BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c24299_g4_i1 len=224 path=[242:0-88 331:89-113 3250:114-120
363:121-173 3499:174-187 430:188-223]

Length=224
                                                                      Score     E

ref|XP_006349261.1|  PREDICTED: putative germin-like protein 2-1-...  92.8    5e-21   
ref|XP_006349268.1|  PREDICTED: germin-like protein subfamily 1 m...  90.9    2e-20   
ref|XP_004230405.1|  PREDICTED: germin-like protein subfamily 1 m...  90.9    2e-20   
ref|XP_006349264.1|  PREDICTED: germin-like protein subfamily 1 m...  90.9    2e-20   
ref|XP_010241946.1|  PREDICTED: putative germin-like protein 2-1      90.1    4e-20   
ref|XP_004230403.1|  PREDICTED: putative germin-like protein 2-1      89.7    7e-20   
ref|XP_006349263.1|  PREDICTED: germin-like protein subfamily 1 m...  89.0    1e-19   
ref|XP_004230404.1|  PREDICTED: putative germin-like protein 2-1      88.6    2e-19   
ref|XP_011013026.1|  PREDICTED: germin-like protein subfamily 1 m...  88.6    2e-19   
ref|XP_011034307.1|  PREDICTED: germin-like protein subfamily 1 m...  88.6    2e-19   
ref|XP_006349267.1|  PREDICTED: germin-like protein subfamily 1 m...  88.2    2e-19   
gb|AFW90592.1|  germin-like protein subfamily 1 member 20 precursor   88.2    2e-19   
ref|XP_009620404.1|  PREDICTED: germin-like protein subfamily 1 m...  87.8    3e-19   
ref|XP_006358459.1|  PREDICTED: germin-like protein subfamily 1 m...  87.8    3e-19   
ref|XP_010251871.1|  PREDICTED: putative germin-like protein 2-1      87.0    6e-19   
ref|XP_010251869.1|  PREDICTED: putative germin-like protein 2-1 ...  87.0    6e-19   
ref|XP_010251870.1|  PREDICTED: putative germin-like protein 2-1 ...  86.7    7e-19   
ref|XP_010251872.1|  PREDICTED: putative germin-like protein 2-1      86.7    8e-19   
ref|XP_009795503.1|  PREDICTED: germin-like protein subfamily 1 m...  86.7    9e-19   
ref|XP_009784933.1|  PREDICTED: germin-like protein subfamily 1 m...  86.7    9e-19   
ref|XP_010251867.1|  PREDICTED: putative germin-like protein 2-1      86.3    1e-18   
ref|XP_009795501.1|  PREDICTED: putative germin-like protein 2-1      85.9    2e-18   
ref|XP_009612543.1|  PREDICTED: germin-like protein subfamily 1 m...  85.9    2e-18   
gb|EYU43092.1|  hypothetical protein MIMGU_mgv1a020152mg              82.8    2e-18   
ref|XP_009620917.1|  PREDICTED: germin-like protein subfamily 1 m...  85.5    2e-18   
ref|XP_009620876.1|  PREDICTED: putative germin-like protein 2-1      85.1    2e-18   
ref|XP_009612541.1|  PREDICTED: germin-like protein subfamily 1 m...  85.5    2e-18   
ref|XP_006346966.1|  PREDICTED: putative germin-like protein 2-1-...  85.1    3e-18   
ref|XP_011099651.1|  PREDICTED: germin-like protein subfamily 1 m...  85.1    3e-18   
gb|KCW64216.1|  hypothetical protein EUGRSUZ_G018672                  81.6    4e-18   
ref|XP_009612542.1|  PREDICTED: putative germin-like protein 2-1      84.7    5e-18   
ref|XP_009786129.1|  PREDICTED: putative germin-like protein 2-1      84.3    5e-18   
ref|XP_006358463.1|  PREDICTED: germin-like protein subfamily 1 m...  84.3    6e-18   
emb|CDP10692.1|  unnamed protein product                              81.3    6e-18   
gb|EYU20547.1|  hypothetical protein MIMGU_mgv1a023357mg              84.3    6e-18   
ref|XP_011099652.1|  PREDICTED: putative germin-like protein 2-1      84.3    7e-18   
gb|EYU40210.1|  hypothetical protein MIMGU_mgv1a022317mg              84.0    8e-18   
ref|XP_011034308.1|  PREDICTED: germin-like protein subfamily 1 m...  84.0    8e-18   
ref|XP_011034305.1|  PREDICTED: germin-like protein subfamily 1 m...  84.0    8e-18   
ref|XP_006349265.1|  PREDICTED: germin-like protein subfamily 1 m...  84.0    8e-18   
gb|EYU28622.1|  hypothetical protein MIMGU_mgv1a018753mg              84.0    9e-18   
ref|XP_006387364.1|  hypothetical protein POPTR_1158s00200g           83.6    1e-17   
gb|EYU20546.1|  hypothetical protein MIMGU_mgv1a013111mg              83.6    1e-17   
gb|EYU20540.1|  hypothetical protein MIMGU_mgv1a013117mg              83.6    1e-17   
ref|XP_009786127.1|  PREDICTED: putative germin-like protein 2-1      83.6    1e-17   
ref|XP_009627660.1|  PREDICTED: germin-like protein subfamily 1 m...  83.6    1e-17   
gb|EYU40209.1|  hypothetical protein MIMGU_mgv1a013129mg              83.2    1e-17   
ref|XP_002319656.2|  hypothetical protein POPTR_0013s04860g           80.9    2e-17   Populus trichocarpa [western balsam poplar]
gb|EYU38444.1|  hypothetical protein MIMGU_mgv1a013102mg              82.8    2e-17   
gb|EYU40211.1|  hypothetical protein MIMGU_mgv1a013108mg              82.8    2e-17   
ref|XP_007030276.1|  RmlC-like cupins superfamily protein             82.4    3e-17   
ref|XP_008780704.1|  PREDICTED: germin-like protein 8-5               81.3    3e-17   
emb|CAN73848.1|  hypothetical protein VITISV_021639                   80.9    3e-17   Vitis vinifera
ref|XP_007030289.1|  RmlC-like cupins superfamily protein             82.4    3e-17   
ref|XP_010027139.1|  PREDICTED: germin-like protein subfamily 1 m...  82.4    3e-17   
ref|XP_002319184.1|  hypothetical protein POPTR_0013s06030g           82.4    3e-17   Populus trichocarpa [western balsam poplar]
ref|XP_010251866.1|  PREDICTED: putative germin-like protein 2-1      82.0    3e-17   
ref|XP_011034444.1|  PREDICTED: germin-like protein subfamily 1 m...  82.0    3e-17   
ref|XP_006358461.1|  PREDICTED: germin-like protein subfamily 1 m...  82.0    4e-17   
ref|XP_010911724.1|  PREDICTED: putative germin-like protein 2-1      82.0    4e-17   
emb|CAN73846.1|  hypothetical protein VITISV_021637                   81.3    4e-17   Vitis vinifera
gb|EYU40208.1|  hypothetical protein MIMGU_mgv1a020439mg              82.0    4e-17   
ref|XP_009625530.1|  PREDICTED: putative germin-like protein 2-1      82.0    4e-17   
ref|XP_010907051.1|  PREDICTED: germin-like protein 12-2              79.7    4e-17   
ref|XP_011034443.1|  PREDICTED: germin-like protein subfamily 1 m...  82.0    4e-17   
ref|XP_002319671.1|  hypothetical protein POPTR_0013s04840g           82.0    4e-17   Populus trichocarpa [western balsam poplar]
emb|CAN73847.1|  hypothetical protein VITISV_021638                   81.6    5e-17   Vitis vinifera
gb|KCW76697.1|  hypothetical protein EUGRSUZ_D01057                   81.6    5e-17   
emb|CAN80134.1|  hypothetical protein VITISV_012033                   81.6    5e-17   Vitis vinifera
gb|KCW80407.1|  hypothetical protein EUGRSUZ_C01764                   81.6    5e-17   
ref|XP_010024911.1|  PREDICTED: germin-like protein subfamily 1 m...  81.6    5e-17   
ref|XP_010066338.1|  PREDICTED: germin-like protein subfamily 1 m...  81.6    5e-17   
ref|XP_011038438.1|  PREDICTED: germin-like protein subfamily 1 m...  81.6    6e-17   
gb|EYU20548.1|  hypothetical protein MIMGU_mgv1a013109mg              81.6    6e-17   
ref|XP_010041605.1|  PREDICTED: germin-like protein subfamily 1 m...  81.6    6e-17   
ref|XP_011038439.1|  PREDICTED: germin-like protein subfamily 1 m...  81.6    6e-17   
ref|XP_002284661.2|  PREDICTED: uncharacterized protein LOC100240807  83.6    6e-17   Vitis vinifera
gb|EYU20545.1|  hypothetical protein MIMGU_mgv1a020779mg              81.6    7e-17   
ref|XP_011034442.1|  PREDICTED: germin-like protein subfamily 1 m...  81.3    7e-17   
ref|XP_002319672.1|  hypothetical protein POPTR_0013s04850g           81.3    8e-17   Populus trichocarpa [western balsam poplar]
emb|CDP10696.1|  unnamed protein product                              78.6    8e-17   
gb|EYU20542.1|  hypothetical protein MIMGU_mgv1a020630mg              81.3    8e-17   
emb|CBI36816.3|  unnamed protein product                              81.3    8e-17   
gb|EYU20549.1|  hypothetical protein MIMGU_mgv1a020596mg              81.3    8e-17   
emb|CDP10694.1|  unnamed protein product                              81.3    9e-17   
ref|XP_009773220.1|  PREDICTED: germin-like protein subfamily 1 m...  80.9    9e-17   
emb|CBI39473.3|  unnamed protein product                              80.9    9e-17   
emb|CDP10693.1|  unnamed protein product                              80.9    1e-16   
ref|XP_010911182.1|  PREDICTED: putative germin-like protein 2-1      80.9    1e-16   
gb|EYU20541.1|  hypothetical protein MIMGU_mgv1a018988mg              80.9    1e-16   
gb|KCW82831.1|  hypothetical protein EUGRSUZ_C04202                   80.9    1e-16   
ref|XP_008780761.1|  PREDICTED: germin-like protein 8-5               79.7    1e-16   
gb|KCW80409.1|  hypothetical protein EUGRSUZ_C01766                   80.9    1e-16   
ref|XP_010024913.1|  PREDICTED: germin-like protein subfamily 1 m...  80.9    1e-16   
ref|XP_010051708.1|  PREDICTED: germin-like protein subfamily 1 m...  80.9    1e-16   
ref|XP_002284284.2|  PREDICTED: germin-like protein subfamily 1 m...  80.9    1e-16   Vitis vinifera
gb|KCW61438.1|  hypothetical protein EUGRSUZ_H04168                   80.5    1e-16   
ref|XP_002280481.2|  PREDICTED: uncharacterized protein LOC100252737  83.6    1e-16   Vitis vinifera
ref|XP_002530594.1|  Rhicadhesin receptor precursor, putative         80.1    1e-16   Ricinus communis
ref|XP_007030278.1|  Germin-like protein subfamily 1 member 18        82.8    1e-16   
ref|XP_010049990.1|  PREDICTED: germin-like protein subfamily 1 m...  80.5    1e-16   
ref|XP_011034445.1|  PREDICTED: germin-like protein subfamily 1 m...  80.5    1e-16   
ref|XP_010048594.1|  PREDICTED: germin-like protein subfamily 1 m...  80.5    1e-16   
ref|XP_009630507.1|  PREDICTED: germin-like protein subfamily 1 m...  80.5    1e-16   
gb|EYU20539.1|  hypothetical protein MIMGU_mgv1a013072mg              80.5    1e-16   
ref|XP_002284320.1|  PREDICTED: germin-like protein subfamily 1 m...  80.5    1e-16   Vitis vinifera
ref|XP_010659615.1|  PREDICTED: germin-like protein subfamily 1 m...  80.5    1e-16   
ref|XP_002531992.1|  Rhicadhesin receptor precursor, putative         80.1    2e-16   Ricinus communis
emb|CBI36783.3|  unnamed protein product                              80.5    2e-16   
ref|XP_011038440.1|  PREDICTED: germin-like protein subfamily 1 m...  80.1    2e-16   
ref|XP_010024917.1|  PREDICTED: germin-like protein subfamily 1 m...  80.1    2e-16   
ref|XP_006358464.1|  PREDICTED: germin-like protein subfamily 1 m...  80.1    2e-16   
ref|XP_006358462.1|  PREDICTED: germin-like protein subfamily 1 m...  80.1    2e-16   
ref|XP_007030272.1|  RmlC-like cupins superfamily protein             80.1    2e-16   
ref|XP_010907049.1|  PREDICTED: LOW QUALITY PROTEIN: germin-like ...  79.7    2e-16   
ref|XP_010066342.1|  PREDICTED: germin-like protein subfamily 1 m...  79.7    3e-16   
ref|XP_010054506.1|  PREDICTED: uncharacterized protein LOC104442816  81.6    3e-16   
ref|XP_007030263.1|  Germin-like protein subfamily 1 member 18        80.1    3e-16   
ref|XP_010027145.1|  PREDICTED: germin-like protein subfamily 1 m...  79.7    3e-16   
ref|XP_008779597.1|  PREDICTED: putative germin-like protein 2-1      77.4    3e-16   
ref|XP_010024923.1|  PREDICTED: germin-like protein subfamily 1 m...  79.7    3e-16   
ref|XP_010066343.1|  PREDICTED: germin-like protein subfamily 1 m...  79.7    3e-16   
ref|XP_010050748.1|  PREDICTED: uncharacterized protein LOC104439371  81.6    3e-16   
ref|XP_010024926.1|  PREDICTED: germin-like protein subfamily 1 m...  79.3    3e-16   
ref|XP_010024924.1|  PREDICTED: germin-like protein subfamily 1 m...  79.3    3e-16   
ref|NP_001267943.1|  germin-like protein 4 precursor                  79.3    3e-16   
gb|KCW61442.1|  hypothetical protein EUGRSUZ_H04173                   79.3    3e-16   
emb|CAN61141.1|  hypothetical protein VITISV_024669                   79.0    4e-16   Vitis vinifera
ref|XP_009385875.1|  PREDICTED: putative germin-like protein 2-1      79.3    4e-16   
emb|CBI36811.3|  unnamed protein product                              79.3    4e-16   
ref|XP_008780786.1|  PREDICTED: germin-like protein 8-5               77.8    5e-16   
ref|XP_002319674.2|  hypothetical protein POPTR_0013s04920g           79.0    5e-16   Populus trichocarpa [western balsam poplar]
emb|CAN74828.1|  hypothetical protein VITISV_002139                   78.6    5e-16   Vitis vinifera
ref|XP_010050166.1|  PREDICTED: germin-like protein subfamily 1 m...  79.0    5e-16   
ref|XP_009786133.1|  PREDICTED: germin-like protein subfamily 1 m...  77.8    5e-16   
ref|XP_002284343.2|  PREDICTED: uncharacterized protein LOC100256308  81.3    5e-16   Vitis vinifera
ref|XP_009341765.1|  PREDICTED: germin-like protein subfamily 1 m...  79.0    5e-16   
ref|XP_002276756.2|  PREDICTED: putative germin-like protein 2-1      79.0    5e-16   Vitis vinifera
ref|XP_010048221.1|  PREDICTED: germin-like protein subfamily 1 m...  79.0    5e-16   
ref|XP_002523177.1|  Rhicadhesin receptor precursor, putative         79.0    5e-16   Ricinus communis
ref|XP_010659820.1|  PREDICTED: germin-like protein 3 isoform X1      78.6    6e-16   
gb|KCW82834.1|  hypothetical protein EUGRSUZ_C04205                   79.0    6e-16   
gb|EYU20535.1|  hypothetical protein MIMGU_mgv1a013054mg              79.0    6e-16   
emb|CBI36791.3|  unnamed protein product                              78.6    6e-16   
emb|CDP16789.1|  unnamed protein product                              80.9    6e-16   
gb|KCW64218.1|  hypothetical protein EUGRSUZ_G01868                   78.6    6e-16   
ref|XP_007030265.1|  Germin-like protein 2                            78.6    7e-16   
ref|XP_010027136.1|  PREDICTED: uncharacterized protein LOC104417584  80.9    7e-16   
ref|XP_010662281.1|  PREDICTED: putative germin-like protein 2-1      78.2    7e-16   
gb|KCW44233.1|  hypothetical protein EUGRSUZ_L02343                   78.6    7e-16   
ref|XP_002531991.1|  Rhicadhesin receptor precursor, putative         78.2    7e-16   Ricinus communis
ref|XP_002276644.1|  PREDICTED: putative germin-like protein 2-1      78.6    7e-16   Vitis vinifera
emb|CDP16787.1|  unnamed protein product                              78.2    9e-16   
gb|EYU20536.1|  hypothetical protein MIMGU_mgv1a025658mg              78.2    9e-16   
ref|XP_002284624.1|  PREDICTED: germin-like protein subfamily 1 m...  78.2    9e-16   Vitis vinifera
ref|XP_009402547.1|  PREDICTED: putative germin-like protein 2-1 ...  78.2    9e-16   
ref|XP_006354543.1|  PREDICTED: germin-like protein subfamily 1 m...  78.2    1e-15   
ref|XP_010659856.1|  PREDICTED: germin-like protein subfamily 1 m...  78.2    1e-15   
ref|NP_001268128.1|  germin-like protein 5                            78.2    1e-15   
emb|CBI36778.3|  unnamed protein product                              81.6    1e-15   
ref|XP_008363404.1|  PREDICTED: LOW QUALITY PROTEIN: germin-like ...  78.2    1e-15   
ref|XP_010257844.1|  PREDICTED: putative germin-like protein 2-1      78.2    1e-15   
ref|XP_008778853.1|  PREDICTED: putative germin-like protein 2-1      78.2    1e-15   
ref|XP_002523178.1|  Rhicadhesin receptor precursor, putative         77.8    1e-15   Ricinus communis
emb|CDP10695.1|  unnamed protein product                              77.8    1e-15   
ref|XP_010041604.1|  PREDICTED: germin-like protein subfamily 1 m...  77.8    1e-15   
ref|XP_008393482.1|  PREDICTED: germin-like protein subfamily 1 m...  78.2    1e-15   
ref|XP_004247722.1|  PREDICTED: germin-like protein subfamily 1 m...  77.8    1e-15   
ref|XP_002284682.1|  PREDICTED: germin-like protein subfamily 1 m...  77.8    1e-15   Vitis vinifera
ref|XP_007030273.1|  RmlC-like cupins superfamily protein             77.8    1e-15   
ref|XP_010024920.1|  PREDICTED: germin-like protein subfamily 1 m...  77.8    1e-15   
emb|CDP10932.1|  unnamed protein product                              77.8    1e-15   
ref|XP_002284616.2|  PREDICTED: germin-like protein subfamily 1 m...  77.8    1e-15   Vitis vinifera
ref|XP_011099650.1|  PREDICTED: germin-like protein subfamily 1 m...  77.8    1e-15   
ref|XP_007201630.1|  hypothetical protein PRUPE_ppa020060mg           77.8    1e-15   
emb|CAN82524.1|  hypothetical protein VITISV_028056                   77.4    2e-15   Vitis vinifera
ref|XP_010024921.1|  PREDICTED: germin-like protein subfamily 1 m...  77.4    2e-15   
ref|XP_008237387.1|  PREDICTED: germin-like protein subfamily 1 m...  77.8    2e-15   
ref|XP_006375870.1|  germin-like protein 1                            77.4    2e-15   
ref|XP_010042132.1|  PREDICTED: germin-like protein subfamily 1 m...  77.4    2e-15   
ref|XP_006845853.1|  hypothetical protein AMTR_s00154p00039580        77.0    2e-15   
ref|XP_004291649.1|  PREDICTED: germin-like protein subfamily 1 m...  77.4    2e-15   
ref|XP_008778966.1|  PREDICTED: putative germin-like protein 2-1      77.4    2e-15   
ref|XP_008393483.1|  PREDICTED: germin-like protein subfamily 1 m...  77.4    2e-15   
gb|KHN14793.1|  Germin-like protein subfamily 1 member 16             76.6    2e-15   
ref|XP_008367619.1|  PREDICTED: germin-like protein subfamily 1 m...  77.4    2e-15   
ref|XP_008351931.1|  PREDICTED: germin-like protein subfamily 1 m...  77.4    2e-15   
ref|XP_008375054.1|  PREDICTED: germin-like protein subfamily 1 m...  77.0    2e-15   
emb|CBI36812.3|  unnamed protein product                              79.3    2e-15   
ref|XP_010052624.1|  PREDICTED: germin-like protein subfamily 1 m...  77.0    2e-15   
ref|XP_010024918.1|  PREDICTED: germin-like protein subfamily 1 m...  77.0    2e-15   
emb|CDP16790.1|  unnamed protein product                              77.0    2e-15   
ref|XP_009349816.1|  PREDICTED: germin-like protein subfamily 1 m...  77.0    2e-15   
ref|XP_010024919.1|  PREDICTED: germin-like protein subfamily 1 m...  77.0    2e-15   
emb|CBI36780.3|  unnamed protein product                              77.8    2e-15   
emb|CBI33611.3|  unnamed protein product                              77.4    3e-15   
gb|KCW61441.1|  hypothetical protein EUGRSUZ_H04171                   77.0    3e-15   
ref|NP_001267944.1|  germin-like protein 7 precursor                  77.0    3e-15   
emb|CBI39477.3|  unnamed protein product                              77.0    3e-15   
ref|XP_008360941.1|  PREDICTED: germin-like protein subfamily 1 m...  77.0    3e-15   
emb|CAN80133.1|  hypothetical protein VITISV_012032                   76.6    3e-15   Vitis vinifera
ref|XP_006375874.1|  germin-like protein 1                            76.6    3e-15   
ref|XP_010024912.1|  PREDICTED: germin-like protein subfamily 1 m...  76.6    3e-15   
gb|KCW61436.1|  hypothetical protein EUGRSUZ_H04166                   76.6    3e-15   
ref|XP_007201690.1|  hypothetical protein PRUPE_ppa016952mg           76.3    3e-15   
ref|XP_009402555.1|  PREDICTED: putative germin-like protein 2-2 ...  76.6    3e-15   
emb|CDP22064.1|  unnamed protein product                              76.6    3e-15   
ref|XP_009402554.1|  PREDICTED: germin-like protein 12-2 isoform X2   76.6    4e-15   
ref|XP_009402552.1|  PREDICTED: germin-like protein 12-2 isoform X1   76.6    4e-15   
ref|XP_009402556.1|  PREDICTED: putative germin-like protein 2-2 ...  76.3    4e-15   
ref|XP_009606432.1|  PREDICTED: germin-like protein subfamily 1 m...  76.6    4e-15   
ref|XP_002276315.2|  PREDICTED: putative germin-like protein 2-1      76.6    4e-15   Vitis vinifera
ref|XP_006375871.1|  hypothetical protein POPTR_0013s04880g           76.3    4e-15   
ref|XP_008776811.1|  PREDICTED: putative germin-like protein 2-1 ...  76.3    4e-15   
ref|XP_006845051.1|  hypothetical protein AMTR_s00794p00001640        76.3    4e-15   
ref|XP_008776810.1|  PREDICTED: putative germin-like protein 2-1 ...  76.3    4e-15   
emb|CAN74480.1|  hypothetical protein VITISV_042844                   75.9    4e-15   Vitis vinifera
ref|XP_007200176.1|  hypothetical protein PRUPE_ppa016529mg           76.3    4e-15   
ref|XP_003536153.1|  PREDICTED: germin-like protein subfamily 1 m...  76.3    4e-15   
ref|XP_007201148.1|  hypothetical protein PRUPE_ppa016020mg           76.3    5e-15   
ref|XP_008393146.1|  PREDICTED: germin-like protein subfamily 1 m...  76.3    5e-15   
gb|KHN14792.1|  Germin-like protein subfamily 1 member 7              76.3    5e-15   
emb|CDP10146.1|  unnamed protein product                              76.3    5e-15   
ref|XP_007199217.1|  hypothetical protein PRUPE_ppa021882mg           76.3    5e-15   
gb|KCW76699.1|  hypothetical protein EUGRSUZ_D01059                   76.3    5e-15   
gb|KDP23768.1|  hypothetical protein JCGZ_23601                       76.3    5e-15   
ref|XP_010549631.1|  PREDICTED: germin-like protein subfamily 1 m...  75.1    5e-15   
ref|XP_002280455.1|  PREDICTED: germin-like protein subfamily 1 m...  75.5    6e-15   Vitis vinifera
emb|CDP21353.1|  unnamed protein product                              78.2    6e-15   
gb|KDP23764.1|  hypothetical protein JCGZ_23597                       75.9    6e-15   
ref|XP_008807191.1|  PREDICTED: putative germin-like protein 2-1      75.9    6e-15   
ref|XP_003535383.1|  PREDICTED: LOW QUALITY PROTEIN: germin-like ...  76.3    6e-15   
ref|XP_006840195.1|  hypothetical protein AMTR_s00089p00119070        75.9    6e-15   
ref|XP_006840206.1|  hypothetical protein AMTR_s00089p00127600        75.9    7e-15   
ref|XP_004301229.1|  PREDICTED: germin-like protein subfamily 1 m...  75.9    7e-15   
ref|XP_002530595.1|  Oxalate oxidase 2 precursor, putative            75.9    7e-15   Ricinus communis
ref|XP_009773221.1|  PREDICTED: germin-like protein subfamily 1 m...  75.9    7e-15   
ref|XP_008808516.1|  PREDICTED: putative germin-like protein 2-1      75.9    7e-15   
ref|XP_003633723.2|  PREDICTED: putative germin-like protein 2-1      75.9    7e-15   
emb|CBI36790.3|  unnamed protein product                              75.5    7e-15   
ref|XP_007200183.1|  hypothetical protein PRUPE_ppa016284mg           75.9    7e-15   
ref|XP_002265608.1|  PREDICTED: putative germin-like protein 2-1      75.5    8e-15   Vitis vinifera
ref|XP_002517295.1|  Nectarin-1 precursor, putative                   74.3    8e-15   Ricinus communis
emb|CAN70189.1|  hypothetical protein VITISV_016562                   75.5    8e-15   Vitis vinifera
emb|CBI33612.3|  unnamed protein product                              75.5    8e-15   
ref|XP_003633724.1|  PREDICTED: putative germin-like protein 2-1      75.5    8e-15   
emb|CBI36782.3|  unnamed protein product                              75.5    8e-15   
ref|XP_010050174.1|  PREDICTED: germin-like protein subfamily 1 m...  75.5    8e-15   
ref|XP_007030284.1|  RmlC-like cupins superfamily protein             75.5    9e-15   
ref|XP_007030281.1|  RmlC-like cupins superfamily protein isoform 2   75.5    9e-15   
emb|CAN71140.1|  hypothetical protein VITISV_005471                   75.5    9e-15   Vitis vinifera
emb|CBI36810.3|  unnamed protein product                              75.9    9e-15   
emb|CAN71348.1|  hypothetical protein VITISV_024253                   75.5    9e-15   Vitis vinifera
emb|CBI33610.3|  unnamed protein product                              76.3    9e-15   
ref|XP_007030280.1|  RmlC-like cupins superfamily protein isoform 1   75.5    9e-15   
ref|XP_009402551.1|  PREDICTED: putative germin-like protein 2-1      75.5    1e-14   
emb|CAN62429.1|  hypothetical protein VITISV_005171                   75.1    1e-14   Vitis vinifera
ref|XP_009402550.1|  PREDICTED: putative germin-like protein 2-1      75.5    1e-14   
ref|XP_008237521.1|  PREDICTED: germin-like protein subfamily 1 m...  75.5    1e-14   
ref|XP_007143989.1|  hypothetical protein PHAVU_007G119700g           75.1    1e-14   
ref|XP_003633711.2|  PREDICTED: putative germin-like protein 2-1      75.1    1e-14   
ref|XP_009388254.1|  PREDICTED: putative germin-like protein 2-2      74.7    1e-14   
ref|XP_007143990.1|  hypothetical protein PHAVU_007G119700g           75.1    1e-14   
ref|XP_002517291.1|  Rhicadhesin receptor precursor, putative         74.7    1e-14   Ricinus communis
ref|XP_002265857.1|  PREDICTED: putative germin-like protein 2-1      75.1    1e-14   Vitis vinifera
gb|KCW61445.1|  hypothetical protein EUGRSUZ_H04176                   75.1    1e-14   
emb|CAB65370.1|  germin-like protein                                  74.7    1e-14   Pisum sativum [garden pea]
emb|CAN70904.1|  hypothetical protein VITISV_032927                   74.7    1e-14   Vitis vinifera
ref|XP_002517294.1|  Rhicadhesin receptor precursor, putative         74.7    1e-14   Ricinus communis
emb|CAN66771.1|  hypothetical protein VITISV_022559                   74.7    1e-14   Vitis vinifera
ref|XP_002517292.1|  Auxin-binding protein ABP19a precursor, puta...  75.1    1e-14   Ricinus communis
ref|XP_010549630.1|  PREDICTED: germin-like protein subfamily 1 m...  74.3    1e-14   
ref|XP_008775104.1|  PREDICTED: putative germin-like protein 2-1      75.1    1e-14   
ref|XP_002517296.1|  Auxin-binding protein ABP19a precursor, puta...  74.7    1e-14   Ricinus communis
ref|XP_008240380.1|  PREDICTED: germin-like protein subfamily 1 m...  75.1    1e-14   
ref|XP_010027143.1|  PREDICTED: uncharacterized protein LOC104417591  77.0    1e-14   
ref|XP_007210592.1|  hypothetical protein PRUPE_ppa016616mg           74.7    1e-14   
ref|XP_009622800.1|  PREDICTED: germin-like protein subfamily 1 m...  74.7    2e-14   
ref|XP_008371812.1|  PREDICTED: germin-like protein subfamily 1 m...  74.7    2e-14   
gb|EYU40207.1|  hypothetical protein MIMGU_mgv1a012993mg              74.7    2e-14   
gb|EPS67173.1|  hypothetical protein M569_07603                       74.7    2e-14   
emb|CAN72994.1|  hypothetical protein VITISV_000563                   74.7    2e-14   
ref|NP_001237300.1|  uncharacterized protein LOC100527781 precursor   74.7    2e-14   
ref|XP_004513532.1|  PREDICTED: germin-like protein subfamily 1 m...  74.7    2e-14   
gb|KCW76698.1|  hypothetical protein EUGRSUZ_D01058                   74.3    2e-14   
ref|XP_010024915.1|  PREDICTED: putative germin-like protein 2-1      74.7    2e-14   
ref|XP_009402546.1|  PREDICTED: germin-like protein 12-2              74.7    2e-14   
emb|CAN71631.1|  hypothetical protein VITISV_015711                   74.3    2e-14   
ref|XP_007030274.1|  Germin-like protein subfamily 1 member 18        77.4    2e-14   
ref|XP_002533207.1|  Rhicadhesin receptor precursor, putative         75.1    2e-14   
gb|EMT15738.1|  hypothetical protein F775_52631                       74.3    2e-14   
gb|KCW61443.1|  hypothetical protein EUGRSUZ_H04174                   74.7    2e-14   
ref|XP_009385876.1|  PREDICTED: germin-like protein 12-2              74.7    2e-14   
gb|KCW61437.1|  hypothetical protein EUGRSUZ_H04167                   74.7    2e-14   
ref|XP_007201563.1|  hypothetical protein PRUPE_ppa018105mg           74.3    2e-14   
ref|NP_001268198.1|  germin-like protein 3 precursor                  74.3    2e-14   
emb|CDP10933.1|  unnamed protein product                              74.3    2e-14   
gb|KCW61456.1|  hypothetical protein EUGRSUZ_H04192                   74.3    2e-14   
ref|XP_008243694.1|  PREDICTED: germin-like protein 9-1               76.3    3e-14   
ref|XP_006354495.1|  PREDICTED: germin-like protein subfamily 1 m...  73.9    3e-14   
ref|XP_009773430.1|  PREDICTED: germin-like protein subfamily 1 m...  73.9    3e-14   
ref|XP_006354496.1|  PREDICTED: germin-like protein subfamily 1 m...  73.9    3e-14   
ref|XP_009402558.1|  PREDICTED: putative germin-like protein 2-1      73.9    3e-14   
ref|XP_010050157.1|  PREDICTED: germin-like protein subfamily 1 m...  73.9    3e-14   
emb|CAN63888.1|  hypothetical protein VITISV_027217                   72.8    3e-14   
ref|XP_010941821.1|  PREDICTED: putative germin-like protein 2-1      73.6    3e-14   
emb|CAN74481.1|  hypothetical protein VITISV_042845                   73.6    3e-14   
ref|XP_008358299.1|  PREDICTED: LOW QUALITY PROTEIN: germin-like ...  73.6    3e-14   
ref|XP_010051709.1|  PREDICTED: germin-like protein subfamily 1 m...  73.9    4e-14   
emb|CAN63889.1|  hypothetical protein VITISV_027218                   73.6    4e-14   
ref|XP_010049992.1|  PREDICTED: germin-like protein subfamily 1 m...  73.6    4e-14   
emb|CDP16788.1|  unnamed protein product                              73.6    4e-14   
ref|XP_010049995.1|  PREDICTED: germin-like protein subfamily 1 m...  73.6    4e-14   
ref|XP_010049993.1|  PREDICTED: germin-like protein subfamily 1 m...  73.6    4e-14   
ref|XP_010051710.1|  PREDICTED: germin-like protein subfamily 1 m...  73.6    4e-14   
ref|XP_002522034.1|  Rhicadhesin receptor precursor, putative         73.6    4e-14   
ref|XP_010660483.1|  PREDICTED: germin-like protein 8-2               72.4    4e-14   
ref|XP_009402557.1|  PREDICTED: putative germin-like protein 2-1      73.6    4e-14   
ref|XP_010049996.1|  PREDICTED: germin-like protein subfamily 1 m...  73.6    4e-14   
ref|XP_002276926.2|  PREDICTED: uncharacterized protein LOC100251187  75.9    4e-14   
ref|XP_002265297.3|  PREDICTED: uncharacterized protein LOC100247931  75.9    4e-14   
gb|EMT00501.1|  Germin-like protein 8-5                               73.6    5e-14   
ref|XP_002281186.2|  PREDICTED: uncharacterized protein LOC100244552  75.9    5e-14   
gb|KCW44232.1|  hypothetical protein EUGRSUZ_L02342                   73.6    5e-14   
gb|KHN28992.1|  Germin-like protein 12-1                              73.2    5e-14   
gb|KHN28993.1|  Germin-like protein 12-1                              73.2    5e-14   
ref|XP_004513533.1|  PREDICTED: germin-like protein subfamily 1 m...  73.6    5e-14   
gb|EMS64312.1|  Germin-like protein 8-5                               73.6    5e-14   
ref|XP_007199406.1|  hypothetical protein PRUPE_ppa026225mg           73.6    5e-14   
ref|XP_002265447.3|  PREDICTED: uncharacterized protein LOC100242782  75.5    5e-14   
ref|XP_008237525.1|  PREDICTED: germin-like protein subfamily 1 m...  73.6    5e-14   
gb|AAX84674.1|  germin-like protein GLP                               73.2    5e-14   
ref|NP_001240963.1|  germin-like protein subfamily 1 member 7-lik...  73.6    5e-14   
ref|XP_008381868.1|  PREDICTED: germin-like protein subfamily 1 m...  73.2    5e-14   
emb|CAN79051.1|  hypothetical protein VITISV_025926                   73.2    5e-14   
ref|XP_002525480.1|  Rhicadhesin receptor precursor, putative         72.8    5e-14   
ref|XP_002270404.2|  PREDICTED: putative germin-like protein 2-1      73.2    5e-14   
gb|KDP23774.1|  hypothetical protein JCGZ_23607                       74.3    5e-14   
ref|XP_003574976.1|  PREDICTED: putative germin-like protein 2-2 ...  73.2    6e-14   
emb|CAB55559.1|  germin-like protein                                  73.2    6e-14   
ref|XP_010235436.1|  PREDICTED: putative germin-like protein 2-2 ...  73.2    6e-14   
ref|XP_007140903.1|  hypothetical protein PHAVU_008G1509000g          71.2    6e-14   
ref|XP_009355938.1|  PREDICTED: germin-like protein subfamily 1 m...  73.2    6e-14   
gb|KDO42113.1|  hypothetical protein CISIN_1g027369mg                 73.2    6e-14   
gb|KDP32127.1|  hypothetical protein JCGZ_12588                       73.2    6e-14   
emb|CAN63434.1|  hypothetical protein VITISV_033830                   73.2    6e-14   
gb|EMS48827.1|  Germin-like protein 8-5                               73.2    7e-14   
ref|XP_006377942.1|  germin-like protein 1                            72.8    7e-14   
ref|XP_003604731.1|  Germin-like protein subfamily 1 member           73.2    7e-14   
ref|XP_003604729.1|  Germin-like protein subfamily 1 member           72.8    7e-14   
ref|NP_001267940.1|  germin-like protein 1                            72.8    7e-14   
ref|NP_001241319.1|  germin-like protein subfamily 1 member 7-lik...  72.8    7e-14   
ref|XP_010024914.1|  PREDICTED: putative germin-like protein 2-1      72.8    7e-14   
ref|XP_011037727.1|  PREDICTED: putative germin-like protein 2-2      72.8    7e-14   
emb|CAB65371.1|  germin-like protein                                  72.8    8e-14   
ref|XP_003553909.1|  PREDICTED: germin-like protein subfamily 1 m...  72.8    8e-14   
gb|KHN04965.1|  Germin-like protein subfamily 1 member 7              72.8    8e-14   
gb|AAL15887.1|AF417299_1  putative germin                             72.4    8e-14   
ref|XP_011075124.1|  PREDICTED: putative germin-like protein 2-1 ...  72.8    8e-14   
ref|XP_011075123.1|  PREDICTED: putative germin-like protein 2-1 ...  72.8    8e-14   
gb|KDP23765.1|  hypothetical protein JCGZ_23598                       73.9    8e-14   
ref|XP_010662282.1|  PREDICTED: putative germin-like protein 2-1      72.4    8e-14   
ref|XP_002299047.1|  germin-like protein 1                            72.8    8e-14   
gb|EMS61024.1|  Putative germin-like protein 2-1                      72.8    9e-14   
gb|KHN28990.1|  Germin-like protein subfamily 1 member 7              72.8    9e-14   
ref|XP_004972687.1|  PREDICTED: germin-like protein 12-2-like         72.4    1e-13   
gb|AAG00425.1|AF250933_1  germin A                                    72.4    1e-13   
emb|CBI36814.3|  unnamed protein product                              72.4    1e-13   
ref|XP_006599050.1|  PREDICTED: germin-like protein subfamily 1 m...  72.4    1e-13   
ref|XP_002521437.1|  Rhicadhesin receptor precursor, putative         72.4    1e-13   
gb|ACT22757.1|  GER4h                                                 72.4    1e-13   
gb|ACT22756.1|  GER4a                                                 72.4    1e-13   
ref|XP_011075119.1|  PREDICTED: putative germin-like protein 2-1 ...  72.4    1e-13   
emb|CBI36815.3|  unnamed protein product                              72.4    1e-13   
gb|EMT32553.1|  Putative germin-like protein 2-2                      72.4    1e-13   
ref|XP_011002008.1|  PREDICTED: germin-like protein subfamily 1 m...  72.4    1e-13   
ref|XP_010027140.1|  PREDICTED: uncharacterized protein LOC104417587  74.7    1e-13   
gb|KHN10835.1|  Germin-like protein 12-1                              72.0    1e-13   
ref|XP_011075120.1|  PREDICTED: putative germin-like protein 2-1 ...  72.4    1e-13   
ref|XP_011075121.1|  PREDICTED: putative germin-like protein 2-1 ...  72.4    1e-13   
ref|XP_008662708.1|  PREDICTED: putative germin-like protein 12-4     72.4    1e-13   
ref|XP_008237526.1|  PREDICTED: germin-like protein subfamily 1 m...  72.4    1e-13   
ref|XP_011039785.1|  PREDICTED: putative germin-like protein 2-1      72.4    1e-13   
gb|EAZ23098.1|  hypothetical protein OsJ_06792                        72.0    1e-13   
ref|XP_008243693.1|  PREDICTED: germin-like protein subfamily 1 m...  72.0    1e-13   
gb|KFK33230.1|  hypothetical protein AALP_AA6G347300                  72.0    1e-13   
ref|NP_001152592.1|  LOC100286232 precursor                           72.0    1e-13   
gb|KDP23769.1|  hypothetical protein JCGZ_23602                       72.0    1e-13   
ref|XP_010049991.1|  PREDICTED: germin-like protein subfamily 1 m...  72.0    1e-13   
gb|ACF87348.1|  unknown                                               69.7    1e-13   
emb|CDP16791.1|  unnamed protein product                              72.0    1e-13   
gb|ACJ64505.1|  germin-like protein                                   72.0    1e-13   
ref|NP_001046874.1|  Os02g0491600                                     72.0    2e-13   
ref|XP_007030283.1|  RmlC-like cupins superfamily protein             71.6    2e-13   
ref|XP_009357348.1|  PREDICTED: germin-like protein subfamily 1 m...  72.0    2e-13   
ref|XP_009414512.1|  PREDICTED: putative germin-like protein 2-1      72.0    2e-13   
ref|XP_006358460.1|  PREDICTED: LOW QUALITY PROTEIN: germin-like ...  72.0    2e-13   
gb|KHN04147.1|  Germin-like protein 12-1                              71.2    2e-13   
gb|EMS53400.1|  Putative germin-like protein 2-1                      72.0    2e-13   
emb|CAN74366.1|  hypothetical protein VITISV_015882                   71.6    2e-13   
ref|NP_001238673.1|  uncharacterized protein LOC100527866 precursor   71.6    2e-13   
ref|XP_004290344.1|  PREDICTED: germin-like protein subfamily 1 m...  71.6    2e-13   
gb|EYU43218.1|  hypothetical protein MIMGU_mgv1a019377mg              71.6    2e-13   
emb|CDP10701.1|  unnamed protein product                              71.6    2e-13   
ref|XP_010689305.1|  PREDICTED: germin-like protein                   71.6    2e-13   
gb|ACG69478.1|  germin-like protein 2                                 71.6    2e-13   
ref|XP_007140907.1|  hypothetical protein PHAVU_008G151200g           71.6    2e-13   
ref|XP_009419544.1|  PREDICTED: putative germin-like protein 2-1      71.6    2e-13   
ref|XP_003553592.1|  PREDICTED: germin-like protein subfamily 1 m...  71.6    2e-13   
gb|EMT15740.1|  Germin-like protein 8-5                               71.6    2e-13   
ref|XP_006597669.1|  PREDICTED: putative germin-like protein 2-1-...  71.2    2e-13   
gb|EMS56245.1|  Germin-like protein 8-5                               71.6    2e-13   
ref|XP_002452098.1|  hypothetical protein SORBIDRAFT_04g019650        71.2    2e-13   
ref|XP_009766872.1|  PREDICTED: germin-like protein subfamily 1 m...  71.6    2e-13   
ref|XP_008808107.1|  PREDICTED: putative germin-like protein 2-1 ...  71.2    2e-13   
sp|Q6K5P9.1|GL22_ORYSJ  RecName: Full=Putative germin-like protei...  71.2    3e-13   
ref|XP_002445171.1|  hypothetical protein SORBIDRAFT_07g005230        71.2    3e-13   
ref|XP_006443312.1|  hypothetical protein CICLE_v10022118mg           71.2    3e-13   
ref|XP_006586856.1|  PREDICTED: putative germin-like protein 2-1-...  71.2    3e-13   
ref|XP_008808106.1|  PREDICTED: putative germin-like protein 2-1 ...  71.2    3e-13   
ref|XP_002452101.1|  hypothetical protein SORBIDRAFT_04g019700        71.2    3e-13   
ref|XP_006586854.1|  PREDICTED: putative germin-like protein 2-1-...  71.2    3e-13   
ref|XP_006371120.1|  hypothetical protein POPTR_0019s04280g           71.2    3e-13   
gb|KDO38410.1|  hypothetical protein CISIN_1g048538mg                 70.9    3e-13   
ref|XP_003535109.1|  PREDICTED: putative germin-like protein 2-1-...  71.2    3e-13   
gb|AFK49577.1|  unknown                                               71.2    3e-13   
ref|XP_011002009.1|  PREDICTED: germin-like protein subfamily 1 m...  71.2    3e-13   
emb|CDP16786.1|  unnamed protein product                              73.9    3e-13   
ref|XP_006345377.1|  PREDICTED: germin-like protein subfamily 1 m...  71.2    3e-13   
ref|XP_003546275.1|  PREDICTED: putative germin-like protein 2-1-...  71.2    3e-13   
ref|XP_008381865.1|  PREDICTED: LOW QUALITY PROTEIN: germin-like ...  70.9    3e-13   
ref|XP_006597667.1|  PREDICTED: putative germin-like protein 2-1-...  71.2    3e-13   
ref|XP_006586855.1|  PREDICTED: putative germin-like protein 2-1-...  70.9    3e-13   
gb|KDP45119.1|  hypothetical protein JCGZ_17451                       71.2    3e-13   
ref|XP_006442440.1|  hypothetical protein CICLE_v10023726mg           70.9    3e-13   
ref|XP_006597668.1|  PREDICTED: putative germin-like protein 2-1-...  70.9    3e-13   
ref|XP_002277055.1|  PREDICTED: putative germin-like protein 2-1      70.9    3e-13   
ref|XP_006371122.1|  Germin-like protein subfamily 1 member 6 pre...  70.9    3e-13   
ref|XP_008777419.1|  PREDICTED: uncharacterized protein LOC103697358  73.2    4e-13   
ref|XP_009758327.1|  PREDICTED: LOW QUALITY PROTEIN: germin-like ...  70.9    4e-13   
ref|XP_008237522.1|  PREDICTED: germin-like protein subfamily 1 m...  70.9    4e-13   
ref|XP_008237524.1|  PREDICTED: germin-like protein subfamily 1 m...  70.9    4e-13   
ref|XP_003604730.1|  Germin-like protein subfamily 1 member           70.9    4e-13   
emb|CDP22258.1|  unnamed protein product                              69.7    4e-13   
gb|AFK39387.1|  unknown                                               70.9    4e-13   
ref|XP_006442447.1|  hypothetical protein CICLE_v10024005mg           70.9    4e-13   
ref|XP_003593910.1|  Germin-like protein subfamily 1 member           70.9    4e-13   
ref|XP_002276445.2|  PREDICTED: uncharacterized protein LOC100254460  73.2    4e-13   
gb|KCW61433.1|  hypothetical protein EUGRSUZ_H04161                   70.9    4e-13   
ref|XP_004247725.2|  PREDICTED: uncharacterized protein LOC101250545  73.6    4e-13   
ref|XP_006840196.1|  hypothetical protein AMTR_s00089p00119480        70.5    5e-13   
ref|XP_007030176.1|  Germin-like protein subfamily 1 member 18        71.2    5e-13   
ref|NP_001152473.1|  germin-like protein subfamily 1 member 11 pr...  70.5    5e-13   
ref|XP_009113441.1|  PREDICTED: germin-like protein subfamily 1 m...  70.5    5e-13   
ref|XP_011012323.1|  PREDICTED: germin-like protein subfamily 1 m...  72.4    5e-13   
ref|XP_006477881.1|  PREDICTED: germin-like protein subfamily 1 m...  70.5    5e-13   
gb|KDP46443.1|  hypothetical protein JCGZ_10283                       70.5    5e-13   
gb|KDP27426.1|  hypothetical protein JCGZ_20256                       70.5    5e-13   
gb|KCW61434.1|  hypothetical protein EUGRSUZ_H04164                   70.5    5e-13   
ref|XP_006477875.1|  PREDICTED: germin-like protein subfamily 1 m...  70.5    5e-13   
ref|NP_001046876.1|  Os02g0491800                                     70.5    5e-13   
ref|XP_009386323.1|  PREDICTED: putative germin-like protein 2-2      70.5    5e-13   
ref|XP_002447481.1|  hypothetical protein SORBIDRAFT_06g001690        70.5    5e-13   
ref|XP_009419633.1|  PREDICTED: uncharacterized protein LOC103999573  72.8    5e-13   
ref|XP_006477883.1|  PREDICTED: germin-like protein subfamily 1 m...  70.5    5e-13   
ref|XP_007201862.1|  hypothetical protein PRUPE_ppa020162mg           70.5    5e-13   
ref|NP_001066188.1|  Os12g0154700                                     70.5    5e-13   
gb|KDP45129.1|  hypothetical protein JCGZ_17461                       70.5    5e-13   
ref|XP_010024910.1|  PREDICTED: germin-like protein subfamily 1 m...  70.5    5e-13   
ref|XP_006477877.1|  PREDICTED: germin-like protein subfamily 1 m...  70.5    5e-13   
ref|XP_007200157.1|  hypothetical protein PRUPE_ppa016753mg           70.5    5e-13   
gb|AFW56909.1|  hypothetical protein ZEAMMB73_144179                  70.9    5e-13   
ref|XP_009622801.1|  PREDICTED: putative germin-like protein 2-1      70.5    6e-13   
ref|XP_010688719.1|  PREDICTED: germin-like protein subfamily 1 m...  70.5    6e-13   
ref|XP_010234322.1|  PREDICTED: germin-like protein 8-8               70.5    6e-13   
ref|XP_006845857.1|  hypothetical protein AMTR_s00154p00044150        70.1    6e-13   
gb|EMT10611.1|  Germin-like protein 8-11                              69.7    6e-13   
ref|XP_008662705.1|  PREDICTED: putative germin-like protein 12-4     70.5    6e-13   
ref|XP_011037778.1|  PREDICTED: putative germin-like protein 2-1      70.5    6e-13   
gb|EMS45228.1|  Germin-like protein 8-9                               70.5    6e-13   
emb|CDP14600.1|  unnamed protein product                              70.5    6e-13   
ref|XP_004229689.1|  PREDICTED: germin-like protein subfamily 1 m...  70.5    6e-13   
ref|XP_002862402.1|  hypothetical protein ARALYDRAFT_497466           70.1    6e-13   
gb|EMT07027.1|  Germin-like protein 8-5                               70.1    6e-13   
emb|CDX95190.1|  BnaC09g16800D                                        70.1    6e-13   
ref|XP_006354544.1|  PREDICTED: germin-like protein subfamily 1 m...  70.1    6e-13   
ref|XP_008662711.1|  PREDICTED: putative germin-like protein 12-4     70.1    6e-13   
gb|KDP29830.1|  hypothetical protein JCGZ_19310                       70.1    7e-13   
ref|XP_006371121.1|  hypothetical protein POPTR_0019s04320g           69.7    7e-13   
ref|XP_011075129.1|  PREDICTED: putative germin-like protein 2-1 ...  70.1    7e-13   
ref|XP_006299201.1|  hypothetical protein CARUB_v10015347mg           70.1    7e-13   
ref|XP_006856738.1|  hypothetical protein AMTR_s03266p00004160        69.7    7e-13   
gb|KCW80410.1|  hypothetical protein EUGRSUZ_C01767                   70.1    7e-13   
ref|XP_011075130.1|  PREDICTED: putative germin-like protein 2-1 ...  70.1    8e-13   
ref|XP_011045439.1|  PREDICTED: germin-like protein subfamily 1 m...  70.1    8e-13   
gb|EAY85909.1|  hypothetical protein OsI_07272                        70.1    8e-13   
ref|XP_003568179.1|  PREDICTED: germin-like protein 8-4               70.1    8e-13   
ref|XP_004293720.1|  PREDICTED: putative germin-like protein 2-2-...  70.1    8e-13   
ref|XP_010463900.1|  PREDICTED: germin-like protein subfamily 1 m...  70.1    8e-13   
ref|XP_006354494.1|  PREDICTED: germin-like protein subfamily 1 m...  70.1    8e-13   



>ref|XP_006349261.1| PREDICTED: putative germin-like protein 2-1-like [Solanum tuberosum]
 ref|XP_006349262.1| PREDICTED: putative germin-like protein 2-1-like [Solanum tuberosum]
Length=228

 Score = 92.8 bits (229),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF +NVG+TNA AFA  +SQ PG + +ANAVFG DPPISDDVLAK F ++KK+V YLQ+Q
Sbjct  163  HFQFNVGKTNAVAFAGLSSQNPGVITIANAVFGSDPPISDDVLAKAFQIDKKVVDYLQSQ  222

Query  42   NW  37
             W
Sbjct  223  FW  224



>ref|XP_006349268.1| PREDICTED: germin-like protein subfamily 1 member 13-like [Solanum 
tuberosum]
Length=228

 Score = 90.9 bits (224),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 49/62 (79%), Gaps = 0/62 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF +NVG+TNA AFA  +SQ PG + +ANAVFG DPPI+DDVLAK F +E K+V YLQ+Q
Sbjct  163  HFQFNVGKTNAVAFAGLSSQNPGVIIIANAVFGSDPPINDDVLAKAFQIENKVVDYLQSQ  222

Query  42   NW  37
             W
Sbjct  223  FW  224



>ref|XP_004230405.1| PREDICTED: germin-like protein subfamily 1 member 14 [Solanum 
lycopersicum]
Length=228

 Score = 90.9 bits (224),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF +NVG+TNA AFA  +SQ PG + +ANAVFG DPPI+DDVLAK F ++KK+V YLQ+Q
Sbjct  163  HFQFNVGKTNAVAFAGLSSQNPGVITIANAVFGSDPPINDDVLAKAFQIDKKVVDYLQSQ  222

Query  42   NW  37
             W
Sbjct  223  FW  224



>ref|XP_006349264.1| PREDICTED: germin-like protein subfamily 1 member 13-like [Solanum 
tuberosum]
Length=228

 Score = 90.9 bits (224),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 49/62 (79%), Gaps = 0/62 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF +NVG+TNA AFA  +SQ PG + +ANAVFG DPPI+DDVLAK F +E K+V YLQ+Q
Sbjct  163  HFQFNVGKTNAVAFAGLSSQNPGVITIANAVFGSDPPINDDVLAKAFQIENKVVDYLQSQ  222

Query  42   NW  37
             W
Sbjct  223  FW  224



>ref|XP_010241946.1| PREDICTED: putative germin-like protein 2-1 [Nelumbo nucifera]
Length=223

 Score = 90.1 bits (222),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 48/62 (77%), Gaps = 0/62 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF +NVG TNA AFA  +SQ PG + +ANAVFGP PPI DDVLAK F ++KK++ YLQAQ
Sbjct  158  HFQFNVGHTNAVAFAGLSSQNPGTITIANAVFGPKPPIKDDVLAKAFQVDKKVIDYLQAQ  217

Query  42   NW  37
             W
Sbjct  218  YW  219



>ref|XP_004230403.1| PREDICTED: putative germin-like protein 2-1 [Solanum lycopersicum]
Length=228

 Score = 89.7 bits (221),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF +NVG+T+A AFA  +SQ PG + +ANAVFG DPPI+DDVLAK F ++KK+V YLQ+Q
Sbjct  163  HFQFNVGKTDAVAFAGLSSQNPGVITIANAVFGSDPPINDDVLAKAFQIDKKVVDYLQSQ  222

Query  42   NW  37
             W
Sbjct  223  FW  224



>ref|XP_006349263.1| PREDICTED: germin-like protein subfamily 1 member 13-like [Solanum 
tuberosum]
Length=228

 Score = 89.0 bits (219),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 49/62 (79%), Gaps = 0/62 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF +NVG+T A AFA FNSQ  G + +ANAVFG DPPI+DD+LAK F ++KK+V YLQ+Q
Sbjct  163  HFQFNVGKTKAVAFAGFNSQNQGVITIANAVFGSDPPINDDILAKAFQVDKKVVDYLQSQ  222

Query  42   NW  37
             W
Sbjct  223  FW  224



>ref|XP_004230404.1| PREDICTED: putative germin-like protein 2-1 [Solanum lycopersicum]
Length=228

 Score = 88.6 bits (218),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 49/62 (79%), Gaps = 0/62 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF +NVG+T A AFA  +SQ PG + +ANAVFG DPPI+DDVLAK F ++KK+V YLQ+Q
Sbjct  163  HFQFNVGKTKAVAFAGLSSQNPGVITIANAVFGSDPPINDDVLAKAFQVDKKVVHYLQSQ  222

Query  42   NW  37
             W
Sbjct  223  FW  224



>ref|XP_011013026.1| PREDICTED: germin-like protein subfamily 1 member 16 [Populus 
euphratica]
Length=228

 Score = 88.6 bits (218),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 39/63 (62%), Positives = 50/63 (79%), Gaps = 0/63 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF  NVG+TNA AFA+ +SQ PG + +ANAVFG DPP++ +VL K FHL+KK+V+YLQ Q
Sbjct  162  HFQLNVGKTNAVAFASLSSQNPGVITIANAVFGADPPMNPNVLTKAFHLDKKLVEYLQKQ  221

Query  42   NWT  34
             WT
Sbjct  222  IWT  224



>ref|XP_011034307.1| PREDICTED: germin-like protein subfamily 1 member 16 [Populus 
euphratica]
Length=229

 Score = 88.6 bits (218),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 39/63 (62%), Positives = 50/63 (79%), Gaps = 0/63 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF  NVG+TNA AFA+ +SQ PG + +ANAVFG DPP++ +VL K FHL+KK+V+YLQ Q
Sbjct  163  HFQLNVGKTNAVAFASLSSQNPGVITIANAVFGADPPMNPNVLTKAFHLDKKLVEYLQKQ  222

Query  42   NWT  34
             WT
Sbjct  223  IWT  225



>ref|XP_006349267.1| PREDICTED: germin-like protein subfamily 1 member 13-like [Solanum 
tuberosum]
Length=228

 Score = 88.2 bits (217),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 49/62 (79%), Gaps = 0/62 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF +NVG+T A AFA  +SQ PG + +ANAVFG DPPI+DD+LAK F ++KK+V YLQ+Q
Sbjct  163  HFQFNVGKTKAVAFAGLSSQNPGVITIANAVFGSDPPINDDILAKAFQVDKKVVDYLQSQ  222

Query  42   NW  37
             W
Sbjct  223  FW  224



>gb|AFW90592.1| germin-like protein subfamily 1 member 20 precursor [Solanum 
tuberosum]
Length=228

 Score = 88.2 bits (217),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 49/62 (79%), Gaps = 0/62 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF +NVG+T A AFA  +SQ PG + +ANAVFG DPPI+DD+LAK F ++KK+V YLQ+Q
Sbjct  163  HFQFNVGKTKAVAFAGLSSQNPGVITIANAVFGSDPPINDDILAKAFQVDKKVVDYLQSQ  222

Query  42   NW  37
             W
Sbjct  223  FW  224



>ref|XP_009620404.1| PREDICTED: germin-like protein subfamily 1 member 17 [Nicotiana 
tomentosiformis]
Length=228

 Score = 87.8 bits (216),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 49/62 (79%), Gaps = 0/62 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF +N+G+T A AFA  +SQ PG + +ANAVFG DPPI+DDVLAK F ++KK++ YLQ+Q
Sbjct  163  HFQFNIGKTTAVAFAGLSSQNPGVITIANAVFGSDPPINDDVLAKAFQVDKKVINYLQSQ  222

Query  42   NW  37
             W
Sbjct  223  FW  224



>ref|XP_006358459.1| PREDICTED: germin-like protein subfamily 1 member 20-like [Solanum 
tuberosum]
Length=228

 Score = 87.8 bits (216),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 49/62 (79%), Gaps = 0/62 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF +NVG+T A AFA  +SQ PG + +ANAVFG DPPI+DDVLAK F ++KK+V YLQ+Q
Sbjct  163  HFQFNVGKTKAVAFAGLSSQNPGVITVANAVFGSDPPINDDVLAKAFQVDKKVVDYLQSQ  222

Query  42   NW  37
             W
Sbjct  223  FW  224



>ref|XP_010251871.1| PREDICTED: putative germin-like protein 2-1 [Nelumbo nucifera]
Length=222

 Score = 87.0 bits (214),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF +NVG TNA AFA  +SQ PG + +ANAVFG  PPI DDVLAK F ++KK++ YLQAQ
Sbjct  157  HFQFNVGHTNAVAFAGLSSQNPGTITIANAVFGSKPPIKDDVLAKAFQVDKKVIDYLQAQ  216

Query  42   NW  37
             W
Sbjct  217  FW  218



>ref|XP_010251869.1| PREDICTED: putative germin-like protein 2-1 isoform X1 [Nelumbo 
nucifera]
Length=222

 Score = 87.0 bits (214),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF +NVG TNA AFA  +SQ PG + +ANAVFG  PPI DDVLAK F ++KK++ YLQAQ
Sbjct  157  HFQFNVGHTNAVAFAGLSSQNPGTITIANAVFGSKPPIKDDVLAKAFQVDKKVIDYLQAQ  216

Query  42   NW  37
             W
Sbjct  217  FW  218



>ref|XP_010251870.1| PREDICTED: putative germin-like protein 2-1 isoform X2 [Nelumbo 
nucifera]
Length=222

 Score = 86.7 bits (213),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF +NVG TNA AFA  +SQ PG + +ANAVFG  PPI DDVLAK F ++KK++ YLQAQ
Sbjct  157  HFQFNVGHTNAVAFAGLSSQNPGTITIANAVFGSKPPIKDDVLAKAFQVDKKVIDYLQAQ  216

Query  42   NW  37
             W
Sbjct  217  FW  218



>ref|XP_010251872.1| PREDICTED: putative germin-like protein 2-1 [Nelumbo nucifera]
Length=222

 Score = 86.7 bits (213),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF +NVG TNA AFA  +SQ PG + +ANAVFG  PPI DDVLAK F ++KK++ YLQAQ
Sbjct  157  HFQFNVGHTNAVAFAGLSSQNPGTITIANAVFGSXPPIKDDVLAKAFQVDKKVIDYLQAQ  216

Query  42   NW  37
             W
Sbjct  217  FW  218



>ref|XP_009795503.1| PREDICTED: germin-like protein subfamily 1 member 20 isoform 
X1 [Nicotiana sylvestris]
 ref|XP_009795504.1| PREDICTED: germin-like protein subfamily 1 member 20 isoform 
X2 [Nicotiana sylvestris]
Length=228

 Score = 86.7 bits (213),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 48/62 (77%), Gaps = 0/62 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF +NVG+TNA AFA  +SQ PG + +ANAVFG DPPI+ DVL K F ++KK+V YLQ+Q
Sbjct  163  HFQFNVGKTNAVAFAGLSSQNPGVITIANAVFGSDPPINPDVLTKAFQVDKKVVDYLQSQ  222

Query  42   NW  37
             W
Sbjct  223  FW  224



>ref|XP_009784933.1| PREDICTED: germin-like protein subfamily 1 member 20 [Nicotiana 
sylvestris]
Length=228

 Score = 86.7 bits (213),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 48/62 (77%), Gaps = 0/62 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF +NVG+TNA AFA  +SQ PG + +ANAVFG DPPI+ DVL K F ++KK+V YLQ+Q
Sbjct  163  HFQFNVGKTNAVAFAGLSSQNPGVITIANAVFGSDPPINPDVLTKAFQVDKKVVDYLQSQ  222

Query  42   NW  37
             W
Sbjct  223  FW  224



>ref|XP_010251867.1| PREDICTED: putative germin-like protein 2-1 [Nelumbo nucifera]
Length=222

 Score = 86.3 bits (212),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF +NVG TNA AFA  +SQ PG + +ANAVFG  PPI DDVLAK F ++KK++ YLQAQ
Sbjct  157  HFQFNVGHTNAVAFAGLSSQNPGTITIANAVFGAKPPIKDDVLAKAFQVDKKVIDYLQAQ  216

Query  42   NW  37
             W
Sbjct  217  FW  218



>ref|XP_009795501.1| PREDICTED: putative germin-like protein 2-1 [Nicotiana sylvestris]
Length=228

 Score = 85.9 bits (211),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 48/62 (77%), Gaps = 0/62 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF +N+G+  A AFA  +SQ PG + +ANAVFG DPPI+DDVLAK F ++KK++ YLQ+Q
Sbjct  163  HFQFNIGKNKAVAFAGLSSQNPGVITIANAVFGSDPPINDDVLAKAFQVDKKVIDYLQSQ  222

Query  42   NW  37
             W
Sbjct  223  FW  224



>ref|XP_009612543.1| PREDICTED: germin-like protein subfamily 1 member 20 [Nicotiana 
tomentosiformis]
Length=228

 Score = 85.9 bits (211),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 48/62 (77%), Gaps = 0/62 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF +NVG+TNA AFA  +SQ PG + +ANAVFG DPPI+ DVLAK F ++ K+V YLQ+Q
Sbjct  163  HFQFNVGKTNAVAFAGLSSQNPGVITIANAVFGSDPPINPDVLAKAFQVDNKVVDYLQSQ  222

Query  42   NW  37
             W
Sbjct  223  FW  224



>gb|EYU43092.1| hypothetical protein MIMGU_mgv1a020152mg, partial [Erythranthe 
guttata]
Length=85

 Score = 82.8 bits (203),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF +NVG+TNA AFA  +SQ PG + +ANAVFG DPPI   VL K F +EK +++YLQAQ
Sbjct  20   HFQFNVGKTNAVAFAGLSSQNPGVITIANAVFGSDPPIDPAVLTKAFQVEKDVIEYLQAQ  79

Query  42   NW  37
             W
Sbjct  80   FW  81



>ref|XP_009620917.1| PREDICTED: germin-like protein subfamily 1 member 17 [Nicotiana 
tomentosiformis]
Length=228

 Score = 85.5 bits (210),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF +NVG+T A AFA  +SQ PG + +ANAVFG DPPI+ DVL K F +EKK+V YLQ+Q
Sbjct  163  HFQFNVGKTKAVAFAGLSSQNPGVITIANAVFGSDPPINPDVLTKAFQVEKKVVDYLQSQ  222

Query  42   NW  37
             W
Sbjct  223  FW  224



>ref|XP_009620876.1| PREDICTED: putative germin-like protein 2-1 [Nicotiana tomentosiformis]
Length=211

 Score = 85.1 bits (209),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 48/62 (77%), Gaps = 0/62 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF +NVG+TNA AFA  +SQ PG + +ANAVFG DPPI+ DVLAK F ++ K+V YLQ+Q
Sbjct  146  HFQFNVGKTNAVAFAGLSSQNPGVITIANAVFGSDPPINPDVLAKAFQVDNKVVDYLQSQ  205

Query  42   NW  37
             W
Sbjct  206  FW  207



>ref|XP_009612541.1| PREDICTED: germin-like protein subfamily 1 member 17 [Nicotiana 
tomentosiformis]
Length=228

 Score = 85.5 bits (210),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF +NVG+T A AFA  +SQ PG + +ANAVFG DPPI+ DVL K F L+KK+V YLQ+Q
Sbjct  163  HFQFNVGKTKAVAFAGLSSQNPGVITIANAVFGSDPPINPDVLTKAFQLDKKVVDYLQSQ  222

Query  42   NW  37
             W
Sbjct  223  FW  224



>ref|XP_006346966.1| PREDICTED: putative germin-like protein 2-1-like [Solanum tuberosum]
Length=228

 Score = 85.1 bits (209),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 48/62 (77%), Gaps = 0/62 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF +NVG+T A AFA  +SQ PG + +ANAVFG DP I++DVLAK F +EKK+V YLQ+Q
Sbjct  163  HFQFNVGKTKAVAFAGLSSQNPGVITIANAVFGSDPSINNDVLAKAFQVEKKVVNYLQSQ  222

Query  42   NW  37
             W
Sbjct  223  FW  224



>ref|XP_011099651.1| PREDICTED: germin-like protein subfamily 1 member 13 [Sesamum 
indicum]
Length=229

 Score = 85.1 bits (209),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 48/62 (77%), Gaps = 0/62 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF +NVG+TNA AFA  +SQ PG + +ANAVFG +PPI+ DVLAK F +EK ++ YLQAQ
Sbjct  164  HFQFNVGKTNALAFAGLSSQNPGVITIANAVFGSNPPINPDVLAKAFQVEKNVIDYLQAQ  223

Query  42   NW  37
             W
Sbjct  224  FW  225



>gb|KCW64216.1| hypothetical protein EUGRSUZ_G018672, partial [Eucalyptus grandis]
Length=79

 Score = 81.6 bits (200),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF  N+G+T A AFAA +SQ PG + +ANAVFG  PPIS DVL K F ++KK+V YLQAQ
Sbjct  15   HFQLNIGKTPALAFAALSSQNPGVITIANAVFGSKPPISADVLTKAFQVDKKVVDYLQAQ  74

Query  42   NW  37
             W
Sbjct  75   FW  76



>ref|XP_009612542.1| PREDICTED: putative germin-like protein 2-1 [Nicotiana tomentosiformis]
Length=228

 Score = 84.7 bits (208),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 48/62 (77%), Gaps = 0/62 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF +N+G+T A AFA  +SQ PG + +ANAVFG DPPI+ DVLAK F ++KK++ YLQ+Q
Sbjct  163  HFQFNIGKTTAVAFAGLSSQNPGVITIANAVFGSDPPINVDVLAKAFQVDKKVIDYLQSQ  222

Query  42   NW  37
             W
Sbjct  223  FW  224



>ref|XP_009786129.1| PREDICTED: putative germin-like protein 2-1 [Nicotiana sylvestris]
Length=228

 Score = 84.3 bits (207),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 48/62 (77%), Gaps = 0/62 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF +NVG+T A AFA  +SQ PG + +ANA+FG DPPI++DVL K F ++KK++ YLQ+Q
Sbjct  163  HFQFNVGKTKAVAFAGLSSQNPGVITIANAIFGSDPPINEDVLTKAFQVDKKVIDYLQSQ  222

Query  42   NW  37
             W
Sbjct  223  FW  224



>ref|XP_006358463.1| PREDICTED: germin-like protein subfamily 1 member 20-like [Solanum 
tuberosum]
Length=228

 Score = 84.3 bits (207),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 48/62 (77%), Gaps = 0/62 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF +NVG+T A AFA  +SQ P  + +ANA+FG DPPI+DDVLAK F ++KK+V YLQ+Q
Sbjct  163  HFQFNVGKTKAVAFAGLSSQNPVVITIANAIFGSDPPINDDVLAKAFQVDKKVVDYLQSQ  222

Query  42   NW  37
             W
Sbjct  223  FW  224



>emb|CDP10692.1| unnamed protein product [Coffea canephora]
Length=86

 Score = 81.3 bits (199),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 46/60 (77%), Gaps = 0/60 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF +NVG+TNA AFA F SQ PG + +ANAVFG DP IS DVLAK F ++KK++  L+AQ
Sbjct  24   HFQFNVGKTNAVAFAGFGSQNPGVITIANAVFGSDPLISADVLAKAFQVDKKVIDLLEAQ  83



>gb|EYU20547.1| hypothetical protein MIMGU_mgv1a023357mg [Erythranthe guttata]
Length=231

 Score = 84.3 bits (207),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 47/63 (75%), Gaps = 0/63 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF +NVG+TNA AFA  +SQ PG + +ANAVFG DPPI+  VL K F +EK ++ YLQAQ
Sbjct  166  HFQFNVGKTNAVAFAGLSSQNPGVITIANAVFGLDPPINPAVLTKAFQVEKNVIDYLQAQ  225

Query  42   NWT  34
             WT
Sbjct  226  FWT  228



>ref|XP_011099652.1| PREDICTED: putative germin-like protein 2-1 [Sesamum indicum]
Length=228

 Score = 84.3 bits (207),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF +NVG TNA AFA  +SQ PG + +ANAVFG DPPIS DVL + F ++K +++YLQ Q
Sbjct  163  HFQFNVGNTNAVAFAGLSSQNPGVITIANAVFGSDPPISSDVLTRAFQVDKNVIKYLQGQ  222

Query  42   NW  37
             W
Sbjct  223  FW  224



>gb|EYU40210.1| hypothetical protein MIMGU_mgv1a022317mg [Erythranthe guttata]
Length=230

 Score = 84.0 bits (206),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF +NVG+TNA AFAA +SQ PG + +ANAVFG DPPI+  VL K F +EK ++ YLQAQ
Sbjct  165  HFQFNVGKTNAVAFAALSSQNPGVITIANAVFGSDPPINPAVLTKGFQVEKNVIDYLQAQ  224

Query  42   NW  37
             W
Sbjct  225  FW  226



>ref|XP_011034308.1| PREDICTED: germin-like protein subfamily 1 member 16 [Populus 
euphratica]
Length=228

 Score = 84.0 bits (206),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 48/63 (76%), Gaps = 0/63 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF  NVG+TNA AFA+ +SQ PG + +ANAVFG DPPI+ +VL K F ++KK+V YLQ Q
Sbjct  162  HFQLNVGKTNAVAFASLSSQNPGVITIANAVFGADPPINPNVLTKAFQVDKKLVDYLQKQ  221

Query  42   NWT  34
             WT
Sbjct  222  FWT  224



>ref|XP_011034305.1| PREDICTED: germin-like protein subfamily 1 member 16 [Populus 
euphratica]
Length=228

 Score = 84.0 bits (206),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 48/63 (76%), Gaps = 0/63 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF  NVG+TNA AFA+ +SQ PG + +ANAVFG DPPI+ +VL K F ++KK+V YLQ Q
Sbjct  162  HFQLNVGKTNAVAFASLSSQNPGVITIANAVFGADPPINPNVLTKAFQVDKKLVDYLQKQ  221

Query  42   NWT  34
             WT
Sbjct  222  FWT  224



>ref|XP_006349265.1| PREDICTED: germin-like protein subfamily 1 member 13-like [Solanum 
tuberosum]
Length=228

 Score = 84.0 bits (206),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF +N G+T   AFA  +SQ PG + +ANAVFG DPPI+DDVLAK F +E K+V YLQ+Q
Sbjct  163  HFQFNPGKTKTVAFAGLSSQNPGVITIANAVFGSDPPINDDVLAKAFQIENKVVDYLQSQ  222

Query  42   NW  37
             W
Sbjct  223  FW  224



>gb|EYU28622.1| hypothetical protein MIMGU_mgv1a018753mg [Erythranthe guttata]
Length=230

 Score = 84.0 bits (206),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF +NVG+TNA AFAA +SQ PG + +ANAVFG DPPI+  VL K F +EK ++ YLQAQ
Sbjct  165  HFQFNVGKTNAVAFAALSSQNPGVITVANAVFGSDPPINPAVLTKAFQVEKNVIDYLQAQ  224

Query  42   NW  37
             W
Sbjct  225  FW  226



>ref|XP_006387364.1| hypothetical protein POPTR_1158s00200g [Populus trichocarpa]
 gb|ERP46278.1| hypothetical protein POPTR_1158s00200g [Populus trichocarpa]
Length=228

 Score = 83.6 bits (205),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 47/63 (75%), Gaps = 0/63 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF  NVGRTNA AFA+ +SQ PG + +A AVFG DPPI+ +VL K F ++KK+V YLQ Q
Sbjct  162  HFQLNVGRTNAVAFASLSSQNPGVITIAKAVFGADPPINPNVLTKAFQVDKKVVDYLQKQ  221

Query  42   NWT  34
             WT
Sbjct  222  LWT  224



>gb|EYU20546.1| hypothetical protein MIMGU_mgv1a013111mg [Erythranthe guttata]
Length=230

 Score = 83.6 bits (205),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF +NVG+TNA AFA  +SQ PG + +ANAVFG DPPI+  VL K F +EK +++YLQAQ
Sbjct  165  HFQFNVGKTNAVAFAGLSSQNPGVITIANAVFGSDPPINPAVLTKAFQVEKDVIEYLQAQ  224

Query  42   NW  37
             W
Sbjct  225  FW  226



>gb|EYU20540.1| hypothetical protein MIMGU_mgv1a013117mg [Erythranthe guttata]
Length=230

 Score = 83.6 bits (205),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF +NVG+TNA AFA  +SQ PG + +ANAVFG DPPI   VL K F +EK +++YLQAQ
Sbjct  165  HFQFNVGKTNAVAFAGLSSQNPGVITIANAVFGSDPPIDPAVLTKAFQVEKDVIEYLQAQ  224

Query  42   NW  37
             W
Sbjct  225  FW  226



>ref|XP_009786127.1| PREDICTED: putative germin-like protein 2-1 [Nicotiana sylvestris]
Length=229

 Score = 83.6 bits (205),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF +NVG+T A AFA  +SQ PG + +AN VFG DP I+DDVLAK F ++KK++ YLQ+Q
Sbjct  163  HFQFNVGKTKAVAFAGLSSQNPGVITIANTVFGSDPQINDDVLAKAFQVDKKVIDYLQSQ  222

Query  42   NW  37
             W
Sbjct  223  FW  224



>ref|XP_009627660.1| PREDICTED: germin-like protein subfamily 1 member 20 [Nicotiana 
tomentosiformis]
Length=228

 Score = 83.6 bits (205),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF +NVG+T A AFA  +SQ PG + +ANAVFG DPPI+ DVL K F L+ K+V YLQ+Q
Sbjct  163  HFQFNVGKTKAVAFAGLSSQNPGVITIANAVFGSDPPINPDVLTKAFQLDNKVVDYLQSQ  222

Query  42   NW  37
             W
Sbjct  223  FW  224



>gb|EYU40209.1| hypothetical protein MIMGU_mgv1a013129mg [Erythranthe guttata]
Length=230

 Score = 83.2 bits (204),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF +NVG+TNA AFA  +SQ PG + +ANAVFG DPPI   VL K F +EK +++YLQAQ
Sbjct  165  HFQFNVGKTNAVAFAGLSSQNPGVITIANAVFGSDPPIDPVVLTKAFQVEKDVIEYLQAQ  224

Query  42   NW  37
             W
Sbjct  225  FW  226



>ref|XP_002319656.2| hypothetical protein POPTR_0013s04860g, partial [Populus trichocarpa]
 gb|EEE95579.2| hypothetical protein POPTR_0013s04860g, partial [Populus trichocarpa]
Length=101

 Score = 80.9 bits (198),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 37/58 (64%), Positives = 45/58 (78%), Gaps = 0/58 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQ  49
            HF +NVG+T A AFA  +SQ PG + +ANAVFG DPPI+ DVLAK F L+KK+V YLQ
Sbjct  41   HFQFNVGKTKALAFAGLSSQNPGVITIANAVFGSDPPINPDVLAKAFQLDKKVVDYLQ  98



>gb|EYU38444.1| hypothetical protein MIMGU_mgv1a013102mg [Erythranthe guttata]
Length=230

 Score = 82.8 bits (203),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF +NVG+TNA AFA  +SQ PG + +ANAVFG DPPI+  VL K F +EK ++ YLQAQ
Sbjct  165  HFQFNVGKTNAVAFAGLSSQNPGVITVANAVFGSDPPINPAVLTKAFQVEKNVIDYLQAQ  224

Query  42   NW  37
             W
Sbjct  225  FW  226



>gb|EYU40211.1| hypothetical protein MIMGU_mgv1a013108mg [Erythranthe guttata]
Length=230

 Score = 82.8 bits (203),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF +NVG+TNA AFA  +SQ PG + +ANAVFG DPPI   VL K F +EK ++ YLQAQ
Sbjct  165  HFQFNVGKTNAVAFAGLSSQNPGVITIANAVFGSDPPIDPAVLTKAFQVEKDVIDYLQAQ  224

Query  42   NW  37
             W
Sbjct  225  FW  226



>ref|XP_007030276.1| RmlC-like cupins superfamily protein [Theobroma cacao]
 ref|XP_007030282.1| RmlC-like cupins superfamily protein [Theobroma cacao]
 gb|EOY10778.1| RmlC-like cupins superfamily protein [Theobroma cacao]
 gb|EOY10784.1| RmlC-like cupins superfamily protein [Theobroma cacao]
Length=225

 Score = 82.4 bits (202),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF  N+G+TNA AFAAF SQ PG + +A AVFG +PPI+ DVL K F L+K +V+YLQ+Q
Sbjct  160  HFQLNIGKTNAVAFAAFGSQNPGVITIAKAVFGSNPPINPDVLTKAFQLDKNVVKYLQSQ  219

Query  42   NW  37
             W
Sbjct  220  FW  221



>ref|XP_008780704.1| PREDICTED: germin-like protein 8-5, partial [Phoenix dactylifera]
Length=152

 Score = 81.3 bits (199),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF +N G+TNA A AA +SQ PG + +ANAVFG  PPISD VLAK F L+KK V +LQAQ
Sbjct  86   HFQFNYGKTNAVAIAALSSQNPGVITIANAVFGAKPPISDYVLAKAFQLDKKTVDWLQAQ  145

Query  42   NW  37
             W
Sbjct  146  FW  147



>emb|CAN73848.1| hypothetical protein VITISV_021639 [Vitis vinifera]
Length=141

 Score = 80.9 bits (198),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 47/60 (78%), Gaps = 0/60 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF +N+G TNA A AA NSQ PG + +A+AVFG +PPI+ D LA+ F L+KK+V+YLQA+
Sbjct  81   HFQFNIGHTNAVAIAALNSQNPGVITIABAVFGSNPPINPDFLARAFQLDKKVVEYLQAR  140



>ref|XP_007030289.1| RmlC-like cupins superfamily protein [Theobroma cacao]
 gb|EOY10791.1| RmlC-like cupins superfamily protein [Theobroma cacao]
Length=221

 Score = 82.4 bits (202),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 48/60 (80%), Gaps = 0/60 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF +N+G+TNA AFA  +SQ PG + +ANAVFG +PPI+ DVLAK F L+KK+V++LQ Q
Sbjct  161  HFQFNIGKTNAIAFAGLSSQNPGVITIANAVFGSNPPINPDVLAKAFKLDKKVVEFLQTQ  220



>ref|XP_010027139.1| PREDICTED: germin-like protein subfamily 1 member 7 [Eucalyptus 
grandis]
Length=221

 Score = 82.4 bits (202),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF  N+G+T A AFAA +SQ PG + +ANAVFG  PPIS DVL K F ++KK+V YLQAQ
Sbjct  156  HFQLNIGKTPALAFAALSSQNPGLITIANAVFGSKPPISADVLTKAFQVDKKVVDYLQAQ  215

Query  42   NW  37
             W
Sbjct  216  FW  217



>ref|XP_002319184.1| hypothetical protein POPTR_0013s06030g [Populus trichocarpa]
 ref|XP_002319673.2| germin-like protein 1 [Populus trichocarpa]
 ref|XP_006375916.1| hypothetical protein POPTR_0013s06010g [Populus trichocarpa]
 ref|XP_002319185.2| hypothetical protein POPTR_0013s06020g [Populus trichocarpa]
 gb|EEE95107.1| hypothetical protein POPTR_0013s06030g [Populus trichocarpa]
 gb|EEE95596.2| germin-like protein 1 [Populus trichocarpa]
 gb|ERP53713.1| hypothetical protein POPTR_0013s06010g [Populus trichocarpa]
 gb|EEE95108.2| hypothetical protein POPTR_0013s06020g [Populus trichocarpa]
Length=228

 Score = 82.4 bits (202),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 37/63 (59%), Positives = 47/63 (75%), Gaps = 0/63 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF  NVG+TNA AFA+ +SQ PG + +A AVFG DPPI+ +VL K F ++KK+V YLQ Q
Sbjct  162  HFQLNVGKTNAVAFASLSSQNPGVITIAKAVFGADPPINPNVLTKAFQVDKKVVDYLQKQ  221

Query  42   NWT  34
             WT
Sbjct  222  LWT  224



>ref|XP_010251866.1| PREDICTED: putative germin-like protein 2-1 [Nelumbo nucifera]
Length=222

 Score = 82.0 bits (201),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF +NVG TNA AFA  +SQ PG + +ANAVF   PPI +DVLAK F ++KK+V YLQAQ
Sbjct  157  HFQFNVGHTNAVAFAGLSSQNPGTITIANAVFEAKPPIKNDVLAKAFQVDKKVVDYLQAQ  216

Query  42   NW  37
             W
Sbjct  217  FW  218



>ref|XP_011034444.1| PREDICTED: germin-like protein subfamily 1 member 13 [Populus 
euphratica]
Length=225

 Score = 82.0 bits (201),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF +NVG+T A A +A +SQ PG + +ANAVFG  PPI  DVLAK F L+KKIV YLQ Q
Sbjct  160  HFQFNVGKTKAAAMSALSSQNPGVITIANAVFGSTPPIRSDVLAKAFQLDKKIVDYLQKQ  219

Query  42   NW  37
             W
Sbjct  220  FW  221



>ref|XP_006358461.1| PREDICTED: germin-like protein subfamily 1 member 14-like [Solanum 
tuberosum]
Length=230

 Score = 82.0 bits (201),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF  NVG+TNA AFA  +SQ  G + +ANAVFG DPPI+DDVLAK F ++KK++  LQ Q
Sbjct  165  HFQLNVGKTNAIAFAGLSSQNAGVITVANAVFGSDPPINDDVLAKAFQVDKKVIDNLQEQ  224

Query  42   NW  37
             W
Sbjct  225  IW  226



>ref|XP_010911724.1| PREDICTED: putative germin-like protein 2-1 [Elaeis guineensis]
Length=221

 Score = 82.0 bits (201),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 47/63 (75%), Gaps = 0/63 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF +N G+T+A A A  +SQ PG + +ANAVFG  PPISD+VLAK F L+KK V +LQAQ
Sbjct  155  HFQFNNGKTSAVALAGLSSQNPGVITIANAVFGAKPPISDEVLAKAFQLDKKTVDWLQAQ  214

Query  42   NWT  34
             WT
Sbjct  215  FWT  217



>emb|CAN73846.1| hypothetical protein VITISV_021637 [Vitis vinifera]
Length=177

 Score = 81.3 bits (199),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 47/60 (78%), Gaps = 0/60 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF +N+G TNA A AA NSQ PG + +ANAVFG +PPI+ D LA+ F L+KK+V+YLQA+
Sbjct  117  HFQFNIGHTNAVAIAALNSQNPGVITIANAVFGSNPPINPDFLARAFQLDKKVVEYLQAR  176



>gb|EYU40208.1| hypothetical protein MIMGU_mgv1a020439mg [Erythranthe guttata]
Length=230

 Score = 82.0 bits (201),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF +NVG+T A AFAA +SQ PG + +ANAVFG DPPI+  VL K F +EK ++ YLQAQ
Sbjct  165  HFQFNVGKTKAVAFAALSSQNPGVITVANAVFGSDPPINRAVLTKAFQVEKNVIDYLQAQ  224

Query  42   NW  37
             W
Sbjct  225  FW  226



>ref|XP_009625530.1| PREDICTED: putative germin-like protein 2-1 [Nicotiana tomentosiformis]
Length=228

 Score = 82.0 bits (201),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF +N+G+T A AFA  +SQ PG + +ANAVFG DP I+ DVLAK F ++KK++ YLQ+Q
Sbjct  163  HFQFNIGKTTAVAFAGLSSQNPGVITIANAVFGSDPSINADVLAKAFQVDKKVIDYLQSQ  222

Query  42   NW  37
             W
Sbjct  223  FW  224



>ref|XP_010907051.1| PREDICTED: germin-like protein 12-2 [Elaeis guineensis]
Length=107

 Score = 79.7 bits (195),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF +N G+TNA A A+ +SQ PG + +ANAVFG  PPISD VLAK F L+KK V +LQ Q
Sbjct  41   HFQFNYGKTNAVAIASLSSQNPGVITIANAVFGAKPPISDYVLAKAFQLDKKTVDWLQTQ  100

Query  42   NW  37
             W
Sbjct  101  FW  102



>ref|XP_011034443.1| PREDICTED: germin-like protein subfamily 1 member 13 [Populus 
euphratica]
Length=225

 Score = 82.0 bits (201),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF +NVG+T A+A +A +SQ PG + +ANAVFG  PPI  DVLAK F ++KKIV YLQ Q
Sbjct  160  HFQFNVGKTKASAISALSSQNPGVITIANAVFGSTPPIRSDVLAKAFQVDKKIVDYLQKQ  219

Query  42   NW  37
             W
Sbjct  220  LW  221



>ref|XP_002319671.1| hypothetical protein POPTR_0013s04840g [Populus trichocarpa]
 gb|EEE95594.1| hypothetical protein POPTR_0013s04840g [Populus trichocarpa]
Length=221

 Score = 82.0 bits (201),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 38/58 (66%), Positives = 45/58 (78%), Gaps = 0/58 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQ  49
            HF +NVG+T A AFA  +SQ PG + +ANAVFG DPPI+ DVLAK F L+KKIV YLQ
Sbjct  161  HFQFNVGKTKALAFAGLSSQNPGVITIANAVFGSDPPINPDVLAKAFQLDKKIVDYLQ  218



>emb|CAN73847.1| hypothetical protein VITISV_021638 [Vitis vinifera]
Length=224

 Score = 81.6 bits (200),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 47/60 (78%), Gaps = 0/60 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF +N+G TNA A AA NSQ PG + +ANAVFG +PPI+ D LA+ F L+KK+V+YLQA+
Sbjct  164  HFQFNIGHTNAVAIAALNSQNPGVITIANAVFGSNPPINPDFLARAFQLDKKVVEYLQAR  223



>gb|KCW76697.1| hypothetical protein EUGRSUZ_D01057 [Eucalyptus grandis]
Length=221

 Score = 81.6 bits (200),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF  N+G+T A AFAA +SQ PG + +ANAVFG  PPIS DVL K F ++KK+V YLQAQ
Sbjct  156  HFQLNIGKTPALAFAALSSQNPGVITIANAVFGSKPPISADVLTKAFQVDKKVVDYLQAQ  215

Query  42   NW  37
             W
Sbjct  216  FW  217



>emb|CAN80134.1| hypothetical protein VITISV_012033 [Vitis vinifera]
Length=224

 Score = 81.6 bits (200),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF +NVG TN  A AA +SQ PG + +ANAVFG DPPIS DVL K F L+K +V YLQ+ 
Sbjct  160  HFQFNVGHTNTVAIAALSSQNPGVITIANAVFGSDPPISIDVLTKAFQLDKDVVNYLQSS  219

Query  42   NW  37
             W
Sbjct  220  FW  221



>gb|KCW80407.1| hypothetical protein EUGRSUZ_C01764 [Eucalyptus grandis]
Length=221

 Score = 81.6 bits (200),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF  N+G+T A AFAA +SQ PG + +ANAVFG  PPIS DVL K F ++KK+V YLQAQ
Sbjct  156  HFQLNIGKTPALAFAALSSQNPGVITIANAVFGSKPPISADVLTKAFQVDKKVVDYLQAQ  215

Query  42   NW  37
             W
Sbjct  216  FW  217



>ref|XP_010024911.1| PREDICTED: germin-like protein subfamily 1 member 7 [Eucalyptus 
grandis]
 gb|KCW61444.1| hypothetical protein EUGRSUZ_H04175 [Eucalyptus grandis]
Length=221

 Score = 81.6 bits (200),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF  N+G+T A AFAA +SQ PG + +ANAVFG  PPIS DVL K F ++KK+V YLQAQ
Sbjct  156  HFQLNIGKTPALAFAALSSQNPGVITIANAVFGSKPPISADVLTKAFQVDKKVVDYLQAQ  215

Query  42   NW  37
             W
Sbjct  216  FW  217



>ref|XP_010066338.1| PREDICTED: germin-like protein subfamily 1 member 7 isoform X1 
[Eucalyptus grandis]
 ref|XP_010066339.1| PREDICTED: germin-like protein subfamily 1 member 7 isoform X2 
[Eucalyptus grandis]
 ref|XP_010066340.1| PREDICTED: germin-like protein subfamily 1 member 7 isoform X3 
[Eucalyptus grandis]
 ref|XP_010066341.1| PREDICTED: germin-like protein subfamily 1 member 7 [Eucalyptus 
grandis]
 ref|XP_010066345.1| PREDICTED: germin-like protein subfamily 1 member 7 [Eucalyptus 
grandis]
 ref|XP_010066346.1| PREDICTED: germin-like protein subfamily 1 member 7 [Eucalyptus 
grandis]
Length=220

 Score = 81.6 bits (200),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF  N+G+T A AFAA +SQ PG + +ANAVFG  PPIS DVL K F ++KK+V YLQAQ
Sbjct  156  HFQLNIGKTPALAFAALSSQNPGVITIANAVFGSKPPISADVLTKAFQVDKKVVDYLQAQ  215

Query  42   NW  37
             W
Sbjct  216  FW  217



>ref|XP_011038438.1| PREDICTED: germin-like protein subfamily 1 member 13 [Populus 
euphratica]
Length=225

 Score = 81.6 bits (200),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF +NVG+T A+A +A +SQ PG + +ANAVFG  PPI  DVLAK F ++KKIV YLQ Q
Sbjct  160  HFQFNVGKTKASAISALSSQNPGVITIANAVFGSTPPIRSDVLAKAFQVDKKIVDYLQKQ  219

Query  42   NW  37
             W
Sbjct  220  FW  221



>gb|EYU20548.1| hypothetical protein MIMGU_mgv1a013109mg [Erythranthe guttata]
Length=230

 Score = 81.6 bits (200),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF +NVG+TNA AFAA +SQ PG + +ANAVFG DP I+  VL K F +EK ++ YLQAQ
Sbjct  165  HFQFNVGKTNAVAFAALSSQNPGVITIANAVFGSDPTINTAVLTKAFQVEKNVIDYLQAQ  224

Query  42   NW  37
             W
Sbjct  225  FW  226



>ref|XP_010041605.1| PREDICTED: germin-like protein subfamily 1 member 7 [Eucalyptus 
grandis]
Length=221

 Score = 81.6 bits (200),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF  N+G+T A AFAA +SQ PG + +ANAVFG  PPIS DVL K F ++KK+V YLQAQ
Sbjct  156  HFQLNIGKTPALAFAALSSQNPGVITIANAVFGSKPPISADVLTKAFQVDKKVVDYLQAQ  215

Query  42   NW  37
             W
Sbjct  216  FW  217



>ref|XP_011038439.1| PREDICTED: germin-like protein subfamily 1 member 13 [Populus 
euphratica]
Length=236

 Score = 81.6 bits (200),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF +NVG+T A+A +A +SQ PG + +ANAVFG  PPI  DVLAK F ++KKIV YLQ Q
Sbjct  171  HFQFNVGKTKASAISALSSQNPGVITIANAVFGSTPPIRSDVLAKAFQVDKKIVDYLQKQ  230

Query  42   NW  37
             W
Sbjct  231  FW  232



>ref|XP_002284661.2| PREDICTED: uncharacterized protein LOC100240807 [Vitis vinifera]
Length=455

 Score = 83.6 bits (205),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 37/64 (58%), Positives = 49/64 (77%), Gaps = 0/64 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF +N+G TNA A A  NSQ PG + +ANAVFG +PPI+ D LA+ F L+KK+V+YLQA+
Sbjct  160  HFQFNIGHTNAVAIAGLNSQNPGVITIANAVFGSNPPINPDFLARAFQLDKKVVEYLQAR  219

Query  42   NWTL  31
             +TL
Sbjct  220  FYTL  223


 Score = 75.9 bits (185),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 32/60 (53%), Positives = 46/60 (77%), Gaps = 0/60 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF  N+G TNA A A FNSQ PG + +A+++FG +PPI+ D LA+ F L+K++V+YLQA+
Sbjct  395  HFQVNIGHTNAVAIAVFNSQNPGVITIASSMFGSNPPINPDFLARAFQLDKRVVEYLQAR  454



>gb|EYU20545.1| hypothetical protein MIMGU_mgv1a020779mg [Erythranthe guttata]
Length=231

 Score = 81.6 bits (200),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 37/63 (59%), Positives = 46/63 (73%), Gaps = 0/63 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF +NVG+TNA AFA  +SQ PG + +ANAVFG DP I+  VL K F +EK ++ YLQAQ
Sbjct  166  HFQFNVGKTNAVAFAGLSSQNPGVITVANAVFGSDPKINPAVLTKAFQVEKNVIDYLQAQ  225

Query  42   NWT  34
             WT
Sbjct  226  FWT  228



>ref|XP_011034442.1| PREDICTED: germin-like protein subfamily 1 member 13 [Populus 
euphratica]
Length=225

 Score = 81.3 bits (199),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF +NVG+T A A +A +SQ PG + +ANAVFG  PPI  DVLAK F ++KKIV YLQ Q
Sbjct  160  HFQFNVGKTKAAAMSALSSQNPGVITIANAVFGSTPPIRSDVLAKAFQVDKKIVDYLQKQ  219

Query  42   NW  37
             W
Sbjct  220  LW  221



>ref|XP_002319672.1| hypothetical protein POPTR_0013s04850g [Populus trichocarpa]
 gb|EEE95595.1| hypothetical protein POPTR_0013s04850g [Populus trichocarpa]
Length=221

 Score = 81.3 bits (199),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 37/58 (64%), Positives = 45/58 (78%), Gaps = 0/58 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQ  49
            HF +NVG+T A AFA  +SQ PG + +ANAVFG DPPI+ DVLAK F L+KK+V YLQ
Sbjct  161  HFQFNVGKTKALAFAGLSSQNPGVITIANAVFGSDPPINPDVLAKAFQLDKKVVDYLQ  218



>emb|CDP10696.1| unnamed protein product [Coffea canephora]
Length=85

 Score = 78.6 bits (192),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 46/60 (77%), Gaps = 0/60 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF +N G+TNA AF+AF SQ PG + +ANAVFG DP IS DVLAK F ++KK++  L+AQ
Sbjct  24   HFQFNFGKTNAVAFSAFGSQNPGVITIANAVFGSDPLISADVLAKAFQVDKKVIYLLEAQ  83



>gb|EYU20542.1| hypothetical protein MIMGU_mgv1a020630mg [Erythranthe guttata]
Length=231

 Score = 81.3 bits (199),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 37/63 (59%), Positives = 46/63 (73%), Gaps = 0/63 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF +NVG+TNA AFA  +SQ PG + +ANAVFG DP I+  VL K F +EK ++ YLQAQ
Sbjct  166  HFQFNVGKTNAVAFAGLSSQNPGVITVANAVFGSDPKINPAVLTKAFQVEKNVIDYLQAQ  225

Query  42   NWT  34
             WT
Sbjct  226  FWT  228



>emb|CBI36816.3| unnamed protein product [Vitis vinifera]
Length=220

 Score = 81.3 bits (199),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 47/60 (78%), Gaps = 0/60 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF +N+G+TNA A AA +SQ PG + +ANAVFG DPPI+ DVL + F L+K +V+YLQ++
Sbjct  160  HFQFNIGKTNAVAIAALSSQNPGVITIANAVFGSDPPINPDVLTRAFQLDKSVVKYLQSR  219



>gb|EYU20549.1| hypothetical protein MIMGU_mgv1a020596mg [Erythranthe guttata]
Length=231

 Score = 81.3 bits (199),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 37/63 (59%), Positives = 46/63 (73%), Gaps = 0/63 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF +NVG+TNA AFA  +SQ PG + +ANAVFG DP I+  VL K F +EK ++ YLQAQ
Sbjct  166  HFQFNVGKTNAVAFAGLSSQNPGVITVANAVFGSDPQINPAVLTKAFQVEKNVIDYLQAQ  225

Query  42   NWT  34
             WT
Sbjct  226  FWT  228



>emb|CDP10694.1| unnamed protein product [Coffea canephora]
Length=224

 Score = 81.3 bits (199),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 46/60 (77%), Gaps = 0/60 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF +NVG+TNA AFA F SQ PG + +ANAVFG DP IS DVLAK F ++KK++  L+AQ
Sbjct  162  HFQFNVGKTNAVAFAGFGSQNPGVITIANAVFGSDPLISADVLAKAFQVDKKVIDLLEAQ  221



>ref|XP_009773220.1| PREDICTED: germin-like protein subfamily 1 member 17 [Nicotiana 
sylvestris]
Length=226

 Score = 80.9 bits (198),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 46/60 (77%), Gaps = 0/60 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HFLYNVG  NAT  A+FNSQ+PGFV + + +F  DPPI DDVLAK F L+KK+++ L+ +
Sbjct  165  HFLYNVGHNNATVLASFNSQRPGFVMIPSEIFASDPPILDDVLAKGFQLDKKVIKQLRKK  224



>emb|CBI39473.3| unnamed protein product [Vitis vinifera]
Length=220

 Score = 80.9 bits (198),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 47/60 (78%), Gaps = 0/60 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF +N+G+TNA A AA +SQ PG + +ANAVFG DPPI+ DVL + F L+K +V+YLQ++
Sbjct  160  HFQFNIGKTNAVAIAALSSQNPGVITIANAVFGSDPPINPDVLTRAFQLDKSVVKYLQSR  219



>emb|CDP10693.1| unnamed protein product [Coffea canephora]
Length=219

 Score = 80.9 bits (198),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 46/60 (77%), Gaps = 0/60 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF +NVG+TNA AFA F SQ PG + +ANAVFG DP IS DVLAK F ++KK++  L+AQ
Sbjct  157  HFQFNVGKTNAVAFAGFGSQNPGVITIANAVFGSDPLISADVLAKAFQVDKKVIDLLEAQ  216



>ref|XP_010911182.1| PREDICTED: putative germin-like protein 2-1 [Elaeis guineensis]
Length=221

 Score = 80.9 bits (198),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF +N G+TNA A A  +SQ PG + +ANAVFG  PPISDDVLAK F L+KK V++LQA 
Sbjct  155  HFQFNYGKTNAVAIAGLSSQNPGVITIANAVFGAKPPISDDVLAKAFQLDKKNVEWLQAP  214

Query  42   NW  37
             W
Sbjct  215  FW  216



>gb|EYU20541.1| hypothetical protein MIMGU_mgv1a018988mg [Erythranthe guttata]
Length=230

 Score = 80.9 bits (198),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF +NVG+TNA AFAA +SQ PG + +AN VFG DPPI+  VL K F ++K ++ YLQAQ
Sbjct  165  HFQFNVGKTNAVAFAALSSQNPGVITIANTVFGSDPPINPAVLTKAFQVKKNVIDYLQAQ  224

Query  42   NW  37
             W
Sbjct  225  FW  226



>gb|KCW82831.1| hypothetical protein EUGRSUZ_C04202, partial [Eucalyptus grandis]
Length=216

 Score = 80.9 bits (198),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF  N+G T A AF++F+SQ PG + +ANAVFG  PPIS DVL K F L KK+V+YL+AQ
Sbjct  151  HFQLNIGNTYALAFSSFSSQNPGLITIANAVFGAKPPISADVLTKAFQLNKKVVEYLEAQ  210

Query  42   NW  37
             W
Sbjct  211  FW  212



>ref|XP_008780761.1| PREDICTED: germin-like protein 8-5, partial [Phoenix dactylifera]
Length=148

 Score = 79.7 bits (195),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF +N G+TNA A A  +SQ PG + +ANAVFG  PPISD VLAK F L+KK V +LQAQ
Sbjct  82   HFQFNYGKTNAVAIAGLSSQNPGVITIANAVFGAKPPISDYVLAKAFQLDKKTVDWLQAQ  141

Query  42   NW  37
             W
Sbjct  142  FW  143



>gb|KCW80409.1| hypothetical protein EUGRSUZ_C01766 [Eucalyptus grandis]
Length=221

 Score = 80.9 bits (198),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF  N+G+T A AFAA +SQ PG + +AN+VFG  PPIS DVL K F ++KK+V YLQAQ
Sbjct  156  HFQLNIGKTPALAFAALSSQNPGVITIANSVFGSKPPISADVLTKAFQVDKKVVDYLQAQ  215

Query  42   NW  37
             W
Sbjct  216  FW  217



>ref|XP_010024913.1| PREDICTED: germin-like protein subfamily 1 member 7 [Eucalyptus 
grandis]
 gb|KCW61440.1| hypothetical protein EUGRSUZ_H04170 [Eucalyptus grandis]
Length=221

 Score = 80.9 bits (198),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF  N+G+T A AFAA +SQ PG + +ANAVFG  PPIS DVL K F +++K+V YLQAQ
Sbjct  156  HFQLNIGKTPALAFAALSSQNPGVITIANAVFGSKPPISADVLTKAFQVDRKVVDYLQAQ  215

Query  42   NW  37
             W
Sbjct  216  FW  217



>ref|XP_010051708.1| PREDICTED: germin-like protein subfamily 1 member 13 [Eucalyptus 
grandis]
Length=251

 Score = 80.9 bits (198),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF  N+G T A AF++F+SQ PG + +ANAVFG  PPIS DVL K F L KK+V+YL+AQ
Sbjct  186  HFQLNIGNTYALAFSSFSSQNPGLITIANAVFGAKPPISADVLTKAFQLNKKVVEYLEAQ  245

Query  42   NW  37
             W
Sbjct  246  FW  247



>ref|XP_002284284.2| PREDICTED: germin-like protein subfamily 1 member 17 [Vitis vinifera]
Length=245

 Score = 80.9 bits (198),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 47/60 (78%), Gaps = 0/60 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF +N+G+TNA A AA +SQ PG + +ANAVFG DPPI+ DVL + F L+K +V+YLQ++
Sbjct  185  HFQFNIGKTNAVAIAALSSQNPGVITIANAVFGSDPPINPDVLTRAFQLDKSVVKYLQSR  244



>gb|KCW61438.1| hypothetical protein EUGRSUZ_H04168 [Eucalyptus grandis]
Length=221

 Score = 80.5 bits (197),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF  N+G+T A AFAA +SQ PG + +AN+VFG  PPIS DVL K F ++KK+V YLQAQ
Sbjct  156  HFQLNIGKTPALAFAALSSQNPGVITIANSVFGSKPPISADVLTKAFQVDKKVVDYLQAQ  215

Query  42   NW  37
             W
Sbjct  216  FW  217



>ref|XP_002280481.2| PREDICTED: uncharacterized protein LOC100252737 [Vitis vinifera]
Length=685

 Score = 83.6 bits (205),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 36/64 (56%), Positives = 47/64 (73%), Gaps = 0/64 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF +NVG+T A A A  +SQ PG + +ANAVFG DPPI+ DVL + F L+KK+V YLQ++
Sbjct  160  HFQFNVGKTKAVAIAGLSSQNPGVITIANAVFGSDPPINPDVLTRAFQLDKKVVSYLQSR  219

Query  42   NWTL  31
            N  L
Sbjct  220  NMAL  223


 Score = 72.4 bits (176),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 31/60 (52%), Positives = 42/60 (70%), Gaps = 0/60 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF +NVG TNA A A  NSQ PG + +A AVFG +PPI+ D+L + F L+K +V  LQ++
Sbjct  620  HFQFNVGHTNAVAIAGLNSQNPGVITIAKAVFGSNPPINTDILTRAFQLDKNVVDDLQSR  679



>ref|XP_002530594.1| Rhicadhesin receptor precursor, putative [Ricinus communis]
 gb|EEF31774.1| Rhicadhesin receptor precursor, putative [Ricinus communis]
Length=190

 Score = 80.1 bits (196),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 36/63 (57%), Positives = 46/63 (73%), Gaps = 0/63 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF +N G TNA AFA  +SQ PG + +ANAVFG +PPI+ DVL K F ++K +V+YLQ Q
Sbjct  125  HFQFNTGNTNAVAFAGLSSQNPGAITIANAVFGSNPPINADVLTKAFQVDKNVVKYLQQQ  184

Query  42   NWT  34
             WT
Sbjct  185  FWT  187



>ref|XP_007030278.1| Germin-like protein subfamily 1 member 18 [Theobroma cacao]
 gb|EOY10780.1| Germin-like protein subfamily 1 member 18 [Theobroma cacao]
Length=476

 Score = 82.8 bits (203),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF  N+G+TNA AFAAF SQ PG + +A AVFG +PPI+ DVL K F L+K +V+YLQ+Q
Sbjct  411  HFQLNIGKTNAVAFAAFGSQNPGVITIAKAVFGSNPPINPDVLTKAFQLDKNVVKYLQSQ  470

Query  42   NW  37
             W
Sbjct  471  FW  472


 Score = 72.8 bits (177),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 43/60 (72%), Gaps = 0/60 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF  N+G+TNA AFA  +SQ PG + +A AVFG +PPI+ DVL K F L+K IV  LQ++
Sbjct  161  HFQLNIGKTNAVAFAGLSSQNPGVITIAKAVFGSNPPINPDVLTKAFQLDKNIVTSLQSR  220



>ref|XP_010049990.1| PREDICTED: germin-like protein subfamily 1 member 7 [Eucalyptus 
grandis]
 gb|KCW82832.1| hypothetical protein EUGRSUZ_C04203 [Eucalyptus grandis]
Length=223

 Score = 80.5 bits (197),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF  N+G T A + ++F+SQ PG + +ANAVFG  PPIS DVL K F L+KK+V+YL+AQ
Sbjct  158  HFQLNIGNTYALSISSFSSQNPGLITIANAVFGAKPPISADVLTKAFQLDKKVVEYLEAQ  217

Query  42   NW  37
            +W
Sbjct  218  SW  219



>ref|XP_011034445.1| PREDICTED: germin-like protein subfamily 1 member 7 [Populus 
euphratica]
 ref|XP_011038441.1| PREDICTED: germin-like protein subfamily 1 member 7 [Populus 
euphratica]
Length=221

 Score = 80.5 bits (197),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 36/58 (62%), Positives = 46/58 (79%), Gaps = 0/58 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQ  49
            HF +N+G+T A AFA  +SQ PG + +ANAVFG DPPI+ DVLAK F L+KK+V+YLQ
Sbjct  161  HFQFNMGQTKALAFAGLSSQNPGVITIANAVFGSDPPINPDVLAKAFQLDKKVVEYLQ  218



>ref|XP_010048594.1| PREDICTED: germin-like protein subfamily 1 member 7 [Eucalyptus 
grandis]
 gb|KCW80890.1| hypothetical protein EUGRSUZ_C02258 [Eucalyptus grandis]
Length=223

 Score = 80.5 bits (197),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF  N+G T A AF++F+SQ PG + +ANAVFG  PPIS DVL K F L+KK+V YLQAQ
Sbjct  158  HFQLNIGNTYALAFSSFSSQNPGIITVANAVFGAKPPISVDVLTKAFQLDKKVVDYLQAQ  217

Query  42   NW  37
             W
Sbjct  218  FW  219



>ref|XP_009630507.1| PREDICTED: germin-like protein subfamily 1 member 17 [Nicotiana 
tomentosiformis]
Length=226

 Score = 80.5 bits (197),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 46/60 (77%), Gaps = 0/60 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HFLYNVG  NAT  A+FNSQ+PGFV + + +F  DPPI DDVLAK F L+KK+++ L+ +
Sbjct  165  HFLYNVGHKNATVLASFNSQRPGFVMIPSEIFASDPPILDDVLAKGFQLDKKVIKQLRKK  224



>gb|EYU20539.1| hypothetical protein MIMGU_mgv1a013072mg [Erythranthe guttata]
Length=231

 Score = 80.5 bits (197),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF +NVG+TNA AFA  +SQ PG + +ANAVFG DP I+  VL K F +EK I+ YLQAQ
Sbjct  166  HFQFNVGKTNAVAFAGLSSQNPGVITIANAVFGSDPSINPAVLTKAFQVEKNIIDYLQAQ  225

Query  42   NW  37
             W
Sbjct  226  FW  227



>ref|XP_002284320.1| PREDICTED: germin-like protein subfamily 1 member 14 [Vitis vinifera]
 emb|CBI36817.3| unnamed protein product [Vitis vinifera]
Length=220

 Score = 80.5 bits (197),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 46/60 (77%), Gaps = 0/60 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF +NVG+T A A AA +SQ PG + +ANAVFG DPPI+ DVL + F L+KK+V YLQ++
Sbjct  160  HFQFNVGKTKAVAIAALSSQNPGVITIANAVFGSDPPINPDVLTRAFQLDKKVVSYLQSR  219



>ref|XP_010659615.1| PREDICTED: germin-like protein subfamily 1 member 14 [Vitis vinifera]
 emb|CBI39472.3| unnamed protein product [Vitis vinifera]
Length=220

 Score = 80.5 bits (197),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 46/60 (77%), Gaps = 0/60 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF +NVG+T A A AA +SQ PG + +ANAVFG DPPI+ DVL + F L+KK+V YLQ++
Sbjct  160  HFQFNVGKTKAVAIAALSSQNPGVITIANAVFGSDPPINPDVLTRAFQLDKKVVSYLQSR  219



>ref|XP_002531992.1| Rhicadhesin receptor precursor, putative [Ricinus communis]
 gb|EEF30391.1| Rhicadhesin receptor precursor, putative [Ricinus communis]
Length=223

 Score = 80.1 bits (196),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 36/63 (57%), Positives = 46/63 (73%), Gaps = 0/63 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF +N G TNA AFA  +SQ PG + +ANAVFG +PPI+ DVL K F ++K +V+YLQ Q
Sbjct  158  HFQFNTGNTNAVAFAGLSSQNPGAITIANAVFGSNPPINADVLTKAFQVDKNVVKYLQKQ  217

Query  42   NWT  34
             WT
Sbjct  218  FWT  220



>emb|CBI36783.3| unnamed protein product [Vitis vinifera]
Length=281

 Score = 80.5 bits (197),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 46/60 (77%), Gaps = 0/60 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF +N+G TNA A A  NSQ PG + +ANAVFG +PPI+ D LA+ F L+KK+V+YLQA+
Sbjct  221  HFQFNIGHTNAVAIAGLNSQNPGVITIANAVFGSNPPINPDFLARAFQLDKKVVEYLQAR  280



>ref|XP_011038440.1| PREDICTED: germin-like protein subfamily 1 member 7 [Populus 
euphratica]
Length=221

 Score = 80.1 bits (196),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 36/58 (62%), Positives = 45/58 (78%), Gaps = 0/58 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQ  49
            HF +N+G+T A AFA  +SQ PG + +ANAVFG DPPI+ DVLAK F L+KK+V YLQ
Sbjct  161  HFQFNMGKTKALAFAGLSSQNPGVITIANAVFGSDPPINPDVLAKAFQLDKKVVDYLQ  218



>ref|XP_010024917.1| PREDICTED: germin-like protein subfamily 1 member 7 [Eucalyptus 
grandis]
 gb|KCW61455.1| hypothetical protein EUGRSUZ_H04191 [Eucalyptus grandis]
Length=221

 Score = 80.1 bits (196),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF  N+G+T   AFAA +SQ PG + +ANAVFG  PPIS DVL K F ++KK+V YLQAQ
Sbjct  156  HFQLNIGKTPTLAFAALSSQNPGVITIANAVFGSKPPISADVLTKAFQVDKKVVDYLQAQ  215

Query  42   NW  37
             W
Sbjct  216  FW  217



>ref|XP_006358464.1| PREDICTED: germin-like protein subfamily 1 member 14-like [Solanum 
tuberosum]
Length=230

 Score = 80.1 bits (196),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF  NVG+TNA AFA  +SQ  G + +ANAVFG DPPI+DDVLAK F ++KK +  LQ Q
Sbjct  165  HFQLNVGKTNAIAFAGLSSQNAGVITVANAVFGSDPPINDDVLAKAFQVDKKAIDDLQEQ  224

Query  42   NW  37
             W
Sbjct  225  FW  226



>ref|XP_006358462.1| PREDICTED: germin-like protein subfamily 1 member 14-like [Solanum 
tuberosum]
Length=230

 Score = 80.1 bits (196),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF  NVG+TNA AFA  +SQ  G + +ANAVFG DPPI+DDVLAK F ++KK +  LQ Q
Sbjct  165  HFQLNVGKTNAIAFAGLSSQNAGVITVANAVFGSDPPINDDVLAKAFQVDKKAIDDLQEQ  224

Query  42   NW  37
             W
Sbjct  225  FW  226



>ref|XP_007030272.1| RmlC-like cupins superfamily protein [Theobroma cacao]
 gb|EOY10774.1| RmlC-like cupins superfamily protein [Theobroma cacao]
Length=225

 Score = 80.1 bits (196),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 48/62 (77%), Gaps = 0/62 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF +NVG+TNA AFAA +SQ PG + +ANAVFG +PPI+ DVL K F L+K +V+ LQ++
Sbjct  160  HFQFNVGKTNAVAFAALSSQNPGVITIANAVFGANPPINPDVLVKAFQLDKNVVKNLQSK  219

Query  42   NW  37
             W
Sbjct  220  FW  221



>ref|XP_010907049.1| PREDICTED: LOW QUALITY PROTEIN: germin-like protein 8-2 [Elaeis 
guineensis]
Length=224

 Score = 79.7 bits (195),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 47/63 (75%), Gaps = 0/63 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF +N G+T+A AFA  +SQ  G + +ANAVFG  PPISD+VLAK F L+KK V +LQAQ
Sbjct  158  HFQFNNGKTSAVAFAGLSSQNLGVITIANAVFGAMPPISDEVLAKAFQLDKKTVDWLQAQ  217

Query  42   NWT  34
             WT
Sbjct  218  LWT  220



>ref|XP_010066342.1| PREDICTED: germin-like protein subfamily 1 member 13 [Eucalyptus 
grandis]
Length=223

 Score = 79.7 bits (195),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF  N+G+TNA AFA  +SQ PG + +AN VFG  PPI+ DVL K F ++ K++ YLQAQ
Sbjct  158  HFQLNIGQTNALAFAFLSSQNPGLITIANTVFGSKPPINVDVLTKAFQVDNKLINYLQAQ  217

Query  42   NW  37
            NW
Sbjct  218  NW  219



>ref|XP_010054506.1| PREDICTED: uncharacterized protein LOC104442816 [Eucalyptus grandis]
Length=448

 Score = 81.6 bits (200),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF  N+G+T A AFAA +SQ PG + +ANAVFG  PPIS DVL K F ++KK+V YLQAQ
Sbjct  156  HFQLNIGKTPALAFAALSSQNPGVITIANAVFGSKPPISADVLTKAFQVDKKVVDYLQAQ  215

Query  42   NW  37
             W
Sbjct  216  FW  217


 Score = 76.3 bits (186),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF  N+G+T A AFAA +SQ PG + +AN+VF   PPIS DVL K F ++KK+V YLQ Q
Sbjct  383  HFQLNIGKTPALAFAALSSQNPGVITIANSVFRSKPPISADVLTKAFQVDKKVVDYLQVQ  442

Query  42   NW  37
             W
Sbjct  443  FW  444



>ref|XP_007030263.1| Germin-like protein subfamily 1 member 18 [Theobroma cacao]
 gb|EOY10765.1| Germin-like protein subfamily 1 member 18 [Theobroma cacao]
Length=252

 Score = 80.1 bits (196),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF  NVG+TNA AFA  +SQ PG + +ANAVFG +PPI+ DVL + F L+ K+V+YLQ++
Sbjct  187  HFQQNVGKTNAVAFAGLSSQNPGVITIANAVFGSNPPINPDVLTRAFQLDNKVVKYLQSR  246

Query  42   NW  37
             W
Sbjct  247  FW  248



>ref|XP_010027145.1| PREDICTED: germin-like protein subfamily 1 member 7 [Eucalyptus 
grandis]
 gb|KCW61467.1| hypothetical protein EUGRSUZ_H04203 [Eucalyptus grandis]
Length=223

 Score = 79.7 bits (195),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF  N+G T A AFA  +SQ PG + +ANAVFG  PPIS DVL K F ++KK+V YLQAQ
Sbjct  158  HFQLNIGNTYALAFAGLSSQNPGLITIANAVFGAKPPISADVLTKAFQVDKKVVDYLQAQ  217

Query  42   NW  37
             W
Sbjct  218  FW  219



>ref|XP_008779597.1| PREDICTED: putative germin-like protein 2-1, partial [Phoenix 
dactylifera]
Length=100

 Score = 77.4 bits (189),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF +N G  NA A AA +SQ PG + +ANAVFG  PPIS DVLAK F ++KK + +LQAQ
Sbjct  34   HFQFNYGTKNAVAIAALSSQNPGVITVANAVFGSKPPISRDVLAKAFQVDKKTIDWLQAQ  93

Query  42   NW  37
             W
Sbjct  94   FW  95



>ref|XP_010024923.1| PREDICTED: germin-like protein subfamily 1 member 7 [Eucalyptus 
grandis]
 gb|KCW61463.1| hypothetical protein EUGRSUZ_H04199 [Eucalyptus grandis]
Length=223

 Score = 79.7 bits (195),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF  N+G T A AFA  +SQ PG + +ANAVFG  PPIS DVL K F ++KK+V YLQAQ
Sbjct  158  HFQLNIGNTYALAFAGLSSQNPGLITIANAVFGAKPPISADVLTKAFQVDKKVVDYLQAQ  217

Query  42   NW  37
             W
Sbjct  218  FW  219



>ref|XP_010066343.1| PREDICTED: germin-like protein subfamily 1 member 17 [Eucalyptus 
grandis]
 ref|XP_010066344.1| PREDICTED: germin-like protein subfamily 1 member 17 [Eucalyptus 
grandis]
 ref|XP_010066348.1| PREDICTED: germin-like protein subfamily 1 member 17 [Eucalyptus 
grandis]
 gb|KCW64220.1| hypothetical protein EUGRSUZ_G01870 [Eucalyptus grandis]
 gb|KCW64221.1| hypothetical protein EUGRSUZ_G01871 [Eucalyptus grandis]
 gb|KCW64224.1| hypothetical protein EUGRSUZ_G01874 [Eucalyptus grandis]
Length=222

 Score = 79.7 bits (195),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF  N+G+TNA AFA  +SQ PG + +AN VFG  PPI+ DVL K F ++ K++ YLQAQ
Sbjct  157  HFQLNIGQTNALAFAFLSSQNPGLITIANTVFGSKPPINVDVLTKAFQVDNKLINYLQAQ  216

Query  42   NW  37
            NW
Sbjct  217  NW  218



>ref|XP_010050748.1| PREDICTED: uncharacterized protein LOC104439371 [Eucalyptus grandis]
Length=448

 Score = 81.6 bits (200),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF  N+G+T A AFAA +SQ PG + +ANAVFG  PPIS DVL K F ++KK+V YLQAQ
Sbjct  156  HFQLNIGKTPALAFAALSSQNPGVITIANAVFGSKPPISADVLTKAFQVDKKVVDYLQAQ  215

Query  42   NW  37
             W
Sbjct  216  FW  217


 Score = 80.5 bits (197),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF  N+G+T A AFAA +SQ PG + +AN+VFG  PPIS DVL K F ++KK+V YLQAQ
Sbjct  383  HFQLNIGKTPALAFAALSSQNPGVITIANSVFGSKPPISADVLTKAFQVDKKVVDYLQAQ  442

Query  42   NW  37
             W
Sbjct  443  FW  444



>ref|XP_010024926.1| PREDICTED: germin-like protein subfamily 1 member 7 [Eucalyptus 
grandis]
 gb|KCW61466.1| hypothetical protein EUGRSUZ_H04202 [Eucalyptus grandis]
Length=223

 Score = 79.3 bits (194),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF  N+G T A AFA  +SQ PG + +ANAVFG  PPIS DVL K F ++KK+V YLQAQ
Sbjct  158  HFQLNIGNTYALAFAGLSSQNPGLITIANAVFGAKPPISADVLTKAFQVDKKVVDYLQAQ  217

Query  42   NW  37
             W
Sbjct  218  FW  219



>ref|XP_010024924.1| PREDICTED: germin-like protein subfamily 1 member 7 [Eucalyptus 
grandis]
 gb|KCW61464.1| hypothetical protein EUGRSUZ_H04200 [Eucalyptus grandis]
Length=223

 Score = 79.3 bits (194),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF  N+G T A AFA  +SQ PG + +ANAVFG  PPIS DVL K F ++KK+V YLQAQ
Sbjct  158  HFQLNIGNTYALAFAGLSSQNPGLITIANAVFGAKPPISADVLTKAFQVDKKVVDYLQAQ  217

Query  42   NW  37
             W
Sbjct  218  FW  219



>ref|NP_001267943.1| germin-like protein 4 precursor [Vitis vinifera]
 gb|ABL60873.1| germin-like protein 4 [Vitis vinifera]
Length=220

 Score = 79.3 bits (194),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 45/60 (75%), Gaps = 0/60 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF +NVG+T A A A  +SQ PG + +ANAVFG DPPI+ DVL + F L+KK+V YLQ++
Sbjct  160  HFQFNVGKTKAVAIAGLSSQNPGVITIANAVFGSDPPINPDVLTRAFQLDKKVVSYLQSR  219



>gb|KCW61442.1| hypothetical protein EUGRSUZ_H04173, partial [Eucalyptus grandis]
Length=216

 Score = 79.3 bits (194),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 45/60 (75%), Gaps = 0/60 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF  N+G+T A AFAA +SQ PG + +ANAVFG  PPIS DVL K F ++KK+V YLQAQ
Sbjct  156  HFQLNIGKTPALAFAALSSQNPGLITIANAVFGSKPPISADVLTKAFQVDKKVVDYLQAQ  215



>emb|CAN61141.1| hypothetical protein VITISV_024669 [Vitis vinifera]
Length=181

 Score = 79.0 bits (193),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 45/60 (75%), Gaps = 0/60 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF +NVG+T A A A  +SQ PG + +ANAVFG DPPI+ DVL + F L+KK+V YLQ++
Sbjct  121  HFQFNVGKTKAVAIAGLSSQNPGVITIANAVFGSDPPINPDVLTRAFQLDKKVVSYLQSR  180



>ref|XP_009385875.1| PREDICTED: putative germin-like protein 2-1 [Musa acuminata subsp. 
malaccensis]
Length=223

 Score = 79.3 bits (194),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 36/63 (57%), Positives = 44/63 (70%), Gaps = 0/63 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF +N G T   A  A +SQ PG + +ANAVFG  PPISDDVLAK F ++KK + +LQAQ
Sbjct  157  HFQFNPGHTKTIAIGALSSQNPGTITIANAVFGSKPPISDDVLAKAFQVDKKTIDWLQAQ  216

Query  42   NWT  34
             WT
Sbjct  217  FWT  219



>emb|CBI36811.3| unnamed protein product [Vitis vinifera]
Length=220

 Score = 79.3 bits (194),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 45/60 (75%), Gaps = 0/60 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF +NVG+T A A A  +SQ PG + +ANAVFG DPPI+ DVL + F L+KK+V YLQ++
Sbjct  160  HFQFNVGKTKAVAIAGLSSQNPGVITIANAVFGSDPPINPDVLTRAFQLDKKVVSYLQSR  219



>ref|XP_008780786.1| PREDICTED: germin-like protein 8-5, partial [Phoenix dactylifera]
Length=148

 Score = 77.8 bits (190),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF +N G+TNA A AA +SQ PG + +ANAVFG  PPI D VLAK F L+KK V +LQAQ
Sbjct  82   HFQFNYGKTNAVAIAALSSQNPGVITIANAVFGAKPPIFDYVLAKAFQLDKKTVDWLQAQ  141

Query  42   NW  37
             W
Sbjct  142  FW  143



>ref|XP_002319674.2| hypothetical protein POPTR_0013s04920g [Populus trichocarpa]
 gb|EEE95597.2| hypothetical protein POPTR_0013s04920g [Populus trichocarpa]
Length=225

 Score = 79.0 bits (193),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF +NVG+T A+A  A +SQ PG + +ANAVFG  PPI  DVLAK F +EK IV +LQ Q
Sbjct  160  HFQFNVGKTKASAIGALSSQNPGVITIANAVFGSTPPIRSDVLAKAFQVEKNIVDFLQKQ  219

Query  42   NW  37
             W
Sbjct  220  FW  221



>emb|CAN74828.1| hypothetical protein VITISV_002139 [Vitis vinifera]
Length=186

 Score = 78.6 bits (192),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF +NVG+TNA AFA  +SQ PG + +ANAVFG DPPI  DVL + F L++ +V+ LQ++
Sbjct  121  HFQFNVGKTNAVAFAGLSSQNPGVITIANAVFGSDPPIDPDVLTRAFQLDEDVVKDLQSR  180

Query  42   NW  37
             W
Sbjct  181  FW  182



>ref|XP_010050166.1| PREDICTED: germin-like protein subfamily 1 member 7 [Eucalyptus 
grandis]
 gb|KCW89288.1| hypothetical protein EUGRSUZ_A01578 [Eucalyptus grandis]
Length=223

 Score = 79.0 bits (193),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF  N+G T A AFA  +SQ PG + +ANAVFG  PPIS DVL K F ++KK+V YLQAQ
Sbjct  158  HFQLNIGNTYALAFAGLSSQSPGVITIANAVFGAKPPISADVLTKAFQVDKKVVDYLQAQ  217

Query  42   NW  37
             W
Sbjct  218  FW  219



>ref|XP_009786133.1| PREDICTED: germin-like protein subfamily 1 member 14 [Nicotiana 
sylvestris]
Length=139

 Score = 77.8 bits (190),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 34/57 (60%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = -3

Query  207  VGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQNW  37
            V   NA AFA  +SQ PG + +ANAVFG DPPI+DDVLAK F ++KK++ YLQ+Q W
Sbjct  79   VTAVNAVAFAGLSSQNPGVITIANAVFGSDPPINDDVLAKAFQVDKKVIDYLQSQFW  135



>ref|XP_002284343.2| PREDICTED: uncharacterized protein LOC100256308 [Vitis vinifera]
Length=477

 Score = 81.3 bits (199),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 47/60 (78%), Gaps = 0/60 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF +N+G+TNA A AA +SQ PG + +ANAVFG DPPI+ DVL + F L+K +V+YLQ++
Sbjct  417  HFQFNIGKTNAVAIAALSSQNPGVITIANAVFGSDPPINPDVLTRAFQLDKSVVKYLQSR  476


 Score = 72.8 bits (177),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 43/61 (70%), Gaps = 0/61 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF +N+G TNA A A  +SQ PG + +ANAVFG DP I+ D L + F L+K +V YLQ++
Sbjct  160  HFQFNIGHTNAVAIAGLSSQNPGVITIANAVFGSDPSINPDFLTRAFQLDKNVVNYLQSR  219

Query  42   N  40
            +
Sbjct  220  S  220



>ref|XP_009341765.1| PREDICTED: germin-like protein subfamily 1 member 17 [Pyrus x 
bretschneideri]
 ref|XP_009349818.1| PREDICTED: germin-like protein subfamily 1 member 17 [Pyrus x 
bretschneideri]
Length=230

 Score = 79.0 bits (193),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 43/62 (69%), Gaps = 0/62 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF  NVG+TNA A AAF SQ PG + +ANAVFG  PPI+ DVL K F L+  +V YLQ Q
Sbjct  165  HFQLNVGKTNALAIAAFGSQNPGVITIANAVFGSKPPINPDVLTKAFQLDNNVVDYLQKQ  224

Query  42   NW  37
             W
Sbjct  225  FW  226



>ref|XP_002276756.2| PREDICTED: putative germin-like protein 2-1 [Vitis vinifera]
Length=228

 Score = 79.0 bits (193),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 36/63 (57%), Positives = 45/63 (71%), Gaps = 0/63 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF  NVG+TNA A A+ +SQ PG + +ANAVFG  P IS DVL K F ++K +V YLQ+Q
Sbjct  161  HFQLNVGKTNAVAIASLSSQNPGVITIANAVFGSKPAISADVLTKAFQVDKNVVNYLQSQ  220

Query  42   NWT  34
             WT
Sbjct  221  FWT  223



>ref|XP_010048221.1| PREDICTED: germin-like protein subfamily 1 member 13 [Eucalyptus 
grandis]
 gb|KCW80406.1| hypothetical protein EUGRSUZ_C01763 [Eucalyptus grandis]
Length=223

 Score = 79.0 bits (193),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF  N G+T A AFA  +SQ PG + +AN+VFG  PPIS DVL K F ++KKIV YLQAQ
Sbjct  158  HFQLNTGKTPALAFAGLSSQNPGVITIANSVFGARPPISADVLTKAFQVDKKIVDYLQAQ  217

Query  42   NW  37
             W
Sbjct  218  FW  219



>ref|XP_002523177.1| Rhicadhesin receptor precursor, putative [Ricinus communis]
 gb|EEF39208.1| Rhicadhesin receptor precursor, putative [Ricinus communis]
Length=216

 Score = 79.0 bits (193),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 44/60 (73%), Gaps = 0/60 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF  NVGR NA A AA +SQ PG + +ANAVFG  P IS+D+LAK F L+ K+V YLQA+
Sbjct  156  HFQRNVGRGNAVALAALSSQNPGVITIANAVFGSTPAISNDILAKAFQLDTKVVNYLQAK  215



>ref|XP_010659820.1| PREDICTED: germin-like protein 3 isoform X1 [Vitis vinifera]
Length=190

 Score = 78.6 bits (192),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF +NVG+TNA AFA  +SQ PG + +ANAVFG DPPI  DVL + F L++ +V+ LQ++
Sbjct  125  HFQFNVGKTNAVAFAGLSSQNPGVITIANAVFGSDPPIDPDVLTRAFQLDEDVVKDLQSR  184

Query  42   NW  37
             W
Sbjct  185  FW  186



>gb|KCW82834.1| hypothetical protein EUGRSUZ_C04205 [Eucalyptus grandis]
Length=223

 Score = 79.0 bits (193),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF  N+G T A AF++F+SQ PG + +ANAVFG   PIS DVL K F L+KK+V+YL+AQ
Sbjct  158  HFQLNIGNTYALAFSSFSSQNPGLITIANAVFGAKAPISADVLTKAFQLDKKVVEYLEAQ  217

Query  42   NW  37
             W
Sbjct  218  FW  219



>gb|EYU20535.1| hypothetical protein MIMGU_mgv1a013054mg [Erythranthe guttata]
Length=231

 Score = 79.0 bits (193),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF +NVG+TNA AFA  +SQ P  + +ANAVFG DPPI+  VL K F +EK ++ YLQ Q
Sbjct  166  HFQFNVGKTNAVAFAGLSSQNPSVITIANAVFGSDPPINPAVLTKAFQVEKNVIDYLQKQ  225

Query  42   NW  37
             W
Sbjct  226  FW  227



>emb|CBI36791.3| unnamed protein product [Vitis vinifera]
Length=225

 Score = 78.6 bits (192),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF +NVG+TNA AFA  +SQ PG + +ANAVFG DPPI  DVL + F L++ +V+ LQ++
Sbjct  160  HFQFNVGKTNAVAFAGLSSQNPGVITIANAVFGSDPPIDPDVLTRAFQLDEDVVKDLQSR  219

Query  42   NW  37
             W
Sbjct  220  FW  221



>emb|CDP16789.1| unnamed protein product [Coffea canephora]
Length=488

 Score = 80.9 bits (198),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF +N G+TNA AFAA +SQ PG + +ANAVFG  PPIS DVL K F ++K +++YLQ+Q
Sbjct  420  HFQFNQGQTNAVAFAALSSQNPGVITIANAVFGSKPPISRDVLTKAFQVDKNVIKYLQSQ  479

Query  42   NW  37
             W
Sbjct  480  FW  481


 Score = 80.9 bits (198),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 35/64 (55%), Positives = 47/64 (73%), Gaps = 0/64 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF +N G +NA AFA   SQ PG + +ANAVFG +PPIS DVL K F ++KK+++YLQ+Q
Sbjct  162  HFQFNQGHSNAVAFAGLGSQNPGVITIANAVFGSNPPISPDVLTKAFQVDKKVIKYLQSQ  221

Query  42   NWTL  31
             W +
Sbjct  222  FWEI  225



>gb|KCW64218.1| hypothetical protein EUGRSUZ_G01868, partial [Eucalyptus grandis]
 gb|KCW64219.1| hypothetical protein EUGRSUZ_G01869, partial [Eucalyptus grandis]
 gb|KCW64222.1| hypothetical protein EUGRSUZ_G01872, partial [Eucalyptus grandis]
 gb|KCW64223.1| hypothetical protein EUGRSUZ_G01873, partial [Eucalyptus grandis]
Length=216

 Score = 78.6 bits (192),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 45/60 (75%), Gaps = 0/60 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF  N+G+T A AFAA +SQ PG + +ANAVFG  PPIS DVL K F ++KK+V YLQAQ
Sbjct  156  HFQLNIGKTPALAFAALSSQNPGVITIANAVFGSKPPISADVLTKAFQVDKKVVDYLQAQ  215



>ref|XP_007030265.1| Germin-like protein 2 [Theobroma cacao]
 gb|EOY10767.1| Germin-like protein 2 [Theobroma cacao]
Length=221

 Score = 78.6 bits (192),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 46/60 (77%), Gaps = 0/60 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF  NVG+TNA AFA  +SQ PG + +ANAVFG +PPI+ DVL   F L+KK+V+YLQ++
Sbjct  161  HFQQNVGKTNAVAFAGLSSQNPGVITIANAVFGSNPPINPDVLTGAFQLDKKVVKYLQSR  220



>ref|XP_010027136.1| PREDICTED: uncharacterized protein LOC104417584 [Eucalyptus grandis]
Length=492

 Score = 80.9 bits (198),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF  N+G+T A AFAA +SQ PG + +AN+VFG  PPIS DVL K F ++KK+V YLQAQ
Sbjct  156  HFQLNIGKTPALAFAALSSQNPGVITIANSVFGSKPPISADVLTKAFQVDKKVVDYLQAQ  215

Query  42   NW  37
             W
Sbjct  216  FW  217


 Score = 79.7 bits (195),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF  N+G+T A AFAA +SQ PG + +ANAVFG  PPIS  VL K F ++KK+V YLQAQ
Sbjct  427  HFQLNIGKTPALAFAALSSQNPGLITIANAVFGSKPPISAGVLTKAFQVDKKVVDYLQAQ  486

Query  42   NW  37
             W
Sbjct  487  FW  488



>ref|XP_010662281.1| PREDICTED: putative germin-like protein 2-1, partial [Vitis vinifera]
Length=187

 Score = 78.2 bits (191),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 36/63 (57%), Positives = 45/63 (71%), Gaps = 0/63 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF  NVG TNA A A+ +SQ PG + +ANAVFG  P IS DVL K F ++K +V+YLQ+Q
Sbjct  120  HFQLNVGTTNAVAIASLSSQNPGVITIANAVFGSKPAISADVLTKAFQVDKNVVEYLQSQ  179

Query  42   NWT  34
             WT
Sbjct  180  FWT  182



>gb|KCW44233.1| hypothetical protein EUGRSUZ_L02343 [Eucalyptus grandis]
Length=231

 Score = 78.6 bits (192),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 45/60 (75%), Gaps = 0/60 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF  N+G+T A AFAA +SQ PG + +ANAVFG  PPIS DVL K F ++KK+V YLQAQ
Sbjct  156  HFQLNIGKTPALAFAALSSQNPGVITIANAVFGSKPPISADVLTKAFQVDKKVVDYLQAQ  215



>ref|XP_002531991.1| Rhicadhesin receptor precursor, putative [Ricinus communis]
 gb|EEF30390.1| Rhicadhesin receptor precursor, putative [Ricinus communis]
Length=194

 Score = 78.2 bits (191),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF +N G TNA AFA  +SQ PG + +ANAVFG +PPI+ DVL K F ++K +V YLQ Q
Sbjct  129  HFQFNTGSTNAVAFAGLSSQNPGAITIANAVFGSNPPINPDVLTKAFQVDKSVVNYLQKQ  188

Query  42   NW  37
             W
Sbjct  189  FW  190



>ref|XP_002276644.1| PREDICTED: putative germin-like protein 2-1 [Vitis vinifera]
Length=228

 Score = 78.6 bits (192),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 35/63 (56%), Positives = 45/63 (71%), Gaps = 0/63 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF  NVG+TNA A A+ +SQ PG + +ANAVFG  P IS DVL K F ++K ++ YLQ+Q
Sbjct  161  HFQLNVGKTNAVAIASLSSQNPGVITIANAVFGSKPAISADVLTKAFQVDKNVINYLQSQ  220

Query  42   NWT  34
             WT
Sbjct  221  FWT  223



>emb|CDP16787.1| unnamed protein product [Coffea canephora]
Length=230

 Score = 78.2 bits (191),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF +N G +NA AFA  +SQ PG + +ANAVFG  PPIS DVL K F ++K +V+YLQ+Q
Sbjct  162  HFQFNKGHSNAVAFAGLSSQNPGVITIANAVFGSKPPISRDVLTKAFQVDKNVVKYLQSQ  221

Query  42   NW  37
             W
Sbjct  222  FW  223



>gb|EYU20536.1| hypothetical protein MIMGU_mgv1a025658mg [Erythranthe guttata]
Length=231

 Score = 78.2 bits (191),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF +N G+TNA AFA  +SQ PG + +ANAVFG DP I+  VL K F +EK ++ YLQAQ
Sbjct  166  HFQFNAGKTNAVAFAGLSSQNPGVITIANAVFGSDPSINPAVLTKAFQVEKNVIDYLQAQ  225

Query  42   NW  37
             W
Sbjct  226  FW  227



>ref|XP_002284624.1| PREDICTED: germin-like protein subfamily 1 member 7 [Vitis vinifera]
 emb|CBI36787.3| unnamed protein product [Vitis vinifera]
Length=220

 Score = 78.2 bits (191),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 46/60 (77%), Gaps = 0/60 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF +N+G TNA A A  NSQ PG + +A+AVFG +PPI+ D LA+ F L+KK+V+YLQA+
Sbjct  160  HFQFNIGHTNAVAIAGLNSQNPGVITIADAVFGSNPPINPDFLARAFQLDKKVVEYLQAR  219



>ref|XP_009402547.1| PREDICTED: putative germin-like protein 2-1 isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009402548.1| PREDICTED: putative germin-like protein 2-1 isoform X2 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009402549.1| PREDICTED: putative germin-like protein 2-1 isoform X3 [Musa 
acuminata subsp. malaccensis]
Length=221

 Score = 78.2 bits (191),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 43/62 (69%), Gaps = 0/62 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF +N G  N  A  A +SQ PG + +ANAVFG  PPISDDVLAK F ++KK + +LQAQ
Sbjct  155  HFQFNPGNCNTIAIGALSSQNPGTITIANAVFGSKPPISDDVLAKAFQVDKKTIDWLQAQ  214

Query  42   NW  37
             W
Sbjct  215  FW  216



>ref|XP_006354543.1| PREDICTED: germin-like protein subfamily 1 member 19-like [Solanum 
tuberosum]
Length=226

 Score = 78.2 bits (191),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 43/60 (72%), Gaps = 0/60 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF YNVGRTNAT  A +NSQ PGF  + N +F  DPPI DD LAK F L+KK+++ L+ +
Sbjct  165  HFQYNVGRTNATILATYNSQNPGFTMIPNIIFASDPPIIDDALAKGFQLDKKVIKQLRKK  224



>ref|XP_010659856.1| PREDICTED: germin-like protein subfamily 1 member 7 [Vitis vinifera]
Length=222

 Score = 78.2 bits (191),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 34/59 (58%), Positives = 45/59 (76%), Gaps = 0/59 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQA  46
            HF +N+G TNA A A  NSQ PG + +A+AVFG +PPI+ D LA+ F L+KK+V+YLQA
Sbjct  162  HFQFNIGHTNAVAIAGLNSQNPGVITIADAVFGSNPPINPDFLARAFQLDKKVVEYLQA  220



>ref|NP_001268128.1| germin-like protein 5 [Vitis vinifera]
 gb|ABL60874.1| germin-like protein 5 [Vitis vinifera]
 emb|CBI39475.3| unnamed protein product [Vitis vinifera]
Length=207

 Score = 78.2 bits (191),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 45/60 (75%), Gaps = 0/60 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF +NVG  NA A AA +SQ PG + +ANAVFG +PPI+ D LAK F L+KK+V+YLQA 
Sbjct  147  HFQFNVGHANAVAIAALSSQNPGVITIANAVFGSNPPINPDFLAKAFQLDKKVVEYLQAH  206



>emb|CBI36778.3| unnamed protein product [Vitis vinifera]
Length=1271

 Score = 81.6 bits (200),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 34/60 (57%), Positives = 47/60 (78%), Gaps = 0/60 (0%)
 Frame = -3

Query  222   HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
             HF  N+G TNA A AAFNSQ PG V +A+++FG +PPI+ D LA+ F L+K++V+YLQA+
Sbjct  1211  HFQVNIGHTNAVAIAAFNSQNPGIVTIASSMFGSNPPINPDFLARAFQLDKRVVEYLQAR  1270



>ref|XP_008363404.1| PREDICTED: LOW QUALITY PROTEIN: germin-like protein subfamily 
1 member 11 [Malus domestica]
Length=225

 Score = 78.2 bits (191),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF  NVG TNA A +  +SQ PG + +ANAVFG +PPI+ DVLAK F +E K+V YLQ Q
Sbjct  160  HFQLNVGHTNAVAISGLSSQNPGVITIANAVFGANPPINPDVLAKAFQVEBKLVTYLQKQ  219

Query  42   NW  37
             W
Sbjct  220  FW  221



>ref|XP_010257844.1| PREDICTED: putative germin-like protein 2-1 [Nelumbo nucifera]
Length=224

 Score = 78.2 bits (191),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 43/62 (69%), Gaps = 0/62 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF +N G TNA A A  +SQ PG + +ANAVFG  PPI DDVLA+ F ++ K++  LQAQ
Sbjct  159  HFQFNTGETNAVALAGLSSQNPGVITIANAVFGSKPPIRDDVLARAFRVDTKLIDNLQAQ  218

Query  42   NW  37
             W
Sbjct  219  FW  220



>ref|XP_008778853.1| PREDICTED: putative germin-like protein 2-1 [Phoenix dactylifera]
Length=222

 Score = 78.2 bits (191),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 45/60 (75%), Gaps = 0/60 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF +N G+TNA A A  +SQ PG + +ANAVFG +PPISD VLAK F L+KK V +LQAQ
Sbjct  156  HFQFNYGKTNAVAIAILSSQNPGVITIANAVFGANPPISDYVLAKAFQLDKKTVDWLQAQ  215



>ref|XP_002523178.1| Rhicadhesin receptor precursor, putative [Ricinus communis]
 gb|EEF39209.1| Rhicadhesin receptor precursor, putative [Ricinus communis]
Length=216

 Score = 77.8 bits (190),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 44/60 (73%), Gaps = 0/60 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF  NVGR NA A AA +SQ PG + +ANAVFG  P IS+D+LAK F L+ K+V YLQA+
Sbjct  156  HFQRNVGRGNAVALAALSSQNPGVITIANAVFGSTPAISNDILAKAFQLDTKVVNYLQAK  215



>emb|CDP10695.1| unnamed protein product [Coffea canephora]
Length=223

 Score = 77.8 bits (190),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 46/60 (77%), Gaps = 0/60 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF +N G+TNA AF+AF SQ PG + +ANAVFG DP IS DVLAK F ++KK++  L+AQ
Sbjct  162  HFQFNFGKTNAVAFSAFGSQNPGVITIANAVFGSDPLISADVLAKAFQVDKKVIYLLEAQ  221



>ref|XP_010041604.1| PREDICTED: germin-like protein subfamily 1 member 13 [Eucalyptus 
grandis]
Length=223

 Score = 77.8 bits (190),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF  N+G+TNA AFA  +SQ PG + +AN VFG  PPI+ DVL K F ++ K++ YLQAQ
Sbjct  158  HFQLNIGQTNALAFAFLSSQNPGLITIANTVFGSKPPINVDVLTKAFQVDNKLINYLQAQ  217

Query  42   NW  37
            +W
Sbjct  218  SW  219



>ref|XP_008393482.1| PREDICTED: germin-like protein subfamily 1 member 13 [Malus domestica]
 ref|XP_008351930.1| PREDICTED: germin-like protein subfamily 1 member 13 [Malus domestica]
Length=230

 Score = 78.2 bits (191),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF  NVG+TNA A AAF+SQ PG + +ANAVFG  PPI+ DVL K F ++  +V YLQ Q
Sbjct  165  HFQLNVGKTNAVAIAAFSSQNPGVITVANAVFGSKPPINPDVLTKAFQVDNNVVDYLQKQ  224

Query  42   NW  37
             W
Sbjct  225  FW  226



>ref|XP_004247722.1| PREDICTED: germin-like protein subfamily 1 member 19 [Solanum 
lycopersicum]
Length=224

 Score = 77.8 bits (190),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 43/60 (72%), Gaps = 0/60 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF YNVGRTNAT  A +NSQ PGF  + N +F  DPPI DD LAK F L+KK+++ L+ +
Sbjct  163  HFQYNVGRTNATILATYNSQNPGFTMIPNIIFASDPPIIDDALAKGFQLDKKVIKQLRKK  222



>ref|XP_002284682.1| PREDICTED: germin-like protein subfamily 1 member 15 [Vitis vinifera]
Length=220

 Score = 77.8 bits (190),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 47/60 (78%), Gaps = 0/60 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF  N+G TNA A AAFNSQ PG V +A+++FG +PPI+ D LA+ F L+K++V+YLQA+
Sbjct  160  HFQVNIGHTNAVAIAAFNSQNPGIVTIASSMFGSNPPINPDFLARAFQLDKRVVEYLQAR  219



>ref|XP_007030273.1| RmlC-like cupins superfamily protein [Theobroma cacao]
 gb|EOY10775.1| RmlC-like cupins superfamily protein [Theobroma cacao]
Length=224

 Score = 77.8 bits (190),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 34/63 (54%), Positives = 46/63 (73%), Gaps = 0/63 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF +N+G+T A AFA  +SQ  G + +ANAVFG DPPI+ DVL K F L+K +V YLQ++
Sbjct  161  HFQFNIGKTEAVAFAGLSSQNAGVITIANAVFGSDPPINPDVLTKAFQLDKNMVAYLQSR  220

Query  42   NWT  34
             W+
Sbjct  221  FWS  223



>ref|XP_010024920.1| PREDICTED: germin-like protein subfamily 1 member 13 [Eucalyptus 
grandis]
 gb|KCW61459.1| hypothetical protein EUGRSUZ_H04195 [Eucalyptus grandis]
Length=223

 Score = 77.8 bits (190),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF  N G+T A AFAA +SQ PG + +AN+VFG  PPIS DVL K F ++KK + YLQAQ
Sbjct  158  HFQLNTGKTPALAFAALSSQNPGVITIANSVFGAKPPISVDVLTKAFQVDKKTIDYLQAQ  217

Query  42   NW  37
             W
Sbjct  218  FW  219



>emb|CDP10932.1| unnamed protein product [Coffea canephora]
Length=224

 Score = 77.8 bits (190),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 46/60 (77%), Gaps = 0/60 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HFL NVG+T A    AFNSQ PG + +ANAVFG +P IS +VL K+F L+KK+++YLQ++
Sbjct  164  HFLRNVGKTKAMGIVAFNSQNPGTITIANAVFGTEPLISPEVLTKSFQLDKKVIEYLQSK  223



>ref|XP_002284616.2| PREDICTED: germin-like protein subfamily 1 member 7 [Vitis vinifera]
 emb|CBI36788.3| unnamed protein product [Vitis vinifera]
Length=220

 Score = 77.8 bits (190),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 45/60 (75%), Gaps = 0/60 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF +N+G  NA A A  NSQ PG + +ANAVFG +PPI+ D LA+ F L+KK+V+YLQA+
Sbjct  160  HFQFNIGHINAVAIAGLNSQNPGVITIANAVFGSNPPINPDFLARAFQLDKKVVKYLQAR  219



>ref|XP_011099650.1| PREDICTED: germin-like protein subfamily 1 member 13 [Sesamum 
indicum]
Length=231

 Score = 77.8 bits (190),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 33/63 (52%), Positives = 46/63 (73%), Gaps = 0/63 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF YNVG+T+A A A+ NSQ PG + +  AVFG +PP+  DVL K+F + +K+V+YLQ+ 
Sbjct  166  HFQYNVGKTSAVAIASLNSQNPGIMTIPKAVFGSEPPVRADVLVKSFQVREKLVEYLQSL  225

Query  42   NWT  34
             WT
Sbjct  226  PWT  228



>ref|XP_007201630.1| hypothetical protein PRUPE_ppa020060mg [Prunus persica]
 gb|EMJ02829.1| hypothetical protein PRUPE_ppa020060mg [Prunus persica]
Length=233

 Score = 77.8 bits (190),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 43/62 (69%), Gaps = 0/62 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF  NVG  NA A AA +SQ PG + +ANAVFG  PPI+ DVLAK F ++ K+V YLQ Q
Sbjct  168  HFQLNVGHVNAVALAALSSQNPGVITIANAVFGSKPPINPDVLAKAFQVDNKVVDYLQKQ  227

Query  42   NW  37
             W
Sbjct  228  FW  229



>emb|CAN82524.1| hypothetical protein VITISV_028056 [Vitis vinifera]
Length=216

 Score = 77.4 bits (189),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/63 (57%), Positives = 44/63 (70%), Gaps = 0/63 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF  NVG TNA A A+ +SQ PG + +ANAVFG  P IS DVL K F L+K +V YLQ++
Sbjct  149  HFQLNVGTTNAVAIASLSSQNPGVITIANAVFGSKPAISADVLTKAFQLDKNVVAYLQSR  208

Query  42   NWT  34
             WT
Sbjct  209  FWT  211



>ref|XP_010024921.1| PREDICTED: germin-like protein subfamily 1 member 13 [Eucalyptus 
grandis]
 gb|KCW61460.1| hypothetical protein EUGRSUZ_H04196 [Eucalyptus grandis]
Length=223

 Score = 77.4 bits (189),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF  N G+T A AFAA +SQ PG + +AN+VFG  PPIS DVL K F +++K V+YLQAQ
Sbjct  158  HFQLNTGKTPALAFAALSSQNPGVITIANSVFGAKPPISVDVLTKAFQVDEKTVEYLQAQ  217

Query  42   NW  37
             W
Sbjct  218  FW  219



>ref|XP_008237387.1| PREDICTED: germin-like protein subfamily 1 member 20 [Prunus 
mume]
Length=233

 Score = 77.8 bits (190),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 43/62 (69%), Gaps = 0/62 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF  NVG  NA A AA +SQ PG + +ANAVFG  PPI+ DVLAK F ++ K+V YLQ Q
Sbjct  168  HFQLNVGHVNAVALAALSSQNPGVITIANAVFGSKPPINPDVLAKAFQVDNKVVNYLQKQ  227

Query  42   NW  37
             W
Sbjct  228  FW  229



>ref|XP_006375870.1| germin-like protein 1 [Populus trichocarpa]
 gb|ERP53667.1| germin-like protein 1 [Populus trichocarpa]
Length=225

 Score = 77.4 bits (189),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF +NVG+T A+A  A +SQ PG + +ANAVFG  PPI  DVLAK F ++K IV +LQ Q
Sbjct  160  HFQFNVGKTKASAIGALSSQNPGVITIANAVFGSTPPIRSDVLAKAFQVDKNIVDFLQKQ  219

Query  42   NW  37
             W
Sbjct  220  FW  221



>ref|XP_010042132.1| PREDICTED: germin-like protein subfamily 1 member 13 [Eucalyptus 
grandis]
Length=223

 Score = 77.4 bits (189),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF  N G+T A AFA+ +SQ PG + +AN+VFG  PPIS DVL K F ++KK V YLQAQ
Sbjct  158  HFQLNTGKTPALAFASLSSQNPGVITIANSVFGAKPPISADVLTKAFQVDKKTVDYLQAQ  217

Query  42   NW  37
             W
Sbjct  218  FW  219



>ref|XP_006845853.1| hypothetical protein AMTR_s00154p00039580 [Amborella trichopoda]
 gb|ERN07528.1| hypothetical protein AMTR_s00154p00039580 [Amborella trichopoda]
Length=188

 Score = 77.0 bits (188),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF  NVG  NA A AAF SQ PG + +ANAVFG +PPISD VLAK F ++KK+V  LQ+ 
Sbjct  123  HFQQNVGYGNAVALAAFGSQNPGVITIANAVFGSNPPISDAVLAKAFQIDKKLVDKLQSS  182

Query  42   NW  37
             W
Sbjct  183  FW  184



>ref|XP_004291649.1| PREDICTED: germin-like protein subfamily 1 member 11-like [Fragaria 
vesca subsp. vesca]
Length=230

 Score = 77.4 bits (189),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF  N+G  NA A AA +SQ PG + +ANAVFG +PPI+ DVL+K F +++K+V+YLQ Q
Sbjct  165  HFQLNIGPVNAVALAALSSQNPGVITIANAVFGANPPINPDVLSKAFQVDEKLVEYLQKQ  224

Query  42   NW  37
             W
Sbjct  225  FW  226



>ref|XP_008778966.1| PREDICTED: putative germin-like protein 2-1 [Phoenix dactylifera]
Length=221

 Score = 77.4 bits (189),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF +N G  NA A AA +SQ PG + +ANAVFG  PPIS DVLAK F ++KK + +LQAQ
Sbjct  155  HFQFNYGTKNAVAIAALSSQNPGVITVANAVFGSKPPISRDVLAKAFQVDKKTIDWLQAQ  214

Query  42   NW  37
             W
Sbjct  215  FW  216



>ref|XP_008393483.1| PREDICTED: germin-like protein subfamily 1 member 13 [Malus domestica]
Length=228

 Score = 77.4 bits (189),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF  NVG+TNA A A  +SQ PG + +ANAVFG +PPI+ DVLAK F ++  +V YLQ Q
Sbjct  163  HFQLNVGKTNALAIAGLSSQNPGVITIANAVFGSNPPINPDVLAKAFQVDBNVVDYLQKQ  222

Query  42   NW  37
             W
Sbjct  223  FW  224



>gb|KHN14793.1| Germin-like protein subfamily 1 member 16 [Glycine soja]
Length=175

 Score = 76.6 bits (187),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 43/62 (69%), Gaps = 0/62 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF  N+G  NA A A  +SQ PG + +ANAVFG  PPISD+VLAK F ++K ++ YLQ Q
Sbjct  110  HFQQNIGYGNALAIAGLSSQNPGVISIANAVFGSKPPISDEVLAKAFQVDKNVIDYLQKQ  169

Query  42   NW  37
             W
Sbjct  170  FW  171



>ref|XP_008367619.1| PREDICTED: germin-like protein subfamily 1 member 13 [Malus domestica]
Length=228

 Score = 77.4 bits (189),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF  NVG+TNA A A  +SQ PG + +ANAVFG +PPI+ DVLAK F ++  +V YLQ Q
Sbjct  163  HFQLNVGKTNALAIAGLSSQNPGVITIANAVFGSNPPINPDVLAKAFQVDDNVVDYLQKQ  222

Query  42   NW  37
             W
Sbjct  223  FW  224



>ref|XP_008351931.1| PREDICTED: germin-like protein subfamily 1 member 13 [Malus domestica]
Length=228

 Score = 77.4 bits (189),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF  NVG+TNA A A  +SQ PG + +ANAVFG +PPI+ DVLAK F ++  +V YLQ Q
Sbjct  163  HFQLNVGKTNALAIAGLSSQNPGVITIANAVFGSNPPINPDVLAKAFQVDBNVVDYLQKQ  222

Query  42   NW  37
             W
Sbjct  223  FW  224



>ref|XP_008375054.1| PREDICTED: germin-like protein subfamily 1 member 13 [Malus domestica]
Length=226

 Score = 77.0 bits (188),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF  NVG+TNA A A  +SQ PG + +ANAVFG +PPI+ DVLAK F +++K V YLQ Q
Sbjct  161  HFQLNVGKTNALAIAGLSSQNPGVITIANAVFGSNPPINPDVLAKAFQVDEKEVDYLQKQ  220

Query  42   NW  37
             W
Sbjct  221  FW  222



>emb|CBI36812.3| unnamed protein product [Vitis vinifera]
Length=447

 Score = 79.3 bits (194),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 45/60 (75%), Gaps = 0/60 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF +NVG+T A A A  +SQ PG + +ANAVFG DPPI+ DVL + F L+KK+V YLQ++
Sbjct  387  HFQFNVGKTKAVAIAGLSSQNPGVITIANAVFGSDPPINPDVLTRAFQLDKKVVSYLQSR  446


 Score = 70.1 bits (170),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 40/55 (73%), Gaps = 0/55 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQ  58
            HF +N+G+TNA A AA +SQ PG + + NAVFG DPPI+ DVL + F L+K ++ 
Sbjct  160  HFQFNIGKTNAVAIAALSSQNPGVITITNAVFGSDPPINPDVLTRAFQLDKSVLS  214



>ref|XP_010052624.1| PREDICTED: germin-like protein subfamily 1 member 13 [Eucalyptus 
grandis]
 gb|KCW76696.1| hypothetical protein EUGRSUZ_D01056 [Eucalyptus grandis]
Length=223

 Score = 77.0 bits (188),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 43/62 (69%), Gaps = 0/62 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF  N G+T A AFA  +SQ PG + +AN+VFG  PPIS DVL K F ++KK V YLQAQ
Sbjct  158  HFQLNTGKTPALAFAGLSSQNPGVITIANSVFGAKPPISADVLTKAFQVDKKTVDYLQAQ  217

Query  42   NW  37
             W
Sbjct  218  FW  219



>ref|XP_010024918.1| PREDICTED: germin-like protein subfamily 1 member 13 [Eucalyptus 
grandis]
 gb|KCW61457.1| hypothetical protein EUGRSUZ_H04193 [Eucalyptus grandis]
Length=223

 Score = 77.0 bits (188),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 43/62 (69%), Gaps = 0/62 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF  N G+T A AFA  +SQ PG + +AN+VFG  PPIS DVL K F ++KK V YLQAQ
Sbjct  158  HFQLNTGKTPALAFAGLSSQNPGVITIANSVFGTKPPISADVLTKAFQVDKKTVDYLQAQ  217

Query  42   NW  37
             W
Sbjct  218  FW  219



>emb|CDP16790.1| unnamed protein product [Coffea canephora]
Length=232

 Score = 77.0 bits (188),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 46/62 (74%), Gaps = 0/62 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF +N G +NA AFAA +SQ PG + +ANAVFG +PPI  DVL K F ++K +++YLQ+Q
Sbjct  164  HFQFNQGHSNAVAFAALSSQNPGVITIANAVFGSNPPIYPDVLTKAFQVDKNVIKYLQSQ  223

Query  42   NW  37
             W
Sbjct  224  FW  225



>ref|XP_009349816.1| PREDICTED: germin-like protein subfamily 1 member 13 [Pyrus x 
bretschneideri]
Length=228

 Score = 77.0 bits (188),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF  NVG+TNA A A  +SQ PG + +ANAVFG +PPI+ DVLAK F ++  +V YLQ Q
Sbjct  163  HFQLNVGKTNALAIAGLSSQNPGVITIANAVFGSNPPINPDVLAKAFQVDDNVVDYLQKQ  222

Query  42   NW  37
             W
Sbjct  223  FW  224



>ref|XP_010024919.1| PREDICTED: germin-like protein subfamily 1 member 13 [Eucalyptus 
grandis]
 ref|XP_010042113.1| PREDICTED: germin-like protein subfamily 1 member 13 [Eucalyptus 
grandis]
 gb|KCW61458.1| hypothetical protein EUGRSUZ_H04194 [Eucalyptus grandis]
Length=223

 Score = 77.0 bits (188),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 43/62 (69%), Gaps = 0/62 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF  N G+T A AFA  +SQ PG + +AN+VFG  PPIS DVL K F ++KK V YLQAQ
Sbjct  158  HFQLNTGKTPALAFAGLSSQNPGVITIANSVFGAKPPISADVLTKAFQVDKKTVDYLQAQ  217

Query  42   NW  37
             W
Sbjct  218  FW  219



>emb|CBI36780.3| unnamed protein product [Vitis vinifera]
Length=313

 Score = 77.8 bits (190),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 47/60 (78%), Gaps = 0/60 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF  N+G TNA A AAFNSQ PG + +A+++FG +PPI+ D LA+ F L+K++V+YLQA+
Sbjct  253  HFQVNIGHTNAVAIAAFNSQNPGVITIASSMFGSNPPINPDFLARAFQLDKRVVEYLQAR  312



>emb|CBI33611.3| unnamed protein product [Vitis vinifera]
Length=289

 Score = 77.4 bits (189),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 36/64 (56%), Positives = 44/64 (69%), Gaps = 0/64 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF  NVG+T A A AA +SQ PG + +ANAVFG  P IS DVL K F ++KK+V YLQ+Q
Sbjct  219  HFQLNVGKTKAVAIAALSSQNPGVITIANAVFGSKPAISADVLTKAFQVDKKVVDYLQSQ  278

Query  42   NWTL  31
               L
Sbjct  279  GVAL  282



>gb|KCW61441.1| hypothetical protein EUGRSUZ_H04171 [Eucalyptus grandis]
Length=217

 Score = 77.0 bits (188),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 43/62 (69%), Gaps = 0/62 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF  N G+T A AFA  +SQ PG + +AN+VFG  PPIS DVL K F ++KK V YLQAQ
Sbjct  152  HFQLNTGKTPALAFAGLSSQNPGVITIANSVFGAKPPISADVLTKAFQVDKKAVDYLQAQ  211

Query  42   NW  37
             W
Sbjct  212  FW  213



>ref|NP_001267944.1| germin-like protein 7 precursor [Vitis vinifera]
 gb|ABL60876.1| germin-like protein 7 [Vitis vinifera]
Length=220

 Score = 77.0 bits (188),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 47/60 (78%), Gaps = 0/60 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF  N+G TNA A AAFNSQ PG + +A+++FG +PPI+ D LA+ F L+K++V+YLQA+
Sbjct  160  HFQVNIGHTNAVAIAAFNSQNPGVITIASSMFGSNPPINPDFLARAFQLDKRVVEYLQAR  219



>emb|CBI39477.3| unnamed protein product [Vitis vinifera]
Length=220

 Score = 77.0 bits (188),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 42/60 (70%), Gaps = 0/60 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF  NVG TNA A AA  SQ PG + +ANAVFG +PPIS DVL K F L+K +V YLQ+ 
Sbjct  160  HFQLNVGHTNAVAIAALGSQNPGVITIANAVFGSNPPISADVLTKAFQLDKNVVDYLQSS  219



>ref|XP_008360941.1| PREDICTED: germin-like protein subfamily 1 member 17 [Malus domestica]
Length=228

 Score = 77.0 bits (188),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF  NVG+TNA A A  +SQ PG + +ANAVFG +PPI+ DVLAK F ++  +V YLQ Q
Sbjct  163  HFQLNVGKTNALAIAGLSSQNPGVITIANAVFGSNPPINPDVLAKAFQVDDNVVDYLQKQ  222

Query  42   NW  37
             W
Sbjct  223  FW  224



>emb|CAN80133.1| hypothetical protein VITISV_012032 [Vitis vinifera]
Length=220

 Score = 76.6 bits (187),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 42/60 (70%), Gaps = 0/60 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF  NVG TNA A AA  SQ PG + +ANAVFG +PPIS DVL K F L+K +V YLQ+ 
Sbjct  160  HFQLNVGHTNAVAIAALGSQNPGVITIANAVFGSNPPISADVLTKAFQLDKNVVDYLQSS  219



>ref|XP_006375874.1| germin-like protein 1, partial [Populus trichocarpa]
 gb|ERP53671.1| germin-like protein 1, partial [Populus trichocarpa]
Length=199

 Score = 76.6 bits (187),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 43/62 (69%), Gaps = 0/62 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF +NVG+T A+A  A +SQ PG + + NAVFG  PPI  DVLAK F ++K +V YLQ Q
Sbjct  134  HFQFNVGKTKASAIGALSSQNPGVITITNAVFGSTPPIRSDVLAKAFQVDKNLVDYLQKQ  193

Query  42   NW  37
             W
Sbjct  194  FW  195



>ref|XP_010024912.1| PREDICTED: germin-like protein subfamily 1 member 13 [Eucalyptus 
grandis]
Length=229

 Score = 76.6 bits (187),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 43/62 (69%), Gaps = 0/62 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF  N G+T A AFA  +SQ PG + +AN+VFG  PPIS DVL K F ++KK V YLQAQ
Sbjct  164  HFQLNTGKTPALAFAGLSSQNPGVITIANSVFGAKPPISADVLTKAFQVDKKAVDYLQAQ  223

Query  42   NW  37
             W
Sbjct  224  FW  225



>gb|KCW61436.1| hypothetical protein EUGRSUZ_H04166, partial [Eucalyptus grandis]
Length=216

 Score = 76.6 bits (187),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 44/60 (73%), Gaps = 0/60 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF  N+G+T A AFAA +SQ PG + +ANAVFG  PPIS  VL K F ++KK+V YLQAQ
Sbjct  156  HFQLNIGKTPALAFAALSSQNPGLITIANAVFGSKPPISAGVLTKAFQVDKKVVDYLQAQ  215



>ref|XP_007201690.1| hypothetical protein PRUPE_ppa016952mg, partial [Prunus persica]
 gb|EMJ02889.1| hypothetical protein PRUPE_ppa016952mg, partial [Prunus persica]
Length=183

 Score = 76.3 bits (186),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 42/62 (68%), Gaps = 0/62 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF  NVG  NA AFA  +SQ PG + +ANAVFG  PPI+ DVL K F ++ K+V YLQ Q
Sbjct  118  HFQLNVGHVNAVAFAGLSSQNPGVITIANAVFGSKPPINPDVLTKAFQVDNKVVDYLQKQ  177

Query  42   NW  37
             W
Sbjct  178  FW  179



>ref|XP_009402555.1| PREDICTED: putative germin-like protein 2-2 isoform X3 [Musa 
acuminata subsp. malaccensis]
Length=203

 Score = 76.6 bits (187),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 43/60 (72%), Gaps = 0/60 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF +N G TN  A  A +SQ PG + +A+AVFG  PPISDDVLAK F ++KK V +LQAQ
Sbjct  143  HFQFNPGHTNTVAIGALSSQNPGTITIADAVFGSKPPISDDVLAKAFQVDKKTVDWLQAQ  202



>emb|CDP22064.1| unnamed protein product [Coffea canephora]
Length=230

 Score = 76.6 bits (187),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF +N G ++A AFA  +SQ PG + +ANAVFG  PPIS DVL K F ++K +V+YLQ+Q
Sbjct  162  HFQFNKGHSSAVAFAGLSSQNPGVITIANAVFGSKPPISRDVLTKAFQVDKNVVKYLQSQ  221

Query  42   NW  37
             W
Sbjct  222  FW  223



>ref|XP_009402554.1| PREDICTED: germin-like protein 12-2 isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=216

 Score = 76.6 bits (187),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 43/60 (72%), Gaps = 0/60 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF +N G TN  A  A +SQ PG + +A+AVFG  PPISDDVLAK F ++KK V +LQAQ
Sbjct  156  HFQFNPGHTNTVAIGALSSQNPGTITIADAVFGSKPPISDDVLAKAFQVDKKTVDWLQAQ  215



>ref|XP_009402552.1| PREDICTED: germin-like protein 12-2 isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=217

 Score = 76.6 bits (187),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 43/60 (72%), Gaps = 0/60 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF +N G TN  A  A +SQ PG + +A+AVFG  PPISDDVLAK F ++KK V +LQAQ
Sbjct  157  HFQFNPGHTNTVAIGALSSQNPGTITIADAVFGSKPPISDDVLAKAFQVDKKTVDWLQAQ  216



>ref|XP_009402556.1| PREDICTED: putative germin-like protein 2-2 isoform X4 [Musa 
acuminata subsp. malaccensis]
Length=196

 Score = 76.3 bits (186),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 43/60 (72%), Gaps = 0/60 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF +N G TN  A  A +SQ PG + +A+AVFG  PPISDDVLAK F ++KK V +LQAQ
Sbjct  136  HFQFNPGHTNTVAIGALSSQNPGTITIADAVFGSKPPISDDVLAKAFQVDKKTVDWLQAQ  195



>ref|XP_009606432.1| PREDICTED: germin-like protein subfamily 1 member 17 [Nicotiana 
tomentosiformis]
Length=224

 Score = 76.6 bits (187),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 33/59 (56%), Positives = 44/59 (75%), Gaps = 0/59 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQA  46
            HF YNVG TNAT F A NSQ PG + +A+ +FG +PP+ +DVL+K F L+KK+V+ LQ 
Sbjct  163  HFQYNVGHTNATVFGALNSQNPGLIVVASELFGSNPPVVEDVLSKAFQLDKKMVEQLQG  221



>ref|XP_002276315.2| PREDICTED: putative germin-like protein 2-1 [Vitis vinifera]
Length=228

 Score = 76.6 bits (187),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 36/63 (57%), Positives = 44/63 (70%), Gaps = 0/63 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF  NVG+TNA A A+ +SQ PG + +ANAVFG  P IS DVL K F ++K  V YLQ+Q
Sbjct  161  HFQLNVGKTNAVAIASLSSQNPGVITIANAVFGSKPAISADVLTKAFQVDKNEVNYLQSQ  220

Query  42   NWT  34
             WT
Sbjct  221  FWT  223



>ref|XP_006375871.1| hypothetical protein POPTR_0013s04880g, partial [Populus trichocarpa]
 gb|ERP53668.1| hypothetical protein POPTR_0013s04880g, partial [Populus trichocarpa]
Length=221

 Score = 76.3 bits (186),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 43/62 (69%), Gaps = 0/62 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF +NVG+T A+A  A +SQ PG + + NAVFG  PPI  DVLAK F ++K +V YLQ Q
Sbjct  156  HFQFNVGKTKASAIGALSSQNPGVITITNAVFGSTPPIRSDVLAKAFQVDKNLVDYLQKQ  215

Query  42   NW  37
             W
Sbjct  216  FW  217



>ref|XP_008776811.1| PREDICTED: putative germin-like protein 2-1 isoform X2 [Phoenix 
dactylifera]
Length=206

 Score = 76.3 bits (186),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF +N G T+A A AA +SQ PG + +ANAVFG +PPISD VLAK F + K  ++YLQAQ
Sbjct  141  HFQFNYGPTHAVAVAALSSQNPGVITIANAVFGSNPPISDAVLAKAFQVGKDTIKYLQAQ  200

Query  42   NW  37
             W
Sbjct  201  FW  202



>ref|XP_006845051.1| hypothetical protein AMTR_s00794p00001640 [Amborella trichopoda]
 gb|ERN06726.1| hypothetical protein AMTR_s00794p00001640 [Amborella trichopoda]
Length=220

 Score = 76.3 bits (186),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF  NVG  NA A AA +SQ PG + +ANAVFG  P IS+DVLAK F ++KK+V  LQ+Q
Sbjct  155  HFQQNVGSKNAVAIAALSSQNPGVITIANAVFGSKPAISNDVLAKAFQVDKKVVNRLQSQ  214

Query  42   NW  37
             W
Sbjct  215  FW  216



>ref|XP_008776810.1| PREDICTED: putative germin-like protein 2-1 isoform X1 [Phoenix 
dactylifera]
Length=203

 Score = 76.3 bits (186),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF +N G T+A A AA +SQ PG + +ANAVFG +PPISD VLAK F + K  ++YLQAQ
Sbjct  138  HFQFNYGPTHAVAVAALSSQNPGVITIANAVFGSNPPISDAVLAKAFQVGKDTIKYLQAQ  197

Query  42   NW  37
             W
Sbjct  198  FW  199



>emb|CAN74480.1| hypothetical protein VITISV_042844 [Vitis vinifera]
Length=192

 Score = 75.9 bits (185),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF +NVG+T A AFA  +SQ PG + +ANAVFG DPPI  DVL + F L++ +V+ LQ++
Sbjct  127  HFQFNVGKTKAVAFAGLSSQNPGVITIANAVFGSDPPIDPDVLTRAFQLDEDVVKDLQSR  186

Query  42   NW  37
             W
Sbjct  187  FW  188



>ref|XP_007200176.1| hypothetical protein PRUPE_ppa016529mg [Prunus persica]
 gb|EMJ01375.1| hypothetical protein PRUPE_ppa016529mg [Prunus persica]
Length=226

 Score = 76.3 bits (186),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 42/62 (68%), Gaps = 0/62 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF  NVG  NA AFA  +SQ PG + +ANAVFG  PPI+ DVL K F ++ K+V YLQ Q
Sbjct  161  HFQLNVGHVNAVAFAGLSSQNPGVITIANAVFGSKPPINPDVLTKAFQVDNKVVDYLQKQ  220

Query  42   NW  37
             W
Sbjct  221  FW  222



>ref|XP_003536153.1| PREDICTED: germin-like protein subfamily 1 member 7-like [Glycine 
max]
 gb|ACG69482.1| germin-like protein 6 [Glycine max]
Length=232

 Score = 76.3 bits (186),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 43/60 (72%), Gaps = 0/60 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF  NVG  NA A AA +SQ PG + +ANAVFG  PPISD+VLAK F ++K IV YLQ Q
Sbjct  161  HFQQNVGYGNAVAIAALSSQNPGVITIANAVFGSKPPISDEVLAKAFQVDKNIVDYLQKQ  220



>ref|XP_007201148.1| hypothetical protein PRUPE_ppa016020mg [Prunus persica]
 gb|EMJ02347.1| hypothetical protein PRUPE_ppa016020mg [Prunus persica]
Length=226

 Score = 76.3 bits (186),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 42/62 (68%), Gaps = 0/62 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF  NVG  NA AFA  +SQ PG + +ANAVFG  PPI+ DVLAK F ++  +V YLQ Q
Sbjct  161  HFQLNVGHVNAVAFAGLSSQNPGVITIANAVFGSKPPINPDVLAKAFQVDDNVVDYLQKQ  220

Query  42   NW  37
             W
Sbjct  221  LW  222



>ref|XP_008393146.1| PREDICTED: germin-like protein subfamily 1 member 11 [Malus domestica]
Length=225

 Score = 76.3 bits (186),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF  NVG T+A A A  +SQ PG + +ANAVFG +PPI+ DVLAK F ++ K+V YLQ Q
Sbjct  160  HFQLNVGHTSAVAIAGLSSQNPGVITIANAVFGANPPINPDVLAKAFQVDDKLVSYLQKQ  219

Query  42   NW  37
             W
Sbjct  220  FW  221



>gb|KHN14792.1| Germin-like protein subfamily 1 member 7 [Glycine soja]
Length=232

 Score = 76.3 bits (186),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 43/60 (72%), Gaps = 0/60 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF  NVG  NA A AA +SQ PG + +ANAVFG  PPISD+VLAK F ++K IV YLQ Q
Sbjct  161  HFQQNVGYGNAVAIAALSSQNPGVITIANAVFGSKPPISDEVLAKAFQVDKNIVDYLQKQ  220



>emb|CDP10146.1| unnamed protein product [Coffea canephora]
Length=217

 Score = 76.3 bits (186),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 44/60 (73%), Gaps = 0/60 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF +N G+TNA A A FNSQ PG V + NAVFG +PPI+DDVLAK F  +K ++  LQ++
Sbjct  157  HFQFNAGKTNAVAIAGFNSQNPGAVVIRNAVFGSNPPINDDVLAKAFQADKTVIDQLQSK  216



>ref|XP_007199217.1| hypothetical protein PRUPE_ppa021882mg [Prunus persica]
 gb|EMJ00416.1| hypothetical protein PRUPE_ppa021882mg [Prunus persica]
Length=226

 Score = 76.3 bits (186),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 42/62 (68%), Gaps = 0/62 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF  NVG  NA AFA  +SQ PG + +ANAVFG  PPI+ DVL K F ++ K+V YLQ Q
Sbjct  161  HFQLNVGHVNAVAFAGLSSQNPGVITIANAVFGSKPPINPDVLTKAFQVDNKVVDYLQKQ  220

Query  42   NW  37
             W
Sbjct  221  FW  222



>gb|KCW76699.1| hypothetical protein EUGRSUZ_D01059 [Eucalyptus grandis]
Length=221

 Score = 76.3 bits (186),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF  N+G+T A AFAA +SQ PG + +AN+VF   PPIS DVL K F ++KK+V YLQ Q
Sbjct  156  HFQLNIGKTPALAFAALSSQNPGVITIANSVFRSKPPISADVLTKAFQVDKKVVDYLQVQ  215

Query  42   NW  37
             W
Sbjct  216  FW  217



>gb|KDP23768.1| hypothetical protein JCGZ_23601 [Jatropha curcas]
Length=229

 Score = 76.3 bits (186),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 43/60 (72%), Gaps = 0/60 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF  N+ +TNA AFA  +SQ PG + +ANA+FGP PPI+ DVL + F L+K +V YLQ Q
Sbjct  166  HFQMNIAKTNAVAFAGLSSQNPGVITIANALFGPKPPINPDVLTRAFQLDKNVVGYLQKQ  225



>ref|XP_010549631.1| PREDICTED: germin-like protein subfamily 1 member 7 isoform X2 
[Tarenaya hassleriana]
Length=141

 Score = 75.1 bits (183),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 43/60 (72%), Gaps = 0/60 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF  NVGRTNA AFA   SQ PG + +A+AVFG  PPI  DVLA+ F L+  +V+YL+A+
Sbjct  74   HFQVNVGRTNAVAFAGLGSQNPGVITIADAVFGSKPPIVPDVLARAFQLDVNVVRYLEAR  133



>ref|XP_002280455.1| PREDICTED: germin-like protein subfamily 1 member 14 [Vitis vinifera]
Length=166

 Score = 75.5 bits (184),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 44/60 (73%), Gaps = 0/60 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF  NVG+T A A AA +SQ PG + +A AVFG DPPI+ DVL + F L+K +V+YLQ++
Sbjct  106  HFQLNVGKTKAVAIAALSSQNPGVITIAKAVFGSDPPINPDVLTRAFQLDKSVVKYLQSR  165



>emb|CDP21353.1| unnamed protein product [Coffea canephora]
Length=459

 Score = 78.2 bits (191),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF +N G +NA AFA  +SQ PG + +ANAVFG  PPIS DVL K F ++K +V+YLQ+Q
Sbjct  391  HFQFNKGHSNAVAFAGLSSQNPGVITIANAVFGSKPPISRDVLTKAFQVDKNVVKYLQSQ  450

Query  42   NW  37
             W
Sbjct  451  FW  452


 Score = 73.6 bits (179),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 42/62 (68%), Gaps = 0/62 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF +N G +NA AFA   SQ PG + +ANAVFG DPPIS DVL K F +   +++ LQ+Q
Sbjct  162  HFQFNQGHSNAVAFAGLGSQNPGVITIANAVFGSDPPISPDVLTKAFQVGNDVIKKLQSQ  221

Query  42   NW  37
             W
Sbjct  222  FW  223



>gb|KDP23764.1| hypothetical protein JCGZ_23597 [Jatropha curcas]
Length=229

 Score = 75.9 bits (185),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 43/60 (72%), Gaps = 0/60 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF  N+ +TNA AFA  +SQ PG + +ANA+FGP PPI+ DVL + F L+K +V YLQ Q
Sbjct  166  HFQMNIAKTNAVAFAGLSSQNPGVITIANALFGPKPPINPDVLTRAFQLDKNVVGYLQKQ  225



>ref|XP_008807191.1| PREDICTED: putative germin-like protein 2-1 [Phoenix dactylifera]
Length=219

 Score = 75.9 bits (185),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 44/60 (73%), Gaps = 0/60 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF +N  +TNA A +  +SQ PG + + NAVFG +PPISDD+LAK F L+KK V +LQAQ
Sbjct  153  HFQFNKAKTNAVAISGLSSQNPGVILVPNAVFGANPPISDDLLAKAFQLDKKTVDWLQAQ  212



>ref|XP_003535383.1| PREDICTED: LOW QUALITY PROTEIN: germin-like protein subfamily 
1 member 13-like [Glycine max]
Length=244

 Score = 76.3 bits (186),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 43/62 (69%), Gaps = 0/62 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF  N+G  NA A A  +SQ PG + +ANAVFG  PPISD+VLAK F ++K ++ YLQ Q
Sbjct  179  HFQQNIGYGNALAIAGLSSQNPGVISIANAVFGSKPPISDEVLAKAFQVDKNVIDYLQKQ  238

Query  42   NW  37
             W
Sbjct  239  FW  240



>ref|XP_006840195.1| hypothetical protein AMTR_s00089p00119070 [Amborella trichopoda]
 gb|ERN01870.1| hypothetical protein AMTR_s00089p00119070 [Amborella trichopoda]
Length=219

 Score = 75.9 bits (185),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF  NVG +NA A AA +SQ PG + +ANAVFG +PPISD VLAK F ++K++V  LQA 
Sbjct  154  HFQQNVGYSNAVAIAALSSQNPGVITIANAVFGANPPISDVVLAKAFQIDKQLVDKLQAS  213

Query  42   NW  37
             W
Sbjct  214  FW  215



>ref|XP_006840206.1| hypothetical protein AMTR_s00089p00127600 [Amborella trichopoda]
 gb|ERN01881.1| hypothetical protein AMTR_s00089p00127600 [Amborella trichopoda]
Length=219

 Score = 75.9 bits (185),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 42/62 (68%), Gaps = 0/62 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF  NVG  N  A A  +SQ PG + +ANAVFG DPPISD VLAK F ++KK+V  LQA 
Sbjct  154  HFQQNVGYGNTVAIAGLSSQNPGVITIANAVFGADPPISDVVLAKAFQIDKKLVDKLQAS  213

Query  42   NW  37
             W
Sbjct  214  FW  215



>ref|XP_004301229.1| PREDICTED: germin-like protein subfamily 1 member 7-like [Fragaria 
vesca subsp. vesca]
Length=209

 Score = 75.9 bits (185),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 42/62 (68%), Gaps = 0/62 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF +N+G+ NA A A  +SQ PG + +ANAVFG  PPI  DVL K F +E  +V+YLQ Q
Sbjct  144  HFQFNIGKVNAVAIAGLSSQNPGVITIANAVFGSKPPIKLDVLTKAFQVESNVVEYLQNQ  203

Query  42   NW  37
             W
Sbjct  204  FW  205



>ref|XP_002530595.1| Oxalate oxidase 2 precursor, putative [Ricinus communis]
 gb|EEF31775.1| Oxalate oxidase 2 precursor, putative [Ricinus communis]
Length=209

 Score = 75.9 bits (185),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 34/63 (54%), Positives = 44/63 (70%), Gaps = 0/63 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF +N+G  NA AFA  +SQ PG + +ANAVFG +P I+ DVL K F ++K +V YLQ Q
Sbjct  144  HFQFNIGHNNAVAFAGLSSQNPGVITIANAVFGSNPSINPDVLTKAFQVDKIVVNYLQEQ  203

Query  42   NWT  34
             WT
Sbjct  204  FWT  206



>ref|XP_009773221.1| PREDICTED: germin-like protein subfamily 1 member 17 [Nicotiana 
sylvestris]
Length=236

 Score = 75.9 bits (185),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 43/60 (72%), Gaps = 0/60 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF YNVG   AT  A+FNSQ PGFV +  ++F  DPPI DDVLAK F L+KK+++ LQ +
Sbjct  174  HFQYNVGNKKATVLASFNSQNPGFVMIPYSIFASDPPILDDVLAKGFQLDKKVIKQLQKK  233



>ref|XP_008808516.1| PREDICTED: putative germin-like protein 2-1 [Phoenix dactylifera]
Length=215

 Score = 75.9 bits (185),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 44/60 (73%), Gaps = 0/60 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF +NVG  NA A + FNSQ PG + +A+AVFG  PPISDDVL K F + K+I++ L+AQ
Sbjct  154  HFQFNVGDINAVAMSGFNSQNPGVITIADAVFGSKPPISDDVLMKAFQVGKEIIEELKAQ  213



>ref|XP_003633723.2| PREDICTED: putative germin-like protein 2-1 [Vitis vinifera]
Length=226

 Score = 75.9 bits (185),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 43/60 (72%), Gaps = 0/60 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF  NVG+T A A AA +SQ PG + +ANAVFG  P IS DVL K F ++KK+V YLQ+Q
Sbjct  166  HFQLNVGKTKAVAIAALSSQNPGVITIANAVFGSKPAISADVLTKAFQVDKKVVDYLQSQ  225



>emb|CBI36790.3| unnamed protein product [Vitis vinifera]
Length=207

 Score = 75.5 bits (184),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 45/60 (75%), Gaps = 0/60 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF +N+G  NA A A  +SQ PG + +ANAVFG +PPI+ D LAK F L+KK+V++LQA+
Sbjct  147  HFQFNIGHMNAVAIAGLSSQNPGVITIANAVFGSNPPINPDFLAKAFQLDKKVVEFLQAR  206



>ref|XP_007200183.1| hypothetical protein PRUPE_ppa016284mg [Prunus persica]
 gb|EMJ01382.1| hypothetical protein PRUPE_ppa016284mg [Prunus persica]
Length=226

 Score = 75.9 bits (185),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 35/62 (56%), Positives = 42/62 (68%), Gaps = 0/62 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF  NVG  NA AFA  +SQ PG + +ANAVFG  PPI+ DVLAK F ++  +V YLQ Q
Sbjct  161  HFQLNVGHVNAVAFAGLSSQNPGVITIANAVFGSKPPINPDVLAKAFQVDNNLVDYLQKQ  220

Query  42   NW  37
             W
Sbjct  221  FW  222



>ref|XP_002265608.1| PREDICTED: putative germin-like protein 2-1 [Vitis vinifera]
Length=221

 Score = 75.5 bits (184),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 43/60 (72%), Gaps = 0/60 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF  NVG+T A A AA +SQ PG + +ANAVFG  P IS DVL K F ++KK+V YLQ+Q
Sbjct  161  HFQLNVGKTKAVAIAALSSQNPGVITIANAVFGSKPAISADVLTKAFQVDKKVVDYLQSQ  220



>ref|XP_002517295.1| Nectarin-1 precursor, putative [Ricinus communis]
 gb|EEF45088.1| Nectarin-1 precursor, putative [Ricinus communis]
Length=139

 Score = 74.3 bits (181),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 43/62 (69%), Gaps = 0/62 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF  N+G+T A AFAA  SQ PG + LAN +FG DP I+ +V+AK FHL+K +V  LQ Q
Sbjct  74   HFQLNLGKTPALAFAALTSQNPGVMTLANGIFGADPSINLEVVAKAFHLDKNLVSKLQGQ  133

Query  42   NW  37
             W
Sbjct  134  EW  135



>emb|CAN70189.1| hypothetical protein VITISV_016562 [Vitis vinifera]
Length=214

 Score = 75.5 bits (184),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 43/60 (72%), Gaps = 0/60 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF  NVG+T A A AA +SQ PG + +ANAVFG  P IS DVL K F ++KK+V YLQ+Q
Sbjct  154  HFQLNVGKTKAVAIAALSSQNPGVITIANAVFGSKPAISADVLTKAFQVDKKVVDYLQSQ  213



>emb|CBI33612.3| unnamed protein product [Vitis vinifera]
Length=221

 Score = 75.5 bits (184),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 43/60 (72%), Gaps = 0/60 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF  NVG+T A A AA +SQ PG + +ANAVFG  P IS DVL K F ++KK+V YLQ+Q
Sbjct  161  HFQLNVGKTKAVAIAALSSQNPGVITIANAVFGSKPAISADVLTKAFQVDKKVVDYLQSQ  220



>ref|XP_003633724.1| PREDICTED: putative germin-like protein 2-1 [Vitis vinifera]
Length=221

 Score = 75.5 bits (184),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 43/60 (72%), Gaps = 0/60 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF  NVG+T A A AA +SQ PG + +ANAVFG  P IS DVL K F ++KK+V YLQ+Q
Sbjct  161  HFQLNVGKTKAVAIAALSSQNPGVITIANAVFGSKPAISADVLTKAFQVDKKVVDYLQSQ  220



>emb|CBI36782.3| unnamed protein product [Vitis vinifera]
Length=213

 Score = 75.5 bits (184),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 32/60 (53%), Positives = 46/60 (77%), Gaps = 0/60 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF  N+G TNA A A FNSQ PG + +A+++FG +PPI+ D LA+ F L+K++V+YLQA+
Sbjct  153  HFQVNIGHTNAVAIAVFNSQNPGVITIASSMFGSNPPINPDFLARAFQLDKRVVEYLQAR  212



>ref|XP_010050174.1| PREDICTED: germin-like protein subfamily 1 member 7 [Eucalyptus 
grandis]
 gb|KCW89289.1| hypothetical protein EUGRSUZ_A01579 [Eucalyptus grandis]
Length=223

 Score = 75.5 bits (184),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 42/62 (68%), Gaps = 0/62 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF  N G TNA AFA  +SQ PG + +ANAVFG   PIS DVL K F ++KK V YLQAQ
Sbjct  158  HFQLNTGNTNALAFAGLSSQNPGVITIANAVFGAKLPISTDVLTKAFQVDKKEVDYLQAQ  217

Query  42   NW  37
             W
Sbjct  218  FW  219



>ref|XP_007030284.1| RmlC-like cupins superfamily protein [Theobroma cacao]
 gb|EOY10786.1| RmlC-like cupins superfamily protein [Theobroma cacao]
Length=226

 Score = 75.5 bits (184),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF  N+G+TNA AFA  +SQ PG + +A AVFG +PPI+ DVL K F L+K IV  LQ++
Sbjct  161  HFQLNIGKTNAVAFAGLSSQNPGVITIAKAVFGSNPPINPDVLTKAFQLDKNIVTSLQSR  220

Query  42   NW  37
             W
Sbjct  221  FW  222



>ref|XP_007030281.1| RmlC-like cupins superfamily protein isoform 2 [Theobroma cacao]
 gb|EOY10783.1| RmlC-like cupins superfamily protein isoform 2 [Theobroma cacao]
Length=226

 Score = 75.5 bits (184),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = -3

Query  222  HFLYNVGRTNATAFAAFNSQKPGFVYLANAVFGPDPPISDDVLAKTFHLEKKIVQYLQAQ  43
            HF  N+G+TNA AFA  +SQ PG + +A AVFG +PPI+ DVL K F L+K IV  LQ++
Sbjct  161  HFQLNIGKTNAVAFAGLSSQNPGVITIAKAVFGSNPPINPDVLTKAFQLDKNIVTSLQSR  220

Query  42   NW  37
             W
Sbjct  221  FW  222



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 518880296928