKKYNTLAWYHNEKLRRELEKLQKKYPSTRIVYADFYAAAIRFNLAPKNFGF  294

Query  817   SggalraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDG  996
             + GAL+ACCG   +YN N   +CG   AT C DP TY +WDG H TEAA+  + K LL+G
Sbjct  295   THGALKACCGDRSKYNVNMANRCGTSNATVCHDPETYASWDGVHYTEAAHHFIAKGLLEG  354

Query  997   SYTYPSMNAL  1026
              Y  P + +L
Sbjct  355   PYADPPLMSL  364



>ref|XP_008439761.1| PREDICTED: GDSL esterase/lipase At1g28570-like [Cucumis melo]
Length=384

 Score =   149 bits (376),  Expect(2) = 9e-60, Method: Compositional matrix adjust.
 Identities = 88/204 (43%), Positives = 120/204 (59%), Gaps = 7/204 (3%)
 Frame = +1

Query  460   FSREKNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVE  639
             F   +NI ++  ++ +V + IA    +LIELG  T+MVPS LP+GC   YL +Y + + E
Sbjct  182   FFDGRNIEELESLVLLVVNKIASVILELIELGVETLMVPSNLPIGCLPVYLEFYKTTSNE  241

Query  640   DYDDL--GCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLG  813
                D   GCL W+NQ + YHNQ LQE+L  +R  HP+ ++IY D FNAAM+IY+ P + G
Sbjct  242   SQFDPQNGCLKWLNQFSEYHNQQLQEQLKRIRVLHPHVHLIYVDYFNAAMRIYNAPKDFG  301

Query  814   FSggalraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLD  993
                     C    G Y F P   CG  G   C DPS Y +WDG HLTEAAY+LM  S+++
Sbjct  302   LVEPLQVCCVDKNGSYYFPPP--CGGAGTIVCDDPSKYASWDGLHLTEAAYELMATSIIN  359

Query  994   GSYTYPSMNALC---PTDAQVAQL  1056
             G +T+P  +  C    T  Q+ QL
Sbjct  360   GEFTFPQFSISCLQRNTSTQLLQL  383


 Score =   110 bits (274),  Expect(2) = 9e-60, Method: Compositional matrix adjust.
 Identities = 62/159 (39%), Positives = 91/159 (57%), Gaps = 7/159 (4%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            SLSDTGN     S     +   P+    PYGETFFH PTGR SDGR++LD +A   GL  
Sbjct  33   SLSDTGNLYYTCS-----FPNPPNVCFFPYGETFFHRPTGRFSDGRLVLDFLAMSLGLPP  87

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNV-SMNDQLHAFQDM  359
              P    +      + ++G+NFAV G+ AL   F+++  I +    V S+ +Q ++F   
Sbjct  88   VQPYQGVEKGITAEDFQKGLNFAVGGATALDLSFFEQRGIPNLPPTVDSLGNQFNSFNQS  147

Query  360  IPSLC-NSPSDCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
              S+C +SP  CK++ ++SLF++GE GGNDY +    G+
Sbjct  148  YSSICTSSPPKCKDIFKSSLFIMGEIGGNDYNYLFFDGR  186



>ref|XP_011096421.1| PREDICTED: GDSL esterase/lipase At5g45910 [Sesamum indicum]
Length=391

 Score =   129 bits (325),  Expect(2) = 1e-59, Method: Compositional matrix adjust.
 Identities = 71/157 (45%), Positives = 95/157 (61%), Gaps = 10/157 (6%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            SL+DTGN++     G L++   P    LPYGETFFHH TGRCSDGR+I+D IA  YGL  
Sbjct  52   SLADTGNFLR---SGALKF---PVIGKLPYGETFFHHGTGRCSDGRLIVDFIAAAYGLPY  105

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTV-TNVSMNDQLHAFQDM  359
              P L   A   G  +  GVNFAV G+ AL A+F+   +I   + TN S++ QL  F ++
Sbjct  106  LRPYL---ALAKGEKVEHGVNFAVAGATALDAKFFYDRKIGQILWTNDSLSVQLGWFNNL  162

Query  360  IPSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSG  470
              +LC++  DC    + SLF++GE GGNDY +    G
Sbjct  163  KSTLCSTKQDCAKYFKRSLFLVGEIGGNDYNYPFFVG  199


 Score =   129 bits (325),  Expect(2) = 1e-59, Method: Compositional matrix adjust.
 Identities = 76/182 (42%), Positives = 113/182 (62%), Gaps = 0/182 (0%)
 Frame = +1

Query  475   NITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVEDYDDL  654
             ++T ++ ++P V   IA     LIE GA  ++V   LP+GC A YLT + + +   YD  
Sbjct  201   SVTQLKAMVPAVVETIAAATSMLIEEGAVELVVAGNLPIGCNAVYLTLFQTSDRTAYDKN  260

Query  655   GCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGFSggalr  834
             GCL   N  + YHN  L+  L  L++++P+A I Y D + A+ + +  P + GF  G+L 
Sbjct  261   GCLKAHNAFSKYHNAQLKLALQNLQQKYPHARISYADYYGASKRFFHVPKHFGFKDGSLV  320

Query  835   accggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDGSYTYPS  1014
             ACCGGGG YNFN   +CG  G+ +C DP  +VNWDG HLTEAAY+ ++  L++GS+ YP 
Sbjct  321   ACCGGGGPYNFNNSARCGHTGSKACLDPKAHVNWDGIHLTEAAYRYISMGLVNGSFMYPP  380

Query  1015  MN  1020
             ++
Sbjct  381   LS  382



>gb|AAG60153.1|AC074360_18 lipase, putative [Arabidopsis thaliana]
Length=391

 Score =   144 bits (363),  Expect(2) = 1e-59, Method: Compositional matrix adjust.
 Identities = 83/191 (43%), Positives = 121/191 (63%), Gaps = 1/191 (1%)
 Frame = +1

Query  460   FSREKNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVE  639
             F + + + +++ ++P+V   I+    +LI +G RT +VP   PLGC+ ++LT + + N+E
Sbjct  182   FFQLRPLDEVKELVPLVISTISSAITELIGMGGRTFLVPGGFPLGCSVAFLTLHQTSNME  241

Query  640   DYDDL-GCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGF  816
             +YD L GCL W+N+   YH++ LQEELN LR+ +P+ NIIY D +NA++++   P+  GF
Sbjct  242   EYDPLTGCLKWLNKFGEYHSEQLQEELNRLRKLNPHVNIIYADYYNASLRLGREPSKYGF  301

Query  817   SggalraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDG  996
                 L ACCG GG YNFN    CG  G  +C DPS YV WDG H+TEAA+K M   L+ G
Sbjct  302   INRHLSACCGVGGPYNFNLSRSCGSVGVEACSDPSKYVAWDGLHMTEAAHKSMADGLVKG  361

Query  997   SYTYPSMNALC  1029
              Y  P  +  C
Sbjct  362   PYAIPPFDWSC  372


 Score =   114 bits (286),  Expect(2) = 1e-59, Method: Compositional matrix adjust.
 Identities = 66/149 (44%), Positives = 91/149 (61%), Gaps = 13/149 (9%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            S++DTGN + L+      ++ +P  +  PYGETFFHHPTGR SDGR+I+D IAE  GL  
Sbjct  43   SIADTGNLLGLS-----DHNNLPMSAFPPYGETFFHHPTGRFSDGRLIIDFIAEFLGLPY  97

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQDMI  362
             PP   S   T G N  +GVNFAV  + AL + F ++ + Y    N S+  QL  F+  +
Sbjct  98   VPPYFGS---TNG-NFEKGVNFAVASATALESSFLEE-KGYHCPHNFSLGVQLKIFKQSL  152

Query  363  PSLCNSPSDCKNLLENSLFVLGEFGGNDY  449
            P+LC  PSD   ++ N+L ++GE G NDY
Sbjct  153  PNLCGLPSD---MIGNALILMGEIGANDY  178



>ref|XP_003593744.1| GDSL esterase/lipase [Medicago truncatula]
 gb|AES63995.1| GDSL-like lipase/acylhydrolase [Medicago truncatula]
Length=360

 Score =   147 bits (372),  Expect(2) = 1e-59, Method: Compositional matrix adjust.
 Identities = 84/181 (46%), Positives = 119/181 (66%), Gaps = 0/181 (0%)
 Frame = +1

Query  475   NITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVEDYDDL  654
             +IT +R  +P+V   IA+   +LI  GA  ++VP  LP+GC+  YLT + S N++DYD+ 
Sbjct  172   DITHLRDTVPLVVQTIAKVIDELIAEGAVELLVPGNLPVGCSVVYLTSFSSKNIKDYDEN  231

Query  655   GCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGFSggalr  834
             GCL   N +A  HN  L   L  LR+++P+A I+Y D F AA + +  P + GF+ GAL 
Sbjct  232   GCLKSFNDLAKNHNMQLNIALQTLRKKNPHARIMYADYFGAAKRFFHSPRHYGFTNGALN  291

Query  835   accggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDGSYTYPS  1014
             ACCGGG +YNFN   +CG +G+  C DPSTY NWDG HLTEAAY+ + K L++G ++ P 
Sbjct  292   ACCGGGRRYNFNDSARCGYKGSKVCEDPSTYTNWDGIHLTEAAYRHIAKGLINGPFSIPP  351

Query  1015  M  1017
             +
Sbjct  352   L  352


 Score =   111 bits (277),  Expect(2) = 1e-59, Method: Compositional matrix adjust.
 Identities = 65/156 (42%), Positives = 85/156 (54%), Gaps = 22/156 (14%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            SLSDTGN+++ T   +    G P     PYGETFF H TGRCSDGR+++D IA  Y L  
Sbjct  38   SLSDTGNFLA-TGANLFTVIGQP-----PYGETFFRHATGRCSDGRLVIDFIAVAYELPY  91

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQDMI  362
              P L  K       IR+GVNFAV G+ AL  EF+              N+ +     + 
Sbjct  92   LQPYL--KVIKSHQIIRKGVNFAVAGATALDVEFF--------------NEGVRKLLWLK  135

Query  363  PSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSG  470
            PSLC +  DC +  +  LFV+GE GGNDY ++  +G
Sbjct  136  PSLCTTKQDCDSYFKRPLFVVGEIGGNDYNYAAFAG  171



>ref|XP_004233850.1| PREDICTED: GDSL esterase/lipase At1g28580-like isoform X1 [Solanum 
lycopersicum]
Length=385

 Score =   129 bits (325),  Expect(2) = 1e-59, Method: Compositional matrix adjust.
 Identities = 85/184 (46%), Positives = 116/184 (63%), Gaps = 2/184 (1%)
 Frame = +1

Query  484   DIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVEDYD-DLGC  660
             ++   +P V   I+    +LIELGA T++VP  LP+GC+ +YLT +   +   YD   GC
Sbjct  193   EVESYVPAVVKTISSAIQELIELGASTLLVPGDLPIGCSTAYLTKFMHSDKGQYDPKTGC  252

Query  661   LIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGFSggalrac  840
             + W+N+ +  +N+LLQ+EL+LLR+ +P A IIY D +NAAMQ Y  P + GF  GAL AC
Sbjct  253   INWLNKFSQQYNELLQKELHLLRDLNPAATIIYADYYNAAMQFYASPKSHGFRKGALVAC  312

Query  841   cggggQYNFNPDLQCGDEGATS-CPDPSTYVNWDGYHLTEAAYKLMTKSLLDGSYTYPSM  1017
             CG GG YNF     CGD  A   C D S Y +WDG H TEAAYK +   LL G++T+P +
Sbjct  313   CGAGGPYNFKFSALCGDPSARDICSDTSVYASWDGMHFTEAAYKWIATGLLQGTFTFPPV  372

Query  1018  NALC  1029
               +C
Sbjct  373   PKIC  376


 Score =   129 bits (324),  Expect(2) = 1e-59, Method: Compositional matrix adjust.
 Identities = 71/156 (46%), Positives = 94/156 (60%), Gaps = 9/156 (6%)
 Frame = +3

Query  3    SLSDTGN--YISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGL  176
            SL+DTGN  +ISL       +      S+ PYGETFFHHPTGR SDGR+++D IAE  GL
Sbjct  38   SLADTGNKLHISLNKTPPSHF------SLPPYGETFFHHPTGRFSDGRLVIDFIAESLGL  91

Query  177  AIPPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQD  356
             + P  L  K +      RQGVNFAV G+ AL + +     I     NVS+  Q+  F+D
Sbjct  92   PLVPAYLEGKDERNNVKFRQGVNFAVGGATALDSAYLLDKGIIPN-NNVSLGTQMDWFKD  150

Query  357  MIPSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLL  464
            M+ S C  PS+C+  L+NSL ++GE GGND+ +  L
Sbjct  151  MMTSFCKFPSECEEFLQNSLILMGEIGGNDFNYGFL  186



>ref|XP_002439448.1| hypothetical protein SORBIDRAFT_09g006570 [Sorghum bicolor]
 gb|EES17878.1| hypothetical protein SORBIDRAFT_09g006570 [Sorghum bicolor]
Length=364

 Score =   130 bits (327),  Expect(2) = 2e-59, Method: Compositional matrix adjust.
 Identities = 69/161 (43%), Positives = 99/161 (61%), Gaps = 21/161 (13%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVL---PYGETFFHHPTGRCSDGRVILDIIAEHYG  173
            S+SDTGN         L   G P+   +   PYGETFFH PTGRCSDGRVI+D +AEH+G
Sbjct  37   SISDTGN---------LCVGGCPAWLTMGQPPYGETFFHRPTGRCSDGRVIVDFLAEHFG  87

Query  174  LAIPPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVS-MNDQLHAF  350
            L +P  S +S       N ++G N A++G+  +  +F+  + + D + N   ++ Q+  F
Sbjct  88   LPLPQASKAS------GNFKKGANMAIIGATTMNFDFFNSIGLRDKIWNNGPLDTQIQWF  141

Query  351  QDMIPSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
            + ++PS+C   +DCKN L  SLFV+GEFGGNDY  +L S +
Sbjct  142  RQLLPSVCG--NDCKNYLSKSLFVVGEFGGNDYNAALFSRR  180


 Score =   127 bits (320),  Expect(2) = 2e-59, Method: Compositional matrix adjust.
 Identities = 76/185 (41%), Positives = 108/185 (58%), Gaps = 2/185 (1%)
 Frame = +1

Query  460   FSREKNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVE  639
             FSR +++ ++R  +P V   +  G   +I  GA  V+VP VLP+GC  +YLT Y + N  
Sbjct  177   FSR-RSMAEVRGYVPRVITKLIHGLETIIRRGAVDVVVPGVLPIGCFPTYLTLYGTSNAA  235

Query  640   DYDDLGCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGFS  819
             DYD  GCL   N ++SYHN LL+  L+ LR  +P+A I+Y D +   + +   P N G  
Sbjct  236   DYDRDGCLRSYNDLSSYHNALLKRSLSSLRRTYPHARIMYADFYTQVIDMIRTPHNFGLK  295

Query  820   -ggalraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDG  996
              G  +    GG G+YN+N + +CG  GA +C DP  Y+ WDG HLTEAAY+ +    L G
Sbjct  296   YGLKVCCGAGGQGKYNYNNNARCGMSGARACADPGNYLIWDGIHLTEAAYRSIADGWLKG  355

Query  997   SYTYP  1011
             +Y  P
Sbjct  356   TYCNP  360



>ref|XP_010052214.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Eucalyptus grandis]
Length=366

 Score =   131 bits (330),  Expect(2) = 2e-59, Method: Compositional matrix adjust.
 Identities = 75/157 (48%), Positives = 93/157 (59%), Gaps = 10/157 (6%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            S SDTGN++     G L Y   P    LPYGETFFHH TGRCS+GR+I+D IAE +GL  
Sbjct  36   SYSDTGNFLI---TGALAY---PEIKNLPYGETFFHHATGRCSNGRLIIDFIAEAFGLPY  89

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQDMI  362
             PP L   A   G  +R GVNFAV G+ A+ A F+    I    TN S+N QL  FQ + 
Sbjct  90   LPPYL---AVAEGPPVRMGVNFAVAGATAIDASFFSAQNI-TLWTNDSLNVQLGWFQSLK  145

Query  363  PSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
             SLC +  +C    + SLF++GE G NDY  S L G+
Sbjct  146  SSLCTTKQECDEYFKKSLFLVGEIGENDYNFSFLFGR  182


 Score =   126 bits (317),  Expect(2) = 2e-59, Method: Compositional matrix adjust.
 Identities = 84/187 (45%), Positives = 113/187 (60%), Gaps = 1/187 (1%)
 Frame = +1

Query  460   FSREKNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVE  639
             F   + I  +RP++P +  AI      LIE GA  ++VP  LP GC + YLT + S N  
Sbjct  178   FLFGRTIEQLRPLVPQIVGAIIRAVSILIEEGAVNLVVPGQLPTGCISLYLTLFQSANES  237

Query  640   DYD-DLGCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGF  816
              YD   GCL   N +  YHN  L++EL  LRE++P+A ++Y D + A++ IY  P   GF
Sbjct  238   AYDPKTGCLKAYNALFKYHNNYLKQELQKLREQYPHARVMYADYYGASISIYRTPKFYGF  297

Query  817   SggalraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDG  996
              GGAL ACCGGGG YNFN    CG  G+T C DPS +V+WDG H TE+AY  + + L+DG
Sbjct  298   YGGALTACCGGGGPYNFNTSAYCGQPGSTVCKDPSAFVDWDGIHSTESAYHYIARGLIDG  357

Query  997   SYTYPSM  1017
              +  P +
Sbjct  358   GFISPPL  364



>ref|XP_010540489.1| PREDICTED: GDSL esterase/lipase At1g28580-like isoform X2 [Tarenaya 
hassleriana]
Length=366

 Score =   157 bits (398),  Expect(2) = 2e-59, Method: Compositional matrix adjust.
 Identities = 87/191 (46%), Positives = 125/191 (65%), Gaps = 2/191 (1%)
 Frame = +1

Query  460   FSREKNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVE  639
             F   KN+ +IR ++P+V + I+    +L+++G RT +VP   P+GC+A+YLT Y + N+E
Sbjct  159   FFAGKNVDEIREMVPLVINVISSAIRELVDMGGRTFLVPGNFPIGCSAAYLTMYQTENME  218

Query  640   DYDDL-GCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGF  816
              YD L GCL W+N+ A +HN+ LQ ELN LR+ +P+ NI+Y D +N  ++++  P   GF
Sbjct  219   KYDPLTGCLKWLNEFAEHHNERLQIELNRLRKLYPHVNIVYADYYNVVLRLFQDPIEFGF  278

Query  817   SggalraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDG  996
                 L  CCG GG YN++P   CGD G   C +PS YVNWDG+HLTE AY+ + K LL G
Sbjct  279   MNRPLSVCCGAGGPYNYSPSRLCGD-GVPYCDNPSKYVNWDGFHLTEHAYRWIAKGLLKG  337

Query  997   SYTYPSMNALC  1029
              Y  P+ N+ C
Sbjct  338   PYADPAFNSYC  348


 Score =   100 bits (248),  Expect(2) = 2e-59, Method: Compositional matrix adjust.
 Identities = 58/157 (37%), Positives = 81/157 (52%), Gaps = 36/157 (23%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            S++DTGN + L+    L +  +P     PYGETFFH PTGR SDGR+I+D          
Sbjct  43   SIADTGNLLILSDPNHLPHFALP-----PYGETFFHFPTGRHSDGRLIID----------  87

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQDMI  362
                                 F V G+ AL     +   +   +TNVS+  QL+ F++++
Sbjct  88   ---------------------FIVAGATALDISCLKGKGVPSDITNVSLGVQLNIFKEIL  126

Query  363  PSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
            PSLC+ PSDC   L  SL ++GE GGNDY +   +GK
Sbjct  127  PSLCSPPSDCSEFLSRSLILMGEIGGNDYNYPFFAGK  163



>ref|XP_004964803.1| PREDICTED: GDSL esterase/lipase At5g45910-like isoform X2 [Setaria 
italica]
Length=363

 Score =   129 bits (325),  Expect(2) = 3e-59, Method: Compositional matrix adjust.
 Identities = 69/160 (43%), Positives = 95/160 (59%), Gaps = 18/160 (11%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVL---PYGETFFHHPTGRCSDGRVILDIIAEHYG  173
            S+SDTGN         L  +G P+   L   PYGETFF   T RCSDGR+++D +AE YG
Sbjct  34   SMSDTGN---------LCVNGAPAGLTLTQPPYGETFFGRATCRCSDGRLVVDFLAEKYG  84

Query  174  LAIPPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVS-MNDQLHAF  350
            L +  PS     + GG + ++G N A++G+  + + F+Q L I D + N   +N Q+  F
Sbjct  85   LPLLKPS-----KQGGADFKKGANMAIIGATTMDSGFFQSLGIADKIWNNGPLNTQIQWF  139

Query  351  QDMIPSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSG  470
            Q ++PS+C S   CK+ L  SLFVLGEFGGNDY   +  G
Sbjct  140  QQLMPSICGSTQACKSYLSKSLFVLGEFGGNDYNAQIFGG  179


 Score =   127 bits (320),  Expect(2) = 3e-59, Method: Compositional matrix adjust.
 Identities = 71/172 (41%), Positives = 107/172 (62%), Gaps = 0/172 (0%)
 Frame = +1

Query  508   VAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVEDYDDLGCLIWVNQMAS  687
             +  AI +G  +LI LGA +++VP VLP+GC   YLT Y + N  DYD  GCL   N ++S
Sbjct  192   IVDAIGKGVDQLISLGATSIVVPGVLPVGCFPIYLTLYQTSNAGDYDQYGCLKRFNALSS  251

Query  688   YHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGFSggalraccggggQYNF  867
              HNQLLQ +++ L+ ++P A I+Y D ++    +   P + GFS      C  GGG+YN+
Sbjct  252   RHNQLLQAKVSSLQSKYPGARIMYADFYSHVYDMVRSPGSYGFSTNLRACCGAGGGKYNY  311

Query  868   NPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDGSYTYPSMNA  1023
                 +CG  GA++C +P + ++WDG HLTEAAYK +    + G+Y +P++ A
Sbjct  312   QNSARCGMSGASACSNPESSLSWDGIHLTEAAYKKIADGWVSGAYCHPAIGA  363



>ref|XP_006844513.1| hypothetical protein AMTR_s00016p00145970 [Amborella trichopoda]
 gb|ERN06188.1| hypothetical protein AMTR_s00016p00145970 [Amborella trichopoda]
Length=387

 Score =   134 bits (338),  Expect(2) = 3e-59, Method: Compositional matrix adjust.
 Identities = 71/189 (38%), Positives = 117/189 (62%), Gaps = 2/189 (1%)
 Frame = +1

Query  460   FSREKNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVE  639
             F + K+  +++  +P + + I + A + I  G  T+++P  LP+GC+ +YLT + + + +
Sbjct  179   FFQGKSTEEVKAFVPSIINTIMKAASEFINEGVETLVIPGNLPIGCSTAYLTMFQTQDKQ  238

Query  640   DYD-DLGCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGF  816
             +YD D GCL   N  A Y+N  LQ+ + ++R++ P+A  IY D +NAA++ +  P   G 
Sbjct  239   EYDPDTGCLKRFNDFAIYYNSKLQDAIQVMRQKFPHATTIYADYYNAALRFFKSPEAFGL  298

Query  817   Sggalraccgggg-QYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLD  993
             +   + + C G G +YNFN +  CG  G T+C DP++Y++WDG HLTE AYK +T SLL 
Sbjct  299   AKETVHSACCGVGDRYNFNFNRMCGTSGVTACSDPASYISWDGMHLTETAYKFITASLLS  358

Query  994   GSYTYPSMN  1020
             G +T P + 
Sbjct  359   GEFTDPPLR  367


 Score =   122 bits (307),  Expect(2) = 3e-59, Method: Compositional matrix adjust.
 Identities = 67/157 (43%), Positives = 95/157 (61%), Gaps = 8/157 (5%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            SL+DTGN + L+ +G     G      LPYGETFFH PTGR S+GR+++D  A+  G+ +
Sbjct  35   SLADTGNTL-LSLNG-----GSSPTGRLPYGETFFHRPTGRFSNGRLVVDFFAQALGVPL  88

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQDMI  362
             PP LS+    GG++  +GVNFAV G+ AL + ++         TN S+  QL  F  ++
Sbjct  89   LPPYLST--LDGGDDFSKGVNFAVGGATALDSSYFISKGFEQHWTNYSLGVQLEWFHQLL  146

Query  363  PSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
            PSLC   SDCK  ++ S+F++GE GGND   +   GK
Sbjct  147  PSLCKPYSDCKEFMKKSMFLVGEIGGNDCNFAFFQGK  183



>gb|KHG30334.1| hypothetical protein F383_10781 [Gossypium arboreum]
Length=370

 Score =   139 bits (349),  Expect(2) = 4e-59, Method: Compositional matrix adjust.
 Identities = 85/181 (47%), Positives = 117/181 (65%), Gaps = 0/181 (0%)
 Frame = +1

Query  475   NITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVEDYDDL  654
             +I  ++ ++P V  AIA     LIE GA  +MVP   P+GC+A YLT + SP  +DYD  
Sbjct  183   SIKQLQSMVPSVVGAIANATSALIEEGAVELMVPGNFPIGCSAVYLTLFESPKKDDYDRH  242

Query  655   GCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGFSggalr  834
             GCL   N  A YHN  L++ L+ LR+++P+  I Y D + AAM+    P + GF GG L+
Sbjct  243   GCLKAFNGFAKYHNNQLKQALDTLRQKYPHVRIFYADYYGAAMRYVHAPLHHGFYGGTLK  302

Query  835   accggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDGSYTYPS  1014
             ACCGGGG YNFN   +CG  G+ +C DPS Y NWDG HLTEAAY+ +  +L++GS ++P 
Sbjct  303   ACCGGGGPYNFNISARCGHPGSEACKDPSVYSNWDGIHLTEAAYRHIALALINGSSSHPP  362

Query  1015  M  1017
             +
Sbjct  363   L  363


 Score =   118 bits (296),  Expect(2) = 4e-59, Method: Compositional matrix adjust.
 Identities = 70/157 (45%), Positives = 91/157 (58%), Gaps = 10/157 (6%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            SLSDTGN   L   G L +   P    LPYGETFF H TGRCSDGR+I+D IAE + L  
Sbjct  34   SLSDTGN---LLLSGALVF---PVIGQLPYGETFFQHATGRCSDGRLIIDFIAEAFSLPY  87

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTV-TNVSMNDQLHAFQDM  359
              P L+ K    G +   GVNFA  G+ AL AEF+ +  +   + TN S+N QL  F+ +
Sbjct  88   LEPYLAVKQ---GQSSPHGVNFAFSGATALDAEFFFQRNMGSILWTNNSLNVQLGWFRKL  144

Query  360  IPSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSG  470
               LC+    C +  + SLF++GE GGNDY ++   G
Sbjct  145  KSDLCSDNESCDDFFKKSLFLVGEIGGNDYNYAFFLG  181



>gb|EYU28060.1| hypothetical protein MIMGU_mgv1a008085mg [Erythranthe guttata]
Length=385

 Score =   132 bits (332),  Expect(2) = 4e-59, Method: Compositional matrix adjust.
 Identities = 72/157 (46%), Positives = 97/157 (62%), Gaps = 10/157 (6%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            SL+DTGN + L+       D  P+ +  PYG TFFH PTGR SDGR+++D IA+ +GL  
Sbjct  40   SLADTGNLLLLSPA-----DNKPAAARPPYGRTFFHRPTGRFSDGRLVIDFIAQRFGLPF  94

Query  183  PPPSLSSK-AQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQDM  359
             PP +  +  +  G  + +GVNFAVVG+ AL  EFY+KL  ++ VTNVS+  QL  F+  
Sbjct  95   VPPYIGGQNGELRGGGVSKGVNFAVVGATALGYEFYEKLGFHNPVTNVSLGTQLDWFKRF  154

Query  360  IPSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSG  470
            + ++     D K  LE SL V+GE GGNDY H L  G
Sbjct  155  LSTI----PDGKKYLERSLVVVGEIGGNDYNHPLSQG  187


 Score =   125 bits (313),  Expect(2) = 4e-59, Method: Compositional matrix adjust.
 Identities = 80/189 (42%), Positives = 113/189 (60%), Gaps = 6/189 (3%)
 Frame = +1

Query  487   IRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYP-SPNVEDYD-DLGC  660
             I+   P V   I     +LI+LG +T++VP++ P+GC   YLT +  S  + DYD   GC
Sbjct  193   IQSFAPAVVDYIGSTIQELIKLGVKTMLVPAIPPIGCLPVYLTQFKKSSTIRDYDPKTGC  252

Query  661   LIWVNQMASYHnqllqeel-nllrerHP-YANIIYTDIFNAAMQIYDGPANLGFSggalr  834
             L W+N+ A YHN+LL++EL  +    +P   +IIY D +NAAM+ Y  P   G S   + 
Sbjct  253   LNWLNEFARYHNKLLKKELNRIQELINPDQIDIIYADYYNAAMRFYLSPNEYGLSKKGIL  312

Query  835   acc-ggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDGSYTYP  1011
               C G GG YN+N   +CG   AT C DPS++ +WDG H TEAAY+L+ + L DG YT P
Sbjct  313   RACCGAGGPYNYNASAECGSSPATCCDDPSSFASWDGLHFTEAAYRLIAQGLFDGPYTTP  372

Query  1012  SMN-ALCPT  1035
              +   +CP+
Sbjct  373   RVKTTICPS  381



>ref|XP_008783975.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Phoenix dactylifera]
Length=377

 Score =   129 bits (324),  Expect(2) = 5e-59, Method: Compositional matrix adjust.
 Identities = 78/190 (41%), Positives = 112/190 (59%), Gaps = 1/190 (1%)
 Frame = +1

Query  460   FSREKNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVE  639
             F   ++I ++R  + I+   I  G  +LI  GA  ++VP V P+GC   YL  Y + + E
Sbjct  175   FFAGRDIEEVRANVHIIVGGIVSGVERLINNGAVDLVVPGVFPIGCFPLYLKLYGTGHKE  234

Query  640   DYDDL-GCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGF  816
             DY    GCL   N +A YHN+ L  EL  LR+ +P   I+Y D + AA++    P N GF
Sbjct  235   DYGHRSGCLKKFNSLAWYHNEKLIMELEKLRKNYPQTRIVYADYYGAAIRFNLAPKNFGF  294

Query  817   SggalraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDG  996
             + GA++ACCG   +YN N + +CG   AT C DP TY +WDG H TEAA++ + K LL+G
Sbjct  295   THGAMKACCGDRSKYNVNMEARCGTSNATVCHDPETYASWDGVHYTEAAHRFIAKGLLEG  354

Query  997   SYTYPSMNAL  1026
              Y +P + +L
Sbjct  355   PYAHPPLISL  364


 Score =   127 bits (320),  Expect(2) = 5e-59, Method: Compositional matrix adjust.
 Identities = 67/158 (42%), Positives = 96/158 (61%), Gaps = 12/158 (8%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            SL+DTGN++    + +L      S +  PYG TFF  PTGRCSDGR++LD I E +GL +
Sbjct  33   SLADTGNHLVNGPNPLL------STTHPPYGMTFFRRPTGRCSDGRLVLDFITEAFGLPL  86

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTV-TNVSMNDQLHAFQDM  359
             PPS     +    +  QG NFA+ G  A+   ++ +  +  TV  N S++DQ+  F+DM
Sbjct  87   LPPS-----KAHDTDFHQGANFAITGGTAMSFGYFHERGLDSTVWVNGSLSDQVDWFEDM  141

Query  360  IPSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
             PSLC+SP +CK+     LF++GEFGGNDY     +G+
Sbjct  142  KPSLCSSPEECKDYFSRCLFIVGEFGGNDYNAFFFAGR  179



>ref|XP_010052216.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Eucalyptus grandis]
 gb|KCW76154.1| hypothetical protein EUGRSUZ_D00533 [Eucalyptus grandis]
Length=386

 Score =   130 bits (326),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 86/183 (47%), Positives = 116/183 (63%), Gaps = 1/183 (1%)
 Frame = +1

Query  475   NITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVEDYD-D  651
             +I  +  ++P+V  AI      LIE GA  ++VP  LP+GC+A YLT + SP+   YD  
Sbjct  203   SIKQLHALVPLVVGAITRAVGMLIEEGAVNLVVPGNLPVGCSAVYLTLFHSPDKSAYDPG  262

Query  652   LGCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGFSggal  831
              GCL   N  A YHN  L++EL  LRE++P+A I+Y D + AA+ IY  P + GF GG L
Sbjct  263   TGCLKAYNVFAKYHNNYLKQELQNLREQYPHARIMYADYYGAALPIYHTPKHYGFYGGTL  322

Query  832   raccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDGSYTYP  1011
             RACCGGGG +NFN   +CG  G+T+C DPS + NWDG HLTE+AY  + K L+ G +  P
Sbjct  323   RACCGGGGPFNFNNSARCGHTGSTACRDPSAFANWDGIHLTESAYHHIAKRLIYGGFISP  382

Query  1012  SMN  1020
              + 
Sbjct  383   PLR  385


 Score =   125 bits (314),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 72/157 (46%), Positives = 94/157 (60%), Gaps = 10/157 (6%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            SLSDTGN++     G L +   P    LPYGETFF H TGRCSDGR+I+D IAE +GL  
Sbjct  54   SLSDTGNFLR---SGALAF---PVIGKLPYGETFFRHATGRCSDGRLIVDFIAEAFGLPH  107

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTV-TNVSMNDQLHAFQDM  359
             PP L   A   G ++R GVNFAV G+ AL + F+   +I   + TN S++ QL  F+++
Sbjct  108  LPPYL---AVAKGPHVRTGVNFAVAGATALDSSFFYAKKIGPLMWTNDSLSVQLRWFKNL  164

Query  360  IPSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSG  470
              SLC +   C      SLF++GE GGNDY +    G
Sbjct  165  KSSLCTTKQQCDEYFNRSLFLVGEIGGNDYNYPSFVG  201



>gb|EAY96951.1| hypothetical protein OsI_18870 [Oryza sativa Indica Group]
Length=361

 Score =   130 bits (326),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 67/161 (42%), Positives = 100/161 (62%), Gaps = 21/161 (13%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVL---PYGETFFHHPTGRCSDGRVILDIIAEHYG  173
            S+SDTGN         L   G PS       PYG+TFF  PTGRCSDGRV++D +AEH+G
Sbjct  34   SISDTGN---------LCVGGCPSWLTTGQPPYGKTFFGRPTGRCSDGRVVVDFLAEHFG  84

Query  174  LAIPPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVS-MNDQLHAF  350
            L +PP      A  GG + ++G N A++G+ ++ A F++ + + D + N   ++ Q+  F
Sbjct  85   LPLPP------ASKGGGDFKKGANMAIIGATSMDAAFFKSIGLSDKIWNNGPLDTQIQWF  138

Query  351  QDMIPSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
            + ++PS+C   +DC++ L  SLFV+GEFGGNDY   L +G+
Sbjct  139  RQLLPSVCG--NDCRSYLSKSLFVVGEFGGNDYNAPLFAGR  177


 Score =   125 bits (315),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 73/181 (40%), Positives = 104/181 (57%), Gaps = 1/181 (1%)
 Frame = +1

Query  472   KNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVEDYDD  651
             + +T++R  +P V   I  G   LI +GA  V+VP VLP+GC   YLT Y + N  DYD 
Sbjct  177   RAMTEVRDYVPQVVSKIIRGLETLIRMGAVDVVVPGVLPIGCFPIYLTLYGTSNGADYDR  236

Query  652   LGCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGFS-gga  828
              GCL   N ++SYHN LL+  L+ L+  +P+A ++Y D ++    +   P N G   G  
Sbjct  237   NGCLKSYNSLSSYHNTLLKRSLSNLQRTYPHARVMYADFYSQVTAMVRSPQNFGLKYGLK  296

Query  829   lraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDGSYTY  1008
             +    GG G YN+N   +CG  G+++C DP+ Y+ WDG HLTEAAY+ +    L G Y  
Sbjct  297   VCCGAGGQGTYNYNNKARCGMSGSSACADPANYLIWDGIHLTEAAYRSIADGWLKGPYCN  356

Query  1009  P  1011
             P
Sbjct  357   P  357



>gb|AAS91011.1| putative lipase [Oryza sativa Japonica Group]
 gb|AAT01386.1| unknown protein, contains GDSL-like lipase/acylhydrolase domain 
[Oryza sativa Japonica Group]
 gb|AAT44169.1| unknown protein, contains GDSL-like lipase/acylhydrolase domain 
[Oryza sativa Japonica Group]
 dbj|BAG94533.1| unnamed protein product [Oryza sativa Japonica Group]
Length=361

 Score =   130 bits (326),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 67/161 (42%), Positives = 100/161 (62%), Gaps = 21/161 (13%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVL---PYGETFFHHPTGRCSDGRVILDIIAEHYG  173
            S+SDTGN         L   G PS       PYG+TFF  PTGRCSDGRV++D +AEH+G
Sbjct  34   SISDTGN---------LCVGGCPSWLTTGQPPYGKTFFGRPTGRCSDGRVVVDFLAEHFG  84

Query  174  LAIPPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVS-MNDQLHAF  350
            L +PP      A  GG + ++G N A++G+ ++ A F++ + + D + N   ++ Q+  F
Sbjct  85   LPLPP------ASKGGGDFKKGANMAIIGATSMDAAFFKSIGLSDKIWNNGPLDTQIQWF  138

Query  351  QDMIPSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
            + ++PS+C   +DC++ L  SLFV+GEFGGNDY   L +G+
Sbjct  139  RQLLPSVCG--NDCRSYLSKSLFVVGEFGGNDYNAPLFAGR  177


 Score =   125 bits (315),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 73/181 (40%), Positives = 104/181 (57%), Gaps = 1/181 (1%)
 Frame = +1

Query  472   KNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVEDYDD  651
             + +T++R  +P V   I  G   LI +GA  V+VP VLP+GC   YLT Y + N  DYD 
Sbjct  177   RAMTEVRDYVPQVVSKIIRGLETLIRMGAVDVVVPGVLPIGCFPIYLTLYGTSNGADYDR  236

Query  652   LGCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGFS-gga  828
              GCL   N ++SYHN LL+  L+ L+  +P+A ++Y D ++    +   P N G   G  
Sbjct  237   NGCLKSYNSLSSYHNTLLKRSLSNLQRTYPHARVMYADFYSQVTAMVRSPQNFGLKYGLK  296

Query  829   lraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDGSYTY  1008
             +    GG G YN+N   +CG  G+++C DP+ Y+ WDG HLTEAAY+ +    L G Y  
Sbjct  297   VCCGAGGQGTYNYNNKARCGMSGSSACADPANYLIWDGIHLTEAAYRSIADGWLKGPYCN  356

Query  1009  P  1011
             P
Sbjct  357   P  357



>ref|NP_001054912.2| Os05g0209600 [Oryza sativa Japonica Group]
 dbj|BAF16826.2| Os05g0209600, partial [Oryza sativa Japonica Group]
Length=367

 Score =   129 bits (325),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 67/161 (42%), Positives = 100/161 (62%), Gaps = 21/161 (13%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVL---PYGETFFHHPTGRCSDGRVILDIIAEHYG  173
            S+SDTGN         L   G PS       PYG+TFF  PTGRCSDGRV++D +AEH+G
Sbjct  40   SISDTGN---------LCVGGCPSWLTTGQPPYGKTFFGRPTGRCSDGRVVVDFLAEHFG  90

Query  174  LAIPPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVS-MNDQLHAF  350
            L +PP      A  GG + ++G N A++G+ ++ A F++ + + D + N   ++ Q+  F
Sbjct  91   LPLPP------ASKGGGDFKKGANMAIIGATSMDAAFFKSIGLSDKIWNNGPLDTQIQWF  144

Query  351  QDMIPSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
            + ++PS+C   +DC++ L  SLFV+GEFGGNDY   L +G+
Sbjct  145  RQLLPSVCG--NDCRSYLSKSLFVVGEFGGNDYNAPLFAGR  183


 Score =   125 bits (315),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 73/181 (40%), Positives = 104/181 (57%), Gaps = 1/181 (1%)
 Frame = +1

Query  472   KNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVEDYDD  651
             + +T++R  +P V   I  G   LI +GA  V+VP VLP+GC   YLT Y + N  DYD 
Sbjct  183   RAMTEVRDYVPQVVSKIIRGLETLIRMGAVDVVVPGVLPIGCFPIYLTLYGTSNGADYDR  242

Query  652   LGCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGFS-gga  828
              GCL   N ++SYHN LL+  L+ L+  +P+A ++Y D ++    +   P N G   G  
Sbjct  243   NGCLKSYNSLSSYHNTLLKRSLSNLQRTYPHARVMYADFYSQVTAMVRSPQNFGLKYGLK  302

Query  829   lraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDGSYTY  1008
             +    GG G YN+N   +CG  G+++C DP+ Y+ WDG HLTEAAY+ +    L G Y  
Sbjct  303   VCCGAGGQGTYNYNNKARCGMSGSSACADPANYLIWDGIHLTEAAYRSIADGWLKGPYCN  362

Query  1009  P  1011
             P
Sbjct  363   P  363



>ref|XP_010925693.1| PREDICTED: GDSL esterase/lipase At5g45910-like isoform X1 [Elaeis 
guineensis]
Length=377

 Score =   130 bits (327),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 67/158 (42%), Positives = 95/158 (60%), Gaps = 12/158 (8%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            SL+DTGN++    + +L      S +  PYG TFF  PTGRCSDGR+++D I E +GL +
Sbjct  34   SLADTGNHLVDGPNPIL------STTHPPYGMTFFRRPTGRCSDGRLVIDFITEAFGLPL  87

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTV-TNVSMNDQLHAFQDM  359
             PPS     +    +  +G NFA+ G  A+  +++    +  TV  N S++DQ+  FQDM
Sbjct  88   LPPS-----KAHNTDFHKGANFAITGGTAMSFDYFHNRGLESTVWVNGSLSDQIDWFQDM  142

Query  360  IPSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
             PSLC+SP +CK      LFV+GEFGGNDY     +G+
Sbjct  143  KPSLCSSPEECKEYFRRCLFVVGEFGGNDYNAFFFAGR  180


 Score =   125 bits (314),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 79/196 (40%), Positives = 111/196 (57%), Gaps = 2/196 (1%)
 Frame = +1

Query  460   FSREKNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVE  639
             F   + I  +   + ++   I EG  +LI  GA  ++VP V P GC   YL  Y S + E
Sbjct  176   FFAGRGIKQVISNVSVIVGGIVEGVERLINQGAVDLVVPGVFPFGCFPLYLKLYGSKHKE  235

Query  640   DYDDL-GCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGF  816
             DY    GCL   N +A YHN+ L+  L  L++++P   I+Y D + AA++    P N GF
Sbjct  236   DYGRRSGCLKKFNTLAWYHNEKLRVGLERLQKKYPSTRIVYADYYAAAIRFNLAPKNFGF  295

Query  817   SggalraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDG  996
             + GAL+ACCG   +YN N   +CG   AT C DP TY +WDG H TEAA++ + K LL+G
Sbjct  296   THGALKACCGDRSKYNVNMSARCGTSNATVCHDPETYASWDGVHYTEAAHRFIAKGLLEG  355

Query  997   SYTYPSMNAL-CPTDA  1041
              Y  P + +L  P D+
Sbjct  356   PYANPPIMSLHSPKDS  371



>ref|XP_002305752.2| GDSL-motif lipase/hydrolase family protein [Populus trichocarpa]
 gb|EEE86263.2| GDSL-motif lipase/hydrolase family protein [Populus trichocarpa]
Length=380

 Score =   138 bits (348),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 85/187 (45%), Positives = 117/187 (63%), Gaps = 5/187 (3%)
 Frame = +1

Query  475   NITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVEDYDDL  654
             +I  +R  +P+V  A+A+    LIE GA  ++VP  LP+GC+A YLT + SPN  DYD  
Sbjct  190   SIKQLRASVPLVVEALAKATSFLIEEGAVELLVPGNLPIGCSAVYLTLFGSPNRTDYDRN  249

Query  655   GCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLG-----FS  819
             GCL   N  + YHN  L+  L +LR+++P+A IIY D + AA + Y  P + G     F 
Sbjct  250   GCLKAYNAFSKYHNNQLKTALQMLRQKYPHARIIYADYYGAAKRFYHAPQHHGKSFELFV  309

Query  820   ggalraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDGS  999
              G L ACCGGGG YNFN   +CG  G+ +C +PS++ NWDG HLTEAAY+ +   L+ GS
Sbjct  310   SGTLTACCGGGGPYNFNNSARCGHIGSRTCSNPSSHANWDGIHLTEAAYRYIAMGLVSGS  369

Query  1000  YTYPSMN  1020
             +T P + 
Sbjct  370   FTTPPLR  376


 Score =   117 bits (292),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 70/161 (43%), Positives = 96/161 (60%), Gaps = 15/161 (9%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            SLSDTGN++     G + +   P  + LPYGETFF H TGRCSDGR+++D I+E  GL  
Sbjct  38   SLSDTGNFLL---SGAMAF---PVIAKLPYGETFFRHATGRCSDGRLVVDFISEASGLPH  91

Query  183  PPPSLSSKAQTGGNNIR--QGVNFAVVGSRALPAEFYQKLEIYDTV-TNVSMNDQLHAFQ  353
             PP L+     G + +    GVNFAV G+ AL A+F+    I   + TN S++ QL  F+
Sbjct  92   LPPYLA----LGKDQLHSFHGVNFAVAGATALDAKFFYDQRIGKIMWTNDSLSVQLGWFK  147

Query  354  DMIPSLCNSP--SDCKNLLENSLFVLGEFGGNDYTHSLLSG  470
             +  SLC S     C N  + SLF++GE GGNDY ++  +G
Sbjct  148  QLKSSLCTSKQGEKCDNYFKKSLFLVGEIGGNDYNYAYFAG  188



>ref|XP_010052212.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Eucalyptus grandis]
Length=392

 Score =   129 bits (324),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 92/211 (44%), Positives = 120/211 (57%), Gaps = 5/211 (2%)
 Frame = +1

Query  460   FSREKNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVE  639
             F   + I  +RP++P +  AI      LIE GA  ++VP  LP GC + YLT + S N  
Sbjct  178   FLFGRTIEQLRPLVPQIVGAIIRAVSTLIEEGAVNLVVPGQLPTGCISMYLTLFQSANES  237

Query  640   DYD-DLGCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGF  816
              YD   GCL   N +  YHN  L++EL  LRE++P+A I+Y D + A++ IY  P   GF
Sbjct  238   AYDPKTGCLEAYNALFKYHNNYLKQELQKLREQYPHARIMYADYYGASISIYRTPKFYGF  297

Query  817   SggalraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDG  996
              GGAL ACCGGGG YNFN    CG  G+T C DPS +V+WDG H TE+AY  + + L+DG
Sbjct  298   YGGALTACCGGGGPYNFNTSAYCGQSGSTVCKDPSAFVDWDGIHSTESAYHYIARGLIDG  357

Query  997   SYTYP----SMNALCPTDAQVAQL*LRMVPF  1077
              +  P      N L  T   V Q  L  V +
Sbjct  358   GFISPPLLFQFNYLHYTKNAVRQFVLSKVTY  388


 Score =   126 bits (317),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 91/157 (58%), Gaps = 10/157 (6%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            S SDTGN++     G L Y   P    LPYGETFFHH TGRCS+GR+I+D IAE +GL  
Sbjct  36   SHSDTGNFLI---TGALAY---PEIKNLPYGETFFHHATGRCSNGRLIIDFIAEAFGLPY  89

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQDMI  362
             PP L   A   G  +R GVNFAV G+ A+   F+    I    TN S+N QL  F+ + 
Sbjct  90   LPPYL---AVAEGPPVRMGVNFAVAGATAIDGSFFSAQNI-TLWTNDSLNVQLGWFKSLK  145

Query  363  PSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
             SLC +  DC    + SLF++GE G NDY    L G+
Sbjct  146  SSLCTTKQDCDEYFKKSLFLVGEIGENDYNLPFLFGR  182



>ref|XP_010041182.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Eucalyptus grandis]
Length=366

 Score =   129 bits (325),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 86/187 (46%), Positives = 113/187 (60%), Gaps = 1/187 (1%)
 Frame = +1

Query  460   FSREKNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVE  639
             F   + I  +RP++P +  AI      LIE GA  ++VP  LP GC + YLT + S N  
Sbjct  178   FLFGRTIEQLRPLVPQIVGAIIRAVSTLIEEGAVNLVVPGQLPTGCISMYLTLFQSANES  237

Query  640   DYD-DLGCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGF  816
              YD   GCL   N +  YHN  L++EL  LRE++P+A I+Y D + A++ IY  P   GF
Sbjct  238   AYDPKTGCLEAYNALFKYHNNYLKQELQKLREQYPHARIMYADYYGASISIYRTPKFYGF  297

Query  817   SggalraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDG  996
              GGAL ACCGGGG YNFN    CG  G+T C DPS +V+WDG H TEAAY  + + L+DG
Sbjct  298   YGGALTACCGGGGPYNFNTSAYCGQSGSTVCKDPSAFVDWDGIHSTEAAYHYIARGLIDG  357

Query  997   SYTYPSM  1017
              +  P +
Sbjct  358   GFISPPL  364


 Score =   125 bits (315),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 91/157 (58%), Gaps = 10/157 (6%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            S SDTGN++     G L Y   P    LPYGETFFHH TGRCS+GR+I+D IAE +GL  
Sbjct  36   SHSDTGNFLI---TGALVY---PEIKNLPYGETFFHHATGRCSNGRLIIDFIAEAFGLPY  89

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQDMI  362
             PP L   A   G  +R GVNFAV G+ A+   F+    I    TN S+N QL  F+ + 
Sbjct  90   LPPYL---AVAEGPPVRMGVNFAVAGATAIDGSFFSAQNI-TLWTNDSLNVQLGWFKSLK  145

Query  363  PSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
             SLC +  DC    + SLF++GE G NDY    L G+
Sbjct  146  SSLCTTKQDCDEYFKKSLFLVGEIGENDYNLPFLFGR  182



>ref|XP_010915608.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Elaeis guineensis]
Length=368

 Score =   130 bits (327),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 70/158 (44%), Positives = 94/158 (59%), Gaps = 12/158 (8%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            SL+DTGN++      +      P    LPYG TFF  PTGRCSDGR+++D IAE +GL +
Sbjct  33   SLADTGNFL------ITGAQPFPGIGRLPYGITFFGRPTGRCSDGRLVIDFIAEAFGLPL  86

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTV-TNVSMNDQLHAFQDM  359
             PPSL+S     G + RQG NFAV    AL   F+++  +     TN S+  QL  F+ +
Sbjct  87   LPPSLAS-----GQDFRQGANFAVTACTALDVAFWEQRGLAGIFWTNDSLGVQLQWFEQL  141

Query  360  IPSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
             PSLC +  +CK+    SLFV+GE GGNDY   LL+ +
Sbjct  142  KPSLCTTLKECKDYFGKSLFVVGEIGGNDYHFPLLANR  179


 Score =   124 bits (312),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 78/183 (43%), Positives = 106/183 (58%), Gaps = 1/183 (1%)
 Frame = +1

Query  472   KNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVEDYD-  648
             + + ++R  +P V   I++    LI  GA  +++P   P GC    LT  PSPN EDYD 
Sbjct  179   RTLEEVRTYVPEVIEKISKTTEILINQGAVDLVLPGSPPSGCFGLLLTLLPSPNKEDYDP  238

Query  649   DLGCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGFSgga  828
               GCL  +N ++ YHN+LL+  +  LR ++P   I+Y D +   +Q    P   GFS GA
Sbjct  239   RTGCLKKLNALSRYHNKLLRRTVKNLRSKYPEVRIVYADFYEPVIQFVRSPERFGFSNGA  298

Query  829   lraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDGSYTY  1008
             L +CCGGGG YNFNP  +C + GAT C DPS  + WDG HLTEAAY+ +    L G Y  
Sbjct  299   LISCCGGGGPYNFNPRARCAEPGATVCKDPSKSIFWDGIHLTEAAYRYIATGWLQGPYAN  358

Query  1009  PSM  1017
             P +
Sbjct  359   PPI  361



>ref|XP_004509605.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Cicer arietinum]
Length=375

 Score =   136 bits (342),  Expect(2) = 3e-58, Method: Compositional matrix adjust.
 Identities = 73/186 (39%), Positives = 106/186 (57%), Gaps = 3/186 (2%)
 Frame = +1

Query  469   EKNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVEDYD  648
             +K I +I+ IIPI+  AI      LIE GA  ++VP   P+GC A++LT   S   ED+D
Sbjct  182   QKTIAEIQEIIPIIVEAITNTTSALIEEGAIELVVPGNFPIGCNAAFLTMVDSKKKEDFD  241

Query  649   DLGCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGFSgga  828
             + GCLI  N +  Y N+ L+  +  L++++  A IIY D +N A ++Y  P   GF+   
Sbjct  242   EFGCLIAYNNLVEYFNEQLKNAIKTLQQKNSQAKIIYFDYYNDAKRLYQAPQQYGFTSDK  301

Query  829   lraccg---gggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDGS  999
                        G YN N ++ CG  GA  C D S  +NWDG HLTEAAY+++ K L++G 
Sbjct  302   NEILKACCGLDGPYNVNFNIPCGGPGAKVCSDTSKLINWDGAHLTEAAYRMIAKGLVEGP  361

Query  1000  YTYPSM  1017
             +  PS+
Sbjct  362   FAIPSL  367


 Score =   118 bits (296),  Expect(2) = 3e-58, Method: Compositional matrix adjust.
 Identities = 66/157 (42%), Positives = 88/157 (56%), Gaps = 10/157 (6%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            S+SDTGN ++   D  +  D        PYG T+F HP GR S+GR+I+D IAE YGL  
Sbjct  37   SISDTGNAMAFHRDHPMPSDS-------PYGSTYFKHPAGRLSNGRLIIDFIAEAYGLPF  89

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQDMI  362
             P   + K  T   +I++GVNFAV GS AL  EF+    +    TN S+N QL  F+++ 
Sbjct  90   LP---AVKNLTKDQDIKKGVNFAVAGSTALEEEFFTNRGVRVPATNNSLNVQLGWFKELK  146

Query  363  PSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
             SLC +  DC    + SLF++GE GGND        K
Sbjct  147  SSLCKNKEDCDVYFKKSLFLVGEIGGNDIIQYAFDQK  183



>ref|XP_009401628.1| PREDICTED: GDSL esterase/lipase At1g28570-like [Musa acuminata 
subsp. malaccensis]
Length=377

 Score =   142 bits (358),  Expect(2) = 3e-58, Method: Compositional matrix adjust.
 Identities = 80/197 (41%), Positives = 119/197 (60%), Gaps = 2/197 (1%)
 Frame = +1

Query  460   FSREKNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVE  639
             F +  N  ++R  +P V  AI+   + LIELG +T++VP   P+GC  +YL  + S NVE
Sbjct  179   FFQGINADEVRTFVPSVIGAISSAINDLIELGVKTLLVPGNFPIGCIPAYLDVFQSKNVE  238

Query  640   DYD-DLGCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGF  816
             DYD   GC+ W+N+ + YHN+LLQ+EL+ LR+ HP+  IIY + ++A +  +  P   GF
Sbjct  239   DYDSQTGCIKWLNEFSEYHNRLLQDELDRLRKLHPHVTIIYANYYDATISFFRAPQLFGF  298

Query  817   SggalraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDG  996
                    C   G  Y  N  +QCG + AT C DPS+ ++WDG HLTEAAY+ + +SLL+G
Sbjct  299   KAPLHACCGSDG-PYGVNRFVQCGHKDATVCSDPSSSISWDGIHLTEAAYETIARSLLEG  357

Query  997   SYTYPSMNALCPTDAQV  1047
              +  P +   CP  + +
Sbjct  358   PHAKPPITRACPQRSAI  374


 Score =   112 bits (279),  Expect(2) = 3e-58, Method: Compositional matrix adjust.
 Identities = 66/156 (42%), Positives = 90/156 (58%), Gaps = 13/156 (8%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            S++DTGN + L S G        S    PYG TFF  PTGR SDGRVI+D IA+  GL +
Sbjct  40   SIADTGNAVRLGSLGA-------SSGSPPYGRTFFDRPTGRFSDGRVIIDFIAQGLGLPL  92

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQDMI  362
              P L   +   G++ RQG NFAV G+ AL  +F+    I  + T+ S+  Q+ +F+ ++
Sbjct  93   VRPYLDGGS---GDDFRQGANFAVGGATALDLDFFSSKGIQASWTDRSLRVQIESFKQLL  149

Query  363  PSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSG  470
             SL    SD K +L +SL ++GE GGNDY H    G
Sbjct  150  SSLS---SDTKEVLNSSLILMGEIGGNDYNHPFFQG  182



>ref|XP_004248142.1| PREDICTED: GDSL esterase/lipase At1g28610 [Solanum lycopersicum]
Length=388

 Score =   137 bits (346),  Expect(2) = 3e-58, Method: Compositional matrix adjust.
 Identities = 88/186 (47%), Positives = 121/186 (65%), Gaps = 2/186 (1%)
 Frame = +1

Query  484   DIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVEDYDDL-GC  660
              +   +P V + I+    ++I+ GA  V+VP  +PLGC+ + LT +   N EDYD + GC
Sbjct  192   KVESYVPAVINTISSVIKEVIKFGASRVVVPGSMPLGCSTALLTIFMDSNKEDYDPITGC  251

Query  661   LIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGFSggalrac  840
             + W+NQ +  +N+LLQ EL+L+R+ HP   IIY D +NAAMQ Y  P   GF+ GAL AC
Sbjct  252   INWLNQFSKNYNKLLQMELHLVRQLHPSVTIIYADHYNAAMQFYLSPNTYGFTKGALVAC  311

Query  841   cggggQYNFNPDLQCGDEGATS-CPDPSTYVNWDGYHLTEAAYKLMTKSLLDGSYTYPSM  1017
             CG GG YN+     CGD  A + C DPS Y +WDG H TEAAYKL+  SLL+G++T+PS+
Sbjct  312   CGAGGPYNYKLFELCGDPTARNICSDPSIYASWDGMHFTEAAYKLIATSLLEGNFTFPSL  371

Query  1018  NALCPT  1035
               +C T
Sbjct  372   PKICST  377


 Score =   116 bits (291),  Expect(2) = 3e-58, Method: Compositional matrix adjust.
 Identities = 68/154 (44%), Positives = 86/154 (56%), Gaps = 8/154 (5%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            SL+DTGN   LT       +  P  + LPYGETFFH PTGR S+GR+I+D IAE  GL +
Sbjct  40   SLTDTGNEFYLTR----YRNPSPYFARLPYGETFFHRPTGRFSNGRLIIDFIAESLGLPL  95

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQDMI  362
             P     K         QGVNFAV GS AL   +     +  T TN S+  QL   ++M+
Sbjct  96   IPAYFGEKDNV---KFTQGVNFAVGGSTALDPTYLSNKGV-KTTTNASLVAQLGWLKEML  151

Query  363  PSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLL  464
             S C  PS+CK  L+NSL  +GE GGND+ +   
Sbjct  152  SSHCKFPSECKEFLKNSLIFVGEIGGNDFIYGFF  185



>ref|XP_006415634.1| hypothetical protein EUTSA_v10009717mg [Eutrema salsugineum]
 gb|ESQ33987.1| hypothetical protein EUTSA_v10009717mg [Eutrema salsugineum]
Length=390

 Score =   145 bits (367),  Expect(2) = 3e-58, Method: Compositional matrix adjust.
 Identities = 83/192 (43%), Positives = 118/192 (61%), Gaps = 2/192 (1%)
 Frame = +1

Query  460   FSREKNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVE  639
             F   K+   I+ ++P+V  AI+     LI+LG +T +VP   PLGC  +YLT + +   E
Sbjct  191   FFEGKSFDKIKDLVPLVIKAISSAIVNLIDLGGKTFVVPGSFPLGCIPAYLTLFQTAKEE  250

Query  640   DYDDL-GCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGF  816
             DYD   GCL W+N+   +HN+ L+ EL  L++ +P+A+IIY D +N+  + +  PA  GF
Sbjct  251   DYDPFTGCLPWLNEFGEHHNEQLKTELKRLQQLYPHASIIYADHYNSMYRFFREPAKHGF  310

Query  817   SggalraccggggQYNFN-PDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLD  993
                 L A CG GG+YNF   + QCG  G + CP+PS YV+WDGYH TEA Y+ M + LL+
Sbjct  311   KNRPLGASCGVGGKYNFTVSEDQCGYRGVSYCPNPSEYVHWDGYHSTEATYRKMAQGLLN  370

Query  994   GSYTYPSMNALC  1029
             G Y  P+ N  C
Sbjct  371   GPYATPAFNWSC  382


 Score =   108 bits (269),  Expect(2) = 3e-58, Method: Compositional matrix adjust.
 Identities = 65/163 (40%), Positives = 92/163 (56%), Gaps = 14/163 (9%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHP-----TGRCSDGRVILDIIAEH  167
            S +DTGNY+ L+SD     +  P  + LPYGETFFH P     T R     +    +AE 
Sbjct  41   SSADTGNYLRLSSD----VNHPPQAAFLPYGETFFHSPPAITPTARFRQNHLFSSALAEF  96

Query  168  YGLAIPPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHA  347
             GL   P +  S+  +      +G+NFAV G+ AL   F  +  I    TNVS++ QL+ 
Sbjct  97   LGLPYVPLNFGSQNVS----FEKGINFAVYGATALDRAFLVEKGIESDFTNVSLSVQLNI  152

Query  348  FQDMIPSLCNSPS-DCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
            F+ ++P+LC S S DC+ +LE+SL ++GE G NDYT+    GK
Sbjct  153  FKQILPNLCASSSRDCREMLEDSLILMGEIGVNDYTYPFFEGK  195



>ref|NP_001042399.1| Os01g0216400 [Oryza sativa Japonica Group]
 dbj|BAA94220.1| putative esterase [Oryza sativa Japonica Group]
 dbj|BAF04313.1| Os01g0216400 [Oryza sativa Japonica Group]
 gb|EAY73027.1| hypothetical protein OsI_00898 [Oryza sativa Indica Group]
Length=382

 Score =   127 bits (318),  Expect(2) = 4e-58, Method: Compositional matrix adjust.
 Identities = 69/158 (44%), Positives = 94/158 (59%), Gaps = 10/158 (6%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            S SDTGN++ L +  +     + + + LPYGETFF HPTGR SDGR+ +D IAE +G+ +
Sbjct  45   SYSDTGNFVKLAAPVI----PVIAFNNLPYGETFFGHPTGRASDGRLNVDFIAEDFGVPL  100

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVT-NVSMNDQLHAFQDM  359
             PP L         N   G NFAVVG+ AL   F+QK  I      N S++ Q+  F  +
Sbjct  101  LPPYLGES-----KNFSHGANFAVVGATALDLAFFQKNNITSVPPFNTSLSVQVEWFHKL  155

Query  360  IPSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
             P+LC++   C++  E SLF +GEFGGNDY   L +GK
Sbjct  156  KPTLCSTTQGCRDYFERSLFFMGEFGGNDYVFLLAAGK  193


 Score =   127 bits (318),  Expect(2) = 4e-58, Method: Compositional matrix adjust.
 Identities = 79/186 (42%), Positives = 104/186 (56%), Gaps = 2/186 (1%)
 Frame = +1

Query  472   KNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVEDYDD  651
             K + +    +P V   I+ G   +IE GAR V+VP  LP GC    LT Y S N  DY+ 
Sbjct  193   KTVDEAMSYVPKVVGVISAGVEAVIEEGARYVVVPGQLPTGCLPIILTLYASANATDYES  252

Query  652   -LGCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGFSgga  828
               GCL   N++A YHN  L   ++LLR +HP A I++ D +   ++    P N GFS  +
Sbjct  253   GAGCLRRFNELARYHNAALFAAVSLLRGKHPSAAIVFADYYQPVIEFVRMPENFGFSRSS  312

Query  829   lracc-ggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDGSYT  1005
                 C GGGG+YN+N    CG  GAT+CPDP+  +NWDG HLTEAAY  +    L G Y 
Sbjct  313   RLRACCGGGGRYNYNATAACGLAGATACPDPAASINWDGVHLTEAAYGRIAAGWLRGPYA  372

Query  1006  YPSMNA  1023
              P + A
Sbjct  373   QPPILA  378



>ref|XP_010915606.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Elaeis guineensis]
Length=361

 Score =   129 bits (324),  Expect(2) = 5e-58, Method: Compositional matrix adjust.
 Identities = 79/180 (44%), Positives = 113/180 (63%), Gaps = 0/180 (0%)
 Frame = +1

Query  472   KNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVEDYDD  651
             +++ ++R   P + + I +G  +LI  GA  ++VP +LP+GC   YL  Y S N  DY+ 
Sbjct  177   RSMAEVRANAPKIVNGIVKGLERLIGNGAVDLVVPGILPIGCFPLYLQLYKSNNKNDYNR  236

Query  652   LGCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGFSggal  831
              GCL   N++A YHNQ+L+ +L  L++R+P   I+Y D +NAAM     P   GF+ GAL
Sbjct  237   FGCLTKYNRVAFYHNQVLKMKLRYLQQRYPQTRIMYADFYNAAMHFVMNPLKYGFTNGAL  296

Query  832   raccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDGSYTYP  1011
             +ACCGGGG YN N D +CG +G+  C +PST+ +WDG H TEAA + +   LL G Y  P
Sbjct  297   KACCGGGGPYNVNLDRRCGQKGSNVCQNPSTFASWDGIHFTEAANRYIATGLLRGPYANP  356


 Score =   124 bits (311),  Expect(2) = 5e-58, Method: Compositional matrix adjust.
 Identities = 70/158 (44%), Positives = 91/158 (58%), Gaps = 13/158 (8%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            SLSD GN I       L        +  PYG TFFH PTGRCSDGR+ +D +AE +GL  
Sbjct  32   SLSDAGNLIVKNPSLYLT-------AKWPYGMTFFHKPTGRCSDGRLFIDFLAEAFGL--  82

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTV-TNVSMNDQLHAFQDM  359
                L   +   G + R+G NFA  G   L   F+Q+  I  ++ TN S++ Q+  F+ M
Sbjct  83   ---PLPPPSLKPGQDFRRGANFATTGGTVLDYSFFQRRGIAKSIFTNGSLDTQISWFEHM  139

Query  360  IPSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
             PSLC +P  CKN +  SLFV+GEFGGNDY+  L SG+
Sbjct  140  KPSLCGTPQACKNYVGKSLFVVGEFGGNDYSAFLFSGR  177



>dbj|BAJ97605.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=362

 Score =   127 bits (319),  Expect(2) = 5e-58, Method: Compositional matrix adjust.
 Identities = 71/183 (39%), Positives = 104/183 (57%), Gaps = 1/183 (1%)
 Frame = +1

Query  472   KNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVEDYDD  651
             + + D+R  +P V   I  G   +I +GA  ++VP VLP+GC   YLT Y + N  DYD 
Sbjct  178   RTMADVRGYVPRVVSHIIRGLETMIRVGAMDIVVPGVLPIGCFPIYLTLYGTSNAGDYDG  237

Query  652   LGCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGFS-gga  828
              GCL   N+++++HN LL+  L  L+  +P+  I+Y D +   +Q+   P N G   G  
Sbjct  238   DGCLKSYNELSAHHNSLLRRSLANLQRTYPHTRIMYADFYAQVIQMIRAPQNFGLKYGLK  297

Query  829   lraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDGSYTY  1008
             +    GG G+YN+N   +CG  GA++C DP  Y+ WDG HLTEAAY+ +    L G Y  
Sbjct  298   VCCGAGGQGKYNYNNKARCGMAGASACSDPHNYLIWDGIHLTEAAYRSIANGWLKGPYCS  357

Query  1009  PSM  1017
             P +
Sbjct  358   PRI  360


 Score =   126 bits (316),  Expect(2) = 5e-58, Method: Compositional matrix adjust.
 Identities = 71/161 (44%), Positives = 97/161 (60%), Gaps = 21/161 (13%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVL---PYGETFFHHPTGRCSDGRVILDIIAEHYG  173
            S+SDTGN         L   G PS       PYGETFF  PTGRCSDGRVI+D +AEH+G
Sbjct  35   SISDTGN---------LCVGGCPSWLTTGQSPYGETFFKRPTGRCSDGRVIVDFLAEHFG  85

Query  174  LAIPPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVS-MNDQLHAF  350
            L + P   +SKA   G + ++G N A++G+  +   F+Q + + D + N   ++ Q+  F
Sbjct  86   LPLLP---ASKA---GGDFKKGANMAIIGATTMDFSFFQSIGLSDKIWNNGPLDTQIQWF  139

Query  351  QDMIPSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
            + ++PS C    DCK  L  SLFV+GEFGGNDY  +L SG+
Sbjct  140  RKLLPSACG--KDCKRHLSKSLFVVGEFGGNDYNAALFSGR  178



>ref|XP_006654152.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Oryza brachyantha]
Length=362

 Score =   127 bits (318),  Expect(2) = 7e-58, Method: Compositional matrix adjust.
 Identities = 72/181 (40%), Positives = 108/181 (60%), Gaps = 1/181 (1%)
 Frame = +1

Query  472   KNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVEDYDD  651
             ++++++R  +P V   I  G   L+ +GA  V+VP VLP+GC   YLT Y + N  DYD 
Sbjct  178   RSMSEVRDYVPQVVSKIIRGLETLVRMGAVDVVVPGVLPIGCFPIYLTLYGTSNGADYDR  237

Query  652   LGCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGFS-gga  828
              GCL   N ++SYHN LL+  L+ L++ +P+A I+Y D ++    +   P N G   G  
Sbjct  238   NGCLRSYNSLSSYHNTLLKRSLSNLQKTYPHARIMYADFYSQVTAMVRSPQNFGLKYGLT  297

Query  829   lraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDGSYTY  1008
             +    GG G+YN+N   +CG  G+++C DP+ Y+ WDG HLTEAAY+ +    L+G Y  
Sbjct  298   VCCGAGGQGKYNYNNKARCGMAGSSACSDPANYLIWDGIHLTEAAYRSIADGWLNGPYCN  357

Query  1009  P  1011
             P
Sbjct  358   P  358


 Score =   126 bits (316),  Expect(2) = 7e-58, Method: Compositional matrix adjust.
 Identities = 65/161 (40%), Positives = 98/161 (61%), Gaps = 21/161 (13%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVL---PYGETFFHHPTGRCSDGRVILDIIAEHYG  173
            S+SDTGN         L   G PS       PYG+TFF  PTGRCSDGRV++D +AEH+G
Sbjct  35   SISDTGN---------LCVGGCPSWLTTGQPPYGKTFFGRPTGRCSDGRVVVDFLAEHFG  85

Query  174  LAIPPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVS-MNDQLHAF  350
            L +PP      A   G + ++G N A++G+ ++ A F++ + + D + N   ++ Q+  F
Sbjct  86   LPLPP------ASKAGGDFKKGANMAIIGATSMDAAFFKSIGLSDKIWNNGPLDTQIQWF  139

Query  351  QDMIPSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
            + ++P++C    DC++ L  SLFV+GEFGGNDY   L +G+
Sbjct  140  RQLLPNVCG--RDCRSYLSKSLFVVGEFGGNDYNAPLFAGR  178



>ref|XP_010925692.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Elaeis guineensis]
Length=360

 Score =   136 bits (342),  Expect(2) = 7e-58, Method: Compositional matrix adjust.
 Identities = 84/180 (47%), Positives = 115/180 (64%), Gaps = 0/180 (0%)
 Frame = +1

Query  472   KNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVEDYDD  651
             K++ ++R   P +   +A+G  +LI  GA  V+VP +LP+GC   YL  Y S N +DY+ 
Sbjct  177   KSMDEVRKNTPNIVDGLADGVERLISNGAVDVVVPGILPIGCFPLYLQLYKSSNKDDYNQ  236

Query  652   LGCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGFSggal  831
              GCL   N++ASYHNQLL+ +L  L++++P   IIY D++NAA Q    P   GF+ GAL
Sbjct  237   FGCLKKYNKVASYHNQLLKIKLQELQQKYPGTRIIYGDLYNAAKQFVVNPKKYGFTNGAL  296

Query  832   raccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDGSYTYP  1011
             +ACCGGGG YN N D +CG  G+  C DPSTY +WDG H TEAA + +   LL G +  P
Sbjct  297   KACCGGGGPYNVNLDYRCGQTGSNVCNDPSTYASWDGIHFTEAANRYIADGLLRGPFGNP  356


 Score =   117 bits (292),  Expect(2) = 7e-58, Method: Compositional matrix adjust.
 Identities = 69/158 (44%), Positives = 87/158 (55%), Gaps = 13/158 (8%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            SLSD GN I   +   L        S  PYG TFFH  TGRCSDGR+ +D IAE  GL  
Sbjct  32   SLSDAGNLIVNNASAYLT-------SKWPYGMTFFHKATGRCSDGRLFIDFIAEAVGL--  82

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTV-TNVSMNDQLHAFQDM  359
                L   +   G + ++G NFA  G   L   F+Q+  +  ++ T  +M  QL  F+ M
Sbjct  83   ---PLPPPSLKPGEDFQKGANFATTGGTVLDYSFFQQRGLTKSLFTTDNMKTQLSWFEKM  139

Query  360  IPSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
             PSLC++  DCK+ +  SLFV GEFGGNDY   L SGK
Sbjct  140  KPSLCSTTQDCKDYIGKSLFVFGEFGGNDYNAFLFSGK  177



>ref|XP_006844517.1| hypothetical protein AMTR_s00016p00148320 [Amborella trichopoda]
 gb|ERN06192.1| hypothetical protein AMTR_s00016p00148320 [Amborella trichopoda]
Length=378

 Score =   126 bits (317),  Expect(2) = 8e-58, Method: Compositional matrix adjust.
 Identities = 70/158 (44%), Positives = 96/158 (61%), Gaps = 8/158 (5%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            SL+DTGN   L  D   Q+  I S   LPYGETFFH PTGRCSDGR+I+D +A+  GL +
Sbjct  39   SLTDTGNLKYLEHD---QFFDIWS---LPYGETFFHRPTGRCSDGRLIVDFLAQGLGLPM  92

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQDMI  362
              P LS     G    R+G NFAV G+ AL     ++  +    TN+S+ +QL  F  ++
Sbjct  93   LQPYLS--GFHGAVEFRKGANFAVGGATALSPSLLREKGVEKLSTNISLENQLQWFYQLL  150

Query  363  PSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSGKK  476
            PS+C+  +DCK  ++ S+F++GE GGNDY  +   G K
Sbjct  151  PSICHPNNDCKEYMKRSIFLVGEIGGNDYYFAFNHGMK  188


 Score =   126 bits (317),  Expect(2) = 8e-58, Method: Compositional matrix adjust.
 Identities = 77/189 (41%), Positives = 110/189 (58%), Gaps = 2/189 (1%)
 Frame = +1

Query  460   FSREKNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVE  639
             F+    I +++  +P V  +I +    LI+ GART++VP  +P GC    LT +PS N  
Sbjct  183   FNHGMKIDEVQAFVPDVVTSIMKTVEGLIQKGARTLVVPGGIPFGCWTCVLTVFPSDNSS  242

Query  640   DYD-DLGCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGF  816
             DYD   GCLI  N   S+HN  L++ +  +R++ P ANIIY D +NA ++ ++ P   GF
Sbjct  243   DYDPQTGCLIPFNDFLSFHNSKLEDGIQAMRKKFPQANIIYADYYNALLRFFESPELYGF  302

Query  817   -SggalraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLD  993
                    ACCG GG YNF+P   CG     SC +PS  VNWDG H TEAA K + ++LL 
Sbjct  303   PKDTVHMACCGVGGPYNFDPARTCGQPEVHSCENPSMRVNWDGLHPTEAASKHVVRALLS  362

Query  994   GSYTYPSMN  1020
             G + +P++ 
Sbjct  363   GEFLHPNIQ  371



>ref|XP_008783909.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Phoenix dactylifera]
Length=360

 Score =   133 bits (334),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 81/180 (45%), Positives = 115/180 (64%), Gaps = 0/180 (0%)
 Frame = +1

Query  472   KNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVEDYDD  651
             +++ ++R   P + + +A+G  +LI  GA  ++VP VLP+GC   YL  Y S +  DY+ 
Sbjct  177   RSLAEVRASTPKIVNGMAKGIERLISNGAVDLVVPGVLPIGCIPLYLQLYKSNDKNDYNK  236

Query  652   LGCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGFSggal  831
              GCL   N++A YHNQ+L+ +L  L++R+P   I+Y D +NAAMQ    P   GFS GAL
Sbjct  237   YGCLKKFNRVAFYHNQMLKIKLRHLQQRYPRTRIMYGDFYNAAMQFVINPGKYGFSNGAL  296

Query  832   raccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDGSYTYP  1011
             +ACCGGGG YN N D +CG +G+  C +PST+ +WDG H TEAA + +   LL G Y  P
Sbjct  297   KACCGGGGPYNVNLDHRCGQKGSNVCKNPSTFASWDGIHFTEAANRYVANGLLRGPYANP  356


 Score =   119 bits (298),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 69/158 (44%), Positives = 89/158 (56%), Gaps = 13/158 (8%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            SLSD GN I       L        +  PYG TFFH PTGRCSDGR+ +D +AE +GL  
Sbjct  32   SLSDAGNLIVKNPSLYLT-------AKWPYGMTFFHKPTGRCSDGRLFIDFLAEAFGL--  82

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTV-TNVSMNDQLHAFQDM  359
                L   +   G + R+G NFA  G   L   F+Q+  +  ++ TN SM  Q+  F+ M
Sbjct  83   ---PLPPPSLKPGQDFRRGANFATTGGTVLDYGFFQRRGLTKSIFTNGSMITQISWFERM  139

Query  360  IPSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
             PSLC +   CKN +  SLFV+GEFGGNDY+  L SG+
Sbjct  140  KPSLCRTTQGCKNYVGRSLFVVGEFGGNDYSAFLFSGR  177



>ref|XP_010915607.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Elaeis guineensis]
Length=377

 Score =   126 bits (317),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 68/158 (43%), Positives = 95/158 (60%), Gaps = 12/158 (8%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            SL+DTGN++    + +L      S +  PYG TFF  PTGRCSDGR+++D I E +GL +
Sbjct  33   SLADTGNHLVNGPNPIL------STTHPPYGMTFFRRPTGRCSDGRLVIDFITEAFGLPL  86

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTV-TNVSMNDQLHAFQDM  359
             PPS   KA     +  QG NF + G  A+   ++ +  +  TV  N S+ DQ+  F+DM
Sbjct  87   LPPS---KAHN--TDFHQGANFGITGGTAMSFGYFHERGLDSTVWVNGSLGDQVDWFEDM  141

Query  360  IPSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
             PSLC+SP +CK+     LFV+GEFGGNDY     +G+
Sbjct  142  KPSLCSSPEECKDYFSRCLFVVGEFGGNDYNAFFFAGR  179


 Score =   125 bits (314),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 77/196 (39%), Positives = 113/196 (58%), Gaps = 2/196 (1%)
 Frame = +1

Query  460   FSREKNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVE  639
             F   ++I D+R  + I+   I +G  +LI  GA  ++VP V P+GC   Y+  Y +   E
Sbjct  175   FFAGRDIQDVRANVNIIVGGIIKGVERLINHGAVDLVVPGVFPIGCFPLYMKLYGTGQKE  234

Query  640   DYDDL-GCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGF  816
             DY    GC+   N +A +HN+ L+ EL  L++ +P+  I+Y D + AA++    P   GF
Sbjct  235   DYGHRSGCIRKFNSLAWHHNEKLRMELEKLQKMYPWTRIVYADYYGAAIRFNFSPNKFGF  294

Query  817   SggalraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDG  996
             + GA++ACCG   +YN N D +CG   AT C DP TY +WDG H TEAA++ + K LL+G
Sbjct  295   THGAMKACCGDRSKYNVNMDARCGTSNATVCHDPETYASWDGVHYTEAAHRFIAKGLLEG  354

Query  997   SYTYPS-MNALCPTDA  1041
              Y  P  MN   P  +
Sbjct  355   PYADPPIMNLRSPKSS  370



>ref|NP_199403.1| GDSL esterase/lipase [Arabidopsis thaliana]
 sp|Q9FJ45.1|GDL83_ARATH RecName: Full=GDSL esterase/lipase At5g45910; AltName: Full=Extracellular 
lipase At5g45910; Flags: Precursor [Arabidopsis 
thaliana]
 dbj|BAB09319.1| GDSL-motif lipase/hydrolase-like protein [Arabidopsis thaliana]
 gb|AED95314.1| GDSL esterase/lipase [Arabidopsis thaliana]
Length=372

 Score =   130 bits (326),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 77/177 (44%), Positives = 117/177 (66%), Gaps = 2/177 (1%)
 Frame = +1

Query  496   IIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVEDYDDLG-CLIWV  672
             ++P V + I +    LIE GA T++VP  LP+GC+A+ L  +   +   YD    C + +
Sbjct  196   LVPFVINKIMDVTSALIEEGAMTLIVPGNLPIGCSAALLERFNDNSGWLYDSRNQCYMPL  255

Query  673   NQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGFSggalrac-cgg  849
             N +A  HN  L++ L  LR+++PYA IIY D +++AMQ ++ P+  GF+G  L+AC  GG
Sbjct  256   NNLAKLHNDKLKKGLAALRKKYPYAKIIYADYYSSAMQFFNSPSKYGFTGSVLKACCGGG  315

Query  850   ggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDGSYTYPSMN  1020
              G+YN  P+++CG++G+T+C DPSTY NWDG HLTEAAY+ +   L+ G +T P+ N
Sbjct  316   DGRYNVQPNVRCGEKGSTTCEDPSTYANWDGIHLTEAAYRHIATGLISGRFTMPTYN  372


 Score =   121 bits (304),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 67/156 (43%), Positives = 95/156 (61%), Gaps = 7/156 (4%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            SLSDTGN++ L+ D        P+   LPYG+TFF+  TGRCSDGR+I+D IAE  GL  
Sbjct  37   SLSDTGNFL-LSGD-----VDSPNIGRLPYGQTFFNRSTGRCSDGRLIIDFIAEASGLPY  90

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDT-VTNVSMNDQLHAFQDM  359
             PP L S       + ++G NFAV G+ A    F++   +  T +TN +++ QL  F+ +
Sbjct  91   IPPYLQSLRTNDSVDFKRGANFAVAGATANEFSFFKNRGLSVTLLTNKTLDIQLDWFKKL  150

Query  360  IPSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLS  467
             PSLC +  +C+     SLF++GE GGNDY + LL+
Sbjct  151  KPSLCKTKPECEQYFRKSLFLVGEIGGNDYNYPLLA  186



>ref|XP_009397450.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009397451.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Musa acuminata 
subsp. malaccensis]
Length=358

 Score =   128 bits (322),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 75/183 (41%), Positives = 102/183 (56%), Gaps = 3/183 (2%)
 Frame = +1

Query  472   KNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVEDYDD  651
             +++  +   +P V HAI  G  +LI  GA  ++VP +LP+GC   +LT Y + N  DY D
Sbjct  170   RSLKQVYTFVPKVIHAIHSGVERLIGHGATEIVVPGMLPIGCFPMFLTLYSTSNTNDYTD  229

Query  652   LGCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGFSggal  831
             +GCL   N + SYHN LL+  L  L+ R+ +  I Y D F+  +Q    P   GFS G  
Sbjct  230   IGCLNKFNDLTSYHNSLLRRRLRGLQRRYSWTRIRYADFFDPTIQFITSPTQYGFSDGGA  289

Query  832   rac---cggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDGSY  1002
                    GG G YN N + +C + G+  C DPS YV+WDG HLTEAAY+L+    L G Y
Sbjct  290   LKACCGAGGRGDYNVNLEAKCAEPGSDVCSDPSMYVSWDGIHLTEAAYRLIANGWLKGPY  349

Query  1003  TYP  1011
               P
Sbjct  350   ANP  352


 Score =   123 bits (309),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 65/158 (41%), Positives = 92/158 (58%), Gaps = 21/158 (13%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            SLSDTGN +                + LPYG +FF  PTGRCS+GR+++D IAE  GL +
Sbjct  33   SLSDTGNVV---------------VAGLPYGMSFFGRPTGRCSNGRLVIDFIAEALGLPL  77

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTV-TNVSMNDQLHAFQDM  359
             PPS +      G +  +G NFA   +  L   F+ +L +   +  N S++ Q+ +F+ M
Sbjct  78   LPPSTAK-----GKSFLKGANFAYTAATTLGFRFFHRLGLSSGLWVNASLSTQIRSFEQM  132

Query  360  IPSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
            +PSLCNS  +CK  L  SLFV+GEFGGNDY   + +G+
Sbjct  133  MPSLCNSSQECKEYLSKSLFVVGEFGGNDYNTPIFAGR  170



>gb|EAZ11035.1| hypothetical protein OsJ_00879 [Oryza sativa Japonica Group]
Length=382

 Score =   127 bits (319),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 69/158 (44%), Positives = 94/158 (59%), Gaps = 10/158 (6%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            S SDTGN++ L +  +     + + + LPYGETFF HPTGR SDGR+ +D IAE +G+ +
Sbjct  45   SYSDTGNFVKLAAPVI----PVIAFNNLPYGETFFGHPTGRASDGRLNVDFIAEDFGVPL  100

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVT-NVSMNDQLHAFQDM  359
             PP L         N   G NFAVVG+ AL   F+QK  I      N S++ Q+  F  +
Sbjct  101  LPPYLGES-----KNFSHGANFAVVGATALDLAFFQKNNITSVPPFNTSLSVQVEWFHKL  155

Query  360  IPSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
             P+LC++   C++  E SLF +GEFGGNDY   L +GK
Sbjct  156  KPTLCSTTQGCRDYFERSLFFMGEFGGNDYVFLLAAGK  193


 Score =   124 bits (312),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 80/190 (42%), Positives = 106/190 (56%), Gaps = 3/190 (2%)
 Frame = +1

Query  472   KNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVEDYDD  651
             K + +    +P V   I+ G   +IE GAR V+VP  LP GC    LT Y S N  DY+ 
Sbjct  193   KTVDEAMSYVPKVVGVISAGVEAVIEEGARYVVVPGQLPTGCLPIILTLYASANATDYES  252

Query  652   -LGCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGFSgga  828
               GCL   N++A YHN  L   ++LLR +HP A I++ D +   ++    P N GFS  +
Sbjct  253   GAGCLRRFNELARYHNAALFAAVSLLRGKHPSAAIVFADYYQPVIEFVRMPENFGFSRSS  312

Query  829   lracc-ggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDGSYT  1005
                 C GGGG+YN+N    CG  GAT+CPDP+  +NWDG HLTEAAY  +    L G Y 
Sbjct  313   RLRACCGGGGRYNYNATAACGLAGATACPDPAASINWDGVHLTEAAYGRIAAGWLRGPYA  372

Query  1006  -YPSMNALCP  1032
               P + A+ P
Sbjct  373   QQPILAAVRP  382



>ref|XP_008783908.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Phoenix dactylifera]
Length=413

 Score =   129 bits (325),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 86/182 (47%), Positives = 112/182 (62%), Gaps = 1/182 (1%)
 Frame = +1

Query  469   EKNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVEDYD  648
              +++ ++R  +P V   I+    +LIELGA  +MV  + P+GC    LT   SPN EDY+
Sbjct  179   RRSLKEVRSYVPKVVDKISMATERLIELGAADLMVAGIPPMGCFPVCLTLLMSPNKEDYE  238

Query  649   -DLGCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGFSgg  825
                GCL  VN +  YHN+LL+  L+ LR ++P   + Y D + AA+++   P   GFS G
Sbjct  239   PGTGCLKEVNNLTRYHNRLLRRSLDQLRIKYPRLRLTYADYYGAAIRLASNPKRYGFSNG  298

Query  826   alraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDGSYT  1005
             ALRACCGGGG YNFN  + CG  G+T C DPSTYV+WD  HLTEAAY  M   LL G Y 
Sbjct  299   ALRACCGGGGPYNFNSTVFCGQPGSTVCKDPSTYVSWDSIHLTEAAYHSMAMGLLQGPYA  358

Query  1006  YP  1011
              P
Sbjct  359   DP  360


 Score =   122 bits (305),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 71/154 (46%), Positives = 94/154 (61%), Gaps = 12/154 (8%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            SLSDTGN + + +  V     +PS S LPYG TFF  PTGR SDGR+I+D IA+ +GL  
Sbjct  34   SLSDTGNLLIILNATV-----VPSGS-LPYGMTFFGGPTGRFSDGRLIIDFIADAFGLPF  87

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTV-TNVSMNDQLHAFQDM  359
             PP ++      G + RQG NFAV G+ AL  EF+Q+  + +    N S++ QL  F+ M
Sbjct  88   LPPFVAR-----GQHFRQGANFAVSGATALDIEFFQQRRLGNLAGVNESLSVQLRWFEGM  142

Query  360  IPSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSL  461
             PSLCNS   C++    SLF++GE G NDY   L
Sbjct  143  KPSLCNSTKSCRDYFSKSLFMIGELGVNDYITPL  176



>ref|XP_003568743.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Brachypodium 
distachyon]
Length=367

 Score =   127 bits (320),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 68/161 (42%), Positives = 98/161 (61%), Gaps = 20/161 (12%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVL---PYGETFFHHPTGRCSDGRVILDIIAEHYG  173
            S+SDTGN         L   G PS       PYGETFF  PTGRCSDGRVI+D +AEH+G
Sbjct  39   SISDTGN---------LCVGGCPSWLTTGQSPYGETFFKRPTGRCSDGRVIIDFLAEHFG  89

Query  174  LAIPPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVS-MNDQLHAF  350
            L + P S ++     G N ++G N A++G+  +  +F++ + + D++ N   ++ Q+  F
Sbjct  90   LPLLPASKAT-----GGNFKKGANMAIIGATTMDFDFFKSIGLSDSIWNNGPLDTQIQWF  144

Query  351  QDMIPSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
            + ++PS C    DC+  L  SLFV+GEFGGNDY  +L SG+
Sbjct  145  RQLLPSACG--RDCRRHLSKSLFVVGEFGGNDYNAALFSGR  183


 Score =   124 bits (310),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 69/183 (38%), Positives = 100/183 (55%), Gaps = 1/183 (1%)
 Frame = +1

Query  472   KNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVEDYDD  651
             +++ D+   +P V   I  G   +I LGA  ++VP VLP+GC   YLT Y + N  DYD 
Sbjct  183   RSMADVTGYVPRVVSHIIRGLETMIRLGAMDIVVPGVLPIGCFPIYLTLYGTSNAGDYDG  242

Query  652   LGCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGFS-gga  828
              GCL   N ++ +HN LL+  +  L+  +P   I+Y D +   +Q+   P N G   G  
Sbjct  243   DGCLKSYNSLSYHHNSLLKRSIAKLQRTYPRTRIMYADFYTQVIQMIRAPQNFGLKYGLK  302

Query  829   lraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDGSYTY  1008
             +     G G+YN+N   +CG  GA++C DP  Y+ WDG HLTEAAY+ +    L G Y  
Sbjct  303   VCCGASGQGKYNYNNKARCGMAGASACSDPQNYLIWDGIHLTEAAYRSIANGWLKGPYCS  362

Query  1009  PSM  1017
             P +
Sbjct  363   PRI  365



>ref|XP_010052211.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Eucalyptus grandis]
 gb|KCW76147.1| hypothetical protein EUGRSUZ_D00523 [Eucalyptus grandis]
Length=367

 Score =   132 bits (331),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 83/183 (45%), Positives = 116/183 (63%), Gaps = 1/183 (1%)
 Frame = +1

Query  472   KNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVEDYDD  651
             ++I  +R ++P+V  AI      LIE GA  +MVP  LP+GC + +LT + S N   YD+
Sbjct  183   QSIKQLRALVPLVVGAITRAVSMLIEEGAVDLMVPGQLPVGCTSMFLTVFQSANESAYDN  242

Query  652   -LGCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGFSgga  828
               GCL   +    YHN  L++EL  LRE++P+A I+Y D + AAM IY  P + GF GG 
Sbjct  243   RTGCLKAYDAFFKYHNNYLKQELQNLREQYPHARIMYADYYGAAMTIYRSPKHYGFYGGT  302

Query  829   lraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDGSYTY  1008
              RACCGGGG +NFN    CG  GAT+C DPS +++WDG H TE+AY  + K +++G +T 
Sbjct  303   PRACCGGGGPHNFNTTAVCGQTGATACKDPSAFMDWDGIHFTESAYHHIAKGMINGGFTS  362

Query  1009  PSM  1017
             P +
Sbjct  363   PPL  365


 Score =   119 bits (298),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 71/159 (45%), Positives = 99/159 (62%), Gaps = 12/159 (8%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            S SDTGNY    +   + +  I S   LPYGETFF + TGRCSDGR+I+D IAE +GL  
Sbjct  35   SHSDTGNYPRTEA---VAFQVIKS---LPYGETFFRNATGRCSDGRLIVDFIAEAFGLPY  88

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFY--QKLEIYDTVTNVSMNDQLHAFQD  356
             PP L+  A+     IR+GVNFAV G+ A+ + F+  QK+ ++   TN S++ QL  F++
Sbjct  89   LPPYLAV-AKGPHVRIRKGVNFAVAGASAINSSFFSAQKIALW---TNDSLSVQLGWFKN  144

Query  357  MIPSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
            +  SLC +  +C    + SLF++GE G NDY    LSG+
Sbjct  145  LKSSLCTTEQECDEYFKKSLFLVGEIGENDYNFPALSGQ  183



>ref|NP_564314.1| GDSL esterase/lipase [Arabidopsis thaliana]
 sp|Q9FPE4.1|GDL12_ARATH RecName: Full=GDSL esterase/lipase At1g28660; AltName: Full=Extracellular 
lipase At1g28660; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAG42007.1|AF327417_1 unknown protein [Arabidopsis thaliana]
 gb|AAN71956.1| unknown protein [Arabidopsis thaliana]
 gb|AEE31011.1| GDSL esterase/lipase [Arabidopsis thaliana]
Length=383

 Score =   129 bits (324),  Expect(2) = 3e-57, Method: Compositional matrix adjust.
 Identities = 81/190 (43%), Positives = 115/190 (61%), Gaps = 2/190 (1%)
 Frame = +1

Query  463   SREKNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVED  642
             S  K+I + + +  ++  AI+     LI LG +T +VP   P GC+A+ LT Y +   ED
Sbjct  187   SEGKSINETK-LQDLIIKAISSAIVDLIALGGKTFLVPGGFPAGCSAACLTQYQNATEED  245

Query  643   YDDL-GCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGFS  819
             YD L GC+  +N++  + N+ L+ EL  L++ +P  NIIY D  N+  + Y  PA  GF 
Sbjct  246   YDPLTGCIPRLNELGEHDNEQLKTELKRLQKLYPDVNIIYADYHNSLYRFYQEPAKYGFK  305

Query  820   ggalraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDGS  999
                L ACCG GG+YNF    +CG EG + C +PS YVNWDGYHLTEAAY+ M + +L+G 
Sbjct  306   NKPLAACCGVGGKYNFTIGKECGYEGVSYCQNPSEYVNWDGYHLTEAAYQKMAEGILNGP  365

Query  1000  YTYPSMNALC  1029
             Y  P+ +  C
Sbjct  366   YATPAFDWSC  375


 Score =   122 bits (305),  Expect(2) = 3e-57, Method: Compositional matrix adjust.
 Identities = 66/158 (42%), Positives = 95/158 (60%), Gaps = 10/158 (6%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            S++DTGN + L+       + +P  +  PYGE+FFH P+GR SDGR+I+D IAE  GL  
Sbjct  42   SIADTGNILHLS-----DVNHLPQTAFFPYGESFFHPPSGRASDGRLIIDFIAEFLGLPY  96

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQDMI  362
             PP   S+  +      QG+NFAV G+ AL   ++    I    TNVS+  QL  F+ ++
Sbjct  97   VPPYFGSQNVS----FEQGINFAVYGATALDRAYFVAKGIESDFTNVSLGVQLDIFKQIL  152

Query  363  PSLCNSPS-DCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
            P+LC S S DC+ +L +SL ++GE GGND+ +    GK
Sbjct  153  PNLCASSSRDCREMLGDSLILMGEIGGNDFFYPSSEGK  190



>ref|NP_001172233.1| Os01g0216900 [Oryza sativa Japonica Group]
 dbj|BAH90963.1| Os01g0216900 [Oryza sativa Japonica Group]
Length=383

 Score =   125 bits (315),  Expect(2) = 3e-57, Method: Compositional matrix adjust.
 Identities = 67/158 (42%), Positives = 94/158 (59%), Gaps = 9/158 (6%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            S +DTGN++ L +  +     I   + LPYGETFF HPTGR ++GR+I+D IA+ + +  
Sbjct  45   SFADTGNFVELAAPLL----PIMPFNNLPYGETFFGHPTGRATNGRIIMDFIADEFHVPF  100

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTV-TNVSMNDQLHAFQDM  359
             PP L      G  N   G NFAVVG+ AL   F+ K  I +    N+S++ QL  FQ +
Sbjct  101  VPPFLGQ----GRQNFTHGANFAVVGASALDLAFFLKNNITNVPPLNISLSVQLEWFQKL  156

Query  360  IPSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
             P+LC +  +C+   + SLF +GEFGGNDY   L +GK
Sbjct  157  KPTLCQTAQECREYFKRSLFFMGEFGGNDYVFILAAGK  194


 Score =   125 bits (313),  Expect(2) = 3e-57, Method: Compositional matrix adjust.
 Identities = 75/184 (41%), Positives = 103/184 (56%), Gaps = 2/184 (1%)
 Frame = +1

Query  472   KNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVEDYDD  651
             K + ++ P +P V  AI+ G   +I+ GAR V+VP  LP GC    LT Y S +  DYD 
Sbjct  194   KTLEELVPYVPKVVQAISAGIEAVIKEGARYVVVPGELPNGCVPIILTLYASKSRGDYDA  253

Query  652   LGCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGF--Sgg  825
              GCL   N +A YHN  L E ++ LR R+P+  I+Y D +   +     PA  GF  S  
Sbjct  254   RGCLKKQNALARYHNSALFEAVSRLRHRYPWVKIVYADYYKPVIDFIKKPARFGFNGSST  313

Query  826   alraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDGSYT  1005
                 C  GGG YN++    CG  GA +CPDP+ +++WDG HLTEAAY  ++   L G Y 
Sbjct  314   LRACCGAGGGPYNYDATAACGLPGAAACPDPAAFISWDGIHLTEAAYARISAGWLHGPYA  373

Query  1006  YPSM  1017
             +P +
Sbjct  374   HPPI  377



>ref|XP_003564307.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Brachypodium 
distachyon]
Length=364

 Score =   128 bits (321),  Expect(2) = 3e-57, Method: Compositional matrix adjust.
 Identities = 69/172 (40%), Positives = 107/172 (62%), Gaps = 0/172 (0%)
 Frame = +1

Query  502   PIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVEDYDDLGCLIWVNQM  681
             P +   I  GA KLI LGA  +++P VLP+GC   YLT Y + N  DYD  GCL   N +
Sbjct  191   PAIVDGIGSGAEKLISLGAMYIVIPGVLPVGCFPIYLTLYQTSNGGDYDQYGCLKRFNAL  250

Query  682   ASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGFSggalraccggggQY  861
             +  HN LLQ +++ L+ ++P+A I+Y D ++    +   P++ GFS      C  GGG+Y
Sbjct  251   SQRHNSLLQAKVSSLQSKYPWAKIMYADFYSHVYDMVKSPSSYGFSTNLRACCGAGGGKY  310

Query  862   NFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDGSYTYPSM  1017
             N+    +CG  GA++C +P++ ++WDG HLTEAAYK +    ++G+Y +P++
Sbjct  311   NYQNGARCGMAGASACGNPASSLSWDGIHLTEAAYKKIADGWVNGAYCHPAI  362


 Score =   122 bits (307),  Expect(2) = 3e-57, Method: Compositional matrix adjust.
 Identities = 67/160 (42%), Positives = 95/160 (59%), Gaps = 20/160 (13%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVL---PYGETFFHHPTGRCSDGRVILDIIAEHYG  173
            S+SDTGN         L  +G P+   L   PYGETFF   T RCSDGR+++D +AE +G
Sbjct  37   SMSDTGN---------LCVNGAPAGLTLTQPPYGETFFGRATCRCSDGRLVVDFLAERFG  87

Query  174  LAIPPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVS-MNDQLHAF  350
            L + PPS     + G  + ++G N A++G+ A+ + F+Q L + D + N   ++ Q+  F
Sbjct  88   LPLLPPS-----KQGSADFKKGANMAIIGATAMGSSFFQSLGVGDKIWNNGPLDTQIQWF  142

Query  351  QDMIPSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSG  470
            Q+++PS+C   S CK  L  SLFVLGE GGNDY   L  G
Sbjct  143  QNLLPSVCG--SSCKTYLSKSLFVLGELGGNDYNAQLFGG  180



>ref|XP_010912648.1| PREDICTED: sinapine esterase-like isoform X3 [Elaeis guineensis]
Length=370

 Score =   143 bits (361),  Expect(2) = 4e-57, Method: Compositional matrix adjust.
 Identities = 91/205 (44%), Positives = 126/205 (61%), Gaps = 3/205 (1%)
 Frame = +1

Query  460   FSREKNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVE  639
             F + K + +IR  +P +  AI+   + LI+LGA+T++VP   P+GC + YL  + S   E
Sbjct  168   FFQGKTVDEIRTFVPSIISAISSAINALIQLGAKTLVVPGNFPIGCVSWYLQAFQSRRKE  227

Query  640   DYD-DLGCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGF  816
             DYD   GC+ W+N+ A YHN+LL +EL+ L++ HP+  IIY D + A + I+  P   GF
Sbjct  228   DYDSQTGCIKWLNEFAEYHNRLLVDELDHLQQLHPHVTIIYADYYKALLNIFRSPTQFGF  287

Query  817   SggalraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDG  996
                 L ACCGGGG YN +  + CG   AT C DPSTYV WDG HLTEAAY+ + + LL+G
Sbjct  288   KKAPLAACCGGGGPYNIS--VPCGGRAATVCNDPSTYVCWDGMHLTEAAYRTIAQGLLEG  345

Query  997   SYTYPSMNALCPTDAQVAQL*LRMV  1071
              +T P +   CP   Q A   LR +
Sbjct  346   PHTAPPITQACPHIEQSAAHSLRPI  370


 Score =   107 bits (266),  Expect(2) = 4e-57, Method: Compositional matrix adjust.
 Identities = 64/159 (40%), Positives = 89/159 (56%), Gaps = 29/159 (18%)
 Frame = +3

Query  3    SLSDTGNYI--SLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGL  176
            SL+DTGN++  S  S G +        + LPYGET+FH PTGR SDGR+I+D IA+  G+
Sbjct  41   SLADTGNFLYSSNNSPGAI--------ARLPYGETYFHRPTGRFSDGRLIIDFIAQDIGI  92

Query  177  AIPPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQD  356
             + PP L      G +  RQGVNFAV G+ AL  +F+++  +  + T  S+  Q+  F+ 
Sbjct  93   PLVPPYLEGP---GDHGFRQGVNFAVAGATALDNDFFREKGLDISWTEYSLGTQIEWFKQ  149

Query  357  MIPSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
            ++PSLC+S S                GGNDY H    GK
Sbjct  150  LLPSLCSSGS----------------GGNDYNHPFFQGK  172



>ref|XP_002455947.1| hypothetical protein SORBIDRAFT_03g027770 [Sorghum bicolor]
 gb|EES01067.1| hypothetical protein SORBIDRAFT_03g027770 [Sorghum bicolor]
Length=437

 Score =   135 bits (341),  Expect(2) = 4e-57, Method: Compositional matrix adjust.
 Identities = 80/200 (40%), Positives = 118/200 (59%), Gaps = 6/200 (3%)
 Frame = +1

Query  466   REKNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVEDY  645
             R+K++ ++  ++P V  AI+     LI LGA+ ++VP   P+GC   YL  + S   EDY
Sbjct  221   RQKSLDELHEVVPNVVGAISSAIVDLINLGAKKLVVPGNFPIGCVPLYLAIFQSQK-EDY  279

Query  646   --DDLGCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGFS  819
               +  GC+ W+N+ A YHN++LQEEL  LR  HP   IIY D + AA+ I+  P   GF+
Sbjct  280   YEEQTGCIKWLNEFAEYHNRMLQEELEKLRNLHPDVTIIYADYYGAALNIFRAPLQFGFT  339

Query  820   ggalraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDGS  999
                   C      YN +P + CG  G+T CPDPS Y++WDG H TEA+YK++ + +L G 
Sbjct  340   VPLNSCCGSDA-PYNCSPSILCGRPGSTVCPDPSKYISWDGLHFTEASYKVVIQGVL-GG  397

Query  1000  YTYPSMNALCP-TDAQVAQL  1056
             Y  P ++  C   + +V+QL
Sbjct  398   YAKPPLSETCRGAEFKVSQL  417


 Score =   114 bits (286),  Expect(2) = 4e-57, Method: Compositional matrix adjust.
 Identities = 62/157 (39%), Positives = 93/157 (59%), Gaps = 11/157 (7%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            SL+DTGN++    D     D       LPYG+TFF  P+GR SDGR +LD  AE +G+  
Sbjct  78   SLTDTGNFLLSVPD-----DFPDPARNLPYGQTFFGRPSGRYSDGRNLLDFFAEAFGMPY  132

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQDMI  362
             PP L      GG + + G NFAV G+ AL   F+++  +  T T  S+++Q+  F+ ++
Sbjct  133  VPPYL------GGGDFQNGANFAVGGATALNGSFFRERGVEPTWTPHSLDEQMQWFKKLL  186

Query  363  PSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
            PS+ +S ++ K ++  SLF +GE GGNDY H ++  K
Sbjct  187  PSIASSETEQKEIMSKSLFFVGEVGGNDYNHLIVRQK  223



>gb|KCW44565.1| hypothetical protein EUGRSUZ_L01922, partial [Eucalyptus grandis]
Length=353

 Score =   125 bits (315),  Expect(2) = 4e-57, Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 91/157 (58%), Gaps = 10/157 (6%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            S SDTGN++     G L Y   P    LPYGETFFHH TGRCS+GR+I+D IAE +GL  
Sbjct  33   SHSDTGNFLI---TGALVY---PEIKNLPYGETFFHHATGRCSNGRLIIDFIAEAFGLPY  86

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQDMI  362
             PP L   A   G  +R GVNFAV G+ A+   F+    I    TN S+N QL  F+ + 
Sbjct  87   LPPYL---AVAEGPPVRMGVNFAVAGATAIDGSFFSAQNI-TLWTNDSLNVQLGWFKSLK  142

Query  363  PSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
             SLC +  DC    + SLF++GE G NDY    L G+
Sbjct  143  SSLCTTKQDCDEYFKKSLFLVGEIGENDYNLPFLFGR  179


 Score =   124 bits (312),  Expect(2) = 4e-57, Method: Compositional matrix adjust.
 Identities = 84/179 (47%), Positives = 109/179 (61%), Gaps = 1/179 (1%)
 Frame = +1

Query  460  FSREKNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVE  639
            F   + I  +RP++P +  AI      LIE GA  ++VP  LP GC + YLT + S N  
Sbjct  175  FLFGRTIEQLRPLVPQIVGAIIRAVSTLIEEGAVNLVVPGQLPTGCISMYLTLFQSANES  234

Query  640  DYD-DLGCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGF  816
             YD   GCL   N +  YHN  L++EL  LRE++P+A I+Y D + A++ IY  P   GF
Sbjct  235  AYDPKTGCLEAYNALFKYHNNYLKQELQKLREQYPHARIMYADYYGASISIYRTPKFYGF  294

Query  817  SggalraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLD  993
             GGAL ACCGGGG YNFN    CG  G+T C DPS +V+WDG H TEAAY  + + L+D
Sbjct  295  YGGALTACCGGGGPYNFNTSAYCGQSGSTVCKDPSAFVDWDGIHSTEAAYHYIARGLID  353



>ref|XP_006828273.1| hypothetical protein AMTR_s00023p00217880 [Amborella trichopoda]
 gb|ERM95689.1| hypothetical protein AMTR_s00023p00217880 [Amborella trichopoda]
Length=374

 Score =   129 bits (324),  Expect(2) = 5e-57, Method: Compositional matrix adjust.
 Identities = 73/158 (46%), Positives = 102/158 (65%), Gaps = 10/158 (6%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            S+SDTGN + L+ D    + GI +    PYG+TFF  PTGRCSDGR+I+D  AE  GL  
Sbjct  37   SISDTGNLL-LSGDN--PFIGIANP---PYGQTFFKKPTGRCSDGRLIVDFFAEALGLPF  90

Query  183  PPPSLS-SKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQDM  359
             PP LS SK++    + R+G+NFAV G+ AL   +++   +    TN S++ QL  FQ  
Sbjct  91   LPPYLSKSKSK---KDFRKGMNFAVAGATALSYSYFESRGMGLLWTNKSLSVQLEWFQQF  147

Query  360  IPSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
            +PSLC+  +DCK  L+NSLF++GE GGND+ + LL  +
Sbjct  148  LPSLCHPGTDCKRYLKNSLFLVGEIGGNDFNYPLLQAR  185


 Score =   120 bits (302),  Expect(2) = 5e-57, Method: Compositional matrix adjust.
 Identities = 77/187 (41%), Positives = 113/187 (60%), Gaps = 2/187 (1%)
 Frame = +1

Query  466   REKNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVEDY  645
             + +++ + R  +P V  AI E    LI LGA+T++VP   P GC+  YLT + + N ++Y
Sbjct  183   QARSLHEARTYVPDVIKAITEAVSVLIRLGAKTLVVPGNFPTGCSTLYLTVFQTNNKDEY  242

Query  646   D-DLGCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGF-S  819
             +   GCLI  N+ ASY+N  LQ+ +  LR+R P A IIY D +N +M+  + P   GF  
Sbjct  243   EPSTGCLIRFNEFASYYNSKLQDGIQALRKRFPKATIIYADNYNMSMRFVETPTLFGFPK  302

Query  820   ggalraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDGS  999
                L ACCGGGG YNF+    CG     +C  P+ Y +WDG HLTEAAY+ + K++L+G 
Sbjct  303   ERVLFACCGGGGPYNFDITKTCGSPRVKACTYPAQYADWDGLHLTEAAYEFIAKAMLNGE  362

Query  1000  YTYPSMN  1020
             + +P + 
Sbjct  363   FMHPPIK  369



>ref|XP_004964802.1| PREDICTED: GDSL esterase/lipase At5g45910-like isoform X1 [Setaria 
italica]
Length=377

 Score =   127 bits (320),  Expect(2) = 5e-57, Method: Compositional matrix adjust.
 Identities = 71/172 (41%), Positives = 107/172 (62%), Gaps = 0/172 (0%)
 Frame = +1

Query  508   VAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVEDYDDLGCLIWVNQMAS  687
             +  AI +G  +LI LGA +++VP VLP+GC   YLT Y + N  DYD  GCL   N ++S
Sbjct  206   IVDAIGKGVDQLISLGATSIVVPGVLPVGCFPIYLTLYQTSNAGDYDQYGCLKRFNALSS  265

Query  688   YHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGFSggalraccggggQYNF  867
              HNQLLQ +++ L+ ++P A I+Y D ++    +   P + GFS      C  GGG+YN+
Sbjct  266   RHNQLLQAKVSSLQSKYPGARIMYADFYSHVYDMVRSPGSYGFSTNLRACCGAGGGKYNY  325

Query  868   NPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDGSYTYPSMNA  1023
                 +CG  GA++C +P + ++WDG HLTEAAYK +    + G+Y +P++ A
Sbjct  326   QNSARCGMSGASACSNPESSLSWDGIHLTEAAYKKIADGWVSGAYCHPAIGA  377


 Score =   122 bits (306),  Expect(2) = 5e-57, Method: Compositional matrix adjust.
 Identities = 71/174 (41%), Positives = 98/174 (56%), Gaps = 32/174 (18%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVL---PYGETFFHHPTGRCSDGRVILDIIAEHYG  173
            S+SDTGN         L  +G P+   L   PYGETFF   T RCSDGR+++D +AE YG
Sbjct  34   SMSDTGN---------LCVNGAPAGLTLTQPPYGETFFGRATCRCSDGRLVVDFLAEKYG  84

Query  174  LAIPPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVS-MNDQLHAF  350
            L +  PS     + GG + ++G N A++G+  + + F+Q L I D + N   +N Q+  F
Sbjct  85   LPLLKPS-----KQGGADFKKGANMAIIGATTMDSGFFQSLGIADKIWNNGPLNTQIQWF  139

Query  351  QDMIPSLCNS----------PSD----CKNLLENSLFVLGEFGGNDYTHSLLSG  470
            Q ++PS+C S          P+D    CK+ L  SLFVLGEFGGNDY   +  G
Sbjct  140  QQLMPSICGSTQGTHAINATPADAGAPCKSYLSKSLFVLGEFGGNDYNAQIFGG  193



>ref|XP_009414900.1| PREDICTED: GDSL esterase/lipase At1g28570-like [Musa acuminata 
subsp. malaccensis]
Length=383

 Score =   142 bits (359),  Expect(2) = 6e-57, Method: Compositional matrix adjust.
 Identities = 83/200 (42%), Positives = 117/200 (59%), Gaps = 2/200 (1%)
 Frame = +1

Query  460   FSREKNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVE  639
             F+++++I +IR  +P V  AI +    LI+LGA T++VP   P+GC  +YL+ Y S   E
Sbjct  183   FAQKQSIQEIRTYVPSVIDAIRQAVDVLIQLGATTLVVPGNFPIGCVPAYLSDYQSTVAE  242

Query  640   DYD-DLGCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGF  816
             +YD   GC+ W+N+++ YHN +L +ELN LR+ +P+A IIY D + A + I   P   GF
Sbjct  243   EYDPQTGCISWLNELSEYHNSMLLDELNQLRKVYPHATIIYADYYEAVLNILRSPQQFGF  302

Query  817   SggalraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDG  996
                    C   G  YNFN    CG + +  C DPS  ++WDG H T+AAY  +  SLLDG
Sbjct  303   KTPLAACCGSDGL-YNFNWSKMCGTQMSKVCSDPSDSLSWDGIHFTDAAYSTIALSLLDG  361

Query  997   SYTYPSMNALCPTDAQVAQL  1056
             +Y YPS    C    Q A L
Sbjct  362   TYAYPSFTEACTNFQQNAAL  381


 Score =   107 bits (267),  Expect(2) = 6e-57, Method: Compositional matrix adjust.
 Identities = 65/155 (42%), Positives = 92/155 (59%), Gaps = 15/155 (10%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            S++DTGN I+    G++    + S   LPYG+T+F H TGR SDGR+I+D IAE  GL +
Sbjct  42   SIADTGNAIN---SGII----VESVRHLPYGQTYFGHATGRFSDGRLIVDFIAEAMGLPM  94

Query  183  PPPSLSSKAQTGGN--NIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQD  356
              P L+     GGN  + R G NFA  G+ AL A F++      +     +  QL  F+ 
Sbjct  95   LRPYLA-----GGNAEDFRYGANFAFAGATALNASFFEDKGFQFSPMEYFLGVQLEWFKQ  149

Query  357  MIPSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSL  461
            ++P LC S S+ K++L NSL +LGE GGNDY ++ 
Sbjct  150  LLPILC-SESNSKDILSNSLILLGEIGGNDYNYAF  183



>gb|KCW76148.1| hypothetical protein EUGRSUZ_D00525 [Eucalyptus grandis]
Length=374

 Score =   126 bits (316),  Expect(2) = 7e-57, Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 91/157 (58%), Gaps = 10/157 (6%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            S SDTGN++     G L Y   P    LPYGETFFHH TGRCS+GR+I+D IAE +GL  
Sbjct  33   SHSDTGNFLI---TGALAY---PEIKNLPYGETFFHHATGRCSNGRLIIDFIAEAFGLPY  86

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQDMI  362
             PP L   A   G  +R GVNFAV G+ A+   F+    I    TN S+N QL  F+ + 
Sbjct  87   LPPYL---AVAEGPPVRMGVNFAVAGATAIDGSFFSAQNI-TLWTNDSLNVQLGWFKSLK  142

Query  363  PSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
             SLC +  DC    + SLF++GE G NDY    L G+
Sbjct  143  SSLCTTKQDCDEYFKKSLFLVGEIGENDYNLPFLFGR  179


 Score =   123 bits (309),  Expect(2) = 7e-57, Method: Compositional matrix adjust.
 Identities = 83/179 (46%), Positives = 109/179 (61%), Gaps = 1/179 (1%)
 Frame = +1

Query  460  FSREKNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVE  639
            F   + I  +RP++P +  AI      LIE GA  ++VP  LP GC + YLT + S N  
Sbjct  175  FLFGRTIEQLRPLVPQIVGAIIRAVSTLIEEGAVNLVVPGQLPTGCISMYLTLFQSANES  234

Query  640  DYD-DLGCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGF  816
             YD   GCL   N +  YHN  L++EL  LRE++P+A I+Y D + A++ IY  P   GF
Sbjct  235  AYDPKTGCLEAYNALFKYHNNYLKQELQKLREQYPHARIMYADYYGASISIYRTPKFYGF  294

Query  817  SggalraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLD  993
             GGAL ACCGGGG YNFN    CG  G+T C DPS +V+WDG H TE+AY  + + L+D
Sbjct  295  YGGALTACCGGGGPYNFNTSAYCGQSGSTVCKDPSAFVDWDGIHSTESAYHYIARGLID  353



>gb|AAM62801.1| GDSL-motif lipase/hydrolase-like protein [Arabidopsis thaliana]
Length=368

 Score =   130 bits (327),  Expect(2) = 7e-57, Method: Compositional matrix adjust.
 Identities = 77/177 (44%), Positives = 117/177 (66%), Gaps = 2/177 (1%)
 Frame = +1

Query  496   IIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVEDYDDLG-CLIWV  672
             ++P V + I +    LIE GA T++VP  LP+GC+A+ L  +   +   YD    C + +
Sbjct  192   LVPFVINKIMDVTSALIEEGAMTLIVPGNLPIGCSAALLERFNDNSGWLYDSRNQCYMPL  251

Query  673   NQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGFSggalrac-cgg  849
             N +A  HN  L++ L  LR+++PYA IIY D +++AMQ ++ P+  GF+G  L+AC  GG
Sbjct  252   NNLAKLHNDKLKKGLAALRKKYPYAKIIYADYYSSAMQFFNSPSKYGFTGSVLKACCGGG  311

Query  850   ggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDGSYTYPSMN  1020
              G+YN  P+++CG++G+T+C DPSTY NWDG HLTEAAY+ +   L+ G +T P+ N
Sbjct  312   DGRYNVQPNVRCGEKGSTTCEDPSTYANWDGIHLTEAAYRHIATGLISGRFTMPTYN  368


 Score =   119 bits (298),  Expect(2) = 7e-57, Method: Compositional matrix adjust.
 Identities = 66/156 (42%), Positives = 94/156 (60%), Gaps = 7/156 (4%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            SLSDTGN++ L+ D        P+   LPYG+TFF+  TGRCSDGR+I+D IAE  GL  
Sbjct  33   SLSDTGNFL-LSGDV-----DSPNIGRLPYGQTFFNRSTGRCSDGRLIIDFIAEASGLPY  86

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDT-VTNVSMNDQLHAFQDM  359
             PP L S       + ++G NFAV G+ A    F++   +  T +TN +++ QL  F+ +
Sbjct  87   IPPYLQSLRTNDSVDFKRGANFAVAGATANEFSFFKNRGLSVTLLTNKTLDIQLDWFKKL  146

Query  360  IPSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLS  467
             PSLC +  +C+     SLF++GE  GNDY + LL+
Sbjct  147  KPSLCKTKPECERYFRKSLFLVGEISGNDYNYPLLA  182



>ref|XP_009416172.1| PREDICTED: GDSL esterase/lipase At1g28570-like [Musa acuminata 
subsp. malaccensis]
Length=390

 Score =   139 bits (351),  Expect(2) = 8e-57, Method: Compositional matrix adjust.
 Identities = 75/196 (38%), Positives = 110/196 (56%), Gaps = 13/196 (7%)
 Frame = +1

Query  460   FSREKNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVE  639
             F + + + +IR  +P V  AI+     LI+LGA+ ++VP  LP+GC   YLT + +  ++
Sbjct  177   FFQNRRVEEIRTFVPSVVKAISSAITDLIKLGAKNLVVPGNLPIGCVPVYLTQFQTQKLD  236

Query  640   DYD-DLGCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGF  816
             DYD   GC+ W+N+ + YHN+LLQ+E+  +R  HP A I Y D + +AM++++ P   GF
Sbjct  237   DYDAKTGCIRWLNEFSQYHNRLLQDEIERVRGLHPNATIAYADYYESAMRLFESPKQFGF  296

Query  817   SggalraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDG  996
                    C            + CG   A  C DPS+Y +WDG HLTEAAY+ +   LL G
Sbjct  297   KEPLSACC------------VGCGGPSAKLCSDPSSYASWDGLHLTEAAYRTIANGLLKG  344

Query  997   SYTYPSMNALCPTDAQ  1044
                 PS+N  CP   Q
Sbjct  345   PLAVPSLNQTCPNVQQ  360


 Score =   109 bits (273),  Expect(2) = 8e-57, Method: Compositional matrix adjust.
 Identities = 66/159 (42%), Positives = 95/159 (60%), Gaps = 13/159 (8%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            SL+DTGN   L SDG    D   + S LPYGET+FH PTGR SDGR+I+D IA+  G+ +
Sbjct  36   SLADTGNI--LASDG----DSAGAVSRLPYGETYFHRPTGRYSDGRLIIDFIAQAMGVPL  89

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQDMI  362
              P L   +     + R G NFAV G+ AL + F++  +I  + T  S+  Q+  F+ ++
Sbjct  90   LRPYLGGGSD---EDFRHGANFAVGGATALNSSFFRDKKIDVSWTEYSLQVQIEWFKQLL  146

Query  363  PSLCNSPSDCK-NLLENSLFVLGEFGGNDYTHSLLSGKK  476
             S   +PS  + ++L NSLF++GE GGNDY H     ++
Sbjct  147  RS---TPSVSEPSILGNSLFLVGEIGGNDYNHPFFQNRR  182



>ref|XP_002457140.1| hypothetical protein SORBIDRAFT_03g001880 [Sorghum bicolor]
 gb|EES02260.1| hypothetical protein SORBIDRAFT_03g001880 [Sorghum bicolor]
Length=367

 Score =   126 bits (317),  Expect(2) = 8e-57, Method: Compositional matrix adjust.
 Identities = 64/160 (40%), Positives = 99/160 (62%), Gaps = 15/160 (9%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVL---PYGETFFHHPTGRCSDGRVILDIIAEHYG  173
            S++DTGN  + +        G PS       PYG T F HPTGRC+DGRVI+D +A+H+G
Sbjct  33   SIADTGNLCTGSG-------GCPSWLTTGQPPYGNTHFGHPTGRCTDGRVIVDFLADHFG  85

Query  174  LAIPPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVS-MNDQLHAF  350
            L + PPS +     G  ++++G N A++G+  +  EF+QK  + +++ N   +  Q+  F
Sbjct  86   LPLLPPSKA----IGAGDVKKGANMAIIGATTMDFEFFQKHGLGNSIWNNGPLGTQIQWF  141

Query  351  QDMIPSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSG  470
            Q ++PS+C + ++C++   NSLFV+GEFGGNDY   L  G
Sbjct  142  QQLMPSICGTGAECQSYFNNSLFVVGEFGGNDYNAPLFGG  181


 Score =   122 bits (307),  Expect(2) = 8e-57, Method: Compositional matrix adjust.
 Identities = 70/182 (38%), Positives = 108/182 (59%), Gaps = 2/182 (1%)
 Frame = +1

Query  478   ITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVEDYDDLG  657
             + ++R  +P +   IA G   LIELGA  V+VP VLP+GC   YLT Y S + +DYD++G
Sbjct  184   MAEVRSYVPEIVDRIASGVETLIELGAVDVVVPGVLPIGCFPLYLTLYQSSSKDDYDEIG  243

Query  658   CLIWVNQMASYHnqllqeelnllrerHPYA-NIIYTDIFNAAMQIYDGPANLGFS-ggal  831
             CL   N ++SYHN+LL++ +  L+ +H     ++Y D++     +   P   G   G  +
Sbjct  244   CLKSFNNLSSYHNELLKQAVAGLQSKHAAGVRLMYADLYAQVADMVRSPETFGLKYGLKV  303

Query  832   raccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDGSYTYP  1011
                 GG G YN+N + +CG  G+++C DP  Y+ WDG HLT+AAY+ +  + L G+Y  P
Sbjct  304   CCGAGGQGSYNYNNNARCGMSGSSACGDPEKYLVWDGIHLTDAAYRSIADAWLKGTYCSP  363

Query  1012  SM  1017
              +
Sbjct  364   GI  365



>ref|XP_004960619.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Setaria italica]
Length=367

 Score =   128 bits (322),  Expect(2) = 9e-57, Method: Compositional matrix adjust.
 Identities = 71/161 (44%), Positives = 99/161 (61%), Gaps = 21/161 (13%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVL---PYGETFFHHPTGRCSDGRVILDIIAEHYG  173
            S+SDTGN         L   G PS       PYGETFF  PTGRCSDGRVI+D +AEH+G
Sbjct  40   SISDTGN---------LCVGGCPSWLTTGQSPYGETFFGRPTGRCSDGRVIIDFLAEHFG  90

Query  174  LAIPPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVS-MNDQLHAF  350
            L + P   +SKA   G + ++G N A++G+  +  +F+  + + D + N   ++ Q+  F
Sbjct  91   LPLLP---ASKA---GGDFKKGANMAIIGATTMNFDFFNSIGLSDKIWNNGPLDTQIQWF  144

Query  351  QDMIPSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
            + ++PS+C    DCKN L  SLFV+GEFGGNDY  +L SG+
Sbjct  145  RQLLPSVCG--KDCKNYLSKSLFVVGEFGGNDYNAALFSGR  183


 Score =   120 bits (302),  Expect(2) = 9e-57, Method: Compositional matrix adjust.
 Identities = 70/181 (39%), Positives = 99/181 (55%), Gaps = 1/181 (1%)
 Frame = +1

Query  472   KNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVEDYDD  651
             + + ++R  +P V   +  G   +I  GA  V+VP VLP+GC   Y+T Y + N  DYD 
Sbjct  183   RTMAEVRGYVPRVVSKLIRGLETIIRSGAVDVVVPGVLPIGCFPIYITLYGTSNAADYDG  242

Query  652   LGCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGFS-gga  828
              GCL   N ++SYHN LL+  L  L+  +P   I+Y D ++    +   P N G   G  
Sbjct  243   DGCLRSYNGLSSYHNSLLKRSLGSLQRTYPRTRIMYADFYSQVTHMIRAPQNFGLKYGLK  302

Query  829   lraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDGSYTY  1008
             +    GG G+YN+N   +CG  GA++C DP  Y+ WDG HLTEAAY+ +    L G Y  
Sbjct  303   VCCGAGGQGKYNYNNKARCGMAGASACADPGNYLIWDGIHLTEAAYRSIADGWLKGPYCN  362

Query  1009  P  1011
             P
Sbjct  363   P  363



>ref|XP_004952371.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Setaria italica]
Length=371

 Score =   133 bits (335),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 75/177 (42%), Positives = 108/177 (61%), Gaps = 1/177 (1%)
 Frame = +1

Query  490   RPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVEDYDDLGCLIW  669
             R   P + + I+ G  KLI +GA  ++VP VLP+GC   YLT Y S N  DYDDLGCL  
Sbjct  192   RKYTPKIVNTISRGIDKLIAMGATDIVVPGVLPIGCFPIYLTIYQSSNSSDYDDLGCLNK  251

Query  670   VNQMASYHnqllqeelnllrerH-PYANIIYTDIFNAAMQIYDGPANLGFSggalraccg  846
              N +++YHN LL++ +++++ RH     I+Y D ++    +   P N GFS      C  
Sbjct  252   FNDLSTYHNTLLKKRVDIIQSRHRKTVRIMYADFYSGVYDMVRNPQNYGFSSVFETCCGS  311

Query  847   gggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDGSYTYPSM  1017
             GGG+YN+    +CG +GA++C  P+++++WDG HLTEAAYK +T   L G Y  P M
Sbjct  312   GGGKYNYQNSARCGMQGASACASPASHLSWDGIHLTEAAYKQITDGWLKGPYCRPPM  368


 Score =   115 bits (288),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 64/151 (42%), Positives = 89/151 (59%), Gaps = 11/151 (7%)
 Frame = +3

Query  30   SLTSDGVLQYDGIPSCSVL---PYGETFFHHPTGRCSDGRVILDIIAEHYGLAIPPPSLS  200
            S+T  G L  +G PS       PYGET+F  PT RCSDGRV++D +++ +GL + PPS S
Sbjct  42   SITDTGNLCTNGRPSMITFTQPPYGETYFGTPTCRCSDGRVVVDFLSDQFGLPLLPPSKS  101

Query  201  SKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVS-MNDQLHAFQDMIPSLCN  377
            S       + +QG N A+ G+ A+ A F++ L + D + N   ++ QL  FQ +  S+C 
Sbjct  102  SSG-----DFKQGANMAITGATAMDAPFFRSLGLSDKIWNNGPISFQLQWFQQIATSICG  156

Query  378  SPSDCKNLLENSLFVLGEFGGNDYTHSLLSG  470
                CK+ L NSLFV GEFGGNDY   +  G
Sbjct  157  --QSCKSYLANSLFVFGEFGGNDYNAMIFGG  185



>ref|XP_010915609.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Elaeis guineensis]
Length=366

 Score =   127 bits (318),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 82/185 (44%), Positives = 112/185 (61%), Gaps = 1/185 (1%)
 Frame = +1

Query  460   FSREKNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVE  639
              S ++++ ++R  +P V   ++    +LIE GA  ++VP   P+GC  ++LT Y SPN E
Sbjct  174   LSVKRSLKEVRSYVPKVIETVSMAIERLIEHGAVDLVVPGNPPIGCYGAFLTLYESPNKE  233

Query  640   DYD-DLGCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGF  816
             DYD   GCL  +N +  YHN+LL+  L  LR ++P     Y D + AA+++   P   GF
Sbjct  234   DYDPRTGCLKKLNDLMRYHNKLLRRLLEQLRIKYPRLRFTYADYYGAAIRLARHPKRYGF  293

Query  817   SggalraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDG  996
             S G  RACCGGGG YNFN  + CG  G   C DPSTYV+WDG H TEAA++ +   LL G
Sbjct  294   SNGVSRACCGGGGPYNFNSTVICGQPGYNVCKDPSTYVSWDGIHSTEAAHRSIAMGLLHG  353

Query  997   SYTYP  1011
              YT P
Sbjct  354   PYTDP  358


 Score =   122 bits (305),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 68/150 (45%), Positives = 89/150 (59%), Gaps = 14/150 (9%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            SLSDTGN + L +   +          LPYG TFF  PTGR SDGR+I+D IAE +GL  
Sbjct  34   SLSDTGNLLILNASAPI--------GRLPYGMTFFGRPTGRFSDGRLIIDFIAEAFGLPF  85

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTV-TNVSMNDQLHAFQDM  359
             PPSL+      G + R G +FAV G+ AL  EF+++  +      N S+  QL  F+++
Sbjct  86   LPPSLAR-----GQDFRHGADFAVSGATALDIEFFRRRGLGAVARVNQSLGVQLRWFEEL  140

Query  360  IPSLCNSPSDCKNLLENSLFVLGEFGGNDY  449
             PSLCNS   CK+    SLF++GE GGNDY
Sbjct  141  KPSLCNSTRSCKDYFSKSLFMVGEIGGNDY  170



>ref|XP_004971762.1| PREDICTED: GDSL esterase/lipase At1g28600-like [Setaria italica]
Length=363

 Score =   130 bits (326),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 77/187 (41%), Positives = 105/187 (56%), Gaps = 1/187 (1%)
 Frame = +1

Query  460   FSREKNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVE  639
             F+  K + + R  +P V   I  G   LI LGA  V+VP VLP+GC   YLT YPS N +
Sbjct  175   FTPGKGMAEARSYVPQVVDRITTGVETLIGLGAVDVVVPGVLPIGCFPVYLTLYPSSNKD  234

Query  640   DYDDLGCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGFS  819
             DYD++GCL   N ++SYHN+LL++ L+ LR +H    ++Y D +     +   P   G  
Sbjct  235   DYDEIGCLRSFNSLSSYHNELLKQALSGLRSKHAGVRLMYADFYAQVTDMVRSPETFGLE  294

Query  820   ggalraccggggQ-YNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDG  996
              G    C  GG   YN+N    CG  GA++C DP  Y+ WDG HLT+AAY  +    LDG
Sbjct  295   YGLRVCCGAGGEGPYNYNNGANCGTAGASACGDPEKYLAWDGVHLTDAAYGSIAGGWLDG  354

Query  997   SYTYPSM  1017
             +Y  P +
Sbjct  355   TYCSPGI  361


 Score =   118 bits (296),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 66/161 (41%), Positives = 99/161 (61%), Gaps = 16/161 (10%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYD--GIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGL  176
            S+SDTGN +   S G   +D  G P     PYG T F  PTGRC+DGRV++D +AE +GL
Sbjct  32   SISDTGN-LCAGSGGCPSWDNTGKP-----PYGNTHFGRPTGRCTDGRVVVDFLAERFGL  85

Query  177  AIPPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTN-VSMNDQLHAFQ  353
             + PPS +S     G + ++G N A++G+ A+  +F++   +  +V N  S+  Q+  FQ
Sbjct  86   PLLPPSKAS-----GGDFKKGANMAIIGATAMDFDFFKSRGLGASVWNDGSLGTQIQWFQ  140

Query  354  DMIPSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSGKK  476
             ++PS+C   + CK+   NSLF++GEFGGNDY  +L +  K
Sbjct  141  QLMPSICG--TGCKSYFSNSLFIVGEFGGNDYNAALFTPGK  179



>ref|NP_849723.1| GDSL esterase/lipase [Arabidopsis thaliana]
 gb|AEE31010.1| GDSL esterase/lipase [Arabidopsis thaliana]
Length=382

 Score =   127 bits (318),  Expect(2) = 2e-56, Method: Compositional matrix adjust.
 Identities = 82/190 (43%), Positives = 116/190 (61%), Gaps = 3/190 (2%)
 Frame = +1

Query  463   SREKNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVED  642
             S  K+I + + +  ++  AI+  A  LI LG +T +VP   P GC+A+ LT Y +   ED
Sbjct  187   SEGKSINETK-LQDLIIKAISS-AIDLIALGGKTFLVPGGFPAGCSAACLTQYQNATEED  244

Query  643   YDDL-GCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGFS  819
             YD L GC+  +N++  + N+ L+ EL  L++ +P  NIIY D  N+  + Y  PA  GF 
Sbjct  245   YDPLTGCIPRLNELGEHDNEQLKTELKRLQKLYPDVNIIYADYHNSLYRFYQEPAKYGFK  304

Query  820   ggalraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDGS  999
                L ACCG GG+YNF    +CG EG + C +PS YVNWDGYHLTEAAY+ M + +L+G 
Sbjct  305   NKPLAACCGVGGKYNFTIGKECGYEGVSYCQNPSEYVNWDGYHLTEAAYQKMAEGILNGP  364

Query  1000  YTYPSMNALC  1029
             Y  P+ +  C
Sbjct  365   YATPAFDWSC  374


 Score =   121 bits (304),  Expect(2) = 2e-56, Method: Compositional matrix adjust.
 Identities = 66/158 (42%), Positives = 95/158 (60%), Gaps = 10/158 (6%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            S++DTGN + L+       + +P  +  PYGE+FFH P+GR SDGR+I+D IAE  GL  
Sbjct  42   SIADTGNILHLS-----DVNHLPQTAFFPYGESFFHPPSGRASDGRLIIDFIAEFLGLPY  96

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVSMNDQLHAFQDMI  362
             PP   S+  +      QG+NFAV G+ AL   ++    I    TNVS+  QL  F+ ++
Sbjct  97   VPPYFGSQNVS----FEQGINFAVYGATALDRAYFVAKGIESDFTNVSLGVQLDIFKQIL  152

Query  363  PSLCNSPS-DCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
            P+LC S S DC+ +L +SL ++GE GGND+ +    GK
Sbjct  153  PNLCASSSRDCREMLGDSLILMGEIGGNDFFYPSSEGK  190



>ref|XP_002453668.1| hypothetical protein SORBIDRAFT_04g010100 [Sorghum bicolor]
 gb|EES06644.1| hypothetical protein SORBIDRAFT_04g010100 [Sorghum bicolor]
Length=365

 Score =   135 bits (339),  Expect(2) = 2e-56, Method: Compositional matrix adjust.
 Identities = 79/179 (44%), Positives = 109/179 (61%), Gaps = 1/179 (1%)
 Frame = +1

Query  478   ITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVEDYDDLG  657
             I   R   P + + I+ G  KLI LGA  ++VP VLP+GC   YLT Y S N  DYDDLG
Sbjct  182   IEQARKYTPKIVNTISRGIDKLIGLGATDIVVPGVLPIGCFPIYLTIYQSSNSSDYDDLG  241

Query  658   CLIWVNQMASYHnqllqeelnllrerH-PYANIIYTDIFNAAMQIYDGPANLGFSggalr  834
             CL   N +++YHN LLQ+ +++++ RH   A I+Y D ++A   +   P   GFS     
Sbjct  242   CLKSFNDLSTYHNTLLQKRVDIIQSRHRKTARIMYADFYSAVYDMVRNPQTYGFSSVFET  301

Query  835   accggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDGSYTYP  1011
              C  GGG+YN+    +CG  GA++C +P+T+++WDG HLTEAAYK +T   L G Y  P
Sbjct  302   CCGSGGGKYNYQNSARCGMSGASACANPATHLSWDGIHLTEAAYKQITDGWLKGPYCRP  360


 Score =   113 bits (283),  Expect(2) = 2e-56, Method: Compositional matrix adjust.
 Identities = 64/151 (42%), Positives = 88/151 (58%), Gaps = 11/151 (7%)
 Frame = +3

Query  30   SLTSDGVLQYDGIPSCSVL---PYGETFFHHPTGRCSDGRVILDIIAEHYGLAIPPPSLS  200
            S+T  G L  +G PS       PYGET+F  PT RCSDGRV++D ++  +GL   PPS S
Sbjct  36   SITDTGNLCTNGRPSQITFTQPPYGETYFGTPTCRCSDGRVVVDFLSTQFGLPFLPPSKS  95

Query  201  SKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVTNVS-MNDQLHAFQDMIPSLCN  377
            S A     + +QG N A+ G+ A+ A F++ L + D + N   ++ QL  FQ +  ++C 
Sbjct  96   SSA-----DFKQGANMAITGATAMDAPFFRSLGLSDKIWNNGPISFQLQWFQQIATAVCG  150

Query  378  SPSDCKNLLENSLFVLGEFGGNDYTHSLLSG  470
                CK+ L NSLFV GEFGGNDY   +  G
Sbjct  151  --QSCKSYLANSLFVFGEFGGNDYNAMIFGG  179



>ref|XP_009413940.1| PREDICTED: uncharacterized protein LOC103995136 [Musa acuminata 
subsp. malaccensis]
Length=731

 Score =   126 bits (317),  Expect(2) = 2e-56, Method: Compositional matrix adjust.
 Identities = 70/158 (44%), Positives = 96/158 (61%), Gaps = 20/158 (13%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            SLSDTGN         +Q  G      LPYG TFF  PTGRCS+GR+++D IAE  GL +
Sbjct  40   SLSDTGN---------VQVAG------LPYGMTFFGRPTGRCSNGRLVIDFIAEAVGLPL  84

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTV-TNVSMNDQLHAFQDM  359
             P S ++K    GN+ RQG NFA   + AL  +F+ +  +   +  N S++ Q+  F+  
Sbjct  85   LPASSTTK----GNSFRQGANFAYTAATALDFDFFNRRGLGGKLWVNASLSSQIGWFEKT  140

Query  360  IPSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
            +PSLC+S S CKN    SLFV+GEFGGNDY  ++ +G+
Sbjct  141  MPSLCSSTSACKNYFGRSLFVVGEFGGNDYNTAIFAGR  178


 Score =   122 bits (305),  Expect(2) = 2e-56, Method: Compositional matrix adjust.
 Identities = 76/184 (41%), Positives = 108/184 (59%), Gaps = 2/184 (1%)
 Frame = +1

Query  472   KNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVEDYDD  651
             +++ ++   +PIV  AI  G  +L+  GA  ++VP +LP+GC   YLT Y S N  DY  
Sbjct  178   RSMAEVNSYVPIVIRAIRLGVERLVGHGAVDILVPGMLPIGCFPVYLTLYGSSNKNDYTG  237

Query  652   LGCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGFSggal  831
             +GCL   N +A +HN LL+  +  L+ +H    I Y D +N A+     PA  GF+GGAL
Sbjct  238   IGCLRKYNDLAMHHNALLRRAIYGLQRKHSGTRIRYADYYNPALGFAADPAKYGFTGGAL  297

Query  832   ra--ccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDGSYT  1005
             +A     G G+YN NP   C   G++ C DP+T+V+WDG HLTEAAY L+ +  L G   
Sbjct  298   KACCGATGSGEYNVNPHKVCAQPGSSVCGDPTTHVSWDGSHLTEAAYLLIARGWLGGPDA  357

Query  1006  YPSM  1017
              PS+
Sbjct  358   KPSI  361


 Score =   122 bits (307),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 77/182 (42%), Positives = 106/182 (58%), Gaps = 2/182 (1%)
 Frame = +1

Query  472   KNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVEDYDD  651
             +++ ++   +P V  AIA G  +LI  GA  ++VP +LP+GC   YLT Y + N  DY  
Sbjct  546   RSMWEVYTFVPRVVQAIAHGVERLIGHGAVDLVVPGMLPIGCFPVYLTLYATSNPSDYSS  605

Query  652   LGCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGFSggal  831
             +GCL   N + SYHN LLQ  L  L+ ++P   I Y + +  A+Q    P+  GFSGG L
Sbjct  606   IGCLRKFNDLTSYHNSLLQAALYQLQIKYPSTRIRYGNYYTPAIQYVAYPSKYGFSGGGL  665

Query  832   ra--ccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDGSYT  1005
             +A     G G+YN N    C   G++ C DP TYV+WDG HLTEAAY+L+    L+G Y 
Sbjct  666   KACCGAAGSGKYNVNLKAMCAKAGSSVCSDPDTYVSWDGIHLTEAAYRLIADGWLNGPYA  725

Query  1006  YP  1011
              P
Sbjct  726   NP  727


 Score =   115 bits (288),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 63/158 (40%), Positives = 88/158 (56%), Gaps = 21/158 (13%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            SLSDTGN +                + LPYG TFF   TGRCS+GR+++D IAE  GL +
Sbjct  409  SLSDTGNVV---------------IAGLPYGMTFFGRATGRCSNGRLVIDFIAEATGLPL  453

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTV-TNVSMNDQLHAFQDM  359
             PPS +      G +  QG NFA   +  L  +F+    +   +  N S++ Q+  F+ M
Sbjct  454  LPPSTAK-----GQSFAQGANFACTAATTLDFDFFYHRNLSGGLWVNASLSQQIGWFEQM  508

Query  360  IPSLCNSPSDCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
            +PSLC    +C + L  SLFV+GEFGGNDYT  + +G+
Sbjct  509  LPSLCGQTRECNDYLGTSLFVVGEFGGNDYTTPIFAGR  546



>ref|XP_004968628.1| PREDICTED: GDSL esterase/lipase At5g45910-like [Setaria italica]
Length=378

 Score =   131 bits (330),  Expect(2) = 2e-56, Method: Compositional matrix adjust.
 Identities = 86/186 (46%), Positives = 107/186 (58%), Gaps = 1/186 (1%)
 Frame = +1

Query  472   KNITDIRPIIPIVAHAIAEGAHKLIELGARTVMVPSVLPLGCAASYLTYYPSPNVEDYDD  651
             K +   +  +P V  AIA G  KLI+ GAR ++VP  LP GC    LT Y SPN  DYD 
Sbjct  191   KTVEQTKTYVPAVVKAIAGGVEKLIKHGARRIVVPGNLPTGCIPIMLTLYASPNKADYDR  250

Query  652   LGCLIWVNQMASYHnqllqeelnllrerHPYANIIYTDIFNAAMQIYDGPANLGF-Sgga  828
              GCL  +N +A YHN  L+ E+  LR ++P   I Y D F   +     PAN GF    A
Sbjct  251   YGCLDKLNGLARYHNAFLRREVMALRIKYPGTKIAYADYFWPVVGFLQNPANSGFDGSTA  310

Query  829   lraccggggQYNFNPDLQCGDEGATSCPDPSTYVNWDGYHLTEAAYKLMTKSLLDGSYTY  1008
             L ACCG GG+YN+N    CG  GAT+C DPS  VNWDG HLTEAAY+ +    L G +  
Sbjct  311   LVACCGAGGRYNYNVTAACGFPGATACADPSRAVNWDGIHLTEAAYRDIAGGWLRGPFAQ  370

Query  1009  PSMNAL  1026
             P + +L
Sbjct  371   PPILSL  376


 Score =   117 bits (292),  Expect(2) = 2e-56, Method: Compositional matrix adjust.
 Identities = 68/161 (42%), Positives = 96/161 (60%), Gaps = 13/161 (8%)
 Frame = +3

Query  3    SLSDTGNYISLTSDGVLQYDGIPSCSVLPYGETFFHHPTGRCSDGRVILDIIAEHYGLAI  182
            S +DTGN++   +     +  +   + LPYGETFFH PTGR S+GR+ILD IAE YGL +
Sbjct  40   SYADTGNFVRFAA----PFIPVIPFNNLPYGETFFHKPTGRASNGRIILDFIAEAYGLPL  95

Query  183  PPPSLSSKAQTGGNNIRQGVNFAVVGSRALPAEFYQKLEIYDTVT-NVSMNDQLHAFQDM  359
             PPSL +       +  +G NFAVVG+ AL   ++ +  I      N S + Q+  F+ +
Sbjct  96   VPPSLDTT-----QSFSKGANFAVVGATALDLSYFMERNITSVPPFNSSFSVQIGWFEQL  150

Query  360  IP-SLCNSPS--DCKNLLENSLFVLGEFGGNDYTHSLLSGK  473
            +  SLCN+ +   C + L+ SLFV+GEFGGNDY   L + K
Sbjct  151  LKTSLCNNTAKGKCDDYLKKSLFVMGEFGGNDYVFLLAANK  191



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2941102238830