BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c24299_g3_i1 len=196 path=[@801@!:0-39 3113:40-45 847:46-195]

Length=196
                                                                      Score     E

ref|XP_011046612.1|  PREDICTED: germin-like protein subfamily 1 m...  67.8    4e-12   
ref|XP_011039266.1|  PREDICTED: germin-like protein subfamily 1 m...  67.8    4e-12   
ref|XP_011046611.1|  PREDICTED: germin-like protein subfamily 1 m...  67.8    4e-12   
ref|XP_011046613.1|  PREDICTED: germin-like protein subfamily 1 m...  67.8    4e-12   
ref|XP_011046610.1|  PREDICTED: germin-like protein subfamily 1 m...  67.8    4e-12   
ref|XP_009620404.1|  PREDICTED: germin-like protein subfamily 1 m...  66.6    8e-12   
ref|XP_006405659.1|  hypothetical protein EUTSA_v10028158mg           66.6    8e-12   
ref|XP_011046609.1|  PREDICTED: germin-like protein subfamily 1 m...  66.6    8e-12   
ref|XP_002306210.1|  hypothetical protein POPTR_0004s18690g           66.6    8e-12   Populus trichocarpa [western balsam poplar]
gb|EYU20535.1|  hypothetical protein MIMGU_mgv1a013054mg              66.6    8e-12   
ref|XP_007140908.1|  hypothetical protein PHAVU_008G1513001g          64.7    1e-11   
ref|XP_007140911.1|  hypothetical protein PHAVU_008G1514000g          64.3    1e-11   
ref|XP_007140900.1|  hypothetical protein PHAVU_008G1508001g          64.7    1e-11   
ref|XP_007030270.1|  Germin-like protein subfamily 1 member 18        67.4    1e-11   
gb|EYU20541.1|  hypothetical protein MIMGU_mgv1a018988mg              66.2    1e-11   
emb|CBI36783.3|  unnamed protein product                              66.6    1e-11   
ref|XP_002313687.2|  hypothetical protein POPTR_0009s14250g           65.9    1e-11   Populus trichocarpa [western balsam poplar]
ref|XP_002313686.1|  germin-like protein 1                            65.9    1e-11   Populus trichocarpa [western balsam poplar]
emb|CDP10933.1|  unnamed protein product                              65.9    2e-11   
gb|EYU40208.1|  hypothetical protein MIMGU_mgv1a020439mg              65.9    2e-11   
emb|CDY11695.1|  BnaC06g13030D                                        65.9    2e-11   
ref|XP_011045439.1|  PREDICTED: germin-like protein subfamily 1 m...  65.9    2e-11   
ref|XP_009125150.1|  PREDICTED: germin-like protein subfamily 1 m...  65.9    2e-11   
emb|CDY69099.1|  BnaA07g37570D                                        65.9    2e-11   
ref|XP_009786129.1|  PREDICTED: putative germin-like protein 2-1      65.5    2e-11   
emb|CDP16508.1|  unnamed protein product                              64.3    2e-11   
ref|XP_006282503.1|  hypothetical protein CARUB_v10006909mg           65.1    3e-11   
gb|EYU20539.1|  hypothetical protein MIMGU_mgv1a013072mg              65.1    3e-11   
ref|XP_009786133.1|  PREDICTED: germin-like protein subfamily 1 m...  63.9    4e-11   
emb|CDP10932.1|  unnamed protein product                              64.7    4e-11   
gb|EYU20546.1|  hypothetical protein MIMGU_mgv1a013111mg              64.7    5e-11   
emb|CDP10695.1|  unnamed protein product                              64.3    5e-11   
ref|XP_010435818.1|  PREDICTED: germin-like protein subfamily 1 m...  64.3    5e-11   
sp|P92997.2|GL113_ARATH  RecName: Full=Germin-like protein subfam...  64.3    5e-11   Arabidopsis thaliana [mouse-ear cress]
emb|CDP10701.1|  unnamed protein product                              64.3    5e-11   
ref|NP_001237300.1|  uncharacterized protein LOC100527781 precursor   64.3    5e-11   
ref|XP_010450837.1|  PREDICTED: germin-like protein subfamily 1 m...  64.3    5e-11   
gb|AAB51572.1|  germin-like protein                                   64.3    5e-11   Arabidopsis thaliana [mouse-ear cress]
gb|EYU20542.1|  hypothetical protein MIMGU_mgv1a020630mg              64.3    6e-11   
ref|XP_010024920.1|  PREDICTED: germin-like protein subfamily 1 m...  64.3    6e-11   
gb|EYU40210.1|  hypothetical protein MIMGU_mgv1a022317mg              64.3    7e-11   
emb|CDP10694.1|  unnamed protein product                              63.9    7e-11   
ref|XP_007143989.1|  hypothetical protein PHAVU_007G119700g           63.9    8e-11   
emb|CBI36778.3|  unnamed protein product                              67.0    8e-11   
ref|XP_010435820.1|  PREDICTED: germin-like protein subfamily 1 m...  63.9    8e-11   
gb|EYU40211.1|  hypothetical protein MIMGU_mgv1a013108mg              63.9    8e-11   
gb|KDP23769.1|  hypothetical protein JCGZ_23602                       63.9    8e-11   
ref|XP_002531992.1|  Rhicadhesin receptor precursor, putative         63.9    8e-11   Ricinus communis
ref|XP_009786127.1|  PREDICTED: putative germin-like protein 2-1      63.9    9e-11   
gb|EYU28622.1|  hypothetical protein MIMGU_mgv1a018753mg              63.9    9e-11   
ref|XP_009625530.1|  PREDICTED: putative germin-like protein 2-1      63.9    9e-11   
ref|XP_006349267.1|  PREDICTED: germin-like protein subfamily 1 m...  63.5    1e-10   
gb|AFW90592.1|  germin-like protein subfamily 1 member 20 precursor   63.5    1e-10   
ref|XP_006346966.1|  PREDICTED: putative germin-like protein 2-1-...  63.5    1e-10   
gb|KDP23759.1|  hypothetical protein JCGZ_23592                       63.5    1e-10   
gb|KDP23767.1|  hypothetical protein JCGZ_23600                       63.2    1e-10   
ref|XP_006286150.1|  hypothetical protein CARUB_v10007709mg           63.5    1e-10   
gb|EYU20536.1|  hypothetical protein MIMGU_mgv1a025658mg              63.5    1e-10   
gb|EPS67173.1|  hypothetical protein M569_07603                       63.2    1e-10   
emb|CDP16787.1|  unnamed protein product                              63.5    1e-10   
gb|AFK48994.1|  unknown                                               63.2    1e-10   
ref|XP_006349264.1|  PREDICTED: germin-like protein subfamily 1 m...  63.2    1e-10   
ref|XP_009612542.1|  PREDICTED: putative germin-like protein 2-1      63.2    1e-10   
ref|XP_006349268.1|  PREDICTED: germin-like protein subfamily 1 m...  63.2    1e-10   
emb|CDP22064.1|  unnamed protein product                              63.2    1e-10   
gb|EYU20548.1|  hypothetical protein MIMGU_mgv1a013109mg              63.2    1e-10   
gb|EYU20549.1|  hypothetical protein MIMGU_mgv1a020596mg              63.2    1e-10   
ref|XP_009795501.1|  PREDICTED: putative germin-like protein 2-1      63.2    2e-10   
ref|XP_007140906.1|  hypothetical protein PHAVU_008G151100g           61.6    2e-10   
ref|XP_006358463.1|  PREDICTED: germin-like protein subfamily 1 m...  63.2    2e-10   
ref|XP_006349261.1|  PREDICTED: putative germin-like protein 2-1-...  63.2    2e-10   
ref|XP_004230403.1|  PREDICTED: putative germin-like protein 2-1      63.2    2e-10   
gb|EYU40209.1|  hypothetical protein MIMGU_mgv1a013129mg              63.2    2e-10   
ref|XP_006349263.1|  PREDICTED: germin-like protein subfamily 1 m...  63.2    2e-10   
gb|EYU38444.1|  hypothetical protein MIMGU_mgv1a013102mg              63.2    2e-10   
ref|XP_004230404.1|  PREDICTED: putative germin-like protein 2-1      62.8    2e-10   
emb|CDP16786.1|  unnamed protein product                              65.5    2e-10   
ref|XP_010441036.1|  PREDICTED: germin-like protein subfamily 1 m...  62.8    2e-10   
ref|XP_006358462.1|  PREDICTED: germin-like protein subfamily 1 m...  62.8    2e-10   
emb|CDP16788.1|  unnamed protein product                              62.8    2e-10   
ref|XP_006354544.1|  PREDICTED: germin-like protein subfamily 1 m...  62.8    2e-10   
ref|XP_009139822.1|  PREDICTED: germin-like protein subfamily 1 m...  62.4    3e-10   
gb|KDP23763.1|  hypothetical protein JCGZ_23596                       62.0    3e-10   
gb|KDP46445.1|  hypothetical protein JCGZ_10285                       62.4    3e-10   
ref|XP_010528770.1|  PREDICTED: germin-like protein subfamily 1 m...  62.8    3e-10   
ref|XP_011002009.1|  PREDICTED: germin-like protein subfamily 1 m...  62.4    3e-10   
emb|CDY37880.1|  BnaC04g31260D                                        62.4    3e-10   
ref|XP_009784933.1|  PREDICTED: germin-like protein subfamily 1 m...  62.4    3e-10   
ref|XP_009612543.1|  PREDICTED: germin-like protein subfamily 1 m...  62.4    3e-10   
ref|XP_009795503.1|  PREDICTED: germin-like protein subfamily 1 m...  62.4    3e-10   
ref|XP_009627660.1|  PREDICTED: germin-like protein subfamily 1 m...  62.4    3e-10   
ref|XP_003590904.1|  Germin-like protein subfamily 1 member           62.0    4e-10   
ref|XP_003604731.1|  Germin-like protein subfamily 1 member           62.0    4e-10   
ref|XP_010463901.1|  PREDICTED: germin-like protein subfamily 1 m...  62.0    4e-10   
ref|XP_003604729.1|  Germin-like protein subfamily 1 member           62.0    4e-10   
emb|CDP10698.1|  unnamed protein product                              62.0    4e-10   
ref|XP_003593910.1|  Germin-like protein subfamily 1 member           61.6    5e-10   
emb|CDY15957.1|  BnaA04g11540D                                        61.6    5e-10   
ref|XP_009129904.1|  PREDICTED: germin-like protein subfamily 1 m...  61.6    5e-10   
ref|XP_004230405.1|  PREDICTED: germin-like protein subfamily 1 m...  61.6    5e-10   
emb|CDX99669.1|  BnaC04g34260D                                        61.6    5e-10   
ref|XP_006443311.1|  hypothetical protein CICLE_v10022142mg           61.6    5e-10   
ref|XP_011099650.1|  PREDICTED: germin-like protein subfamily 1 m...  61.6    5e-10   
ref|XP_006358459.1|  PREDICTED: germin-like protein subfamily 1 m...  61.6    5e-10   
ref|XP_003604730.1|  Germin-like protein subfamily 1 member           61.6    6e-10   
ref|XP_002868741.1|  predicted protein                                61.6    6e-10   
ref|XP_002868743.1|  predicted protein                                61.2    6e-10   
gb|KCW61445.1|  hypothetical protein EUGRSUZ_H04176                   61.2    7e-10   
ref|XP_002868798.1|  predicted protein                                61.2    7e-10   
ref|XP_006358464.1|  PREDICTED: germin-like protein subfamily 1 m...  61.2    7e-10   
emb|CDP16789.1|  unnamed protein product                              63.5    8e-10   
gb|EYU20540.1|  hypothetical protein MIMGU_mgv1a013117mg              61.2    8e-10   
emb|CDP21353.1|  unnamed protein product                              63.2    8e-10   
ref|XP_002284661.2|  PREDICTED: uncharacterized protein LOC100240807  63.2    9e-10   Vitis vinifera
emb|CDP16790.1|  unnamed protein product                              61.2    9e-10   
gb|EYU20545.1|  hypothetical protein MIMGU_mgv1a020779mg              60.8    9e-10   
gb|EYU20547.1|  hypothetical protein MIMGU_mgv1a023357mg              60.8    1e-09   
ref|XP_002868742.1|  predicted protein                                60.8    1e-09   
gb|EYU40849.1|  hypothetical protein MIMGU_mgv1a021360mg              60.8    1e-09   
ref|XP_006405663.1|  hypothetical protein EUTSA_v10027916mg           60.5    1e-09   
gb|EYU20538.1|  hypothetical protein MIMGU_mgv1a012929mg              60.8    1e-09   
ref|XP_006349265.1|  PREDICTED: germin-like protein subfamily 1 m...  60.5    1e-09   
gb|ABR92335.1|  putative germin-like protein                          60.8    1e-09   Salvia miltiorrhiza [Chinese salvia]
ref|NP_198727.1|  germin-like protein subfamily 1 member 14           60.5    1e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004142552.1|  PREDICTED: germin-like protein subfamily 1 m...  60.5    1e-09   
ref|XP_006371122.1|  Germin-like protein subfamily 1 member 6 pre...  60.5    2e-09   
ref|XP_007200176.1|  hypothetical protein PRUPE_ppa016529mg           60.1    2e-09   
ref|XP_006405658.1|  hypothetical protein EUTSA_v10027918mg           60.1    2e-09   
emb|CAN80134.1|  hypothetical protein VITISV_012033                   60.1    2e-09   Vitis vinifera
emb|CDP14601.1|  unnamed protein product                              60.1    2e-09   
ref|XP_003535383.1|  PREDICTED: LOW QUALITY PROTEIN: germin-like ...  60.1    2e-09   
ref|XP_010251871.1|  PREDICTED: putative germin-like protein 2-1      59.7    2e-09   
ref|XP_011099651.1|  PREDICTED: germin-like protein subfamily 1 m...  59.7    2e-09   
ref|XP_002284343.2|  PREDICTED: uncharacterized protein LOC100256308  62.0    2e-09   Vitis vinifera
ref|XP_006371118.1|  hypothetical protein POPTR_0019s042602g          58.5    3e-09   
emb|CBI36812.3|  unnamed protein product                              61.6    3e-09   
ref|XP_011002008.1|  PREDICTED: germin-like protein subfamily 1 m...  59.7    3e-09   
ref|XP_010251869.1|  PREDICTED: putative germin-like protein 2-1 ...  59.7    3e-09   
ref|XP_010027140.1|  PREDICTED: uncharacterized protein LOC104417587  61.6    3e-09   
gb|ADD71877.1|  germin-like protein subfamily 1 member 1 precursor    59.3    3e-09   Arachis hypogaea [goober]
gb|EYU20537.1|  hypothetical protein MIMGU_mgv1a013077mg              59.3    3e-09   
ref|XP_003618164.1|  Germin-like protein subfamily 1 member           59.3    4e-09   
ref|XP_006358461.1|  PREDICTED: germin-like protein subfamily 1 m...  59.3    4e-09   
ref|XP_006408215.1|  hypothetical protein EUTSA_v10022237mg           58.9    4e-09   
ref|XP_011012323.1|  PREDICTED: germin-like protein subfamily 1 m...  60.8    4e-09   
ref|XP_006349266.1|  PREDICTED: germin-like protein subfamily 1 m...  58.9    4e-09   
ref|NP_198734.1|  germin-like protein subfamily 1 member 19           59.3    4e-09   Arabidopsis thaliana [mouse-ear cress]
emb|CDP14600.1|  unnamed protein product                              59.3    4e-09   
ref|NP_187246.1|  germin-like protein subfamily 1 member 7            59.3    4e-09   Arabidopsis thaliana [mouse-ear cress]
ref|NP_198731.1|  germin-like protein subfamily 1 member 17           59.3    4e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002284682.1|  PREDICTED: germin-like protein subfamily 1 m...  58.9    5e-09   Vitis vinifera
ref|XP_002325370.2|  hypothetical protein POPTR_0019s04270g           58.9    5e-09   Populus trichocarpa [western balsam poplar]
ref|XP_002265857.1|  PREDICTED: putative germin-like protein 2-1      58.9    5e-09   Vitis vinifera
ref|XP_004247721.1|  PREDICTED: germin-like protein subfamily 1 m...  58.9    5e-09   
emb|CBI36780.3|  unnamed protein product                              60.1    5e-09   
ref|XP_010257844.1|  PREDICTED: putative germin-like protein 2-1      58.9    5e-09   
gb|KDP45307.1|  hypothetical protein JCGZ_09556                       58.9    6e-09   
ref|XP_002868738.1|  hypothetical protein ARALYDRAFT_494073           58.9    6e-09   
emb|CBI36815.3|  unnamed protein product                              58.9    6e-09   
ref|XP_002325797.2|  hypothetical protein POPTR_0019s04340g           58.9    6e-09   Populus trichocarpa [western balsam poplar]
gb|AFK39387.1|  unknown                                               58.9    6e-09   
ref|XP_010450836.1|  PREDICTED: germin-like protein subfamily 1 m...  58.9    6e-09   
ref|XP_006371120.1|  hypothetical protein POPTR_0019s04280g           58.9    6e-09   
emb|CDP16791.1|  unnamed protein product                              58.9    6e-09   
ref|XP_010464157.1|  PREDICTED: germin-like protein subfamily 1 m...  58.9    6e-09   
emb|CBI36786.3|  unnamed protein product                              58.5    6e-09   
gb|KCW61443.1|  hypothetical protein EUGRSUZ_H04174                   58.5    6e-09   
ref|XP_010024914.1|  PREDICTED: putative germin-like protein 2-1      58.5    6e-09   
ref|XP_010050157.1|  PREDICTED: germin-like protein subfamily 1 m...  58.5    6e-09   
gb|EYU38443.1|  hypothetical protein MIMGU_mgv1a013090mg              58.9    6e-09   
gb|KCW61437.1|  hypothetical protein EUGRSUZ_H04167                   58.5    6e-09   
ref|XP_010024915.1|  PREDICTED: putative germin-like protein 2-1      58.5    7e-09   
ref|XP_009140209.1|  PREDICTED: germin-like protein subfamily 1 m...  58.5    7e-09   
ref|XP_003633711.2|  PREDICTED: putative germin-like protein 2-1      58.5    7e-09   
emb|CBI33612.3|  unnamed protein product                              58.5    7e-09   
gb|EYU42478.1|  hypothetical protein MIMGU_mgv1a022407mg              58.5    8e-09   
ref|XP_002319671.1|  hypothetical protein POPTR_0013s04840g           58.5    8e-09   Populus trichocarpa [western balsam poplar]
ref|XP_009124949.1|  PREDICTED: germin-like protein subfamily 1 m...  58.5    8e-09   
ref|XP_011034445.1|  PREDICTED: germin-like protein subfamily 1 m...  58.5    8e-09   
ref|XP_002319672.1|  hypothetical protein POPTR_0013s04850g           58.5    8e-09   Populus trichocarpa [western balsam poplar]
ref|NP_187067.1|  germin-like protein subfamily 1 member 3            58.5    8e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002270404.2|  PREDICTED: putative germin-like protein 2-1      58.5    8e-09   Vitis vinifera
ref|XP_011038440.1|  PREDICTED: germin-like protein subfamily 1 m...  58.2    8e-09   
ref|XP_006408007.1|  hypothetical protein EUTSA_v10021469mg           58.5    9e-09   
gb|KFK33209.1|  hypothetical protein AALP_AA6G344900                  57.8    9e-09   
ref|XP_004513532.1|  PREDICTED: germin-like protein subfamily 1 m...  58.2    9e-09   
ref|XP_010659856.1|  PREDICTED: germin-like protein subfamily 1 m...  58.2    1e-08   
ref|XP_007143990.1|  hypothetical protein PHAVU_007G119700g           58.2    1e-08   
gb|ABR68690.1|  oxalate oxidase                                       57.4    1e-08   Theobroma cacao [chocolate]
emb|CBI36782.3|  unnamed protein product                              57.8    1e-08   
ref|XP_007030273.1|  RmlC-like cupins superfamily protein             57.8    1e-08   
ref|XP_009612541.1|  PREDICTED: germin-like protein subfamily 1 m...  57.8    1e-08   
ref|XP_010528697.1|  PREDICTED: germin-like protein subfamily 1 m...  57.8    1e-08   
gb|KCW64217.1|  hypothetical protein EUGRSUZ_G018671                  57.0    1e-08   
gb|EYU38442.1|  hypothetical protein MIMGU_mgv1a013089mg              57.8    1e-08   
ref|XP_007199217.1|  hypothetical protein PRUPE_ppa021882mg           57.8    1e-08   
ref|XP_002276756.2|  PREDICTED: putative germin-like protein 2-1      57.8    1e-08   Vitis vinifera
ref|XP_009620917.1|  PREDICTED: germin-like protein subfamily 1 m...  57.8    1e-08   
ref|XP_010434310.1|  PREDICTED: germin-like protein subfamily 1 m...  57.8    2e-08   
ref|XP_002276644.1|  PREDICTED: putative germin-like protein 2-1      57.8    2e-08   Vitis vinifera
emb|CBI33611.3|  unnamed protein product                              58.5    2e-08   
ref|XP_006298965.1|  hypothetical protein CARUB_v10015090mg           57.8    2e-08   
ref|XP_002280481.2|  PREDICTED: uncharacterized protein LOC100252737  59.7    2e-08   Vitis vinifera
gb|KCW61442.1|  hypothetical protein EUGRSUZ_H04173                   57.4    2e-08   
ref|XP_010041604.1|  PREDICTED: germin-like protein subfamily 1 m...  57.4    2e-08   
ref|XP_010066342.1|  PREDICTED: germin-like protein subfamily 1 m...  57.4    2e-08   
gb|KCW44232.1|  hypothetical protein EUGRSUZ_L02342                   57.4    2e-08   
ref|NP_198729.1|  germin-like protein subfamily 1 member 16           57.4    2e-08   Arabidopsis thaliana [mouse-ear cress]
emb|CAA63023.1|  germin type2                                         57.4    2e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004513533.1|  PREDICTED: germin-like protein subfamily 1 m...  57.4    2e-08   
ref|NP_198735.1|  germin-like protein 2a                              57.4    2e-08   Arabidopsis thaliana [mouse-ear cress]
ref|NP_198732.2|  germin-like protein subfamily 1 member 18           57.4    2e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010450835.1|  PREDICTED: LOW QUALITY PROTEIN: germin-like ...  57.4    2e-08   
ref|NP_001267943.1|  germin-like protein 4 precursor                  57.4    2e-08   
gb|KDP46446.1|  hypothetical protein JCGZ_10286                       57.8    2e-08   
ref|XP_010027139.1|  PREDICTED: germin-like protein subfamily 1 m...  57.4    2e-08   
emb|CBI36811.3|  unnamed protein product                              57.4    2e-08   
ref|XP_006358460.1|  PREDICTED: LOW QUALITY PROTEIN: germin-like ...  57.4    2e-08   
gb|KHN04965.1|  Germin-like protein subfamily 1 member 7              57.4    2e-08   
ref|NP_001240963.1|  germin-like protein subfamily 1 member 7-lik...  57.4    2e-08   
ref|XP_010659615.1|  PREDICTED: germin-like protein subfamily 1 m...  57.4    2e-08   
emb|CBI36816.3|  unnamed protein product                              57.4    2e-08   
ref|XP_010027136.1|  PREDICTED: uncharacterized protein LOC104417584  59.3    2e-08   
ref|NP_198728.1|  germin-like protein subfamily 1 member 15           57.4    2e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002284320.1|  PREDICTED: germin-like protein subfamily 1 m...  57.0    2e-08   Vitis vinifera
ref|NP_001267944.1|  germin-like protein 7 precursor                  57.0    2e-08   
ref|XP_009773430.1|  PREDICTED: germin-like protein subfamily 1 m...  57.0    2e-08   
emb|CAN71348.1|  hypothetical protein VITISV_024253                   57.0    2e-08   Vitis vinifera
gb|KCW80409.1|  hypothetical protein EUGRSUZ_C01766                   57.0    3e-08   
gb|KCW61438.1|  hypothetical protein EUGRSUZ_H04168                   57.0    3e-08   
gb|KDO36579.1|  hypothetical protein CISIN_1g048097mg                 57.0    3e-08   
gb|KCW61436.1|  hypothetical protein EUGRSUZ_H04166                   57.0    3e-08   
gb|KCW76699.1|  hypothetical protein EUGRSUZ_D01059                   57.0    3e-08   
gb|KFK33208.1|  hypothetical protein AALP_AA6G344800                  57.0    3e-08   
ref|XP_006845051.1|  hypothetical protein AMTR_s00794p00001640        56.6    3e-08   
emb|CBI36814.3|  unnamed protein product                              57.0    3e-08   
ref|XP_002281186.2|  PREDICTED: uncharacterized protein LOC100244552  58.5    3e-08   Vitis vinifera
gb|KDP45308.1|  hypothetical protein JCGZ_09557                       57.0    3e-08   
ref|XP_006599050.1|  PREDICTED: germin-like protein subfamily 1 m...  56.6    3e-08   
ref|XP_002276926.2|  PREDICTED: uncharacterized protein LOC100251187  58.5    3e-08   Vitis vinifera
ref|XP_004489241.1|  PREDICTED: putative germin-like protein 2-1-...  56.6    3e-08   
ref|XP_006345483.1|  PREDICTED: germin-like protein subfamily 1 m...  56.6    4e-08   
ref|XP_008443754.1|  PREDICTED: germin-like protein subfamily 1 m...  56.6    4e-08   
ref|XP_002265447.3|  PREDICTED: uncharacterized protein LOC100242782  58.5    4e-08   Vitis vinifera
ref|XP_009773221.1|  PREDICTED: germin-like protein subfamily 1 m...  56.6    4e-08   
ref|XP_010549632.1|  PREDICTED: germin-like protein subfamily 1 m...  55.5    4e-08   
ref|XP_010050748.1|  PREDICTED: uncharacterized protein LOC104439371  58.2    4e-08   
ref|XP_002265297.3|  PREDICTED: uncharacterized protein LOC100247931  58.5    4e-08   Vitis vinifera
gb|AFK34934.1|  unknown                                               55.8    4e-08   
ref|XP_007199406.1|  hypothetical protein PRUPE_ppa026225mg           56.6    4e-08   
ref|NP_001268128.1|  germin-like protein 5                            56.2    5e-08   
ref|XP_006477875.1|  PREDICTED: germin-like protein subfamily 1 m...  56.2    5e-08   
gb|KDP45302.1|  hypothetical protein JCGZ_09551                       56.6    5e-08   
ref|XP_003618167.1|  Germin-like protein                              56.2    5e-08   
ref|XP_006477881.1|  PREDICTED: germin-like protein subfamily 1 m...  56.2    6e-08   
ref|XP_008363404.1|  PREDICTED: LOW QUALITY PROTEIN: germin-like ...  56.2    6e-08   
ref|XP_006857269.1|  hypothetical protein AMTR_s00067p00013880        54.3    6e-08   
gb|KFK24125.1|  hypothetical protein AALP_AAs58370U000100             56.2    6e-08   
emb|CAN80133.1|  hypothetical protein VITISV_012032                   55.8    6e-08   Vitis vinifera
ref|XP_004229689.1|  PREDICTED: germin-like protein subfamily 1 m...  56.2    6e-08   
ref|XP_003633724.1|  PREDICTED: putative germin-like protein 2-1      55.8    6e-08   
ref|XP_002265608.1|  PREDICTED: putative germin-like protein 2-1      55.8    6e-08   Vitis vinifera
ref|XP_007201563.1|  hypothetical protein PRUPE_ppa018105mg           56.2    6e-08   
ref|XP_010054506.1|  PREDICTED: uncharacterized protein LOC104442816  57.8    7e-08   
ref|XP_002868739.1|  predicted protein                                55.8    7e-08   
ref|XP_003633723.2|  PREDICTED: putative germin-like protein 2-1      55.8    8e-08   
emb|CBI39477.3|  unnamed protein product                              55.8    8e-08   
ref|XP_002276315.2|  PREDICTED: putative germin-like protein 2-1      55.8    8e-08   Vitis vinifera
emb|CAN72994.1|  hypothetical protein VITISV_000563                   55.5    8e-08   Vitis vinifera
emb|CBI36810.3|  unnamed protein product                              56.6    8e-08   
ref|XP_008243694.1|  PREDICTED: germin-like protein 9-1               57.4    8e-08   
ref|XP_010435821.1|  PREDICTED: germin-like protein subfamily 1 m...  55.1    8e-08   
ref|XP_006299201.1|  hypothetical protein CARUB_v10015347mg           55.8    9e-08   
ref|XP_007200183.1|  hypothetical protein PRUPE_ppa016284mg           55.8    9e-08   
gb|EYU40207.1|  hypothetical protein MIMGU_mgv1a012993mg              55.8    9e-08   
ref|XP_007201862.1|  hypothetical protein PRUPE_ppa020162mg           55.5    9e-08   
ref|XP_007200157.1|  hypothetical protein PRUPE_ppa016753mg           55.5    9e-08   
ref|XP_010412923.1|  PREDICTED: germin-like protein subfamily 1 m...  55.5    9e-08   
emb|CAN79051.1|  hypothetical protein VITISV_025926                   55.1    1e-07   Vitis vinifera
emb|CAN73847.1|  hypothetical protein VITISV_021638                   55.5    1e-07   
ref|XP_002530595.1|  Oxalate oxidase 2 precursor, putative            55.1    1e-07   
ref|XP_008371812.1|  PREDICTED: germin-like protein subfamily 1 m...  55.5    1e-07   
gb|KHN14792.1|  Germin-like protein subfamily 1 member 7              55.5    1e-07   
ref|XP_003618162.1|  Germin-like protein subfamily 1 member           55.1    1e-07   
ref|XP_006442442.1|  hypothetical protein CICLE_v10022152mg           55.1    1e-07   
ref|XP_003536153.1|  PREDICTED: germin-like protein subfamily 1 m...  55.5    1e-07   
ref|XP_006442444.1|  hypothetical protein CICLE_v10023384mg           55.1    1e-07   
ref|XP_006442438.1|  hypothetical protein CICLE_v10024000mg           55.1    1e-07   
ref|XP_006477883.1|  PREDICTED: germin-like protein subfamily 1 m...  55.1    1e-07   
ref|XP_006442447.1|  hypothetical protein CICLE_v10024005mg           55.1    1e-07   
ref|XP_006477879.1|  PREDICTED: germin-like protein subfamily 1 m...  55.1    1e-07   
ref|XP_006477877.1|  PREDICTED: germin-like protein subfamily 1 m...  55.1    1e-07   
gb|ACG69489.1|  germin-like protein 13                                55.1    1e-07   
ref|XP_002277055.1|  PREDICTED: putative germin-like protein 2-1      55.1    1e-07   
ref|XP_006442436.1|  hypothetical protein CICLE_v10024280mg           55.1    1e-07   
ref|XP_003618165.1|  Germin-like protein subfamily 1 member           55.1    1e-07   
gb|KCW80408.1|  hypothetical protein EUGRSUZ_C01765                   54.7    1e-07   
gb|KHN28990.1|  Germin-like protein subfamily 1 member 7              55.1    1e-07   
ref|XP_003553909.1|  PREDICTED: germin-like protein subfamily 1 m...  55.1    1e-07   
emb|CBI33610.3|  unnamed protein product                              56.2    1e-07   
ref|XP_007201148.1|  hypothetical protein PRUPE_ppa016020mg           55.1    1e-07   
gb|KDP23773.1|  hypothetical protein JCGZ_23606                       54.3    2e-07   
ref|XP_004489240.1|  PREDICTED: germin-like protein subfamily 1 m...  54.7    2e-07   
emb|CAN72946.1|  hypothetical protein VITISV_034968                   57.0    2e-07   
ref|XP_010463902.1|  PREDICTED: germin-like protein subfamily 1 m...  54.7    2e-07   
ref|XP_003553592.1|  PREDICTED: germin-like protein subfamily 1 m...  54.7    2e-07   
gb|KDP23764.1|  hypothetical protein JCGZ_23597                       54.7    2e-07   
gb|KDP23768.1|  hypothetical protein JCGZ_23601                       54.7    2e-07   
ref|NP_187070.1|  RmlC-like cupins superfamily protein                54.7    2e-07   
ref|XP_010251872.1|  PREDICTED: putative germin-like protein 2-1      54.7    2e-07   
emb|CAN66771.1|  hypothetical protein VITISV_022559                   54.3    2e-07   
ref|XP_006345478.1|  PREDICTED: germin-like protein subfamily 1 m...  54.7    2e-07   
ref|XP_009606432.1|  PREDICTED: germin-like protein subfamily 1 m...  54.7    2e-07   
ref|XP_007030281.1|  RmlC-like cupins superfamily protein isoform 2   54.3    2e-07   
ref|XP_010251870.1|  PREDICTED: putative germin-like protein 2-1 ...  54.3    3e-07   
ref|XP_010489667.1|  PREDICTED: uncharacterized protein LOC104767323  56.2    3e-07   
ref|XP_006299843.1|  hypothetical protein CARUB_v10016046mg           54.3    3e-07   
ref|XP_007030280.1|  RmlC-like cupins superfamily protein isoform 1   54.3    3e-07   
ref|XP_010528696.1|  PREDICTED: germin-like protein subfamily 1 m...  54.3    3e-07   
emb|CAN82524.1|  hypothetical protein VITISV_028056                   54.3    3e-07   
ref|XP_006854750.1|  hypothetical protein AMTR_s03649p00000860        52.8    3e-07   
ref|NP_001241319.1|  germin-like protein subfamily 1 member 7-lik...  53.9    3e-07   
emb|CDP10693.1|  unnamed protein product                              53.9    3e-07   
ref|XP_010241946.1|  PREDICTED: putative germin-like protein 2-1      53.9    3e-07   
gb|KDP46443.1|  hypothetical protein JCGZ_10283                       53.9    4e-07   
ref|XP_010672478.1|  PREDICTED: germin-like protein subfamily 1 m...  53.9    4e-07   
ref|XP_007210592.1|  hypothetical protein PRUPE_ppa016616mg           53.9    4e-07   
ref|XP_002276445.2|  PREDICTED: uncharacterized protein LOC100254460  55.8    4e-07   
ref|XP_006840206.1|  hypothetical protein AMTR_s00089p00127600        53.9    4e-07   
ref|XP_006345479.1|  PREDICTED: putative germin-like protein subf...  53.9    4e-07   
gb|KHN28994.1|  Germin-like protein subfamily 1 member 18             53.9    4e-07   
gb|KHN26390.1|  Germin-like protein subfamily 1 member 7              53.9    4e-07   
ref|XP_003553912.1|  PREDICTED: germin-like protein subfamily 1 m...  53.9    4e-07   
ref|XP_008240380.1|  PREDICTED: germin-like protein subfamily 1 m...  53.9    4e-07   
ref|XP_010463900.1|  PREDICTED: germin-like protein subfamily 1 m...  53.9    5e-07   
gb|KDP46444.1|  hypothetical protein JCGZ_10284                       53.9    5e-07   
ref|XP_006345482.1|  PREDICTED: putative germin-like protein 2-1-...  53.5    5e-07   
ref|XP_009766874.1|  PREDICTED: putative germin-like protein 2-1      53.9    5e-07   
ref|XP_010528694.1|  PREDICTED: germin-like protein subfamily 1 m...  53.5    5e-07   
ref|XP_010683101.1|  PREDICTED: germin-like protein subfamily 1 m...  53.5    5e-07   
gb|EPS68345.1|  hypothetical protein M569_06426                       52.8    5e-07   
gb|KCW80410.1|  hypothetical protein EUGRSUZ_C01767                   53.1    5e-07   
ref|XP_007030284.1|  RmlC-like cupins superfamily protein             53.5    6e-07   
ref|XP_006840196.1|  hypothetical protein AMTR_s00089p00119480        53.1    6e-07   
ref|XP_006443312.1|  hypothetical protein CICLE_v10022118mg           53.1    6e-07   
ref|XP_002884431.1|  hypothetical protein ARALYDRAFT_477679           53.1    7e-07   
ref|XP_007030176.1|  Germin-like protein subfamily 1 member 18        54.3    7e-07   
ref|XP_008367619.1|  PREDICTED: germin-like protein subfamily 1 m...  53.5    7e-07   
ref|XP_008393483.1|  PREDICTED: germin-like protein subfamily 1 m...  53.1    7e-07   
gb|KDO42113.1|  hypothetical protein CISIN_1g027369mg                 53.1    7e-07   
ref|XP_008351931.1|  PREDICTED: germin-like protein subfamily 1 m...  53.1    7e-07   
ref|XP_002870813.1|  predicted protein                                53.1    8e-07   
ref|XP_008778966.1|  PREDICTED: putative germin-like protein 2-1      53.1    8e-07   
ref|XP_007030289.1|  RmlC-like cupins superfamily protein             52.8    9e-07   
ref|XP_007030278.1|  Germin-like protein subfamily 1 member 18        54.7    9e-07   
ref|NP_001236994.1|  uncharacterized protein LOC100527249 precursor   52.8    9e-07   
gb|ACG69479.1|  germin-like protein 3                                 52.8    9e-07   
ref|XP_006345480.1|  PREDICTED: germin-like protein subfamily 1 m...  52.8    9e-07   
gb|EPS68344.1|  hypothetical protein M569_06425                       52.8    9e-07   
emb|CAN73846.1|  hypothetical protein VITISV_021637                   52.0    1e-06   
ref|XP_010441023.1|  PREDICTED: putative germin-like protein subf...  52.8    1e-06   
ref|XP_010435803.1|  PREDICTED: putative germin-like protein subf...  52.8    1e-06   
ref|XP_007030274.1|  Germin-like protein subfamily 1 member 18        54.7    1e-06   
ref|XP_009419633.1|  PREDICTED: uncharacterized protein LOC103999573  54.3    1e-06   
ref|XP_010417597.1|  PREDICTED: germin-like protein 9-1               54.3    1e-06   
ref|XP_008393146.1|  PREDICTED: germin-like protein subfamily 1 m...  52.8    1e-06   
gb|KCW61434.1|  hypothetical protein EUGRSUZ_H04164                   52.8    1e-06   
ref|XP_008443751.1|  PREDICTED: germin-like protein subfamily 1 m...  52.8    1e-06   
ref|NP_187065.1|  putative germin-like protein subfamily 1 member 2   52.8    1e-06   
gb|KCW61454.1|  hypothetical protein EUGRSUZ_H04190                   52.8    1e-06   
ref|XP_010051708.1|  PREDICTED: germin-like protein subfamily 1 m...  53.1    1e-06   
ref|XP_004142551.1|  PREDICTED: germin-like protein subfamily 1 m...  52.8    1e-06   
ref|XP_010024910.1|  PREDICTED: germin-like protein subfamily 1 m...  52.8    1e-06   
gb|KHN28583.1|  Germin-like protein subfamily 1 member 16             52.4    1e-06   
ref|XP_004155681.1|  PREDICTED: LOW QUALITY PROTEIN: germin-like ...  52.4    1e-06   
ref|XP_006354496.1|  PREDICTED: germin-like protein subfamily 1 m...  52.4    1e-06   
ref|XP_010024921.1|  PREDICTED: germin-like protein subfamily 1 m...  52.4    1e-06   
ref|NP_001238085.1|  uncharacterized protein LOC100306389 precursor   52.4    1e-06   
ref|XP_009349816.1|  PREDICTED: germin-like protein subfamily 1 m...  52.4    1e-06   
ref|XP_006442440.1|  hypothetical protein CICLE_v10023726mg           52.4    1e-06   
ref|XP_007030272.1|  RmlC-like cupins superfamily protein             52.4    1e-06   
ref|XP_010251866.1|  PREDICTED: putative germin-like protein 2-1      52.4    2e-06   
ref|XP_011099652.1|  PREDICTED: putative germin-like protein 2-1      52.4    2e-06   
ref|XP_006840201.1|  hypothetical protein AMTR_s00089p00122070        51.2    2e-06   
ref|XP_009341765.1|  PREDICTED: germin-like protein subfamily 1 m...  52.4    2e-06   
ref|XP_009622800.1|  PREDICTED: germin-like protein subfamily 1 m...  52.0    2e-06   
ref|XP_002870812.1|  predicted protein                                52.0    2e-06   
ref|XP_002884546.1|  hypothetical protein ARALYDRAFT_477892           52.0    2e-06   
ref|XP_006354543.1|  PREDICTED: germin-like protein subfamily 1 m...  52.0    2e-06   
ref|XP_008393482.1|  PREDICTED: germin-like protein subfamily 1 m...  52.0    2e-06   
ref|XP_009766872.1|  PREDICTED: germin-like protein subfamily 1 m...  52.0    2e-06   
ref|XP_006345477.1|  PREDICTED: germin-like protein subfamily 1 m...  52.0    2e-06   
ref|XP_006857270.1|  hypothetical protein AMTR_s00067p00014150        52.0    2e-06   
ref|XP_002284616.2|  PREDICTED: germin-like protein subfamily 1 m...  52.0    2e-06   
ref|XP_010066343.1|  PREDICTED: germin-like protein subfamily 1 m...  52.0    2e-06   
ref|XP_007201630.1|  hypothetical protein PRUPE_ppa020060mg           52.0    2e-06   
ref|XP_008237387.1|  PREDICTED: germin-like protein subfamily 1 m...  52.0    2e-06   
ref|XP_006405680.1|  hypothetical protein EUTSA_v10027917mg           52.0    2e-06   
ref|XP_010042132.1|  PREDICTED: germin-like protein subfamily 1 m...  52.0    2e-06   
gb|KCW61456.1|  hypothetical protein EUGRSUZ_H04192                   52.0    2e-06   
ref|XP_010024919.1|  PREDICTED: germin-like protein subfamily 1 m...  51.6    2e-06   
ref|XP_010450850.1|  PREDICTED: putative germin-like protein subf...  51.6    2e-06   
ref|XP_010052624.1|  PREDICTED: germin-like protein subfamily 1 m...  51.6    2e-06   
ref|XP_010024918.1|  PREDICTED: germin-like protein subfamily 1 m...  51.6    2e-06   
ref|XP_010048221.1|  PREDICTED: germin-like protein subfamily 1 m...  51.6    3e-06   
ref|XP_004247722.1|  PREDICTED: germin-like protein subfamily 1 m...  51.6    3e-06   
ref|XP_006354495.1|  PREDICTED: germin-like protein subfamily 1 m...  51.6    3e-06   
ref|XP_010049990.1|  PREDICTED: germin-like protein subfamily 1 m...  51.6    3e-06   
gb|KDP34916.1|  hypothetical protein JCGZ_09204                       51.6    3e-06   
ref|XP_007030265.1|  Germin-like protein 2                            51.6    3e-06   
ref|NP_001241457.1|  germin-like protein subfamily 1 member 7-lik...  51.6    3e-06   
ref|XP_009135968.1|  PREDICTED: putative germin-like protein subf...  51.6    3e-06   
gb|KDP45129.1|  hypothetical protein JCGZ_17461                       51.6    3e-06   
gb|KDP45119.1|  hypothetical protein JCGZ_17451                       51.6    3e-06   
gb|KCW82834.1|  hypothetical protein EUGRSUZ_C04205                   51.6    3e-06   
gb|KDP45127.1|  hypothetical protein JCGZ_17459                       51.6    3e-06   
ref|XP_006345484.1|  PREDICTED: putative germin-like protein 2-1-...  51.6    3e-06   
ref|XP_010050174.1|  PREDICTED: germin-like protein subfamily 1 m...  51.2    3e-06   
gb|KCW61435.1|  hypothetical protein EUGRSUZ_H04165                   51.2    3e-06   
ref|XP_006405677.1|  hypothetical protein EUTSA_v10027920mg           51.2    4e-06   
ref|XP_006345376.1|  PREDICTED: germin-like protein subfamily 1 m...  51.2    4e-06   
ref|XP_003547666.1|  PREDICTED: germin-like protein subfamily 1 m...  51.2    4e-06   
ref|XP_002284624.1|  PREDICTED: germin-like protein subfamily 1 m...  51.2    4e-06   
ref|XP_006405676.1|  hypothetical protein EUTSA_v10027913mg           51.2    4e-06   
ref|XP_007030267.1|  Germin-like protein subfamily 1 member 18        52.0    4e-06   
gb|KDP32127.1|  hypothetical protein JCGZ_12588                       51.2    4e-06   
ref|XP_006840197.1|  hypothetical protein AMTR_s00089p00120230        51.6    4e-06   
gb|KCW82831.1|  hypothetical protein EUGRSUZ_C04202                   50.8    4e-06   
ref|XP_007030211.1|  Uncharacterized protein TCM_026019               51.2    4e-06   
ref|XP_009385875.1|  PREDICTED: putative germin-like protein 2-1      51.2    4e-06   
ref|XP_010435801.1|  PREDICTED: putative germin-like protein subf...  50.8    5e-06   
ref|XP_010672571.1|  PREDICTED: putative germin-like protein 2-1      51.2    5e-06   
ref|XP_006345485.1|  PREDICTED: germin-like protein subfamily 1 m...  50.8    6e-06   
emb|CAN63889.1|  hypothetical protein VITISV_027218                   50.4    6e-06   
ref|XP_010688720.1|  PREDICTED: germin-like protein subfamily 1 m...  50.8    6e-06   
ref|XP_010027143.1|  PREDICTED: uncharacterized protein LOC104417591  52.0    6e-06   
ref|XP_010450851.1|  PREDICTED: putative germin-like protein subf...  50.8    6e-06   
ref|XP_008237524.1|  PREDICTED: germin-like protein subfamily 1 m...  50.8    6e-06   
ref|XP_007030263.1|  Germin-like protein subfamily 1 member 18        51.2    6e-06   
ref|XP_008237526.1|  PREDICTED: germin-like protein subfamily 1 m...  50.8    7e-06   
ref|XP_010050166.1|  PREDICTED: germin-like protein subfamily 1 m...  50.4    7e-06   
ref|XP_006405679.1|  hypothetical protein EUTSA_v10027925mg           50.4    7e-06   
ref|XP_006345377.1|  PREDICTED: germin-like protein subfamily 1 m...  50.4    7e-06   
ref|XP_010027135.1|  PREDICTED: germin-like protein subfamily 1 m...  51.6    7e-06   
ref|XP_010027145.1|  PREDICTED: germin-like protein subfamily 1 m...  50.4    7e-06   
ref|XP_006840195.1|  hypothetical protein AMTR_s00089p00119070        50.4    8e-06   
ref|NP_198707.1|  putative germin-like protein subfamily 1 member 9   50.4    9e-06   
ref|XP_010050940.1|  PREDICTED: germin-like protein subfamily 1 m...  49.3    9e-06   
emb|CAN63434.1|  hypothetical protein VITISV_033830                   50.1    9e-06   
ref|XP_008237522.1|  PREDICTED: germin-like protein subfamily 1 m...  50.4    9e-06   
ref|XP_010024926.1|  PREDICTED: germin-like protein subfamily 1 m...  50.1    1e-05   
ref|XP_010024924.1|  PREDICTED: germin-like protein subfamily 1 m...  50.1    1e-05   
ref|XP_010672564.1|  PREDICTED: putative germin-like protein 2-1      50.4    1e-05   
ref|XP_010024925.1|  PREDICTED: germin-like protein subfamily 1 m...  49.7    1e-05   
ref|XP_010024923.1|  PREDICTED: germin-like protein subfamily 1 m...  50.1    1e-05   
dbj|BAJ98011.1|  predicted protein                                    50.1    1e-05   
ref|XP_010441022.1|  PREDICTED: putative germin-like protein subf...  49.7    1e-05   
ref|XP_010688719.1|  PREDICTED: germin-like protein subfamily 1 m...  50.1    1e-05   
gb|KCW82833.1|  hypothetical protein EUGRSUZ_C04204                   49.3    1e-05   
ref|XP_009622801.1|  PREDICTED: putative germin-like protein 2-1      49.7    1e-05   
ref|NP_001189803.1|  putative germin-like protein subfamily 1 mem...  50.1    2e-05   
ref|XP_010051710.1|  PREDICTED: germin-like protein subfamily 1 m...  49.7    2e-05   
ref|XP_010049992.1|  PREDICTED: germin-like protein subfamily 1 m...  49.7    2e-05   
gb|AAX84674.1|  germin-like protein GLP                               49.3    2e-05   
ref|XP_010049995.1|  PREDICTED: germin-like protein subfamily 1 m...  49.3    2e-05   
ref|XP_010049993.1|  PREDICTED: germin-like protein subfamily 1 m...  49.3    2e-05   
ref|XP_011046314.1|  PREDICTED: germin-like protein subfamily 1 m...  49.7    2e-05   
ref|XP_010049991.1|  PREDICTED: germin-like protein subfamily 1 m...  49.3    2e-05   
ref|XP_007030276.1|  RmlC-like cupins superfamily protein             49.3    2e-05   
gb|KDP45303.1|  hypothetical protein JCGZ_09552                       49.7    2e-05   
ref|XP_010049996.1|  PREDICTED: germin-like protein subfamily 1 m...  49.3    2e-05   
ref|XP_009125097.1|  PREDICTED: germin-like protein subfamily 1 m...  49.3    2e-05   
ref|XP_009402547.1|  PREDICTED: putative germin-like protein 2-1 ...  49.3    2e-05   
ref|XP_010672553.1|  PREDICTED: putative germin-like protein 2-1      49.7    2e-05   
gb|AFK49577.1|  unknown                                               49.3    2e-05   
gb|AAD00509.1|  germin-like protein                                   49.3    2e-05   
ref|NP_193199.1|  germin-like protein 9                               49.3    2e-05   
gb|KDP45306.1|  hypothetical protein JCGZ_09555                       49.3    2e-05   
ref|XP_003618169.1|  Germin-like protein subfamily 1 member           48.9    2e-05   
ref|XP_010450848.1|  PREDICTED: germin-like protein subfamily 1 m...  49.3    2e-05   
ref|XP_010441025.1|  PREDICTED: germin-like protein subfamily 1 m...  49.3    2e-05   
ref|XP_006354494.1|  PREDICTED: germin-like protein subfamily 1 m...  48.9    3e-05   
ref|XP_007213316.1|  hypothetical protein PRUPE_ppb017655mg           48.9    3e-05   
ref|XP_009357348.1|  PREDICTED: germin-like protein subfamily 1 m...  48.9    3e-05   
emb|CAN70904.1|  hypothetical protein VITISV_032927                   48.5    3e-05   
ref|XP_009355938.1|  PREDICTED: germin-like protein subfamily 1 m...  48.9    3e-05   
gb|KCW64218.1|  hypothetical protein EUGRSUZ_G01868                   48.9    3e-05   
ref|XP_010251867.1|  PREDICTED: putative germin-like protein 2-1      48.9    3e-05   
ref|XP_006405674.1|  hypothetical protein EUTSA_v10027914mg           48.9    3e-05   
ref|XP_010041605.1|  PREDICTED: germin-like protein subfamily 1 m...  48.9    3e-05   
ref|XP_011038438.1|  PREDICTED: germin-like protein subfamily 1 m...  48.9    3e-05   
ref|XP_011034444.1|  PREDICTED: germin-like protein subfamily 1 m...  48.9    3e-05   
ref|XP_011034442.1|  PREDICTED: germin-like protein subfamily 1 m...  48.9    3e-05   
ref|XP_009362202.1|  PREDICTED: putative germin-like protein 2-1      48.5    3e-05   
ref|XP_010066338.1|  PREDICTED: germin-like protein subfamily 1 m...  48.9    3e-05   
ref|XP_008375054.1|  PREDICTED: germin-like protein subfamily 1 m...  48.9    3e-05   
gb|EMS67056.1|  Germin-like protein 12-2                              48.9    3e-05   
ref|XP_006375870.1|  germin-like protein 1                            48.9    3e-05   
gb|KFK33215.1|  hypothetical protein AALP_AA6G345500                  48.5    3e-05   
ref|XP_010672088.1|  PREDICTED: germin-like protein subfamily 1 m...  48.9    3e-05   



>ref|XP_011046612.1| PREDICTED: germin-like protein subfamily 1 member 16 [Populus 
euphratica]
Length=256

 Score = 67.8 bits (164),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = -3

Query  164  TMASSLPIMKSILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            TM     ++   ++LAL +SF  AYDP P+QDFCVA+ DA +AV VNGK+CKNP
Sbjct  30   TMMKVAHLIAVFILLALASSFVTAYDPSPLQDFCVAIDDANSAVLVNGKLCKNP  83



>ref|XP_011039266.1| PREDICTED: germin-like protein subfamily 1 member 16 [Populus 
euphratica]
Length=256

 Score = 67.8 bits (164),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = -3

Query  164  TMASSLPIMKSILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            TM     ++   ++LAL +SF  AYDP P+QDFCVA+ DA +AV VNGK+CKNP
Sbjct  30   TMMKVANLIAVFILLALASSFVTAYDPSPLQDFCVAIDDANSAVLVNGKLCKNP  83



>ref|XP_011046611.1| PREDICTED: germin-like protein subfamily 1 member 16 isoform 
X3 [Populus euphratica]
Length=256

 Score = 67.8 bits (164),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = -3

Query  164  TMASSLPIMKSILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            TM     ++   ++LAL +SF  AYDP P+QDFCVA+ DA +AV VNGK+CKNP
Sbjct  30   TMMKVANLIAVFILLALASSFVTAYDPSPLQDFCVAIDDANSAVLVNGKLCKNP  83



>ref|XP_011046613.1| PREDICTED: germin-like protein subfamily 1 member 16 [Populus 
euphratica]
Length=256

 Score = 67.8 bits (164),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = -3

Query  164  TMASSLPIMKSILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            TM     ++   ++LAL +SF  AYDP P+QDFCVA+ DA +AV VNGK+CKNP
Sbjct  30   TMMKVANLIAVFILLALASSFVTAYDPSPLQDFCVAIDDANSAVLVNGKLCKNP  83



>ref|XP_011046610.1| PREDICTED: germin-like protein subfamily 1 member 16 isoform 
X2 [Populus euphratica]
Length=256

 Score = 67.8 bits (164),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = -3

Query  164  TMASSLPIMKSILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            TM     ++   ++LAL +SF  AYDP P+QDFCVA+ DA +AV VNGK+CKNP
Sbjct  30   TMMKVANLIAVFILLALASSFVTAYDPSPLQDFCVAIDDANSAVLVNGKLCKNP  83



>ref|XP_009620404.1| PREDICTED: germin-like protein subfamily 1 member 17 [Nicotiana 
tomentosiformis]
Length=228

 Score = 66.6 bits (161),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 29/44 (66%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = -3

Query  134  SILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            +I ILA+V+S + AYDP P+QDFCVAV D+  AVFVNGK+CK+P
Sbjct  9    TIGILAIVSSISHAYDPSPLQDFCVAVNDSMAAVFVNGKICKDP  52



>ref|XP_006405659.1| hypothetical protein EUTSA_v10028158mg [Eutrema salsugineum]
 gb|ESQ47112.1| hypothetical protein EUTSA_v10028158mg [Eutrema salsugineum]
Length=222

 Score = 66.6 bits (161),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = -3

Query  131  ILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            I ILALV SFA+AYDP P+QDFCVA  D +  VFVNGK CK+P
Sbjct  10   ITILALVISFAKAYDPSPLQDFCVATDDIKIGVFVNGKFCKDP  52



>ref|XP_011046609.1| PREDICTED: germin-like protein subfamily 1 member 16 isoform 
X1 [Populus euphratica]
Length=226

 Score = 66.6 bits (161),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 28/42 (67%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = -3

Query  128  LILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            ++LAL +SF  AYDP P+QDFCVA+ DA +AV VNGK+CKNP
Sbjct  12   ILLALASSFVTAYDPSPLQDFCVAIDDANSAVLVNGKLCKNP  53



>ref|XP_002306210.1| hypothetical protein POPTR_0004s18690g [Populus trichocarpa]
 ref|XP_002306209.2| germin-like protein 1 [Populus trichocarpa]
 gb|EEE86721.1| hypothetical protein POPTR_0004s18690g [Populus trichocarpa]
 gb|EEE86720.2| germin-like protein 1 [Populus trichocarpa]
Length=226

 Score = 66.6 bits (161),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 28/42 (67%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = -3

Query  128  LILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            ++LAL +SF  AYDP P+QDFCVA+ DA +AV VNGK+CKNP
Sbjct  12   ILLALASSFVTAYDPSPLQDFCVAIDDANSAVLVNGKLCKNP  53



>gb|EYU20535.1| hypothetical protein MIMGU_mgv1a013054mg [Erythranthe guttata]
Length=231

 Score = 66.6 bits (161),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 30/46 (65%), Positives = 37/46 (80%), Gaps = 0/46 (0%)
 Frame = -3

Query  140  MKSILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            + +IL++A  A+   A DP P+QDFCVAV DAQ+AVFVNGKVCKNP
Sbjct  9    LTTILVVASFATLGFASDPSPLQDFCVAVNDAQSAVFVNGKVCKNP  54



>ref|XP_007140908.1| hypothetical protein PHAVU_008G1513001g, partial [Phaseolus vulgaris]
 gb|ESW12902.1| hypothetical protein PHAVU_008G1513001g, partial [Phaseolus vulgaris]
Length=77

 Score = 64.7 bits (156),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = -3

Query  131  ILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            + ILAL +S A AYDP P+QDFCVA+ D + AVFVNGK+CK+P
Sbjct  8    VAILALTSSIASAYDPSPLQDFCVALNDTKNAVFVNGKLCKDP  50



>ref|XP_007140911.1| hypothetical protein PHAVU_008G1514000g, partial [Phaseolus vulgaris]
 gb|ESW12905.1| hypothetical protein PHAVU_008G1514000g, partial [Phaseolus vulgaris]
Length=74

 Score = 64.3 bits (155),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = -3

Query  131  ILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            + ILAL +S A AYDP P+QDFCVA+ D + AVFVNGK+CK+P
Sbjct  8    VAILALTSSIASAYDPSPLQDFCVALNDTKNAVFVNGKLCKDP  50



>ref|XP_007140900.1| hypothetical protein PHAVU_008G1508001g, partial [Phaseolus vulgaris]
 gb|ESW12894.1| hypothetical protein PHAVU_008G1508001g, partial [Phaseolus vulgaris]
Length=92

 Score = 64.7 bits (156),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = -3

Query  131  ILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            + ILAL +S A AYDP P+QDFCVA+ D + AVFVNGK+CK+P
Sbjct  8    VAILALTSSIASAYDPSPLQDFCVALNDTKNAVFVNGKLCKDP  50



>ref|XP_007030270.1| Germin-like protein subfamily 1 member 18 [Theobroma cacao]
 gb|EOY10772.1| Germin-like protein subfamily 1 member 18 [Theobroma cacao]
Length=329

 Score = 67.4 bits (163),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 30/57 (53%), Positives = 41/57 (72%), Gaps = 0/57 (0%)
 Frame = -3

Query  173  TAITMASSLPIMKSILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            T +T    + I+ + ++LALV+S A A DP P+QDFCVA+ DA+  VFVNGK CK+P
Sbjct  73   TCLTTMKGVQILVAFVLLALVSSLASASDPSPLQDFCVAINDAKNGVFVNGKFCKDP  129



>gb|EYU20541.1| hypothetical protein MIMGU_mgv1a018988mg [Erythranthe guttata]
Length=230

 Score = 66.2 bits (160),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/53 (58%), Positives = 39/53 (74%), Gaps = 0/53 (0%)
 Frame = -3

Query  161  MASSLPIMKSILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            M  +L  + ++  +A +A+FA A DP P+QDFCVAV DA  AVFVNGKVCKNP
Sbjct  1    MKMALVSLTTLFFIACLATFAYASDPSPLQDFCVAVKDADAAVFVNGKVCKNP  53



>emb|CBI36783.3| unnamed protein product [Vitis vinifera]
Length=281

 Score = 66.6 bits (161),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 42/57 (74%), Gaps = 0/57 (0%)
 Frame = -3

Query  173  TAITMASSLPIMKSILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            +++TM   +  + ++ ++AL +S A A+DPRP+QD CVA+ + + AVFVNGK CKNP
Sbjct  58   SSLTMKKGVSFLVTVALMALASSLASAFDPRPLQDTCVAIDEPENAVFVNGKFCKNP  114



>ref|XP_002313687.2| hypothetical protein POPTR_0009s14250g [Populus trichocarpa]
 gb|EEE87642.2| hypothetical protein POPTR_0009s14250g [Populus trichocarpa]
Length=225

 Score = 65.9 bits (159),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -3

Query  125  ILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            +LAL +SFA AYDP P+QDFCV + DA +AV VNGK+CKNP
Sbjct  12   LLALASSFATAYDPSPLQDFCVGINDADSAVVVNGKLCKNP  52



>ref|XP_002313686.1| germin-like protein 1 [Populus trichocarpa]
 gb|EEE87641.1| germin-like protein 1 [Populus trichocarpa]
Length=225

 Score = 65.9 bits (159),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -3

Query  125  ILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            +LAL +SFA AYDP P+QDFCV + DA +AV VNGK+CKNP
Sbjct  12   LLALASSFATAYDPSPLQDFCVGINDADSAVVVNGKLCKNP  52



>emb|CDP10933.1| unnamed protein product [Coffea canephora]
Length=224

 Score = 65.9 bits (159),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/40 (75%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = -3

Query  122  LALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            LAL  SF+ AYD  P+QDFCVAVPDA  AVFVNGK+CKNP
Sbjct  14   LALSPSFSYAYDDAPLQDFCVAVPDASAAVFVNGKICKNP  53



>gb|EYU40208.1| hypothetical protein MIMGU_mgv1a020439mg [Erythranthe guttata]
Length=230

 Score = 65.9 bits (159),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 39/53 (74%), Gaps = 0/53 (0%)
 Frame = -3

Query  161  MASSLPIMKSILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            M   L  + ++ ++A +ASFA A DP P+QDFCVAV DA  AVFVNGK+CK+P
Sbjct  1    MKMGLVSLTTLFVIACLASFAYASDPSPLQDFCVAVKDADAAVFVNGKICKDP  53



>emb|CDY11695.1| BnaC06g13030D [Brassica napus]
Length=219

 Score = 65.9 bits (159),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = -3

Query  131  ILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            I +LA+V SFA+AYDP P+QDFCVA+ D +  VFVNGK CK+P
Sbjct  7    ITVLAVVISFAKAYDPSPLQDFCVAIDDPKNGVFVNGKFCKDP  49



>ref|XP_011045439.1| PREDICTED: germin-like protein subfamily 1 member 13 [Populus 
euphratica]
Length=225

 Score = 65.9 bits (159),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -3

Query  125  ILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            +LAL +SFA AYDP P+QDFCV + DA +AV VNGK+CKNP
Sbjct  12   LLALASSFATAYDPSPLQDFCVGINDADSAVVVNGKLCKNP  52



>ref|XP_009125150.1| PREDICTED: germin-like protein subfamily 1 member 13 [Brassica 
rapa]
Length=219

 Score = 65.9 bits (159),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = -3

Query  131  ILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            I +LA+V SFA+AYDP P+QDFCVA+ D +  VFVNGK CK+P
Sbjct  7    ITVLAVVISFAKAYDPSPLQDFCVAIDDPKNGVFVNGKFCKDP  49



>emb|CDY69099.1| BnaA07g37570D [Brassica napus]
Length=219

 Score = 65.9 bits (159),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = -3

Query  131  ILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            I +LA+V SFA+AYDP P+QDFCVA+ D +  VFVNGK CK+P
Sbjct  7    ITVLAVVISFAKAYDPSPLQDFCVAIDDPKNGVFVNGKFCKDP  49



>ref|XP_009786129.1| PREDICTED: putative germin-like protein 2-1 [Nicotiana sylvestris]
Length=228

 Score = 65.5 bits (158),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/53 (58%), Positives = 41/53 (77%), Gaps = 1/53 (2%)
 Frame = -3

Query  161  MASSLPIMKSILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            MA  L ++ ++ ILA+V S + AYDP P+QDFCVAV D+  AVFVNGK+CK+P
Sbjct  1    MARKLFVL-TVAILAVVFSISHAYDPSPLQDFCVAVNDSMAAVFVNGKICKDP  52



>emb|CDP16508.1| unnamed protein product [Coffea canephora]
Length=107

 Score = 64.3 bits (155),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/45 (71%), Positives = 36/45 (80%), Gaps = 2/45 (4%)
 Frame = -3

Query  137  KSILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            KS  +LAL +SF+ AYD   +QDFCVAVPDA  AVFVNGKVCKNP
Sbjct  47   KSCYVLALTSSFSSAYDY--LQDFCVAVPDATVAVFVNGKVCKNP  89



>ref|XP_006282503.1| hypothetical protein CARUB_v10006909mg [Capsella rubella]
 gb|EOA15401.1| hypothetical protein CARUB_v10006909mg [Capsella rubella]
Length=221

 Score = 65.1 bits (157),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 39/50 (78%), Gaps = 3/50 (6%)
 Frame = -3

Query  143  IMKSILIL---ALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            + KS++++   ALV SFA+AYDP P+QDFCVA+ D +  VFVNGK CK+P
Sbjct  2    VSKSLILMTLSALVISFAKAYDPSPLQDFCVAIDDPKNGVFVNGKFCKDP  51



>gb|EYU20539.1| hypothetical protein MIMGU_mgv1a013072mg [Erythranthe guttata]
Length=231

 Score = 65.1 bits (157),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 29/46 (63%), Positives = 37/46 (80%), Gaps = 0/46 (0%)
 Frame = -3

Query  140  MKSILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            + +IL++A  A+   A DP P+QDFCVAV DA++AVFVNGKVCKNP
Sbjct  9    LTTILVVASFATLGFASDPSPLQDFCVAVNDAKSAVFVNGKVCKNP  54



>ref|XP_009786133.1| PREDICTED: germin-like protein subfamily 1 member 14 [Nicotiana 
sylvestris]
Length=139

 Score = 63.9 bits (154),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 28/44 (64%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = -3

Query  134  SILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            +I ILA+V+S + A DP P+QDFCVAV D+  AVFVNGK+CK+P
Sbjct  9    TIAILAIVSSISHASDPSPLQDFCVAVNDSMAAVFVNGKICKDP  52



>emb|CDP10932.1| unnamed protein product [Coffea canephora]
Length=224

 Score = 64.7 bits (156),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 39/53 (74%), Gaps = 0/53 (0%)
 Frame = -3

Query  161  MASSLPIMKSILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            MA++  I+   + LAL +SF+ A+D  P+QDFCVAV D   AVFVNGK+CKNP
Sbjct  1    MAAAGFIVTLAICLALSSSFSHAFDDNPLQDFCVAVSDTSAAVFVNGKICKNP  53



>gb|EYU20546.1| hypothetical protein MIMGU_mgv1a013111mg [Erythranthe guttata]
Length=230

 Score = 64.7 bits (156),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 29/53 (55%), Positives = 38/53 (72%), Gaps = 0/53 (0%)
 Frame = -3

Query  161  MASSLPIMKSILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            M  +L  + +I ++A  A+FA A DP P+QDFCVAV D +  VFVNGK+CKNP
Sbjct  1    MKMALVSIATIFVVAFFATFAYASDPSPLQDFCVAVNDTEAFVFVNGKICKNP  53



>emb|CDP10695.1| unnamed protein product [Coffea canephora]
Length=223

 Score = 64.3 bits (155),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 28/48 (58%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = -3

Query  146  PIMKSILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            P + +I  +AL +S A A DP P+QDFCVA+ D +TAVFVNGK+CK+P
Sbjct  4    PFLITIATMALFSSLATASDPSPLQDFCVAINDPKTAVFVNGKICKDP  51



>ref|XP_010435818.1| PREDICTED: germin-like protein subfamily 1 member 13 [Camelina 
sativa]
Length=222

 Score = 64.3 bits (155),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = -3

Query  131  ILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            I + ALV SFA+AYDP P+QDFCVA+ D +  VFVNGK CK+P
Sbjct  10   ITLSALVISFAKAYDPSPLQDFCVAIDDPKNGVFVNGKFCKDP  52



>sp|P92997.2|GL113_ARATH RecName: Full=Germin-like protein subfamily 1 member 13; Flags: 
Precursor [Arabidopsis thaliana]
Length=222

 Score = 64.3 bits (155),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 38/50 (76%), Gaps = 3/50 (6%)
 Frame = -3

Query  143  IMKSILIL---ALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            + KS++++   ALV SFA AYDP P+QDFCVA+ D +  VFVNGK CK+P
Sbjct  3    VSKSLILITLSALVISFAEAYDPSPLQDFCVAIDDLKNGVFVNGKFCKDP  52



>emb|CDP10701.1| unnamed protein product [Coffea canephora]
Length=230

 Score = 64.3 bits (155),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 28/48 (58%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = -3

Query  146  PIMKSILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            P + +I  +AL +S A A DP P+QDFCVA+ D +TAVFVNGK+CK+P
Sbjct  4    PFLITIATMALFSSLATASDPSPLQDFCVAINDPKTAVFVNGKICKDP  51



>ref|NP_001237300.1| uncharacterized protein LOC100527781 precursor [Glycine max]
 gb|ACG69488.1| germin-like protein 12 [Glycine max]
 gb|ACU16953.1| unknown [Glycine max]
 gb|KHN04964.1| Germin-like protein subfamily 1 member 7 [Glycine soja]
Length=222

 Score = 64.3 bits (155),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = -3

Query  131  ILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            +++LAL +S A AYDP P+QDFCVA+ D +T VFVNGK CK+P
Sbjct  8    VVLLALASSIAFAYDPSPLQDFCVAINDTKTGVFVNGKFCKDP  50



>ref|XP_010450837.1| PREDICTED: germin-like protein subfamily 1 member 13 [Camelina 
sativa]
Length=222

 Score = 64.3 bits (155),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = -3

Query  131  ILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            I + ALV SFA+AYDP P+QDFCVA+ D +  VFVNGK CK+P
Sbjct  10   ITLSALVISFAKAYDPSPLQDFCVAIDDPKNGVFVNGKFCKDP  52



>gb|AAB51572.1| germin-like protein [Arabidopsis thaliana]
Length=222

 Score = 64.3 bits (155),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 38/50 (76%), Gaps = 3/50 (6%)
 Frame = -3

Query  143  IMKSILIL---ALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            + KS++++   ALV SFA AYDP P+QDFCVA+ D +  VFVNGK CK+P
Sbjct  3    VSKSLILITLSALVISFAEAYDPSPLQDFCVAIDDLKNGVFVNGKFCKDP  52



>gb|EYU20542.1| hypothetical protein MIMGU_mgv1a020630mg [Erythranthe guttata]
Length=231

 Score = 64.3 bits (155),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 29/46 (63%), Positives = 36/46 (78%), Gaps = 0/46 (0%)
 Frame = -3

Query  140  MKSILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            + +I +++  A+FA A DP P+QDFCVAV DA  AVFVNGKVCKNP
Sbjct  9    VTTIFVISCWATFAYASDPSPLQDFCVAVKDADAAVFVNGKVCKNP  54



>ref|XP_010024920.1| PREDICTED: germin-like protein subfamily 1 member 13 [Eucalyptus 
grandis]
 gb|KCW61459.1| hypothetical protein EUGRSUZ_H04195 [Eucalyptus grandis]
Length=223

 Score = 64.3 bits (155),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 32/49 (65%), Positives = 40/49 (82%), Gaps = 2/49 (4%)
 Frame = -3

Query  149  LPIMKSILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            LPI  S+LILALVA+ A AYDP P+QD CVA+ D ++AVFVNG+ CK+P
Sbjct  4    LPI--SLLILALVAATAFAYDPSPLQDICVAINDPKSAVFVNGEFCKDP  50



>gb|EYU40210.1| hypothetical protein MIMGU_mgv1a022317mg [Erythranthe guttata]
Length=230

 Score = 64.3 bits (155),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 29/53 (55%), Positives = 39/53 (74%), Gaps = 0/53 (0%)
 Frame = -3

Query  161  MASSLPIMKSILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            M   L  + ++ ++A +ASFA A DP P+QDFCVAV +A  AVFVNGK+CK+P
Sbjct  1    MKMGLVSLTTLFVIACLASFAYASDPSPLQDFCVAVKEADAAVFVNGKICKDP  53



>emb|CDP10694.1| unnamed protein product [Coffea canephora]
Length=224

 Score = 63.9 bits (154),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 28/48 (58%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = -3

Query  146  PIMKSILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            P + +I  +AL++S A A DP P+QDFCVA+ D +TAVFVNGK+CK+P
Sbjct  4    PFLITIATMALLSSLAIASDPSPLQDFCVAINDPKTAVFVNGKICKDP  51



>ref|XP_007143989.1| hypothetical protein PHAVU_007G119700g [Phaseolus vulgaris]
 gb|ESW15983.1| hypothetical protein PHAVU_007G119700g [Phaseolus vulgaris]
Length=224

 Score = 63.9 bits (154),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = -3

Query  131  ILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            +++LAL +S A AYDP P+QDFCVA+ D +T VFVNGK CK+P
Sbjct  8    VVLLALASSVAFAYDPSPLQDFCVAINDTKTGVFVNGKFCKDP  50



>emb|CBI36778.3| unnamed protein product [Vitis vinifera]
Length=1271

 Score = 67.0 bits (162),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 28/59 (47%), Positives = 40/59 (68%), Gaps = 0/59 (0%)
 Frame = -3

Query  179   NITAITMASSLPIMKSILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
             N + +TM  S+  + ++  +AL +  A AYDP P++D CVAV + + AVFVNGK CKNP
Sbjct  1046  NHSTLTMKKSVSFLVTVAFMALASFLASAYDPSPLEDTCVAVDEPKNAVFVNGKFCKNP  1104



>ref|XP_010435820.1| PREDICTED: germin-like protein subfamily 1 member 13 [Camelina 
sativa]
Length=224

 Score = 63.9 bits (154),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 28/44 (64%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = -3

Query  134  SILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            SI+ LALV  F+ AYDP P+QDFCVAV +    VFVNGK+CK+P
Sbjct  9    SIITLALVIPFSNAYDPSPLQDFCVAVGNLNNGVFVNGKLCKDP  52



>gb|EYU40211.1| hypothetical protein MIMGU_mgv1a013108mg [Erythranthe guttata]
Length=230

 Score = 63.9 bits (154),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 29/53 (55%), Positives = 38/53 (72%), Gaps = 0/53 (0%)
 Frame = -3

Query  161  MASSLPIMKSILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            M  +L  + +I ++A  A+FA A DP P+QDFCVAV D +  VFVNGK+CKNP
Sbjct  1    MKMTLVSLATIFVVASFATFAYASDPSPLQDFCVAVNDTEAFVFVNGKICKNP  53



>gb|KDP23769.1| hypothetical protein JCGZ_23602 [Jatropha curcas]
Length=223

 Score = 63.9 bits (154),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 28/44 (64%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = -3

Query  134  SILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            S  +LAL  SFA AYDP P+QDFCVAV + + A+FVNGK CK+P
Sbjct  9    SFTVLALAFSFASAYDPSPLQDFCVAVEEPKNAIFVNGKFCKDP  52



>ref|XP_002531992.1| Rhicadhesin receptor precursor, putative [Ricinus communis]
 gb|EEF30391.1| Rhicadhesin receptor precursor, putative [Ricinus communis]
Length=223

 Score = 63.9 bits (154),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 28/46 (61%), Positives = 37/46 (80%), Gaps = 0/46 (0%)
 Frame = -3

Query  140  MKSILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            + + +ILAL +SFA A+DP P+QDFCVA  D + AVFVNGK+CK+P
Sbjct  7    LAAFVILALSSSFALAFDPSPLQDFCVATDDPKDAVFVNGKLCKDP  52



>ref|XP_009786127.1| PREDICTED: putative germin-like protein 2-1 [Nicotiana sylvestris]
Length=229

 Score = 63.9 bits (154),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 28/44 (64%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = -3

Query  134  SILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            +I ILA+V+S + A DP P+QDFCVAV D+  AVFVNGK+CK+P
Sbjct  9    TIAILAIVSSISHASDPSPLQDFCVAVNDSMAAVFVNGKICKDP  52



>gb|EYU28622.1| hypothetical protein MIMGU_mgv1a018753mg [Erythranthe guttata]
Length=230

 Score = 63.9 bits (154),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 29/53 (55%), Positives = 36/53 (68%), Gaps = 0/53 (0%)
 Frame = -3

Query  161  MASSLPIMKSILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            M  +L  +  + +LA  A+   A DP P+QDFCVAV DA  AVFVNGK+CKNP
Sbjct  1    MKMTLVSLTVVFVLAYFATLGYASDPSPLQDFCVAVKDADAAVFVNGKICKNP  53



>ref|XP_009625530.1| PREDICTED: putative germin-like protein 2-1 [Nicotiana tomentosiformis]
Length=228

 Score = 63.9 bits (154),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 28/44 (64%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = -3

Query  134  SILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            +I ILA+V+S + A DP P+QDFCVAV D+  AVFVNGK+CK+P
Sbjct  9    TIAILAVVSSISHASDPSPLQDFCVAVNDSMAAVFVNGKICKDP  52



>ref|XP_006349267.1| PREDICTED: germin-like protein subfamily 1 member 13-like [Solanum 
tuberosum]
Length=228

 Score = 63.5 bits (153),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = -3

Query  131  ILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            I ILA+V S + A DP P+QDFCVAV D+ T VFVNGKVCK+P
Sbjct  10   IAILAVVTSISHASDPSPLQDFCVAVNDSMTTVFVNGKVCKDP  52



>gb|AFW90592.1| germin-like protein subfamily 1 member 20 precursor [Solanum 
tuberosum]
Length=228

 Score = 63.5 bits (153),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = -3

Query  131  ILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            I ILA+V S + A DP P+QDFCVAV D+ T VFVNGKVCK+P
Sbjct  10   IAILAVVTSISHASDPSPLQDFCVAVNDSMTTVFVNGKVCKDP  52



>ref|XP_006346966.1| PREDICTED: putative germin-like protein 2-1-like [Solanum tuberosum]
Length=228

 Score = 63.5 bits (153),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = -3

Query  131  ILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            I ILA+V S + A DP P+QDFCVA+ D+ T VFVNGKVCK+P
Sbjct  10   IAILAVVTSISHASDPSPLQDFCVAINDSMTTVFVNGKVCKDP  52



>gb|KDP23759.1| hypothetical protein JCGZ_23592 [Jatropha curcas]
Length=182

 Score = 63.5 bits (153),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = -3

Query  125  ILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            +LAL  S+A AYDP P+QDFCVA+ + + AVFVNGK CKNP
Sbjct  18   VLALALSYASAYDPSPLQDFCVAIDEPKNAVFVNGKFCKNP  58



>gb|KDP23767.1| hypothetical protein JCGZ_23600 [Jatropha curcas]
Length=176

 Score = 63.2 bits (152),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = -3

Query  125  ILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            +LAL  S+A AYDP P+QDFCVA+ + + AVFVNGK CKNP
Sbjct  12   VLALALSYASAYDPSPLQDFCVAIDEPKNAVFVNGKFCKNP  52



>ref|XP_006286150.1| hypothetical protein CARUB_v10007709mg [Capsella rubella]
 gb|EOA19048.1| hypothetical protein CARUB_v10007709mg [Capsella rubella]
Length=226

 Score = 63.5 bits (153),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 28/47 (60%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = -3

Query  143  IMKSILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            ++ SI+ LALV  F+ AYDP P+QDFCVAV + +  VFVNGK CK+P
Sbjct  8    LIISIITLALVIPFSNAYDPSPLQDFCVAVGNLKNGVFVNGKFCKDP  54



>gb|EYU20536.1| hypothetical protein MIMGU_mgv1a025658mg [Erythranthe guttata]
Length=231

 Score = 63.5 bits (153),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 28/46 (61%), Positives = 37/46 (80%), Gaps = 0/46 (0%)
 Frame = -3

Query  140  MKSILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            + +IL++A  A+   A DP P+QDFCVAV DA++AVFVNGKVCK+P
Sbjct  9    LTTILVVASFATLGFASDPSPLQDFCVAVNDAKSAVFVNGKVCKDP  54



>gb|EPS67173.1| hypothetical protein M569_07603 [Genlisea aurea]
Length=220

 Score = 63.2 bits (152),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 38/53 (72%), Gaps = 0/53 (0%)
 Frame = -3

Query  161  MASSLPIMKSILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            MASS P +  ++ +AL+ +F  A DP  +QDFCVAVPD+   VFVNGK CKNP
Sbjct  1    MASSSPALCFLISIALLLAFTSASDPTQLQDFCVAVPDSANPVFVNGKFCKNP  53



>emb|CDP16787.1| unnamed protein product [Coffea canephora]
Length=230

 Score = 63.5 bits (153),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = -3

Query  125  ILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            ILALV +   A DP P+QDFCVAVPDA   VFVNGK+CK+P
Sbjct  11   ILALVFTIVHASDPSPLQDFCVAVPDANAGVFVNGKICKDP  51



>gb|AFK48994.1| unknown [Lotus japonicus]
Length=223

 Score = 63.2 bits (152),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 27/43 (63%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = -3

Query  131  ILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            + ILAL +SFA AYDP P+QDFCV + D +  VFVNGK CK+P
Sbjct  8    VTILALASSFASAYDPSPLQDFCVGINDPKDGVFVNGKFCKDP  50



>ref|XP_006349264.1| PREDICTED: germin-like protein subfamily 1 member 13-like [Solanum 
tuberosum]
Length=228

 Score = 63.2 bits (152),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = -3

Query  131  ILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            I I+A+++S + A DP P+QDFCVAV D+++AVFVNGK CKNP
Sbjct  10   IAIMAVLSSMSHASDPSPLQDFCVAVDDSKSAVFVNGKFCKNP  52



>ref|XP_009612542.1| PREDICTED: putative germin-like protein 2-1 [Nicotiana tomentosiformis]
Length=228

 Score = 63.2 bits (152),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 28/44 (64%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = -3

Query  134  SILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            +I ILA+V+S + A DP P+QDFCVAV D+  AVFVNGK+CK+P
Sbjct  9    TIAILAVVSSISHASDPSPLQDFCVAVNDSMAAVFVNGKICKDP  52



>ref|XP_006349268.1| PREDICTED: germin-like protein subfamily 1 member 13-like [Solanum 
tuberosum]
Length=228

 Score = 63.2 bits (152),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = -3

Query  131  ILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            I I+A+++S + A DP P+QDFCVAV D+++AVFVNGK CKNP
Sbjct  10   IAIMAVLSSMSHASDPSPLQDFCVAVDDSKSAVFVNGKFCKNP  52



>emb|CDP22064.1| unnamed protein product [Coffea canephora]
Length=230

 Score = 63.2 bits (152),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = -3

Query  125  ILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            ILALV +   A DP P+QDFCVAVPDA   VFVNGK+CK+P
Sbjct  11   ILALVFTIVHASDPSPLQDFCVAVPDANAGVFVNGKICKDP  51



>gb|EYU20548.1| hypothetical protein MIMGU_mgv1a013109mg [Erythranthe guttata]
Length=230

 Score = 63.2 bits (152),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/44 (66%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = -3

Query  134  SILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            +I I++ +A+ A A DP P+QDFCVAV DA  AVFVNGKVCKNP
Sbjct  10   TIFIVSCLATLAYASDPSPLQDFCVAVKDADAAVFVNGKVCKNP  53



>gb|EYU20549.1| hypothetical protein MIMGU_mgv1a020596mg [Erythranthe guttata]
Length=231

 Score = 63.2 bits (152),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/46 (63%), Positives = 36/46 (78%), Gaps = 0/46 (0%)
 Frame = -3

Query  140  MKSILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            + +I I++ +A+ A A DP P+QDFCVAV DA  AVFVNGKVCKNP
Sbjct  9    VTTIFIVSCLATLAYASDPSPLQDFCVAVKDADAAVFVNGKVCKNP  54



>ref|XP_009795501.1| PREDICTED: putative germin-like protein 2-1 [Nicotiana sylvestris]
Length=228

 Score = 63.2 bits (152),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 28/44 (64%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = -3

Query  134  SILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            +I ILA+V+S + A DP P+QDFCVAV D+  AVFVNGK+CK+P
Sbjct  9    TIAILAVVSSISHASDPSPLQDFCVAVNDSMAAVFVNGKICKDP  52



>ref|XP_007140906.1| hypothetical protein PHAVU_008G151100g [Phaseolus vulgaris]
 gb|ESW12900.1| hypothetical protein PHAVU_008G151100g [Phaseolus vulgaris]
Length=84

 Score = 61.6 bits (148),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = -3

Query  131  ILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            + ILAL +S A AYDP P+QDF VA+ D + AVFVNGK+CK+P
Sbjct  8    VAILALTSSIASAYDPSPLQDFLVALNDTKNAVFVNGKLCKDP  50



>ref|XP_006358463.1| PREDICTED: germin-like protein subfamily 1 member 20-like [Solanum 
tuberosum]
Length=228

 Score = 63.2 bits (152),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 28/44 (64%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = -3

Query  134  SILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            +I ILA+V S + A DP P+QDFCVAV D+++AVFVNGK CK+P
Sbjct  9    TIAILAVVTSISHASDPSPLQDFCVAVEDSKSAVFVNGKFCKDP  52



>ref|XP_006349261.1| PREDICTED: putative germin-like protein 2-1-like [Solanum tuberosum]
 ref|XP_006349262.1| PREDICTED: putative germin-like protein 2-1-like [Solanum tuberosum]
Length=228

 Score = 63.2 bits (152),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = -3

Query  131  ILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            I ILA+V S + A DP P+QDFCVAV D+  AVFVNGK CKNP
Sbjct  10   IAILAVVTSISHASDPSPLQDFCVAVNDSMNAVFVNGKFCKNP  52



>ref|XP_004230403.1| PREDICTED: putative germin-like protein 2-1 [Solanum lycopersicum]
Length=228

 Score = 63.2 bits (152),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = -3

Query  131  ILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            I ILA+V S + A DP P+QDFCVAV D+  AVFVNGK CKNP
Sbjct  10   IAILAVVTSISHASDPSPLQDFCVAVNDSMNAVFVNGKFCKNP  52



>gb|EYU40209.1| hypothetical protein MIMGU_mgv1a013129mg [Erythranthe guttata]
Length=230

 Score = 63.2 bits (152),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/53 (55%), Positives = 38/53 (72%), Gaps = 0/53 (0%)
 Frame = -3

Query  161  MASSLPIMKSILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            M  +L  + +I ++A  A+FA A DP P+QDFCVAV D +  VFVNGK+CKNP
Sbjct  1    MKMALVSLATIFVVASFATFAYASDPSPLQDFCVAVNDTKAFVFVNGKICKNP  53



>ref|XP_006349263.1| PREDICTED: germin-like protein subfamily 1 member 13-like [Solanum 
tuberosum]
Length=228

 Score = 63.2 bits (152),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = -3

Query  131  ILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            I IL++V S + A DP P+QDFCVAV D+ T VFVNGKVCK+P
Sbjct  10   IAILSVVTSISHASDPSPLQDFCVAVNDSMTTVFVNGKVCKDP  52



>gb|EYU38444.1| hypothetical protein MIMGU_mgv1a013102mg [Erythranthe guttata]
Length=230

 Score = 63.2 bits (152),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/53 (55%), Positives = 36/53 (68%), Gaps = 0/53 (0%)
 Frame = -3

Query  161  MASSLPIMKSILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            M  +L  +  + +LA  A+   A DP P+QDFCVAV DA  AVFVNGK+CKNP
Sbjct  1    MKMTLVSLTVVFVLASFATLGYASDPSPLQDFCVAVKDADAAVFVNGKICKNP  53



>ref|XP_004230404.1| PREDICTED: putative germin-like protein 2-1 [Solanum lycopersicum]
Length=228

 Score = 62.8 bits (151),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = -3

Query  131  ILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            I ILA+V S + A DP P+QDFCVAV D+ T VFVNGKVCK+P
Sbjct  10   IAILAVVTSISHASDPSPLQDFCVAVNDSMTPVFVNGKVCKDP  52



>emb|CDP16786.1| unnamed protein product [Coffea canephora]
Length=690

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 39/55 (71%), Gaps = 2/55 (4%)
 Frame = -3

Query  167  ITMASSLPIMKSILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            ITMA  + I  +IL  ALV +   A DP P+QDFCVAVPDA   VFVNGK+CK+P
Sbjct  230  ITMAVRIHIAAAIL--ALVFTVVHASDPSPLQDFCVAVPDANAGVFVNGKICKDP  282


 Score = 65.5 bits (158),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 39/55 (71%), Gaps = 2/55 (4%)
 Frame = -3

Query  167  ITMASSLPIMKSILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            ITMA  + I  +IL  ALV +   A DP P+QDFCVAVPDA   VFVNGK+CK+P
Sbjct  460  ITMAVRIHIAAAIL--ALVFTVVHASDPSPLQDFCVAVPDANAGVFVNGKICKDP  512


 Score = 63.2 bits (152),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = -3

Query  125  ILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            ILALV +   A DP P+QDFCVAVPDA   VFVNGK+CK+P
Sbjct  11   ILALVFTIVYASDPSPLQDFCVAVPDANAGVFVNGKICKDP  51



>ref|XP_010441036.1| PREDICTED: germin-like protein subfamily 1 member 13 [Camelina 
sativa]
Length=222

 Score = 62.8 bits (151),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = -3

Query  131  ILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            I + ALV SF +AYDP P+QDFCVA+ D +  VFVNGK CK+P
Sbjct  10   ITLSALVISFVKAYDPSPLQDFCVAIDDPKNGVFVNGKFCKDP  52



>ref|XP_006358462.1| PREDICTED: germin-like protein subfamily 1 member 14-like [Solanum 
tuberosum]
Length=230

 Score = 62.8 bits (151),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/44 (66%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = -3

Query  134  SILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            +I ILAL +S + A DP P+QDFCVAV D++T VFVNGKVCK+P
Sbjct  11   TIAILALASSPSTASDPSPLQDFCVAVNDSKTTVFVNGKVCKDP  54



>emb|CDP16788.1| unnamed protein product [Coffea canephora]
Length=229

 Score = 62.8 bits (151),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = -3

Query  125  ILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            ILALV +   A DP P+QDFCVAVPDA   VFVNGK+CK+P
Sbjct  11   ILALVFTVVHASDPSPLQDFCVAVPDANAGVFVNGKICKDP  51



>ref|XP_006354544.1| PREDICTED: germin-like protein subfamily 1 member 15-like [Solanum 
tuberosum]
Length=224

 Score = 62.8 bits (151),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 24/43 (56%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = -3

Query  131  ILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            ++   L++SF  ++DP P QDFCVA  D+ TAVFVNGK+CK+P
Sbjct  10   VVTFGLLSSFGSSFDPNPFQDFCVAATDSNTAVFVNGKICKDP  52



>ref|XP_009139822.1| PREDICTED: germin-like protein subfamily 1 member 13 [Brassica 
rapa]
 emb|CDX74487.1| BnaA04g09020D [Brassica napus]
Length=222

 Score = 62.4 bits (150),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = -3

Query  134  SILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            +I+ LALV  F  AYDP P+QDFCVAV +    VFVNGK CK+P
Sbjct  9    TIMTLALVMPFGNAYDPSPLQDFCVAVNNLNNGVFVNGKFCKDP  52



>gb|KDP23763.1| hypothetical protein JCGZ_23596 [Jatropha curcas]
Length=176

 Score = 62.0 bits (149),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = -3

Query  125  ILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            +LAL  S+A AYDP P+QDFCVA+ + + A+FVNGK CKNP
Sbjct  12   VLALALSYASAYDPSPLQDFCVAIDEPKNAMFVNGKFCKNP  52



>gb|KDP46445.1| hypothetical protein JCGZ_10285 [Jatropha curcas]
Length=227

 Score = 62.4 bits (150),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -3

Query  143  IMKSILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            ++ ++ +LA+ +SFA AYDP P+QDFCVA  D+ + VFVNGK CK+P
Sbjct  4    LLIALGVLAMASSFAIAYDPSPLQDFCVATDDSASGVFVNGKFCKDP  50



>ref|XP_010528770.1| PREDICTED: germin-like protein subfamily 1 member 18 [Tarenaya 
hassleriana]
Length=252

 Score = 62.8 bits (151),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = -3

Query  131  ILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            + ILA  +SFA AYDP P+QDFCVA+ D ++ VFVNG+ CK+P
Sbjct  40   VAILATASSFASAYDPSPLQDFCVAINDLKSGVFVNGRFCKDP  82



>ref|XP_011002009.1| PREDICTED: germin-like protein subfamily 1 member 13 [Populus 
euphratica]
Length=225

 Score = 62.4 bits (150),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = -3

Query  152  SLPIMKSILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            S+  + + ++L L +S A AYDP P+QDFCVA+ D + AVFVNGK CK+P
Sbjct  3    SVHFLLAFVLLTLASSIASAYDPSPLQDFCVAINDPKAAVFVNGKFCKDP  52



>emb|CDY37880.1| BnaC04g31260D [Brassica napus]
Length=222

 Score = 62.4 bits (150),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 32/44 (73%), Gaps = 0/44 (0%)
 Frame = -3

Query  134  SILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            +I+ LALV  F  AYDP P+QDFCVAV +    VFVNGK CK+P
Sbjct  9    TIITLALVMPFGNAYDPSPLQDFCVAVNNLNNGVFVNGKFCKDP  52



>ref|XP_009784933.1| PREDICTED: germin-like protein subfamily 1 member 20 [Nicotiana 
sylvestris]
Length=228

 Score = 62.4 bits (150),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 26/44 (59%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = -3

Query  134  SILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            +I I+AL++S + A+DP P+QD CVAV D+  AVFVNGK+CK+P
Sbjct  9    TIAIMALLSSMSHAFDPSPLQDICVAVDDSMAAVFVNGKICKDP  52



>ref|XP_009612543.1| PREDICTED: germin-like protein subfamily 1 member 20 [Nicotiana 
tomentosiformis]
Length=228

 Score = 62.4 bits (150),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 26/44 (59%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = -3

Query  134  SILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            +I I+AL++S + A+DP P+QD CVAV D+  AVFVNGK+CK+P
Sbjct  9    TIAIMALLSSMSHAFDPSPLQDICVAVDDSMAAVFVNGKICKDP  52



>ref|XP_009795503.1| PREDICTED: germin-like protein subfamily 1 member 20 isoform 
X1 [Nicotiana sylvestris]
 ref|XP_009795504.1| PREDICTED: germin-like protein subfamily 1 member 20 isoform 
X2 [Nicotiana sylvestris]
Length=228

 Score = 62.4 bits (150),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 26/44 (59%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = -3

Query  134  SILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            +I I+AL++S + A+DP P+QD CVAV D+  AVFVNGK+CK+P
Sbjct  9    TIAIMALLSSMSHAFDPSPLQDICVAVDDSMAAVFVNGKICKDP  52



>ref|XP_009627660.1| PREDICTED: germin-like protein subfamily 1 member 20 [Nicotiana 
tomentosiformis]
Length=228

 Score = 62.4 bits (150),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 26/44 (59%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = -3

Query  134  SILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            +I I+AL++S + A+DP P+QD CVAV D+  AVFVNGK+CK+P
Sbjct  9    TIAIMALLSSMSHAFDPSPLQDICVAVDDSMAAVFVNGKICKDP  52



>ref|XP_003590904.1| Germin-like protein subfamily 1 member [Medicago truncatula]
 gb|AES61155.1| germin family protein [Medicago truncatula]
 gb|AFK44678.1| unknown [Medicago truncatula]
Length=222

 Score = 62.0 bits (149),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = -3

Query  131  ILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            + +LAL +S   AYDP P+QDFCVA+ D +T VFVNGK CK+P
Sbjct  8    VALLALASSVGFAYDPSPLQDFCVAINDTKTGVFVNGKFCKDP  50



>ref|XP_003604731.1| Germin-like protein subfamily 1 member [Medicago truncatula]
 gb|AES86928.1| germin family protein [Medicago truncatula]
Length=221

 Score = 62.0 bits (149),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = -3

Query  125  ILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            ILAL +S A AYDP P+QDFCVA+ D +  VFVNGK CK+P
Sbjct  10   ILALASSLAFAYDPSPLQDFCVAIKDPKDGVFVNGKFCKDP  50



>ref|XP_010463901.1| PREDICTED: germin-like protein subfamily 1 member 5 [Camelina 
sativa]
Length=230

 Score = 62.0 bits (149),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 29/53 (55%), Positives = 36/53 (68%), Gaps = 1/53 (2%)
 Frame = -3

Query  161  MASSLPIMKSILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            M   L I+  I++LAL +SF   YDP P+QD+CVAV D    VFVNGK CK+P
Sbjct  1    MEGRLRILAKIVLLALASSFVYCYDPSPLQDYCVAVDDIH-GVFVNGKFCKDP  52



>ref|XP_003604729.1| Germin-like protein subfamily 1 member [Medicago truncatula]
 ref|XP_003614210.1| Germin-like protein subfamily 1 member [Medicago truncatula]
 ref|XP_003614212.1| Germin-like protein subfamily 1 member [Medicago truncatula]
 gb|AES86926.1| germin family protein [Medicago truncatula]
 gb|AES97168.1| germin family protein [Medicago truncatula]
 gb|AES97170.1| germin family protein [Medicago truncatula]
Length=221

 Score = 62.0 bits (149),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = -3

Query  125  ILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            ILAL +S A AYDP P+QDFCVA+ D +  VFVNGK CK+P
Sbjct  10   ILALASSLAFAYDPSPLQDFCVAIKDPKDGVFVNGKFCKDP  50



>emb|CDP10698.1| unnamed protein product [Coffea canephora]
Length=223

 Score = 62.0 bits (149),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = -3

Query  146  PIMKSILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            P + ++  +AL++S A A DP P+QDFCVA+ D++ AVFVNGK+CK+P
Sbjct  4    PFLITLAAMALLSSLAIASDPSPLQDFCVAINDSKAAVFVNGKICKDP  51



>ref|XP_003593910.1| Germin-like protein subfamily 1 member [Medicago truncatula]
 gb|AES64161.1| germin family protein [Medicago truncatula]
 gb|AFK37724.1| unknown [Medicago truncatula]
Length=221

 Score = 61.6 bits (148),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = -3

Query  125  ILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            ILAL +S A AYDP P+QDFCVA+ D +  VFVNGK CK+P
Sbjct  10   ILALASSLAFAYDPSPLQDFCVAIKDPKDGVFVNGKFCKDP  50



>emb|CDY15957.1| BnaA04g11540D [Brassica napus]
Length=223

 Score = 61.6 bits (148),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 30/47 (64%), Positives = 35/47 (74%), Gaps = 1/47 (2%)
 Frame = -3

Query  143  IMKSILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            I+  I ILALV SFA AYDP P+QDFCVA+ D    VFVNG+ CK+P
Sbjct  8    ILIPIAILALVISFAEAYDPSPLQDFCVAIDDL-NGVFVNGRFCKDP  53



>ref|XP_009129904.1| PREDICTED: germin-like protein subfamily 1 member 16 [Brassica 
rapa]
 emb|CDY05545.1| BnaA02g31460D [Brassica napus]
Length=223

 Score = 61.6 bits (148),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 30/47 (64%), Positives = 35/47 (74%), Gaps = 1/47 (2%)
 Frame = -3

Query  143  IMKSILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            I+  I ILALV SFA AYDP P+QDFCVA+ D    VFVNG+ CK+P
Sbjct  8    ILIPIAILALVISFAEAYDPSPLQDFCVAIDDL-NGVFVNGRFCKDP  53



>ref|XP_004230405.1| PREDICTED: germin-like protein subfamily 1 member 14 [Solanum 
lycopersicum]
Length=228

 Score = 61.6 bits (148),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = -3

Query  134  SILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            +I I+A++ S + A DP P+QDFCVAV D++ AVFVNGK CKNP
Sbjct  9    TISIMAVLFSLSHASDPSPLQDFCVAVNDSKNAVFVNGKFCKNP  52



>emb|CDX99669.1| BnaC04g34260D [Brassica napus]
Length=223

 Score = 61.6 bits (148),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 30/47 (64%), Positives = 35/47 (74%), Gaps = 1/47 (2%)
 Frame = -3

Query  143  IMKSILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            I+  I ILALV SFA AYDP P+QDFCVA+ D    VFVNG+ CK+P
Sbjct  8    ILIPIAILALVISFAEAYDPSPLQDFCVAIDDL-NGVFVNGRFCKDP  53



>ref|XP_006443311.1| hypothetical protein CICLE_v10022142mg [Citrus clementina]
 ref|XP_006479019.1| PREDICTED: germin-like protein subfamily 1 member 17-like isoform 
X1 [Citrus sinensis]
 ref|XP_006479021.1| PREDICTED: germin-like protein subfamily 1 member 17-like isoform 
X1 [Citrus sinensis]
 gb|ESR56551.1| hypothetical protein CICLE_v10022142mg [Citrus clementina]
 gb|KDO42112.1| hypothetical protein CISIN_1g027622mg [Citrus sinensis]
Length=221

 Score = 61.6 bits (148),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 37/53 (70%), Gaps = 0/53 (0%)
 Frame = -3

Query  161  MASSLPIMKSILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            M +S+  +K   +L L +S A A+DP P+QD CVA+ + + AVFVNGK CK+P
Sbjct  1    MKTSVQFLKGFALLVLASSLASAFDPSPLQDICVAIDEPKNAVFVNGKFCKDP  53



>ref|XP_011099650.1| PREDICTED: germin-like protein subfamily 1 member 13 [Sesamum 
indicum]
Length=231

 Score = 61.6 bits (148),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 29/51 (57%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = -3

Query  155  SSLPIMKSILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            S+   + S+ IL + +S A AYDP P+QDFCVAV D++ AVFVNGK+CK+P
Sbjct  4    SAFHFVLSMAILVVGSSPADAYDPDPLQDFCVAVNDSKAAVFVNGKICKDP  54



>ref|XP_006358459.1| PREDICTED: germin-like protein subfamily 1 member 20-like [Solanum 
tuberosum]
Length=228

 Score = 61.6 bits (148),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 28/44 (64%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = -3

Query  134  SILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            +I ILA V S + A DP P+QDFCVAV D+++AVFVNGK CK+P
Sbjct  9    TIAILAAVTSISHASDPSPLQDFCVAVNDSKSAVFVNGKFCKDP  52



>ref|XP_003604730.1| Germin-like protein subfamily 1 member [Medicago truncatula]
 gb|AES86927.1| germin family protein [Medicago truncatula]
Length=221

 Score = 61.6 bits (148),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = -3

Query  125  ILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            ILAL +S A AYDP P+QDFCVA+ D +  VFVNGK CK+P
Sbjct  10   ILALASSIAFAYDPSPLQDFCVAIKDPKDGVFVNGKFCKDP  50



>ref|XP_002868741.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH45000.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=222

 Score = 61.6 bits (148),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = -3

Query  131  ILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            I I ALV SFA A DP P+QDFCVA+ D +  VFVNGK CK+P
Sbjct  10   ITISALVISFAEASDPSPLQDFCVAIGDLKNGVFVNGKFCKDP  52



>ref|XP_002868743.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH45002.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=222

 Score = 61.2 bits (147),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = -3

Query  131  ILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            I I ALV SFA A DP P+QDFCVA+ D +  VFVNGK CK+P
Sbjct  10   ITISALVISFAEASDPSPLQDFCVAIGDLKNGVFVNGKFCKDP  52



>gb|KCW61445.1| hypothetical protein EUGRSUZ_H04176 [Eucalyptus grandis]
Length=223

 Score = 61.2 bits (147),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 38/50 (76%), Gaps = 2/50 (4%)
 Frame = -3

Query  152  SLPIMKSILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            S P+  S+LILAL  + A AYDP P+QD CVA+ D ++AVFVNG+ CK+P
Sbjct  3    SFPV--SLLILALATTTAFAYDPSPLQDICVAINDPKSAVFVNGEFCKDP  50



>ref|XP_002868798.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH45057.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=222

 Score = 61.2 bits (147),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = -3

Query  131  ILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            I I ALV SFA A DP P+QDFCVA+ D +  VFVNGK CK+P
Sbjct  10   ITISALVISFAEANDPSPLQDFCVAIGDLKNGVFVNGKFCKDP  52



>ref|XP_006358464.1| PREDICTED: germin-like protein subfamily 1 member 14-like [Solanum 
tuberosum]
Length=230

 Score = 61.2 bits (147),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 29/44 (66%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = -3

Query  134  SILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            +I ILAL +S + A DP P+QDFCVAV D++T VFVNGKVCK P
Sbjct  11   TIAILALASSPSTASDPSPLQDFCVAVNDSKTTVFVNGKVCKYP  54



>emb|CDP16789.1| unnamed protein product [Coffea canephora]
Length=488

 Score = 63.5 bits (153),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 39/58 (67%), Gaps = 2/58 (3%)
 Frame = -3

Query  176  ITAITMASSLPIMKSILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            +  ITMA  + I  +IL   LV +   A DP P+QDFCVAVPDA   VFVNGK+CK+P
Sbjct  254  LNLITMAVRVHIAAAIL--TLVFAVVHASDPSPLQDFCVAVPDANAGVFVNGKICKDP  309


 Score = 63.2 bits (152),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = -3

Query  125  ILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            +LALV +   A DP P+QDFCVAVPDA   VFVNGK+CK+P
Sbjct  11   LLALVFTIVHASDPSPLQDFCVAVPDANAGVFVNGKICKDP  51



>gb|EYU20540.1| hypothetical protein MIMGU_mgv1a013117mg [Erythranthe guttata]
Length=230

 Score = 61.2 bits (147),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 28/53 (53%), Positives = 36/53 (68%), Gaps = 0/53 (0%)
 Frame = -3

Query  161  MASSLPIMKSILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            M  +L  + +I  +A  A+F  A DP P+QDFCVAV D +  VFVNGK+CKNP
Sbjct  1    MKMALVSLATIFAIASFATFGYASDPSPLQDFCVAVNDTEAFVFVNGKICKNP  53



>emb|CDP21353.1| unnamed protein product [Coffea canephora]
Length=459

 Score = 63.2 bits (152),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = -3

Query  125  ILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            ILALV +   A DP P+QDFCVAVPDA   VFVNGK+CK+P
Sbjct  240  ILALVFTIVHASDPSPLQDFCVAVPDANAGVFVNGKICKDP  280


 Score = 62.8 bits (151),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = -3

Query  125  ILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            ILALV +   A DP P+QDFCVAVPDA   VFVNGK+CK+P
Sbjct  11   ILALVFTVVHASDPSPLQDFCVAVPDANAGVFVNGKICKDP  51



>ref|XP_002284661.2| PREDICTED: uncharacterized protein LOC100240807 [Vitis vinifera]
Length=455

 Score = 63.2 bits (152),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 38/53 (72%), Gaps = 0/53 (0%)
 Frame = -3

Query  161  MASSLPIMKSILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            M   +  + ++ ++AL +S A A+DPRP+QD CVA+ + + AVFVNGK CKNP
Sbjct  1    MKKGVSFLVTVALMALASSLASAFDPRPLQDTCVAIDEPENAVFVNGKFCKNP  53


 Score = 52.0 bits (123),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 26/67 (39%), Positives = 38/67 (57%), Gaps = 11/67 (16%)
 Frame = -3

Query  170  AITMASSLPIMKSILILALVASFARAYDPRPMQDFCVAVPDAQT-----------AVFVN  24
             +T+   +  M ++ ++AL +  A AYDP P++D CVAV + +            AVFVN
Sbjct  222  TLTIKKGVSFMVTVALMALASFLASAYDPSPLEDTCVAVDEPKNAGYIFSFFLLHAVFVN  281

Query  23   GKVCKNP  3
            GK CKNP
Sbjct  282  GKFCKNP  288



>emb|CDP16790.1| unnamed protein product [Coffea canephora]
Length=232

 Score = 61.2 bits (147),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 38/55 (69%), Gaps = 2/55 (4%)
 Frame = -3

Query  167  ITMASSLPIMKSILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            +TMA    I  +IL  ALV +   A DP P+QDFCVAVPDA   VFVNGK+C++P
Sbjct  1    MTMAFRFHIAAAIL--ALVFTSVHASDPSPLQDFCVAVPDANAGVFVNGKICQDP  53



>gb|EYU20545.1| hypothetical protein MIMGU_mgv1a020779mg [Erythranthe guttata]
Length=231

 Score = 60.8 bits (146),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 27/46 (59%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = -3

Query  140  MKSILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            + +I +++ +A+ A A DP P+QDFCVAV D   AVFVNGKVCKNP
Sbjct  9    VTTIFVVSCLATLAYASDPSPLQDFCVAVKDEDAAVFVNGKVCKNP  54



>gb|EYU20547.1| hypothetical protein MIMGU_mgv1a023357mg [Erythranthe guttata]
Length=231

 Score = 60.8 bits (146),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 27/46 (59%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = -3

Query  140  MKSILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            + +I +++ +A+ A A DP P+QDFCVAV D   AVFVNGKVCKNP
Sbjct  9    VTTIFVVSCLATLAYASDPSPLQDFCVAVKDEDAAVFVNGKVCKNP  54



>ref|XP_002868742.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH45001.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=222

 Score = 60.8 bits (146),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = -3

Query  131  ILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            I I ALV SF  A DP P+QDFCVA+ D +  VFVNGK CK+P
Sbjct  10   ITISALVISFGEASDPSPLQDFCVAISDLKNGVFVNGKFCKDP  52



>gb|EYU40849.1| hypothetical protein MIMGU_mgv1a021360mg [Erythranthe guttata]
Length=230

 Score = 60.8 bits (146),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/48 (60%), Positives = 36/48 (75%), Gaps = 4/48 (8%)
 Frame = -3

Query  134  SILILALVASFAR----AYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            ++L L +VA FA     AYDP P+QDFCVAV D+  AVFVNGK+CK+P
Sbjct  5    NLLFLVVVAVFATLSADAYDPNPLQDFCVAVNDSSAAVFVNGKICKDP  52



>ref|XP_006405663.1| hypothetical protein EUTSA_v10027916mg [Eutrema salsugineum]
 gb|ESQ47116.1| hypothetical protein EUTSA_v10027916mg [Eutrema salsugineum]
Length=222

 Score = 60.5 bits (145),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/52 (54%), Positives = 36/52 (69%), Gaps = 3/52 (6%)
 Frame = -3

Query  149  LPIMKSILI---LALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            +  ++S+L+   LALV  F  AYDP P+QDFCVAV +    VFVNGK CK+P
Sbjct  1    MKFLQSLLVFITLALVIPFGNAYDPSPLQDFCVAVNNLNNGVFVNGKFCKDP  52



>gb|EYU20538.1| hypothetical protein MIMGU_mgv1a012929mg [Erythranthe guttata]
Length=235

 Score = 60.8 bits (146),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/49 (59%), Positives = 36/49 (73%), Gaps = 4/49 (8%)
 Frame = -3

Query  137  KSILILALVASF----ARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            +SIL L ++A F    A AYDP P+QDFCVAV D+  AV VNGK+CK+P
Sbjct  10   QSILFLVILAFFISLLANAYDPDPLQDFCVAVTDSDAAVLVNGKICKDP  58



>ref|XP_006349265.1| PREDICTED: germin-like protein subfamily 1 member 13-like [Solanum 
tuberosum]
Length=228

 Score = 60.5 bits (145),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -3

Query  143  IMKSILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            ++ +I I+A+++S + A DP P+QDFCVAV D + AVFVNGK CK+P
Sbjct  6    LILAIAIMAVLSSMSHASDPSPLQDFCVAVDDTKNAVFVNGKFCKDP  52



>gb|ABR92335.1| putative germin-like protein [Salvia miltiorrhiza]
Length=235

 Score = 60.8 bits (146),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 27/51 (53%), Positives = 35/51 (69%), Gaps = 0/51 (0%)
 Frame = -3

Query  155  SSLPIMKSILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            SS+  +    IL   +  A AYDP P+QDFC+AV D + AVFVNGK+CK+P
Sbjct  5    SSVEFLVFFTILVSSSLLAEAYDPNPLQDFCIAVNDTEAAVFVNGKICKDP  55



>ref|NP_198727.1| germin-like protein subfamily 1 member 14 [Arabidopsis thaliana]
 sp|Q9FID0.1|GL114_ARATH RecName: Full=Germin-like protein subfamily 1 member 14; Flags: 
Precursor [Arabidopsis thaliana]
 dbj|BAB10832.1| germin-like protein [Arabidopsis thaliana]
 gb|AED94395.1| germin-like protein subfamily 1 member 14 [Arabidopsis thaliana]
Length=222

 Score = 60.5 bits (145),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = -3

Query  131  ILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            I + ALV SFA A DP P+QDFCVA+ D +  VFVNGK CK+P
Sbjct  10   ITLSALVISFAEANDPSPLQDFCVAIGDLKNGVFVNGKFCKDP  52



>ref|XP_004142552.1| PREDICTED: germin-like protein subfamily 1 member 17-like [Cucumis 
sativus]
 ref|XP_004155680.1| PREDICTED: germin-like protein subfamily 1 member 17-like [Cucumis 
sativus]
 gb|KGN66715.1| Rhicadhesin receptor [Cucumis sativus]
Length=224

 Score = 60.5 bits (145),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 36/55 (65%), Gaps = 0/55 (0%)
 Frame = -3

Query  167  ITMASSLPIMKSILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            IT++   P    +L+L +    A A+DP P+QDFCVA  +  +AVFVNGK CKNP
Sbjct  2    ITISVGFPSAAFLLVLQVTVFVASAFDPSPLQDFCVAADEPNSAVFVNGKFCKNP  56



>ref|XP_006371122.1| Germin-like protein subfamily 1 member 6 precursor [Populus trichocarpa]
 gb|ERP48919.1| Germin-like protein subfamily 1 member 6 precursor [Populus trichocarpa]
Length=224

 Score = 60.5 bits (145),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 36/50 (72%), Gaps = 0/50 (0%)
 Frame = -3

Query  152  SLPIMKSILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            S+  + + ++L L +S A AYDP P+QDFCVA+ D + AVFVNGK C +P
Sbjct  3    SVHFLLAFVLLTLASSIASAYDPSPLQDFCVAINDPKAAVFVNGKFCTDP  52



>ref|XP_007200176.1| hypothetical protein PRUPE_ppa016529mg [Prunus persica]
 gb|EMJ01375.1| hypothetical protein PRUPE_ppa016529mg [Prunus persica]
Length=226

 Score = 60.1 bits (144),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = -3

Query  143  IMKSILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            ++ ++ ILA     A AYDP P+QDFCVAV D ++ VFVNGK CK+P
Sbjct  7    LIITLAILAFATFLASAYDPSPLQDFCVAVKDIKSGVFVNGKFCKDP  53



>ref|XP_006405658.1| hypothetical protein EUTSA_v10027918mg [Eutrema salsugineum]
 gb|ESQ47111.1| hypothetical protein EUTSA_v10027918mg [Eutrema salsugineum]
Length=221

 Score = 60.1 bits (144),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/42 (67%), Positives = 33/42 (79%), Gaps = 1/42 (2%)
 Frame = -3

Query  128  LILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            +ILALV SFA AYDP P+QDFCVA+ D    VFVNG+ CK+P
Sbjct  11   IILALVTSFADAYDPSPLQDFCVAIDDLN-GVFVNGRFCKDP  51



>emb|CAN80134.1| hypothetical protein VITISV_012033 [Vitis vinifera]
Length=224

 Score = 60.1 bits (144),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/53 (53%), Positives = 37/53 (70%), Gaps = 0/53 (0%)
 Frame = -3

Query  161  MASSLPIMKSILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            M  S+ ++ +I  +AL  S + AYDP P+QD CVAV D + AVFVNGK CK+P
Sbjct  1    MMRSVRLLVTIAFMALACSISSAYDPSPLQDTCVAVDDPKAAVFVNGKFCKDP  53



>emb|CDP14601.1| unnamed protein product [Coffea canephora]
Length=224

 Score = 60.1 bits (144),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 28/53 (53%), Positives = 38/53 (72%), Gaps = 0/53 (0%)
 Frame = -3

Query  161  MASSLPIMKSILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            MA++  ++   + L   +S + A+D  P+QDFCVAVPDA  AVFVNGK+CKNP
Sbjct  1    MAAAGFLVTLAIFLVSSSSISNAFDNDPLQDFCVAVPDASAAVFVNGKICKNP  53



>ref|XP_003535383.1| PREDICTED: LOW QUALITY PROTEIN: germin-like protein subfamily 
1 member 13-like [Glycine max]
Length=244

 Score = 60.1 bits (144),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 24/43 (56%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = -3

Query  131  ILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            +++  L +S A AYDP P+QDFCVA+ D +T VFVNGK+C++P
Sbjct  35   VVLWVLASSVAFAYDPSPLQDFCVAINDTKTGVFVNGKLCQDP  77



>ref|XP_010251871.1| PREDICTED: putative germin-like protein 2-1 [Nelumbo nucifera]
Length=222

 Score = 59.7 bits (143),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 27/46 (59%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = -3

Query  140  MKSILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            M ++L+L    S A A DP P+QDFCVA+ D +T VFVNGK CKNP
Sbjct  5    MIAVLVLLAJCSQALASDPSPLQDFCVAIKDTETPVFVNGKFCKNP  50



>ref|XP_011099651.1| PREDICTED: germin-like protein subfamily 1 member 13 [Sesamum 
indicum]
Length=229

 Score = 59.7 bits (143),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/53 (55%), Positives = 38/53 (72%), Gaps = 1/53 (2%)
 Frame = -3

Query  161  MASSLPIMKSILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            M  +   + +IL+ +L + FA A DP P+QDFCVAV D+  AVFVNGK+CKNP
Sbjct  1    MKMAFGFLAAILVASL-SPFAHASDPSPLQDFCVAVNDSVAAVFVNGKICKNP  52



>ref|XP_002284343.2| PREDICTED: uncharacterized protein LOC100256308 [Vitis vinifera]
Length=477

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 40/57 (70%), Gaps = 0/57 (0%)
 Frame = -3

Query  173  TAITMASSLPIMKSILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            T +TM   +  + ++ ++ALV+S A A DP P+QD CVA+ + + AVFVNGK CK+P
Sbjct  254  TTLTMKKGVSFLVTVALVALVSSLASASDPSPLQDTCVAIDEPKDAVFVNGKFCKDP  310


 Score = 59.3 bits (142),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 38/53 (72%), Gaps = 0/53 (0%)
 Frame = -3

Query  161  MASSLPIMKSILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            M   +  + +++++ALV+S A A DP P+QD CVA+ + + AVFVNGK CK+P
Sbjct  1    MKKGVSFLVTVVLMALVSSLASASDPSPLQDTCVAIDEPKDAVFVNGKFCKDP  53



>ref|XP_006371118.1| hypothetical protein POPTR_0019s042602g, partial [Populus trichocarpa]
 gb|ERP48915.1| hypothetical protein POPTR_0019s042602g, partial [Populus trichocarpa]
Length=105

 Score = 58.5 bits (140),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 36/50 (72%), Gaps = 0/50 (0%)
 Frame = -3

Query  152  SLPIMKSILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            S+  + + ++L L +S A A DP P+QDFCVA+ D + AVFVNGK CK+P
Sbjct  3    SVHFLLAFVLLTLASSIASASDPSPLQDFCVAINDPKAAVFVNGKFCKDP  52



>emb|CBI36812.3| unnamed protein product [Vitis vinifera]
Length=447

 Score = 61.6 bits (148),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 40/57 (70%), Gaps = 0/57 (0%)
 Frame = -3

Query  173  TAITMASSLPIMKSILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            T +TM   +  + ++ ++ALV+S A A DP P+QD CVA+ + + AVFVNGK CK+P
Sbjct  224  TTLTMKKGVSFLVTVALVALVSSLASASDPSPLQDTCVAIDEPKDAVFVNGKFCKDP  280


 Score = 56.6 bits (135),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 36/53 (68%), Gaps = 0/53 (0%)
 Frame = -3

Query  161  MASSLPIMKSILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            M   +  + ++ ++ALV+S A A DP P+QD CVA+   + AVFVNGK CK+P
Sbjct  1    MKKGVSFLVTVALVALVSSLASASDPSPLQDTCVAIDGPKEAVFVNGKFCKDP  53



>ref|XP_011002008.1| PREDICTED: germin-like protein subfamily 1 member 13 [Populus 
euphratica]
Length=225

 Score = 59.7 bits (143),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = -3

Query  140  MKSILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            + + ++L + +S A AYDP P+QDFCVA+ D + AVFVNGK CK+P
Sbjct  7    LLAFVLLTVASSIASAYDPSPLQDFCVAINDPKAAVFVNGKFCKDP  52



>ref|XP_010251869.1| PREDICTED: putative germin-like protein 2-1 isoform X1 [Nelumbo 
nucifera]
Length=222

 Score = 59.7 bits (143),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 27/46 (59%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = -3

Query  140  MKSILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            M ++L+L    S A A DP P+QDFCVA+ D +T VFVNGK CKNP
Sbjct  5    MIAVLVLLAJCSQALASDPSPLQDFCVAIKDTETPVFVNGKFCKNP  50



>ref|XP_010027140.1| PREDICTED: uncharacterized protein LOC104417587 [Eucalyptus grandis]
Length=549

 Score = 61.6 bits (148),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 38/52 (73%), Gaps = 4/52 (8%)
 Frame = -3

Query  146  PIMKS----ILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            P MKS    +LILAL  + A AYDP P+QD CVA+ D ++AVFVNG+ CK+P
Sbjct  325  PTMKSFPVSLLILALATTTAFAYDPSPLQDICVAINDPKSAVFVNGEFCKDP  376


 Score = 58.2 bits (139),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 25/49 (51%), Positives = 36/49 (73%), Gaps = 0/49 (0%)
 Frame = -3

Query  149  LPIMKSILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            +  + + ++LAL +S A A DP P+QDFCVA+ D+ +AV VNGK CK+P
Sbjct  2    MKFLLTFVLLALASSHAFASDPSPLQDFCVAINDSNSAVLVNGKFCKDP  50



>gb|ADD71877.1| germin-like protein subfamily 1 member 1 precursor [Arachis hypogaea]
Length=223

 Score = 59.3 bits (142),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 27/39 (69%), Positives = 32/39 (82%), Gaps = 2/39 (5%)
 Frame = -3

Query  113  VASFARAYDPRPMQDFCVAVPDA--QTAVFVNGKVCKNP  3
            +ASFA AYDP P+QDFCVA+PD   + AVFVNGK CK+P
Sbjct  13   LASFASAYDPSPLQDFCVALPDGSIKDAVFVNGKFCKDP  51



>gb|EYU20537.1| hypothetical protein MIMGU_mgv1a013077mg [Erythranthe guttata]
Length=231

 Score = 59.3 bits (142),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 28/48 (58%), Positives = 36/48 (75%), Gaps = 4/48 (8%)
 Frame = -3

Query  134  SILILALVASFAR----AYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            ++L LA++A FA     AYDP P+QDFCVAV D+  AV VNGK+CK+P
Sbjct  7    NLLFLAILAVFASLLADAYDPNPLQDFCVAVNDSDAAVLVNGKICKDP  54



>ref|XP_003618164.1| Germin-like protein subfamily 1 member [Medicago truncatula]
 gb|AES74382.1| germin family protein [Medicago truncatula]
Length=220

 Score = 59.3 bits (142),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 32/51 (63%), Positives = 37/51 (73%), Gaps = 6/51 (12%)
 Frame = -3

Query  140  MKSILI-----LALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            MKSI +     LAL AS A A+DP P+QDFCVA+ D +T VFVNGK CKNP
Sbjct  1    MKSIYLFFTAFLAL-ASCAFAFDPSPLQDFCVAINDTKTGVFVNGKFCKNP  50



>ref|XP_006358461.1| PREDICTED: germin-like protein subfamily 1 member 14-like [Solanum 
tuberosum]
Length=230

 Score = 59.3 bits (142),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = -3

Query  134  SILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            +I ILAL +S + A DP P+QDFCVAV +++  VFVNGKVCK+P
Sbjct  11   TIAILALTSSPSTASDPSPLQDFCVAVNESKETVFVNGKVCKDP  54



>ref|XP_006408215.1| hypothetical protein EUTSA_v10022237mg, partial [Eutrema salsugineum]
 gb|ESQ49668.1| hypothetical protein EUTSA_v10022237mg, partial [Eutrema salsugineum]
Length=204

 Score = 58.9 bits (141),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = -3

Query  143  IMKSILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            ++  +++LAL +SF   YDP P+QDFCVA  +    VFVNGK CK+P
Sbjct  8    LVAQVILLALASSFVSCYDPSPLQDFCVAANNNTNGVFVNGKFCKDP  54



>ref|XP_011012323.1| PREDICTED: germin-like protein subfamily 1 member 20 [Populus 
euphratica]
Length=392

 Score = 60.8 bits (146),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = -3

Query  152  SLPIMKSILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            S+  + + ++L + +S A AYDP P+QDFCVA+ D + AVFVNGK CK+P
Sbjct  3    SVHFLLAFVLLTVASSIASAYDPSPLQDFCVAINDPKAAVFVNGKFCKDP  52



>ref|XP_006349266.1| PREDICTED: germin-like protein subfamily 1 member 13-like [Solanum 
tuberosum]
Length=171

 Score = 58.9 bits (141),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = -3

Query  134  SILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            +I I+AL+ S + A DP P+QDFCVAV D++ AVFVNGK CK+P
Sbjct  9    AIAIMALLPSRSLASDPSPLQDFCVAVDDSKNAVFVNGKFCKDP  52



>ref|NP_198734.1| germin-like protein subfamily 1 member 19 [Arabidopsis thaliana]
 sp|Q9FL89.1|GL119_ARATH RecName: Full=Germin-like protein subfamily 1 member 19; Flags: 
Precursor [Arabidopsis thaliana]
 dbj|BAB09372.1| oxalate oxidase (germin protein)-like protein [Arabidopsis thaliana]
 gb|AED94404.1| germin-like protein subfamily 1 member 19 [Arabidopsis thaliana]
Length=221

 Score = 59.3 bits (142),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 35/47 (74%), Gaps = 1/47 (2%)
 Frame = -3

Query  140  MKSILI-LALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            M  ILI L+ + + A+AYDP P+QDFCVA+ D +  VFVNGK CK+P
Sbjct  5    MSLILITLSALVTIAKAYDPSPLQDFCVAIDDPKNGVFVNGKFCKDP  51



>emb|CDP14600.1| unnamed protein product [Coffea canephora]
Length=224

 Score = 59.3 bits (142),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 28/53 (53%), Positives = 39/53 (74%), Gaps = 0/53 (0%)
 Frame = -3

Query  161  MASSLPIMKSILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            MA++  ++   ++L   +S + A+D  P+QDFCVAVPDA  AVFVNGK+CKNP
Sbjct  1    MAAAGFLVTLAIVLVSSSSISTAFDNDPLQDFCVAVPDASAAVFVNGKICKNP  53



>ref|NP_187246.1| germin-like protein subfamily 1 member 7 [Arabidopsis thaliana]
 sp|Q9SFF9.1|GL17_ARATH RecName: Full=Germin-like protein subfamily 1 member 7; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAF23221.1|AC013454_8 germin-like protein [Arabidopsis thaliana]
 gb|AAF26097.1|AC012393_23 germin-like protein [Arabidopsis thaliana]
 dbj|BAF01026.1| germin-like protein [Arabidopsis thaliana]
 gb|AEE74322.1| germin-like protein subfamily 1 member 7 [Arabidopsis thaliana]
Length=229

 Score = 59.3 bits (142),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 30/47 (64%), Positives = 36/47 (77%), Gaps = 2/47 (4%)
 Frame = -3

Query  143  IMKSILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            + K+IL LAL +SF   YDP P+QDFCVAV DA + VFVNGK CK+P
Sbjct  9    VAKAIL-LALASSFVSCYDPSPLQDFCVAVDDA-SGVFVNGKFCKDP  53



>ref|NP_198731.1| germin-like protein subfamily 1 member 17 [Arabidopsis thaliana]
 sp|Q9FIC6.1|GL117_ARATH RecName: Full=Germin-like protein subfamily 1 member 17; Flags: 
Precursor [Arabidopsis thaliana]
 dbj|BAB10836.1| germin-like protein [Arabidopsis thaliana]
 gb|AED94399.1| germin-like protein subfamily 1 member 17 [Arabidopsis thaliana]
Length=221

 Score = 59.3 bits (142),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 35/47 (74%), Gaps = 1/47 (2%)
 Frame = -3

Query  140  MKSILI-LALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            M  ILI L+ + + A+AYDP P+QDFCVA+ D +  VFVNGK CK+P
Sbjct  5    MSLILITLSALVTIAKAYDPSPLQDFCVAIDDPKNGVFVNGKFCKDP  51



>ref|XP_002284682.1| PREDICTED: germin-like protein subfamily 1 member 15 [Vitis vinifera]
Length=220

 Score = 58.9 bits (141),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 36/53 (68%), Gaps = 0/53 (0%)
 Frame = -3

Query  161  MASSLPIMKSILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            M  S+  + ++  +AL +  A AYDP P++D CVAV + + AVFVNGK CKNP
Sbjct  1    MKKSVSFLVTVAFMALASFLASAYDPSPLEDTCVAVDEPKNAVFVNGKFCKNP  53



>ref|XP_002325370.2| hypothetical protein POPTR_0019s04270g [Populus trichocarpa]
 gb|EEE99751.2| hypothetical protein POPTR_0019s04270g [Populus trichocarpa]
Length=205

 Score = 58.9 bits (141),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 36/50 (72%), Gaps = 0/50 (0%)
 Frame = -3

Query  152  SLPIMKSILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            S+  + + ++L L +S A A DP P+QDFCVA+ D + AVFVNGK CK+P
Sbjct  3    SVHFLLAFVLLTLASSIASASDPSPLQDFCVAINDPKAAVFVNGKFCKDP  52



>ref|XP_002265857.1| PREDICTED: putative germin-like protein 2-1 [Vitis vinifera]
Length=221

 Score = 58.9 bits (141),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 28/46 (61%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = -3

Query  140  MKSILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            + SI +LA+    A A DP P+QDFCVAV D +T VFVNGKVCK+P
Sbjct  9    LASIPLLAMSFFLAFASDPSPLQDFCVAVNDTKTTVFVNGKVCKDP  54



>ref|XP_004247721.1| PREDICTED: germin-like protein subfamily 1 member 17 [Solanum 
lycopersicum]
Length=224

 Score = 58.9 bits (141),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 24/43 (56%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = -3

Query  131  ILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            I+   L+ SF  ++DP P+QDFCVA  D+  AVFVNGK CK+P
Sbjct  10   IVTFGLLFSFGSSFDPNPLQDFCVAATDSNDAVFVNGKFCKDP  52



>emb|CBI36780.3| unnamed protein product [Vitis vinifera]
Length=313

 Score = 60.1 bits (144),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 26/57 (46%), Positives = 37/57 (65%), Gaps = 0/57 (0%)
 Frame = -3

Query  173  TAITMASSLPIMKSILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            + +TM   +  + ++  +AL +  A AYDP P++D CVAV +   AVFVNGK CKNP
Sbjct  90   STLTMKRGVSFLVTVAFMALASFLASAYDPSPLEDTCVAVDEPNNAVFVNGKFCKNP  146



>ref|XP_010257844.1| PREDICTED: putative germin-like protein 2-1 [Nelumbo nucifera]
Length=224

 Score = 58.9 bits (141),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 31/53 (58%), Positives = 38/53 (72%), Gaps = 1/53 (2%)
 Frame = -3

Query  161  MASSLPIMKSILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            MA++  +  SIL LAL +S A A DP P+QDFCVA+ D + AV VNGK CKNP
Sbjct  1    MAAAQVLAVSIL-LALASSLAFASDPSPLQDFCVAIKDPKAAVLVNGKFCKNP  52



>gb|KDP45307.1| hypothetical protein JCGZ_09556 [Jatropha curcas]
Length=233

 Score = 58.9 bits (141),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 25/41 (61%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = -3

Query  125  ILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            +LA+ +SFA AYDP P+QD CVA  D  + VFVNGK CK+P
Sbjct  10   VLAMASSFAIAYDPSPLQDLCVATEDYSSGVFVNGKFCKDP  50



>ref|XP_002868738.1| hypothetical protein ARALYDRAFT_494073 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44997.1| hypothetical protein ARALYDRAFT_494073 [Arabidopsis lyrata subsp. 
lyrata]
Length=222

 Score = 58.9 bits (141),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 34/43 (79%), Gaps = 1/43 (2%)
 Frame = -3

Query  131  ILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            I I++LV SFA AYDP P+QDFCVA+ D +  VFVNG+ CK+P
Sbjct  10   IAIISLVISFANAYDPSPLQDFCVAIDDLK-GVFVNGRFCKDP  51



>emb|CBI36815.3| unnamed protein product [Vitis vinifera]
Length=220

 Score = 58.9 bits (141),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 38/53 (72%), Gaps = 0/53 (0%)
 Frame = -3

Query  161  MASSLPIMKSILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            M   +  + +++++ALV+S A A DP P+QD CVA+ + + AVFVNGK CK+P
Sbjct  1    MKKGVSFLVTVVLMALVSSLASASDPSPLQDTCVAIDEPKDAVFVNGKFCKDP  53



>ref|XP_002325797.2| hypothetical protein POPTR_0019s04340g [Populus trichocarpa]
 gb|EEF00179.2| hypothetical protein POPTR_0019s04340g [Populus trichocarpa]
Length=225

 Score = 58.9 bits (141),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 36/50 (72%), Gaps = 0/50 (0%)
 Frame = -3

Query  152  SLPIMKSILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            S+  + + ++L L +S A A DP P+QDFCVA+ D + AVFVNGK CK+P
Sbjct  3    SVHFLLAFVLLTLASSIASASDPSPLQDFCVAINDPKAAVFVNGKFCKDP  52



>gb|AFK39387.1| unknown [Medicago truncatula]
Length=221

 Score = 58.9 bits (141),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = -3

Query  125  ILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            ILAL +S A AYDP P+ DFCVA+ D +  VFVNGK CK+P
Sbjct  10   ILALASSLAFAYDPSPLLDFCVAIKDPKDGVFVNGKFCKDP  50



>ref|XP_010450836.1| PREDICTED: germin-like protein subfamily 1 member 13 [Camelina 
sativa]
Length=224

 Score = 58.9 bits (141),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = -3

Query  134  SILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKN  6
            S + LALV  F+ AYDP P+QDFCVAV +    VFVNGK CK+
Sbjct  9    SFITLALVIPFSNAYDPSPLQDFCVAVGNLNNGVFVNGKFCKD  51



>ref|XP_006371120.1| hypothetical protein POPTR_0019s04280g [Populus trichocarpa]
 ref|XP_002325371.2| hypothetical protein POPTR_0019s04290g [Populus trichocarpa]
 gb|ERP48917.1| hypothetical protein POPTR_0019s04280g [Populus trichocarpa]
 gb|EEE99752.2| hypothetical protein POPTR_0019s04290g [Populus trichocarpa]
Length=225

 Score = 58.9 bits (141),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 36/50 (72%), Gaps = 0/50 (0%)
 Frame = -3

Query  152  SLPIMKSILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            S+  + + ++L L +S A A DP P+QDFCVA+ D + AVFVNGK CK+P
Sbjct  3    SVHFLLAFVLLTLASSIASASDPSPLQDFCVAINDPKAAVFVNGKFCKDP  52



>emb|CDP16791.1| unnamed protein product [Coffea canephora]
Length=230

 Score = 58.9 bits (141),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = -3

Query  128  LILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            +IL LV +   A DP P+QDFCVAVPDA   VFVNGK+CK+P
Sbjct  10   VILTLVFAIVCASDPSPLQDFCVAVPDANATVFVNGKICKDP  51



>ref|XP_010464157.1| PREDICTED: germin-like protein subfamily 1 member 7 [Camelina 
sativa]
Length=225

 Score = 58.9 bits (141),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 30/47 (64%), Positives = 35/47 (74%), Gaps = 2/47 (4%)
 Frame = -3

Query  143  IMKSILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            + K+IL LAL +SF   YDP P+QDFCVAV DA   VFVNGK CK+P
Sbjct  9    VAKAIL-LALASSFVSCYDPSPLQDFCVAVDDAN-GVFVNGKFCKDP  53



>emb|CBI36786.3| unnamed protein product [Vitis vinifera]
Length=193

 Score = 58.5 bits (140),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 25/40 (63%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = -3

Query  122  LALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            +AL +S A A+DPRP+QD CVA+ + + AVFVNGK CKNP
Sbjct  1    MALASSLASAFDPRPLQDTCVAIDEPENAVFVNGKFCKNP  40



>gb|KCW61443.1| hypothetical protein EUGRSUZ_H04174 [Eucalyptus grandis]
Length=222

 Score = 58.5 bits (140),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 25/49 (51%), Positives = 36/49 (73%), Gaps = 0/49 (0%)
 Frame = -3

Query  149  LPIMKSILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            +  + + ++LAL +S A A DP P+QDFCVA+ D+ +AV VNGK CK+P
Sbjct  1    MKFLLTFVLLALASSHAFASDPSPLQDFCVAINDSNSAVLVNGKFCKDP  49



>ref|XP_010024914.1| PREDICTED: putative germin-like protein 2-1 [Eucalyptus grandis]
 gb|KCW61439.1| hypothetical protein EUGRSUZ_H04169 [Eucalyptus grandis]
Length=222

 Score = 58.5 bits (140),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 25/49 (51%), Positives = 36/49 (73%), Gaps = 0/49 (0%)
 Frame = -3

Query  149  LPIMKSILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            +  + + ++LAL +S A A DP P+QDFCVA+ D+ +AV VNGK CK+P
Sbjct  1    MKFLLTFVLLALASSHAFASDPSPLQDFCVAINDSNSAVLVNGKFCKDP  49



>ref|XP_010050157.1| PREDICTED: germin-like protein subfamily 1 member 13 [Eucalyptus 
grandis]
 gb|KCW89287.1| hypothetical protein EUGRSUZ_A01577 [Eucalyptus grandis]
Length=223

 Score = 58.5 bits (140),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 33/49 (67%), Gaps = 2/49 (4%)
 Frame = -3

Query  149  LPIMKSILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            LPI  S LILAL    A AYDP P+QD CVA  D  + VFVNGK CK+P
Sbjct  4    LPI--SFLILALATVTAFAYDPSPLQDICVATNDLNSGVFVNGKFCKDP  50



>gb|EYU38443.1| hypothetical protein MIMGU_mgv1a013090mg [Erythranthe guttata]
Length=231

 Score = 58.9 bits (141),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = -3

Query  155  SSLPIMKSILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            S + ++  +++   V+  A AYDP P+QDFCVAV D+  AV VNGK+CK+P
Sbjct  4    SGINLLFLVVLSVFVSLLADAYDPNPLQDFCVAVKDSDAAVLVNGKICKDP  54



>gb|KCW61437.1| hypothetical protein EUGRSUZ_H04167 [Eucalyptus grandis]
Length=222

 Score = 58.5 bits (140),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 25/49 (51%), Positives = 36/49 (73%), Gaps = 0/49 (0%)
 Frame = -3

Query  149  LPIMKSILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            +  + + ++LAL +S A A DP P+QDFCVA+ D+ +AV VNGK CK+P
Sbjct  1    MKFLLTFVLLALASSHAFASDPSPLQDFCVAINDSNSAVLVNGKFCKDP  49



>ref|XP_010024915.1| PREDICTED: putative germin-like protein 2-1 [Eucalyptus grandis]
Length=223

 Score = 58.5 bits (140),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 25/49 (51%), Positives = 36/49 (73%), Gaps = 0/49 (0%)
 Frame = -3

Query  149  LPIMKSILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            +  + + ++LAL +S A A DP P+QDFCVA+ D+ +AV VNGK CK+P
Sbjct  2    MKFLLTFVLLALASSHAFASDPSPLQDFCVAINDSNSAVLVNGKFCKDP  50



>ref|XP_009140209.1| PREDICTED: germin-like protein subfamily 1 member 16 [Brassica 
rapa]
Length=223

 Score = 58.5 bits (140),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 34/47 (72%), Gaps = 1/47 (2%)
 Frame = -3

Query  143  IMKSILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            I+  I ILALV SFA AYDP P+QDFCVA+ D    VFVN + CK+P
Sbjct  8    ILIPIAILALVISFAEAYDPSPLQDFCVAIDDL-NGVFVNDRFCKDP  53



>ref|XP_003633711.2| PREDICTED: putative germin-like protein 2-1 [Vitis vinifera]
Length=221

 Score = 58.5 bits (140),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = -3

Query  131  ILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            I +LA+    A A DP P+QDFCVAV D +T VFVNGKVCK+P
Sbjct  12   IALLAMSFFLASASDPSPLQDFCVAVNDTKTTVFVNGKVCKDP  54



>emb|CBI33612.3| unnamed protein product [Vitis vinifera]
Length=221

 Score = 58.5 bits (140),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = -3

Query  131  ILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            I +LA+    A A DP P+QDFCVAV D +T VFVNGKVCK+P
Sbjct  12   IALLAMSFFLASASDPSPLQDFCVAVNDTKTTVFVNGKVCKDP  54



>gb|EYU42478.1| hypothetical protein MIMGU_mgv1a022407mg [Erythranthe guttata]
Length=230

 Score = 58.5 bits (140),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 28/48 (58%), Positives = 35/48 (73%), Gaps = 4/48 (8%)
 Frame = -3

Query  134  SILILALVASFAR----AYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            ++L L +VA FA     AYDP P+QDFCVAV D+  AV VNGK+CK+P
Sbjct  5    NLLFLVVVAVFATLSADAYDPNPLQDFCVAVNDSSAAVLVNGKICKDP  52



>ref|XP_002319671.1| hypothetical protein POPTR_0013s04840g [Populus trichocarpa]
 gb|EEE95594.1| hypothetical protein POPTR_0013s04840g [Populus trichocarpa]
Length=221

 Score = 58.5 bits (140),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 33/42 (79%), Gaps = 1/42 (2%)
 Frame = -3

Query  128  LILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            ++LAL +SFA A+DP P+QDFCVAV D    VFVNGK CK+P
Sbjct  11   VLLALASSFASAFDPSPLQDFCVAV-DETDGVFVNGKFCKDP  51



>ref|XP_009124949.1| PREDICTED: germin-like protein subfamily 1 member 7 [Brassica 
rapa]
 emb|CDY18834.1| BnaAnng02990D [Brassica napus]
Length=229

 Score = 58.5 bits (140),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 32/43 (74%), Gaps = 1/43 (2%)
 Frame = -3

Query  131  ILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            +++LAL +SF   YDP P+QDFCVAV D    VFVNGK CK+P
Sbjct  12   VIVLALASSFVSCYDPSPLQDFCVAV-DGANGVFVNGKFCKDP  53



>ref|XP_011034445.1| PREDICTED: germin-like protein subfamily 1 member 7 [Populus 
euphratica]
 ref|XP_011038441.1| PREDICTED: germin-like protein subfamily 1 member 7 [Populus 
euphratica]
Length=221

 Score = 58.5 bits (140),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 33/42 (79%), Gaps = 1/42 (2%)
 Frame = -3

Query  128  LILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            ++LAL +SFA A+DP P+QDFCVAV D    VFVNGK CK+P
Sbjct  11   VLLALASSFASAFDPSPLQDFCVAV-DETDGVFVNGKFCKDP  51



>ref|XP_002319672.1| hypothetical protein POPTR_0013s04850g [Populus trichocarpa]
 gb|EEE95595.1| hypothetical protein POPTR_0013s04850g [Populus trichocarpa]
Length=221

 Score = 58.5 bits (140),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 33/42 (79%), Gaps = 1/42 (2%)
 Frame = -3

Query  128  LILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            ++LAL +SFA A+DP P+QDFCVAV D    VFVNGK CK+P
Sbjct  11   VLLALASSFASAFDPSPLQDFCVAV-DETDGVFVNGKFCKDP  51



>ref|NP_187067.1| germin-like protein subfamily 1 member 3 [Arabidopsis thaliana]
 sp|Q9M8X3.1|GL13_ARATH RecName: Full=Germin-like protein subfamily 1 member 3; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAF26796.1|AC016829_20 germin-like protein [Arabidopsis thaliana]
 gb|AAT47795.1| At3g04170 [Arabidopsis thaliana]
 gb|AEE74047.1| germin-like protein subfamily 1 member 3 [Arabidopsis thaliana]
Length=227

 Score = 58.5 bits (140),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
 Frame = -3

Query  140  MKSILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            +  I++LAL +SF   YDP P+QD+CVAVP+ +  VFVNG+ CK+P
Sbjct  9    LAKIILLALASSFVSCYDPSPLQDYCVAVPE-KNGVFVNGEFCKDP  53



>ref|XP_002270404.2| PREDICTED: putative germin-like protein 2-1 [Vitis vinifera]
Length=221

 Score = 58.5 bits (140),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 25/43 (58%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = -3

Query  131  ILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            +++LA+  SFA A DP P+QDFCVAV D    VFVNGK C++P
Sbjct  12   VVLLAMAFSFASASDPSPLQDFCVAVNDTNDTVFVNGKFCRDP  54



>ref|XP_011038440.1| PREDICTED: germin-like protein subfamily 1 member 7 [Populus 
euphratica]
Length=221

 Score = 58.2 bits (139),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 33/42 (79%), Gaps = 1/42 (2%)
 Frame = -3

Query  128  LILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            ++LAL +SFA A+DP P+QDFCVAV D    VFVNGK CK+P
Sbjct  11   VLLALASSFASAFDPSPLQDFCVAV-DETDGVFVNGKFCKDP  51



>ref|XP_006408007.1| hypothetical protein EUTSA_v10021469mg [Eutrema salsugineum]
 gb|ESQ49460.1| hypothetical protein EUTSA_v10021469mg [Eutrema salsugineum]
Length=225

 Score = 58.5 bits (140),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 34/47 (72%), Gaps = 1/47 (2%)
 Frame = -3

Query  143  IMKSILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            ++  +++LAL +SF   YDP P+QDFCVAV D    VFVNGK CK+P
Sbjct  8    LVAKVILLALASSFVSCYDPSPLQDFCVAVDDVN-GVFVNGKFCKDP  53



>gb|KFK33209.1| hypothetical protein AALP_AA6G344900 [Arabis alpina]
Length=187

 Score = 57.8 bits (138),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 25/44 (57%), Positives = 30/44 (68%), Gaps = 0/44 (0%)
 Frame = -3

Query  134  SILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            +I+ LAL   F  AYDP P+QDFCVA+      VFVNGK CK+P
Sbjct  9    AIVTLALAIPFGNAYDPSPLQDFCVAIDKLDNGVFVNGKFCKDP  52



>ref|XP_004513532.1| PREDICTED: germin-like protein subfamily 1 member 7-like [Cicer 
arietinum]
Length=221

 Score = 58.2 bits (139),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = -3

Query  125  ILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            ILAL +  A AYDP P+QDFCVA+ D +  VFVNGK CK+P
Sbjct  10   ILALASCVAFAYDPSPLQDFCVAIKDPKDGVFVNGKFCKDP  50



>ref|XP_010659856.1| PREDICTED: germin-like protein subfamily 1 member 7 [Vitis vinifera]
Length=222

 Score = 58.2 bits (139),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 24/52 (46%), Positives = 36/52 (69%), Gaps = 0/52 (0%)
 Frame = -3

Query  161  MASSLPIMKSILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKN  6
            M   +  + ++ ++AL +S   A+DP P+QD CVA+P+ + AVFVNGK CKN
Sbjct  1    MKKGVSFLVAVALMALASSLVAAFDPSPLQDTCVAIPEPKNAVFVNGKFCKN  52



>ref|XP_007143990.1| hypothetical protein PHAVU_007G119700g [Phaseolus vulgaris]
 gb|ESW15984.1| hypothetical protein PHAVU_007G119700g [Phaseolus vulgaris]
Length=228

 Score = 58.2 bits (139),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 35/47 (74%), Gaps = 4/47 (9%)
 Frame = -3

Query  131  ILILALVASFARAYDPRPMQDFCVAVPDAQT----AVFVNGKVCKNP  3
            +++LAL +S A AYDP P+QDFCVA+ D +T     VFVNGK CK+P
Sbjct  8    VVLLALASSVAFAYDPSPLQDFCVAINDTKTGGIYGVFVNGKFCKDP  54



>gb|ABR68690.1| oxalate oxidase [Theobroma cacao]
Length=144

 Score = 57.4 bits (137),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = -3

Query  125  ILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            +LA   S A A+DP P+QDFCVA+ D +  VFVNGK CK+P
Sbjct  13   LLAFANSLASAFDPSPLQDFCVAINDTKNGVFVNGKFCKDP  53



>emb|CBI36782.3| unnamed protein product [Vitis vinifera]
Length=213

 Score = 57.8 bits (138),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = -3

Query  140  MKSILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            M ++ ++AL +  A AYDP P++D CVAV + + AVFVNGK CKNP
Sbjct  1    MVTVALMALASFLASAYDPSPLEDTCVAVDEPKNAVFVNGKFCKNP  46



>ref|XP_007030273.1| RmlC-like cupins superfamily protein [Theobroma cacao]
 gb|EOY10775.1| RmlC-like cupins superfamily protein [Theobroma cacao]
Length=224

 Score = 57.8 bits (138),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = -3

Query  125  ILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            +LA   S A A+DP P+QDFCVA+ D +  VFVNGK CK+P
Sbjct  13   LLAFANSLASAFDPSPLQDFCVAINDTKNGVFVNGKFCKDP  53



>ref|XP_009612541.1| PREDICTED: germin-like protein subfamily 1 member 17 [Nicotiana 
tomentosiformis]
Length=228

 Score = 57.8 bits (138),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 26/51 (51%), Positives = 39/51 (76%), Gaps = 1/51 (2%)
 Frame = -3

Query  152  SLPIMK-SILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            +L ++K +I  +A++ S + A+DP P+QD CVAV D+  AVFVNGK+CK+P
Sbjct  2    ALKVLKLTIATMAVLFSMSHAFDPSPLQDICVAVDDSMAAVFVNGKICKDP  52



>ref|XP_010528697.1| PREDICTED: germin-like protein subfamily 1 member 8 [Tarenaya 
hassleriana]
Length=219

 Score = 57.8 bits (138),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 25/44 (57%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = -3

Query  134  SILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            S+ +L++   +A A DP P+QDFCVAV D   AVFVNGK+CK+P
Sbjct  8    SLFLLSVTIPYAMASDPSPLQDFCVAVNDPANAVFVNGKICKDP  51



>gb|KCW64217.1| hypothetical protein EUGRSUZ_G018671, partial [Eucalyptus grandis]
Length=131

 Score = 57.0 bits (136),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = -3

Query  143  IMKSILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
             + + ++LAL +  A A DP P+QDFCVAV D  +AVFVNGK CK+P
Sbjct  3    FLLTFVLLALASCHAFASDPSPLQDFCVAVNDPNSAVFVNGKFCKDP  49



>gb|EYU38442.1| hypothetical protein MIMGU_mgv1a013089mg [Erythranthe guttata]
Length=231

 Score = 57.8 bits (138),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 36/48 (75%), Gaps = 4/48 (8%)
 Frame = -3

Query  134  SILILALVASF----ARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            ++L LA+++ F    A AYDP P+QDFCVAV D+  AV VNGK+CK+P
Sbjct  7    NLLFLAVLSVFVSLLADAYDPNPLQDFCVAVNDSDAAVLVNGKICKDP  54



>ref|XP_007199217.1| hypothetical protein PRUPE_ppa021882mg [Prunus persica]
 gb|EMJ00416.1| hypothetical protein PRUPE_ppa021882mg [Prunus persica]
Length=226

 Score = 57.8 bits (138),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = -3

Query  143  IMKSILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            ++ ++  LA     A AYDP P+QDFCVA+ D +  VFVNGK CK+P
Sbjct  7    LISTLAFLAFATFLASAYDPSPLQDFCVALKDIKDGVFVNGKFCKDP  53



>ref|XP_002276756.2| PREDICTED: putative germin-like protein 2-1 [Vitis vinifera]
Length=228

 Score = 57.8 bits (138),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = -3

Query  131  ILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            I++LA+  S A A DP P+QDFCVAV D   +VFVNGK CK+P
Sbjct  12   IVLLAMAFSVASASDPSPLQDFCVAVNDTNDSVFVNGKFCKDP  54



>ref|XP_009620917.1| PREDICTED: germin-like protein subfamily 1 member 17 [Nicotiana 
tomentosiformis]
Length=228

 Score = 57.8 bits (138),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = -3

Query  143  IMKSILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            ++ +I  +A++ S + A+DP P+QD CVAV D+  AVFVNGK+CK+P
Sbjct  6    LILTIATMAVLFSMSHAFDPSPLQDICVAVDDSMAAVFVNGKICKDP  52



>ref|XP_010434310.1| PREDICTED: germin-like protein subfamily 1 member 7 [Camelina 
sativa]
 ref|XP_010486077.1| PREDICTED: germin-like protein subfamily 1 member 7 [Camelina 
sativa]
Length=225

 Score = 57.8 bits (138),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 35/47 (74%), Gaps = 2/47 (4%)
 Frame = -3

Query  143  IMKSILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            + K+IL LA+ +SF   YDP P+QDFCVAV DA   VFVNGK CK+P
Sbjct  9    VAKAIL-LAIASSFVSCYDPSPLQDFCVAVDDAN-GVFVNGKFCKDP  53



>ref|XP_002276644.1| PREDICTED: putative germin-like protein 2-1 [Vitis vinifera]
Length=228

 Score = 57.8 bits (138),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = -3

Query  131  ILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            I++LA+  S A A DP P+QDFCVAV D   +VFVNGK CK+P
Sbjct  12   IVLLAMAFSVASASDPSPLQDFCVAVNDTNDSVFVNGKFCKDP  54



>emb|CBI33611.3| unnamed protein product [Vitis vinifera]
Length=289

 Score = 58.5 bits (140),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = -3

Query  131  ILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            I +LA+    A A DP P+QDFCVAV D +T VFVNGKVCK+P
Sbjct  70   IALLAMSFFLASASDPSPLQDFCVAVNDTKTTVFVNGKVCKDP  112



>ref|XP_006298965.1| hypothetical protein CARUB_v10015090mg [Capsella rubella]
 gb|EOA31863.1| hypothetical protein CARUB_v10015090mg [Capsella rubella]
Length=229

 Score = 57.8 bits (138),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 35/47 (74%), Gaps = 2/47 (4%)
 Frame = -3

Query  143  IMKSILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            + K+IL LA+ +SF   YDP P+QDFCVAV DA   VFVNGK CK+P
Sbjct  9    VAKAIL-LAIASSFVSCYDPSPLQDFCVAVNDAN-GVFVNGKFCKDP  53



>ref|XP_002280481.2| PREDICTED: uncharacterized protein LOC100252737 [Vitis vinifera]
Length=685

 Score = 59.7 bits (143),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 39/57 (68%), Gaps = 0/57 (0%)
 Frame = -3

Query  173  TAITMASSLPIMKSILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            + +TM   +  + ++ ++ALV+S A A DP P+QD CVA+ +   AVFVNGK CK+P
Sbjct  457  STLTMKKGVSFLVTVALIALVSSLASASDPGPLQDTCVAIDEPSDAVFVNGKFCKDP  513


 Score = 57.4 bits (137),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 37/53 (70%), Gaps = 0/53 (0%)
 Frame = -3

Query  161  MASSLPIMKSILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            M   +  + ++ ++ALV+S A A DP P+QD CVA+ + + AVFVNGK CK+P
Sbjct  1    MKKGVSFLVTVALVALVSSLASASDPSPLQDTCVAIDEPKDAVFVNGKFCKDP  53



>gb|KCW61442.1| hypothetical protein EUGRSUZ_H04173, partial [Eucalyptus grandis]
Length=216

 Score = 57.4 bits (137),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 36/49 (73%), Gaps = 4/49 (8%)
 Frame = -3

Query  149  LPIMKSILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            LPI  S+LILAL  +   AYDP P+QDFCVA+ D +  VFVNGK CK+P
Sbjct  4    LPI--SLLILALATATTYAYDPSPLQDFCVAINDPK--VFVNGKFCKDP  48



>ref|XP_010041604.1| PREDICTED: germin-like protein subfamily 1 member 13 [Eucalyptus 
grandis]
Length=223

 Score = 57.4 bits (137),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/49 (53%), Positives = 35/49 (71%), Gaps = 0/49 (0%)
 Frame = -3

Query  149  LPIMKSILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            +  + + ++LAL +  A A DP P+QDFCVAV D  +AVFVNGK CK+P
Sbjct  2    MKFLLTFVLLALASCHAFASDPSPLQDFCVAVNDPNSAVFVNGKFCKDP  50



>ref|XP_010066342.1| PREDICTED: germin-like protein subfamily 1 member 13 [Eucalyptus 
grandis]
Length=223

 Score = 57.4 bits (137),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/49 (53%), Positives = 35/49 (71%), Gaps = 0/49 (0%)
 Frame = -3

Query  149  LPIMKSILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            +  + + ++LAL +  A A DP P+QDFCVAV D  +AVFVNGK CK+P
Sbjct  2    MKFLLTFVLLALASCHAFASDPSPLQDFCVAVNDPNSAVFVNGKFCKDP  50



>gb|KCW44232.1| hypothetical protein EUGRSUZ_L02342, partial [Eucalyptus grandis]
Length=218

 Score = 57.4 bits (137),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/49 (53%), Positives = 35/49 (71%), Gaps = 0/49 (0%)
 Frame = -3

Query  149  LPIMKSILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            +  + + ++LAL +  A A DP P+QDFCVAV D  +AVFVNGK CK+P
Sbjct  2    MKFLLTFVLLALASCHAFASDPSPLQDFCVAVNDPNSAVFVNGKFCKDP  50



>ref|NP_198729.1| germin-like protein subfamily 1 member 16 [Arabidopsis thaliana]
 sp|Q9FIC8.1|GL116_ARATH RecName: Full=Germin-like protein subfamily 1 member 16; Flags: 
Precursor [Arabidopsis thaliana]
 dbj|BAB10834.1| germin-like protein [Arabidopsis thaliana]
 gb|AAL32875.1| germin-like protein [Arabidopsis thaliana]
 gb|AAO29972.1| germin-like protein [Arabidopsis thaliana]
 gb|AED94397.1| germin-like protein subfamily 1 member 16 [Arabidopsis thaliana]
Length=222

 Score = 57.4 bits (137),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 32/41 (78%), Gaps = 1/41 (2%)
 Frame = -3

Query  125  ILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            I+ALV SF  AYDP P+QDFCVA+ D +  VFVNG+ CK+P
Sbjct  12   IIALVLSFVNAYDPSPLQDFCVAIDDLK-GVFVNGRFCKDP  51



>emb|CAA63023.1| germin type2 [Arabidopsis thaliana]
Length=222

 Score = 57.4 bits (137),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 32/41 (78%), Gaps = 1/41 (2%)
 Frame = -3

Query  125  ILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            I+ALV SF  AYDP P+QDFCVA+ D +  VFVNG+ CK+P
Sbjct  12   IIALVLSFVNAYDPSPLQDFCVAIDDLK-GVFVNGRFCKDP  51



>ref|XP_004513533.1| PREDICTED: germin-like protein subfamily 1 member 18-like [Cicer 
arietinum]
Length=221

 Score = 57.4 bits (137),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = -3

Query  125  ILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            ILAL +S A A DP P+QDFCVA+ D +  VFVNGK CK+P
Sbjct  10   ILALASSVAFASDPSPLQDFCVAIKDPKDGVFVNGKFCKDP  50



>ref|NP_198735.1| germin-like protein 2a [Arabidopsis thaliana]
 sp|P92996.1|GL120_ARATH RecName: Full=Germin-like protein subfamily 1 member 20; AltName: 
Full=GLP2a copy 2; AltName: Full=GLP2b; AltName: Full=Germin 
type 2; Short=At-GERM2; Short=AtGER2; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAB51570.1| germin-like protein [Arabidopsis thaliana]
 dbj|BAB09373.1| germin-like protein [Arabidopsis thaliana]
 gb|AAO42026.1| putative germin-like protein (GLP2a) copy2 [Arabidopsis thaliana]
 gb|AAO50602.1| putative germin-like protein (GLP2a) copy2 [Arabidopsis thaliana]
 gb|AED94405.1| germin-like protein 2a [Arabidopsis thaliana]
Length=222

 Score = 57.4 bits (137),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 32/41 (78%), Gaps = 1/41 (2%)
 Frame = -3

Query  125  ILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            I+ALV SF  AYDP P+QDFCVA+ D +  VFVNG+ CK+P
Sbjct  12   IIALVLSFVNAYDPSPLQDFCVAIDDLK-GVFVNGRFCKDP  51



>ref|NP_198732.2| germin-like protein subfamily 1 member 18 [Arabidopsis thaliana]
 sp|P92999.2|GL118_ARATH RecName: Full=Germin-like protein subfamily 1 member 18; AltName: 
Full=GLP2a copy 1; Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB09370.1| oxalate oxidase (germin protein)-like protein [Arabidopsis thaliana]
 gb|AAM98218.1| germin-like protein GLP2a copy1 [Arabidopsis thaliana]
 gb|AAN72181.1| germin-like protein GLP2a copy1 [Arabidopsis thaliana]
 gb|AED94400.1| germin-like protein subfamily 1 member 18 [Arabidopsis thaliana]
Length=222

 Score = 57.4 bits (137),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 32/41 (78%), Gaps = 1/41 (2%)
 Frame = -3

Query  125  ILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            I+ALV SF  AYDP P+QDFCVA+ D +  VFVNG+ CK+P
Sbjct  12   IIALVLSFVNAYDPSPLQDFCVAIDDLK-GVFVNGRFCKDP  51



>ref|XP_010450835.1| PREDICTED: LOW QUALITY PROTEIN: germin-like protein subfamily 
1 member 18 [Camelina sativa]
Length=224

 Score = 57.4 bits (137),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 32/43 (74%), Gaps = 1/43 (2%)
 Frame = -3

Query  131  ILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            + I+ALV SFA AYDP P+QDFCVA  D    VFVNG+ CK+P
Sbjct  10   VAIIALVISFANAYDPXPLQDFCVATDDL-NGVFVNGRFCKDP  51



>ref|NP_001267943.1| germin-like protein 4 precursor [Vitis vinifera]
 gb|ABL60873.1| germin-like protein 4 [Vitis vinifera]
Length=220

 Score = 57.4 bits (137),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 37/53 (70%), Gaps = 0/53 (0%)
 Frame = -3

Query  161  MASSLPIMKSILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            M   +  + ++ ++ALV+S A A DP P+QD CVA+ + + AVFVNGK CK+P
Sbjct  1    MKKGVSFLVTVALVALVSSLASASDPSPLQDTCVAIDEPKDAVFVNGKFCKDP  53



>gb|KDP46446.1| hypothetical protein JCGZ_10286 [Jatropha curcas]
Length=245

 Score = 57.8 bits (138),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 25/44 (57%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = -3

Query  134  SILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            ++ +LA+ ASFA AYD  P+QDFCVA   + + VFVNGK CK+P
Sbjct  7    ALAVLAMAASFAIAYDASPLQDFCVATDGSDSGVFVNGKFCKDP  50



>ref|XP_010027139.1| PREDICTED: germin-like protein subfamily 1 member 7 [Eucalyptus 
grandis]
Length=221

 Score = 57.4 bits (137),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 36/49 (73%), Gaps = 4/49 (8%)
 Frame = -3

Query  149  LPIMKSILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            LPI  S+LILAL  +   AYDP P+QDFCVA+ D +  VFVNGK CK+P
Sbjct  4    LPI--SLLILALATATTYAYDPSPLQDFCVAINDPK--VFVNGKFCKDP  48



>emb|CBI36811.3| unnamed protein product [Vitis vinifera]
Length=220

 Score = 57.4 bits (137),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 37/53 (70%), Gaps = 0/53 (0%)
 Frame = -3

Query  161  MASSLPIMKSILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            M   +  + ++ ++ALV+S A A DP P+QD CVA+ + + AVFVNGK CK+P
Sbjct  1    MKKGVSFLVTVALVALVSSLASASDPSPLQDTCVAIDEPKDAVFVNGKFCKDP  53



>ref|XP_006358460.1| PREDICTED: LOW QUALITY PROTEIN: germin-like protein subfamily 
1 member 18-like [Solanum tuberosum]
Length=233

 Score = 57.4 bits (137),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = -3

Query  134  SILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            +I ILAL +S + A DP P++ FCVAV D++T VFVNGKVCK+P
Sbjct  11   TIAILALASSPSTASDPSPLKIFCVAVNDSKTTVFVNGKVCKDP  54



>gb|KHN04965.1| Germin-like protein subfamily 1 member 7 [Glycine soja]
Length=232

 Score = 57.4 bits (137),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 34/47 (72%), Gaps = 4/47 (9%)
 Frame = -3

Query  131  ILILALVASFARAYDPRPMQDFCVAVPDAQT----AVFVNGKVCKNP  3
            +++LAL +S A  YDP P+QDFCVA+ D +T     VFVNGK CK+P
Sbjct  8    VVLLALASSVAFGYDPSPLQDFCVAINDTKTGGLYGVFVNGKFCKDP  54



>ref|NP_001240963.1| germin-like protein subfamily 1 member 7-like precursor [Glycine 
max]
 gb|ACG69487.1| germin-like protein 11 [Glycine max]
Length=232

 Score = 57.4 bits (137),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 34/47 (72%), Gaps = 4/47 (9%)
 Frame = -3

Query  131  ILILALVASFARAYDPRPMQDFCVAVPDAQT----AVFVNGKVCKNP  3
            +++LAL +S A  YDP P+QDFCVA+ D +T     VFVNGK CK+P
Sbjct  8    VVLLALASSVAFGYDPSPLQDFCVAINDTKTGGLYGVFVNGKFCKDP  54



>ref|XP_010659615.1| PREDICTED: germin-like protein subfamily 1 member 14 [Vitis vinifera]
 emb|CBI39472.3| unnamed protein product [Vitis vinifera]
Length=220

 Score = 57.4 bits (137),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 37/53 (70%), Gaps = 0/53 (0%)
 Frame = -3

Query  161  MASSLPIMKSILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            M   +  + ++ ++ALV+S A A DP P+QD CVA+ + + AVFVNGK CK+P
Sbjct  1    MKKGVSFLVTVALVALVSSLASASDPSPLQDTCVAIDEPKDAVFVNGKFCKDP  53



>emb|CBI36816.3| unnamed protein product [Vitis vinifera]
Length=220

 Score = 57.4 bits (137),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 37/53 (70%), Gaps = 0/53 (0%)
 Frame = -3

Query  161  MASSLPIMKSILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            M   +  + ++ ++ALV+S A A DP P+QD CVA+ + + AVFVNGK CK+P
Sbjct  1    MKKGVSFLVTVALVALVSSLASASDPSPLQDTCVAIDEPKDAVFVNGKFCKDP  53



>ref|XP_010027136.1| PREDICTED: uncharacterized protein LOC104417584 [Eucalyptus grandis]
Length=492

 Score = 59.3 bits (142),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/60 (53%), Positives = 39/60 (65%), Gaps = 4/60 (7%)
 Frame = -3

Query  182  RNITAITMASSLPIMKSILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            +  T  T    LPI  S+LILAL  +   AYDP P+QDFCVA+ D +  VFVNGK CK+P
Sbjct  264  KGTTLSTTMKFLPI--SLLILALATATTFAYDPSPLQDFCVAINDPK--VFVNGKFCKDP  319


 Score = 58.5 bits (140),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 37/49 (76%), Gaps = 4/49 (8%)
 Frame = -3

Query  149  LPIMKSILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            LPI  S+LILAL  + + AYDP P+QDFCVA+ D +  VFVNGK CK+P
Sbjct  4    LPI--SLLILALATATSFAYDPSPLQDFCVAINDPK--VFVNGKFCKDP  48



>ref|NP_198728.1| germin-like protein subfamily 1 member 15 [Arabidopsis thaliana]
 sp|Q9FIC9.1|GL115_ARATH RecName: Full=Germin-like protein subfamily 1 member 15; Flags: 
Precursor [Arabidopsis thaliana]
 dbj|BAB10833.1| germin-like protein [Arabidopsis thaliana]
 gb|AED94396.1| germin-like protein subfamily 1 member 15 [Arabidopsis thaliana]
Length=221

 Score = 57.4 bits (137),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 32/43 (74%), Gaps = 1/43 (2%)
 Frame = -3

Query  131  ILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            I   ALV + A+AYDP P+QDFCVA+ D +  VFVNGK CK+P
Sbjct  10   ITFWALV-TIAKAYDPSPLQDFCVAIDDPKNGVFVNGKFCKDP  51



>ref|XP_002284320.1| PREDICTED: germin-like protein subfamily 1 member 14 [Vitis vinifera]
 emb|CBI36817.3| unnamed protein product [Vitis vinifera]
Length=220

 Score = 57.0 bits (136),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 37/53 (70%), Gaps = 0/53 (0%)
 Frame = -3

Query  161  MASSLPIMKSILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            M   +  + ++ ++ALV+S A A DP P+QD CVA+ + + AVFVNGK CK+P
Sbjct  1    MKKGVSFLVTVALVALVSSLASASDPSPLQDTCVAIDEPKDAVFVNGKFCKDP  53



>ref|NP_001267944.1| germin-like protein 7 precursor [Vitis vinifera]
 gb|ABL60876.1| germin-like protein 7 [Vitis vinifera]
Length=220

 Score = 57.0 bits (136),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 34/53 (64%), Gaps = 0/53 (0%)
 Frame = -3

Query  161  MASSLPIMKSILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            M   +  + ++  +AL +  A AYDP P++D CVAV +   AVFVNGK CKNP
Sbjct  1    MKRGVSFLVTVAFMALASFLASAYDPSPLEDTCVAVDEPNNAVFVNGKFCKNP  53



>ref|XP_009773430.1| PREDICTED: germin-like protein subfamily 1 member 17 [Nicotiana 
sylvestris]
Length=224

 Score = 57.0 bits (136),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 21/43 (49%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = -3

Query  131  ILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            ++ +  +  F  ++DP P QDFC+AV D+++AVFVNGK+CK+P
Sbjct  10   LVTVGFIFPFGSSFDPSPFQDFCIAVSDSKSAVFVNGKLCKDP  52



>emb|CAN71348.1| hypothetical protein VITISV_024253 [Vitis vinifera]
Length=220

 Score = 57.0 bits (136),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 34/53 (64%), Gaps = 0/53 (0%)
 Frame = -3

Query  161  MASSLPIMKSILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            M   +  + ++  +AL +  A AYDP P++D CVAV +   AVFVNGK CKNP
Sbjct  1    MKRGVSFLVTVAFMALASFLASAYDPSPLEDTCVAVDEPNNAVFVNGKFCKNP  53



>gb|KCW80409.1| hypothetical protein EUGRSUZ_C01766 [Eucalyptus grandis]
Length=221

 Score = 57.0 bits (136),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 37/49 (76%), Gaps = 4/49 (8%)
 Frame = -3

Query  149  LPIMKSILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            LPI  S+LILAL  + + AYDP P+QDFCVA+ D +  VFVNGK CK+P
Sbjct  4    LPI--SLLILALATATSFAYDPSPLQDFCVAINDPK--VFVNGKFCKDP  48



>gb|KCW61438.1| hypothetical protein EUGRSUZ_H04168 [Eucalyptus grandis]
Length=221

 Score = 57.0 bits (136),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 37/49 (76%), Gaps = 4/49 (8%)
 Frame = -3

Query  149  LPIMKSILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            LPI  S+LILAL  + + AYDP P+QDFCVA+ D +  VFVNGK CK+P
Sbjct  4    LPI--SLLILALATATSFAYDPSPLQDFCVAINDPK--VFVNGKFCKDP  48



>gb|KDO36579.1| hypothetical protein CISIN_1g048097mg [Citrus sinensis]
Length=224

 Score = 57.0 bits (136),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = -3

Query  125  ILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            + AL +S A AYDP P+QD CVA+ D +  VFVNGK CK+P
Sbjct  12   LFALASSLASAYDPSPLQDICVAIIDHKDGVFVNGKFCKDP  52



>gb|KCW61436.1| hypothetical protein EUGRSUZ_H04166, partial [Eucalyptus grandis]
Length=216

 Score = 57.0 bits (136),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 36/49 (73%), Gaps = 4/49 (8%)
 Frame = -3

Query  149  LPIMKSILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            LPI  S+LILAL  +   AYDP P+QDFCVA+ D +  VFVNGK CK+P
Sbjct  4    LPI--SLLILALATATTFAYDPSPLQDFCVAINDPK--VFVNGKFCKDP  48



>gb|KCW76699.1| hypothetical protein EUGRSUZ_D01059 [Eucalyptus grandis]
Length=221

 Score = 57.0 bits (136),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 37/49 (76%), Gaps = 4/49 (8%)
 Frame = -3

Query  149  LPIMKSILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            LPI  S+LILAL  + + AYDP P+QDFCVA+ D +  VFVNGK CK+P
Sbjct  4    LPI--SLLILALATATSFAYDPSPLQDFCVAINDPK--VFVNGKFCKDP  48



>gb|KFK33208.1| hypothetical protein AALP_AA6G344800 [Arabis alpina]
Length=222

 Score = 57.0 bits (136),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 24/44 (55%), Positives = 29/44 (66%), Gaps = 0/44 (0%)
 Frame = -3

Query  134  SILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            + + LAL   F  AYDP P+QDFCVA+      VFVNGK CK+P
Sbjct  9    AFITLALATPFGDAYDPSPLQDFCVAIDKLDNGVFVNGKFCKDP  52



>ref|XP_006845051.1| hypothetical protein AMTR_s00794p00001640 [Amborella trichopoda]
 gb|ERN06726.1| hypothetical protein AMTR_s00794p00001640 [Amborella trichopoda]
Length=220

 Score = 56.6 bits (135),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 36/50 (72%), Gaps = 6/50 (12%)
 Frame = -3

Query  140  MKSILIL----ALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            MKS  ++    ALVASFA A DP P+QDFCVA  D  + VFVNGKVCK+P
Sbjct  1    MKSFFLVLSFFALVASFALASDPSPLQDFCVA--DNASKVFVNGKVCKDP  48



>emb|CBI36814.3| unnamed protein product [Vitis vinifera]
Length=225

 Score = 57.0 bits (136),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 36/53 (68%), Gaps = 0/53 (0%)
 Frame = -3

Query  161  MASSLPIMKSILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            M   +  + ++ ++ALV+S A A DP P+QD CVA+ +   AVFVNGK CK+P
Sbjct  1    MKKGVSFLVTVALIALVSSLASASDPGPLQDTCVAIDEPSDAVFVNGKFCKDP  53



>ref|XP_002281186.2| PREDICTED: uncharacterized protein LOC100244552 [Vitis vinifera]
Length=478

 Score = 58.5 bits (140),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = -3

Query  131  ILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            I +LA+    A A DP P+QDFCVAV D +T VFVNGKVCK+P
Sbjct  269  IALLAMSFFLASASDPSPLQDFCVAVNDTKTTVFVNGKVCKDP  311


 Score = 50.4 bits (119),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 21/33 (64%), Positives = 25/33 (76%), Gaps = 0/33 (0%)
 Frame = -3

Query  104  FARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKN  6
             A   DP P+Q+FCVAV D +T VFVNGKVCK+
Sbjct  5    LASVSDPSPLQEFCVAVNDTKTTVFVNGKVCKD  37



>gb|KDP45308.1| hypothetical protein JCGZ_09557 [Jatropha curcas]
Length=233

 Score = 57.0 bits (136),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 24/41 (59%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = -3

Query  125  ILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            +LA+ +SFA AYDP P+QD CVA  D  + V VNGK CK+P
Sbjct  10   VLAMASSFAIAYDPSPLQDLCVATEDYSSGVLVNGKFCKDP  50



>ref|XP_006599050.1| PREDICTED: germin-like protein subfamily 1 member 7-like [Glycine 
max]
 gb|KHN10837.1| Germin-like protein subfamily 1 member 7 [Glycine soja]
Length=221

 Score = 56.6 bits (135),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 25/43 (58%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = -3

Query  131  ILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            + +LAL  S A AYDP P+QDFCV V   +  VFVNGK CK+P
Sbjct  8    VAVLALAFSVASAYDPSPLQDFCVTVNGTKDGVFVNGKFCKDP  50



>ref|XP_002276926.2| PREDICTED: uncharacterized protein LOC100251187, partial [Vitis 
vinifera]
Length=447

 Score = 58.5 bits (140),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 38/58 (66%), Gaps = 0/58 (0%)
 Frame = -3

Query  176  ITAITMASSLPIMKSILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            +T + +A  +  +  I +LA+  S A A DP P+QDFCVAV D+  AVFV GK C++P
Sbjct  216  LTGLGLAMVVNTLAYIALLAMAFSLASASDPSPLQDFCVAVNDSNAAVFVKGKFCRDP  273


 Score = 58.5 bits (140),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = -3

Query  131  ILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            I++LA   S A A DP P+QDFCVAV D + AVFVNGK CK+P
Sbjct  5    IVLLATAFSVASASDPSPLQDFCVAVNDTKDAVFVNGKFCKDP  47



>ref|XP_004489241.1| PREDICTED: putative germin-like protein 2-1-like [Cicer arietinum]
Length=220

 Score = 56.6 bits (135),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 24/37 (65%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = -3

Query  113  VASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            +AS A A+DP P+QDFCVA+ D +T VFVNGK CK+P
Sbjct  14   LASCAFAFDPSPLQDFCVAINDTKTGVFVNGKFCKDP  50



>ref|XP_006345483.1| PREDICTED: germin-like protein subfamily 1 member 11-like [Solanum 
tuberosum]
Length=224

 Score = 56.6 bits (135),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 26/51 (51%), Positives = 35/51 (69%), Gaps = 0/51 (0%)
 Frame = -3

Query  155  SSLPIMKSILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            S L  + ++ I A + S A AYD  P+QD CVAV D+  +VFVNGK+CK+P
Sbjct  2    SMLWFITTLAITAFICSSAYAYDNNPLQDICVAVNDSHASVFVNGKMCKDP  52



>ref|XP_008443754.1| PREDICTED: germin-like protein subfamily 1 member 17 [Cucumis 
melo]
Length=223

 Score = 56.6 bits (135),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 25/43 (58%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = -3

Query  131  ILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            +L+L      A A+DP P+QDFCVAV + ++AVFVNGK CKNP
Sbjct  13   LLVLQETIFVASAFDPSPLQDFCVAVDEPKSAVFVNGKFCKNP  55



>ref|XP_002265447.3| PREDICTED: uncharacterized protein LOC100242782 [Vitis vinifera]
Length=450

 Score = 58.5 bits (140),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = -3

Query  131  ILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            I +LA+    A A DP P+QDFCVAV D +T VFVNGKVCK+P
Sbjct  241  IALLAMSFFLASASDPSPLQDFCVAVNDTKTTVFVNGKVCKDP  283



>ref|XP_009773221.1| PREDICTED: germin-like protein subfamily 1 member 17 [Nicotiana 
sylvestris]
Length=236

 Score = 56.6 bits (135),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 29/57 (51%), Positives = 36/57 (63%), Gaps = 1/57 (2%)
 Frame = -3

Query  170  AITMASSLPIMKSILILALVAS-FARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            AITM+ S  I   + I A  +S  A AYD  P+QD CV V D   +VFVNGK+CK+P
Sbjct  6    AITMSMSWLITTLVAIAAFFSSQLAYAYDLNPLQDICVGVKDTNASVFVNGKICKDP  62



>ref|XP_010549632.1| PREDICTED: germin-like protein subfamily 1 member 7 isoform X3 
[Tarenaya hassleriana]
Length=114

 Score = 55.5 bits (132),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 35/53 (66%), Gaps = 1/53 (2%)
 Frame = -3

Query  161  MASSLPIMKSILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            M S   ++ + ++LA  + FA  YDP P+QDFCVA+ D    VFVNGK CK+P
Sbjct  1    MKSIHFLVTTTILLAFASPFASCYDPSPLQDFCVAIDDFN-GVFVNGKFCKDP  52



>ref|XP_010050748.1| PREDICTED: uncharacterized protein LOC104439371 [Eucalyptus grandis]
Length=448

 Score = 58.2 bits (139),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 39/54 (72%), Gaps = 4/54 (7%)
 Frame = -3

Query  164  TMASSLPIMKSILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            T+   LPI  S+LILAL  + + AYDP P+QDFCVA+ D +  VFVNGK CK+P
Sbjct  226  TIMKFLPI--SLLILALATATSFAYDPSPLQDFCVAINDPK--VFVNGKFCKDP  275



>ref|XP_002265297.3| PREDICTED: uncharacterized protein LOC100247931 [Vitis vinifera]
Length=490

 Score = 58.5 bits (140),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = -3

Query  131  ILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            I +LA+    A A DP P+QDFCVAV D +T VFVNGKVCK+P
Sbjct  12   IALLAMSFFLASASDPSPLQDFCVAVNDTKTTVFVNGKVCKDP  54


 Score = 55.8 bits (133),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = -3

Query  131  ILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            I + A+    A A DP P+QDFCVAV D +T VFVNGKVCK+P
Sbjct  281  IALSAMSFFLASASDPSPLQDFCVAVNDTKTTVFVNGKVCKDP  323



>gb|AFK34934.1| unknown [Medicago truncatula]
Length=130

 Score = 55.8 bits (133),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 27/53 (51%), Positives = 36/53 (68%), Gaps = 3/53 (6%)
 Frame = -3

Query  161  MASSLPIMKSILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            M +S+  + + L LA   S A A+DP P+QDFCVA+ D +  VFVNGK CK+P
Sbjct  1    MKTSILFVTAFLALA---SCAFAFDPSPLQDFCVAINDTKNGVFVNGKFCKDP  50



>ref|XP_007199406.1| hypothetical protein PRUPE_ppa026225mg [Prunus persica]
 gb|EMJ00605.1| hypothetical protein PRUPE_ppa026225mg [Prunus persica]
Length=226

 Score = 56.6 bits (135),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = -3

Query  143  IMKSILILALVASFARAYDPRPMQDFCVAVPDAQTAVFVNGKVCKNP  3
            +  ++ ILA  +    AYDP P+QDFCVA+    +AVFVNGK CK+P
Sbjct  7    LTSTVAILAFTSFLVSAYDPSPLQDFCVAINKPPSAVFVNGKFCKDP  53



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 520786521752