BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c24296_g3_i1 len=469 path=[9928:0-187 10116:188-225 9495:226-468]

Length=469
                                                                      Score     E

gb|EYU25871.1|  hypothetical protein MIMGU_mgv1a0229061mg               176   3e-52   
ref|XP_010095033.1|  UDP-glucuronic acid decarboxylase 1                180   3e-52   
ref|XP_009600595.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    178   3e-51   
ref|XP_011101753.1|  PREDICTED: UDP-glucuronic acid decarboxylase 6     178   3e-51   
ref|XP_009759288.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    177   3e-51   
ref|XP_011093808.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    177   4e-51   
ref|XP_009798386.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    177   5e-51   
ref|XP_009614233.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    177   7e-51   
gb|EYU28872.1|  hypothetical protein MIMGU_mgv1a013516mg                173   8e-51   
ref|XP_006365709.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    176   1e-50   
ref|XP_011027159.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    176   1e-50   
gb|EYU25869.1|  hypothetical protein MIMGU_mgv1a009483mg                176   2e-50   
ref|XP_002528436.1|  dtdp-glucose 4-6-dehydratase, putative             175   3e-50   Ricinus communis
gb|KDP44990.1|  hypothetical protein JCGZ_01490                         175   3e-50   
ref|XP_004236755.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    175   4e-50   
ref|XP_004142743.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    175   5e-50   
ref|XP_002315231.1|  thymidine diphospho-glucose 4-6-dehydratase ...    174   8e-50   Populus trichocarpa [western balsam poplar]
gb|AGK44108.1|  UDP-glucuronate decarboxylase protein 7                 174   1e-49   
ref|XP_008463469.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    172   1e-49   
gb|AEH04658.1|  UDP-glucuronate decarboxylase                           173   2e-49   
ref|XP_008463473.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    173   2e-49   
ref|XP_007016477.1|  UDP-XYL synthase 6 isoform 1                       172   4e-49   
ref|XP_006345947.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    172   5e-49   
ref|XP_007016481.1|  UDP-XYL synthase 5 isoform 5                       171   6e-49   
ref|XP_010685807.1|  PREDICTED: UDP-glucuronic acid decarboxylase 5     172   6e-49   
ref|XP_010253235.1|  PREDICTED: UDP-glucuronic acid decarboxylase 6     172   6e-49   
gb|AAB68605.1|  thymidine diphospho-glucose 4-6-dehydratase homolog     169   7e-49   Prunus armeniaca
ref|XP_007009383.1|  UDP-XYL synthase 6                                 171   9e-49   
gb|KHF97898.1|  UDP-glucuronic acid decarboxylase 1                     171   2e-48   
gb|KDO67669.1|  hypothetical protein CISIN_1g0190621mg                  168   2e-48   
gb|AAR07600.1|  fiber dTDP-glucose 4-6-dehydratase                      166   2e-48   Gossypium barbadense [Egyptian cotton]
ref|XP_008461666.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    170   2e-48   
ref|XP_011070932.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    170   2e-48   
ref|XP_006436028.1|  hypothetical protein CICLE_v10031983mg             168   2e-48   
ref|XP_008370795.1|  PREDICTED: UDP-glucuronic acid decarboxylase 5     170   3e-48   
ref|XP_008233600.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    170   3e-48   
emb|CDP00069.1|  unnamed protein product                                170   4e-48   
gb|KDP44213.1|  hypothetical protein JCGZ_05680                         170   4e-48   
ref|XP_011070931.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    170   4e-48   
ref|XP_011026645.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    169   7e-48   
ref|XP_007150308.1|  hypothetical protein PHAVU_005G142500g             169   7e-48   
ref|XP_009337607.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    169   8e-48   
ref|XP_010092783.1|  UDP-glucuronic acid decarboxylase 1                169   8e-48   
gb|AGV54801.1|  UDP-glucuronic acid decarboxylase 1                     169   8e-48   
ref|XP_009357704.1|  PREDICTED: UDP-glucuronic acid decarboxylase 5     169   9e-48   
ref|XP_007218257.1|  hypothetical protein PRUPE_ppa008154mg             169   1e-47   
gb|AFK35834.1|  unknown                                                 169   1e-47   
ref|XP_006436025.1|  hypothetical protein CICLE_v10031983mg             168   1e-47   
ref|NP_001289643.1|  UDP-glucuronic acid decarboxylase 1                168   1e-47   
ref|XP_010067391.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    168   1e-47   
ref|XP_002312082.1|  thymidine diphospho-glucose 4-6-dehydratase ...    168   2e-47   Populus trichocarpa [western balsam poplar]
gb|KHG30474.1|  UDP-glucuronic acid decarboxylase 1                     168   2e-47   
ref|XP_006424785.1|  hypothetical protein CICLE_v10028768mg             167   3e-47   
ref|XP_010658590.1|  PREDICTED: UDP-glucuronic acid decarboxylase 5     167   3e-47   
ref|XP_004147689.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    167   3e-47   
ref|XP_008371532.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    167   3e-47   
ref|XP_006349010.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    167   4e-47   
ref|XP_009794492.1|  PREDICTED: UDP-glucuronic acid decarboxylase 6     167   4e-47   
ref|XP_004250968.1|  PREDICTED: UDP-glucuronic acid decarboxylase 5     167   4e-47   
ref|XP_010259957.1|  PREDICTED: UDP-glucuronic acid decarboxylase 6     167   4e-47   
gb|KHG01309.1|  UDP-glucuronic acid decarboxylase 1                     167   5e-47   
gb|ACJ54442.1|  UDP-glucuronic acid decarboxylase 3                     167   5e-47   
ref|XP_002298368.2|  UDP-GLUCURONIC ACID DECARBOXYLASE family pro...    166   6e-47   Populus trichocarpa [western balsam poplar]
ref|XP_010030993.1|  PREDICTED: UDP-glucuronic acid decarboxylase 3     166   6e-47   
ref|XP_008223244.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    166   7e-47   
ref|XP_002531372.1|  dtdp-glucose 4-6-dehydratase, putative             166   7e-47   Ricinus communis
gb|AGK44107.1|  UDP-glucuronate decarboxylase protein 6                 166   7e-47   
ref|XP_002284153.1|  PREDICTED: UDP-glucuronic acid decarboxylase 6     166   8e-47   Vitis vinifera
ref|XP_007205475.1|  hypothetical protein PRUPE_ppa008066mg             166   8e-47   
gb|ABK92517.1|  unknown                                                 166   9e-47   Populus trichocarpa [western balsam poplar]
ref|NP_001239907.1|  uncharacterized protein LOC100790835               166   1e-46   
ref|NP_001240928.1|  uncharacterized protein LOC100819843               166   1e-46   
ref|XP_009600262.1|  PREDICTED: UDP-glucuronic acid decarboxylase 6     166   1e-46   
gb|AGK44104.1|  UDP-glucuronate decarboxylase protein 3                 165   2e-46   
ref|XP_011093811.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    165   2e-46   
ref|XP_003597351.1|  UDP-glucuronic acid decarboxylase                  165   2e-46   
ref|XP_004294576.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    165   3e-46   
ref|XP_008366330.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    164   3e-46   
ref|XP_010535511.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    164   3e-46   
ref|XP_007132085.1|  hypothetical protein PHAVU_011G065700g             164   3e-46   
ref|NP_001266015.1|  UDP-glucuronic acid decarboxylase 6-like           165   3e-46   
ref|XP_009358351.1|  PREDICTED: UDP-glucuronic acid decarboxylase 6     164   3e-46   
ref|XP_010043574.1|  PREDICTED: UDP-glucuronic acid decarboxylase 6     164   3e-46   
gb|AFW90530.1|  UDP-glucuronic acid decarboxylase 1-like isoform 1      164   4e-46   
ref|XP_008357523.1|  PREDICTED: UDP-glucuronic acid decarboxylase 6     164   4e-46   
ref|XP_010535508.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    164   4e-46   
emb|CDX68376.1|  BnaC01g24540D                                          164   5e-46   
ref|XP_008349711.1|  PREDICTED: UDP-glucuronic acid decarboxylase 6     164   6e-46   
ref|XP_009353708.1|  PREDICTED: UDP-glucuronic acid decarboxylase 6     164   7e-46   
ref|XP_010510584.1|  PREDICTED: UDP-glucuronic acid decarboxylase 6     163   9e-46   
emb|CDP09026.1|  unnamed protein product                                163   9e-46   
ref|NP_190228.1|  UDP-XYL synthase 5                                    163   1e-45   Arabidopsis thaliana [mouse-ear cress]
gb|ACU22991.1|  unknown                                                 162   1e-45   Glycine max [soybeans]
emb|CDY31727.1|  BnaA04g16630D                                          163   1e-45   
ref|XP_006291434.1|  hypothetical protein CARUB_v10017577mg             162   2e-45   
gb|KFK32269.1|  hypothetical protein AALP_AA6G220300                    159   2e-45   
gb|AAX37336.1|  UDP-glucuronic acid decarboxylase 3                     162   2e-45   Populus tomentosa [Chinese white poplar]
gb|KFK33978.1|  hypothetical protein AALP_AA5G086200                    162   2e-45   
ref|XP_009409525.1|  PREDICTED: UDP-glucuronic acid decarboxylase 5     162   2e-45   
ref|XP_002877483.1|  UDP-xyl synthase 5                                 162   2e-45   
ref|XP_010514963.1|  PREDICTED: UDP-glucuronic acid decarboxylase 5     162   2e-45   
ref|XP_010426076.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    162   2e-45   
ref|XP_006418896.1|  hypothetical protein EUTSA_v10002602mg             162   2e-45   
ref|XP_009103712.1|  PREDICTED: UDP-glucuronic acid decarboxylase 6     162   2e-45   
emb|CDY04584.1|  BnaA07g14100D                                          162   2e-45   
ref|XP_008803419.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    162   3e-45   
ref|XP_010520284.1|  PREDICTED: UDP-glucuronic acid decarboxylase 5     162   3e-45   
ref|XP_006294492.1|  hypothetical protein CARUB_v10023520mg             162   3e-45   
ref|XP_003539685.1|  PREDICTED: UDP-glucuronic acid decarboxylase 5     162   4e-45   
gb|KHN32112.1|  UDP-glucuronic acid decarboxylase 1                     161   5e-45   
ref|NP_180443.1|  UDP-XYL synthase 6                                    161   5e-45   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002881007.1|  hypothetical protein ARALYDRAFT_481790             161   5e-45   
ref|XP_011000276.1|  PREDICTED: UDP-glucuronic acid decarboxylase 5     161   6e-45   
ref|XP_006409908.1|  hypothetical protein EUTSA_v10016891mg             161   6e-45   
ref|XP_010521823.1|  PREDICTED: UDP-glucuronic acid decarboxylase 5     161   7e-45   
ref|XP_010937669.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    161   7e-45   
ref|XP_010907073.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    160   7e-45   
ref|XP_009419265.1|  PREDICTED: UDP-glucuronic acid decarboxylase 6     161   8e-45   
ref|XP_003538004.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    161   8e-45   
ref|XP_010503253.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    161   8e-45   
ref|XP_004487020.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    161   9e-45   
ref|XP_010922372.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    160   9e-45   
ref|XP_002866324.1|  UDP-glucuronic acid decarboxylase                  160   1e-44   
ref|XP_010922371.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    160   1e-44   
ref|XP_010454830.1|  PREDICTED: UDP-glucuronic acid decarboxylase 3     160   1e-44   
ref|XP_004487023.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    160   1e-44   
ref|XP_010907071.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    160   1e-44   
ref|XP_006400977.1|  hypothetical protein EUTSA_v10014020mg             160   1e-44   
ref|XP_009132003.1|  PREDICTED: UDP-glucuronic acid decarboxylase 3     160   1e-44   
emb|CDY02881.1|  BnaC02g10080D                                          160   1e-44   
ref|XP_010446198.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    160   1e-44   
emb|CDX71122.1|  BnaC03g12060D                                          160   2e-44   
ref|XP_006846098.1|  hypothetical protein AMTR_s00012p00122270          160   2e-44   
dbj|BAB40967.1|  UDP-D-glucuronate carboxy-lyase                        160   2e-44   Pisum sativum [garden pea]
ref|XP_006280756.1|  hypothetical protein CARUB_v10026723mg             160   2e-44   
ref|XP_009140938.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    160   2e-44   
ref|NP_001078768.1|  UDP-glucuronic acid decarboxylase 3                160   2e-44   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003543505.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    160   2e-44   
gb|AAK53026.1|AF375442_1  AT5g59290/mnc17_180                           160   2e-44   Arabidopsis thaliana [mouse-ear cress]
ref|NP_200737.1|  UDP-glucuronic acid decarboxylase 3                   159   2e-44   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009414315.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    160   3e-44   
ref|XP_008776577.1|  PREDICTED: UDP-glucuronic acid decarboxylase 6     159   4e-44   
ref|XP_009126705.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    159   5e-44   
ref|XP_008812029.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    159   5e-44   
ref|XP_010937665.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    159   7e-44   
ref|XP_008784504.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    157   2e-43   
ref|XP_003538003.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    157   3e-43   
gb|AES88860.2|  UDP-glucuronic acid decarboxylase                       156   4e-43   
gb|AFK44446.1|  unknown                                                 156   5e-43   
gb|AES88859.2|  UDP-glucuronic acid decarboxylase                       156   5e-43   
ref|NP_001130758.1|  hypothetical protein                               156   5e-43   Zea mays [maize]
ref|XP_003606663.1|  UDP-glucuronic acid decarboxylase                  156   5e-43   
ref|XP_003606662.1|  UDP-glucuronic acid decarboxylase                  156   6e-43   
ref|XP_010920649.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    155   1e-42   
ref|XP_004984746.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    156   1e-42   
gb|KCW83553.1|  hypothetical protein EUGRSUZ_B00451                     151   1e-42   
ref|XP_010029263.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    150   2e-42   
ref|XP_004984747.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    155   2e-42   
ref|XP_010920645.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    155   2e-42   
ref|XP_009403448.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    155   2e-42   
ref|XP_006649856.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    155   2e-42   
ref|NP_001049723.1|  Os03g0278000                                       154   2e-42   Oryza sativa Japonica Group [Japonica rice]
emb|CAC14890.1|  d-TDP-glucose dehydratase                              154   3e-42   Phragmites australis
ref|XP_003558221.1|  PREDICTED: UDP-glucuronic acid decarboxylase 6     154   4e-42   
gb|EEC74970.1|  hypothetical protein OsI_10996                          155   4e-42   Oryza sativa Indica Group [Indian rice]
ref|NP_001132037.1|  uncharacterized protein LOC100193447               154   5e-42   Zea mays [maize]
gb|AAT80326.1|  UDP-D-glucuronate decarboxylase                         153   9e-42   Hordeum vulgare [barley]
gb|EMS54364.1|  UDP-glucuronic acid decarboxylase 1                     153   1e-41   
gb|EMT27519.1|  UDP-glucuronic acid decarboxylase 1                     153   1e-41   
ref|XP_007132088.1|  hypothetical protein PHAVU_011G065800g             152   3e-41   
ref|XP_011070930.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    148   9e-40   
gb|ABK24241.1|  unknown                                                 148   1e-39   Picea sitchensis
ref|XP_002963158.1|  hypothetical protein SELMODRAFT_438351             143   7e-38   
ref|XP_001775323.1|  predicted protein                                  139   2e-36   
emb|CDY15778.1|  BnaC04g15460D                                          132   2e-35   
ref|XP_009387911.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    128   5e-34   
emb|CDO98853.1|  unnamed protein product                                130   6e-34   
dbj|BAI66424.1|  UDP-D-glucuronate decarboxylase                        130   7e-34   Triticum aestivum [Canadian hard winter wheat]
gb|EMS47862.1|  UDP-glucuronic acid decarboxylase 1                     129   7e-34   
gb|KHG20553.1|  UDP-glucuronic acid decarboxylase 1                     128   1e-33   
ref|XP_010098258.1|  UDP-glucuronic acid decarboxylase 1                129   1e-33   
emb|CBI22997.3|  unnamed protein product                                131   2e-33   
gb|ABK94589.1|  unknown                                                 126   2e-33   Populus trichocarpa [western balsam poplar]
ref|XP_006419549.1|  hypothetical protein CICLE_v10004959mg             132   2e-33   
ref|XP_008454336.1|  PREDICTED: UDP-glucuronic acid decarboxylase 2     132   3e-33   
gb|KDO71703.1|  hypothetical protein CISIN_1g013226mg                   132   3e-33   
ref|XP_010069913.1|  PREDICTED: UDP-glucuronic acid decarboxylase 2     132   3e-33   
ref|XP_006489058.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    132   3e-33   
ref|XP_001776651.1|  predicted protein                                  131   3e-33   
gb|EMT08059.1|  UDP-glucuronic acid decarboxylase 1                     129   3e-33   
gb|EMS60966.1|  UDP-glucuronic acid decarboxylase 1                     130   4e-33   
emb|CBI36861.3|  unnamed protein product                                127   4e-33   
gb|AAT80328.1|  UDP-D-glucuronate decarboxylase                         130   5e-33   Hordeum vulgare [barley]
gb|ABK24329.1|  unknown                                                 130   5e-33   Picea sitchensis
ref|XP_002269917.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    131   5e-33   Vitis vinifera
gb|KHN03354.1|  UDP-glucuronic acid decarboxylase 1                     128   5e-33   
ref|XP_006359374.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    131   6e-33   
ref|XP_004247418.1|  PREDICTED: UDP-glucuronic acid decarboxylase 2     131   6e-33   
gb|AAT80327.1|  UDP-D-glucuronate decarboxylase                         130   6e-33   Hordeum vulgare [barley]
ref|XP_010528269.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    130   6e-33   
ref|XP_009769287.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    130   7e-33   
gb|KHN02958.1|  UDP-glucuronic acid decarboxylase 1                     128   8e-33   
dbj|BAJ85483.1|  predicted protein                                      130   8e-33   
ref|XP_004152248.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    130   9e-33   
ref|XP_011019255.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    130   9e-33   
gb|AGK44105.1|  UDP-glucuronate decarboxylase protein 4                 130   1e-32   
ref|XP_010520999.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    130   1e-32   
ref|XP_006397963.1|  hypothetical protein EUTSA_v10001451mg             130   1e-32   
ref|XP_010519351.1|  PREDICTED: UDP-glucuronic acid decarboxylase 2     130   1e-32   
ref|XP_006294240.1|  hypothetical protein CARUB_v10023238mg             130   1e-32   
ref|XP_009133822.1|  PREDICTED: UDP-glucuronic acid decarboxylase 4     130   1e-32   
ref|XP_009783145.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    130   1e-32   
ref|XP_002534053.1|  dtdp-glucose 4-6-dehydratase, putative             129   1e-32   Ricinus communis
emb|CDP17130.1|  unnamed protein product                                126   1e-32   
ref|XP_002882125.1|  UDP-glucuronic acid decarboxylase 2                130   1e-32   
ref|XP_004508205.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    130   1e-32   
ref|XP_003591521.1|  UDP-glucuronic acid decarboxylase                  130   1e-32   
ref|XP_010507865.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    129   2e-32   
ref|NP_182287.1|  UDP-xylose synthase 4                                 129   2e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007510791.1|  predicted protein                                  128   2e-32   
ref|XP_009622783.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    129   2e-32   
emb|CBI32664.3|  unnamed protein product                                125   2e-32   
ref|XP_010506806.1|  PREDICTED: UDP-glucuronic acid decarboxylase 4     129   2e-32   
ref|XP_002309433.2|  hypothetical protein POPTR_0006s23050g             129   2e-32   Populus trichocarpa [western balsam poplar]
gb|KHG12543.1|  UDP-glucuronic acid decarboxylase 1                     129   2e-32   
ref|XP_009414893.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    129   2e-32   
ref|XP_010518480.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    129   2e-32   
ref|XP_009411672.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    129   2e-32   
gb|AGK44109.1|  UDP-glucuronate decarboxylase protein 1                 129   2e-32   
ref|XP_003550538.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    129   2e-32   
ref|XP_008784747.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    129   2e-32   
ref|XP_010684197.1|  PREDICTED: UDP-glucuronic acid decarboxylase 1     129   3e-32   
ref|XP_009104397.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    129   3e-32   
gb|ABK24464.1|  unknown                                                 129   3e-32   Picea sitchensis
ref|XP_002994140.1|  hypothetical protein SELMODRAFT_270121             129   3e-32   
ref|XP_002972645.1|  hypothetical protein SELMODRAFT_267587             129   3e-32   
ref|XP_006349950.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    128   3e-32   
ref|XP_007163113.1|  hypothetical protein PHAVU_001G207400g             128   4e-32   
ref|XP_006855561.1|  hypothetical protein AMTR_s00057p00223540          129   4e-32   
ref|XP_009389617.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    129   4e-32   
ref|XP_005650385.1|  UDP-D-glucuronic acid decarboxylase                127   4e-32   
ref|XP_008789858.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    128   4e-32   
gb|AGK44157.1|  UDP-glucuronate decarboxylase protein 1                 128   5e-32   
gb|KDP28164.1|  hypothetical protein JCGZ_13935                         128   5e-32   
ref|XP_002323432.2|  hypothetical protein POPTR_0016s08130g             128   5e-32   Populus trichocarpa [western balsam poplar]
gb|AGK44144.1|  UDP-glucuronate decarboxylase protein 1                 128   5e-32   
gb|AGK44125.1|  UDP-glucuronate decarboxylase protein 1                 128   5e-32   
gb|AGK44131.1|  UDP-glucuronate decarboxylase protein 1                 128   5e-32   
ref|XP_002268787.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    128   5e-32   Vitis vinifera
ref|XP_007035620.1|  NAD(P)-binding Rossmann-fold superfamily pro...    128   5e-32   
gb|AGK44134.1|  UDP-glucuronate decarboxylase protein 1                 128   5e-32   
gb|AGK44133.1|  UDP-glucuronate decarboxylase protein 1                 128   5e-32   
gb|AGK44156.1|  UDP-glucuronate decarboxylase protein 1                 128   5e-32   
ref|XP_002876692.1|  UDP-glucuronic acid decarboxylase 2                128   5e-32   
ref|XP_004290795.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    128   5e-32   
gb|AGK44153.1|  UDP-glucuronate decarboxylase protein 1                 128   5e-32   
gb|AGK44135.1|  UDP-glucuronate decarboxylase protein 1                 128   5e-32   
gb|AGK44132.1|  UDP-glucuronate decarboxylase protein 1                 128   5e-32   
gb|AGK44122.1|  UDP-glucuronate decarboxylase protein 1                 128   5e-32   
gb|AGK44128.1|  UDP-glucuronate decarboxylase protein 1                 128   5e-32   
gb|AGK44158.1|  UDP-glucuronate decarboxylase protein 1                 128   5e-32   
gb|AGK44138.1|  UDP-glucuronate decarboxylase protein 1                 128   5e-32   
gb|AAT40109.1|  putative UDP-glucuronate decarboxylase 3                128   5e-32   Nicotiana tabacum [American tobacco]
ref|XP_010523949.1|  PREDICTED: UDP-glucuronic acid decarboxylase 2     128   5e-32   
gb|AGK44140.1|  UDP-glucuronate decarboxylase protein 1                 128   5e-32   
gb|AGK44129.1|  UDP-glucuronate decarboxylase protein 1                 128   5e-32   
gb|AGK44121.1|  UDP-glucuronate decarboxylase protein 1                 128   5e-32   
gb|AGK44147.1|  UDP-glucuronate decarboxylase protein 1                 128   5e-32   
gb|AGK44127.1|  UDP-glucuronate decarboxylase protein 1                 128   5e-32   
gb|AGK44119.1|  UDP-glucuronate decarboxylase protein 1                 128   6e-32   
gb|AGK44117.1|  UDP-glucuronate decarboxylase protein 1                 128   6e-32   
ref|XP_009417727.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    128   6e-32   
ref|XP_007050929.1|  NAD(P)-binding Rossmann-fold superfamily pro...    128   6e-32   
gb|AGK44155.1|  UDP-glucuronate decarboxylase protein 1                 128   6e-32   
gb|AGK44150.1|  UDP-glucuronate decarboxylase protein 1                 128   6e-32   
gb|KHG10803.1|  UDP-glucuronic acid decarboxylase 1                     128   6e-32   
gb|AGK44130.1|  UDP-glucuronate decarboxylase protein 1                 128   6e-32   
gb|AGK44142.1|  UDP-glucuronate decarboxylase protein 1                 128   6e-32   
ref|XP_006584022.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    128   6e-32   
gb|AGK44148.1|  UDP-glucuronate decarboxylase protein 1                 128   6e-32   
gb|AGK44116.1|  UDP-glucuronate decarboxylase protein 1                 128   6e-32   
gb|AGK44146.1|  UDP-glucuronate decarboxylase protein 1                 128   6e-32   
ref|XP_007050928.1|  NAD(P)-binding Rossmann-fold superfamily pro...    128   6e-32   
ref|XP_009602593.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    128   7e-32   
ref|XP_009382533.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    128   7e-32   
gb|ACJ54441.1|  UDP-glucuronic acid decarboxylase 2                     128   7e-32   
gb|KCW61167.1|  hypothetical protein EUGRSUZ_H03936                     127   7e-32   
ref|XP_009138714.1|  PREDICTED: UDP-glucuronic acid decarboxylase 2     128   7e-32   
gb|KHG01436.1|  UDP-glucuronic acid decarboxylase 1                     128   7e-32   
ref|XP_001769958.1|  predicted protein                                  128   7e-32   
ref|XP_003057114.1|  predicted protein                                  127   7e-32   
ref|XP_008386777.1|  PREDICTED: UDP-glucuronic acid decarboxylase 4     126   7e-32   
gb|AAX37334.1|  UDP-glucuronic acid decarboxylase 1                     128   7e-32   
ref|XP_004249606.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    128   8e-32   
ref|XP_010512678.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    128   8e-32   
gb|KDP35573.1|  hypothetical protein JCGZ_09011                         127   8e-32   
gb|KFK37504.1|  hypothetical protein AALP_AA4G266000                    127   9e-32   
ref|XP_010097372.1|  UDP-glucuronic acid decarboxylase 1                127   9e-32   
ref|XP_007154178.1|  hypothetical protein PHAVU_003G096800g             127   9e-32   
ref|XP_006402337.1|  hypothetical protein EUTSA_v10005973mg             127   9e-32   
ref|XP_010314849.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    127   9e-32   
ref|XP_006291142.1|  hypothetical protein CARUB_v10017258mg             127   9e-32   
ref|XP_010024710.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    127   9e-32   
ref|XP_009596687.1|  PREDICTED: UDP-glucuronic acid decarboxylase 2     127   9e-32   
ref|XP_010684525.1|  PREDICTED: UDP-glucuronic acid decarboxylase 2     127   1e-31   
gb|AGK44136.1|  UDP-glucuronate decarboxylase protein 1                 127   1e-31   
gb|ACF86406.1|  unknown                                                 122   1e-31   
ref|XP_006645818.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    125   1e-31   
ref|XP_004984432.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    127   1e-31   
ref|XP_011011220.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    127   1e-31   
gb|AAK32785.1|AF361617_1  AT3g62830/F26K9_260                           127   1e-31   
ref|NP_191842.1|  UDP-glucuronic acid decarboxylase                     127   1e-31   
gb|AFW77655.1|  hypothetical protein ZEAMMB73_341531                    123   1e-31   
ref|XP_008788999.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    127   1e-31   
ref|XP_010413227.1|  PREDICTED: UDP-glucuronic acid decarboxylase 2     127   1e-31   
ref|XP_003609686.1|  UDP-glucuronic acid decarboxylase                  127   1e-31   
gb|AGK44145.1|  UDP-glucuronate decarboxylase protein 1                 127   1e-31   
gb|KHN03722.1|  UDP-glucuronic acid decarboxylase 1                     125   1e-31   
ref|XP_010468914.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    127   1e-31   
ref|XP_011079661.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    127   1e-31   
ref|XP_009779106.1|  PREDICTED: UDP-glucuronic acid decarboxylase 2     127   1e-31   
ref|XP_010259550.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    127   1e-31   
ref|XP_001763355.1|  predicted protein                                  127   1e-31   
ref|XP_004495956.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    127   1e-31   
ref|XP_010937727.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    127   1e-31   
ref|XP_010938386.1|  PREDICTED: LOW QUALITY PROTEIN: UDP-glucuron...    127   1e-31   
ref|XP_009421356.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    127   1e-31   
gb|KFK35463.1|  hypothetical protein AALP_AA5G287200                    127   1e-31   
ref|XP_007200976.1|  hypothetical protein PRUPE_ppa004626mg             127   1e-31   
ref|XP_011011217.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    127   1e-31   
ref|XP_007144481.1|  hypothetical protein PHAVU_007G159700g             127   1e-31   
ref|XP_008235095.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    127   1e-31   
ref|XP_002506033.1|  predicted protein                                  126   1e-31   
emb|CDY67354.1|  BnaA09g54730D                                          127   1e-31   
ref|XP_009631491.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    127   2e-31   
gb|AGK44159.1|  UDP-glucuronate decarboxylase protein 1                 127   2e-31   
ref|XP_009800368.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    127   2e-31   
emb|CDX73548.1|  BnaC08g24550D                                          127   2e-31   
gb|AAT40110.1|  putative UDP-glucuronate decarboxylase 4                127   2e-31   
gb|EPS69228.1|  hypothetical protein M569_05539                         127   2e-31   
ref|XP_011082471.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    127   2e-31   
gb|EYU43965.1|  hypothetical protein MIMGU_mgv1a013177mg                123   2e-31   
ref|XP_002440972.1|  hypothetical protein SORBIDRAFT_09g018070          127   2e-31   
ref|XP_011007309.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    127   2e-31   
gb|EAY73734.1|  hypothetical protein OsI_01609                          123   2e-31   
ref|XP_009116044.1|  PREDICTED: UDP-glucuronic acid decarboxylase 1     126   2e-31   
gb|AGK44103.1|  UDP-glucuronate decarboxylase protein 2                 126   2e-31   
ref|XP_008789000.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    126   2e-31   
ref|XP_003568619.1|  PREDICTED: UDP-glucuronic acid decarboxylase 2     126   2e-31   
gb|KHN49005.1|  UDP-glucuronic acid decarboxylase 1                     123   2e-31   
ref|XP_004302799.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    126   2e-31   
emb|CAN76038.1|  hypothetical protein VITISV_005029                     126   2e-31   
ref|XP_009787388.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    126   2e-31   
ref|XP_010269565.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    126   2e-31   
gb|ABK92487.1|  unknown                                                 126   2e-31   
ref|XP_002301480.1|  UDP-XYLOSE SYNTHASE 4 family protein               126   2e-31   
ref|XP_006386738.1|  hypothetical protein POPTR_0002s20570g             126   2e-31   
gb|AFW77654.1|  hypothetical protein ZEAMMB73_341531                    123   2e-31   
ref|XP_006428995.1|  hypothetical protein CICLE_v10011665mg             126   3e-31   
ref|XP_002277802.1|  PREDICTED: UDP-glucuronic acid decarboxylase 1     126   3e-31   
gb|KDO49814.1|  hypothetical protein CISIN_1g014011mg                   126   3e-31   
ref|XP_009348817.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    126   3e-31   
gb|AAL65400.1|  dTDP-glucose 4-6-dehydratase-like protein               122   3e-31   
emb|CDY25119.1|  BnaC06g18610D                                          126   3e-31   
gb|KHG20895.1|  UDP-glucuronic acid decarboxylase 1                     123   3e-31   
ref|XP_007027130.1|  UDP-glucuronic acid decarboxylase 1 isoform 1      126   3e-31   
ref|XP_002465293.1|  hypothetical protein SORBIDRAFT_01g035730          126   3e-31   
ref|XP_008340799.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    126   3e-31   
ref|XP_006480725.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    126   3e-31   
ref|XP_011094795.1|  PREDICTED: UDP-glucuronic acid decarboxylase 1     126   3e-31   
gb|AFW81508.1|  hypothetical protein ZEAMMB73_704580                    122   3e-31   
ref|XP_006575782.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    125   3e-31   
ref|XP_006342840.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    125   3e-31   
gb|KHG08309.1|  UDP-glucuronic acid decarboxylase 1                     120   4e-31   
ref|XP_009624356.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    126   4e-31   
ref|XP_007227467.1|  hypothetical protein PRUPE_ppa008317mg             125   4e-31   
gb|AGK44137.1|  UDP-glucuronate decarboxylase protein 1                 125   4e-31   
gb|AGK44106.1|  UDP-glucuronate decarboxylase protein 5                 126   4e-31   
ref|XP_004229249.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    125   4e-31   
ref|XP_003536125.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    125   4e-31   
ref|XP_011033535.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    125   4e-31   
ref|XP_002321005.1|  UDP-XYLOSE SYNTHASE 4 family protein               125   4e-31   
gb|KHN08684.1|  UDP-glucuronic acid decarboxylase 1                     125   4e-31   
ref|XP_010530427.1|  PREDICTED: UDP-glucuronic acid decarboxylase 1     125   4e-31   
gb|KHN43508.1|  UDP-glucuronic acid decarboxylase 1                     125   4e-31   
gb|AGK44143.1|  UDP-glucuronate decarboxylase protein 1                 125   4e-31   
ref|XP_006363689.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    125   4e-31   
ref|XP_002523086.1|  dtdp-glucose 4-6-dehydratase, putative             125   5e-31   
ref|XP_006444354.1|  hypothetical protein CICLE_v10020167mg             125   5e-31   
ref|XP_006345671.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    125   5e-31   
ref|XP_006479962.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    125   5e-31   
ref|XP_006654306.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    123   5e-31   
ref|XP_003567612.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    125   6e-31   
ref|XP_011077418.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    125   6e-31   
ref|XP_006293145.1|  hypothetical protein CARUB_v10019457mg             125   6e-31   
ref|XP_001769957.1|  predicted protein                                  125   6e-31   
ref|XP_008387753.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    124   6e-31   
ref|XP_003553652.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    125   7e-31   
ref|XP_003520738.2|  PREDICTED: UDP-glucuronic acid decarboxylase...    125   7e-31   
ref|XP_004962322.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    125   7e-31   
emb|CDX76206.1|  BnaA04g04700D                                          125   7e-31   
ref|XP_008369016.1|  PREDICTED: UDP-glucuronic acid decarboxylase 2     125   7e-31   
ref|XP_009139397.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    125   7e-31   
gb|KHN20398.1|  UDP-glucuronic acid decarboxylase 1                     125   7e-31   
ref|XP_009335739.1|  PREDICTED: UDP-glucuronic acid decarboxylase 2     125   8e-31   
ref|XP_008369838.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    125   8e-31   
gb|EYU46664.1|  hypothetical protein MIMGU_mgv1a006713mg                125   8e-31   
ref|XP_008223207.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    125   8e-31   
ref|XP_009335683.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    125   8e-31   
emb|CDY30862.1|  BnaC04g27170D                                          125   8e-31   
ref|XP_009352283.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    125   9e-31   
ref|XP_008241657.1|  PREDICTED: UDP-glucuronic acid decarboxylase 1     125   9e-31   
ref|XP_007205215.1|  hypothetical protein PRUPE_ppa005905mg             125   9e-31   
gb|AAX37335.1|  UDP-glucuronic acid decarboxylase 2                     125   9e-31   
ref|XP_010931658.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    124   1e-30   
ref|XP_004298135.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    124   1e-30   
ref|XP_010922431.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    124   1e-30   
gb|KEH42335.1|  UDP-glucuronic acid decarboxylase                       124   1e-30   
emb|CDP06664.1|  unnamed protein product                                124   1e-30   
ref|XP_003562461.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    124   1e-30   
ref|XP_008387725.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    124   1e-30   
ref|XP_006658113.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    122   1e-30   
ref|XP_009377117.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    124   2e-30   
gb|KHN05938.1|  UDP-glucuronic acid decarboxylase 1                     124   2e-30   
gb|EYU41667.1|  hypothetical protein MIMGU_mgv1a006632mg                124   2e-30   
ref|NP_001042876.1|  Os01g0315800                                       124   2e-30   
ref|XP_006850637.1|  hypothetical protein AMTR_s00034p00191270          120   2e-30   
gb|KFK34603.1|  hypothetical protein AALP_AA5G167100                    124   2e-30   
ref|XP_003537209.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    124   2e-30   
gb|EEC71759.1|  hypothetical protein OsI_04351                          120   2e-30   
gb|AFW77652.1|  hypothetical protein ZEAMMB73_341531                    124   2e-30   
ref|XP_003542474.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    124   2e-30   
ref|XP_008649519.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    124   2e-30   
ref|XP_010047285.1|  PREDICTED: UDP-glucuronic acid decarboxylase 1     124   2e-30   
gb|ACI46983.1|  UDP-glucuronic acid decarboxylase 1                     123   2e-30   
gb|AFW81510.1|  hypothetical protein ZEAMMB73_704580                    123   3e-30   
ref|XP_007144320.1|  hypothetical protein PHAVU_007G146300g             123   3e-30   
gb|ACL52693.1|  unknown                                                 123   3e-30   
ref|XP_010260024.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    123   3e-30   
ref|XP_010253356.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    123   3e-30   
ref|NP_001140492.1|  uncharacterized protein LOC100272553               123   3e-30   
ref|XP_002457758.1|  hypothetical protein SORBIDRAFT_03g012980          123   3e-30   
ref|XP_009794075.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    123   3e-30   
ref|XP_004967510.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    123   3e-30   
ref|XP_010921662.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    123   3e-30   
ref|NP_001189772.1|  UDP-xylose synthase 4                              123   3e-30   
ref|XP_001421368.1|  predicted protein                                  122   3e-30   
gb|AGK44124.1|  UDP-glucuronate decarboxylase protein 1                 123   4e-30   
ref|XP_008783601.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    122   4e-30   
ref|XP_004494986.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    123   4e-30   
ref|XP_008458422.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    123   5e-30   
ref|XP_006403678.1|  hypothetical protein EUTSA_v10010296mg             123   5e-30   
ref|XP_009374642.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    122   5e-30   
ref|XP_002876209.1|  UDP-glucuronic acid decarboxylase 1                122   7e-30   
ref|XP_008350562.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    115   7e-30   
ref|XP_002968263.1|  hypothetical protein SELMODRAFT_267191             121   8e-30   
ref|XP_004958670.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    122   9e-30   
ref|XP_002976115.1|  hypothetical protein SELMODRAFT_443053             122   9e-30   
ref|XP_009404621.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    122   9e-30   
ref|NP_001044737.1|  Os01g0837300                                       121   1e-29   
dbj|BAD73406.1|  UDP-glucuronic acid decarboxylase                      121   1e-29   
ref|XP_009341642.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    122   1e-29   
gb|AFW77656.1|  hypothetical protein ZEAMMB73_341531                    115   1e-29   
gb|AAV31405.1|  putative UDP-glucuronic acid decarboxylase              122   1e-29   
ref|NP_001055318.1|  Os05g0363200                                       121   1e-29   
ref|XP_010504116.1|  PREDICTED: UDP-glucuronic acid decarboxylase 1     121   1e-29   
gb|ACN33277.1|  unknown                                                 119   1e-29   
gb|EAZ14079.1|  hypothetical protein OsJ_04003                          121   1e-29   
gb|EEE67804.1|  hypothetical protein OsJ_25550                          121   2e-29   
ref|XP_008390646.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    121   2e-29   
ref|XP_008812272.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    121   2e-29   
gb|EPS72114.1|  hypothetical protein M569_02642                         121   2e-29   
gb|EEE63432.1|  hypothetical protein OsJ_18245                          121   2e-29   
gb|EAZ05112.1|  hypothetical protein OsI_27304                          121   2e-29   
ref|NP_001060612.1|  Os07g0674100                                       121   2e-29   
ref|XP_010427004.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    121   2e-29   
gb|EYU38483.1|  hypothetical protein MIMGU_mgv1a006574mg                121   2e-29   
ref|XP_008442593.1|  PREDICTED: UDP-glucuronic acid decarboxylase 1     120   3e-29   
ref|XP_003564565.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    120   3e-29   
dbj|BAJ95172.1|  predicted protein                                      120   3e-29   
ref|XP_011090988.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    120   3e-29   
gb|AAT80325.1|  UDP-D-glucuronate decarboxylase                         120   3e-29   
ref|NP_850694.2|  UDP-glucuronic acid decarboxylase 1                   120   4e-29   
ref|NP_001145832.1|  uncharacterized protein LOC100279339               119   4e-29   
gb|EMS54627.1|  UDP-glucuronic acid decarboxylase 1                     118   4e-29   
ref|XP_003083159.1|  GDP-mannose 4,6 dehydratase (ISS)                  120   4e-29   
tpg|DAA54401.1|  TPA: hypothetical protein ZEAMMB73_310567              120   4e-29   
tpg|DAA54402.1|  TPA: hypothetical protein ZEAMMB73_310567              120   5e-29   
ref|XP_004137768.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    120   5e-29   
emb|CDM84875.1|  unnamed protein product                                119   5e-29   
ref|XP_002456603.1|  hypothetical protein SORBIDRAFT_03g039180          119   6e-29   
tpg|DAA56935.1|  TPA: hypothetical protein ZEAMMB73_172315              119   7e-29   
tpg|DAA56936.1|  TPA: UDP-glucuronic acid decarboxylase 1               119   7e-29   
emb|CEG01656.1|  NAD-dependent epimerase/dehydratase                    120   7e-29   
ref|XP_002955959.1|  hypothetical protein VOLCADRAFT_66420              118   7e-29   
ref|XP_006348327.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    112   8e-29   
gb|ACN36265.1|  unknown                                                 119   8e-29   
ref|NP_001151221.1|  UDP-glucuronic acid decarboxylase 1                119   8e-29   
ref|NP_001288406.1|  UDP-glucuronic acid decarboxylase 1-like           119   1e-28   
ref|XP_006644976.1|  PREDICTED: UDP-glucuronic acid decarboxylase...    119   1e-28   



>gb|EYU25871.1| hypothetical protein MIMGU_mgv1a0229061mg, partial [Erythranthe 
guttata]
Length=206

 Score =   176 bits (447),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 86/93 (92%), Positives = 91/93 (98%), Gaps = 0/93 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            MVDGLIRLMEGDNTGPINIGNPGEFTMLELA+TVKEMIN +VKIVTVENTPDDPRQRKPD
Sbjct  109  MVDGLIRLMEGDNTGPINIGNPGEFTMLELAETVKEMINPEVKIVTVENTPDDPRQRKPD  168

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRLGI  281
            ITKAKELLGWEPK+KLR+GIPLME+DFR RLGI
Sbjct  169  ITKAKELLGWEPKIKLREGIPLMEEDFRQRLGI  201



>ref|XP_010095033.1| UDP-glucuronic acid decarboxylase 1 [Morus notabilis]
 gb|EXB58139.1| UDP-glucuronic acid decarboxylase 1 [Morus notabilis]
Length=346

 Score =   180 bits (457),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 86/97 (89%), Positives = 95/97 (98%), Gaps = 0/97 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            MVDGLIRLMEG+NTGPINIGNPGEFTMLELA+TVKE+IN DV+I++VENTPDDPRQRKPD
Sbjct  250  MVDGLIRLMEGENTGPINIGNPGEFTMLELAETVKELINPDVEIISVENTPDDPRQRKPD  309

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRLGIGRKS  293
            ITKAKELLGWEPKVKLRDG+PLMEDDFRTRLG+ RK+
Sbjct  310  ITKAKELLGWEPKVKLRDGLPLMEDDFRTRLGVPRKN  346



>ref|XP_009600595.1| PREDICTED: UDP-glucuronic acid decarboxylase 5-like [Nicotiana 
tomentosiformis]
 ref|XP_009600596.1| PREDICTED: UDP-glucuronic acid decarboxylase 5-like [Nicotiana 
tomentosiformis]
 ref|XP_009600597.1| PREDICTED: UDP-glucuronic acid decarboxylase 5-like [Nicotiana 
tomentosiformis]
Length=343

 Score =   178 bits (451),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 85/97 (88%), Positives = 93/97 (96%), Gaps = 0/97 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            MVDGLIRLMEGDNTGPINIGNPGEFTMLELA+TVKE+IN +V+I+TVENTPDDPRQRKPD
Sbjct  247  MVDGLIRLMEGDNTGPINIGNPGEFTMLELAETVKELINPEVQIITVENTPDDPRQRKPD  306

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRLGIGRKS  293
            ITKAKELLGWEP +KLR+GIPLMEDDFR RLGI RK+
Sbjct  307  ITKAKELLGWEPTIKLRNGIPLMEDDFRGRLGISRKN  343



>ref|XP_011101753.1| PREDICTED: UDP-glucuronic acid decarboxylase 6 [Sesamum indicum]
 ref|XP_011101754.1| PREDICTED: UDP-glucuronic acid decarboxylase 6 [Sesamum indicum]
 ref|XP_011101755.1| PREDICTED: UDP-glucuronic acid decarboxylase 6 [Sesamum indicum]
 ref|XP_011101756.1| PREDICTED: UDP-glucuronic acid decarboxylase 6 [Sesamum indicum]
 ref|XP_011101757.1| PREDICTED: UDP-glucuronic acid decarboxylase 6 [Sesamum indicum]
Length=346

 Score =   178 bits (451),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 86/97 (89%), Positives = 94/97 (97%), Gaps = 0/97 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            MVDGLIRLMEGDNTGPIN+GNPGEFTMLELA+TVKEMIN +V+I+TVENTPDDPRQRKPD
Sbjct  250  MVDGLIRLMEGDNTGPINLGNPGEFTMLELAETVKEMINPEVEIMTVENTPDDPRQRKPD  309

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRLGIGRKS  293
            ITKAKELLGWEPK+KLRDGIPLME+DFR RLGI RK+
Sbjct  310  ITKAKELLGWEPKIKLRDGIPLMEEDFRKRLGILRKN  346



>ref|XP_009759288.1| PREDICTED: UDP-glucuronic acid decarboxylase 6-like [Nicotiana 
sylvestris]
 ref|XP_009759289.1| PREDICTED: UDP-glucuronic acid decarboxylase 6-like [Nicotiana 
sylvestris]
 ref|XP_009759290.1| PREDICTED: UDP-glucuronic acid decarboxylase 6-like [Nicotiana 
sylvestris]
Length=343

 Score =   177 bits (450),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 85/96 (89%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            MVDGLIRLMEGDNTGPINIGNPGEFTM+ELA+ VKE+IN +VKI+TVENTPDDPRQRKPD
Sbjct  247  MVDGLIRLMEGDNTGPINIGNPGEFTMIELAENVKELINPEVKIITVENTPDDPRQRKPD  306

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRLGIGRK  290
            ITKAKELLGWEPK+KLRDGIPLME+DFR RLGI RK
Sbjct  307  ITKAKELLGWEPKIKLRDGIPLMEEDFRGRLGISRK  342



>ref|XP_011093808.1| PREDICTED: UDP-glucuronic acid decarboxylase 6-like [Sesamum 
indicum]
 ref|XP_011093809.1| PREDICTED: UDP-glucuronic acid decarboxylase 6-like [Sesamum 
indicum]
Length=346

 Score =   177 bits (450),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 85/97 (88%), Positives = 92/97 (95%), Gaps = 0/97 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            MVDGLIRLMEGD TGPINIGNPGEFTMLELA+TVKE+IN +VKI+TVENTPDDPRQRKPD
Sbjct  250  MVDGLIRLMEGDQTGPINIGNPGEFTMLELAETVKELINPEVKIITVENTPDDPRQRKPD  309

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRLGIGRKS  293
            ITKAKELLGWEP +KLR+GIPLMEDDFR RLGI RK+
Sbjct  310  ITKAKELLGWEPTIKLREGIPLMEDDFRQRLGISRKN  346



>ref|XP_009798386.1| PREDICTED: UDP-glucuronic acid decarboxylase 5-like [Nicotiana 
sylvestris]
 ref|XP_009798387.1| PREDICTED: UDP-glucuronic acid decarboxylase 5-like [Nicotiana 
sylvestris]
Length=343

 Score =   177 bits (449),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 85/97 (88%), Positives = 92/97 (95%), Gaps = 0/97 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            MVDGLIRLMEGDNTGPINIGNPGEFTMLELA+TVKE+IN +V+I+TVENTPDDPRQRKPD
Sbjct  247  MVDGLIRLMEGDNTGPINIGNPGEFTMLELAETVKELINPEVQIITVENTPDDPRQRKPD  306

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRLGIGRKS  293
            ITKAKELLGWEP +KLRDGIPLMEDDFR RL I RK+
Sbjct  307  ITKAKELLGWEPTIKLRDGIPLMEDDFRGRLCISRKN  343



>ref|XP_009614233.1| PREDICTED: UDP-glucuronic acid decarboxylase 6-like [Nicotiana 
tomentosiformis]
 ref|XP_009614234.1| PREDICTED: UDP-glucuronic acid decarboxylase 6-like [Nicotiana 
tomentosiformis]
 ref|XP_009614235.1| PREDICTED: UDP-glucuronic acid decarboxylase 6-like [Nicotiana 
tomentosiformis]
 ref|XP_009614236.1| PREDICTED: UDP-glucuronic acid decarboxylase 6-like [Nicotiana 
tomentosiformis]
 ref|XP_009614237.1| PREDICTED: UDP-glucuronic acid decarboxylase 6-like [Nicotiana 
tomentosiformis]
 gb|AAT40107.1| UDP-glucuronate decarboxylase 1 [Nicotiana tabacum]
Length=343

 Score =   177 bits (448),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 84/96 (88%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            MVDGLIRLMEGDNTGPINIGNPGEFTM+ELA+ VKE+IN +VKI+TVENTPDDPRQRKPD
Sbjct  247  MVDGLIRLMEGDNTGPINIGNPGEFTMIELAENVKELINPEVKIITVENTPDDPRQRKPD  306

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRLGIGRK  290
            ITKAKEL+GWEPK+KLRDGIPLME+DFR RLGI RK
Sbjct  307  ITKAKELIGWEPKIKLRDGIPLMEEDFRGRLGISRK  342



>gb|EYU28872.1| hypothetical protein MIMGU_mgv1a013516mg [Erythranthe guttata]
Length=218

 Score =   173 bits (438),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 84/97 (87%), Positives = 92/97 (95%), Gaps = 0/97 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            MVDGL+RLMEGDNTGPINIGNPGEFTM ELA+TVKEMIN +VKI++VENTPDDPRQRKPD
Sbjct  122  MVDGLMRLMEGDNTGPINIGNPGEFTMSELAETVKEMINPEVKIISVENTPDDPRQRKPD  181

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRLGIGRKS  293
            ITKAKELLGWEPKVKL+ GIPLME+DFR RLGI RK+
Sbjct  182  ITKAKELLGWEPKVKLQQGIPLMEEDFRKRLGILRKN  218



>ref|XP_006365709.1| PREDICTED: UDP-glucuronic acid decarboxylase 6-like isoform X1 
[Solanum tuberosum]
 ref|XP_006365710.1| PREDICTED: UDP-glucuronic acid decarboxylase 6-like isoform X2 
[Solanum tuberosum]
Length=343

 Score =   176 bits (447),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 84/96 (88%), Positives = 90/96 (94%), Gaps = 0/96 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            MVDGLIRLMEGDNTGPINIGNPGEFTMLELA+ VKE+IN DV+I+TVENTPDDPRQRKPD
Sbjct  247  MVDGLIRLMEGDNTGPINIGNPGEFTMLELAENVKELINPDVQIITVENTPDDPRQRKPD  306

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRLGIGRK  290
            ITKAK LLGWEP +KL DGIPLMEDDFR+RLGI RK
Sbjct  307  ITKAKSLLGWEPTIKLSDGIPLMEDDFRSRLGISRK  342



>ref|XP_011027159.1| PREDICTED: UDP-glucuronic acid decarboxylase 6-like [Populus 
euphratica]
 ref|XP_011027160.1| PREDICTED: UDP-glucuronic acid decarboxylase 6-like [Populus 
euphratica]
 ref|XP_011027161.1| PREDICTED: UDP-glucuronic acid decarboxylase 6-like [Populus 
euphratica]
Length=346

 Score =   176 bits (446),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 82/97 (85%), Positives = 94/97 (97%), Gaps = 0/97 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            MVDGLIRLMEG+NTGPINIGNPGEFTM+ELA+TVKE+IN +VKI++VENTPDDPRQRKPD
Sbjct  250  MVDGLIRLMEGENTGPINIGNPGEFTMIELAETVKELINPEVKIISVENTPDDPRQRKPD  309

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRLGIGRKS  293
            ITKAKELLGWEPK+KLRDG+PLME+DFR RLG+ RK+
Sbjct  310  ITKAKELLGWEPKIKLRDGLPLMEEDFRQRLGVPRKN  346



>gb|EYU25869.1| hypothetical protein MIMGU_mgv1a009483mg [Erythranthe guttata]
Length=340

 Score =   176 bits (445),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 85/94 (90%), Positives = 90/94 (96%), Gaps = 0/94 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            MVDGLIRLMEGDNTGPINIGNPGEFTMLELA+TVKEMIN +VKIVTVENTPDDPRQRKPD
Sbjct  243  MVDGLIRLMEGDNTGPINIGNPGEFTMLELAETVKEMINPEVKIVTVENTPDDPRQRKPD  302

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRLGIG  284
            ITKAKE LGWEPK+KLR+GIPLME+DFR RLGI 
Sbjct  303  ITKAKETLGWEPKIKLREGIPLMEEDFRQRLGIS  336



>ref|XP_002528436.1| dtdp-glucose 4-6-dehydratase, putative [Ricinus communis]
 gb|EEF33919.1| dtdp-glucose 4-6-dehydratase, putative [Ricinus communis]
Length=346

 Score =   175 bits (444),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 84/96 (88%), Positives = 91/96 (95%), Gaps = 0/96 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            MVDGLIRLMEG+NTGPINIGNPGEFTMLELA+TVKE+IN DV+I  VENTPDDPRQRKPD
Sbjct  250  MVDGLIRLMEGENTGPINIGNPGEFTMLELAETVKELINPDVEIAKVENTPDDPRQRKPD  309

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRLGIGRK  290
            ITKAKELLGWEPK+KLRDG+PLMEDDFR RLG+ RK
Sbjct  310  ITKAKELLGWEPKIKLRDGLPLMEDDFRLRLGVPRK  345



>gb|KDP44990.1| hypothetical protein JCGZ_01490 [Jatropha curcas]
Length=346

 Score =   175 bits (444),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 84/96 (88%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            MVDGLIRLMEG+NTGPINIGNPGEFTMLELA+TVKE+IN DV+I+ VENTPDDPRQRKPD
Sbjct  250  MVDGLIRLMEGENTGPINIGNPGEFTMLELAETVKELINPDVEIIRVENTPDDPRQRKPD  309

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRLGIGRK  290
            ITKAKELLGWEPKVKLRDG+PLME+DFR RLG+ RK
Sbjct  310  ITKAKELLGWEPKVKLRDGLPLMEEDFRQRLGVPRK  345



>ref|XP_004236755.1| PREDICTED: UDP-glucuronic acid decarboxylase 6-like [Solanum 
lycopersicum]
 ref|XP_010319260.1| PREDICTED: UDP-glucuronic acid decarboxylase 6-like [Solanum 
lycopersicum]
 ref|XP_010319261.1| PREDICTED: UDP-glucuronic acid decarboxylase 6-like [Solanum 
lycopersicum]
Length=343

 Score =   175 bits (443),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 83/96 (86%), Positives = 90/96 (94%), Gaps = 0/96 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            MVDGLIRLMEGDNTGPINIGNPGEFTMLELA+ VKE+IN DV+I+TVENTPDDPRQRKPD
Sbjct  247  MVDGLIRLMEGDNTGPINIGNPGEFTMLELAENVKELINPDVQIITVENTPDDPRQRKPD  306

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRLGIGRK  290
            ITKAK +LGWEP +KL DGIPLMEDDFR+RLGI RK
Sbjct  307  ITKAKSVLGWEPTIKLSDGIPLMEDDFRSRLGISRK  342



>ref|XP_004142743.1| PREDICTED: UDP-glucuronic acid decarboxylase 1-like [Cucumis 
sativus]
 ref|XP_004156715.1| PREDICTED: UDP-glucuronic acid decarboxylase 1-like [Cucumis 
sativus]
 gb|KGN51285.1| hypothetical protein Csa_5G512920 [Cucumis sativus]
Length=346

 Score =   175 bits (443),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 84/96 (88%), Positives = 91/96 (95%), Gaps = 0/96 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            MVDGLIRLMEGDNTGPINIGNPGEFTMLELA+TVKE+IN  V+I+ VENTPDDPRQRKPD
Sbjct  250  MVDGLIRLMEGDNTGPINIGNPGEFTMLELAETVKELINPAVEIIMVENTPDDPRQRKPD  309

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRLGIGRK  290
            ITKAKELLGWEPK+KLRDG+PLMEDDFRTRL + RK
Sbjct  310  ITKAKELLGWEPKIKLRDGLPLMEDDFRTRLEVPRK  345



>ref|XP_002315231.1| thymidine diphospho-glucose 4-6-dehydratase family protein [Populus 
trichocarpa]
 ref|XP_006378724.1| hypothetical protein POPTR_0010s21420g [Populus trichocarpa]
 gb|ABK93800.1| unknown [Populus trichocarpa]
 gb|ABK94518.1| unknown [Populus trichocarpa]
 gb|EEF01402.1| thymidine diphospho-glucose 4-6-dehydratase family protein [Populus 
trichocarpa]
 gb|ERP56521.1| hypothetical protein POPTR_0010s21420g [Populus trichocarpa]
Length=346

 Score =   174 bits (441),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 81/97 (84%), Positives = 93/97 (96%), Gaps = 0/97 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            MVDGLIRLMEG+NTGPINIGNPGEFTM+ELA+ VKE+IN +VKI++VENTPDDPRQRKPD
Sbjct  250  MVDGLIRLMEGENTGPINIGNPGEFTMIELAENVKELINPEVKIISVENTPDDPRQRKPD  309

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRLGIGRKS  293
            ITKAKELLGWEPK+KLRDG+PLME+DFR RLG+ RK+
Sbjct  310  ITKAKELLGWEPKIKLRDGLPLMEEDFRQRLGVPRKN  346



>gb|AGK44108.1| UDP-glucuronate decarboxylase protein 7 [Populus tomentosa]
 gb|AGK44115.1| UDP-glucuronate decarboxylase protein 7 [Populus tomentosa]
Length=346

 Score =   174 bits (440),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 80/97 (82%), Positives = 94/97 (97%), Gaps = 0/97 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            MVDGLIRLMEG+NTGPINIGNPGEFTM+ELA+TVKE+IN +VKI++VENTPDDPRQRKPD
Sbjct  250  MVDGLIRLMEGENTGPINIGNPGEFTMIELAETVKELINPEVKIISVENTPDDPRQRKPD  309

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRLGIGRKS  293
            ITKAKE+LGWEPK+KLRDG+PLM++DFR RLG+ RK+
Sbjct  310  ITKAKEMLGWEPKIKLRDGLPLMKEDFRQRLGVPRKN  346



>ref|XP_008463469.1| PREDICTED: UDP-glucuronic acid decarboxylase 5 isoform X1 [Cucumis 
melo]
 ref|XP_008463470.1| PREDICTED: UDP-glucuronic acid decarboxylase 5 isoform X1 [Cucumis 
melo]
Length=314

 Score =   172 bits (437),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 84/97 (87%), Positives = 91/97 (94%), Gaps = 0/97 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            MVDGLIRLMEGDNTGPINIGNPGEFTMLELA+TVKE+IN  V+IV VENTPDDPRQRKPD
Sbjct  218  MVDGLIRLMEGDNTGPINIGNPGEFTMLELAETVKELINPAVEIVMVENTPDDPRQRKPD  277

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRLGIGRKS  293
            ITKAKELL WEPK+KLRDG+PLMEDDFRTRL + RK+
Sbjct  278  ITKAKELLQWEPKIKLRDGLPLMEDDFRTRLEVPRKN  314



>gb|AEH04658.1| UDP-glucuronate decarboxylase [Camellia oleifera]
Length=340

 Score =   173 bits (439),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 81/97 (84%), Positives = 92/97 (95%), Gaps = 0/97 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            MVDGLIRLMEG++TGPINIGNPGEFTMLELA+ VKE+IN DVKI+TVENTPDDPRQRKPD
Sbjct  244  MVDGLIRLMEGNDTGPINIGNPGEFTMLELAENVKELINPDVKIITVENTPDDPRQRKPD  303

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRLGIGRKS  293
            ITKAKELLGWEPK+KLRDG+P ME+DFR RLG+ +K+
Sbjct  304  ITKAKELLGWEPKIKLRDGLPFMEEDFRQRLGVPKKA  340



>ref|XP_008463473.1| PREDICTED: UDP-glucuronic acid decarboxylase 5 isoform X2 [Cucumis 
melo]
Length=350

 Score =   173 bits (439),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 84/97 (87%), Positives = 91/97 (94%), Gaps = 0/97 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            MVDGLIRLMEGDNTGPINIGNPGEFTMLELA+TVKE+IN  V+IV VENTPDDPRQRKPD
Sbjct  254  MVDGLIRLMEGDNTGPINIGNPGEFTMLELAETVKELINPAVEIVMVENTPDDPRQRKPD  313

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRLGIGRKS  293
            ITKAKELL WEPK+KLRDG+PLMEDDFRTRL + RK+
Sbjct  314  ITKAKELLQWEPKIKLRDGLPLMEDDFRTRLEVPRKN  350



>ref|XP_007016477.1| UDP-XYL synthase 6 isoform 1 [Theobroma cacao]
 ref|XP_007016478.1| UDP-XYL synthase 6 isoform 1 [Theobroma cacao]
 ref|XP_007016479.1| UDP-XYL synthase 6 isoform 1 [Theobroma cacao]
 ref|XP_007016480.1| UDP-XYL synthase 6 isoform 1 [Theobroma cacao]
 gb|EOY34096.1| UDP-XYL synthase 6 isoform 1 [Theobroma cacao]
 gb|EOY34097.1| UDP-XYL synthase 6 isoform 1 [Theobroma cacao]
 gb|EOY34098.1| UDP-XYL synthase 6 isoform 1 [Theobroma cacao]
 gb|EOY34099.1| UDP-XYL synthase 6 isoform 1 [Theobroma cacao]
Length=346

 Score =   172 bits (436),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 82/96 (85%), Positives = 91/96 (95%), Gaps = 0/96 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            MVDGLIRLMEG+NTGPINIGNPGEFTMLELA+TVKE+IN +V+I TVENTPDDPRQRKPD
Sbjct  250  MVDGLIRLMEGENTGPINIGNPGEFTMLELAETVKELINPEVEIKTVENTPDDPRQRKPD  309

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRLGIGRK  290
            I KAKELLGWEPKVKLRDG+PLME+DFR RLG+ +K
Sbjct  310  IAKAKELLGWEPKVKLRDGLPLMEEDFRLRLGVSKK  345



>ref|XP_006345947.1| PREDICTED: UDP-glucuronic acid decarboxylase 6-like isoform X1 
[Solanum tuberosum]
 ref|XP_006345948.1| PREDICTED: UDP-glucuronic acid decarboxylase 6-like isoform X2 
[Solanum tuberosum]
Length=343

 Score =   172 bits (436),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 82/96 (85%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            MV+GL+RLM+G+NTGPINIGNPGEFTMLELA+ VKE+IN +VKI+TVENTPDDPRQRKPD
Sbjct  247  MVNGLMRLMDGENTGPINIGNPGEFTMLELAENVKELINPEVKIITVENTPDDPRQRKPD  306

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRLGIGRK  290
            ITKAKELLGWEPKVKLRDG+PLME+DFR RLGI RK
Sbjct  307  ITKAKELLGWEPKVKLRDGLPLMEEDFRDRLGISRK  342



>ref|XP_007016481.1| UDP-XYL synthase 5 isoform 5 [Theobroma cacao]
 gb|EOY34100.1| UDP-XYL synthase 5 isoform 5 [Theobroma cacao]
Length=327

 Score =   171 bits (434),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 82/96 (85%), Positives = 91/96 (95%), Gaps = 0/96 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            MVDGLIRLMEG+NTGPINIGNPGEFTMLELA+TVKE+IN +V+I TVENTPDDPRQRKPD
Sbjct  231  MVDGLIRLMEGENTGPINIGNPGEFTMLELAETVKELINPEVEIKTVENTPDDPRQRKPD  290

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRLGIGRK  290
            I KAKELLGWEPKVKLRDG+PLME+DFR RLG+ +K
Sbjct  291  IAKAKELLGWEPKVKLRDGLPLMEEDFRLRLGVSKK  326



>ref|XP_010685807.1| PREDICTED: UDP-glucuronic acid decarboxylase 5 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010685808.1| PREDICTED: UDP-glucuronic acid decarboxylase 5 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010685809.1| PREDICTED: UDP-glucuronic acid decarboxylase 5 [Beta vulgaris 
subsp. vulgaris]
Length=342

 Score =   172 bits (435),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 81/93 (87%), Positives = 91/93 (98%), Gaps = 0/93 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            MVDGLIRLMEG+NTGPINIGNPGEFTMLELA+TVKE+IN +VKI++V+NTPDDPRQRKPD
Sbjct  247  MVDGLIRLMEGENTGPINIGNPGEFTMLELAETVKELINPNVKIISVDNTPDDPRQRKPD  306

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRLGI  281
            ITKAKELLGWEPKVKLR+G+PLMEDDFR RLG+
Sbjct  307  ITKAKELLGWEPKVKLREGLPLMEDDFRLRLGV  339



>ref|XP_010253235.1| PREDICTED: UDP-glucuronic acid decarboxylase 6 [Nelumbo nucifera]
 ref|XP_010253236.1| PREDICTED: UDP-glucuronic acid decarboxylase 6 [Nelumbo nucifera]
 ref|XP_010253237.1| PREDICTED: UDP-glucuronic acid decarboxylase 6 [Nelumbo nucifera]
 ref|XP_010253238.1| PREDICTED: UDP-glucuronic acid decarboxylase 6 [Nelumbo nucifera]
Length=344

 Score =   172 bits (435),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 81/96 (84%), Positives = 90/96 (94%), Gaps = 0/96 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            MVDGLIRLMEG+NTGPINIGNPGEFTMLELA+TVKE+IN +VKI+ VENTPDDPRQRKPD
Sbjct  248  MVDGLIRLMEGENTGPINIGNPGEFTMLELAETVKELINPNVKIIMVENTPDDPRQRKPD  307

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRLGIGRK  290
            ITKA ELLGWEPKVKLRDG+P ME+DFR RLG+ +K
Sbjct  308  ITKATELLGWEPKVKLRDGLPFMEEDFRQRLGVQKK  343



>gb|AAB68605.1| thymidine diphospho-glucose 4-6-dehydratase homolog [Prunus armeniaca]
Length=265

 Score =   169 bits (429),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 80/93 (86%), Positives = 89/93 (96%), Gaps = 0/93 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            MVDGLIRLM+GDNTGPINIGNPGEFTM+ELA+ VKE+IN  V+I+ VENTPDDPRQRKPD
Sbjct  169  MVDGLIRLMQGDNTGPINIGNPGEFTMIELAENVKELINPKVEIIMVENTPDDPRQRKPD  228

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRLGI  281
            ITKAK+LLGWEPKVKLRDG+PLMEDDFRTRLG+
Sbjct  229  ITKAKDLLGWEPKVKLRDGLPLMEDDFRTRLGV  261



>ref|XP_007009383.1| UDP-XYL synthase 6 [Theobroma cacao]
 gb|EOY18193.1| UDP-XYL synthase 6 [Theobroma cacao]
Length=343

 Score =   171 bits (434),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 81/97 (84%), Positives = 90/97 (93%), Gaps = 0/97 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            MVDGLIRLMEG+NTGPINIGNPGEFTMLELA+ VKE+IN +V+I  VENTPDDPRQRKPD
Sbjct  247  MVDGLIRLMEGENTGPINIGNPGEFTMLELAEAVKELINPEVQISMVENTPDDPRQRKPD  306

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRLGIGRKS  293
            ITKAKELLGWEP VKLRDG+PLME+DFR RLG+ RK+
Sbjct  307  ITKAKELLGWEPTVKLRDGLPLMEEDFRQRLGVSRKN  343



>gb|KHF97898.1| UDP-glucuronic acid decarboxylase 1 [Gossypium arboreum]
Length=343

 Score =   171 bits (432),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 81/97 (84%), Positives = 92/97 (95%), Gaps = 0/97 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            MVDGLIRLMEG+NTGPINIGNPGEFTMLELA++VKE+IN +VKI  VENTPDDPRQRKPD
Sbjct  247  MVDGLIRLMEGENTGPINIGNPGEFTMLELAESVKELINPEVKISMVENTPDDPRQRKPD  306

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRLGIGRKS  293
            ITKAKE+LGWEPKVKLRDG+PLME+DFR RLG+ +K+
Sbjct  307  ITKAKEVLGWEPKVKLRDGLPLMEEDFRLRLGVPKKN  343



>gb|KDO67669.1| hypothetical protein CISIN_1g0190621mg, partial [Citrus sinensis]
 gb|KDO67670.1| hypothetical protein CISIN_1g0190621mg, partial [Citrus sinensis]
 gb|KDO67671.1| hypothetical protein CISIN_1g0190621mg, partial [Citrus sinensis]
Length=257

 Score =   168 bits (426),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 80/97 (82%), Positives = 89/97 (92%), Gaps = 0/97 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            MVDGLIRLMEG+NTGPINIGNPGEFTMLELA+ VKE+IN +V+I  VENTPDDPRQRKPD
Sbjct  161  MVDGLIRLMEGENTGPINIGNPGEFTMLELAENVKELINPNVEITMVENTPDDPRQRKPD  220

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRLGIGRKS  293
            ITKA ELLGWEPK+KLRDG+PLMEDDFR RL + RK+
Sbjct  221  ITKATELLGWEPKIKLRDGLPLMEDDFRLRLAVPRKN  257



>gb|AAR07600.1| fiber dTDP-glucose 4-6-dehydratase, partial [Gossypium barbadense]
Length=181

 Score =   166 bits (419),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 80/97 (82%), Positives = 90/97 (93%), Gaps = 0/97 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            MVDGLIRLMEG+NTGPINIGNPGEFTMLELA+TVKE+IN  V+I  VENTPDDPRQRKPD
Sbjct  85   MVDGLIRLMEGENTGPINIGNPGEFTMLELAETVKELINPKVEIKMVENTPDDPRQRKPD  144

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRLGIGRKS  293
            I KAKELLGWEPKVKLRDG+PLME+DFR RLG+ +++
Sbjct  145  IPKAKELLGWEPKVKLRDGLPLMEEDFRLRLGVSKEN  181



>ref|XP_008461666.1| PREDICTED: UDP-glucuronic acid decarboxylase 6-like [Cucumis 
melo]
 ref|XP_008461667.1| PREDICTED: UDP-glucuronic acid decarboxylase 6-like [Cucumis 
melo]
 ref|XP_008461668.1| PREDICTED: UDP-glucuronic acid decarboxylase 6-like [Cucumis 
melo]
Length=344

 Score =   170 bits (431),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 81/95 (85%), Positives = 90/95 (95%), Gaps = 0/95 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            MV+GLIRLMEGDNTGPINIGNPGEFTMLELA+TVKE+IN +V+IV VENTPDDPRQRKPD
Sbjct  250  MVEGLIRLMEGDNTGPINIGNPGEFTMLELAETVKELINPNVEIVMVENTPDDPRQRKPD  309

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRLGIGR  287
            ITKAKE+LGWEPK+KLRDG+PLMEDDFR RL + R
Sbjct  310  ITKAKEVLGWEPKIKLRDGLPLMEDDFRARLQVPR  344



>ref|XP_011070932.1| PREDICTED: UDP-glucuronic acid decarboxylase 5-like isoform X3 
[Sesamum indicum]
 ref|XP_011070933.1| PREDICTED: UDP-glucuronic acid decarboxylase 5-like isoform X3 
[Sesamum indicum]
Length=345

 Score =   170 bits (431),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 81/96 (84%), Positives = 89/96 (93%), Gaps = 0/96 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            MVDGLIRLMEGDNTGPINIGNP EFTMLELA+TVKEMIN  ++I+ VENTPDDPRQRKPD
Sbjct  250  MVDGLIRLMEGDNTGPINIGNPSEFTMLELAETVKEMINPAIEIIKVENTPDDPRQRKPD  309

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRLGIGRK  290
            ITKAKELLGWEP++KL DGIPLME+DFR R+GI RK
Sbjct  310  ITKAKELLGWEPRIKLHDGIPLMEEDFRKRIGILRK  345



>ref|XP_006436028.1| hypothetical protein CICLE_v10031983mg [Citrus clementina]
 gb|ESR49268.1| hypothetical protein CICLE_v10031983mg [Citrus clementina]
Length=264

 Score =   168 bits (425),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 80/97 (82%), Positives = 89/97 (92%), Gaps = 0/97 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            MVDGLIRLMEG+NTGPINIGNPGEFTMLELA+ VKE+IN +V+I  VENTPDDPRQRKPD
Sbjct  168  MVDGLIRLMEGENTGPINIGNPGEFTMLELAENVKELINPNVEITMVENTPDDPRQRKPD  227

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRLGIGRKS  293
            ITKA ELLGWEPK+KLRDG+PLMEDDFR RL + RK+
Sbjct  228  ITKATELLGWEPKIKLRDGLPLMEDDFRLRLAVPRKN  264



>ref|XP_008370795.1| PREDICTED: UDP-glucuronic acid decarboxylase 5 [Malus domestica]
 ref|XP_008370801.1| PREDICTED: UDP-glucuronic acid decarboxylase 5 [Malus domestica]
 ref|XP_008370809.1| PREDICTED: UDP-glucuronic acid decarboxylase 5 [Malus domestica]
 ref|XP_008370818.1| PREDICTED: UDP-glucuronic acid decarboxylase 5 [Malus domestica]
 ref|XP_008354119.1| PREDICTED: UDP-glucuronic acid decarboxylase 5 [Malus domestica]
 ref|XP_008354120.1| PREDICTED: UDP-glucuronic acid decarboxylase 5 [Malus domestica]
 ref|XP_008354122.1| PREDICTED: UDP-glucuronic acid decarboxylase 5 [Malus domestica]
 ref|XP_008354123.1| PREDICTED: UDP-glucuronic acid decarboxylase 5 [Malus domestica]
Length=342

 Score =   170 bits (431),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 80/93 (86%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            MVDGLIRLM+GDNTGPINIGNPGEFTMLELA+ VKE+IN  V+I+ VENTPDDPRQRKPD
Sbjct  247  MVDGLIRLMQGDNTGPINIGNPGEFTMLELAENVKELINPKVEIIMVENTPDDPRQRKPD  306

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRLGI  281
            I+KAKELLGWEPKVKLRDG+PLMEDDFR RLG+
Sbjct  307  ISKAKELLGWEPKVKLRDGLPLMEDDFRARLGV  339



>ref|XP_008233600.1| PREDICTED: UDP-glucuronic acid decarboxylase 5-like [Prunus mume]
 ref|XP_008233601.1| PREDICTED: UDP-glucuronic acid decarboxylase 5-like [Prunus mume]
Length=343

 Score =   170 bits (430),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 80/93 (86%), Positives = 89/93 (96%), Gaps = 0/93 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            MVDGLIRLM+GDNTGPINIGNPGEFTM+ELA+ VKE+IN  V+I+ VENTPDDPRQRKPD
Sbjct  247  MVDGLIRLMQGDNTGPINIGNPGEFTMIELAENVKELINPKVEIIMVENTPDDPRQRKPD  306

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRLGI  281
            ITKAK+LLGWEPKVKLRDG+PLMEDDFRTRLG+
Sbjct  307  ITKAKDLLGWEPKVKLRDGLPLMEDDFRTRLGV  339



>emb|CDP00069.1| unnamed protein product [Coffea canephora]
Length=346

 Score =   170 bits (430),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 80/97 (82%), Positives = 92/97 (95%), Gaps = 0/97 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            MVDGLIRLMEG++TGP+NIGNPGEFTM+ELA+TVKE+IN +V+I+TVENTPDDPRQRKPD
Sbjct  250  MVDGLIRLMEGEHTGPVNIGNPGEFTMIELAETVKELINPEVEIITVENTPDDPRQRKPD  309

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRLGIGRKS  293
            ITKAKELLGWEPKVKLR+G+PLME DFR RL I RK+
Sbjct  310  ITKAKELLGWEPKVKLREGLPLMEGDFRKRLEISRKN  346



>gb|KDP44213.1| hypothetical protein JCGZ_05680 [Jatropha curcas]
Length=347

 Score =   170 bits (430),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 81/97 (84%), Positives = 91/97 (94%), Gaps = 0/97 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            MVDGLIRLM+G NTGPINIGNPGEFTM+ELADTVKE+I+ DV+I  VENTPDDPRQRKPD
Sbjct  251  MVDGLIRLMQGQNTGPINIGNPGEFTMIELADTVKELISPDVEIKMVENTPDDPRQRKPD  310

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRLGIGRKS  293
            ITKAKELLGWEPKVKLRDG+PLME+DFR RLG+ +K+
Sbjct  311  ITKAKELLGWEPKVKLRDGLPLMEEDFRKRLGVPKKN  347



>ref|XP_011070931.1| PREDICTED: UDP-glucuronic acid decarboxylase 5-like isoform X2 
[Sesamum indicum]
Length=367

 Score =   170 bits (431),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 81/96 (84%), Positives = 89/96 (93%), Gaps = 0/96 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            MVDGLIRLMEGDNTGPINIGNP EFTMLELA+TVKEMIN  ++I+ VENTPDDPRQRKPD
Sbjct  272  MVDGLIRLMEGDNTGPINIGNPSEFTMLELAETVKEMINPAIEIIKVENTPDDPRQRKPD  331

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRLGIGRK  290
            ITKAKELLGWEP++KL DGIPLME+DFR R+GI RK
Sbjct  332  ITKAKELLGWEPRIKLHDGIPLMEEDFRKRIGILRK  367



>ref|XP_011026645.1| PREDICTED: UDP-glucuronic acid decarboxylase 6-like [Populus 
euphratica]
 ref|XP_011026712.1| PREDICTED: UDP-glucuronic acid decarboxylase 6-like [Populus 
euphratica]
Length=346

 Score =   169 bits (428),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 79/97 (81%), Positives = 92/97 (95%), Gaps = 0/97 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            MVDGLIRLMEG+NTGPINIGNPGEFTM+ELA+TVKE+IN +V+I+ VENTPDDPRQRKPD
Sbjct  250  MVDGLIRLMEGENTGPINIGNPGEFTMMELAETVKELINPEVEIIVVENTPDDPRQRKPD  309

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRLGIGRKS  293
            ITKAKELLGWEPK+KLRDG+PLME+DFR RL + R++
Sbjct  310  ITKAKELLGWEPKIKLRDGLPLMEEDFRRRLEVPREN  346



>ref|XP_007150308.1| hypothetical protein PHAVU_005G142500g [Phaseolus vulgaris]
 gb|ESW22302.1| hypothetical protein PHAVU_005G142500g [Phaseolus vulgaris]
Length=349

 Score =   169 bits (428),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 80/97 (82%), Positives = 91/97 (94%), Gaps = 0/97 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            +VDGLIRLMEG NTGPIN+GNPGEFTM ELA+TVKE+IN DV+I  VENTPDDPRQRKPD
Sbjct  253  LVDGLIRLMEGTNTGPINLGNPGEFTMTELAETVKELINPDVEIKMVENTPDDPRQRKPD  312

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRLGIGRKS  293
            ITKAKELLGWEPKVKLRDG+PLME++FR RLG+G+K+
Sbjct  313  ITKAKELLGWEPKVKLRDGLPLMEENFRLRLGVGKKN  349



>ref|XP_009337607.1| PREDICTED: UDP-glucuronic acid decarboxylase 5-like [Pyrus x 
bretschneideri]
 ref|XP_009337608.1| PREDICTED: UDP-glucuronic acid decarboxylase 5-like [Pyrus x 
bretschneideri]
 ref|XP_009337609.1| PREDICTED: UDP-glucuronic acid decarboxylase 5-like [Pyrus x 
bretschneideri]
Length=342

 Score =   169 bits (427),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 79/93 (85%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            MVDGLIRLM+GDNTGPINIGNPGEFTMLELA+ VKE+IN  ++I+ VENTPDDPRQRKPD
Sbjct  247  MVDGLIRLMQGDNTGPINIGNPGEFTMLELAENVKELINPKLEIIMVENTPDDPRQRKPD  306

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRLGI  281
            I+KAKELLGWEPKVKLRDG+PLMEDDFR RLG+
Sbjct  307  ISKAKELLGWEPKVKLRDGLPLMEDDFRARLGV  339



>ref|XP_010092783.1| UDP-glucuronic acid decarboxylase 1 [Morus notabilis]
 gb|EXB52248.1| UDP-glucuronic acid decarboxylase 1 [Morus notabilis]
Length=346

 Score =   169 bits (428),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 80/96 (83%), Positives = 92/96 (96%), Gaps = 0/96 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            MVDGLIRLMEG++TGPINIGNPGEFTMLELA+TVKE+IN +V+I TVENTPDDPRQRKPD
Sbjct  250  MVDGLIRLMEGEHTGPINIGNPGEFTMLELAETVKELINPNVEIKTVENTPDDPRQRKPD  309

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRLGIGRK  290
            ITKAKELLGWEPK+KLR+G+PLME+DFR RLG+ +K
Sbjct  310  ITKAKELLGWEPKIKLREGLPLMEEDFRLRLGVPKK  345



>gb|AGV54801.1| UDP-glucuronic acid decarboxylase 1 [Phaseolus vulgaris]
Length=349

 Score =   169 bits (428),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 80/97 (82%), Positives = 91/97 (94%), Gaps = 0/97 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            +VDGLIRLMEG NTGPIN+GNPGEFTM ELA+TVKE+IN DV+I  VENTPDDPRQRKPD
Sbjct  253  LVDGLIRLMEGTNTGPINLGNPGEFTMTELAETVKELINPDVEIKMVENTPDDPRQRKPD  312

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRLGIGRKS  293
            ITKAKELLGWEPKVKLRDG+PLME++FR RLG+G+K+
Sbjct  313  ITKAKELLGWEPKVKLRDGLPLMEENFRLRLGVGKKN  349



>ref|XP_009357704.1| PREDICTED: UDP-glucuronic acid decarboxylase 5 [Pyrus x bretschneideri]
 ref|XP_009357705.1| PREDICTED: UDP-glucuronic acid decarboxylase 5 [Pyrus x bretschneideri]
 ref|XP_009357706.1| PREDICTED: UDP-glucuronic acid decarboxylase 5 [Pyrus x bretschneideri]
 ref|XP_009357707.1| PREDICTED: UDP-glucuronic acid decarboxylase 5 [Pyrus x bretschneideri]
Length=342

 Score =   169 bits (427),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 79/93 (85%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            MVDGLIRLM+GDNTGPINIGNPGEFTMLELA+ VKE+IN  V+I+ VENTPDDPRQRKPD
Sbjct  247  MVDGLIRLMQGDNTGPINIGNPGEFTMLELAENVKELINPKVEIIMVENTPDDPRQRKPD  306

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRLGI  281
            I+KAKELLGWEPKVKLR+G+PLMEDDFR RLG+
Sbjct  307  ISKAKELLGWEPKVKLREGLPLMEDDFRARLGV  339



>ref|XP_007218257.1| hypothetical protein PRUPE_ppa008154mg [Prunus persica]
 ref|XP_007218258.1| hypothetical protein PRUPE_ppa008154mg [Prunus persica]
 ref|XP_007218259.1| hypothetical protein PRUPE_ppa008154mg [Prunus persica]
 ref|XP_007218260.1| hypothetical protein PRUPE_ppa008154mg [Prunus persica]
 gb|EMJ19456.1| hypothetical protein PRUPE_ppa008154mg [Prunus persica]
 gb|EMJ19457.1| hypothetical protein PRUPE_ppa008154mg [Prunus persica]
 gb|EMJ19458.1| hypothetical protein PRUPE_ppa008154mg [Prunus persica]
 gb|EMJ19459.1| hypothetical protein PRUPE_ppa008154mg [Prunus persica]
Length=343

 Score =   169 bits (427),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 80/93 (86%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            MVDGLIRLM+GDNTGPINIGNPGEFTM+ELA+ VKE+IN  V+I+ VENTPDDPRQRKPD
Sbjct  247  MVDGLIRLMQGDNTGPINIGNPGEFTMIELAENVKELINPKVEIIMVENTPDDPRQRKPD  306

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRLGI  281
            ITKAKELLGWEPKVKLRDG+PLMEDD RTRLG+
Sbjct  307  ITKAKELLGWEPKVKLRDGLPLMEDDVRTRLGV  339



>gb|AFK35834.1| unknown [Lotus japonicus]
Length=346

 Score =   169 bits (427),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 79/97 (81%), Positives = 90/97 (93%), Gaps = 0/97 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            MVDGLIRLMEG+NTGPINIGNPGEFTM+ELA+ VKE+INS V+I  +ENTPDDPRQRKPD
Sbjct  250  MVDGLIRLMEGENTGPINIGNPGEFTMIELAENVKELINSTVEIKMIENTPDDPRQRKPD  309

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRLGIGRKS  293
            I KAKELLGWEPKVKLRDG+PLME+DFR RLG+ +K+
Sbjct  310  IAKAKELLGWEPKVKLRDGLPLMEEDFRLRLGVAKKN  346



>ref|XP_006436025.1| hypothetical protein CICLE_v10031983mg [Citrus clementina]
 ref|XP_006436026.1| hypothetical protein CICLE_v10031983mg [Citrus clementina]
 ref|XP_006436027.1| hypothetical protein CICLE_v10031983mg [Citrus clementina]
 ref|XP_006486081.1| PREDICTED: UDP-glucuronic acid decarboxylase 6-like isoform X1 
[Citrus sinensis]
 ref|XP_006486082.1| PREDICTED: UDP-glucuronic acid decarboxylase 6-like isoform X2 
[Citrus sinensis]
 ref|XP_006486083.1| PREDICTED: UDP-glucuronic acid decarboxylase 6-like isoform X3 
[Citrus sinensis]
 gb|ESR49265.1| hypothetical protein CICLE_v10031983mg [Citrus clementina]
 gb|ESR49266.1| hypothetical protein CICLE_v10031983mg [Citrus clementina]
 gb|ESR49267.1| hypothetical protein CICLE_v10031983mg [Citrus clementina]
Length=346

 Score =   168 bits (426),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 80/97 (82%), Positives = 89/97 (92%), Gaps = 0/97 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            MVDGLIRLMEG+NTGPINIGNPGEFTMLELA+ VKE+IN +V+I  VENTPDDPRQRKPD
Sbjct  250  MVDGLIRLMEGENTGPINIGNPGEFTMLELAENVKELINPNVEITMVENTPDDPRQRKPD  309

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRLGIGRKS  293
            ITKA ELLGWEPK+KLRDG+PLMEDDFR RL + RK+
Sbjct  310  ITKATELLGWEPKIKLRDGLPLMEDDFRLRLAVPRKN  346



>ref|NP_001289643.1| UDP-glucuronic acid decarboxylase 1 [Eucalyptus grandis]
 gb|ACF04279.1| UDP-D-glucuronate carboxy-lyase [Eucalyptus grandis]
Length=346

 Score =   168 bits (426),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 82/97 (85%), Positives = 90/97 (93%), Gaps = 0/97 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            MVDGLIRLMEG+NTGPINIGNPGEFTM+ELA+TVKE+IN DV+I  VENTPDDPRQRKPD
Sbjct  250  MVDGLIRLMEGENTGPINIGNPGEFTMIELAETVKELINPDVEITMVENTPDDPRQRKPD  309

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRLGIGRKS  293
            ITKAKELLGWEPKVKLR+G+PLMEDDFR RL   RK+
Sbjct  310  ITKAKELLGWEPKVKLRNGLPLMEDDFRLRLDKPRKN  346



>ref|XP_010067391.1| PREDICTED: UDP-glucuronic acid decarboxylase 5-like [Eucalyptus 
grandis]
 ref|XP_010067392.1| PREDICTED: UDP-glucuronic acid decarboxylase 5-like [Eucalyptus 
grandis]
 ref|XP_010067393.1| PREDICTED: UDP-glucuronic acid decarboxylase 5-like [Eucalyptus 
grandis]
 ref|XP_010067395.1| PREDICTED: UDP-glucuronic acid decarboxylase 5-like [Eucalyptus 
grandis]
 ref|XP_010067396.1| PREDICTED: UDP-glucuronic acid decarboxylase 5-like [Eucalyptus 
grandis]
 ref|XP_010067397.1| PREDICTED: UDP-glucuronic acid decarboxylase 5-like [Eucalyptus 
grandis]
 gb|KCW65521.1| hypothetical protein EUGRSUZ_G02921 [Eucalyptus grandis]
Length=346

 Score =   168 bits (426),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 79/91 (87%), Positives = 88/91 (97%), Gaps = 0/91 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            MVDGLIRLM+GD+TGPINIGNPGEFTMLELA+ VKE+IN +VKI +VENTPDDPRQRKPD
Sbjct  250  MVDGLIRLMDGDHTGPINIGNPGEFTMLELAENVKELINPNVKIASVENTPDDPRQRKPD  309

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRL  275
            I+KAKELLGWEPKVKLRDG+PLMEDDFR+RL
Sbjct  310  ISKAKELLGWEPKVKLRDGLPLMEDDFRSRL  340



>ref|XP_002312082.1| thymidine diphospho-glucose 4-6-dehydratase family protein [Populus 
trichocarpa]
 gb|ABK95438.1| unknown [Populus trichocarpa]
 gb|EEE89449.1| thymidine diphospho-glucose 4-6-dehydratase family protein [Populus 
trichocarpa]
Length=346

 Score =   168 bits (425),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 79/97 (81%), Positives = 92/97 (95%), Gaps = 0/97 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            MVDGLIRLMEG+NTGPINIGNPGEFTM+ELA+TVKE+IN +V+I+ VENTPDDPRQRKPD
Sbjct  250  MVDGLIRLMEGENTGPINIGNPGEFTMMELAETVKELINPEVEIIGVENTPDDPRQRKPD  309

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRLGIGRKS  293
            ITKAKELLGWEPK+KLRDG+PLME+DFR RL + R++
Sbjct  310  ITKAKELLGWEPKIKLRDGLPLMEEDFRRRLEVPREN  346



>gb|KHG30474.1| UDP-glucuronic acid decarboxylase 1 [Gossypium arboreum]
Length=346

 Score =   168 bits (425),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 80/96 (83%), Positives = 90/96 (94%), Gaps = 0/96 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            MVDGLIRLMEG+NTGPINIGNPGEFTMLELA+TVKE+IN  V+I  VENTPDDPRQRKPD
Sbjct  250  MVDGLIRLMEGENTGPINIGNPGEFTMLELAETVKELINPKVEIKMVENTPDDPRQRKPD  309

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRLGIGRK  290
            ITKAKELLGWEPK+KLRDG+PLME+DFR RLG+ ++
Sbjct  310  ITKAKELLGWEPKMKLRDGLPLMEEDFRLRLGVSKE  345



>ref|XP_006424785.1| hypothetical protein CICLE_v10028768mg [Citrus clementina]
 ref|XP_006424786.1| hypothetical protein CICLE_v10028768mg [Citrus clementina]
 ref|XP_006488286.1| PREDICTED: UDP-glucuronic acid decarboxylase 6-like isoform X1 
[Citrus sinensis]
 ref|XP_006488287.1| PREDICTED: UDP-glucuronic acid decarboxylase 6-like isoform X2 
[Citrus sinensis]
 ref|XP_006488288.1| PREDICTED: UDP-glucuronic acid decarboxylase 6-like isoform X3 
[Citrus sinensis]
 gb|ESR38025.1| hypothetical protein CICLE_v10028768mg [Citrus clementina]
 gb|ESR38026.1| hypothetical protein CICLE_v10028768mg [Citrus clementina]
 gb|KDO72911.1| hypothetical protein CISIN_1g019293mg [Citrus sinensis]
 gb|KDO72912.1| hypothetical protein CISIN_1g019293mg [Citrus sinensis]
 gb|KDO72913.1| hypothetical protein CISIN_1g019293mg [Citrus sinensis]
 gb|KDO72914.1| hypothetical protein CISIN_1g019293mg [Citrus sinensis]
Length=343

 Score =   167 bits (424),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 78/97 (80%), Positives = 92/97 (95%), Gaps = 0/97 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            MVDGLIRLMEG+NTGP+NIGNPGEFTMLELA+TVKE+IN  ++I  VENTPDDPRQRKPD
Sbjct  247  MVDGLIRLMEGENTGPVNIGNPGEFTMLELAETVKELINPGIEIKMVENTPDDPRQRKPD  306

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRLGIGRKS  293
            I+KAKELLGWEPKVKLRDG+PLME+DFR+RLG+ +++
Sbjct  307  ISKAKELLGWEPKVKLRDGLPLMEEDFRSRLGVPKRN  343



>ref|XP_010658590.1| PREDICTED: UDP-glucuronic acid decarboxylase 5 [Vitis vinifera]
 ref|XP_010658591.1| PREDICTED: UDP-glucuronic acid decarboxylase 5 [Vitis vinifera]
 ref|XP_010658592.1| PREDICTED: UDP-glucuronic acid decarboxylase 5 [Vitis vinifera]
 ref|XP_010658593.1| PREDICTED: UDP-glucuronic acid decarboxylase 5 [Vitis vinifera]
 ref|XP_010658594.1| PREDICTED: UDP-glucuronic acid decarboxylase 5 [Vitis vinifera]
 emb|CAN65700.1| hypothetical protein VITISV_010481 [Vitis vinifera]
 emb|CBI31696.3| unnamed protein product [Vitis vinifera]
Length=345

 Score =   167 bits (424),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 79/95 (83%), Positives = 88/95 (93%), Gaps = 0/95 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            MVDGL+RLMEGDNTGPINIGNPGEFTMLELA+TVKE+IN  V+I  VENTPDDPRQRKPD
Sbjct  250  MVDGLVRLMEGDNTGPINIGNPGEFTMLELAETVKELINPKVEISMVENTPDDPRQRKPD  309

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRLGIGR  287
            ITKAKELLGWEP VKLR+G+PLME+DFR RLG+ +
Sbjct  310  ITKAKELLGWEPNVKLREGLPLMEEDFRLRLGVAK  344



>ref|XP_004147689.1| PREDICTED: UDP-glucuronic acid decarboxylase 1-like [Cucumis 
sativus]
 ref|XP_004168963.1| PREDICTED: UDP-glucuronic acid decarboxylase 1-like [Cucumis 
sativus]
 gb|KGN50550.1| hypothetical protein Csa_5G182060 [Cucumis sativus]
Length=344

 Score =   167 bits (424),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 79/95 (83%), Positives = 89/95 (94%), Gaps = 0/95 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            MV+GLIRLMEGDNTGPINIGNPGEFTMLELA+TVKE+IN +V+IV VENTPDDPRQRKPD
Sbjct  250  MVEGLIRLMEGDNTGPINIGNPGEFTMLELAETVKELINPNVEIVMVENTPDDPRQRKPD  309

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRLGIGR  287
            ITKA+E+LGWEPK+ LRDG+PLMEDDFR RL + R
Sbjct  310  ITKAQEVLGWEPKINLRDGLPLMEDDFRARLQVPR  344



>ref|XP_008371532.1| PREDICTED: UDP-glucuronic acid decarboxylase 5-like [Malus domestica]
 ref|XP_008371539.1| PREDICTED: UDP-glucuronic acid decarboxylase 5-like [Malus domestica]
 ref|XP_008371549.1| PREDICTED: UDP-glucuronic acid decarboxylase 5-like [Malus domestica]
 ref|XP_008371556.1| PREDICTED: UDP-glucuronic acid decarboxylase 5-like [Malus domestica]
 ref|XP_008371564.1| PREDICTED: UDP-glucuronic acid decarboxylase 5-like [Malus domestica]
Length=342

 Score =   167 bits (423),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 78/93 (84%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            MVDGLIRLM+GDNTGPINIGNPGEFTMLELA+ VKE+IN  V+I+ VENTPDDPRQRKP+
Sbjct  247  MVDGLIRLMQGDNTGPINIGNPGEFTMLELAENVKELINPKVEIIMVENTPDDPRQRKPN  306

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRLGI  281
            I+KAKELLGWEPKVKLR+G+PLMEDDFR RLG+
Sbjct  307  ISKAKELLGWEPKVKLREGLPLMEDDFRARLGV  339



>ref|XP_006349010.1| PREDICTED: UDP-glucuronic acid decarboxylase 6-like isoform X1 
[Solanum tuberosum]
 ref|XP_006349011.1| PREDICTED: UDP-glucuronic acid decarboxylase 6-like isoform X2 
[Solanum tuberosum]
Length=346

 Score =   167 bits (423),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 80/96 (83%), Positives = 89/96 (93%), Gaps = 0/96 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            MVDGLIRLMEGDNTGPINIGNPGEFTM+ELA+ VKE+I+  V+I  VENTPDDPRQRKPD
Sbjct  250  MVDGLIRLMEGDNTGPINIGNPGEFTMIELAELVKELISPKVEIKMVENTPDDPRQRKPD  309

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRLGIGRK  290
            ITKAKELLGWEPKVKLRDG+PLME+DFR RLG+ +K
Sbjct  310  ITKAKELLGWEPKVKLRDGLPLMEEDFRLRLGVSKK  345



>ref|XP_009794492.1| PREDICTED: UDP-glucuronic acid decarboxylase 6 [Nicotiana sylvestris]
 ref|XP_009794493.1| PREDICTED: UDP-glucuronic acid decarboxylase 6 [Nicotiana sylvestris]
 gb|AAT40108.1| putative UDP-glucuronate decarboxylase 2 [Nicotiana tabacum]
Length=346

 Score =   167 bits (423),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 79/96 (82%), Positives = 90/96 (94%), Gaps = 0/96 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            MV+GLIRLMEG+NTGPINIGNPGEFTM+ELA+ VKE+IN  V+I +VENTPDDPRQRKPD
Sbjct  250  MVNGLIRLMEGENTGPINIGNPGEFTMIELAELVKELINPKVEIKSVENTPDDPRQRKPD  309

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRLGIGRK  290
            ITKAKELLGWEPKVKLRDG+PLME+DFR RLG+ +K
Sbjct  310  ITKAKELLGWEPKVKLRDGLPLMEEDFRLRLGVSKK  345



>ref|XP_004250968.1| PREDICTED: UDP-glucuronic acid decarboxylase 5 [Solanum lycopersicum]
Length=346

 Score =   167 bits (423),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 80/96 (83%), Positives = 89/96 (93%), Gaps = 0/96 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            MVDGLIRLMEGDNTGPINIGNPGEFTM+ELA+ VKE+I+  V+I  VENTPDDPRQRKPD
Sbjct  250  MVDGLIRLMEGDNTGPINIGNPGEFTMIELAELVKELISPKVEIKMVENTPDDPRQRKPD  309

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRLGIGRK  290
            ITKAKELLGWEPKVKLRDG+PLME+DFR RLG+ +K
Sbjct  310  ITKAKELLGWEPKVKLRDGLPLMEEDFRLRLGVSKK  345



>ref|XP_010259957.1| PREDICTED: UDP-glucuronic acid decarboxylase 6 [Nelumbo nucifera]
 ref|XP_010259958.1| PREDICTED: UDP-glucuronic acid decarboxylase 6 [Nelumbo nucifera]
Length=345

 Score =   167 bits (422),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 78/96 (81%), Positives = 90/96 (94%), Gaps = 0/96 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            MVDGLIRLMEG++ GPIN+GNPGEFTM+ELA+TVKE+IN DVKI TVENTPDDPRQRKP+
Sbjct  250  MVDGLIRLMEGNHIGPINLGNPGEFTMMELAETVKELINPDVKITTVENTPDDPRQRKPN  309

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRLGIGRK  290
            IT+AKELLGWEPK+KLR G+PLME+DFR RLGI +K
Sbjct  310  ITRAKELLGWEPKIKLRGGLPLMEEDFRQRLGIQKK  345



>gb|KHG01309.1| UDP-glucuronic acid decarboxylase 1 [Gossypium arboreum]
Length=345

 Score =   167 bits (422),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 80/96 (83%), Positives = 90/96 (94%), Gaps = 0/96 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            MVDGLIRLMEG++TGPINIGNPGEFTM+ELA+TVKE+I  DV+I  VENTPDDPRQRKPD
Sbjct  250  MVDGLIRLMEGEHTGPINIGNPGEFTMVELAETVKELIKPDVEINMVENTPDDPRQRKPD  309

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRLGIGRK  290
            ITKAKELLGWEPKVKLRDG+PLME+DFR RLGI ++
Sbjct  310  ITKAKELLGWEPKVKLRDGLPLMEEDFRLRLGISKE  345



>gb|ACJ54442.1| UDP-glucuronic acid decarboxylase 3 [Gossypium hirsutum]
Length=345

 Score =   167 bits (422),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 80/96 (83%), Positives = 90/96 (94%), Gaps = 0/96 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            MVDGLIRLMEG++TGPINIGNPGEFTM+ELA+TVKE+I  DV+I  VENTPDDPRQRKPD
Sbjct  250  MVDGLIRLMEGEHTGPINIGNPGEFTMVELAETVKELIKPDVEINMVENTPDDPRQRKPD  309

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRLGIGRK  290
            ITKAKELLGWEPKVKLRDG+PLME+DFR RLGI ++
Sbjct  310  ITKAKELLGWEPKVKLRDGLPLMEEDFRLRLGISKE  345



>ref|XP_002298368.2| UDP-GLUCURONIC ACID DECARBOXYLASE family protein [Populus trichocarpa]
 gb|EEE83173.2| UDP-GLUCURONIC ACID DECARBOXYLASE family protein [Populus trichocarpa]
Length=329

 Score =   166 bits (420),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 80/96 (83%), Positives = 88/96 (92%), Gaps = 0/96 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            MVDGLIRLMEG+NTGPINIGNPGEFTM ELA+TVKE+IN  V+I  VENTPDDPRQRKPD
Sbjct  233  MVDGLIRLMEGENTGPINIGNPGEFTMTELAETVKELINPGVEINMVENTPDDPRQRKPD  292

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRLGIGRK  290
            ITKAK LLGWEPKVKLRDG+PLME+DFR RLG+ +K
Sbjct  293  ITKAKALLGWEPKVKLRDGLPLMEEDFRLRLGVSKK  328



>ref|XP_010030993.1| PREDICTED: UDP-glucuronic acid decarboxylase 3 [Eucalyptus grandis]
 ref|XP_010030994.1| PREDICTED: UDP-glucuronic acid decarboxylase 3 [Eucalyptus grandis]
 ref|XP_010030995.1| PREDICTED: UDP-glucuronic acid decarboxylase 3 [Eucalyptus grandis]
 gb|KCW50244.1| hypothetical protein EUGRSUZ_J00040 [Eucalyptus grandis]
 gb|KCW50245.1| hypothetical protein EUGRSUZ_J00040 [Eucalyptus grandis]
 gb|KCW50246.1| hypothetical protein EUGRSUZ_J00040 [Eucalyptus grandis]
 gb|KCW50247.1| hypothetical protein EUGRSUZ_J00040 [Eucalyptus grandis]
 gb|KCW50248.1| hypothetical protein EUGRSUZ_J00040 [Eucalyptus grandis]
Length=346

 Score =   166 bits (421),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 81/97 (84%), Positives = 89/97 (92%), Gaps = 0/97 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            MVDGLIRLMEG+NTGPINIGNPGEFTM+ELA+TVKE+IN DV+I  VENTPDDPRQRKPD
Sbjct  250  MVDGLIRLMEGENTGPINIGNPGEFTMIELAETVKELINPDVEITMVENTPDDPRQRKPD  309

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRLGIGRKS  293
            ITKA ELLGWEPKVKLR+G+PLMEDDFR RL   RK+
Sbjct  310  ITKANELLGWEPKVKLRNGLPLMEDDFRLRLDKPRKN  346



>ref|XP_008223244.1| PREDICTED: UDP-glucuronic acid decarboxylase 5 isoform X2 [Prunus 
mume]
Length=314

 Score =   166 bits (419),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 79/97 (81%), Positives = 90/97 (93%), Gaps = 0/97 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            MVDGLIRLMEG++TGPINIGNPGEFTMLELA+TVKE+IN  V+I  VENTPDDPRQRKPD
Sbjct  218  MVDGLIRLMEGEHTGPINIGNPGEFTMLELAETVKELINPGVEIKRVENTPDDPRQRKPD  277

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRLGIGRKS  293
            ITKAKELLGWEPK+KLR+G+PLME+DFR RLG  +K+
Sbjct  278  ITKAKELLGWEPKIKLREGLPLMEEDFRLRLGAAKKN  314



>ref|XP_002531372.1| dtdp-glucose 4-6-dehydratase, putative [Ricinus communis]
 gb|EEF31020.1| dtdp-glucose 4-6-dehydratase, putative [Ricinus communis]
Length=346

 Score =   166 bits (421),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 79/93 (85%), Positives = 89/93 (96%), Gaps = 0/93 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            MV GLIRLMEG+NTGPINIGNPGEFTM+ELA+TVKE+IN +V+I  VENTPDDPRQRKPD
Sbjct  250  MVYGLIRLMEGENTGPINIGNPGEFTMIELAETVKELINPEVEINMVENTPDDPRQRKPD  309

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRLGI  281
            ITKAKELLGWEPKVKLR+G+PLME+DFRTRLG+
Sbjct  310  ITKAKELLGWEPKVKLRNGLPLMEEDFRTRLGV  342



>gb|AGK44107.1| UDP-glucuronate decarboxylase protein 6 [Populus tomentosa]
 gb|AGK44114.1| UDP-glucuronate decarboxylase protein 6 [Populus tomentosa]
Length=346

 Score =   166 bits (421),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 78/97 (80%), Positives = 90/97 (93%), Gaps = 0/97 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            MVDGLIRLMEG+NTGPINIGNPGEFTM+ELA+T KE+IN  V+I+ VENTPDDPRQRKPD
Sbjct  250  MVDGLIRLMEGENTGPINIGNPGEFTMMELAETAKELINPQVEIIGVENTPDDPRQRKPD  309

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRLGIGRKS  293
            ITKAKELLGWEPK+KLRDG+PLME+DFR RL + R++
Sbjct  310  ITKAKELLGWEPKIKLRDGLPLMEEDFRRRLEVPREN  346



>ref|XP_002284153.1| PREDICTED: UDP-glucuronic acid decarboxylase 6 [Vitis vinifera]
 ref|XP_010651048.1| PREDICTED: UDP-glucuronic acid decarboxylase 6 [Vitis vinifera]
 emb|CAN80550.1| hypothetical protein VITISV_019391 [Vitis vinifera]
 emb|CBI16166.3| unnamed protein product [Vitis vinifera]
Length=346

 Score =   166 bits (421),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 79/96 (82%), Positives = 90/96 (94%), Gaps = 0/96 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            MVDGLIRLMEG+NTGPINIGNPGEFTMLELA+TVKE+IN +V I  V+NTPDDPRQRKPD
Sbjct  250  MVDGLIRLMEGENTGPINIGNPGEFTMLELAETVKELINPEVVIKMVDNTPDDPRQRKPD  309

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRLGIGRK  290
            I+KAKELLGWEPK+KLRDG+PLME+DFR RLG+ +K
Sbjct  310  ISKAKELLGWEPKIKLRDGLPLMEEDFRLRLGVPKK  345



>ref|XP_007205475.1| hypothetical protein PRUPE_ppa008066mg [Prunus persica]
 ref|XP_008223236.1| PREDICTED: UDP-glucuronic acid decarboxylase 6 isoform X1 [Prunus 
mume]
 gb|EMJ06674.1| hypothetical protein PRUPE_ppa008066mg [Prunus persica]
Length=346

 Score =   166 bits (421),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 79/97 (81%), Positives = 90/97 (93%), Gaps = 0/97 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            MVDGLIRLMEG++TGPINIGNPGEFTMLELA+TVKE+IN  V+I  VENTPDDPRQRKPD
Sbjct  250  MVDGLIRLMEGEHTGPINIGNPGEFTMLELAETVKELINPGVEIKRVENTPDDPRQRKPD  309

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRLGIGRKS  293
            ITKAKELLGWEPK+KLR+G+PLME+DFR RLG  +K+
Sbjct  310  ITKAKELLGWEPKIKLREGLPLMEEDFRLRLGAAKKN  346



>gb|ABK92517.1| unknown [Populus trichocarpa]
Length=346

 Score =   166 bits (420),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 80/96 (83%), Positives = 88/96 (92%), Gaps = 0/96 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            MVDGLIRLMEG+NTGPINIGNPGEFTM ELA+TVKE+IN  V+I  VENTPDDPRQRKPD
Sbjct  250  MVDGLIRLMEGENTGPINIGNPGEFTMTELAETVKELINPGVEINMVENTPDDPRQRKPD  309

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRLGIGRK  290
            ITKAK LLGWEPKVKLRDG+PLME+DFR RLG+ +K
Sbjct  310  ITKAKALLGWEPKVKLRDGLPLMEEDFRLRLGVSKK  345



>ref|NP_001239907.1| uncharacterized protein LOC100790835 [Glycine max]
 ref|XP_006597022.1| PREDICTED: uncharacterized protein LOC100790835 isoform X1 [Glycine 
max]
 ref|XP_006597023.1| PREDICTED: uncharacterized protein LOC100790835 isoform X2 [Glycine 
max]
 ref|XP_006597024.1| PREDICTED: uncharacterized protein LOC100790835 isoform X3 [Glycine 
max]
 ref|XP_006597025.1| PREDICTED: uncharacterized protein LOC100790835 isoform X4 [Glycine 
max]
 ref|XP_006597026.1| PREDICTED: uncharacterized protein LOC100790835 isoform X5 [Glycine 
max]
 ref|XP_006597027.1| PREDICTED: uncharacterized protein LOC100790835 isoform X6 [Glycine 
max]
 gb|ACU21211.1| unknown [Glycine max]
 gb|KHN33400.1| UDP-glucuronic acid decarboxylase 1 [Glycine soja]
Length=348

 Score =   166 bits (420),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 79/97 (81%), Positives = 89/97 (92%), Gaps = 0/97 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            +VDGLIRLMEG NTGPIN+GNPGEFTM ELA+TVKE+IN  V+I  VENTPDDPRQRKPD
Sbjct  252  LVDGLIRLMEGSNTGPINLGNPGEFTMTELAETVKELINPGVEIKMVENTPDDPRQRKPD  311

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRLGIGRKS  293
            ITKAKELLGWEPKVKLRDG+P ME+DFR RLG+G+K+
Sbjct  312  ITKAKELLGWEPKVKLRDGLPRMEEDFRLRLGVGKKN  348



>ref|NP_001240928.1| uncharacterized protein LOC100819843 [Glycine max]
 ref|XP_006591914.1| PREDICTED: uncharacterized protein LOC100819843 isoform X1 [Glycine 
max]
 ref|XP_006591915.1| PREDICTED: uncharacterized protein LOC100819843 isoform X2 [Glycine 
max]
 gb|ACU23582.1| unknown [Glycine max]
 gb|KHN32113.1| UDP-glucuronic acid decarboxylase 1 [Glycine soja]
Length=342

 Score =   166 bits (419),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 79/93 (85%), Positives = 87/93 (94%), Gaps = 0/93 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            MVDGLIRLMEG+NTGPINIGNPGEFTM+ELA+ VKE+IN  V+I  VENTPDDPRQRKPD
Sbjct  246  MVDGLIRLMEGENTGPINIGNPGEFTMIELAENVKELINPKVEINMVENTPDDPRQRKPD  305

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRLGI  281
            ITKAKELLGWEPKVKLRDG+PLME+DFR RLG+
Sbjct  306  ITKAKELLGWEPKVKLRDGLPLMEEDFRQRLGV  338



>ref|XP_009600262.1| PREDICTED: UDP-glucuronic acid decarboxylase 6 [Nicotiana tomentosiformis]
 ref|XP_009600263.1| PREDICTED: UDP-glucuronic acid decarboxylase 6 [Nicotiana tomentosiformis]
Length=346

 Score =   166 bits (419),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 78/96 (81%), Positives = 89/96 (93%), Gaps = 0/96 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            MV+GLIRLMEG+NTGPINIGNPGEFTM+ELA+ VKE+IN  V+I +VENTPDDPRQRKPD
Sbjct  250  MVNGLIRLMEGENTGPINIGNPGEFTMIELAELVKELINPKVEIKSVENTPDDPRQRKPD  309

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRLGIGRK  290
            I KAKELLGWEPKVKLRDG+PLME+DFR RLG+ +K
Sbjct  310  IAKAKELLGWEPKVKLRDGLPLMEEDFRLRLGVSKK  345



>gb|AGK44104.1| UDP-glucuronate decarboxylase protein 3 [Populus tomentosa]
Length=343

 Score =   165 bits (418),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 80/96 (83%), Positives = 88/96 (92%), Gaps = 0/96 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            MVDGLIRLMEG+NTGPINIGNPGEFTM ELA+TVKE+IN  V+I  VENTPDDPRQRKPD
Sbjct  247  MVDGLIRLMEGENTGPINIGNPGEFTMTELAETVKELINPGVEINMVENTPDDPRQRKPD  306

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRLGIGRK  290
            ITKAK LLGWEPKVKLRDG+PLME+DFR RLG+ +K
Sbjct  307  ITKAKALLGWEPKVKLRDGLPLMEEDFRLRLGVTKK  342



>ref|XP_011093811.1| PREDICTED: UDP-glucuronic acid decarboxylase 6-like [Sesamum 
indicum]
Length=344

 Score =   165 bits (418),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 80/93 (86%), Positives = 87/93 (94%), Gaps = 0/93 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            MVDGLIRLMEGD+TGPINIGNPGEFTMLELA+ VKE+IN +V+I+TVENTPDDPRQRKP 
Sbjct  248  MVDGLIRLMEGDDTGPINIGNPGEFTMLELAEAVKELINPEVQIITVENTPDDPRQRKPV  307

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRLGI  281
            ITKAKE LGWEPKVKLR+GIPLME DFR RLGI
Sbjct  308  ITKAKESLGWEPKVKLREGIPLMEADFRQRLGI  340



>ref|XP_003597351.1| UDP-glucuronic acid decarboxylase [Medicago truncatula]
 gb|ACJ85406.1| unknown [Medicago truncatula]
 gb|AES67602.1| UDP-glucuronic acid decarboxylase [Medicago truncatula]
Length=351

 Score =   165 bits (418),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 80/97 (82%), Positives = 88/97 (91%), Gaps = 0/97 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            MVDGLIRLMEG+NTGPINIGNPGEFTM ELA+ VKE+IN  V+I  VENTPDDPRQRKPD
Sbjct  255  MVDGLIRLMEGENTGPINIGNPGEFTMTELAENVKELINPAVEIKMVENTPDDPRQRKPD  314

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRLGIGRKS  293
            ITKA ELLGWEPKVKLRDG+PLME+DFR RLG+ RK+
Sbjct  315  ITKATELLGWEPKVKLRDGLPLMEEDFRLRLGVPRKN  351



>ref|XP_004294576.1| PREDICTED: UDP-glucuronic acid decarboxylase 1-like [Fragaria 
vesca subsp. vesca]
Length=346

 Score =   165 bits (417),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 78/97 (80%), Positives = 89/97 (92%), Gaps = 0/97 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            MVDGLIRLMEG++TGPINIGNPGEFTMLELA+TVKE+IN  V+I  VENTPDDPRQRKPD
Sbjct  250  MVDGLIRLMEGEHTGPINIGNPGEFTMLELAETVKELINPQVEIKRVENTPDDPRQRKPD  309

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRLGIGRKS  293
            ITKAKELLGWEPK+ LR+G+PLME+DFR RLG  +K+
Sbjct  310  ITKAKELLGWEPKITLREGLPLMEEDFRLRLGAAKKN  346



>ref|XP_008366330.1| PREDICTED: UDP-glucuronic acid decarboxylase 6-like [Malus domestica]
Length=328

 Score =   164 bits (416),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 77/96 (80%), Positives = 90/96 (94%), Gaps = 0/96 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            +VDGLIRLMEG++TGPIN+GNPGEFTMLELA+TVKE+IN +V+I  VENTPDDPRQRKPD
Sbjct  232  LVDGLIRLMEGEHTGPINLGNPGEFTMLELAETVKELINPEVEIKRVENTPDDPRQRKPD  291

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRLGIGRK  290
            ITKAKELLGWEPK+KLR+G+PLME+DFR RLG  +K
Sbjct  292  ITKAKELLGWEPKIKLREGLPLMEEDFRLRLGANKK  327



>ref|XP_010535511.1| PREDICTED: UDP-glucuronic acid decarboxylase 5 isoform X2 [Tarenaya 
hassleriana]
Length=315

 Score =   164 bits (415),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 77/93 (83%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            MVDGLIRLMEG++TGPINIGNPGEFTMLELA+TVKE+IN  ++I  VENTPDDPRQRKPD
Sbjct  221  MVDGLIRLMEGEDTGPINIGNPGEFTMLELAETVKELINPSIEIKMVENTPDDPRQRKPD  280

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRLGI  281
            ITKAK++LGWEPKVKLR+G+PLMEDDFR RLG+
Sbjct  281  ITKAKQVLGWEPKVKLREGLPLMEDDFRVRLGV  313



>ref|XP_007132085.1| hypothetical protein PHAVU_011G065700g [Phaseolus vulgaris]
 ref|XP_007132086.1| hypothetical protein PHAVU_011G065700g [Phaseolus vulgaris]
 ref|XP_007132087.1| hypothetical protein PHAVU_011G065700g [Phaseolus vulgaris]
 gb|AGV54384.1| UDP-glucuronic acid decarboxylase [Phaseolus vulgaris]
 gb|ESW04079.1| hypothetical protein PHAVU_011G065700g [Phaseolus vulgaris]
 gb|ESW04080.1| hypothetical protein PHAVU_011G065700g [Phaseolus vulgaris]
 gb|ESW04081.1| hypothetical protein PHAVU_011G065700g [Phaseolus vulgaris]
Length=342

 Score =   164 bits (416),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 79/97 (81%), Positives = 88/97 (91%), Gaps = 0/97 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            MVDGLIRLMEG+NTGPINIGNPGEFTM ELA+ VKE+IN  V+I  VENTPDDPRQRKPD
Sbjct  246  MVDGLIRLMEGENTGPINIGNPGEFTMTELAENVKELINPAVEIKMVENTPDDPRQRKPD  305

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRLGIGRKS  293
            ITKAKELLGWEPK+KLRDG+PLME+DFR RLG+  K+
Sbjct  306  ITKAKELLGWEPKIKLRDGLPLMEEDFRLRLGVPNKN  342



>ref|NP_001266015.1| UDP-glucuronic acid decarboxylase 6-like [Cicer arietinum]
 emb|CAB61752.1| dTDP-glucose 4-6-dehydratase [Cicer arietinum]
Length=346

 Score =   165 bits (417),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 79/97 (81%), Positives = 90/97 (93%), Gaps = 0/97 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            +VDGLIRLM G +TGPIN+GNPGEFTMLELA+TVKE+IN +V+I TVENTPDDPRQRKPD
Sbjct  250  LVDGLIRLMGGSDTGPINLGNPGEFTMLELAETVKELINPNVEIKTVENTPDDPRQRKPD  309

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRLGIGRKS  293
            ITKAKELLGWEPKVKLRDG+PLME DFR RLG+ +K+
Sbjct  310  ITKAKELLGWEPKVKLRDGLPLMEGDFRLRLGVDKKN  346



>ref|XP_009358351.1| PREDICTED: UDP-glucuronic acid decarboxylase 6 [Pyrus x bretschneideri]
Length=346

 Score =   164 bits (416),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 77/96 (80%), Positives = 90/96 (94%), Gaps = 0/96 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            +VDGLIRLMEG+ TGPIN+GNPGEFTMLELA+TVKE+IN +V+I  VENTPDDPRQRKPD
Sbjct  250  LVDGLIRLMEGEQTGPINLGNPGEFTMLELAETVKELINPEVEIKRVENTPDDPRQRKPD  309

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRLGIGRK  290
            ITKAKELLGWEPK+KLR+G+PLME+DFR RLG+ +K
Sbjct  310  ITKAKELLGWEPKIKLREGLPLMEEDFRLRLGVNKK  345



>ref|XP_010043574.1| PREDICTED: UDP-glucuronic acid decarboxylase 6 [Eucalyptus grandis]
 ref|XP_010043575.1| PREDICTED: UDP-glucuronic acid decarboxylase 6 [Eucalyptus grandis]
 ref|XP_010043576.1| PREDICTED: UDP-glucuronic acid decarboxylase 6 [Eucalyptus grandis]
Length=345

 Score =   164 bits (416),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 78/96 (81%), Positives = 89/96 (93%), Gaps = 0/96 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            +VDGLIRLM+G+NTGPIN+GNPGEFT+LELA TVKE+IN +V+I  VENTPDDPRQRKPD
Sbjct  249  LVDGLIRLMDGENTGPINLGNPGEFTVLELAKTVKELINPEVEIKMVENTPDDPRQRKPD  308

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRLGIGRK  290
            ITKA ELLGWEPKVKLRDG+PLME+DFRTRL I +K
Sbjct  309  ITKATELLGWEPKVKLRDGLPLMENDFRTRLAIAKK  344



>gb|AFW90530.1| UDP-glucuronic acid decarboxylase 1-like isoform 1 [Phaseolus 
vulgaris]
Length=342

 Score =   164 bits (416),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 79/97 (81%), Positives = 88/97 (91%), Gaps = 0/97 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            MVDGLIRLMEG+NTGPINIGNPGEFTM ELA+ VKE+IN  V+I  VENTPDDPRQRKPD
Sbjct  246  MVDGLIRLMEGENTGPINIGNPGEFTMTELAENVKELINPAVEIKMVENTPDDPRQRKPD  305

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRLGIGRKS  293
            ITKAKELLGWEPK+KLRDG+PLME+DFR RLG+  K+
Sbjct  306  ITKAKELLGWEPKIKLRDGLPLMEEDFRLRLGVPNKN  342



>ref|XP_008357523.1| PREDICTED: UDP-glucuronic acid decarboxylase 6 [Malus domestica]
Length=346

 Score =   164 bits (416),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 77/96 (80%), Positives = 90/96 (94%), Gaps = 0/96 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            +VDGLIRLMEG++TGPIN+GNPGEFTMLELA+TVKE+IN +V+I  VENTPDDPRQRKPD
Sbjct  250  LVDGLIRLMEGEHTGPINLGNPGEFTMLELAETVKELINPEVEIKRVENTPDDPRQRKPD  309

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRLGIGRK  290
            ITKAKELLGWEPK+KLR+G+PLME+DFR RLG+  K
Sbjct  310  ITKAKELLGWEPKIKLREGLPLMEEDFRLRLGVNEK  345



>ref|XP_010535508.1| PREDICTED: UDP-glucuronic acid decarboxylase 5 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010535509.1| PREDICTED: UDP-glucuronic acid decarboxylase 5 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010535510.1| PREDICTED: UDP-glucuronic acid decarboxylase 5 isoform X1 [Tarenaya 
hassleriana]
Length=339

 Score =   164 bits (415),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 77/93 (83%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            MVDGLIRLMEG++TGPINIGNPGEFTMLELA+TVKE+IN  ++I  VENTPDDPRQRKPD
Sbjct  245  MVDGLIRLMEGEDTGPINIGNPGEFTMLELAETVKELINPSIEIKMVENTPDDPRQRKPD  304

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRLGI  281
            ITKAK++LGWEPKVKLR+G+PLMEDDFR RLG+
Sbjct  305  ITKAKQVLGWEPKVKLREGLPLMEDDFRVRLGV  337



>emb|CDX68376.1| BnaC01g24540D [Brassica napus]
Length=341

 Score =   164 bits (415),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 77/96 (80%), Positives = 89/96 (93%), Gaps = 0/96 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            MV+GL+RLMEGD TGPINIGNPGEFTM+ELA+TVKE+IN  +KI  VENTPDDPRQRKPD
Sbjct  246  MVEGLMRLMEGDETGPINIGNPGEFTMVELAETVKELINPSIKIKMVENTPDDPRQRKPD  305

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRLGIGRK  290
            ITKAKE+LGWEPKVKLR+G+PLME+DFR RLG+ +K
Sbjct  306  ITKAKEVLGWEPKVKLREGLPLMEEDFRQRLGVPKK  341



>ref|XP_008349711.1| PREDICTED: UDP-glucuronic acid decarboxylase 6 [Malus domestica]
Length=346

 Score =   164 bits (415),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 77/96 (80%), Positives = 90/96 (94%), Gaps = 0/96 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            +VDGLIRLMEG++TGPIN+GNPGEFTMLELA+TVKE+IN +V+I  VENTPDDPRQRKPD
Sbjct  250  LVDGLIRLMEGEHTGPINLGNPGEFTMLELAETVKELINPEVEIKRVENTPDDPRQRKPD  309

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRLGIGRK  290
            ITKAKELLGWEPK+KLR+G+PLME+DFR RLG  +K
Sbjct  310  ITKAKELLGWEPKIKLREGLPLMEEDFRLRLGANKK  345



>ref|XP_009353708.1| PREDICTED: UDP-glucuronic acid decarboxylase 6 [Pyrus x bretschneideri]
 ref|XP_009353709.1| PREDICTED: UDP-glucuronic acid decarboxylase 6 [Pyrus x bretschneideri]
Length=346

 Score =   164 bits (414),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 77/96 (80%), Positives = 90/96 (94%), Gaps = 0/96 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            +VDGLIRLMEG++TGPIN+GNPGEFTMLELA+TVKE+IN +V+I  VENTPDDPRQRKPD
Sbjct  250  LVDGLIRLMEGEHTGPINLGNPGEFTMLELAETVKELINPEVEIKRVENTPDDPRQRKPD  309

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRLGIGRK  290
            ITKAKELLGWEPK+KLR+G+PLME+DFR RLG  +K
Sbjct  310  ITKAKELLGWEPKIKLREGLPLMEEDFRLRLGANKK  345



>ref|XP_010510584.1| PREDICTED: UDP-glucuronic acid decarboxylase 6 [Camelina sativa]
 ref|XP_010510585.1| PREDICTED: UDP-glucuronic acid decarboxylase 6 [Camelina sativa]
 ref|XP_010510586.1| PREDICTED: UDP-glucuronic acid decarboxylase 6 [Camelina sativa]
Length=343

 Score =   163 bits (413),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 76/96 (79%), Positives = 89/96 (93%), Gaps = 0/96 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            MVDGL+RLMEGD TGPINIGNPGEFTM+ELA+TVKE+I  D++I  VENTPDDPRQRKPD
Sbjct  248  MVDGLMRLMEGDQTGPINIGNPGEFTMVELAETVKELIKPDIEIKMVENTPDDPRQRKPD  307

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRLGIGRK  290
            I+KAKE+LGWEPKVKLR+G+PLME+DFR RLG+ +K
Sbjct  308  ISKAKEVLGWEPKVKLREGLPLMEEDFRLRLGVSKK  343



>emb|CDP09026.1| unnamed protein product [Coffea canephora]
Length=346

 Score =   163 bits (413),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 77/96 (80%), Positives = 89/96 (93%), Gaps = 0/96 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            MVDGLIRLMEG++TGPINIGNPGEFTM+ELA+TVKE+IN +++I  VENTPDDP QRKP 
Sbjct  250  MVDGLIRLMEGEHTGPINIGNPGEFTMIELAETVKELINPNIEIKMVENTPDDPSQRKPV  309

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRLGIGRK  290
            ITKAKELLGWEPKVKLRDG+PLME+DFR RLG+ +K
Sbjct  310  ITKAKELLGWEPKVKLRDGLPLMEEDFRLRLGVSKK  345



>ref|NP_190228.1| UDP-XYL synthase 5 [Arabidopsis thaliana]
 ref|NP_001030820.1| UDP-XYL synthase 5 [Arabidopsis thaliana]
 sp|Q9SN95.1|UXS5_ARATH RecName: Full=UDP-glucuronic acid decarboxylase 5; AltName: Full=UDP-XYL 
synthase 5; AltName: Full=UDP-glucuronate decarboxylase 
5; Short=UGD; Short=UXS-5 [Arabidopsis thaliana]
 emb|CAB62035.1| dTDP-glucose 4-6-dehydratases-like protein [Arabidopsis thaliana]
 gb|AAL59920.1| putative dTDP-glucose 4-6-dehydratase [Arabidopsis thaliana]
 gb|AAM20236.1| putative dTDP-glucose 4-6-dehydratases [Arabidopsis thaliana]
 gb|AAM64676.1| dTDP-glucose 4-6-dehydratases-like protein [Arabidopsis thaliana]
 dbj|BAF00515.1| dTDP-glucose 4-6-dehydratases-like protein [Arabidopsis thaliana]
 dbj|BAH20162.1| AT3G46440 [Arabidopsis thaliana]
 gb|AEE78158.1| UDP-XYL synthase 5 [Arabidopsis thaliana]
 gb|AEE78159.1| UDP-XYL synthase 5 [Arabidopsis thaliana]
Length=341

 Score =   163 bits (412),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 76/95 (80%), Positives = 89/95 (94%), Gaps = 0/95 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            MVDGL+RLMEGD+TGPINIGNPGEFTM+ELA+TVKE+IN  ++I  VENTPDDPRQRKPD
Sbjct  246  MVDGLMRLMEGDDTGPINIGNPGEFTMVELAETVKELINPSIEIKMVENTPDDPRQRKPD  305

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRLGIGR  287
            ITKAKE+LGWEPKVKLR+G+PLME+DFR RLG+ +
Sbjct  306  ITKAKEVLGWEPKVKLREGLPLMEEDFRLRLGVHK  340



>gb|ACU22991.1| unknown [Glycine max]
Length=292

 Score =   162 bits (409),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 78/97 (80%), Positives = 88/97 (91%), Gaps = 0/97 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            +VDGLIRLMEG +TGPIN+GNPGEFTMLELA+TVKE+IN DV+I  VENTPDDPRQRKP 
Sbjct  196  LVDGLIRLMEGSDTGPINLGNPGEFTMLELAETVKELINPDVEIKVVENTPDDPRQRKPI  255

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRLGIGRKS  293
            ITKA ELLGWEPKVKLRDG+PLME+DFR RLG  +K+
Sbjct  256  ITKAMELLGWEPKVKLRDGLPLMEEDFRLRLGFDKKN  292



>emb|CDY31727.1| BnaA04g16630D [Brassica napus]
 emb|CDX77205.1| BnaC04g40000D [Brassica napus]
Length=342

 Score =   163 bits (412),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 77/96 (80%), Positives = 89/96 (93%), Gaps = 0/96 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            MVDGL+RLMEGD TGPINIGNPGEFTM+ELA+TVKE+I  DV+I  VENTPDDPRQRKPD
Sbjct  247  MVDGLMRLMEGDQTGPINIGNPGEFTMVELAETVKELIKPDVEIKMVENTPDDPRQRKPD  306

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRLGIGRK  290
            I+KAKE+LGWEPKVKLR+G+PLME+DFR RLG+ +K
Sbjct  307  ISKAKEVLGWEPKVKLREGLPLMEEDFRLRLGVFKK  342



>ref|XP_006291434.1| hypothetical protein CARUB_v10017577mg [Capsella rubella]
 gb|EOA24332.1| hypothetical protein CARUB_v10017577mg [Capsella rubella]
Length=341

 Score =   162 bits (411),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 76/93 (82%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            MVDGL+RLMEGD+TGPINIGNPGEFTM+ELA+TVKE+IN  ++I  VENTPDDPRQRKPD
Sbjct  246  MVDGLMRLMEGDDTGPINIGNPGEFTMVELAETVKELINPSIEIKMVENTPDDPRQRKPD  305

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRLGI  281
            ITKAKE+LGWEPKVKLR+G+PLME+DFR RLG+
Sbjct  306  ITKAKEVLGWEPKVKLREGLPLMEEDFRLRLGV  338



>gb|KFK32269.1| hypothetical protein AALP_AA6G220300 [Arabis alpina]
Length=215

 Score =   159 bits (402),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 75/96 (78%), Positives = 89/96 (93%), Gaps = 0/96 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            MV+GL+RLMEGD TGPINIGNPGEFTM+ELA+TVKE++  DV+I  VENTPDDPRQRKPD
Sbjct  120  MVEGLMRLMEGDQTGPINIGNPGEFTMVELAETVKELMKPDVEIKMVENTPDDPRQRKPD  179

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRLGIGRK  290
            I+KAKE+LGWEPKVKLR+G+PLME+DFR RLG+ +K
Sbjct  180  ISKAKEVLGWEPKVKLREGLPLMEEDFRLRLGVLKK  215



>gb|AAX37336.1| UDP-glucuronic acid decarboxylase 3 [Populus tomentosa]
 gb|AGK44111.1| UDP-glucuronate decarboxylase protein 3 [Populus tomentosa]
Length=343

 Score =   162 bits (411),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 79/96 (82%), Positives = 87/96 (91%), Gaps = 0/96 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            MVDGLIRLMEG+NTGPINIGNPGEFTM ELA+TVKE+IN  V+I  VENTPDDPRQRKPD
Sbjct  247  MVDGLIRLMEGENTGPINIGNPGEFTMTELAETVKELINPGVEINMVENTPDDPRQRKPD  306

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRLGIGRK  290
            ITKAK LLGWEPKVKLRDG+PLME+D R RLG+ +K
Sbjct  307  ITKAKALLGWEPKVKLRDGLPLMEEDLRLRLGVTKK  342



>gb|KFK33978.1| hypothetical protein AALP_AA5G086200 [Arabis alpina]
Length=341

 Score =   162 bits (411),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 76/93 (82%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            MVDGL+RLMEGD+TGPINIGNPGEFTM+ELA+TVKE+IN  ++I  VENTPDDPRQRKPD
Sbjct  246  MVDGLMRLMEGDDTGPINIGNPGEFTMVELAETVKELINPSIEIKMVENTPDDPRQRKPD  305

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRLGI  281
            ITKAKE+LGWEPKVKLR+G+PLME+DFR RLG+
Sbjct  306  ITKAKEVLGWEPKVKLREGLPLMEEDFRLRLGV  338



>ref|XP_009409525.1| PREDICTED: UDP-glucuronic acid decarboxylase 5 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009409526.1| PREDICTED: UDP-glucuronic acid decarboxylase 5 [Musa acuminata 
subsp. malaccensis]
Length=348

 Score =   162 bits (411),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 76/97 (78%), Positives = 87/97 (90%), Gaps = 0/97 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            MVDGLIRLMEGDNTGPINIGNPGEFTM+ELA+TVKE+IN  V +  VENTPDDPRQRKPD
Sbjct  250  MVDGLIRLMEGDNTGPINIGNPGEFTMMELAETVKELINPAVPLKNVENTPDDPRQRKPD  309

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRLGIGRKS  293
            ITKAKELLGWEPK+ LR+G+P ME+DFR RLG+ ++ 
Sbjct  310  ITKAKELLGWEPKITLREGLPFMEEDFRQRLGVPKQH  346



>ref|XP_002877483.1| UDP-xyl synthase 5 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH53742.1| UDP-xyl synthase 5 [Arabidopsis lyrata subsp. lyrata]
Length=341

 Score =   162 bits (411),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 76/93 (82%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            MVDGL+RLMEGD+TGPINIGNPGEFTM+ELA+TVKE+IN  ++I  VENTPDDPRQRKPD
Sbjct  246  MVDGLMRLMEGDDTGPINIGNPGEFTMVELAETVKELINPSIEIKMVENTPDDPRQRKPD  305

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRLGI  281
            ITKAKE+LGWEPKVKLR+G+PLME+DFR RLG+
Sbjct  306  ITKAKEVLGWEPKVKLREGLPLMEEDFRLRLGV  338



>ref|XP_010514963.1| PREDICTED: UDP-glucuronic acid decarboxylase 5 [Camelina sativa]
 ref|XP_010514964.1| PREDICTED: UDP-glucuronic acid decarboxylase 5 [Camelina sativa]
Length=341

 Score =   162 bits (411),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 76/93 (82%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            MVDGL+RLMEGD+TGPINIGNPGEFTM+ELA+TVKE+IN  ++I  VENTPDDPRQRKPD
Sbjct  246  MVDGLMRLMEGDDTGPINIGNPGEFTMVELAETVKELINPSIEIKMVENTPDDPRQRKPD  305

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRLGI  281
            ITKAKE+LGWEPKVKLR+G+PLME+DFR RLG+
Sbjct  306  ITKAKEVLGWEPKVKLREGLPLMEEDFRLRLGV  338



>ref|XP_010426076.1| PREDICTED: UDP-glucuronic acid decarboxylase 5-like [Camelina 
sativa]
Length=341

 Score =   162 bits (411),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 76/93 (82%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            MVDGL+RLMEGD+TGPINIGNPGEFTM+ELA+TVKE+IN  ++I  VENTPDDPRQRKPD
Sbjct  246  MVDGLMRLMEGDDTGPINIGNPGEFTMVELAETVKELINPSIEIKMVENTPDDPRQRKPD  305

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRLGI  281
            ITKAKE+LGWEPKVKLR+G+PLME+DFR RLG+
Sbjct  306  ITKAKEVLGWEPKVKLREGLPLMEEDFRLRLGV  338



>ref|XP_006418896.1| hypothetical protein EUTSA_v10002602mg [Eutrema salsugineum]
 ref|XP_006418897.1| hypothetical protein EUTSA_v10002602mg [Eutrema salsugineum]
 gb|ESQ37332.1| hypothetical protein EUTSA_v10002602mg [Eutrema salsugineum]
 gb|ESQ37333.1| hypothetical protein EUTSA_v10002602mg [Eutrema salsugineum]
Length=341

 Score =   162 bits (410),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 76/93 (82%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            MVDGL+RLMEGD+TGPINIGNPGEFTM+ELA+TVKE+IN  ++I  VENTPDDPRQRKPD
Sbjct  246  MVDGLMRLMEGDDTGPINIGNPGEFTMVELAETVKELINPSIEIKMVENTPDDPRQRKPD  305

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRLGI  281
            ITKAKE+LGWEPKVKLR+G+PLME+DFR RLG+
Sbjct  306  ITKAKEVLGWEPKVKLREGLPLMEEDFRLRLGV  338



>ref|XP_009103712.1| PREDICTED: UDP-glucuronic acid decarboxylase 6 [Brassica rapa]
Length=339

 Score =   162 bits (410),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 77/96 (80%), Positives = 89/96 (93%), Gaps = 0/96 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            MVDGL+RLMEGD TGPINIGNPGEFTM+ELA+TVKE+I  DV+I  VENTPDDPRQRKPD
Sbjct  244  MVDGLMRLMEGDQTGPINIGNPGEFTMVELAETVKELIKPDVEIKMVENTPDDPRQRKPD  303

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRLGIGRK  290
            I+KAKE+LGWEPKVKLR+G+PLME+DFR RLG+ +K
Sbjct  304  ISKAKEVLGWEPKVKLREGLPLMEEDFRLRLGVLKK  339



>emb|CDY04584.1| BnaA07g14100D [Brassica napus]
Length=339

 Score =   162 bits (410),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 77/96 (80%), Positives = 89/96 (93%), Gaps = 0/96 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            MVDGL+RLMEGD TGPINIGNPGEFTM+ELA+TVKE+I  DV+I  VENTPDDPRQRKPD
Sbjct  244  MVDGLMRLMEGDQTGPINIGNPGEFTMVELAETVKELIKPDVEIKMVENTPDDPRQRKPD  303

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRLGIGRK  290
            I+KAKE+LGWEPKVKLR+G+PLME+DFR RLG+ +K
Sbjct  304  ISKAKEVLGWEPKVKLREGLPLMEEDFRLRLGVLKK  339



>ref|XP_008803419.1| PREDICTED: UDP-glucuronic acid decarboxylase 6-like [Phoenix 
dactylifera]
Length=342

 Score =   162 bits (410),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 75/97 (77%), Positives = 88/97 (91%), Gaps = 0/97 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            MVDGLIRLMEGDNTGPIN+GNPGEFTM+ELA+ VKE+I+ +V +  VENTPDDPRQRKPD
Sbjct  246  MVDGLIRLMEGDNTGPINLGNPGEFTMMELAEAVKELIDPNVPVKNVENTPDDPRQRKPD  305

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRLGIGRKS  293
            ITKAKELLGWEPK+ LR G+PLME+DFR RLG+ +K+
Sbjct  306  ITKAKELLGWEPKITLRQGLPLMEEDFRQRLGVPKKA  342



>ref|XP_010520284.1| PREDICTED: UDP-glucuronic acid decarboxylase 5 [Tarenaya hassleriana]
 ref|XP_010520286.1| PREDICTED: UDP-glucuronic acid decarboxylase 5 [Tarenaya hassleriana]
Length=341

 Score =   162 bits (409),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 75/93 (81%), Positives = 89/93 (96%), Gaps = 0/93 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            MVDGL+RLMEG++TGPINIGNPGEFTMLELA+TVKE+IN  ++I TVENTPDDP+QRKPD
Sbjct  245  MVDGLVRLMEGEDTGPINIGNPGEFTMLELAETVKELINPGIEIKTVENTPDDPKQRKPD  304

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRLGI  281
            ITKAK++LGWEPKVKLR+G+PLME+DFR RLG+
Sbjct  305  ITKAKQVLGWEPKVKLREGLPLMEEDFRLRLGV  337



>ref|XP_006294492.1| hypothetical protein CARUB_v10023520mg, partial [Capsella rubella]
 gb|EOA27390.1| hypothetical protein CARUB_v10023520mg, partial [Capsella rubella]
Length=353

 Score =   162 bits (410),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 75/96 (78%), Positives = 89/96 (93%), Gaps = 0/96 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            MVDGL+RLMEGD TGPINIGNPGEFTM+ELA+TVKE+I  D++I  VENTPDDP+QRKPD
Sbjct  258  MVDGLMRLMEGDQTGPINIGNPGEFTMVELAETVKELIKPDIEIKMVENTPDDPKQRKPD  317

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRLGIGRK  290
            I+KAKE+LGWEPKVKLR+G+PLME+DFR RLG+ +K
Sbjct  318  ISKAKEVLGWEPKVKLREGLPLMEEDFRLRLGVSKK  353



>ref|XP_003539685.1| PREDICTED: UDP-glucuronic acid decarboxylase 5 [Glycine max]
Length=343

 Score =   162 bits (409),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 78/97 (80%), Positives = 88/97 (91%), Gaps = 0/97 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            +VDGLIRLMEG +TGPIN+GNPGEFTMLELA+TVKE+IN DV+I  VENTPDDPRQRKP 
Sbjct  247  LVDGLIRLMEGSDTGPINLGNPGEFTMLELAETVKELINPDVEIKVVENTPDDPRQRKPI  306

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRLGIGRKS  293
            ITKA ELLGWEPKVKLRDG+PLME+DFR RLG  +K+
Sbjct  307  ITKAMELLGWEPKVKLRDGLPLMEEDFRLRLGFDKKN  343



>gb|KHN32112.1| UDP-glucuronic acid decarboxylase 1 [Glycine soja]
Length=343

 Score =   161 bits (408),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 78/97 (80%), Positives = 88/97 (91%), Gaps = 0/97 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            +VDGLIRLMEG +TGPIN+GNPGEFTMLELA+TVKE+IN DV+I  VENTPDDPRQRKP 
Sbjct  247  LVDGLIRLMEGSDTGPINLGNPGEFTMLELAETVKELINPDVEIKVVENTPDDPRQRKPI  306

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRLGIGRKS  293
            ITKA ELLGWEPKVKLRDG+PLME+DFR RLG  +K+
Sbjct  307  ITKAMELLGWEPKVKLRDGLPLMEEDFRLRLGFDKKN  343



>ref|NP_180443.1| UDP-XYL synthase 6 [Arabidopsis thaliana]
 ref|NP_973555.1| UDP-XYL synthase 6 [Arabidopsis thaliana]
 ref|NP_001077972.1| UDP-XYL synthase 6 [Arabidopsis thaliana]
 sp|Q9ZV36.1|UXS6_ARATH RecName: Full=UDP-glucuronic acid decarboxylase 6; AltName: Full=UDP-XYL 
synthase 6; AltName: Full=UDP-glucuronate decarboxylase 
6; Short=UGD; Short=UXS-6 [Arabidopsis thaliana]
 gb|AAC79582.1| putative nucleotide-sugar dehydratase [Arabidopsis thaliana]
 gb|AAM20554.1| putative nucleotide-sugar dehydratase [Arabidopsis thaliana]
 gb|AAM91299.1| putative nucleotide-sugar dehydratase [Arabidopsis thaliana]
 gb|AEC08167.1| UDP-XYL synthase 6 [Arabidopsis thaliana]
 gb|AEC08168.1| UDP-XYL synthase 6 [Arabidopsis thaliana]
 gb|AEC08169.1| UDP-XYL synthase 6 [Arabidopsis thaliana]
Length=343

 Score =   161 bits (408),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 76/96 (79%), Positives = 89/96 (93%), Gaps = 0/96 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            MV+GL+RLMEGD TGPINIGNPGEFTM+ELA+TVKE+I  DV+I  VENTPDDPRQRKPD
Sbjct  248  MVEGLMRLMEGDQTGPINIGNPGEFTMVELAETVKELIKPDVEIKMVENTPDDPRQRKPD  307

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRLGIGRK  290
            I+KAKE+LGWEPKVKLR+G+PLME+DFR RLG+ +K
Sbjct  308  ISKAKEVLGWEPKVKLREGLPLMEEDFRLRLGVPKK  343



>ref|XP_002881007.1| hypothetical protein ARALYDRAFT_481790 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57266.1| hypothetical protein ARALYDRAFT_481790 [Arabidopsis lyrata subsp. 
lyrata]
Length=343

 Score =   161 bits (408),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 75/96 (78%), Positives = 89/96 (93%), Gaps = 0/96 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            MV+GL+RLMEGD TGPINIGNPGEFTM+ELA+TVKE+I  DV+I  VENTPDDP+QRKPD
Sbjct  248  MVEGLMRLMEGDQTGPINIGNPGEFTMVELAETVKELIKPDVEIKMVENTPDDPKQRKPD  307

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRLGIGRK  290
            I+KAKE+LGWEPKVKLR+G+PLME+DFR RLG+ +K
Sbjct  308  ISKAKEVLGWEPKVKLREGLPLMEEDFRLRLGVSKK  343



>ref|XP_011000276.1| PREDICTED: UDP-glucuronic acid decarboxylase 5 [Populus euphratica]
 ref|XP_011000278.1| PREDICTED: UDP-glucuronic acid decarboxylase 5 [Populus euphratica]
Length=343

 Score =   161 bits (408),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 78/96 (81%), Positives = 87/96 (91%), Gaps = 0/96 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            MVDGLIRLMEG++TGPINIGNPGEFTM  LA+TVKE+IN  V+I  VENTPDDPRQRKPD
Sbjct  247  MVDGLIRLMEGEHTGPINIGNPGEFTMTGLAETVKELINPGVEINMVENTPDDPRQRKPD  306

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRLGIGRK  290
            ITKAK LLGWEPKVKLRDG+PLME+DFR RLG+ +K
Sbjct  307  ITKAKALLGWEPKVKLRDGLPLMEEDFRLRLGVTKK  342



>ref|XP_006409908.1| hypothetical protein EUTSA_v10016891mg [Eutrema salsugineum]
 gb|ESQ51361.1| hypothetical protein EUTSA_v10016891mg [Eutrema salsugineum]
Length=339

 Score =   161 bits (407),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 76/96 (79%), Positives = 89/96 (93%), Gaps = 0/96 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            MVDGL+RLMEGD TGPINIGNPGEFTM+ELA+TVKE+I  DV+I  VENTPDDPRQRKPD
Sbjct  244  MVDGLMRLMEGDQTGPINIGNPGEFTMVELAETVKELIKPDVEIKMVENTPDDPRQRKPD  303

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRLGIGRK  290
            I+KAK++LGWEPKVKLR+G+PLME+DFR RLG+ +K
Sbjct  304  ISKAKQVLGWEPKVKLREGLPLMEEDFRLRLGVLKK  339



>ref|XP_010521823.1| PREDICTED: UDP-glucuronic acid decarboxylase 5 [Tarenaya hassleriana]
 ref|XP_010521824.1| PREDICTED: UDP-glucuronic acid decarboxylase 5 [Tarenaya hassleriana]
 ref|XP_010521825.1| PREDICTED: UDP-glucuronic acid decarboxylase 5 [Tarenaya hassleriana]
Length=342

 Score =   161 bits (407),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 75/97 (77%), Positives = 89/97 (92%), Gaps = 0/97 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            MV+GLIRLMEG++TGPINIGNPGEFTM+ELA+ VKE+IN +V++  VENTPDDPRQRKPD
Sbjct  246  MVEGLIRLMEGEHTGPINIGNPGEFTMIELAENVKELINPEVEVKMVENTPDDPRQRKPD  305

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRLGIGRKS  293
            IT AK LLGWEPKVKLRDG+PLME+DFR RLG+ +K+
Sbjct  306  ITNAKTLLGWEPKVKLRDGLPLMEEDFRLRLGVQKKN  342



>ref|XP_010937669.1| PREDICTED: UDP-glucuronic acid decarboxylase 6-like isoform X2 
[Elaeis guineensis]
Length=348

 Score =   161 bits (407),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 75/93 (81%), Positives = 87/93 (94%), Gaps = 0/93 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            MVDGLI LMEGD+TGPINIGNPGEFTM+ELA+TVKE+I+  V+++ VENTPDDPRQRKPD
Sbjct  250  MVDGLIHLMEGDHTGPINIGNPGEFTMMELAETVKELIDPTVEVMIVENTPDDPRQRKPD  309

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRLGI  281
            ITKAKELLGWEPKV LR+G+PLME+DFR RLG+
Sbjct  310  ITKAKELLGWEPKVTLREGLPLMEEDFRQRLGV  342



>ref|XP_010907073.1| PREDICTED: UDP-glucuronic acid decarboxylase 6 isoform X2 [Elaeis 
guineensis]
 ref|XP_010907074.1| PREDICTED: UDP-glucuronic acid decarboxylase 6 isoform X2 [Elaeis 
guineensis]
Length=314

 Score =   160 bits (405),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 76/97 (78%), Positives = 87/97 (90%), Gaps = 0/97 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            MVDGLIRLMEGDNTGPIN+GNPGEFTM+ELA+TVKE+I+  V +  VENTPDDPRQRKPD
Sbjct  218  MVDGLIRLMEGDNTGPINLGNPGEFTMMELAETVKELIDPTVPVKIVENTPDDPRQRKPD  277

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRLGIGRKS  293
            ITKAKELLGWEPK+ LR G+PLME DFR RLG+ +K+
Sbjct  278  ITKAKELLGWEPKIILRQGLPLMEKDFRLRLGVPKKA  314



>ref|XP_009419265.1| PREDICTED: UDP-glucuronic acid decarboxylase 6 [Musa acuminata 
subsp. malaccensis]
Length=346

 Score =   161 bits (407),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 75/97 (77%), Positives = 86/97 (89%), Gaps = 0/97 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            MVDGLIRLMEGDNTGPINIGNPGEFTM+ELA+ VKE+I   + I  VENTPDDPRQRKPD
Sbjct  250  MVDGLIRLMEGDNTGPINIGNPGEFTMMELAEIVKELIEPSISIEIVENTPDDPRQRKPD  309

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRLGIGRKS  293
            ITKAK+LLGWEPK+ LR G+PLME+DFR RLG+ +K+
Sbjct  310  ITKAKQLLGWEPKITLRQGLPLMEEDFRLRLGVPKKA  346



>ref|XP_003538004.1| PREDICTED: UDP-glucuronic acid decarboxylase 6-like isoformX1 
[Glycine max]
 ref|XP_003538005.1| PREDICTED: UDP-glucuronic acid decarboxylase 6-like isoformX2 
[Glycine max]
 ref|XP_006590989.1| PREDICTED: UDP-glucuronic acid decarboxylase 6-like isoform X3 
[Glycine max]
 gb|KHN21972.1| UDP-glucuronic acid decarboxylase 1 [Glycine soja]
Length=342

 Score =   161 bits (407),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 77/93 (83%), Positives = 85/93 (91%), Gaps = 0/93 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            MVDGLIRLMEG+NTGPINIGNPGEFTM+ELA+ VKE+IN  V+I  VENTPDDPRQRKPD
Sbjct  246  MVDGLIRLMEGENTGPINIGNPGEFTMIELAENVKELINPKVQINMVENTPDDPRQRKPD  305

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRLGI  281
            ITKAKELL WEPKVKL DG+PLME+DFR RLG+
Sbjct  306  ITKAKELLRWEPKVKLYDGLPLMEEDFRQRLGV  338



>ref|XP_010503253.1| PREDICTED: UDP-glucuronic acid decarboxylase 5-like [Camelina 
sativa]
Length=341

 Score =   161 bits (407),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 75/93 (81%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            MVDGL+RLMEG++TGPINIGNPGEFTM+ELA+TVKE+IN  ++I  VENTPDDPRQRKPD
Sbjct  246  MVDGLMRLMEGNDTGPINIGNPGEFTMVELAETVKELINPSIEIKMVENTPDDPRQRKPD  305

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRLGI  281
            ITKAKE+LGWEPKVKLR+G+PLME+DFR RLG+
Sbjct  306  ITKAKEVLGWEPKVKLREGLPLMEEDFRLRLGV  338



>ref|XP_004487020.1| PREDICTED: UDP-glucuronic acid decarboxylase 6-like isoform X1 
[Cicer arietinum]
 ref|XP_004487021.1| PREDICTED: UDP-glucuronic acid decarboxylase 6-like isoform X2 
[Cicer arietinum]
 ref|XP_004487022.1| PREDICTED: UDP-glucuronic acid decarboxylase 6-like isoform X3 
[Cicer arietinum]
Length=350

 Score =   161 bits (407),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 78/96 (81%), Positives = 86/96 (90%), Gaps = 0/96 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            MVDGLIRLMEG+NTGPINIGNPGEFTM ELA+ VKE+IN  V+I  VENTPDDPRQRKPD
Sbjct  254  MVDGLIRLMEGENTGPINIGNPGEFTMTELAENVKELINPAVEIKMVENTPDDPRQRKPD  313

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRLGIGRK  290
            ITKA ELLGWEPKVKLRDG+PLME+DFR RL + +K
Sbjct  314  ITKATELLGWEPKVKLRDGLPLMEEDFRLRLEVPKK  349



>ref|XP_010922372.1| PREDICTED: UDP-glucuronic acid decarboxylase 6-like isoform X2 
[Elaeis guineensis]
Length=314

 Score =   160 bits (405),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 75/97 (77%), Positives = 88/97 (91%), Gaps = 0/97 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            MVDGLIRLMEGDNTGPIN+GNPGEFTM+ELA+ VKE+I+ +V +  VENTPDDPRQRKPD
Sbjct  218  MVDGLIRLMEGDNTGPINLGNPGEFTMMELAENVKELIDPNVPVKIVENTPDDPRQRKPD  277

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRLGIGRKS  293
            ITKAKELLGWEPK+ LR G+PLME+DFR RLG+ +K+
Sbjct  278  ITKAKELLGWEPKIILRQGLPLMEEDFRQRLGVPKKA  314



>ref|XP_002866324.1| UDP-glucuronic acid decarboxylase [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42583.1| UDP-glucuronic acid decarboxylase [Arabidopsis lyrata subsp. 
lyrata]
Length=342

 Score =   160 bits (406),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 75/93 (81%), Positives = 87/93 (94%), Gaps = 0/93 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            MVDGLIRLMEGD+TGPINIGNPGEFTM+ELA+TVKE+IN  ++I  VENTPDDPRQRKPD
Sbjct  247  MVDGLIRLMEGDDTGPINIGNPGEFTMVELAETVKELINPSIEIKMVENTPDDPRQRKPD  306

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRLGI  281
            I+KAKE+LGWEPKVKLR+G+PLME+DFR RL +
Sbjct  307  ISKAKEVLGWEPKVKLREGLPLMEEDFRLRLNV  339



>ref|XP_010922371.1| PREDICTED: UDP-glucuronic acid decarboxylase 6-like isoform X1 
[Elaeis guineensis]
Length=342

 Score =   160 bits (406),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 75/97 (77%), Positives = 88/97 (91%), Gaps = 0/97 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            MVDGLIRLMEGDNTGPIN+GNPGEFTM+ELA+ VKE+I+ +V +  VENTPDDPRQRKPD
Sbjct  246  MVDGLIRLMEGDNTGPINLGNPGEFTMMELAENVKELIDPNVPVKIVENTPDDPRQRKPD  305

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRLGIGRKS  293
            ITKAKELLGWEPK+ LR G+PLME+DFR RLG+ +K+
Sbjct  306  ITKAKELLGWEPKIILRQGLPLMEEDFRQRLGVPKKA  342



>ref|XP_010454830.1| PREDICTED: UDP-glucuronic acid decarboxylase 3 [Camelina sativa]
 ref|XP_010483546.1| PREDICTED: UDP-glucuronic acid decarboxylase 3 [Camelina sativa]
Length=342

 Score =   160 bits (406),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 75/93 (81%), Positives = 87/93 (94%), Gaps = 0/93 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            MVDGLIRLMEGD+TGPINIGNPGEFTM+ELA+TVKE+IN  ++I  VENTPDDPRQRKPD
Sbjct  247  MVDGLIRLMEGDDTGPINIGNPGEFTMVELAETVKELINPSIEIKMVENTPDDPRQRKPD  306

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRLGI  281
            I+KAKE+LGWEPKVKLR+G+PLME+DFR RL +
Sbjct  307  ISKAKEVLGWEPKVKLREGLPLMEEDFRLRLNV  339



>ref|XP_004487023.1| PREDICTED: UDP-glucuronic acid decarboxylase 6-like isoform X4 
[Cicer arietinum]
Length=314

 Score =   160 bits (404),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 78/96 (81%), Positives = 86/96 (90%), Gaps = 0/96 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            MVDGLIRLMEG+NTGPINIGNPGEFTM ELA+ VKE+IN  V+I  VENTPDDPRQRKPD
Sbjct  218  MVDGLIRLMEGENTGPINIGNPGEFTMTELAENVKELINPAVEIKMVENTPDDPRQRKPD  277

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRLGIGRK  290
            ITKA ELLGWEPKVKLRDG+PLME+DFR RL + +K
Sbjct  278  ITKATELLGWEPKVKLRDGLPLMEEDFRLRLEVPKK  313



>ref|XP_010907071.1| PREDICTED: UDP-glucuronic acid decarboxylase 6 isoform X1 [Elaeis 
guineensis]
 ref|XP_010907072.1| PREDICTED: UDP-glucuronic acid decarboxylase 6 isoform X1 [Elaeis 
guineensis]
Length=342

 Score =   160 bits (406),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 76/97 (78%), Positives = 87/97 (90%), Gaps = 0/97 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            MVDGLIRLMEGDNTGPIN+GNPGEFTM+ELA+TVKE+I+  V +  VENTPDDPRQRKPD
Sbjct  246  MVDGLIRLMEGDNTGPINLGNPGEFTMMELAETVKELIDPTVPVKIVENTPDDPRQRKPD  305

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRLGIGRKS  293
            ITKAKELLGWEPK+ LR G+PLME DFR RLG+ +K+
Sbjct  306  ITKAKELLGWEPKIILRQGLPLMEKDFRLRLGVPKKA  342



>ref|XP_006400977.1| hypothetical protein EUTSA_v10014020mg [Eutrema salsugineum]
 ref|XP_006400978.1| hypothetical protein EUTSA_v10014020mg [Eutrema salsugineum]
 gb|ESQ42430.1| hypothetical protein EUTSA_v10014020mg [Eutrema salsugineum]
 gb|ESQ42431.1| hypothetical protein EUTSA_v10014020mg [Eutrema salsugineum]
Length=342

 Score =   160 bits (406),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 75/93 (81%), Positives = 87/93 (94%), Gaps = 0/93 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            MVDGLIRLMEGD+TGPINIGNPGEFTM+ELA+TVKE+IN  ++I  VENTPDDPRQRKPD
Sbjct  247  MVDGLIRLMEGDDTGPINIGNPGEFTMVELAETVKELINPSIEIKMVENTPDDPRQRKPD  306

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRLGI  281
            I+KAKE+LGWEPKVKLR+G+PLME+DFR RL +
Sbjct  307  ISKAKEVLGWEPKVKLREGLPLMEEDFRLRLNV  339



>ref|XP_009132003.1| PREDICTED: UDP-glucuronic acid decarboxylase 3 [Brassica rapa]
 ref|XP_009132004.1| PREDICTED: UDP-glucuronic acid decarboxylase 3 [Brassica rapa]
 emb|CDX88693.1| BnaA03g09560D [Brassica napus]
Length=343

 Score =   160 bits (405),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 75/93 (81%), Positives = 87/93 (94%), Gaps = 0/93 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            MVDGLIRLMEGD+TGPINIGNPGEFTM+ELA+TVKE+IN  ++I  VENTPDDPRQRKPD
Sbjct  248  MVDGLIRLMEGDDTGPINIGNPGEFTMVELAETVKELINPSIEIKMVENTPDDPRQRKPD  307

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRLGI  281
            I+KAKE+LGWEPKVKLR+G+PLME+DFR RL +
Sbjct  308  ISKAKEVLGWEPKVKLREGLPLMEEDFRLRLNV  340



>emb|CDY02881.1| BnaC02g10080D [Brassica napus]
Length=342

 Score =   160 bits (405),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 75/93 (81%), Positives = 87/93 (94%), Gaps = 0/93 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            MVDGLIRLMEGD+TGPINIGNPGEFTM+ELA+TVKE+IN  ++I  VENTPDDPRQRKPD
Sbjct  247  MVDGLIRLMEGDDTGPINIGNPGEFTMVELAETVKELINPSIEIKMVENTPDDPRQRKPD  306

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRLGI  281
            I+KAKE+LGWEPKVKLR+G+PLME+DFR RL +
Sbjct  307  ISKAKEVLGWEPKVKLREGLPLMEEDFRLRLNV  339



>ref|XP_010446198.1| PREDICTED: UDP-glucuronic acid decarboxylase 3-like [Camelina 
sativa]
Length=339

 Score =   160 bits (405),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 75/93 (81%), Positives = 87/93 (94%), Gaps = 0/93 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            MVDGLIRLMEGD+TGPINIGNPGEFTM+ELA+TVKE+IN  ++I  VENTPDDPRQRKPD
Sbjct  244  MVDGLIRLMEGDDTGPINIGNPGEFTMVELAETVKELINPSIEIKMVENTPDDPRQRKPD  303

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRLGI  281
            I+KAKE+LGWEPKVKLR+G+PLME+DFR RL +
Sbjct  304  ISKAKEVLGWEPKVKLREGLPLMEEDFRLRLNV  336



>emb|CDX71122.1| BnaC03g12060D [Brassica napus]
Length=358

 Score =   160 bits (406),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 75/93 (81%), Positives = 87/93 (94%), Gaps = 0/93 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            MVDGLIRLMEGD+TGPINIGNPGEFTM+ELA+TVKE+IN  ++I  VENTPDDPRQRKPD
Sbjct  263  MVDGLIRLMEGDDTGPINIGNPGEFTMVELAETVKELINPSIEIKMVENTPDDPRQRKPD  322

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRLGI  281
            I+KAKE+LGWEPKVKLR+G+PLME+DFR RL +
Sbjct  323  ISKAKEVLGWEPKVKLREGLPLMEEDFRLRLNV  355



>ref|XP_006846098.1| hypothetical protein AMTR_s00012p00122270 [Amborella trichopoda]
 gb|ERN07773.1| hypothetical protein AMTR_s00012p00122270 [Amborella trichopoda]
Length=346

 Score =   160 bits (405),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 75/96 (78%), Positives = 88/96 (92%), Gaps = 0/96 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            MVDGLIRLMEGD+TGPINIGNPGEFTM+ELA+TVKE+I+S + +  V+NTPDDPRQRKPD
Sbjct  251  MVDGLIRLMEGDHTGPINIGNPGEFTMMELAETVKELIDSSILVKIVDNTPDDPRQRKPD  310

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRLGIGRK  290
            ITKA  LLGWEPKVKLR+G+PLME+DFR RLG+ +K
Sbjct  311  ITKANNLLGWEPKVKLREGLPLMEEDFRQRLGVPKK  346



>dbj|BAB40967.1| UDP-D-glucuronate carboxy-lyase [Pisum sativum]
Length=346

 Score =   160 bits (405),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 77/93 (83%), Positives = 86/93 (92%), Gaps = 0/93 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            +VDGLIRLM G +TGPIN+GNPGEFTMLELA+TVKE+IN +V+I  VENTPDDPRQRKPD
Sbjct  250  LVDGLIRLMGGSDTGPINLGNPGEFTMLELAETVKELINPNVEIKIVENTPDDPRQRKPD  309

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRLGI  281
            ITKA+ELLGWEPKVKLRDG+PLME DFR RLGI
Sbjct  310  ITKAQELLGWEPKVKLRDGLPLMEGDFRLRLGI  342



>ref|XP_006280756.1| hypothetical protein CARUB_v10026723mg [Capsella rubella]
 gb|EOA13654.1| hypothetical protein CARUB_v10026723mg [Capsella rubella]
Length=342

 Score =   160 bits (405),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 75/95 (79%), Positives = 88/95 (93%), Gaps = 0/95 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            MVDGLIRLMEG++TGPINIGNPGEFTM+ELA+TVKE+IN  ++I  VENTPDDPRQRKPD
Sbjct  247  MVDGLIRLMEGEDTGPINIGNPGEFTMVELAETVKELINPSIEIKMVENTPDDPRQRKPD  306

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRLGIGR  287
            I+KAKE+LGWEPKVKLR+G+PLME+DFR RL + R
Sbjct  307  ISKAKEVLGWEPKVKLREGLPLMEEDFRLRLNVPR  341



>ref|XP_009140938.1| PREDICTED: UDP-glucuronic acid decarboxylase 6-like [Brassica 
rapa]
 ref|XP_009140939.1| PREDICTED: UDP-glucuronic acid decarboxylase 6-like [Brassica 
rapa]
 ref|XP_009140940.1| PREDICTED: UDP-glucuronic acid decarboxylase 6-like [Brassica 
rapa]
Length=342

 Score =   160 bits (404),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 76/96 (79%), Positives = 88/96 (92%), Gaps = 0/96 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            MVDGL+RLMEGD TGPINIGNPGEFTM+ELA+TVKE+   DV+I  VENTPDDPRQRKPD
Sbjct  247  MVDGLMRLMEGDQTGPINIGNPGEFTMVELAETVKELKKPDVEIKMVENTPDDPRQRKPD  306

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRLGIGRK  290
            I+KAKE+LGWEPKVKLR+G+PLME+DFR RLG+ +K
Sbjct  307  ISKAKEVLGWEPKVKLREGLPLMEEDFRLRLGVFKK  342



>ref|NP_001078768.1| UDP-glucuronic acid decarboxylase 3 [Arabidopsis thaliana]
 gb|AED97167.1| UDP-glucuronic acid decarboxylase 3 [Arabidopsis thaliana]
Length=357

 Score =   160 bits (405),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 75/95 (79%), Positives = 88/95 (93%), Gaps = 0/95 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            MVDGLIRLMEG++TGPINIGNPGEFTM+ELA+TVKE+IN  ++I  VENTPDDPRQRKPD
Sbjct  262  MVDGLIRLMEGNDTGPINIGNPGEFTMVELAETVKELINPSIEIKMVENTPDDPRQRKPD  321

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRLGIGR  287
            I+KAKE+LGWEPKVKLR+G+PLME+DFR RL + R
Sbjct  322  ISKAKEVLGWEPKVKLREGLPLMEEDFRLRLNVPR  356



>ref|XP_003543505.1| PREDICTED: UDP-glucuronic acid decarboxylase 6-like [Glycine 
max]
 gb|KHN30187.1| UDP-glucuronic acid decarboxylase 1 [Glycine soja]
Length=348

 Score =   160 bits (404),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 77/97 (79%), Positives = 87/97 (90%), Gaps = 0/97 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            +VDGLIRLM G NTGPIN+GNPGEFTM ELA+TVKE+IN  V+I  VENTPDDPRQRKPD
Sbjct  252  LVDGLIRLMGGSNTGPINLGNPGEFTMTELAETVKELINPGVEIKMVENTPDDPRQRKPD  311

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRLGIGRKS  293
            ITKAKELLGWEPKVKLRDG+P ME+DFR RL +G+K+
Sbjct  312  ITKAKELLGWEPKVKLRDGLPRMEEDFRLRLEVGKKN  348



>gb|AAK53026.1|AF375442_1 AT5g59290/mnc17_180 [Arabidopsis thaliana]
 gb|AAM16219.1| AT5g59290/mnc17_180 [Arabidopsis thaliana]
Length=342

 Score =   160 bits (404),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 75/95 (79%), Positives = 88/95 (93%), Gaps = 0/95 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            MVDGLIRLMEG++TGPINIGNPGEFTM+ELA+TVKE+IN  ++I  VENTPDDPRQRKPD
Sbjct  247  MVDGLIRLMEGNDTGPINIGNPGEFTMVELAETVKELINPSIEIKMVENTPDDPRQRKPD  306

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRLGIGR  287
            I+KAKE+LGWEPKVKLR+G+PLME+DFR RL + R
Sbjct  307  ISKAKEVLGWEPKVKLREGLPLMEEDFRLRLNVPR  341



>ref|NP_200737.1| UDP-glucuronic acid decarboxylase 3 [Arabidopsis thaliana]
 sp|Q9FIE8.1|UXS3_ARATH RecName: Full=UDP-glucuronic acid decarboxylase 3; AltName: Full=UDP-XYL 
synthase 3; AltName: Full=UDP-glucuronate decarboxylase 
3; Short=UGD; Short=UXS-3 [Arabidopsis thaliana]
 gb|AAK70882.1|AF387789_1 UDP-glucuronic acid decarboxylase [Arabidopsis thaliana]
 dbj|BAB09774.1| dTDP-glucose 4-6-dehydratase [Arabidopsis thaliana]
 gb|AAM65979.1| dTDP-glucose 4-6-dehydratase-like protein [Arabidopsis thaliana]
 gb|AED97166.1| UDP-glucuronic acid decarboxylase 3 [Arabidopsis thaliana]
Length=342

 Score =   159 bits (403),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 75/95 (79%), Positives = 88/95 (93%), Gaps = 0/95 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            MVDGLIRLMEG++TGPINIGNPGEFTM+ELA+TVKE+IN  ++I  VENTPDDPRQRKPD
Sbjct  247  MVDGLIRLMEGNDTGPINIGNPGEFTMVELAETVKELINPSIEIKMVENTPDDPRQRKPD  306

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRLGIGR  287
            I+KAKE+LGWEPKVKLR+G+PLME+DFR RL + R
Sbjct  307  ISKAKEVLGWEPKVKLREGLPLMEEDFRLRLNVPR  341



>ref|XP_009414315.1| PREDICTED: UDP-glucuronic acid decarboxylase 6-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009414316.1| PREDICTED: UDP-glucuronic acid decarboxylase 6-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009414317.1| PREDICTED: UDP-glucuronic acid decarboxylase 6-like [Musa acuminata 
subsp. malaccensis]
Length=348

 Score =   160 bits (404),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 74/97 (76%), Positives = 87/97 (90%), Gaps = 0/97 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            MVDGLIRLMEG++TGPINIGNPGEFTM+ELA+ VKE+I+  V +  VENTPDDPRQRKP+
Sbjct  250  MVDGLIRLMEGEHTGPINIGNPGEFTMMELAEAVKELIDPAVPVKIVENTPDDPRQRKPN  309

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRLGIGRKS  293
            ITKAKELLGWEPK+ LR+G+PLMEDDFR RLG+ +K 
Sbjct  310  ITKAKELLGWEPKITLREGLPLMEDDFRQRLGVSKKH  346



>ref|XP_008776577.1| PREDICTED: UDP-glucuronic acid decarboxylase 6 [Phoenix dactylifera]
 ref|XP_008776584.1| PREDICTED: UDP-glucuronic acid decarboxylase 6 [Phoenix dactylifera]
Length=342

 Score =   159 bits (402),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 75/97 (77%), Positives = 87/97 (90%), Gaps = 0/97 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            MVDGLIRLMEGDNTGPIN+GNPGEFTM+ELA+T+KE+I+  V +  VENTPDDPRQRKPD
Sbjct  246  MVDGLIRLMEGDNTGPINLGNPGEFTMMELAETIKELIDPTVPVKVVENTPDDPRQRKPD  305

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRLGIGRKS  293
            ITKAKELLGWE KV LR G+PLME+DFR RLG+ +K+
Sbjct  306  ITKAKELLGWEHKVTLRQGLPLMEEDFRRRLGVPKKA  342



>ref|XP_009126705.1| PREDICTED: UDP-glucuronic acid decarboxylase 3-like [Brassica 
rapa]
 emb|CDY32652.1| BnaA02g07140D [Brassica napus]
Length=342

 Score =   159 bits (401),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 74/93 (80%), Positives = 87/93 (94%), Gaps = 0/93 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            MVDGLIRLMEG++TGPINIGNPGEFTM+ELA+TVKE+IN  ++I  VENTPDDPRQRKPD
Sbjct  247  MVDGLIRLMEGNDTGPINIGNPGEFTMVELAETVKELINPSIEIKMVENTPDDPRQRKPD  306

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRLGI  281
            I+KAKE+LGWEPKVKLR+G+PLME+DFR RL +
Sbjct  307  ISKAKEVLGWEPKVKLREGLPLMEEDFRLRLNV  339



>ref|XP_008812029.1| PREDICTED: UDP-glucuronic acid decarboxylase 6-like [Phoenix 
dactylifera]
 ref|XP_008812030.1| PREDICTED: UDP-glucuronic acid decarboxylase 6-like [Phoenix 
dactylifera]
Length=348

 Score =   159 bits (402),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 75/91 (82%), Positives = 85/91 (93%), Gaps = 0/91 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            MVDGLIRLMEGD+TGPINIGNPGEFTM+ELA+TVKE+I+  V++  VENTPDDPRQRKPD
Sbjct  250  MVDGLIRLMEGDHTGPINIGNPGEFTMMELAETVKELIDPTVQVKIVENTPDDPRQRKPD  309

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRL  275
            ITKAKELLGWEPKV LR+G+PLME+DFR RL
Sbjct  310  ITKAKELLGWEPKVTLREGLPLMEEDFRQRL  340



>ref|XP_010937665.1| PREDICTED: UDP-glucuronic acid decarboxylase 6-like isoform X1 
[Elaeis guineensis]
 ref|XP_010937666.1| PREDICTED: UDP-glucuronic acid decarboxylase 6-like isoform X1 
[Elaeis guineensis]
 ref|XP_010937668.1| PREDICTED: UDP-glucuronic acid decarboxylase 6-like isoform X1 
[Elaeis guineensis]
Length=378

 Score =   159 bits (402),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 74/92 (80%), Positives = 86/92 (93%), Gaps = 0/92 (0%)
 Frame = +3

Query  6    VDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPDI  185
            VDGLI LMEGD+TGPINIGNPGEFTM+ELA+TVKE+I+  V+++ VENTPDDPRQRKPDI
Sbjct  281  VDGLIHLMEGDHTGPINIGNPGEFTMMELAETVKELIDPTVEVMIVENTPDDPRQRKPDI  340

Query  186  TKAKELLGWEPKVKLRDGIPLMEDDFRTRLGI  281
            TKAKELLGWEPKV LR+G+PLME+DFR RLG+
Sbjct  341  TKAKELLGWEPKVTLREGLPLMEEDFRQRLGV  372



>ref|XP_008784504.1| PREDICTED: UDP-glucuronic acid decarboxylase 6-like [Phoenix 
dactylifera]
 ref|XP_008784505.1| PREDICTED: UDP-glucuronic acid decarboxylase 6-like [Phoenix 
dactylifera]
 ref|XP_008784508.1| PREDICTED: UDP-glucuronic acid decarboxylase 6-like [Phoenix 
dactylifera]
 ref|XP_008784509.1| PREDICTED: UDP-glucuronic acid decarboxylase 6-like [Phoenix 
dactylifera]
Length=348

 Score =   157 bits (397),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 73/97 (75%), Positives = 89/97 (92%), Gaps = 0/97 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            MVDGLI LM+G++TGPINIGNPGEFTM+ELA+TVKE+I+  V++  VENTPDDPRQRKPD
Sbjct  250  MVDGLIGLMDGEHTGPINIGNPGEFTMMELAETVKELIDPTVEVKIVENTPDDPRQRKPD  309

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRLGIGRKS  293
            ITKA+ELLGWEPK+KLR+G+PLME+DFR RLG+ +K 
Sbjct  310  ITKARELLGWEPKIKLREGLPLMEEDFRQRLGVPKKH  346



>ref|XP_003538003.1| PREDICTED: UDP-glucuronic acid decarboxylase 5-like isoform X1 
[Glycine max]
 ref|XP_006590990.1| PREDICTED: UDP-glucuronic acid decarboxylase 5-like isoform X2 
[Glycine max]
 ref|XP_006590991.1| PREDICTED: UDP-glucuronic acid decarboxylase 5-like isoform X3 
[Glycine max]
 gb|KHN21973.1| UDP-glucuronic acid decarboxylase 1 [Glycine soja]
Length=341

 Score =   157 bits (397),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 76/91 (84%), Positives = 84/91 (92%), Gaps = 0/91 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            +VDGLIRLMEG +TGPIN+GNPGEFTMLELA+TVKE+IN DV+I  VENTPDDPRQRKP 
Sbjct  247  LVDGLIRLMEGSDTGPINLGNPGEFTMLELAETVKELINPDVEIKVVENTPDDPRQRKPI  306

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRL  275
            ITKA ELLGWEPKVKLRDG+PLME+DFR RL
Sbjct  307  ITKAMELLGWEPKVKLRDGLPLMEEDFRLRL  337



>gb|AES88860.2| UDP-glucuronic acid decarboxylase [Medicago truncatula]
Length=342

 Score =   156 bits (395),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 75/96 (78%), Positives = 86/96 (90%), Gaps = 0/96 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            +VDGLIRLM G +TGPIN+GNPGEFTM ELA+TVKE+IN +V+I  VENTPDDPRQRKPD
Sbjct  246  LVDGLIRLMGGSDTGPINLGNPGEFTMTELAETVKELINPNVEIKIVENTPDDPRQRKPD  305

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRLGIGRK  290
            ITKAKELLGWEPKVKL +G+PLME DFR RLG+ +K
Sbjct  306  ITKAKELLGWEPKVKLSEGLPLMEGDFRLRLGVDKK  341



>gb|AFK44446.1| unknown [Medicago truncatula]
Length=345

 Score =   156 bits (395),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 75/96 (78%), Positives = 86/96 (90%), Gaps = 0/96 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            +VDGLIRLM G +TGPIN+GNPGEFTM ELA+TVKE+IN +V+I  VENTPDDPRQRKPD
Sbjct  249  LVDGLIRLMGGSDTGPINLGNPGEFTMTELAETVKELINPNVEIKIVENTPDDPRQRKPD  308

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRLGIGRK  290
            ITKAKELLGWEPKVKL +G+PLME DFR RLG+ +K
Sbjct  309  ITKAKELLGWEPKVKLSEGLPLMEGDFRLRLGVDKK  344



>gb|AES88859.2| UDP-glucuronic acid decarboxylase [Medicago truncatula]
Length=345

 Score =   156 bits (395),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 75/96 (78%), Positives = 86/96 (90%), Gaps = 0/96 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            +VDGLIRLM G +TGPIN+GNPGEFTM ELA+TVKE+IN +V+I  VENTPDDPRQRKPD
Sbjct  249  LVDGLIRLMGGSDTGPINLGNPGEFTMTELAETVKELINPNVEIKIVENTPDDPRQRKPD  308

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRLGIGRK  290
            ITKAKELLGWEPKVKL +G+PLME DFR RLG+ +K
Sbjct  309  ITKAKELLGWEPKVKLSEGLPLMEGDFRLRLGVDKK  344



>ref|NP_001130758.1| hypothetical protein [Zea mays]
 ref|XP_008672856.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|ACF79103.1| unknown [Zea mays]
 gb|ACN28084.1| unknown [Zea mays]
 gb|ACN29118.1| unknown [Zea mays]
 gb|ACN34424.1| unknown [Zea mays]
 tpg|DAA44690.1| TPA: hypothetical protein ZEAMMB73_752508 [Zea mays]
 tpg|DAA44691.1| TPA: hypothetical protein ZEAMMB73_752508 [Zea mays]
Length=350

 Score =   156 bits (395),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 73/99 (74%), Positives = 86/99 (87%), Gaps = 0/99 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            MVDGLIRLM G+NTGPIN+GNPGEFTMLELA+ VKE+IN D+ +   ENTPDDPRQRKPD
Sbjct  252  MVDGLIRLMNGNNTGPINLGNPGEFTMLELAENVKELINPDITVTMTENTPDDPRQRKPD  311

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRLGIGRKS*A  299
            ITKAKE+LGWEPK+ L+DG+ LMEDDFR RL + +K+ A
Sbjct  312  ITKAKEVLGWEPKIVLKDGLVLMEDDFRERLAVPKKTKA  350



>ref|XP_003606663.1| UDP-glucuronic acid decarboxylase [Medicago truncatula]
Length=342

 Score =   156 bits (395),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 75/96 (78%), Positives = 86/96 (90%), Gaps = 0/96 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            +VDGLIRLM G +TGPIN+GNPGEFTM ELA+TVKE+IN +V+I  VENTPDDPRQRKPD
Sbjct  246  LVDGLIRLMGGSDTGPINLGNPGEFTMTELAETVKELINPNVEIKIVENTPDDPRQRKPD  305

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRLGIGRK  290
            ITKAKELLGWEPKVKL +G+PLME DFR RLG+ +K
Sbjct  306  ITKAKELLGWEPKVKLSEGLPLMEGDFRLRLGVDKK  341



>ref|XP_003606662.1| UDP-glucuronic acid decarboxylase [Medicago truncatula]
Length=345

 Score =   156 bits (394),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 75/96 (78%), Positives = 86/96 (90%), Gaps = 0/96 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            +VDGLIRLM G +TGPIN+GNPGEFTM ELA+TVKE+IN +V+I  VENTPDDPRQRKPD
Sbjct  249  LVDGLIRLMGGSDTGPINLGNPGEFTMTELAETVKELINPNVEIKIVENTPDDPRQRKPD  308

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRLGIGRK  290
            ITKAKELLGWEPKVKL +G+PLME DFR RLG+ +K
Sbjct  309  ITKAKELLGWEPKVKLSEGLPLMEGDFRLRLGVDKK  344



>ref|XP_010920649.1| PREDICTED: UDP-glucuronic acid decarboxylase 6-like isoform X2 
[Elaeis guineensis]
Length=319

 Score =   155 bits (391),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 72/97 (74%), Positives = 85/97 (88%), Gaps = 0/97 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            MVDGLIRLM GD+TGPINIGNPGEFTM+ELA+TVKE+++  V++  VENTPDDPRQRKPD
Sbjct  221  MVDGLIRLMGGDHTGPINIGNPGEFTMMELAETVKELVDPTVQVKIVENTPDDPRQRKPD  280

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRLGIGRKS  293
            I KAK LLGWEPK+ LR+G+PLMEDDFR RL + +K 
Sbjct  281  IAKAKGLLGWEPKITLREGLPLMEDDFRQRLAVPKKQ  317



>ref|XP_004984746.1| PREDICTED: UDP-glucuronic acid decarboxylase 6-like isoform X1 
[Setaria italica]
Length=379

 Score =   156 bits (394),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 72/97 (74%), Positives = 84/97 (87%), Gaps = 0/97 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            MVDGLI+LM G+NTGPIN+GNPGEFTMLELA+ VKE+IN +V +   ENTPDDPRQRKPD
Sbjct  283  MVDGLIKLMNGNNTGPINLGNPGEFTMLELAENVKELINPEVTVTMTENTPDDPRQRKPD  342

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRLGIGRKS  293
            ITKAKE+LGWEPKV LRDG+  MEDDFR RL + +K+
Sbjct  343  ITKAKEVLGWEPKVVLRDGLVFMEDDFRERLAVPKKA  379



>gb|KCW83553.1| hypothetical protein EUGRSUZ_B00451 [Eucalyptus grandis]
Length=204

 Score =   151 bits (382),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 74/87 (85%), Positives = 80/87 (92%), Gaps = 0/87 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            MVDGLI LMEG+NTGPINIGNPGEFTM+ELA+TVKE+IN DV+I  VENT DDPRQRKPD
Sbjct  118  MVDGLIWLMEGENTGPINIGNPGEFTMIELAETVKELINPDVEITMVENTLDDPRQRKPD  177

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDF  263
            I KAKELLGWEPKVKLRDG+ LMEDDF
Sbjct  178  IAKAKELLGWEPKVKLRDGLLLMEDDF  204



>ref|XP_010029263.1| PREDICTED: UDP-glucuronic acid decarboxylase 3-like [Eucalyptus 
grandis]
Length=170

 Score =   150 bits (379),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 74/87 (85%), Positives = 80/87 (92%), Gaps = 0/87 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            MVDGLI LMEG+NTGPINIGNPGEFTM+ELA+TVKE+IN DV+I  VENT DDPRQRKPD
Sbjct  84   MVDGLIWLMEGENTGPINIGNPGEFTMIELAETVKELINPDVEITMVENTLDDPRQRKPD  143

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDF  263
            I KAKELLGWEPKVKLRDG+ LMEDDF
Sbjct  144  IAKAKELLGWEPKVKLRDGLLLMEDDF  170



>ref|XP_004984747.1| PREDICTED: UDP-glucuronic acid decarboxylase 6-like isoform X2 
[Setaria italica]
Length=347

 Score =   155 bits (392),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 72/97 (74%), Positives = 84/97 (87%), Gaps = 0/97 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            MVDGLI+LM G+NTGPIN+GNPGEFTMLELA+ VKE+IN +V +   ENTPDDPRQRKPD
Sbjct  251  MVDGLIKLMNGNNTGPINLGNPGEFTMLELAENVKELINPEVTVTMTENTPDDPRQRKPD  310

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRLGIGRKS  293
            ITKAKE+LGWEPKV LRDG+  MEDDFR RL + +K+
Sbjct  311  ITKAKEVLGWEPKVVLRDGLVFMEDDFRERLAVPKKA  347



>ref|XP_010920645.1| PREDICTED: UDP-glucuronic acid decarboxylase 6-like isoform X1 
[Elaeis guineensis]
 ref|XP_010920646.1| PREDICTED: UDP-glucuronic acid decarboxylase 6-like isoform X1 
[Elaeis guineensis]
 ref|XP_010920647.1| PREDICTED: UDP-glucuronic acid decarboxylase 6-like isoform X1 
[Elaeis guineensis]
 ref|XP_010920648.1| PREDICTED: UDP-glucuronic acid decarboxylase 6-like isoform X1 
[Elaeis guineensis]
Length=348

 Score =   155 bits (392),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 72/97 (74%), Positives = 85/97 (88%), Gaps = 0/97 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            MVDGLIRLM GD+TGPINIGNPGEFTM+ELA+TVKE+++  V++  VENTPDDPRQRKPD
Sbjct  250  MVDGLIRLMGGDHTGPINIGNPGEFTMMELAETVKELVDPTVQVKIVENTPDDPRQRKPD  309

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRLGIGRKS  293
            I KAK LLGWEPK+ LR+G+PLMEDDFR RL + +K 
Sbjct  310  IAKAKGLLGWEPKITLREGLPLMEDDFRQRLAVPKKQ  346



>ref|XP_009403448.1| PREDICTED: UDP-glucuronic acid decarboxylase 6-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009403449.1| PREDICTED: UDP-glucuronic acid decarboxylase 6-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009403450.1| PREDICTED: UDP-glucuronic acid decarboxylase 6-like [Musa acuminata 
subsp. malaccensis]
Length=346

 Score =   155 bits (391),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 70/97 (72%), Positives = 84/97 (87%), Gaps = 0/97 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            MVDGLIRLMEG+NTGPIN+GNPGEFTM ELA+ VKE+I   + I  VENTPDDPRQRKP+
Sbjct  250  MVDGLIRLMEGENTGPINLGNPGEFTMTELAEVVKELIEPSISIKIVENTPDDPRQRKPN  309

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRLGIGRKS  293
            I KAK+LLGWEPK+ LR G+PLME+DF+ RLG+ +K+
Sbjct  310  IAKAKQLLGWEPKITLRQGLPLMEEDFKQRLGVSKKA  346



>ref|XP_006649856.1| PREDICTED: UDP-glucuronic acid decarboxylase 6-like [Oryza brachyantha]
Length=351

 Score =   155 bits (391),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 73/99 (74%), Positives = 86/99 (87%), Gaps = 0/99 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            MV+GLI+LM GDNTGPIN+GNPGEFTMLELA+ VKE+IN +V +   ENTPDDPRQRKPD
Sbjct  253  MVNGLIKLMNGDNTGPINLGNPGEFTMLELAENVKELINPEVTVTMTENTPDDPRQRKPD  312

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRLGIGRKS*A  299
            ITKAKE+LGWEPK+ LRDG+ LMEDDFR RL + +K+ A
Sbjct  313  ITKAKEVLGWEPKIVLRDGLVLMEDDFRERLQVPKKNKA  351



>ref|NP_001049723.1| Os03g0278000 [Oryza sativa Japonica Group]
 dbj|BAB84334.1| UDP-glucuronic acid decarboxylase [Oryza sativa Japonica Group]
 gb|ABF95273.1| RmlD substrate binding domain containing protein, expressed [Oryza 
sativa Japonica Group]
 gb|ABF95274.1| RmlD substrate binding domain containing protein, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF11637.1| Os03g0278000 [Oryza sativa Japonica Group]
 gb|EAZ26454.1| hypothetical protein OsJ_10342 [Oryza sativa Japonica Group]
 dbj|BAG94823.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87281.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|AGH17544.1| UDP-glucuronic acid decarboxylase [Oryza sativa]
 gb|AJB98444.1| NAD-dependent epimerase/dehydratase family domain containing 
protein, partial [Oryza sativa]
Length=350

 Score =   154 bits (390),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 73/99 (74%), Positives = 86/99 (87%), Gaps = 0/99 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            MV+GLI+LM GDNTGPIN+GNPGEFTMLELA+ VKE+IN +V +   ENTPDDPRQRKPD
Sbjct  252  MVNGLIKLMNGDNTGPINLGNPGEFTMLELAENVKELINPEVTVTMTENTPDDPRQRKPD  311

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRLGIGRKS*A  299
            ITKAKE+LGWEPK+ LRDG+ LMEDDFR RL + +K+ A
Sbjct  312  ITKAKEVLGWEPKIVLRDGLVLMEDDFRERLQVPKKNQA  350



>emb|CAC14890.1| d-TDP-glucose dehydratase [Phragmites australis]
Length=350

 Score =   154 bits (389),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 73/99 (74%), Positives = 86/99 (87%), Gaps = 0/99 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            MVDGLI+LM G+NTGPIN+GNPGEFTMLELA+ VKE+IN +V +   ENTPDDPRQRKPD
Sbjct  252  MVDGLIKLMNGNNTGPINLGNPGEFTMLELAEKVKELINPEVTVTMTENTPDDPRQRKPD  311

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRLGIGRKS*A  299
            ITKAKE+LGWEPKV LRDG+ LMEDDFR RL + +++ A
Sbjct  312  ITKAKEVLGWEPKVVLRDGLVLMEDDFRERLAVPKETKA  350



>ref|XP_003558221.1| PREDICTED: UDP-glucuronic acid decarboxylase 6 [Brachypodium 
distachyon]
Length=347

 Score =   154 bits (389),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 74/99 (75%), Positives = 85/99 (86%), Gaps = 0/99 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            MV+GL++LM GDNTGPINIGNPGEFTMLELA+ VKE+IN +V +   ENTPDDPRQRKPD
Sbjct  249  MVNGLMKLMNGDNTGPINIGNPGEFTMLELAENVKELINPEVTVTMTENTPDDPRQRKPD  308

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRLGIGRKS*A  299
            ITKAKE+L WEPKV LRDG+ LMEDDFR RL + +KS A
Sbjct  309  ITKAKEVLDWEPKVVLRDGLVLMEDDFRERLAVPKKSKA  347



>gb|EEC74970.1| hypothetical protein OsI_10996 [Oryza sativa Indica Group]
Length=423

 Score =   155 bits (393),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 73/99 (74%), Positives = 86/99 (87%), Gaps = 0/99 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            MV+GLI+LM GDNTGPIN+GNPGEFTMLELA+ VKE+IN +V +   ENTPDDPRQRKPD
Sbjct  325  MVNGLIKLMNGDNTGPINLGNPGEFTMLELAENVKELINPEVTVTMTENTPDDPRQRKPD  384

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRLGIGRKS*A  299
            ITKAKE+LGWEPK+ LRDG+ LMEDDFR RL + +K+ A
Sbjct  385  ITKAKEVLGWEPKIVLRDGLVLMEDDFRERLQVPKKNQA  423



>ref|NP_001132037.1| uncharacterized protein LOC100193447 [Zea mays]
 gb|ACF80717.1| unknown [Zea mays]
 gb|AFW88807.1| UDP-glucuronic acid decarboxylase 1 isoform 1 [Zea mays]
 gb|AFW88808.1| UDP-glucuronic acid decarboxylase 1 isoform 2 [Zea mays]
Length=350

 Score =   154 bits (388),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 73/99 (74%), Positives = 85/99 (86%), Gaps = 0/99 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            MVDGLI+LM G+ TGPIN+GNPGEFTMLELA+ VKE+IN DV +   ENTPDDPRQRKPD
Sbjct  252  MVDGLIKLMNGNKTGPINLGNPGEFTMLELAENVKELINPDVTVTMTENTPDDPRQRKPD  311

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRLGIGRKS*A  299
            ITKAKE+LGWEPK+ LRDG+ LMEDDFR RL + +K+ A
Sbjct  312  ITKAKEVLGWEPKIVLRDGLVLMEDDFRERLTVPKKTKA  350



>gb|AAT80326.1| UDP-D-glucuronate decarboxylase [Hordeum vulgare]
 dbj|BAJ90511.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=348

 Score =   153 bits (386),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 73/99 (74%), Positives = 85/99 (86%), Gaps = 0/99 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            MV+GL++LM GDNTGPINIGNPGEFTMLELA+ VKE+IN +V +   ENTPDDPRQRKPD
Sbjct  250  MVNGLMKLMNGDNTGPINIGNPGEFTMLELAENVKELINPEVTVTMTENTPDDPRQRKPD  309

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRLGIGRKS*A  299
            ITKAKE+L WEPKV LRDG+ LMEDDFR RL + +K+ A
Sbjct  310  ITKAKEVLDWEPKVVLRDGLVLMEDDFRERLAVPKKAKA  348



>gb|EMS54364.1| UDP-glucuronic acid decarboxylase 1 [Triticum urartu]
Length=348

 Score =   153 bits (386),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 73/99 (74%), Positives = 85/99 (86%), Gaps = 0/99 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            MV+GL++LM GDNTGPINIGNPGEFTMLELA+ VKE+IN +V +   ENTPDDPRQRKPD
Sbjct  250  MVNGLMKLMNGDNTGPINIGNPGEFTMLELAENVKELINPEVTVTMTENTPDDPRQRKPD  309

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRLGIGRKS*A  299
            ITKAKE+L WEPKV LRDG+ LMEDDFR RL + +K+ A
Sbjct  310  ITKAKEVLDWEPKVVLRDGLVLMEDDFRERLAVPKKTKA  348



>gb|EMT27519.1| UDP-glucuronic acid decarboxylase 1 [Aegilops tauschii]
Length=386

 Score =   153 bits (387),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 73/99 (74%), Positives = 85/99 (86%), Gaps = 0/99 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            MV+GL++LM GDNTGPINIGNPGEFTMLELA+ VKE+IN +V +   ENTPDDPRQRKPD
Sbjct  288  MVNGLMKLMNGDNTGPINIGNPGEFTMLELAENVKELINPEVTVTMTENTPDDPRQRKPD  347

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRLGIGRKS*A  299
            ITKAKE+L WEPKV LRDG+ LMEDDFR RL + +K+ A
Sbjct  348  ITKAKEVLDWEPKVVLRDGLVLMEDDFRERLAVPKKTKA  386



>ref|XP_007132088.1| hypothetical protein PHAVU_011G065800g [Phaseolus vulgaris]
 ref|XP_007132089.1| hypothetical protein PHAVU_011G065800g [Phaseolus vulgaris]
 gb|ESW04082.1| hypothetical protein PHAVU_011G065800g [Phaseolus vulgaris]
 gb|ESW04083.1| hypothetical protein PHAVU_011G065800g [Phaseolus vulgaris]
Length=346

 Score =   152 bits (383),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 71/93 (76%), Positives = 84/93 (90%), Gaps = 0/93 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            +VDGLIRLMEG +TGPIN+GNPGEFT+LELA+ VKE++N  V+I  V+NTPDDPRQRKPD
Sbjct  250  LVDGLIRLMEGSDTGPINLGNPGEFTVLELAEKVKELVNPGVEIKIVDNTPDDPRQRKPD  309

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRLGI  281
            ITKAKELL WEPK KL+DG+PLME+DFR RLG+
Sbjct  310  ITKAKELLNWEPKFKLQDGLPLMEEDFRLRLGV  342



>ref|XP_011070930.1| PREDICTED: UDP-glucuronic acid decarboxylase 5-like isoform X1 
[Sesamum indicum]
Length=364

 Score =   148 bits (373),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 74/96 (77%), Positives = 82/96 (85%), Gaps = 8/96 (8%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            MVDGLIRLMEGDNTG        EFTMLELA+TVKEMIN  ++I+ VENTPDDPRQRKPD
Sbjct  277  MVDGLIRLMEGDNTG--------EFTMLELAETVKEMINPAIEIIKVENTPDDPRQRKPD  328

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRLGIGRK  290
            ITKAKELLGWEP++KL DGIPLME+DFR R+GI RK
Sbjct  329  ITKAKELLGWEPRIKLHDGIPLMEEDFRKRIGILRK  364



>gb|ABK24241.1| unknown [Picea sitchensis]
 gb|ACN39800.1| unknown [Picea sitchensis]
Length=351

 Score =   148 bits (373),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 69/96 (72%), Positives = 80/96 (83%), Gaps = 0/96 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            MVDGLIRLMEG+NTGPIN+GNPGEFTMLELA+ VKE+I    ++   ENTPDDPR RKPD
Sbjct  256  MVDGLIRLMEGENTGPINLGNPGEFTMLELAEAVKELIEPSAQLKITENTPDDPRMRKPD  315

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRLGIGRK  290
            ITKAK LLGWEPKV LR+G+P M +DFR RL + +K
Sbjct  316  ITKAKTLLGWEPKVSLREGLPRMAEDFRLRLNVPKK  351



>ref|XP_002963158.1| hypothetical protein SELMODRAFT_438351 [Selaginella moellendorffii]
 ref|XP_002981631.1| hypothetical protein SELMODRAFT_154643 [Selaginella moellendorffii]
 gb|EFJ17446.1| hypothetical protein SELMODRAFT_154643 [Selaginella moellendorffii]
 gb|EFJ35029.1| hypothetical protein SELMODRAFT_438351 [Selaginella moellendorffii]
Length=348

 Score =   143 bits (360),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 65/95 (68%), Positives = 82/95 (86%), Gaps = 0/95 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            +VDGLI+LM  D+TGPIN+GNPGEFT+LELA+ V+E+++S  K   V+NTPDDPR+RKPD
Sbjct  254  LVDGLIKLMACDDTGPINLGNPGEFTILELAEAVRELVDSSAKWKVVDNTPDDPRKRKPD  313

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRLGIGR  287
            ITKAK +L WEPKV LRDG+PLM +DFR+RLGI +
Sbjct  314  ITKAKSILKWEPKVALRDGLPLMVEDFRSRLGIHK  348



>ref|XP_001775323.1| predicted protein [Physcomitrella patens]
 gb|EDQ59928.1| predicted protein [Physcomitrella patens]
Length=339

 Score =   139 bits (349),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 66/91 (73%), Positives = 75/91 (82%), Gaps = 0/91 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            MVDGL RLM GD+TGPINIGNPGEFTMLELA  VKE+I    +   VENTPDDPR+RKPD
Sbjct  244  MVDGLYRLMNGDHTGPINIGNPGEFTMLELAGLVKELIEPSAETKIVENTPDDPRKRKPD  303

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRL  275
            ITKA +LLGW+PKV LR+G+PLM  DF+ RL
Sbjct  304  ITKATKLLGWDPKVTLREGLPLMAADFKERL  334



>emb|CDY15778.1| BnaC04g15460D [Brassica napus]
Length=201

 Score =   132 bits (333),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 63/83 (76%), Positives = 74/83 (89%), Gaps = 0/83 (0%)
 Frame = +3

Query  42   TGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPDITKAKELLGWEPK  221
            T PINIGNPGEFTM+ELA+TVK++I  DV+I  VENTPDDPRQRKPDI+KAKE+LGWEPK
Sbjct  119  TRPINIGNPGEFTMVELAETVKDLIKLDVEIKMVENTPDDPRQRKPDISKAKEVLGWEPK  178

Query  222  VKLRDGIPLMEDDFRTRLGIGRK  290
            VKLR+G+PLME+DF  RLG+  K
Sbjct  179  VKLREGLPLMEEDFCLRLGVLEK  201



>ref|XP_009387911.1| PREDICTED: UDP-glucuronic acid decarboxylase 4-like [Musa acuminata 
subsp. malaccensis]
Length=176

 Score =   128 bits (322),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 60/91 (66%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            +V+GL+RLMEG++ GP N+GNPGEFTMLELA+ V+E I+ + KI    NT DDP +RKPD
Sbjct  63   LVEGLMRLMEGEHVGPFNLGNPGEFTMLELANVVQETIDPNAKIEFRPNTEDDPHKRKPD  122

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRL  275
            ITKAKELLGWEPK+ LR G+PLM  DFR R+
Sbjct  123  ITKAKELLGWEPKIPLRQGLPLMVSDFRKRI  153



>emb|CDO98853.1| unnamed protein product [Coffea canephora]
Length=239

 Score =   130 bits (326),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 60/91 (66%), Positives = 75/91 (82%), Gaps = 0/91 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            +V+GL+RLMEGD+ GP N+GNPGEFTMLELA  V++ I+ + KI   ENT DDP +RKPD
Sbjct  134  LVEGLMRLMEGDHVGPFNLGNPGEFTMLELAKVVQDTIDPNAKIEFRENTADDPHKRKPD  193

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRL  275
            I+KAK+LLGWEPKV LR+G+PLM  DFR R+
Sbjct  194  ISKAKKLLGWEPKVSLREGLPLMVSDFRRRI  224



>dbj|BAI66424.1| UDP-D-glucuronate decarboxylase [Triticum aestivum]
 gb|EMT09071.1| UDP-glucuronic acid decarboxylase 1 [Aegilops tauschii]
Length=271

 Score =   130 bits (328),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 60/91 (66%), Positives = 75/91 (82%), Gaps = 0/91 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            +V+GL++LMEGD+ GP N+GNPGEFTMLELA  V++ I+ + +I    NT DDP +RKPD
Sbjct  166  LVEGLMKLMEGDHVGPFNLGNPGEFTMLELAKVVQDTIDPNARIEFRANTADDPHKRKPD  225

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRL  275
            ITKAKELLGWEPKV LR+G+PLM  DFRTR+
Sbjct  226  ITKAKELLGWEPKVALRNGLPLMVQDFRTRI  256



>gb|EMS47862.1| UDP-glucuronic acid decarboxylase 1 [Triticum urartu]
Length=224

 Score =   129 bits (325),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 60/91 (66%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            +V+GL+RLMEGD+ GP N+GNPGEFTMLELA  V++ I+ + +I   ENT DDP +RKPD
Sbjct  120  LVEGLMRLMEGDHIGPFNLGNPGEFTMLELAKVVQDTIDPNARIEFRENTQDDPHKRKPD  179

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRL  275
            ITKAKE LGWEPK+ LRDG+PLM  DFR R+
Sbjct  180  ITKAKEQLGWEPKIALRDGLPLMVTDFRKRI  210



>gb|KHG20553.1| UDP-glucuronic acid decarboxylase 1 [Gossypium arboreum]
Length=190

 Score =   128 bits (321),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 59/91 (65%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            +V+GL+RLMEG++ GP N+GNPGEFTMLELA+ V+E I+ + KI    NT DDP +RKPD
Sbjct  83   LVEGLMRLMEGEHVGPFNLGNPGEFTMLELAEVVQETIDPNAKIEFRPNTEDDPHKRKPD  142

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRL  275
            I++AKELLGWEPKV LR G+PLM  DFR R+
Sbjct  143  ISRAKELLGWEPKVSLRKGLPLMVSDFRQRI  173



>ref|XP_010098258.1| UDP-glucuronic acid decarboxylase 1 [Morus notabilis]
 gb|EXB74762.1| UDP-glucuronic acid decarboxylase 1 [Morus notabilis]
Length=225

 Score =   129 bits (323),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 60/91 (66%), Positives = 73/91 (80%), Gaps = 0/91 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            +V+GLIRLMEGD+ GP N+GNPGEFTMLELA  V+E+I+ + KI    NT DDP +R+PD
Sbjct  120  LVEGLIRLMEGDHVGPFNLGNPGEFTMLELAQVVQEVIDPNAKIEFRPNTEDDPHKRRPD  179

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRL  275
            I+KAKELLGWEP V LR G+PLM  DFR R+
Sbjct  180  ISKAKELLGWEPVVSLRKGLPLMVSDFRQRI  210



>emb|CBI22997.3| unnamed protein product [Vitis vinifera]
Length=345

 Score =   131 bits (330),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 62/96 (65%), Positives = 75/96 (78%), Gaps = 0/96 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            +V+GLIRLMEG++ GP N+GNPGEFTMLELA  V+E I+ + KI    NT DDP +RKPD
Sbjct  239  LVEGLIRLMEGEHVGPFNLGNPGEFTMLELAQVVQETIDPNAKIEFRPNTEDDPHKRKPD  298

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRLGIGRK  290
            I+KAK+LLGWEP V LR+G+PLM  DFR RL   RK
Sbjct  299  ISKAKQLLGWEPSVSLRNGLPLMVSDFRQRLFGDRK  334



>gb|ABK94589.1| unknown [Populus trichocarpa]
Length=139

 Score =   126 bits (316),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 57/91 (63%), Positives = 73/91 (80%), Gaps = 0/91 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            +VDGL+ LMEG++ GP N+GNPGEFTML+LA+ VKE I+S   I    NT DDP +RKPD
Sbjct  40   LVDGLVALMEGEHVGPFNLGNPGEFTMLQLAEVVKETIDSSATIEFKPNTADDPHKRKPD  99

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRL  275
            I+KAKELL WEP++ LR+G+PLM +DFR R+
Sbjct  100  ISKAKELLNWEPRISLREGLPLMVNDFRNRI  130



>ref|XP_006419549.1| hypothetical protein CICLE_v10004959mg [Citrus clementina]
 gb|ESR32789.1| hypothetical protein CICLE_v10004959mg [Citrus clementina]
Length=447

 Score =   132 bits (332),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 60/91 (66%), Positives = 75/91 (82%), Gaps = 0/91 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            +V+GLIRLMEGD+ GP N+GNPGEFTMLELA+ V+E+I+ + +I    NT DDP +RKPD
Sbjct  332  LVEGLIRLMEGDHVGPFNLGNPGEFTMLELAEVVQEIIDRNARIEFRPNTEDDPHKRKPD  391

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRL  275
            ITKAK+LLGWEP+V LR G+PLM  DFR R+
Sbjct  392  ITKAKQLLGWEPRVTLRKGLPLMVADFRHRI  422



>ref|XP_008454336.1| PREDICTED: UDP-glucuronic acid decarboxylase 2 [Cucumis melo]
Length=435

 Score =   132 bits (331),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 62/91 (68%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            +V+GL+RLMEG++ GP N+GNPGEFTMLELA  V+E I+ D KIV   NT DDP +RKPD
Sbjct  331  LVEGLMRLMEGEHIGPFNLGNPGEFTMLELAKVVQETIDPDAKIVYKPNTEDDPHKRKPD  390

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRL  275
            ITKAK+LLGWEPKV LR G+PLM  DFR R+
Sbjct  391  ITKAKDLLGWEPKVPLRKGLPLMVSDFRQRI  421



>gb|KDO71703.1| hypothetical protein CISIN_1g013226mg [Citrus sinensis]
Length=447

 Score =   132 bits (331),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 60/91 (66%), Positives = 75/91 (82%), Gaps = 0/91 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            +V+GLIRLMEGD+ GP N+GNPGEFTMLELA+ V+E+I+ + +I    NT DDP +RKPD
Sbjct  332  LVEGLIRLMEGDHVGPFNLGNPGEFTMLELAEVVQEIIDRNARIEFRPNTEDDPHKRKPD  391

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRL  275
            ITKAK+LLGWEP+V LR G+PLM  DFR R+
Sbjct  392  ITKAKQLLGWEPRVTLRKGLPLMVADFRHRI  422



>ref|XP_010069913.1| PREDICTED: UDP-glucuronic acid decarboxylase 2 [Eucalyptus grandis]
 gb|KCW58435.1| hypothetical protein EUGRSUZ_H01112 [Eucalyptus grandis]
Length=443

 Score =   132 bits (331),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 62/91 (68%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            +V+GL+RLMEG++ GP N+GNPGEFTMLELA+ VKE I+ + KI    NT DDP +RKPD
Sbjct  338  LVEGLMRLMEGEHVGPFNLGNPGEFTMLELAEVVKETIDPNAKIEFKPNTEDDPHKRKPD  397

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRL  275
            ITKAKELLGWEPKV LR G+PLM  DFR R+
Sbjct  398  ITKAKELLGWEPKVALRKGLPLMVSDFRQRV  428



>ref|XP_006489058.1| PREDICTED: UDP-glucuronic acid decarboxylase 2-like [Citrus sinensis]
Length=447

 Score =   132 bits (331),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 60/91 (66%), Positives = 75/91 (82%), Gaps = 0/91 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            +V+GLIRLMEGD+ GP N+GNPGEFTMLELA+ V+E+I+ + +I    NT DDP +RKPD
Sbjct  332  LVEGLIRLMEGDHVGPFNLGNPGEFTMLELAEVVQEIIDRNARIEFRPNTEDDPHKRKPD  391

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRL  275
            ITKAK+LLGWEP+V LR G+PLM  DFR R+
Sbjct  392  ITKAKQLLGWEPRVTLRKGLPLMVADFRHRI  422



>ref|XP_001776651.1| predicted protein [Physcomitrella patens]
 gb|EDQ58487.1| predicted protein [Physcomitrella patens]
Length=436

 Score =   131 bits (330),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 59/91 (65%), Positives = 75/91 (82%), Gaps = 0/91 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            +V+GL+RLMEG++ GP N+GNPGEFTMLELA+ VKE+I+    I   ENT DDP +RKPD
Sbjct  336  LVEGLMRLMEGEHVGPFNLGNPGEFTMLELAEVVKEVIDPSATIEYKENTSDDPHKRKPD  395

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRL  275
            I+KAKELLGWEPK+ L+ G+PLM +DFR R+
Sbjct  396  ISKAKELLGWEPKISLKKGLPLMVEDFRKRI  426



>gb|EMT08059.1| UDP-glucuronic acid decarboxylase 1 [Aegilops tauschii]
Length=313

 Score =   129 bits (325),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 60/91 (66%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            +V+GL+RLMEGD+ GP N+GNPGEFTMLELA  V++ I+ + +I   ENT DDP +RKPD
Sbjct  209  LVEGLMRLMEGDHIGPFNLGNPGEFTMLELAKVVQDTIDPNARIEFRENTQDDPHKRKPD  268

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRL  275
            ITKAKE LGWEPK+ LRDG+PLM  DFR R+
Sbjct  269  ITKAKEQLGWEPKIALRDGLPLMVTDFRKRI  299



>gb|EMS60966.1| UDP-glucuronic acid decarboxylase 1 [Triticum urartu]
Length=327

 Score =   130 bits (326),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 59/91 (65%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            +V+GL++LMEGD+ GP N+GNPGEFTMLELA  V++ I+ + +I    NT DDP +RKPD
Sbjct  224  LVEGLMKLMEGDHVGPFNLGNPGEFTMLELAKVVQDTIDPNARIEFRANTADDPHKRKPD  283

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRL  275
            ITKAKELLGWEPKV LR+G+PLM  DFR R+
Sbjct  284  ITKAKELLGWEPKVALRNGLPLMVQDFRARI  314



>emb|CBI36861.3| unnamed protein product [Vitis vinifera]
Length=229

 Score =   127 bits (320),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 60/91 (66%), Positives = 73/91 (80%), Gaps = 0/91 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            +V+GLIRLMEG++ GP N+GNPGEFTMLELA  V+E I+ + KI    NT DDP +RKPD
Sbjct  120  LVEGLIRLMEGEHVGPFNLGNPGEFTMLELAQVVQETIDPNAKIEFRPNTEDDPHKRKPD  179

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRL  275
            I+KAK+LLGWEPKV LR G+PLM  DFR R+
Sbjct  180  ISKAKDLLGWEPKVALRKGLPLMVSDFRERI  210



>gb|AAT80328.1| UDP-D-glucuronate decarboxylase [Hordeum vulgare]
Length=385

 Score =   130 bits (327),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 59/91 (65%), Positives = 75/91 (82%), Gaps = 0/91 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            +V+GL++LMEG++ GP N+GNPGEFTMLELA  V++ I+ + +I    NT DDP +RKPD
Sbjct  282  LVEGLMKLMEGEHVGPFNLGNPGEFTMLELAKVVQDTIDPNARIEFRANTADDPHKRKPD  341

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRL  275
            ITKAKELLGWEPKV LR+G+PLM  DFRTR+
Sbjct  342  ITKAKELLGWEPKVALRNGLPLMVQDFRTRI  372



>gb|ABK24329.1| unknown [Picea sitchensis]
Length=417

 Score =   130 bits (328),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 60/91 (66%), Positives = 75/91 (82%), Gaps = 0/91 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            +V+GLIRLME ++ GP N+GNPGEFTMLELA+ VKE I+S+ KI   ENT DDP +RKPD
Sbjct  326  LVEGLIRLMESNHVGPFNLGNPGEFTMLELAEVVKETIDSNAKIEFKENTADDPHKRKPD  385

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRL  275
            ITKAK+LL WEPK+ LR+G+PLM +DF  R+
Sbjct  386  ITKAKDLLKWEPKISLREGLPLMVEDFHKRI  416



>ref|XP_002269917.1| PREDICTED: UDP-glucuronic acid decarboxylase 2-like [Vitis vinifera]
Length=429

 Score =   131 bits (329),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 62/96 (65%), Positives = 75/96 (78%), Gaps = 0/96 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            +V+GLIRLMEG++ GP N+GNPGEFTMLELA  V+E I+ + KI    NT DDP +RKPD
Sbjct  323  LVEGLIRLMEGEHVGPFNLGNPGEFTMLELAQVVQETIDPNAKIEFRPNTEDDPHKRKPD  382

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRLGIGRK  290
            I+KAK+LLGWEP V LR+G+PLM  DFR RL   RK
Sbjct  383  ISKAKQLLGWEPSVSLRNGLPLMVSDFRQRLFGDRK  418



>gb|KHN03354.1| UDP-glucuronic acid decarboxylase 1 [Glycine soja]
Length=279

 Score =   128 bits (322),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 59/91 (65%), Positives = 73/91 (80%), Gaps = 0/91 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            +V+GL+RLMEG++ GP N+GNPGEFTMLELA  V+E I+ + KI    NT DDP +RKPD
Sbjct  173  LVEGLMRLMEGEHVGPFNLGNPGEFTMLELAQVVQETIDPNAKIEFRPNTEDDPHKRKPD  232

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRL  275
            I+KAKELLGW+P V LR+G+PLM  DFR RL
Sbjct  233  ISKAKELLGWQPSVSLREGLPLMVSDFRQRL  263



>ref|XP_006359374.1| PREDICTED: UDP-glucuronic acid decarboxylase 2-like [Solanum 
tuberosum]
Length=439

 Score =   131 bits (329),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 59/91 (65%), Positives = 75/91 (82%), Gaps = 0/91 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            +V+GL+RLMEG++ GP N+GNPGEFTMLELA  V+E I+ + +IV   NT DDP +RKPD
Sbjct  335  LVEGLMRLMEGEHVGPFNLGNPGEFTMLELAKVVQETIDPNAQIVHKPNTEDDPHKRKPD  394

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRL  275
            I+KAKELLGWEPKV LR+G+P+M  DFR R+
Sbjct  395  ISKAKELLGWEPKVALRNGLPMMVQDFRQRI  425



>ref|XP_004247418.1| PREDICTED: UDP-glucuronic acid decarboxylase 2 [Solanum lycopersicum]
Length=440

 Score =   131 bits (329),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 59/91 (65%), Positives = 75/91 (82%), Gaps = 0/91 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            +V+GL+RLMEG++ GP N+GNPGEFTMLELA  V+E I+ + +IV   NT DDP +RKPD
Sbjct  336  LVEGLMRLMEGEHVGPFNLGNPGEFTMLELAKVVQETIDPNAQIVHKPNTEDDPHKRKPD  395

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRL  275
            I+KAKELLGWEPKV LR+G+P+M  DFR R+
Sbjct  396  ISKAKELLGWEPKVALRNGLPMMVQDFRQRI  426



>gb|AAT80327.1| UDP-D-glucuronate decarboxylase [Hordeum vulgare]
Length=400

 Score =   130 bits (327),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 60/91 (66%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            +V+GL+RLMEGD+ GP N+GNPGEFTMLELA  V++ I+ + +I   ENT DDP +RKPD
Sbjct  296  LVEGLMRLMEGDHIGPFNLGNPGEFTMLELAKVVQDTIDPNARIEFRENTQDDPHKRKPD  355

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRL  275
            ITKAKE LGWEPK+ LRDG+PLM  DFR R+
Sbjct  356  ITKAKEQLGWEPKIALRDGLPLMVTDFRKRI  386



>ref|XP_010528269.1| PREDICTED: UDP-glucuronic acid decarboxylase 1-like [Tarenaya 
hassleriana]
Length=433

 Score =   130 bits (328),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 59/91 (65%), Positives = 75/91 (82%), Gaps = 0/91 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            +VDGL+ LMEG++ GP N+GNPGEFTMLELA+ VKE+I++  +I    NT DDP +RKPD
Sbjct  334  LVDGLVALMEGEHVGPFNLGNPGEFTMLELAEVVKEVIDTSARIEFRPNTADDPHKRKPD  393

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRL  275
            I+KAKELL WEPK+ LRDG+PLM +DFR R+
Sbjct  394  ISKAKELLNWEPKISLRDGLPLMVNDFRDRI  424



>ref|XP_009769287.1| PREDICTED: UDP-glucuronic acid decarboxylase 4-like [Nicotiana 
sylvestris]
Length=430

 Score =   130 bits (328),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 60/91 (66%), Positives = 73/91 (80%), Gaps = 0/91 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            +V+GL+RLMEGD+ GP N+GNPGEFTMLELA  V+E I+ + KI    NT DDP +RKPD
Sbjct  326  LVEGLMRLMEGDHVGPFNLGNPGEFTMLELAKVVQETIDPNAKIEFRSNTEDDPHKRKPD  385

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRL  275
            ITKAK+LLGWEP V LR G+P+M DDFR R+
Sbjct  386  ITKAKQLLGWEPTVSLRQGLPMMVDDFRQRI  416



>gb|KHN02958.1| UDP-glucuronic acid decarboxylase 1 [Glycine soja]
Length=274

 Score =   128 bits (321),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 59/91 (65%), Positives = 73/91 (80%), Gaps = 0/91 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            +V+GL+RLMEG++ GP N+GNPGEFTMLELA  V+E I+ + KI    NT DDP +RKPD
Sbjct  168  LVEGLMRLMEGEHVGPFNLGNPGEFTMLELAQVVQETIDPNAKIEFRPNTEDDPHKRKPD  227

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRL  275
            I+KAKELLGW+P V LR+G+PLM  DFR RL
Sbjct  228  ISKAKELLGWQPTVSLREGLPLMVSDFRQRL  258



>dbj|BAJ85483.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=436

 Score =   130 bits (327),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 59/91 (65%), Positives = 75/91 (82%), Gaps = 0/91 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            +V+GL++LMEG++ GP N+GNPGEFTMLELA  V++ I+ + +I    NT DDP +RKPD
Sbjct  333  LVEGLMKLMEGEHVGPFNLGNPGEFTMLELAKVVQDTIDPNARIEFRANTADDPHKRKPD  392

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRL  275
            ITKAKELLGWEPKV LR+G+PLM  DFRTR+
Sbjct  393  ITKAKELLGWEPKVALRNGLPLMVQDFRTRI  423



>ref|XP_004152248.1| PREDICTED: UDP-glucuronic acid decarboxylase 1-like [Cucumis 
sativus]
 ref|XP_004156838.1| PREDICTED: UDP-glucuronic acid decarboxylase 1-like [Cucumis 
sativus]
 gb|KGN52813.1| hypothetical protein Csa_4G001800 [Cucumis sativus]
Length=435

 Score =   130 bits (327),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 60/91 (66%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            +V+GL++LMEG++ GP N+GNPGEFTMLELA  V+E I+ D KIV   NT DDP +RKPD
Sbjct  331  LVEGLMKLMEGEHIGPFNLGNPGEFTMLELAKVVQETIDPDAKIVYKPNTADDPHKRKPD  390

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRL  275
            ITKAK+LLGWEPK+ LR G+PLM  DFR R+
Sbjct  391  ITKAKDLLGWEPKIPLRKGLPLMVSDFRQRI  421



>ref|XP_011019255.1| PREDICTED: UDP-glucuronic acid decarboxylase 1-like [Populus 
euphratica]
Length=429

 Score =   130 bits (327),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 59/91 (65%), Positives = 73/91 (80%), Gaps = 0/91 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            +VDGL+ LMEG++ GP N+GNPGEFTMLELA+ VKE I+S   I    NT DDP +RKPD
Sbjct  330  LVDGLVALMEGEHVGPFNLGNPGEFTMLELAEVVKETIDSSATIEFRANTADDPHKRKPD  389

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRL  275
            I+KAKELL WEPK+ LR+G+PLM +DFR R+
Sbjct  390  ISKAKELLNWEPKISLREGLPLMVNDFRNRI  420



>gb|AGK44105.1| UDP-glucuronate decarboxylase protein 4 [Populus tomentosa]
 gb|AGK44112.1| UDP-glucuronate decarboxylase protein 4 [Populus tomentosa]
Length=424

 Score =   130 bits (326),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 59/91 (65%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            +VDGL+ LMEG++ GP N+GNPGEFTMLELA+ VKE I+S   I    NT DDP +RKPD
Sbjct  325  LVDGLVALMEGEHVGPFNLGNPGEFTMLELAEVVKETIDSSATIEFRPNTADDPHKRKPD  384

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRL  275
            I+KAKELL WEPK+ LR+G+PLM +DFR+R+
Sbjct  385  ISKAKELLNWEPKISLREGLPLMVNDFRSRI  415



>ref|XP_010520999.1| PREDICTED: UDP-glucuronic acid decarboxylase 2-like [Tarenaya 
hassleriana]
Length=434

 Score =   130 bits (326),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 60/91 (66%), Positives = 73/91 (80%), Gaps = 0/91 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            +V+GL+RLMEG++ GP N+GNPGEFTMLELA  V+E I+ + KI    NT DDP +RKPD
Sbjct  335  LVEGLMRLMEGEHVGPFNLGNPGEFTMLELAQVVQEAIDPNAKIEFRPNTEDDPHKRKPD  394

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRL  275
            IT+AKELLGWEPKV LR G+PLM  DFR R+
Sbjct  395  ITRAKELLGWEPKVSLRHGLPLMVSDFRLRI  425



>ref|XP_006397963.1| hypothetical protein EUTSA_v10001451mg [Eutrema salsugineum]
 gb|ESQ39416.1| hypothetical protein EUTSA_v10001451mg [Eutrema salsugineum]
Length=440

 Score =   130 bits (326),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 61/91 (67%), Positives = 73/91 (80%), Gaps = 0/91 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            +V+GL+RLMEG++ GP N+GNPGEFTMLELA  V+E I+ + KI    NT DDP +RKPD
Sbjct  335  LVEGLMRLMEGEHVGPFNLGNPGEFTMLELAKVVQETIDPNAKIEFRPNTEDDPHKRKPD  394

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRL  275
            ITKAKELLGWEPKV LR G+PLM  DFR R+
Sbjct  395  ITKAKELLGWEPKVALRQGLPLMVKDFRQRV  425



>ref|XP_010519351.1| PREDICTED: UDP-glucuronic acid decarboxylase 2 [Tarenaya hassleriana]
Length=439

 Score =   130 bits (326),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 60/91 (66%), Positives = 73/91 (80%), Gaps = 0/91 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            +V+GL+RLMEG++ GP N+GNPGEFTMLELA  V+E I+ + KI    NT DDP +RKPD
Sbjct  335  LVEGLMRLMEGEHVGPFNLGNPGEFTMLELAQVVQEAIDPNAKIEFRPNTEDDPHKRKPD  394

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRL  275
            IT+AKELLGWEPKV LR G+PLM  DFR R+
Sbjct  395  ITRAKELLGWEPKVSLRHGLPLMVSDFRLRI  425



>ref|XP_006294240.1| hypothetical protein CARUB_v10023238mg [Capsella rubella]
 gb|EOA27138.1| hypothetical protein CARUB_v10023238mg [Capsella rubella]
Length=437

 Score =   130 bits (326),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 61/91 (67%), Positives = 73/91 (80%), Gaps = 0/91 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            +V+GL+RLMEG++ GP N+GNPGEFTMLELA  V+E I+ + KI    NT DDP +RKPD
Sbjct  331  LVEGLMRLMEGEHVGPFNLGNPGEFTMLELAKVVQETIDPNAKIEFRPNTEDDPHKRKPD  390

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRL  275
            ITKAKELLGWEPKV LR G+PLM  DFR R+
Sbjct  391  ITKAKELLGWEPKVALRQGLPLMVKDFRQRV  421



>ref|XP_009133822.1| PREDICTED: UDP-glucuronic acid decarboxylase 4 [Brassica rapa]
Length=438

 Score =   130 bits (326),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 61/91 (67%), Positives = 73/91 (80%), Gaps = 0/91 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            +V+GL+RLMEG++ GP N+GNPGEFTMLELA  V+E I+ + KI    NT DDP +RKPD
Sbjct  332  LVEGLMRLMEGEHVGPFNLGNPGEFTMLELAKVVQETIDPNAKIEFRPNTEDDPHKRKPD  391

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRL  275
            ITKAKELLGWEPKV LR G+PLM  DFR R+
Sbjct  392  ITKAKELLGWEPKVALRQGLPLMVKDFRQRV  422



>ref|XP_009783145.1| PREDICTED: UDP-glucuronic acid decarboxylase 1-like [Nicotiana 
sylvestris]
Length=433

 Score =   130 bits (326),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 60/91 (66%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            +VDGL+ LMEG++ GP N+GNPGEFTMLELA+ VKE+I+   KI    NT DDP +RKPD
Sbjct  334  LVDGLVALMEGEHIGPFNLGNPGEFTMLELAEVVKEVIDPSAKIEFRANTADDPHKRKPD  393

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRL  275
            I+KAKELL WEPKV LR+G+PLM +DFR R+
Sbjct  394  ISKAKELLNWEPKVPLREGLPLMVNDFRNRI  424



>ref|XP_002534053.1| dtdp-glucose 4-6-dehydratase, putative [Ricinus communis]
 gb|EEF28331.1| dtdp-glucose 4-6-dehydratase, putative [Ricinus communis]
Length=369

 Score =   129 bits (324),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 59/91 (65%), Positives = 72/91 (79%), Gaps = 0/91 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            +VDGL+ LME ++ GP N+GNPGEFTMLELA+ VKE I+S   I    NT DDP +RKPD
Sbjct  269  LVDGLVALMESEHVGPFNLGNPGEFTMLELAEVVKETIDSSATIEFKPNTADDPHKRKPD  328

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRL  275
            I+KAKELL WEPK+ LRDG+PLM +DFR R+
Sbjct  329  ISKAKELLNWEPKISLRDGLPLMVNDFRNRI  359



>emb|CDP17130.1| unnamed protein product [Coffea canephora]
Length=222

 Score =   126 bits (316),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 58/91 (64%), Positives = 72/91 (79%), Gaps = 0/91 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            +V+GL+RLMEG++ GP N+GNPGEFTMLELA  V+E I+ + KI    NT DDP +RKPD
Sbjct  120  LVEGLMRLMEGEHVGPFNLGNPGEFTMLELAQVVQETIDPNAKIEFKPNTEDDPHKRKPD  179

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRL  275
            I+KAKE LGWEPK+ LR G+PLM  DFR R+
Sbjct  180  ISKAKEFLGWEPKIPLRKGLPLMVADFRQRI  210



>ref|XP_002882125.1| UDP-glucuronic acid decarboxylase 2 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58384.1| UDP-glucuronic acid decarboxylase 2 [Arabidopsis lyrata subsp. 
lyrata]
Length=436

 Score =   130 bits (326),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 61/91 (67%), Positives = 73/91 (80%), Gaps = 0/91 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            +V+GL+RLMEG++ GP N+GNPGEFTMLELA  V+E I+ + KI    NT DDP +RKPD
Sbjct  330  LVEGLMRLMEGEHVGPFNLGNPGEFTMLELAKVVQETIDPNAKIEFRPNTEDDPHKRKPD  389

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRL  275
            ITKAKELLGWEPKV LR G+PLM  DFR R+
Sbjct  390  ITKAKELLGWEPKVALRQGLPLMVKDFRQRV  420



>ref|XP_004508205.1| PREDICTED: UDP-glucuronic acid decarboxylase 2-like [Cicer arietinum]
Length=436

 Score =   130 bits (326),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 59/91 (65%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            +V+GL+RLMEG++ GP N+GNPGEFTMLELA  V+E I+++ KI    NT DDP +RKPD
Sbjct  331  LVEGLMRLMEGEHVGPFNLGNPGEFTMLELAQVVQETIDTNAKIEFRPNTEDDPHKRKPD  390

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRL  275
            I+KAKELLGW+P V LR+G+PLM  DFR RL
Sbjct  391  ISKAKELLGWQPSVSLREGLPLMVSDFRQRL  421



>ref|XP_003591521.1| UDP-glucuronic acid decarboxylase [Medicago truncatula]
 gb|AES61772.1| UDP-glucuronic acid decarboxylase-like protein [Medicago truncatula]
Length=430

 Score =   130 bits (326),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 60/91 (66%), Positives = 73/91 (80%), Gaps = 0/91 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            +V+GL+RLMEG++ GP N+GNPGEFTMLELA  V+E I+ D KIV  +NT DDP +RKPD
Sbjct  329  LVEGLMRLMEGEHVGPFNLGNPGEFTMLELAKVVQETIDPDAKIVYRDNTEDDPHKRKPD  388

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRL  275
            I+ AKE LGWEPKV LR G+PLM  DFR R+
Sbjct  389  ISNAKEHLGWEPKVDLRKGLPLMVSDFRQRI  419



>ref|XP_010507865.1| PREDICTED: UDP-glucuronic acid decarboxylase 4-like [Camelina 
sativa]
Length=438

 Score =   129 bits (325),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 61/91 (67%), Positives = 73/91 (80%), Gaps = 0/91 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            +V+GL+RLMEG++ GP N+GNPGEFTMLELA  V+E I+ + KI    NT DDP +RKPD
Sbjct  332  LVEGLMRLMEGEHVGPFNLGNPGEFTMLELAKVVQETIDPNAKIEFRPNTEDDPHKRKPD  391

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRL  275
            ITKAKELLGWEPKV LR G+PLM  DFR R+
Sbjct  392  ITKAKELLGWEPKVALRQGLPLMVKDFRQRV  422



>ref|NP_182287.1| UDP-xylose synthase 4 [Arabidopsis thaliana]
 sp|Q8S8T4.1|UXS4_ARATH RecName: Full=UDP-glucuronic acid decarboxylase 4; AltName: Full=UDP-XYL 
synthase 4; AltName: Full=UDP-glucuronate decarboxylase 
4; Short=UGD; Short=UXS-4 [Arabidopsis thaliana]
 gb|AAM14846.1| putative dTDP-glucose 4-6-dehydratase [Arabidopsis thaliana]
 gb|AAY25428.1| At2g47650 [Arabidopsis thaliana]
 dbj|BAH19459.1| AT2G47650 [Arabidopsis thaliana]
 gb|AEC10871.1| UDP-xylose synthase 4 [Arabidopsis thaliana]
Length=443

 Score =   129 bits (325),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 61/91 (67%), Positives = 73/91 (80%), Gaps = 0/91 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            +V+GL+RLMEG++ GP N+GNPGEFTMLELA  V+E I+ + KI    NT DDP +RKPD
Sbjct  337  LVEGLMRLMEGEHVGPFNLGNPGEFTMLELAKVVQETIDPNAKIEFRPNTEDDPHKRKPD  396

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRL  275
            ITKAKELLGWEPKV LR G+PLM  DFR R+
Sbjct  397  ITKAKELLGWEPKVALRQGLPLMVKDFRQRV  427



>ref|XP_007510791.1| predicted protein [Bathycoccus prasinos]
 emb|CCO18324.1| predicted protein [Bathycoccus prasinos]
Length=326

 Score =   128 bits (321),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 60/93 (65%), Positives = 77/93 (83%), Gaps = 0/93 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            +V GL+ LM+GD+TGPIN+GNPGEFTMLELA+ VKE++N   +IV  ENT DDP +RKPD
Sbjct  234  LVAGLMALMDGDDTGPINLGNPGEFTMLELAEKVKEVVNPKAEIVFKENTQDDPSRRKPD  293

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRLGI  281
            I+KA ++LGWEPK+KL DG+  M  DF+TRLG+
Sbjct  294  ISKAMKVLGWEPKIKLEDGLLHMIGDFKTRLGV  326



>ref|XP_009622783.1| PREDICTED: UDP-glucuronic acid decarboxylase 4-like [Nicotiana 
tomentosiformis]
Length=430

 Score =   129 bits (325),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 60/91 (66%), Positives = 73/91 (80%), Gaps = 0/91 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            +V+GL+RLMEGD+ GP N+GNPGEFTMLELA  V+E I+ + KI    NT DDP +RKPD
Sbjct  326  LVEGLMRLMEGDHVGPFNLGNPGEFTMLELAKVVQETIDPNAKIEFRPNTEDDPHKRKPD  385

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRL  275
            ITKAK+LLGWEP V LR G+P+M DDFR R+
Sbjct  386  ITKAKQLLGWEPTVSLRQGLPMMVDDFRQRI  416



>emb|CBI32664.3| unnamed protein product [Vitis vinifera]
Length=220

 Score =   125 bits (315),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 57/91 (63%), Positives = 72/91 (79%), Gaps = 0/91 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            +VDGL+ LMEG++ GP N+GNPGEFTMLELA+ VKE I+S   I    NT DDP +RKPD
Sbjct  120  LVDGLVALMEGEHVGPFNLGNPGEFTMLELAEVVKETIDSSATIEFKPNTADDPHKRKPD  179

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRL  275
            I++AKELL WEPK+ LR+G+PLM  DF+ R+
Sbjct  180  ISRAKELLNWEPKISLREGLPLMVSDFQNRI  210



>ref|XP_010506806.1| PREDICTED: UDP-glucuronic acid decarboxylase 4 [Camelina sativa]
Length=435

 Score =   129 bits (325),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 61/91 (67%), Positives = 73/91 (80%), Gaps = 0/91 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            +V+GL+RLMEG++ GP N+GNPGEFTMLELA  V+E I+ + KI    NT DDP +RKPD
Sbjct  329  LVEGLMRLMEGEHVGPFNLGNPGEFTMLELAKVVQETIDPNAKIEFRPNTEDDPHKRKPD  388

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRL  275
            ITKAKELLGWEPKV LR G+PLM  DFR R+
Sbjct  389  ITKAKELLGWEPKVALRQGLPLMVKDFRQRV  419



>ref|XP_002309433.2| hypothetical protein POPTR_0006s23050g [Populus trichocarpa]
 gb|EEE92956.2| hypothetical protein POPTR_0006s23050g [Populus trichocarpa]
Length=429

 Score =   129 bits (325),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 59/91 (65%), Positives = 73/91 (80%), Gaps = 0/91 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            +VDGL+ LMEG++ GP N+GNPGEFTMLELA+ VKE I+S   I    NT DDP +RKPD
Sbjct  330  LVDGLVALMEGEHVGPFNLGNPGEFTMLELAEVVKETIDSSATIEFRPNTADDPHKRKPD  389

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRL  275
            I+KAKELL WEPK+ LR+G+PLM +DFR R+
Sbjct  390  ISKAKELLNWEPKISLREGLPLMVNDFRNRI  420



>gb|KHG12543.1| UDP-glucuronic acid decarboxylase 1 [Gossypium arboreum]
Length=445

 Score =   129 bits (325),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 59/91 (65%), Positives = 73/91 (80%), Gaps = 0/91 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            +V+GLIRLMEGD+ GP N+GNPGEFTMLELA+ V+E I+ + KI    NT DDP +RKPD
Sbjct  341  LVEGLIRLMEGDHVGPFNLGNPGEFTMLELAEVVQEAIDPNAKIEFRPNTEDDPHKRKPD  400

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRL  275
            I+KAK+LLGWEP + LR G+PLM  DFR R+
Sbjct  401  ISKAKQLLGWEPTISLRKGLPLMVSDFRQRI  431



>ref|XP_009414893.1| PREDICTED: UDP-glucuronic acid decarboxylase 2-like [Musa acuminata 
subsp. malaccensis]
Length=443

 Score =   129 bits (325),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 59/91 (65%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            +V+GLI+LMEG++ GP N+GNPGEFTMLELA  V++ I+ D KI    NT DDP +RKPD
Sbjct  330  LVEGLIKLMEGEHVGPFNLGNPGEFTMLELAKVVQDTIDPDAKIEFRPNTADDPHKRKPD  389

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRL  275
            IT+AKELLGWEPK+ LR+G+PLM  DFR R+
Sbjct  390  ITRAKELLGWEPKISLREGLPLMVSDFRKRI  420



>ref|XP_010518480.1| PREDICTED: UDP-glucuronic acid decarboxylase 4-like [Camelina 
sativa]
Length=438

 Score =   129 bits (325),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 61/91 (67%), Positives = 73/91 (80%), Gaps = 0/91 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            +V+GL+RLMEG++ GP N+GNPGEFTMLELA  V+E I+ + KI    NT DDP +RKPD
Sbjct  332  LVEGLMRLMEGEHVGPFNLGNPGEFTMLELAKVVQETIDPNAKIEFRPNTEDDPHKRKPD  391

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRL  275
            ITKAKELLGWEPKV LR G+PLM  DFR R+
Sbjct  392  ITKAKELLGWEPKVALRQGLPLMVKDFRQRV  422



>ref|XP_009411672.1| PREDICTED: UDP-glucuronic acid decarboxylase 2-like [Musa acuminata 
subsp. malaccensis]
Length=446

 Score =   129 bits (324),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 63/101 (62%), Positives = 77/101 (76%), Gaps = 1/101 (1%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            +V+GL+RLMEG++ GP N+GNPGEFTM+ELA  V+E I+ D KI    NT DDP +RKPD
Sbjct  335  LVEGLMRLMEGEHIGPFNLGNPGEFTMVELAKVVQETIDPDAKIEFRPNTEDDPHKRKPD  394

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRLGIGRKS*AKP  305
            IT+AKELLGWEPK+ LR G+PLM  DFR R+  G  S A P
Sbjct  395  ITRAKELLGWEPKIPLRQGLPLMVSDFRKRI-FGDHSDANP  434



>gb|AGK44109.1| UDP-glucuronate decarboxylase protein 1 [Populus tomentosa]
Length=430

 Score =   129 bits (324),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 58/91 (64%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            +VDGL+ LMEG++ GP N+GNPGEFTMLELA+ VKE I+S   I    NT DDP +RKPD
Sbjct  331  LVDGLVALMEGEHVGPFNLGNPGEFTMLELAEVVKETIDSSATIEFKPNTADDPHKRKPD  390

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRL  275
            I+KAKELL WEP++ LR+G+PLM +DFR+R+
Sbjct  391  ISKAKELLNWEPRISLREGLPLMVNDFRSRI  421



>ref|XP_003550538.1| PREDICTED: UDP-glucuronic acid decarboxylase 2-like [Glycine 
max]
Length=395

 Score =   129 bits (323),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 59/91 (65%), Positives = 73/91 (80%), Gaps = 0/91 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            +V+GL+RLMEG++ GP N+GNPGEFTMLELA  V+E I+ + KI    NT DDP +RKPD
Sbjct  289  LVEGLMRLMEGEHVGPFNLGNPGEFTMLELAQVVQETIDPNAKIEFRPNTEDDPHKRKPD  348

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRL  275
            I+KAKELLGW+P V LR+G+PLM  DFR RL
Sbjct  349  ISKAKELLGWQPSVSLREGLPLMVSDFRQRL  379



>ref|XP_008784747.1| PREDICTED: UDP-glucuronic acid decarboxylase 2-like [Phoenix 
dactylifera]
Length=443

 Score =   129 bits (324),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 60/91 (66%), Positives = 73/91 (80%), Gaps = 0/91 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            +V+GL+RLMEG++ GP N+GNPGEFTMLELA  V+E I+ + +I    NT DDP +RKPD
Sbjct  336  LVEGLMRLMEGEHVGPFNLGNPGEFTMLELAKVVQETIDPNARIEFRPNTEDDPHKRKPD  395

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRL  275
            ITKAKELLGWEPKV LR G+PLM  DFR R+
Sbjct  396  ITKAKELLGWEPKVSLRHGLPLMVSDFRKRI  426



>ref|XP_010684197.1| PREDICTED: UDP-glucuronic acid decarboxylase 1 [Beta vulgaris 
subsp. vulgaris]
Length=437

 Score =   129 bits (324),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 60/91 (66%), Positives = 71/91 (78%), Gaps = 0/91 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            +VDGL+ LMEG++ GP N+GNPGEFTMLELA+ VK  I+    IV   NT DDP +RKPD
Sbjct  338  LVDGLMALMEGEHVGPFNLGNPGEFTMLELAEVVKTTIDPSASIVFKSNTADDPHKRKPD  397

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRL  275
            I+KAKELL WEPKV LRDG+PLM  DFR R+
Sbjct  398  ISKAKELLNWEPKVSLRDGLPLMVADFRNRI  428



>ref|XP_009104397.1| PREDICTED: UDP-glucuronic acid decarboxylase 2-like [Brassica 
rapa]
Length=433

 Score =   129 bits (324),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 60/91 (66%), Positives = 72/91 (79%), Gaps = 0/91 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            +V+GL+RLMEG++ GP N+GNPGEFTMLELA  V+E I+ +  I    NT DDP +RKPD
Sbjct  326  LVEGLMRLMEGEHVGPFNLGNPGEFTMLELAKVVQETIDPNANIAFRPNTEDDPHKRKPD  385

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRL  275
            ITKAKELLGWEPKV LR G+PLM  DFR R+
Sbjct  386  ITKAKELLGWEPKVSLRQGLPLMVKDFRQRV  416



>gb|ABK24464.1| unknown [Picea sitchensis]
Length=439

 Score =   129 bits (324),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 60/91 (66%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            +V+GL+RLMEG++ GP N+GNPGEFTMLELA  VKE I+ + KI    NT DDP +RKPD
Sbjct  330  LVEGLMRLMEGEHVGPFNLGNPGEFTMLELAQVVKETIDPNAKIEFRPNTEDDPHKRKPD  389

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRL  275
            ITKAK+LLGW+PKV LR G+PLM +DFR R+
Sbjct  390  ITKAKDLLGWQPKVSLRKGLPLMVEDFRRRV  420



>ref|XP_002994140.1| hypothetical protein SELMODRAFT_270121 [Selaginella moellendorffii]
 gb|EFJ04801.1| hypothetical protein SELMODRAFT_270121 [Selaginella moellendorffii]
Length=423

 Score =   129 bits (323),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 59/91 (65%), Positives = 75/91 (82%), Gaps = 0/91 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            +V+GLIRLMEG++ GP N+GNPGEFTMLELA  V+E I+ + KI    NT DDP +RKPD
Sbjct  325  LVEGLIRLMEGEHIGPFNLGNPGEFTMLELAQVVRETIDPEAKIEFRNNTEDDPHKRKPD  384

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRL  275
            ITKAK+LLGW+PK+ LR+G+PLM +DFR R+
Sbjct  385  ITKAKKLLGWKPKISLREGLPLMVEDFRRRV  415



>ref|XP_002972645.1| hypothetical protein SELMODRAFT_267587 [Selaginella moellendorffii]
 gb|EFJ25866.1| hypothetical protein SELMODRAFT_267587 [Selaginella moellendorffii]
Length=423

 Score =   129 bits (323),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 59/91 (65%), Positives = 75/91 (82%), Gaps = 0/91 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            +V+GLIRLMEG++ GP N+GNPGEFTMLELA  V+E I+ + KI    NT DDP +RKPD
Sbjct  325  LVEGLIRLMEGEHIGPFNLGNPGEFTMLELAQVVRETIDPEAKIEFRNNTEDDPHKRKPD  384

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRL  275
            ITKAK+LLGW+PK+ LR+G+PLM +DFR R+
Sbjct  385  ITKAKKLLGWKPKISLREGLPLMVEDFRRRV  415



>ref|XP_006349950.1| PREDICTED: UDP-glucuronic acid decarboxylase 4-like [Solanum 
tuberosum]
Length=385

 Score =   128 bits (322),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 59/91 (65%), Positives = 73/91 (80%), Gaps = 0/91 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            +V+GL+RLMEG++ GP N+GNPGEFTMLELA  V+E I+ + KI    NT DDP +RKPD
Sbjct  281  LVEGLMRLMEGNHVGPFNLGNPGEFTMLELAKVVQETIDPNAKIEFRPNTEDDPHKRKPD  340

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRL  275
            ITKAK+LLGWEP V LR G+P+M DDFR R+
Sbjct  341  ITKAKQLLGWEPAVSLRQGLPMMVDDFRQRI  371



>ref|XP_007163113.1| hypothetical protein PHAVU_001G207400g [Phaseolus vulgaris]
 gb|ESW35107.1| hypothetical protein PHAVU_001G207400g [Phaseolus vulgaris]
Length=423

 Score =   128 bits (322),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 60/91 (66%), Positives = 73/91 (80%), Gaps = 0/91 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            +V+GL+RLMEG++ GP N+GNPGEFTMLELA  V+E I+ + KI    NT DDP +RKPD
Sbjct  322  LVEGLMRLMEGEHVGPFNLGNPGEFTMLELAKVVQETIDPEAKIEYRPNTEDDPHKRKPD  381

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRL  275
            IT+AKELLGWEPKV LR G+PLM  DFR R+
Sbjct  382  ITRAKELLGWEPKVDLRKGLPLMVSDFRQRI  412



>ref|XP_006855561.1| hypothetical protein AMTR_s00057p00223540 [Amborella trichopoda]
 gb|ERN17028.1| hypothetical protein AMTR_s00057p00223540 [Amborella trichopoda]
Length=442

 Score =   129 bits (323),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 60/91 (66%), Positives = 73/91 (80%), Gaps = 0/91 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            +V+GL+RLMEG++ GP N+GNPGEFTMLELA  V+E I+ + +I    NT DDP +RKPD
Sbjct  325  LVEGLMRLMEGEHVGPFNLGNPGEFTMLELAQVVQETIDPNARIDFRPNTEDDPHKRKPD  384

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRL  275
            I KAKELLGWEPKV LR G+PLM  DFRTR+
Sbjct  385  IGKAKELLGWEPKVALRQGLPLMVSDFRTRI  415



>ref|XP_009389617.1| PREDICTED: UDP-glucuronic acid decarboxylase 2-like [Musa acuminata 
subsp. malaccensis]
Length=438

 Score =   129 bits (323),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 60/91 (66%), Positives = 73/91 (80%), Gaps = 0/91 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            +V+GLI+LMEG+N GP N+GNPGEFTMLELA  V++ I+ + KI    NT DDP +RKPD
Sbjct  330  LVEGLIKLMEGENVGPFNLGNPGEFTMLELAKVVQDTIDPNAKIEFRPNTADDPHKRKPD  389

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRL  275
            IT+AKELLGWEPKV L DG+PLM  DFR R+
Sbjct  390  ITRAKELLGWEPKVSLSDGLPLMVTDFRKRI  420



>ref|XP_005650385.1| UDP-D-glucuronic acid decarboxylase [Coccomyxa subellipsoidea 
C-169]
 gb|EIE25841.1| UDP-D-glucuronic acid decarboxylase [Coccomyxa subellipsoidea 
C-169]
Length=343

 Score =   127 bits (320),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 58/93 (62%), Positives = 73/93 (78%), Gaps = 0/93 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            +V+G++R+M+G  TGP NIGNP EFTMLELA  VKE++N D +IV  ENT DDP +RKPD
Sbjct  242  LVEGMVRVMDGPYTGPFNIGNPTEFTMLELAQVVKEVVNPDAQIVYKENTADDPSRRKPD  301

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRLGI  281
            I+KAK+ LGWEPKV LR+G+  M  DF  RLG+
Sbjct  302  ISKAKKALGWEPKVALREGLSRMVSDFAKRLGV  334



>ref|XP_008789858.1| PREDICTED: UDP-glucuronic acid decarboxylase 2-like [Phoenix 
dactylifera]
Length=445

 Score =   128 bits (322),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 59/91 (65%), Positives = 72/91 (79%), Gaps = 0/91 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            +V+GL+RLMEG++ GP N+GNPGEFTMLELA  V+E I  + +I    NT DDP +RKPD
Sbjct  336  LVEGLMRLMEGEHVGPFNLGNPGEFTMLELAKVVQETIEPNARIEFRPNTEDDPHKRKPD  395

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRL  275
            ITKAKELLGWEPK+ LR G+PLM  DFR R+
Sbjct  396  ITKAKELLGWEPKISLRQGLPLMVSDFRKRI  426



>gb|AGK44157.1| UDP-glucuronate decarboxylase protein 1 [Populus tomentosa]
Length=430

 Score =   128 bits (322),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 58/91 (64%), Positives = 73/91 (80%), Gaps = 0/91 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            +VDGL+ LMEG++ GP N+GNPGEFTMLELA+ VKE I+S   I    NT DDP +RKPD
Sbjct  331  LVDGLVALMEGEHVGPFNLGNPGEFTMLELAEVVKETIDSSATIEFKPNTADDPHKRKPD  390

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRL  275
            I+KAKELL WEP++ LR+G+PLM +DFR R+
Sbjct  391  ISKAKELLNWEPRISLREGLPLMVNDFRNRI  421



>gb|KDP28164.1| hypothetical protein JCGZ_13935 [Jatropha curcas]
Length=437

 Score =   128 bits (322),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 59/91 (65%), Positives = 73/91 (80%), Gaps = 0/91 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            +V+GL+RLMEG++ GP N+GNPGEFTMLELA  V+E I+ + KI    NT DDP +RKPD
Sbjct  331  LVEGLMRLMEGEHVGPFNLGNPGEFTMLELAQVVQETIDPNAKIEFKPNTEDDPHKRKPD  390

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRL  275
            ITKAKELLGWEPK+ LR G+PLM  DF+ R+
Sbjct  391  ITKAKELLGWEPKISLRKGLPLMVSDFQQRI  421



>ref|XP_002323432.2| hypothetical protein POPTR_0016s08130g [Populus trichocarpa]
 gb|EEF05193.2| hypothetical protein POPTR_0016s08130g [Populus trichocarpa]
Length=435

 Score =   128 bits (322),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 58/91 (64%), Positives = 73/91 (80%), Gaps = 0/91 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            +VDGL+ LMEG++ GP N+GNPGEFTMLELA+ VKE I+S   I    NT DDP +RKPD
Sbjct  336  LVDGLVALMEGEHVGPFNLGNPGEFTMLELAEVVKETIDSSATIEFKPNTADDPHKRKPD  395

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRL  275
            I+KAKELL WEP++ LR+G+PLM +DFR R+
Sbjct  396  ISKAKELLNWEPRISLREGLPLMVNDFRNRI  426



>gb|AGK44144.1| UDP-glucuronate decarboxylase protein 1 [Populus tomentosa]
Length=430

 Score =   128 bits (322),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 58/91 (64%), Positives = 73/91 (80%), Gaps = 0/91 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            +VDGL+ LMEG++ GP N+GNPGEFTMLELA+ VKE I+S   I    NT DDP +RKPD
Sbjct  331  LVDGLVALMEGEHVGPFNLGNPGEFTMLELAEVVKETIDSSATIEFKPNTADDPHKRKPD  390

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRL  275
            I+KAKELL WEP++ LR+G+PLM +DFR R+
Sbjct  391  ISKAKELLNWEPRISLREGLPLMVNDFRNRI  421



>gb|AGK44125.1| UDP-glucuronate decarboxylase protein 1 [Populus tomentosa]
Length=430

 Score =   128 bits (322),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 58/91 (64%), Positives = 73/91 (80%), Gaps = 0/91 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            +VDGL+ LMEG++ GP N+GNPGEFTMLELA+ VKE I+S   I    NT DDP +RKPD
Sbjct  331  LVDGLVALMEGEHVGPFNLGNPGEFTMLELAEVVKETIDSSATIEFKPNTADDPHKRKPD  390

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRL  275
            I+KAKELL WEP++ LR+G+PLM +DFR R+
Sbjct  391  ISKAKELLNWEPRISLREGLPLMVNDFRNRI  421



>gb|AGK44131.1| UDP-glucuronate decarboxylase protein 1 [Populus tomentosa]
 gb|AGK44154.1| UDP-glucuronate decarboxylase protein 1 [Populus tomentosa]
Length=430

 Score =   128 bits (322),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 58/91 (64%), Positives = 73/91 (80%), Gaps = 0/91 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            +VDGL+ LMEG++ GP N+GNPGEFTMLELA+ VKE I+S   I    NT DDP +RKPD
Sbjct  331  LVDGLVALMEGEHVGPFNLGNPGEFTMLELAEVVKETIDSSATIEFKPNTADDPHKRKPD  390

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRL  275
            I+KAKELL WEP++ LR+G+PLM +DFR R+
Sbjct  391  ISKAKELLNWEPRISLREGLPLMVNDFRNRI  421



>ref|XP_002268787.1| PREDICTED: UDP-glucuronic acid decarboxylase 2-like [Vitis vinifera]
Length=444

 Score =   128 bits (322),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 60/91 (66%), Positives = 73/91 (80%), Gaps = 0/91 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            +V+GLIRLMEG++ GP N+GNPGEFTMLELA  V+E I+ + KI    NT DDP +RKPD
Sbjct  335  LVEGLIRLMEGEHVGPFNLGNPGEFTMLELAQVVQETIDPNAKIEFRPNTEDDPHKRKPD  394

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRL  275
            I+KAK+LLGWEPKV LR G+PLM  DFR R+
Sbjct  395  ISKAKDLLGWEPKVALRKGLPLMVSDFRERI  425



>ref|XP_007035620.1| NAD(P)-binding Rossmann-fold superfamily protein [Theobroma cacao]
 gb|EOY06546.1| NAD(P)-binding Rossmann-fold superfamily protein [Theobroma cacao]
Length=431

 Score =   128 bits (322),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 59/91 (65%), Positives = 73/91 (80%), Gaps = 0/91 (0%)
 Frame = +3

Query  3    MVDGLIRLMEGDNTGPINIGNPGEFTMLELADTVKEMINSDVKIVTVENTPDDPRQRKPD  182
            +V+GL+RLMEGD+ GP N+GNPGEFTMLELA+ V+E I+ + KI    NT DDP +RKPD
Sbjct  329  LVEGLMRLMEGDHVGPFNLGNPGEFTMLELAEVVQETIDPNAKIEFRPNTEDDPHKRKPD  388

Query  183  ITKAKELLGWEPKVKLRDGIPLMEDDFRTRL  275
            I+KAK+LLGWEP V LR G+PLM  DFR R+
Sbjct  389  ISKAKQLLGWEPTVSLRKGLPLMVSDFRQRI  419



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 512662103758