BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c24293_g1_i1 len=1401 path=[2779:0-221 3001:222-260 4955:261-280
3040:281-590 3350:591-682 3442:683-863 3623:864-881 3641:882-989
3749:990-1043 3803:1044-1114 3874:1115-1197 3957:1198-1350
4110:1351-1368 4128:1369-1400]

Length=1401
                                                                      Score     E

ref|XP_006339325.1|  PREDICTED: exocyst complex component 7-like      90.5    5e-16   
ref|XP_009624884.1|  PREDICTED: exocyst complex component EXO70A1...  89.0    2e-15   
ref|XP_009771505.1|  PREDICTED: exocyst complex component EXO70A1...  88.6    2e-15   
ref|XP_011046402.1|  PREDICTED: exocyst complex component EXO70A1...  80.5    9e-13   
ref|XP_002322790.2|  hypothetical protein POPTR_0016s07170g           80.1    1e-12   Populus trichocarpa [western balsam poplar]
ref|XP_002309247.1|  hypothetical protein POPTR_0006s22030g           79.7    2e-12   Populus trichocarpa [western balsam poplar]
ref|XP_004249408.1|  PREDICTED: exocyst complex component EXO70A1     77.4    1e-11   
ref|XP_004154191.1|  PREDICTED: uncharacterized protein LOC101221668  74.7    1e-11   
ref|XP_002532543.1|  protein binding protein, putative                76.3    2e-11   Ricinus communis
ref|XP_004159234.1|  PREDICTED: exocyst complex component 7-like      75.1    5e-11   
gb|EYU19401.1|  hypothetical protein MIMGU_mgv1a002725mg              75.1    6e-11   
ref|XP_009383511.1|  PREDICTED: exocyst complex component EXO70A1...  73.9    1e-10   
emb|CDP10608.1|  unnamed protein product                              73.9    1e-10   
ref|XP_007204602.1|  hypothetical protein PRUPE_ppa002792mg           73.9    1e-10   
gb|KHN13248.1|  Exocyst complex component 7                           73.6    1e-10   
ref|XP_003543668.1|  PREDICTED: exocyst complex component EXO70A1...  73.9    1e-10   
ref|XP_008462620.1|  PREDICTED: exocyst complex component EXO70A1...  72.8    3e-10   
ref|XP_008462619.1|  PREDICTED: exocyst complex component EXO70A1...  72.8    3e-10   
gb|KDP36125.1|  hypothetical protein JCGZ_08769                       72.4    3e-10   
ref|XP_002280545.1|  PREDICTED: exocyst complex component EXO70A1...  72.4    3e-10   Vitis vinifera
ref|XP_010654150.1|  PREDICTED: exocyst complex component EXO70A1...  72.4    3e-10   
ref|NP_001065801.1|  Os11g0157400                                     72.4    3e-10   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010654151.1|  PREDICTED: exocyst complex component EXO70A1...  72.4    3e-10   
ref|XP_002268110.1|  PREDICTED: exocyst complex component EXO70A1     72.4    3e-10   Vitis vinifera
emb|CBI25018.3|  unnamed protein product                              72.4    3e-10   
gb|KDO70600.1|  hypothetical protein CISIN_1g0368061mg                69.3    5e-10   
ref|XP_006430076.1|  hypothetical protein CICLE_v10011277mg           72.0    5e-10   
ref|XP_008799697.1|  PREDICTED: exocyst complex component EXO70A1...  71.6    7e-10   
ref|XP_007027956.1|  Exocyst subunit exo70 family protein A2 isof...  70.9    8e-10   
ref|XP_011077804.1|  PREDICTED: exocyst complex component EXO70A1...  71.2    9e-10   
ref|XP_011077803.1|  PREDICTED: exocyst complex component EXO70A1...  70.9    1e-09   
ref|XP_007027954.1|  Exocyst subunit exo70 family protein A2 isof...  70.9    1e-09   
ref|XP_007151187.1|  hypothetical protein PHAVU_004G025400g           70.9    1e-09   
ref|XP_007027955.1|  Exocyst subunit exo70 family protein A2 isof...  70.5    1e-09   
emb|CAN73810.1|  hypothetical protein VITISV_039782                   70.9    1e-09   Vitis vinifera
ref|XP_006401836.1|  hypothetical protein EUTSA_v10015542mg           70.5    1e-09   
ref|XP_009127247.1|  PREDICTED: exocyst complex component EXO70A1...  70.5    2e-09   
ref|XP_004174025.1|  PREDICTED: exocyst complex component 7-like      66.2    3e-09   
ref|XP_008813458.1|  PREDICTED: exocyst complex component EXO70A1...  69.3    3e-09   
ref|XP_002311935.2|  exocyst subunit EXO70 family protein             68.9    4e-09   Populus trichocarpa [western balsam poplar]
ref|XP_006662750.1|  PREDICTED: exocyst complex component EXO70A1...  68.9    4e-09   
ref|XP_004162733.1|  PREDICTED: exocyst complex component 7-like      68.9    4e-09   
ref|XP_006481587.1|  PREDICTED: exocyst complex component EXO70A1...  68.9    4e-09   
ref|XP_008446747.1|  PREDICTED: exocyst complex component EXO70A1     68.9    5e-09   
ref|XP_009378235.1|  PREDICTED: exocyst complex component EXO70A1...  68.6    5e-09   
ref|XP_004135040.1|  PREDICTED: exocyst complex component 7-like      68.9    5e-09   
ref|XP_011011641.1|  PREDICTED: exocyst complex component EXO70A1...  68.6    5e-09   
ref|XP_011042604.1|  PREDICTED: exocyst complex component EXO70A1...  68.6    6e-09   
ref|XP_002516636.1|  protein binding protein, putative                68.6    6e-09   Ricinus communis
ref|XP_008241041.1|  PREDICTED: exocyst complex component EXO70A1     68.6    7e-09   
gb|KHG11246.1|  Exocyst complex component 7                           68.2    7e-09   
ref|XP_011032906.1|  PREDICTED: exocyst complex component EXO70A1...  67.8    1e-08   
ref|XP_010237920.1|  PREDICTED: exocyst complex component EXO70A1...  67.4    1e-08   
ref|XP_008231810.1|  PREDICTED: exocyst complex component EXO70A1     67.4    1e-08   
ref|XP_007214655.1|  hypothetical protein PRUPE_ppa002633mg           67.4    1e-08   
ref|XP_006854674.1|  hypothetical protein AMTR_s00030p00210320        67.4    1e-08   
gb|KEH41922.1|  exocyst subunit exo70 family protein                  67.0    2e-08   
ref|XP_010555667.1|  PREDICTED: exocyst complex component EXO70A1...  67.0    2e-08   
dbj|BAB10532.1|  unnamed protein product                              66.6    2e-08   Arabidopsis thaliana [mouse-ear cress]
ref|NP_200048.2|  exocyst subunit exo70 family protein A3             67.0    2e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009623413.1|  PREDICTED: exocyst complex component EXO70A1...  67.0    2e-08   
gb|KDO43038.1|  hypothetical protein CISIN_1g038773mg                 65.9    2e-08   
ref|XP_009349077.1|  PREDICTED: exocyst complex component EXO70A1...  66.6    2e-08   
ref|XP_010908201.1|  PREDICTED: exocyst complex component EXO70A1...  66.6    2e-08   
ref|XP_009374086.1|  PREDICTED: exocyst complex component EXO70A1...  66.6    3e-08   
ref|XP_010059110.1|  PREDICTED: exocyst complex component EXO70A1...  66.2    3e-08   
ref|XP_010059105.1|  PREDICTED: exocyst complex component EXO70A1...  66.2    3e-08   
ref|XP_007010469.1|  Exocyst subunit exo70 family protein A1          66.2    3e-08   
ref|XP_010319288.1|  PREDICTED: exocyst complex component EXO70A1...  66.2    3e-08   
ref|XP_009792795.1|  PREDICTED: exocyst complex component EXO70A1...  66.2    3e-08   
ref|XP_004236807.1|  PREDICTED: exocyst complex component EXO70A1...  66.2    3e-08   
ref|XP_009624114.1|  PREDICTED: exocyst complex component EXO70A1...  66.2    3e-08   
ref|XP_010246859.1|  PREDICTED: exocyst complex component EXO70A1...  66.2    3e-08   
gb|KHG26941.1|  Exocyst complex component 7                           66.2    4e-08   
ref|XP_010246852.1|  PREDICTED: exocyst complex component EXO70A1...  66.2    4e-08   
ref|XP_009758704.1|  PREDICTED: exocyst complex component EXO70A1...  65.9    4e-08   
gb|KCW50565.1|  hypothetical protein EUGRSUZ_J00280                   65.9    4e-08   
ref|XP_010031304.1|  PREDICTED: exocyst complex component EXO70A1     65.9    4e-08   
gb|KDP22763.1|  hypothetical protein JCGZ_01980                       65.9    5e-08   
ref|XP_008360595.1|  PREDICTED: exocyst complex component EXO70A1...  65.5    5e-08   
ref|XP_006445773.1|  hypothetical protein CICLE_v10014543mg           65.5    6e-08   
ref|XP_002315422.2|  exocyst subunit EXO70 family protein             65.1    7e-08   Populus trichocarpa [western balsam poplar]
ref|XP_010442761.1|  PREDICTED: exocyst complex component EXO70A1...  65.1    8e-08   
ref|XP_010444749.1|  PREDICTED: exocyst complex component EXO70A1...  65.1    8e-08   
ref|XP_004303435.1|  PREDICTED: exocyst complex component 7-like      65.1    8e-08   
ref|XP_004978733.1|  PREDICTED: exocyst complex component 7-like ...  64.7    9e-08   
ref|XP_010942405.1|  PREDICTED: exocyst complex component EXO70A1...  64.7    1e-07   
ref|XP_010490839.1|  PREDICTED: exocyst complex component EXO70A1...  64.3    1e-07   
ref|XP_010452234.1|  PREDICTED: exocyst complex component EXO70A1     64.3    1e-07   
ref|XP_010423699.1|  PREDICTED: exocyst complex component EXO70A1...  64.3    1e-07   
ref|XP_002450318.1|  hypothetical protein SORBIDRAFT_05g003650        64.3    1e-07   Sorghum bicolor [broomcorn]
ref|XP_008798863.1|  PREDICTED: exocyst complex component EXO70A1...  64.3    1e-07   
gb|AEI26267.1|  Exo70A1                                               63.9    2e-07   
ref|XP_008375555.1|  PREDICTED: exocyst complex component EXO70A1...  63.5    2e-07   
ref|NP_001147814.1|  protein binding protein                          63.5    2e-07   Zea mays [maize]
ref|XP_010695091.1|  PREDICTED: exocyst complex component EXO70A1...  63.5    2e-07   
ref|XP_004249947.1|  PREDICTED: exocyst complex component EXO70A1...  63.5    2e-07   
gb|EMT29261.1|  Exocyst complex component 7                           63.5    2e-07   
ref|XP_006365689.1|  PREDICTED: exocyst complex component 7-like      63.5    2e-07   
ref|XP_008375553.1|  PREDICTED: exocyst complex component EXO70A1...  63.5    2e-07   
ref|XP_010482595.1|  PREDICTED: exocyst complex component EXO70A1...  63.5    2e-07   
gb|ACV92697.1|  exocyst subunit EXO70 A1                              63.5    2e-07   Brassica napus [oilseed rape]
gb|AGC65586.1|  exocyst subunit EXO70A1                               63.5    2e-07   
ref|XP_009122692.1|  PREDICTED: exocyst complex component EXO70A1     63.2    3e-07   
emb|CDX70300.1|  BnaA10g26490D                                        63.2    3e-07   
ref|XP_006280174.1|  hypothetical protein CARUB_v10026076mg           63.2    3e-07   
ref|XP_008677197.1|  PREDICTED: protein binding protein isoform X1    63.2    3e-07   
ref|XP_011024156.1|  PREDICTED: exocyst complex component EXO70A1...  63.2    3e-07   
ref|XP_002864165.1|  predicted protein                                63.2    3e-07   
gb|EPS69172.1|  hypothetical protein M569_05594                       62.8    3e-07   
ref|XP_011024157.1|  PREDICTED: exocyst complex component EXO70A1...  62.8    3e-07   
ref|XP_010554525.1|  PREDICTED: exocyst complex component EXO70A1...  62.8    3e-07   
ref|NP_195974.2|  exocyst subunit exo70 family protein A1             62.8    4e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010554528.1|  PREDICTED: exocyst complex component EXO70A1...  62.8    4e-07   
ref|XP_009341579.1|  PREDICTED: exocyst complex component EXO70A1     62.8    4e-07   
ref|NP_001119162.1|  exocyst subunit exo70 family protein A1          62.4    4e-07   Arabidopsis thaliana [mouse-ear cress]
gb|KFK38381.1|  hypothetical protein AALP_AA3G106300                  62.8    4e-07   
gb|EMS50309.1|  Exocyst complex component 7                           62.0    6e-07   
ref|NP_001190216.1|  exocyst subunit exo70 family protein A1          62.0    6e-07   
ref|NP_200047.3|  exocyst subunit exo70-A2                            62.0    7e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006367154.1|  PREDICTED: exocyst complex component 7-like      62.0    7e-07   
dbj|BAB10531.1|  unnamed protein product                              62.0    7e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006398806.1|  hypothetical protein EUTSA_v10012941mg           61.6    8e-07   
gb|ABA96523.1|  retrotransposon protein, putative, unclassified, ...  62.0    8e-07   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002864166.1|  ATEXO70A3                                        61.2    1e-06   
ref|XP_010262979.1|  PREDICTED: exocyst complex component EXO70A1...  61.6    1e-06   
ref|XP_008354827.1|  PREDICTED: exocyst complex component EXO70A1...  61.2    1e-06   
ref|NP_001130310.1|  uncharacterized protein LOC100191404             60.8    1e-06   Zea mays [maize]
dbj|BAJ96443.1|  predicted protein                                    60.8    1e-06   
dbj|BAJ95107.1|  predicted protein                                    60.8    2e-06   
gb|EYU19838.1|  hypothetical protein MIMGU_mgv1a002571mg              60.8    2e-06   
ref|XP_004978329.1|  PREDICTED: exocyst complex component 7-like      60.5    2e-06   
ref|XP_004496114.1|  PREDICTED: exocyst complex component 7-like      60.5    2e-06   
ref|XP_006663839.1|  PREDICTED: exocyst complex component EXO70A1...  60.1    2e-06   
ref|XP_010683605.1|  PREDICTED: exocyst complex component EXO70A1...  59.7    3e-06   
ref|XP_002871042.1|  predicted protein                                59.7    4e-06   
ref|XP_006287255.1|  hypothetical protein CARUB_v10000445mg           59.7    4e-06   
gb|ABK25032.1|  unknown                                               59.3    4e-06   Picea sitchensis
ref|XP_003591688.1|  Exocyst complex component EXO70                  58.9    7e-06   
ref|XP_007144229.1|  hypothetical protein PHAVU_007G138700g           58.5    9e-06   
gb|EAY82341.1|  hypothetical protein OsI_37551                        58.2    1e-05   Oryza sativa Indica Group [Indian rice]
ref|XP_003555696.2|  PREDICTED: exocyst complex component EXO70A1...  58.2    1e-05   
gb|KHN48504.1|  Exocyst complex component 7                           58.2    1e-05   
ref|XP_002442845.1|  hypothetical protein SORBIDRAFT_08g003730        57.8    1e-05   Sorghum bicolor [broomcorn]
ref|XP_006606315.1|  PREDICTED: exocyst complex component EXO70A1...  57.8    1e-05   
gb|KHN00969.1|  Exocyst complex component 7                           57.8    1e-05   
ref|XP_010109193.1|  Exocyst complex component 7                      57.0    2e-05   
ref|XP_003577018.1|  PREDICTED: exocyst complex component EXO70A1...  57.8    2e-05   
ref|XP_010473802.1|  PREDICTED: exocyst complex component EXO70A1...  57.4    2e-05   
ref|XP_010442762.1|  PREDICTED: exocyst complex component EXO70A1...  55.8    6e-05   
emb|CDY44373.1|  BnaC02g03040D                                        55.5    7e-05   
gb|EYU19837.1|  hypothetical protein MIMGU_mgv1a0037321mg             54.7    1e-04   
ref|XP_010482596.1|  PREDICTED: exocyst complex component EXO70A1...  54.7    1e-04   
ref|XP_004307071.1|  PREDICTED: exocyst complex component 7-like      54.7    1e-04   
ref|XP_006589346.1|  PREDICTED: exocyst complex component EXO70A1...  54.7    1e-04   
ref|XP_003536279.1|  PREDICTED: exocyst complex component EXO70A1...  54.3    2e-04   
ref|XP_009402622.1|  PREDICTED: exocyst complex component EXO70A1...  52.8    5e-04   
emb|CDO99931.1|  unnamed protein product                              52.0    9e-04   
gb|EPS68385.1|  hypothetical protein M569_06379                       52.0    9e-04   



>ref|XP_006339325.1| PREDICTED: exocyst complex component 7-like [Solanum tuberosum]
Length=647

 Score = 90.5 bits (223),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 45/73 (62%), Positives = 53/73 (73%), Gaps = 1/73 (1%)
 Frame = -2

Query  443  DCLFECFPQSLLPPTASPNLHVGSGTKEHQTKSFKTADYHLPYLIPSRILLLLHDLAQLM  264
            DCLF+C PQSL P T S +   G+G KEHQ +S +T  YH P LIP RIL LLHDLAQ M
Sbjct  161  DCLFDCLPQSLRPSTGSDSKGDGAGAKEHQ-RSLETVVYHPPDLIPPRILPLLHDLAQQM  219

Query  263  IRSGHQQQAFNIY  225
            I++GHQQQ + IY
Sbjct  220  IQAGHQQQLYTIY  232



>ref|XP_009624884.1| PREDICTED: exocyst complex component EXO70A1-like [Nicotiana 
tomentosiformis]
Length=640

 Score = 89.0 bits (219),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 45/76 (59%), Positives = 55/76 (72%), Gaps = 1/76 (1%)
 Frame = -2

Query  443  DCLFECFPQSLLPPTASPNLHVGSGTKEHQTKSFKTADYHLPYLIPSRILLLLHDLAQLM  264
            D LF+C PQSL P T SP+   G+G KEHQ +S +T  YH P LIP RIL LLH+LAQ M
Sbjct  161  DRLFDCLPQSLRPSTGSPSKGDGTGVKEHQ-RSLETVVYHPPALIPPRILPLLHELAQQM  219

Query  263  IRSGHQQQAFNIYR*I  216
            I++GHQQQ + IY+ I
Sbjct  220  IQAGHQQQLYTIYKEI  235



>ref|XP_009771505.1| PREDICTED: exocyst complex component EXO70A1-like [Nicotiana 
sylvestris]
Length=498

 Score = 88.6 bits (218),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 45/76 (59%), Positives = 55/76 (72%), Gaps = 1/76 (1%)
 Frame = -2

Query  443  DCLFECFPQSLLPPTASPNLHVGSGTKEHQTKSFKTADYHLPYLIPSRILLLLHDLAQLM  264
            D LF+C PQSL P T SP+   G+G KEHQ +S +T  YH P LIP RIL LLH+LAQ M
Sbjct  19   DRLFDCLPQSLRPSTGSPSKGDGTGMKEHQ-RSLETVVYHPPALIPPRILPLLHELAQQM  77

Query  263  IRSGHQQQAFNIYR*I  216
            I++GHQQQ + IY+ I
Sbjct  78   IQAGHQQQLYTIYKEI  93



>ref|XP_011046402.1| PREDICTED: exocyst complex component EXO70A1-like [Populus euphratica]
Length=644

 Score = 80.5 bits (197),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 45/78 (58%), Positives = 52/78 (67%), Gaps = 4/78 (5%)
 Frame = -2

Query  443  DCLFECFPQSLLPPTA-SPNLHV-GSGTK--EHQTKSFKTADYHLPYLIPSRILLLLHDL  276
            D LFEC P SL P ++ SP  H  GSG    +HQ KS + A Y LP LIP R+L LLHDL
Sbjct  160  DRLFECLPDSLRPSSSGSPRNHGDGSGKSLTDHQEKSLENAVYTLPILIPGRVLPLLHDL  219

Query  275  AQLMIRSGHQQQAFNIYR  222
            AQ M ++GHQQQ F IYR
Sbjct  220  AQQMAQAGHQQQLFRIYR  237



>ref|XP_002322790.2| hypothetical protein POPTR_0016s07170g [Populus trichocarpa]
 gb|EEF04551.2| hypothetical protein POPTR_0016s07170g [Populus trichocarpa]
Length=684

 Score = 80.1 bits (196),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 43/78 (55%), Positives = 51/78 (65%), Gaps = 4/78 (5%)
 Frame = -2

Query  443  DCLFECFPQSLLPPTA-SPNLHVGSGTK---EHQTKSFKTADYHLPYLIPSRILLLLHDL  276
            D LFEC P SL P ++ SP  H    +K   EHQ KS + A Y LP LIP R++ LLHDL
Sbjct  200  DRLFECLPNSLRPSSSGSPRKHGDDNSKSPTEHQGKSLENAVYTLPTLIPPRVIPLLHDL  259

Query  275  AQLMIRSGHQQQAFNIYR  222
            AQ M ++GHQQQ F IYR
Sbjct  260  AQQMAQAGHQQQLFRIYR  277



>ref|XP_002309247.1| hypothetical protein POPTR_0006s22030g [Populus trichocarpa]
 gb|EEE92770.1| hypothetical protein POPTR_0006s22030g [Populus trichocarpa]
Length=644

 Score = 79.7 bits (195),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 45/78 (58%), Positives = 52/78 (67%), Gaps = 4/78 (5%)
 Frame = -2

Query  443  DCLFECFPQSLLPPTA-SPNLH-VGSGTK--EHQTKSFKTADYHLPYLIPSRILLLLHDL  276
            D LFEC P SL P ++ SP  H  GSG    +HQ KS + A Y LP LIP R+L LLHDL
Sbjct  160  DRLFECLPDSLRPSSSGSPRNHGDGSGKSLIDHQEKSLENAVYTLPILIPPRVLPLLHDL  219

Query  275  AQLMIRSGHQQQAFNIYR  222
            AQ M ++GHQQQ F IYR
Sbjct  220  AQQMAQAGHQQQLFRIYR  237



>ref|XP_004249408.1| PREDICTED: exocyst complex component EXO70A1 [Solanum lycopersicum]
Length=640

 Score = 77.4 bits (189),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 44/73 (60%), Positives = 51/73 (70%), Gaps = 1/73 (1%)
 Frame = -2

Query  443  DCLFECFPQSLLPPTASPNLHVGSGTKEHQTKSFKTADYHLPYLIPSRILLLLHDLAQLM  264
            D LF+C PQSL P T S +   G G KEHQ +S +T  YH P LIP RIL LLHDLAQ M
Sbjct  161  DRLFDCLPQSLRPSTGSDSKGDGGGAKEHQ-RSLETVVYHPPDLIPPRILPLLHDLAQQM  219

Query  263  IRSGHQQQAFNIY  225
            I++GHQQQ + IY
Sbjct  220  IQAGHQQQLYTIY  232



>ref|XP_004154191.1| PREDICTED: uncharacterized protein LOC101221668, partial [Cucumis 
sativus]
Length=267

 Score = 74.7 bits (182),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 41/77 (53%), Positives = 52/77 (68%), Gaps = 4/77 (5%)
 Frame = -2

Query  443  DCLFECFPQSLLPPTASPNLHVGSGTK---EHQTKSFKTADYHLPYLIPSRILLLLHDLA  273
            D LF+C P +L P +AS + H  SG+K   + Q KS + A +  P LIP R+L LLHDLA
Sbjct  75   DRLFDCLPNNLRPSSASAH-HGDSGSKINSDQQNKSLEAAVFIPPTLIPPRVLPLLHDLA  133

Query  272  QLMIRSGHQQQAFNIYR  222
            Q MI++GHQQQ F IYR
Sbjct  134  QQMIQAGHQQQLFRIYR  150



>ref|XP_002532543.1| protein binding protein, putative [Ricinus communis]
 gb|EEF29837.1| protein binding protein, putative [Ricinus communis]
Length=638

 Score = 76.3 bits (186),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 50/80 (63%), Gaps = 7/80 (9%)
 Frame = -2

Query  443  DCLFECFPQSLLP---PTASPNLHVGSGTKEHQ---TKSFKTADYHLPYLIPSRILLLLH  282
            D LFEC P +L P    T SP LH G  T  +    TKS + A Y +P LIP R+L LLH
Sbjct  160  DRLFECLPNALRPSAGATGSPKLH-GDTTNNNAKSPTKSLEAAIYTIPTLIPPRVLPLLH  218

Query  281  DLAQLMIRSGHQQQAFNIYR  222
            DLAQ M+ +GHQQQ F IYR
Sbjct  219  DLAQQMVLAGHQQQLFRIYR  238



>ref|XP_004159234.1| PREDICTED: exocyst complex component 7-like [Cucumis sativus]
Length=628

 Score = 75.1 bits (183),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 41/77 (53%), Positives = 52/77 (68%), Gaps = 4/77 (5%)
 Frame = -2

Query  443  DCLFECFPQSLLPPTASPNLHVGSGTK---EHQTKSFKTADYHLPYLIPSRILLLLHDLA  273
            D LF+C P +L P +AS + H  SG+K   + Q KS + A +  P LIP R+L LLHDLA
Sbjct  160  DRLFDCLPNNLRPSSASAH-HGDSGSKINSDQQNKSLEAAVFIPPTLIPPRVLPLLHDLA  218

Query  272  QLMIRSGHQQQAFNIYR  222
            Q MI++GHQQQ F IYR
Sbjct  219  QQMIQAGHQQQLFRIYR  235



>gb|EYU19401.1| hypothetical protein MIMGU_mgv1a002725mg [Erythranthe guttata]
Length=643

 Score = 75.1 bits (183),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 46/76 (61%), Gaps = 2/76 (3%)
 Frame = -2

Query  443  DCLFECFPQSLLPPTASPNLHVGSGTK--EHQTKSFKTADYHLPYLIPSRILLLLHDLAQ  270
            D LF+C P S+ P   SP     +G K  EHQ KS +   Y LP LIP RIL LLHD+ Q
Sbjct  161  DRLFDCLPNSMRPSAGSPRDGESNGKKQSEHQNKSLEPVVYQLPTLIPPRILPLLHDMTQ  220

Query  269  LMIRSGHQQQAFNIYR  222
             MI++GHQ Q   IYR
Sbjct  221  QMIQAGHQLQIATIYR  236



>ref|XP_009383511.1| PREDICTED: exocyst complex component EXO70A1-like [Musa acuminata 
subsp. malaccensis]
Length=643

 Score = 73.9 bits (180),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 35/74 (47%), Positives = 46/74 (62%), Gaps = 0/74 (0%)
 Frame = -2

Query  443  DCLFECFPQSLLPPTASPNLHVGSGTKEHQTKSFKTADYHLPYLIPSRILLLLHDLAQLM  264
            D LF+C P+SL P + +       G  EHQ +S + A Y  P LIP R+L LLHDLA  +
Sbjct  160  DRLFDCLPKSLQPHSETSGHQADGGKPEHQARSLEAAVYKTPTLIPPRVLPLLHDLANQL  219

Query  263  IRSGHQQQAFNIYR  222
            +++GHQQQ   IYR
Sbjct  220  VQAGHQQQCSKIYR  233



>emb|CDP10608.1| unnamed protein product [Coffea canephora]
Length=583

 Score = 73.9 bits (180),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 40/75 (53%), Positives = 46/75 (61%), Gaps = 2/75 (3%)
 Frame = -2

Query  443  DCLFECFPQSLLPPTASPNLHVGSGTK--EHQTKSFKTADYHLPYLIPSRILLLLHDLAQ  270
            D LF+C P +L P T SP    GSG K  EH  KS +   YH P LIP RIL LLHDLA 
Sbjct  102  DLLFDCLPNTLRPSTGSPAQGDGSGLKSSEHHKKSLEPVVYHPPTLIPPRILPLLHDLAF  161

Query  269  LMIRSGHQQQAFNIY  225
             ++  GH QQ FNI+
Sbjct  162  QLVEGGHHQQLFNIH  176



>ref|XP_007204602.1| hypothetical protein PRUPE_ppa002792mg [Prunus persica]
 gb|EMJ05801.1| hypothetical protein PRUPE_ppa002792mg [Prunus persica]
Length=633

 Score = 73.9 bits (180),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/74 (51%), Positives = 44/74 (59%), Gaps = 0/74 (0%)
 Frame = -2

Query  443  DCLFECFPQSLLPPTASPNLHVGSGTKEHQTKSFKTADYHLPYLIPSRILLLLHDLAQLM  264
            DCLF+C P SL P +          + EHQ KS +   Y    LIP R+L LLHDLAQ M
Sbjct  160  DCLFDCLPDSLRPSSDPAGQKSDGKSSEHQNKSLQPVIYTPLTLIPPRVLPLLHDLAQQM  219

Query  263  IRSGHQQQAFNIYR  222
            I +GHQQQ F IYR
Sbjct  220  ILAGHQQQLFRIYR  233



>gb|KHN13248.1| Exocyst complex component 7 [Glycine soja]
Length=484

 Score = 73.6 bits (179),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 36/74 (49%), Positives = 46/74 (62%), Gaps = 1/74 (1%)
 Frame = -2

Query  443  DCLFECFPQSLLPPTASPNLHVGSGTKEHQTKSFKTADYHLPYLIPSRILLLLHDLAQLM  264
            D LFEC P SL P  +      G G    + +S +T  + LP LIP R++ LLHDLAQ M
Sbjct  16   DRLFECLPNSLRPSNSGKQSE-GGGKNHSEKQSSETVTFALPILIPPRVIPLLHDLAQQM  74

Query  263  IRSGHQQQAFNIYR  222
            +++GHQQQ F IYR
Sbjct  75   VQAGHQQQLFRIYR  88



>ref|XP_003543668.1| PREDICTED: exocyst complex component EXO70A1-like isoform 1 [Glycine 
max]
Length=628

 Score = 73.9 bits (180),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 36/74 (49%), Positives = 46/74 (62%), Gaps = 1/74 (1%)
 Frame = -2

Query  443  DCLFECFPQSLLPPTASPNLHVGSGTKEHQTKSFKTADYHLPYLIPSRILLLLHDLAQLM  264
            D LFEC P SL P  +      G G    + +S +T  + LP LIP R++ LLHDLAQ M
Sbjct  160  DRLFECLPNSLRPSNSGKQSE-GGGKNHSEKQSSETVTFALPILIPPRVIPLLHDLAQQM  218

Query  263  IRSGHQQQAFNIYR  222
            +++GHQQQ F IYR
Sbjct  219  VQAGHQQQLFRIYR  232



>ref|XP_008462620.1| PREDICTED: exocyst complex component EXO70A1 isoform X2 [Cucumis 
melo]
Length=638

 Score = 72.8 bits (177),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 40/77 (52%), Positives = 52/77 (68%), Gaps = 4/77 (5%)
 Frame = -2

Query  443  DCLFECFPQSLLPPTASPNLHVGSGTK---EHQTKSFKTADYHLPYLIPSRILLLLHDLA  273
            D LF+C P +L P +AS + H  SG+K   ++  KS + A +  P LIP R+L LLHDLA
Sbjct  160  DRLFDCLPNNLRPSSASSH-HGDSGSKNNSDNHNKSLEAAVFIPPTLIPPRVLPLLHDLA  218

Query  272  QLMIRSGHQQQAFNIYR  222
            Q MI++GHQQQ F IYR
Sbjct  219  QQMIQAGHQQQLFRIYR  235



>ref|XP_008462619.1| PREDICTED: exocyst complex component EXO70A1 isoform X1 [Cucumis 
melo]
Length=639

 Score = 72.8 bits (177),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 40/77 (52%), Positives = 52/77 (68%), Gaps = 4/77 (5%)
 Frame = -2

Query  443  DCLFECFPQSLLPPTASPNLHVGSGTK---EHQTKSFKTADYHLPYLIPSRILLLLHDLA  273
            D LF+C P +L P +AS + H  SG+K   ++  KS + A +  P LIP R+L LLHDLA
Sbjct  160  DRLFDCLPNNLRPSSASSH-HGDSGSKNNSDNHNKSLEAAVFIPPTLIPPRVLPLLHDLA  218

Query  272  QLMIRSGHQQQAFNIYR  222
            Q MI++GHQQQ F IYR
Sbjct  219  QQMIQAGHQQQLFRIYR  235



>gb|KDP36125.1| hypothetical protein JCGZ_08769 [Jatropha curcas]
Length=540

 Score = 72.4 bits (176),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 39/78 (50%), Positives = 49/78 (63%), Gaps = 3/78 (4%)
 Frame = -2

Query  443  DCLFECFPQSLLPPTASPNLHVGSGTKE--HQTKSFKTADYHLPYLIPSRILLLLHDLAQ  270
            D LF+C P SL P + SP  H G+   +     KS +   Y +P LIP R+L LLHDLAQ
Sbjct  61   DHLFDCLPNSLRPSSGSPR-HQGAANAKSTENNKSSEAPIYTVPTLIPPRVLPLLHDLAQ  119

Query  269  LMIRSGHQQQAFNIYR*I  216
             M+++GHQQQ F IYR I
Sbjct  120  QMVQAGHQQQLFRIYRDI  137



>ref|XP_002280545.1| PREDICTED: exocyst complex component EXO70A1 isoform X3 [Vitis 
vinifera]
 emb|CBI30382.3| unnamed protein product [Vitis vinifera]
Length=648

 Score = 72.4 bits (176),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 43/83 (52%), Positives = 49/83 (59%), Gaps = 11/83 (13%)
 Frame = -2

Query  443  DCLFECFPQSLLPPTASPNLHVGSGT---------KEHQTKSFKTADYHLPYLIPSRILL  291
            D LF+C P SL P + SP  H G  T          EH  KS +TA Y  P LIP RIL 
Sbjct  160  DRLFDCLPHSLRPSSGSPG-HQGEATGKNPSSTNHSEH-NKSLETAVYTAPTLIPPRILP  217

Query  290  LLHDLAQLMIRSGHQQQAFNIYR  222
            LLHDLAQ M ++GHQQQ + IYR
Sbjct  218  LLHDLAQQMSQAGHQQQLYKIYR  240



>ref|XP_010654150.1| PREDICTED: exocyst complex component EXO70A1 isoform X1 [Vitis 
vinifera]
Length=650

 Score = 72.4 bits (176),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 43/83 (52%), Positives = 49/83 (59%), Gaps = 11/83 (13%)
 Frame = -2

Query  443  DCLFECFPQSLLPPTASPNLHVGSGT---------KEHQTKSFKTADYHLPYLIPSRILL  291
            D LF+C P SL P + SP  H G  T          EH  KS +TA Y  P LIP RIL 
Sbjct  160  DRLFDCLPHSLRPSSGSPG-HQGEATGKNPSSTNHSEH-NKSLETAVYTAPTLIPPRILP  217

Query  290  LLHDLAQLMIRSGHQQQAFNIYR  222
            LLHDLAQ M ++GHQQQ + IYR
Sbjct  218  LLHDLAQQMSQAGHQQQLYKIYR  240



>ref|NP_001065801.1| Os11g0157400 [Oryza sativa Japonica Group]
 gb|ABA91554.2| exocyst subunit EXO70 family protein, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF27646.1| Os11g0157400 [Oryza sativa Japonica Group]
 dbj|BAG89990.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC67711.1| hypothetical protein OsI_35189 [Oryza sativa Indica Group]
 gb|EEE51681.1| hypothetical protein OsJ_33035 [Oryza sativa Japonica Group]
Length=643

 Score = 72.4 bits (176),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 50/75 (67%), Gaps = 1/75 (1%)
 Frame = -2

Query  443  DCLFECFPQSLLPPTASPNLHVG-SGTKEHQTKSFKTADYHLPYLIPSRILLLLHDLAQL  267
            D LF+C P+SL P    P+   G +G  EH +KS +TA Y  P LIP RIL L++D+AQ 
Sbjct  165  DRLFDCLPKSLRPTKDDPDADPGNAGHSEHPSKSLETAVYRTPTLIPPRILPLMNDIAQQ  224

Query  266  MIRSGHQQQAFNIYR  222
            +I++G+QQ  + IYR
Sbjct  225  LIQAGNQQSCYKIYR  239



>ref|XP_010654151.1| PREDICTED: exocyst complex component EXO70A1 isoform X2 [Vitis 
vinifera]
Length=650

 Score = 72.4 bits (176),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 43/83 (52%), Positives = 49/83 (59%), Gaps = 11/83 (13%)
 Frame = -2

Query  443  DCLFECFPQSLLPPTASPNLHVGSGT---------KEHQTKSFKTADYHLPYLIPSRILL  291
            D LF+C P SL P + SP  H G  T          EH  KS +TA Y  P LIP RIL 
Sbjct  160  DRLFDCLPHSLRPSSGSPG-HQGEATGKNPSSTNHSEH-NKSLETAVYTAPTLIPPRILP  217

Query  290  LLHDLAQLMIRSGHQQQAFNIYR  222
            LLHDLAQ M ++GHQQQ + IYR
Sbjct  218  LLHDLAQQMSQAGHQQQLYKIYR  240



>ref|XP_002268110.1| PREDICTED: exocyst complex component EXO70A1 [Vitis vinifera]
Length=650

 Score = 72.4 bits (176),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 39/81 (48%), Positives = 47/81 (58%), Gaps = 7/81 (9%)
 Frame = -2

Query  443  DCLFECFPQSLLPPTASPNLHVGSGTK-------EHQTKSFKTADYHLPYLIPSRILLLL  285
            D LF+  P SL P + SP     S  K       EHQ  + +TA Y  P LIP R+L LL
Sbjct  160  DRLFDGLPNSLRPSSGSPGNQADSSIKALSNNHSEHQNSNLETAVYTPPTLIPPRVLPLL  219

Query  284  HDLAQLMIRSGHQQQAFNIYR  222
            HDLAQ M+++GHQQQ   IYR
Sbjct  220  HDLAQQMVQAGHQQQLLKIYR  240



>emb|CBI25018.3| unnamed protein product [Vitis vinifera]
Length=644

 Score = 72.4 bits (176),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 39/81 (48%), Positives = 47/81 (58%), Gaps = 7/81 (9%)
 Frame = -2

Query  443  DCLFECFPQSLLPPTASPNLHVGSGTK-------EHQTKSFKTADYHLPYLIPSRILLLL  285
            D LF+  P SL P + SP     S  K       EHQ  + +TA Y  P LIP R+L LL
Sbjct  154  DRLFDGLPNSLRPSSGSPGNQADSSIKALSNNHSEHQNSNLETAVYTPPTLIPPRVLPLL  213

Query  284  HDLAQLMIRSGHQQQAFNIYR  222
            HDLAQ M+++GHQQQ   IYR
Sbjct  214  HDLAQQMVQAGHQQQLLKIYR  234



>gb|KDO70600.1| hypothetical protein CISIN_1g0368061mg, partial [Citrus sinensis]
Length=233

 Score = 69.3 bits (168),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 36/74 (49%), Positives = 43/74 (58%), Gaps = 0/74 (0%)
 Frame = -2

Query  443  DCLFECFPQSLLPPTASPNLHVGSGTKEHQTKSFKTADYHLPYLIPSRILLLLHDLAQLM  264
            D LF+C P SL P +        S +     KS + A Y  P LIP R+L LLHDLAQ M
Sbjct  160  DRLFDCLPNSLRPSSGPSGQEGDSKSHAEHQKSLQAAIYTPPTLIPPRVLPLLHDLAQQM  219

Query  263  IRSGHQQQAFNIYR  222
            + +GHQQQ F IYR
Sbjct  220  VLAGHQQQLFRIYR  233



>ref|XP_006430076.1| hypothetical protein CICLE_v10011277mg [Citrus clementina]
 gb|ESR43316.1| hypothetical protein CICLE_v10011277mg [Citrus clementina]
Length=635

 Score = 72.0 bits (175),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 37/74 (50%), Positives = 44/74 (59%), Gaps = 0/74 (0%)
 Frame = -2

Query  443  DCLFECFPQSLLPPTASPNLHVGSGTKEHQTKSFKTADYHLPYLIPSRILLLLHDLAQLM  264
            D LF+C P SL P +  P     S +     KS + A Y  P LIP R+L LLHDLAQ M
Sbjct  160  DRLFDCLPNSLRPSSGPPGQEGDSKSHAEHQKSLQAAIYTPPTLIPPRVLPLLHDLAQQM  219

Query  263  IRSGHQQQAFNIYR  222
            + +GHQQQ F IYR
Sbjct  220  VLAGHQQQLFRIYR  233



>ref|XP_008799697.1| PREDICTED: exocyst complex component EXO70A1-like [Phoenix dactylifera]
Length=645

 Score = 71.6 bits (174),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 38/78 (49%), Positives = 49/78 (63%), Gaps = 5/78 (6%)
 Frame = -2

Query  443  DCLFECFPQSLLPPTASPNLHVGSGTKE----HQTKSFKTADYHLPYLIPSRILLLLHDL  276
            D LF+C P SL P + S     G G+K     +Q KS +TA Y  P LIP RI+ LLHDL
Sbjct  160  DRLFDCLPNSLRPSSGSTGDQ-GDGSKNPSTSNQAKSLETAVYKTPTLIPPRIVPLLHDL  218

Query  275  AQLMIRSGHQQQAFNIYR  222
            AQ ++++GH+QQ   IYR
Sbjct  219  AQQLVQAGHEQQCAKIYR  236



>ref|XP_007027956.1| Exocyst subunit exo70 family protein A2 isoform 3 [Theobroma 
cacao]
 gb|EOY08458.1| Exocyst subunit exo70 family protein A2 isoform 3 [Theobroma 
cacao]
Length=438

 Score = 70.9 bits (172),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 38/76 (50%), Positives = 46/76 (61%), Gaps = 2/76 (3%)
 Frame = -2

Query  443  DCLFECFPQSLLPPTASPNLHVGSGTKEHQT--KSFKTADYHLPYLIPSRILLLLHDLAQ  270
            D LF+  P SL P   SP      G+K H    K+ + A Y  P LIP R+L LLHDLAQ
Sbjct  160  DRLFDGLPNSLRPSATSPGKQGELGSKNHSENQKNLENAVYTPPTLIPPRVLPLLHDLAQ  219

Query  269  LMIRSGHQQQAFNIYR  222
             M+++GHQQQ F IYR
Sbjct  220  QMVQAGHQQQLFRIYR  235



>ref|XP_011077804.1| PREDICTED: exocyst complex component EXO70A1-like isoform X2 
[Sesamum indicum]
Length=608

 Score = 71.2 bits (173),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 34/75 (45%), Positives = 49/75 (65%), Gaps = 1/75 (1%)
 Frame = -2

Query  443  DCLFECFPQSLLPPTA-SPNLHVGSGTKEHQTKSFKTADYHLPYLIPSRILLLLHDLAQL  267
            D LF+C P S+ P T  SP     +G K  + ++ +T  Y LP LIP+++L LLH++A+ 
Sbjct  161  DRLFDCLPNSMRPSTGGSPRDGESNGKKASEQQNKETVVYQLPTLIPAKLLPLLHEIAEQ  220

Query  266  MIRSGHQQQAFNIYR  222
            MI++GHQQ   NIYR
Sbjct  221  MIQAGHQQTVMNIYR  235



>ref|XP_011077803.1| PREDICTED: exocyst complex component EXO70A1-like isoform X1 
[Sesamum indicum]
Length=634

 Score = 70.9 bits (172),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 34/75 (45%), Positives = 49/75 (65%), Gaps = 1/75 (1%)
 Frame = -2

Query  443  DCLFECFPQSLLPPTA-SPNLHVGSGTKEHQTKSFKTADYHLPYLIPSRILLLLHDLAQL  267
            D LF+C P S+ P T  SP     +G K  + ++ +T  Y LP LIP+++L LLH++A+ 
Sbjct  161  DRLFDCLPNSMRPSTGGSPRDGESNGKKASEQQNKETVVYQLPTLIPAKLLPLLHEIAEQ  220

Query  266  MIRSGHQQQAFNIYR  222
            MI++GHQQ   NIYR
Sbjct  221  MIQAGHQQTVMNIYR  235



>ref|XP_007027954.1| Exocyst subunit exo70 family protein A2 isoform 1 [Theobroma 
cacao]
 gb|EOY08456.1| Exocyst subunit exo70 family protein A2 isoform 1 [Theobroma 
cacao]
Length=643

 Score = 70.9 bits (172),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 38/76 (50%), Positives = 46/76 (61%), Gaps = 2/76 (3%)
 Frame = -2

Query  443  DCLFECFPQSLLPPTASPNLHVGSGTKEH--QTKSFKTADYHLPYLIPSRILLLLHDLAQ  270
            D LF+  P SL P   SP      G+K H    K+ + A Y  P LIP R+L LLHDLAQ
Sbjct  160  DRLFDGLPNSLRPSATSPGKQGELGSKNHSENQKNLENAVYTPPTLIPPRVLPLLHDLAQ  219

Query  269  LMIRSGHQQQAFNIYR  222
             M+++GHQQQ F IYR
Sbjct  220  QMVQAGHQQQLFRIYR  235



>ref|XP_007151187.1| hypothetical protein PHAVU_004G025400g [Phaseolus vulgaris]
 gb|ESW23181.1| hypothetical protein PHAVU_004G025400g [Phaseolus vulgaris]
Length=628

 Score = 70.9 bits (172),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 38/75 (51%), Positives = 46/75 (61%), Gaps = 3/75 (4%)
 Frame = -2

Query  443  DCLFECFPQSLLPPTASPNLHVGSGTKEHQTK-SFKTADYHLPYLIPSRILLLLHDLAQL  267
            D LFEC P SL P  +    H   G K H  K S +   + LP LIP R++ LLHDLAQ 
Sbjct  160  DRLFECLPNSLRPSNSGK--HGEGGGKNHSRKQSSEGVAFALPTLIPPRVIPLLHDLAQQ  217

Query  266  MIRSGHQQQAFNIYR  222
            M+++GHQQQ F IYR
Sbjct  218  MVQAGHQQQLFRIYR  232



>ref|XP_007027955.1| Exocyst subunit exo70 family protein A2 isoform 2 [Theobroma 
cacao]
 gb|EOY08457.1| Exocyst subunit exo70 family protein A2 isoform 2 [Theobroma 
cacao]
Length=501

 Score = 70.5 bits (171),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 38/76 (50%), Positives = 46/76 (61%), Gaps = 2/76 (3%)
 Frame = -2

Query  443  DCLFECFPQSLLPPTASPNLHVGSGTKEHQT--KSFKTADYHLPYLIPSRILLLLHDLAQ  270
            D LF+  P SL P   SP      G+K H    K+ + A Y  P LIP R+L LLHDLAQ
Sbjct  160  DRLFDGLPNSLRPSATSPGKQGELGSKNHSENQKNLENAVYTPPTLIPPRVLPLLHDLAQ  219

Query  269  LMIRSGHQQQAFNIYR  222
             M+++GHQQQ F IYR
Sbjct  220  QMVQAGHQQQLFRIYR  235



>emb|CAN73810.1| hypothetical protein VITISV_039782 [Vitis vinifera]
Length=643

 Score = 70.9 bits (172),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 42/83 (51%), Positives = 48/83 (58%), Gaps = 11/83 (13%)
 Frame = -2

Query  443  DCLFECFPQSLLPPTASPNLHVGSGT---------KEHQTKSFKTADYHLPYLIPSRILL  291
            D LF+C P  L P + SP  H G  T          EH  KS +TA Y  P LIP RIL 
Sbjct  160  DRLFDCLPHXLRPSSGSPG-HQGEATGKNPSSTNHSEH-NKSLETAVYTAPTLIPPRILP  217

Query  290  LLHDLAQLMIRSGHQQQAFNIYR  222
            LLHDLAQ M ++GHQQQ + IYR
Sbjct  218  LLHDLAQQMSQAGHQQQLYKIYR  240



>ref|XP_006401836.1| hypothetical protein EUTSA_v10015542mg [Eutrema salsugineum]
 gb|ESQ43289.1| hypothetical protein EUTSA_v10015542mg [Eutrema salsugineum]
Length=631

 Score = 70.5 bits (171),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 37/76 (49%), Positives = 46/76 (61%), Gaps = 6/76 (8%)
 Frame = -2

Query  443  DCLFECFPQSLLPPTASPNLHVGSGTKEHQ--TKSFKTADYHLPYLIPSRILLLLHDLAQ  270
            D LFEC P +L P T       G G K H    KS + A + +P +IP R+L LLHDLAQ
Sbjct  160  DRLFECLPSNLRPSTDGE----GGGGKSHDPHQKSLENAIFTVPTVIPPRVLPLLHDLAQ  215

Query  269  LMIRSGHQQQAFNIYR  222
             M+++GHQQQ F  YR
Sbjct  216  QMVQAGHQQQLFKTYR  231



>ref|XP_009127247.1| PREDICTED: exocyst complex component EXO70A1-like [Brassica rapa]
 emb|CDY27076.1| BnaA02g10960D [Brassica napus]
 emb|CDX91635.1| BnaC02g15250D [Brassica napus]
Length=632

 Score = 70.5 bits (171),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 37/76 (49%), Positives = 46/76 (61%), Gaps = 6/76 (8%)
 Frame = -2

Query  443  DCLFECFPQSLLPPTASPNLHVGSGTKEHQ--TKSFKTADYHLPYLIPSRILLLLHDLAQ  270
            D LFEC P +L P T       G G K H    KS + A + +P +IP R+L LLHDLAQ
Sbjct  161  DRLFECLPSNLRPSTDGE----GGGGKSHDPHQKSLENAIFTVPTVIPPRVLPLLHDLAQ  216

Query  269  LMIRSGHQQQAFNIYR  222
             M+++GHQQQ F  YR
Sbjct  217  QMVQAGHQQQLFKTYR  232



>ref|XP_004174025.1| PREDICTED: exocyst complex component 7-like, partial [Cucumis 
sativus]
Length=178

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 44/73 (60%), Gaps = 2/73 (3%)
 Frame = -2

Query  437  LFECFPQSLLPPTASPNLHVGSGT--KEHQTKSFKTADYHLPYLIPSRILLLLHDLAQLM  264
            LF+C P+SL P + SP    G       H   S +TA Y  P LIP R+L LLHDL+Q M
Sbjct  106  LFDCLPKSLQPSSDSPGHDSGGKNHHSAHHDNSLETAVYTPPTLIPPRVLPLLHDLSQQM  165

Query  263  IRSGHQQQAFNIY  225
            +++GHQQQ   +Y
Sbjct  166  VQAGHQQQILKVY  178



>ref|XP_008813458.1| PREDICTED: exocyst complex component EXO70A1-like [Phoenix dactylifera]
Length=648

 Score = 69.3 bits (168),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 48/84 (57%), Gaps = 8/84 (10%)
 Frame = -2

Query  443  DCLFECFPQSLLPPTASPNLHVGSGTK--------EHQTKSFKTADYHLPYLIPSRILLL  288
            DCLF+C P +L P + SP      G K        EHQ K+ + A Y  P LI  RIL L
Sbjct  157  DCLFDCLPDALRPSSGSPVQQGDDGGKNPSGTTNSEHQAKNSEAAVYTPPTLIAPRILPL  216

Query  287  LHDLAQLMIRSGHQQQAFNIYR*I  216
            LH LAQ ++++G+QQQ   IYR I
Sbjct  217  LHKLAQQLVQAGYQQQCLKIYREI  240



>ref|XP_002311935.2| exocyst subunit EXO70 family protein [Populus trichocarpa]
 gb|EEE89302.2| exocyst subunit EXO70 family protein [Populus trichocarpa]
Length=648

 Score = 68.9 bits (167),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 38/77 (49%), Positives = 49/77 (64%), Gaps = 4/77 (5%)
 Frame = -2

Query  443  DCLFECFPQSLLPPTASPNLHVGSGTK---EHQTKSFKTADYHLPYLIPSRILLLLHDLA  273
            D LFEC P+SL P + SP  ++ SG     EHQ  + +T  +    LIP RIL LLHDLA
Sbjct  161  DRLFECLPESLRPSSESPG-NLSSGRNHHHEHQNGASETGGFKHLTLIPPRILPLLHDLA  219

Query  272  QLMIRSGHQQQAFNIYR  222
            Q M+++G+QQQ   IYR
Sbjct  220  QQMVQAGNQQQLLRIYR  236



>ref|XP_006662750.1| PREDICTED: exocyst complex component EXO70A1-like [Oryza brachyantha]
Length=646

 Score = 68.9 bits (167),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 34/75 (45%), Positives = 49/75 (65%), Gaps = 1/75 (1%)
 Frame = -2

Query  443  DCLFECFPQSLLPPTASPNLHVG-SGTKEHQTKSFKTADYHLPYLIPSRILLLLHDLAQL  267
            D LF+C P+SL P    P+   G +G  EH +KS +TA Y  P LIP RIL L++D+AQ 
Sbjct  165  DRLFDCLPKSLRPTKDDPDGDRGNAGHSEHPSKSLETAVYRTPTLIPPRILPLMNDIAQQ  224

Query  266  MIRSGHQQQAFNIYR  222
            ++++G+QQ    +YR
Sbjct  225  LVQAGNQQSCHKVYR  239



>ref|XP_004162733.1| PREDICTED: exocyst complex component 7-like [Cucumis sativus]
Length=594

 Score = 68.9 bits (167),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 35/74 (47%), Positives = 45/74 (61%), Gaps = 2/74 (3%)
 Frame = -2

Query  437  LFECFPQSLLPPTASPNLHVGSGT--KEHQTKSFKTADYHLPYLIPSRILLLLHDLAQLM  264
            LF+C P+SL P + SP    G       H   S +TA Y  P LIP R+L LLHDL+Q M
Sbjct  111  LFDCLPKSLQPSSDSPGHDSGGKNHHSAHHDNSLETAVYTPPTLIPPRVLPLLHDLSQQM  170

Query  263  IRSGHQQQAFNIYR  222
            +++GHQQQ   +YR
Sbjct  171  VQAGHQQQILKVYR  184



>ref|XP_006481587.1| PREDICTED: exocyst complex component EXO70A1-like [Citrus sinensis]
Length=635

 Score = 68.9 bits (167),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 36/74 (49%), Positives = 43/74 (58%), Gaps = 0/74 (0%)
 Frame = -2

Query  443  DCLFECFPQSLLPPTASPNLHVGSGTKEHQTKSFKTADYHLPYLIPSRILLLLHDLAQLM  264
            D LF+C P SL P +        S +     KS + A Y  P LIP R+L LLHDLAQ M
Sbjct  160  DRLFDCLPNSLRPSSGPSGQEGDSKSHAEHQKSLQAAIYTPPTLIPPRVLPLLHDLAQQM  219

Query  263  IRSGHQQQAFNIYR  222
            + +GHQQQ F IYR
Sbjct  220  VLAGHQQQLFRIYR  233



>ref|XP_008446747.1| PREDICTED: exocyst complex component EXO70A1 [Cucumis melo]
Length=651

 Score = 68.9 bits (167),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 35/74 (47%), Positives = 45/74 (61%), Gaps = 2/74 (3%)
 Frame = -2

Query  437  LFECFPQSLLPPTASPNLHVGSGT--KEHQTKSFKTADYHLPYLIPSRILLLLHDLAQLM  264
            LF+C P+SL P + SP    G       H   S +TA Y  P LIP R+L LLHDL+Q M
Sbjct  168  LFDCLPKSLQPSSDSPGHDSGGKNHHSAHHDNSLETAVYTPPTLIPPRVLPLLHDLSQQM  227

Query  263  IRSGHQQQAFNIYR  222
            +++GHQQQ   +YR
Sbjct  228  VQAGHQQQILKVYR  241



>ref|XP_009378235.1| PREDICTED: exocyst complex component EXO70A1-like isoform X1 
[Pyrus x bretschneideri]
 ref|XP_009378241.1| PREDICTED: exocyst complex component EXO70A1-like isoform X1 
[Pyrus x bretschneideri]
Length=633

 Score = 68.6 bits (166),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 37/74 (50%), Positives = 41/74 (55%), Gaps = 0/74 (0%)
 Frame = -2

Query  443  DCLFECFPQSLLPPTASPNLHVGSGTKEHQTKSFKTADYHLPYLIPSRILLLLHDLAQLM  264
            D LF+C P SL P  A      G    EH  KS K   Y    LIP R+L LLHDLAQ M
Sbjct  160  DRLFDCLPDSLRPDPAGQKNDAGGKGSEHPNKSLKPVIYTPLTLIPPRVLPLLHDLAQQM  219

Query  263  IRSGHQQQAFNIYR  222
            + +GHQQQ F  YR
Sbjct  220  VLAGHQQQLFRTYR  233



>ref|XP_004135040.1| PREDICTED: exocyst complex component 7-like [Cucumis sativus]
Length=651

 Score = 68.9 bits (167),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 35/74 (47%), Positives = 45/74 (61%), Gaps = 2/74 (3%)
 Frame = -2

Query  437  LFECFPQSLLPPTASPNLHVGSGT--KEHQTKSFKTADYHLPYLIPSRILLLLHDLAQLM  264
            LF+C P+SL P + SP    G       H   S +TA Y  P LIP R+L LLHDL+Q M
Sbjct  168  LFDCLPKSLQPSSDSPGHDSGGKNHHSAHHDNSLETAVYTPPTLIPPRVLPLLHDLSQQM  227

Query  263  IRSGHQQQAFNIYR  222
            +++GHQQQ   +YR
Sbjct  228  VQAGHQQQILKVYR  241



>ref|XP_011011641.1| PREDICTED: exocyst complex component EXO70A1-like [Populus euphratica]
Length=645

 Score = 68.6 bits (166),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 42/79 (53%), Positives = 52/79 (66%), Gaps = 5/79 (6%)
 Frame = -2

Query  443  DCLFECFPQSLLPPTASPNL--HVGSGTK---EHQTKSFKTADYHLPYLIPSRILLLLHD  279
            D LFEC P SL P ++S +   H    +K   EHQ KS + A Y LP LIP R++ LLHD
Sbjct  160  DRLFECLPNSLRPSSSSGSPRKHGNDNSKSPTEHQGKSLENAVYTLPTLIPPRVIPLLHD  219

Query  278  LAQLMIRSGHQQQAFNIYR  222
            LAQ M+++GHQQQ F IYR
Sbjct  220  LAQQMVQAGHQQQLFRIYR  238



>ref|XP_011042604.1| PREDICTED: exocyst complex component EXO70A1-like [Populus euphratica]
Length=645

 Score = 68.6 bits (166),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 42/79 (53%), Positives = 52/79 (66%), Gaps = 5/79 (6%)
 Frame = -2

Query  443  DCLFECFPQSLLPPTASPNL--HVGSGTK---EHQTKSFKTADYHLPYLIPSRILLLLHD  279
            D LFEC P SL P ++S +   H    +K   EHQ KS + A Y LP LIP R++ LLHD
Sbjct  160  DRLFECLPNSLRPSSSSGSPRKHGNDNSKSPTEHQGKSLENAVYTLPTLIPPRVIPLLHD  219

Query  278  LAQLMIRSGHQQQAFNIYR  222
            LAQ M+++GHQQQ F IYR
Sbjct  220  LAQQMVQAGHQQQLFRIYR  238



>ref|XP_002516636.1| protein binding protein, putative [Ricinus communis]
 gb|EEF45760.1| protein binding protein, putative [Ricinus communis]
Length=628

 Score = 68.6 bits (166),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 37/75 (49%), Positives = 47/75 (63%), Gaps = 1/75 (1%)
 Frame = -2

Query  443  DCLFECFPQSLLPPTASP-NLHVGSGTKEHQTKSFKTADYHLPYLIPSRILLLLHDLAQL  267
            D LFEC P+S+ P   SP N + G    E    + +T  +    LIP RIL LLHDLAQ 
Sbjct  144  DRLFECLPESMQPSAGSPLNHNGGRNHSEQPNNNPETGAFKHLTLIPPRILPLLHDLAQQ  203

Query  266  MIRSGHQQQAFNIYR  222
            M+++GHQQQ F+IYR
Sbjct  204  MVQAGHQQQLFSIYR  218



>ref|XP_008241041.1| PREDICTED: exocyst complex component EXO70A1 [Prunus mume]
Length=633

 Score = 68.6 bits (166),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 37/74 (50%), Positives = 42/74 (57%), Gaps = 0/74 (0%)
 Frame = -2

Query  443  DCLFECFPQSLLPPTASPNLHVGSGTKEHQTKSFKTADYHLPYLIPSRILLLLHDLAQLM  264
            D LF+C P SL P +            EHQ KS +   Y    LIP R+L LLHDLAQ M
Sbjct  160  DRLFDCLPDSLRPSSDPAGQKSDGKGSEHQNKSLQPVIYTPLTLIPPRVLPLLHDLAQQM  219

Query  263  IRSGHQQQAFNIYR  222
            I +GHQQQ F IYR
Sbjct  220  ILAGHQQQLFRIYR  233



>gb|KHG11246.1| Exocyst complex component 7 [Gossypium arboreum]
Length=618

 Score = 68.2 bits (165),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 35/74 (47%), Positives = 43/74 (58%), Gaps = 0/74 (0%)
 Frame = -2

Query  443  DCLFECFPQSLLPPTASPNLHVGSGTKEHQTKSFKTADYHLPYLIPSRILLLLHDLAQLM  264
            D LF+  P SL P   SP     S       K+ + A Y  P LIP R+L LLH+LAQ M
Sbjct  160  DRLFDGLPDSLRPSATSPGKRNDSKKDSDNQKNSENAVYTPPTLIPPRVLPLLHNLAQQM  219

Query  263  IRSGHQQQAFNIYR  222
            +++GHQQQ F IYR
Sbjct  220  VQAGHQQQLFRIYR  233



>ref|XP_011032906.1| PREDICTED: exocyst complex component EXO70A1-like [Populus euphratica]
Length=648

 Score = 67.8 bits (164),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 37/77 (48%), Positives = 49/77 (64%), Gaps = 4/77 (5%)
 Frame = -2

Query  443  DCLFECFPQSLLPPTASPNLHVGSGTK---EHQTKSFKTADYHLPYLIPSRILLLLHDLA  273
            D LF+C P+SL P + SP  ++ SG     EHQ  + +T  +    LIP RIL LLHDLA
Sbjct  161  DRLFDCLPESLRPSSESPG-NLSSGKNHHHEHQNGASETGGFKHLTLIPPRILPLLHDLA  219

Query  272  QLMIRSGHQQQAFNIYR  222
            Q M+++G+QQQ   IYR
Sbjct  220  QQMVQAGNQQQLLRIYR  236



>ref|XP_010237920.1| PREDICTED: exocyst complex component EXO70A1-like [Brachypodium 
distachyon]
Length=647

 Score = 67.4 bits (163),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 46/74 (62%), Gaps = 2/74 (3%)
 Frame = -2

Query  443  DCLFECFPQSLLPPTASPNLHVGSGTKEHQTKSFKTADYHLPYLIPSRILLLLHDLAQLM  264
            D LF+C P+SL P    P      G  EH +K  +TA Y  P L+P R+L L++D+AQ +
Sbjct  165  DRLFDCLPKSLRPSKDDP--ESDRGNAEHPSKGLETAVYRTPTLVPPRVLPLMNDIAQQL  222

Query  263  IRSGHQQQAFNIYR  222
            +++G+QQ  + IYR
Sbjct  223  VQAGNQQSCYKIYR  236



>ref|XP_008231810.1| PREDICTED: exocyst complex component EXO70A1 [Prunus mume]
Length=650

 Score = 67.4 bits (163),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 36/76 (47%), Positives = 45/76 (59%), Gaps = 4/76 (5%)
 Frame = -2

Query  437  LFECFPQSLLPPTASPNLHVG----SGTKEHQTKSFKTADYHLPYLIPSRILLLLHDLAQ  270
            LF+C P SL P + SP  + G    +   EH   S + A Y  P LIP R++ LLHDLAQ
Sbjct  165  LFDCLPNSLRPSSGSPGDYSGKNPSNNHAEHHNSSLENAVYTPPTLIPPRVIPLLHDLAQ  224

Query  269  LMIRSGHQQQAFNIYR  222
             M ++GHQQQ   IYR
Sbjct  225  QMFQAGHQQQLLIIYR  240



>ref|XP_007214655.1| hypothetical protein PRUPE_ppa002633mg [Prunus persica]
 gb|EMJ15854.1| hypothetical protein PRUPE_ppa002633mg [Prunus persica]
Length=650

 Score = 67.4 bits (163),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 36/76 (47%), Positives = 45/76 (59%), Gaps = 4/76 (5%)
 Frame = -2

Query  437  LFECFPQSLLPPTASPNLHVG----SGTKEHQTKSFKTADYHLPYLIPSRILLLLHDLAQ  270
            LF+C P SL P + SP  + G    +   EH   S + A Y  P LIP R++ LLHDLAQ
Sbjct  165  LFDCLPNSLRPSSGSPGDYSGKNPSNNHAEHHNSSLENAVYTPPTLIPPRVIPLLHDLAQ  224

Query  269  LMIRSGHQQQAFNIYR  222
             M ++GHQQQ   IYR
Sbjct  225  QMFQAGHQQQLLIIYR  240



>ref|XP_006854674.1| hypothetical protein AMTR_s00030p00210320 [Amborella trichopoda]
 gb|ERN16141.1| hypothetical protein AMTR_s00030p00210320 [Amborella trichopoda]
Length=649

 Score = 67.4 bits (163),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 44/80 (55%), Gaps = 6/80 (8%)
 Frame = -2

Query  443  DCLFECFPQSLLPPTASPNLHVGSGTK------EHQTKSFKTADYHLPYLIPSRILLLLH  282
            D LFEC P S+ P T S      S  K      +HQ KS +     LP LIP RI+ LLH
Sbjct  160  DRLFECLPNSMRPSTGSHGDQGDSSGKSPGHQPDHQVKSTEGVVPTLPTLIPPRIMPLLH  219

Query  281  DLAQLMIRSGHQQQAFNIYR  222
            DLA  M+++GHQQQ    YR
Sbjct  220  DLATRMVQAGHQQQCLKTYR  239



>gb|KEH41922.1| exocyst subunit exo70 family protein [Medicago truncatula]
Length=633

 Score = 67.0 bits (162),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/74 (47%), Positives = 47/74 (64%), Gaps = 4/74 (5%)
 Frame = -2

Query  443  DCLFECFPQSLLPPTASPNLHVGSGTKEH-QTKSFKTADYHLPYLIPSRILLLLHDLAQL  267
            D LF+C P SL P   S   + G G K H + +S +T  + LP LIP R++ LLH+LA  
Sbjct  160  DRLFDCLPNSLRP---SAQQNAGGGGKNHPEKQSVETVTFTLPTLIPPRVIPLLHELALQ  216

Query  266  MIRSGHQQQAFNIY  225
            M+++GHQQQ F IY
Sbjct  217  MVQAGHQQQLFRIY  230



>ref|XP_010555667.1| PREDICTED: exocyst complex component EXO70A1-like [Tarenaya hassleriana]
Length=637

 Score = 67.0 bits (162),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 49/77 (64%), Gaps = 3/77 (4%)
 Frame = -2

Query  443  DCLFECFPQSLLPPTASPNLHVGSGT-KEHQTKSFKTAD--YHLPYLIPSRILLLLHDLA  273
            D LF+C P SL P + S     G  + ++HQ K  + A+  + +P +IP R++ LLHDLA
Sbjct  160  DRLFDCLPSSLRPSSDSGQSEGGGKSHQDHQLKKLENANAIFTVPTVIPPRVVPLLHDLA  219

Query  272  QLMIRSGHQQQAFNIYR  222
            Q M+++GHQQQ F  YR
Sbjct  220  QQMVQAGHQQQLFKSYR  236



>dbj|BAB10532.1| unnamed protein product [Arabidopsis thaliana]
Length=547

 Score = 66.6 bits (161),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 45/76 (59%), Gaps = 6/76 (8%)
 Frame = -2

Query  437  LFECFPQSLLPPTASPNLHVGSGTKEH--QTKSFKTADYHLPYLIPSRILLLLHDLAQLM  264
            LFEC P +L PP+       GS  K H  Q+      DY +P +IP  +L +LHDLAQ M
Sbjct  116  LFECLPSNLRPPSDDE----GSDGKSHDPQSNGLGKTDYTVPTIIPPTVLPVLHDLAQQM  171

Query  263  IRSGHQQQAFNIYR*I  216
            +++GHQQ+ F  YR I
Sbjct  172  VKAGHQQELFKTYRDI  187



>ref|NP_200048.2| exocyst subunit exo70 family protein A3 [Arabidopsis thaliana]
 gb|AED96204.1| exocyst subunit exo70 family protein A3 [Arabidopsis thaliana]
Length=586

 Score = 67.0 bits (162),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 45/76 (59%), Gaps = 6/76 (8%)
 Frame = -2

Query  437  LFECFPQSLLPPTASPNLHVGSGTKEH--QTKSFKTADYHLPYLIPSRILLLLHDLAQLM  264
            LFEC P +L PP+       GS  K H  Q+      DY +P +IP  +L +LHDLAQ M
Sbjct  116  LFECLPSNLRPPSDDE----GSDGKSHDPQSNGLGKTDYTVPTIIPPTVLPVLHDLAQQM  171

Query  263  IRSGHQQQAFNIYR*I  216
            +++GHQQ+ F  YR I
Sbjct  172  VKAGHQQELFKTYRDI  187



>ref|XP_009623413.1| PREDICTED: exocyst complex component EXO70A1-like [Nicotiana 
tomentosiformis]
Length=652

 Score = 67.0 bits (162),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 37/79 (47%), Positives = 44/79 (56%), Gaps = 5/79 (6%)
 Frame = -2

Query  443  DCLFECFPQSLLPPTASPNLHVGSG-----TKEHQTKSFKTADYHLPYLIPSRILLLLHD  279
            D LFEC P S+ P + SP     SG         +    + A +  P LIP RIL LLHD
Sbjct  164  DRLFECLPNSMRPSSGSPGHQESSGKNRLSNSNAEQNGAENAVFTPPALIPPRILPLLHD  223

Query  278  LAQLMIRSGHQQQAFNIYR  222
            LAQ MI++GHQQQ   IYR
Sbjct  224  LAQQMIQAGHQQQFVKIYR  242



>gb|KDO43038.1| hypothetical protein CISIN_1g038773mg, partial [Citrus sinensis]
Length=322

 Score = 65.9 bits (159),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 38/81 (47%), Positives = 46/81 (57%), Gaps = 7/81 (9%)
 Frame = -2

Query  443  DCLFECFPQSLLPPTASPNLHVGSGTK-------EHQTKSFKTADYHLPYLIPSRILLLL  285
            D LFEC P S+ P + SP  +  S  K       E      +TA +  P LIP RIL LL
Sbjct  164  DRLFECLPNSMRPSSGSPGHNGDSSHKSPSNHHSEQPNGDAETAVFTPPTLIPPRILPLL  223

Query  284  HDLAQLMIRSGHQQQAFNIYR  222
            HDLAQ M+++GHQQQ   IYR
Sbjct  224  HDLAQQMVQAGHQQQLQRIYR  244



>ref|XP_009349077.1| PREDICTED: exocyst complex component EXO70A1-like [Pyrus x bretschneideri]
Length=632

 Score = 66.6 bits (161),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 38/75 (51%), Positives = 44/75 (59%), Gaps = 2/75 (3%)
 Frame = -2

Query  443  DCLFECFPQSLLP-PTASPNLHVGSGTKEHQTKSFKTADYHLPYLIPSRILLLLHDLAQL  267
            D LF+C P SL P P    N   G G+ +H  KS K   Y    LIP R+L LLHDLAQ 
Sbjct  160  DRLFDCLPDSLRPDPAGQKNEASGKGS-DHPNKSLKPVIYTPLTLIPPRVLPLLHDLAQQ  218

Query  266  MIRSGHQQQAFNIYR  222
            M+ +GHQQQ F  YR
Sbjct  219  MVLAGHQQQLFRTYR  233



>ref|XP_010908201.1| PREDICTED: exocyst complex component EXO70A1-like [Elaeis guineensis]
Length=647

 Score = 66.6 bits (161),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 38/83 (46%), Positives = 46/83 (55%), Gaps = 7/83 (8%)
 Frame = -2

Query  443  DCLFECFPQSLLPPTASPNLHVGSG-------TKEHQTKSFKTADYHLPYLIPSRILLLL  285
            D LF+C P SL P + SP     SG         EHQ K+ + A Y  P LI  RIL LL
Sbjct  157  DRLFDCLPDSLRPSSGSPGKQGDSGKNPSGTSNSEHQAKNSEAAVYTPPTLIAPRILPLL  216

Query  284  HDLAQLMIRSGHQQQAFNIYR*I  216
            H LAQ ++++GHQQQ    YR I
Sbjct  217  HKLAQQLVQAGHQQQCLKNYREI  239



>ref|XP_009374086.1| PREDICTED: exocyst complex component EXO70A1-like [Pyrus x bretschneideri]
Length=633

 Score = 66.6 bits (161),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 38/75 (51%), Positives = 44/75 (59%), Gaps = 2/75 (3%)
 Frame = -2

Query  443  DCLFECFPQSLLP-PTASPNLHVGSGTKEHQTKSFKTADYHLPYLIPSRILLLLHDLAQL  267
            D LF+C P SL P P+   N   G G+ EH  K  K   Y    LIP R+L LLHDLAQ 
Sbjct  160  DRLFDCLPDSLRPDPSGQKNDAGGKGS-EHPNKGLKPVIYTPLTLIPPRVLPLLHDLAQQ  218

Query  266  MIRSGHQQQAFNIYR  222
            M+ +GHQQQ F  YR
Sbjct  219  MVLAGHQQQLFRTYR  233



>ref|XP_010059110.1| PREDICTED: exocyst complex component EXO70A1 isoform X2 [Eucalyptus 
grandis]
Length=550

 Score = 66.2 bits (160),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 44/75 (59%), Gaps = 1/75 (1%)
 Frame = -2

Query  443  DCLFECFPQSLLPPTASP-NLHVGSGTKEHQTKSFKTADYHLPYLIPSRILLLLHDLAQL  267
            D L +C P SL P + S  N    SG  EH +K+        P LIP R+L LLHDLAQ 
Sbjct  160  DLLIDCLPNSLRPSSGSSGNQSEASGKPEHPSKTPDAGVCKPPTLIPPRVLPLLHDLAQQ  219

Query  266  MIRSGHQQQAFNIYR  222
            M+++GHQQQ F  YR
Sbjct  220  MVQAGHQQQLFRTYR  234



>ref|XP_010059105.1| PREDICTED: exocyst complex component EXO70A1 isoform X1 [Eucalyptus 
grandis]
 gb|KCW90466.1| hypothetical protein EUGRSUZ_A02594 [Eucalyptus grandis]
Length=639

 Score = 66.2 bits (160),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 44/75 (59%), Gaps = 1/75 (1%)
 Frame = -2

Query  443  DCLFECFPQSLLPPTASP-NLHVGSGTKEHQTKSFKTADYHLPYLIPSRILLLLHDLAQL  267
            D L +C P SL P + S  N    SG  EH +K+        P LIP R+L LLHDLAQ 
Sbjct  160  DLLIDCLPNSLRPSSGSSGNQSEASGKPEHPSKTPDAGVCKPPTLIPPRVLPLLHDLAQQ  219

Query  266  MIRSGHQQQAFNIYR  222
            M+++GHQQQ F  YR
Sbjct  220  MVQAGHQQQLFRTYR  234



>ref|XP_007010469.1| Exocyst subunit exo70 family protein A1 [Theobroma cacao]
 gb|EOY19279.1| Exocyst subunit exo70 family protein A1 [Theobroma cacao]
Length=651

 Score = 66.2 bits (160),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 46/81 (57%), Gaps = 7/81 (9%)
 Frame = -2

Query  443  DCLFECFPQSLLPPTASPNLHVGSGTK-------EHQTKSFKTADYHLPYLIPSRILLLL  285
            D LF+  P +L P + SP     +G K       E +    +TA Y  P LIP RI+ LL
Sbjct  161  DRLFDGLPNALRPSSGSPGNQGDAGGKSTSHNHSELEKSELETAVYTPPTLIPPRIMPLL  220

Query  284  HDLAQLMIRSGHQQQAFNIYR  222
            HDLAQ M+R+GHQQQ   IY+
Sbjct  221  HDLAQQMVRAGHQQQLLRIYK  241



>ref|XP_010319288.1| PREDICTED: exocyst complex component EXO70A1 isoform X1 [Solanum 
lycopersicum]
Length=657

 Score = 66.2 bits (160),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 40/80 (50%), Positives = 47/80 (59%), Gaps = 8/80 (10%)
 Frame = -2

Query  443  DCLFECFPQSLLPPTASPNLHVGSGTKEHQTKSFKTAD------YHLPYLIPSRILLLLH  282
            D LFEC P S+ PP+ SP  H  S  K H + S    D      +  P LIP RIL LLH
Sbjct  170  DRLFECLPNSMRPPS-SPG-HQDSSGKSHLSNSNAEQDGAGNAVFTPPTLIPPRILPLLH  227

Query  281  DLAQLMIRSGHQQQAFNIYR  222
            DLAQ M+++GHQQQ   IYR
Sbjct  228  DLAQQMVQAGHQQQFIKIYR  247



>ref|XP_009792795.1| PREDICTED: exocyst complex component EXO70A1-like [Nicotiana 
sylvestris]
Length=652

 Score = 66.2 bits (160),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 36/79 (46%), Positives = 44/79 (56%), Gaps = 5/79 (6%)
 Frame = -2

Query  443  DCLFECFPQSLLPPTASPNLHVGSGTKE-----HQTKSFKTADYHLPYLIPSRILLLLHD  279
            D LFEC P S+ P + SP     SG         +    + A +  P LIP RIL LLHD
Sbjct  164  DRLFECLPNSMRPSSGSPGHQESSGKNRLSNSIAEQNGAENAVFTPPTLIPPRILPLLHD  223

Query  278  LAQLMIRSGHQQQAFNIYR  222
            LAQ M+++GHQQQ   IYR
Sbjct  224  LAQQMVQAGHQQQFVKIYR  242



>ref|XP_004236807.1| PREDICTED: exocyst complex component EXO70A1 isoform X2 [Solanum 
lycopersicum]
Length=651

 Score = 66.2 bits (160),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 40/80 (50%), Positives = 47/80 (59%), Gaps = 8/80 (10%)
 Frame = -2

Query  443  DCLFECFPQSLLPPTASPNLHVGSGTKEHQTKSFKTAD------YHLPYLIPSRILLLLH  282
            D LFEC P S+ PP+ SP  H  S  K H + S    D      +  P LIP RIL LLH
Sbjct  170  DRLFECLPNSMRPPS-SPG-HQDSSGKSHLSNSNAEQDGAGNAVFTPPTLIPPRILPLLH  227

Query  281  DLAQLMIRSGHQQQAFNIYR  222
            DLAQ M+++GHQQQ   IYR
Sbjct  228  DLAQQMVQAGHQQQFIKIYR  247



>ref|XP_009624114.1| PREDICTED: exocyst complex component EXO70A1-like [Nicotiana 
tomentosiformis]
Length=656

 Score = 66.2 bits (160),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 37/77 (48%), Positives = 44/77 (57%), Gaps = 6/77 (8%)
 Frame = -2

Query  437  LFECFPQSLLPPTASPNL-----HVGSGTKEHQTKSFKTADYHLPYLIPSRILLLLHDLA  273
            LFEC P S+ P + SP       H+ S   EH   +  T  Y  P LIP RIL LLHDL 
Sbjct  172  LFECLPNSMRPSSGSPGESNGKNHLSSSHAEHNNGTDNTV-YTPPTLIPPRILPLLHDLV  230

Query  272  QLMIRSGHQQQAFNIYR  222
            Q M+++GHQQQ   IYR
Sbjct  231  QQMVQAGHQQQLVKIYR  247



>ref|XP_010246859.1| PREDICTED: exocyst complex component EXO70A1-like isoform X2 
[Nelumbo nucifera]
Length=648

 Score = 66.2 bits (160),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 37/81 (46%), Positives = 45/81 (56%), Gaps = 8/81 (10%)
 Frame = -2

Query  443  DCLFECFPQSLLPPTASPNLHVGSGTK-------EHQTKSFKTADYHLPYLIPSRILLLL  285
            D LFE  P S+ P + SP  H G G         E Q K  + A Y  P LIP RIL LL
Sbjct  160  DRLFEGLPNSMRPSSGSPG-HQGDGMNPSSNNHPEQQNKGVENAVYTPPTLIPPRILPLL  218

Query  284  HDLAQLMIRSGHQQQAFNIYR  222
            HDLAQ ++++GH+QQ    YR
Sbjct  219  HDLAQQLVQAGHRQQLIKTYR  239



>gb|KHG26941.1| Exocyst complex component 7 [Gossypium arboreum]
Length=650

 Score = 66.2 bits (160),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 45/81 (56%), Gaps = 7/81 (9%)
 Frame = -2

Query  443  DCLFECFPQSLLPPTASPNLHVGSGTK-------EHQTKSFKTADYHLPYLIPSRILLLL  285
            D LF+  P SL P + SP      G +       EHQ    +TA Y  P LIP RI+ LL
Sbjct  161  DRLFDGLPNSLRPSSGSPGNQGEPGGRGPSHNHSEHQNVDLETAVYTPPTLIPPRIMPLL  220

Query  284  HDLAQLMIRSGHQQQAFNIYR  222
            HDLA+ M+R+GH QQ   IY+
Sbjct  221  HDLAKQMVRAGHNQQLLKIYK  241



>ref|XP_010246852.1| PREDICTED: exocyst complex component EXO70A1-like isoform X1 
[Nelumbo nucifera]
Length=664

 Score = 66.2 bits (160),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 37/81 (46%), Positives = 45/81 (56%), Gaps = 8/81 (10%)
 Frame = -2

Query  443  DCLFECFPQSLLPPTASPNLHVGSGTK-------EHQTKSFKTADYHLPYLIPSRILLLL  285
            D LFE  P S+ P + SP  H G G         E Q K  + A Y  P LIP RIL LL
Sbjct  160  DRLFEGLPNSMRPSSGSPG-HQGDGMNPSSNNHPEQQNKGVENAVYTPPTLIPPRILPLL  218

Query  284  HDLAQLMIRSGHQQQAFNIYR  222
            HDLAQ ++++GH+QQ    YR
Sbjct  219  HDLAQQLVQAGHRQQLIKTYR  239



>ref|XP_009758704.1| PREDICTED: exocyst complex component EXO70A1-like [Nicotiana 
sylvestris]
Length=656

 Score = 65.9 bits (159),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 37/77 (48%), Positives = 44/77 (57%), Gaps = 6/77 (8%)
 Frame = -2

Query  437  LFECFPQSLLPPTASPNL-----HVGSGTKEHQTKSFKTADYHLPYLIPSRILLLLHDLA  273
            LFEC P S+ P + SP       H+ S   EH   +  T  Y  P LIP RIL LLHDL 
Sbjct  172  LFECLPNSMRPSSGSPGDSNGKNHLSSSHAEHNNGTDNTV-YTPPTLIPPRILPLLHDLV  230

Query  272  QLMIRSGHQQQAFNIYR  222
            Q M+++GHQQQ   IYR
Sbjct  231  QQMVQAGHQQQLVKIYR  247



>gb|KCW50565.1| hypothetical protein EUGRSUZ_J00280 [Eucalyptus grandis]
Length=581

 Score = 65.9 bits (159),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 38/81 (47%), Positives = 43/81 (53%), Gaps = 7/81 (9%)
 Frame = -2

Query  443  DCLFECFPQSLLPPTASPNLHVGSGT-------KEHQTKSFKTADYHLPYLIPSRILLLL  285
            D LFEC P SL P T SP     SG         +H   + + A Y  P LIP RIL LL
Sbjct  161  DRLFECLPSSLRPSTGSPGHQGDSGGTNPSHAHSDHHNGNLENAVYTPPTLIPPRILPLL  220

Query  284  HDLAQLMIRSGHQQQAFNIYR  222
            HDLAQ M+ +G QQQ    YR
Sbjct  221  HDLAQQMVHAGDQQQLLKDYR  241



>ref|XP_010031304.1| PREDICTED: exocyst complex component EXO70A1 [Eucalyptus grandis]
 gb|KCW50564.1| hypothetical protein EUGRSUZ_J00280 [Eucalyptus grandis]
Length=651

 Score = 65.9 bits (159),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 38/81 (47%), Positives = 43/81 (53%), Gaps = 7/81 (9%)
 Frame = -2

Query  443  DCLFECFPQSLLPPTASPNLHVGSGT-------KEHQTKSFKTADYHLPYLIPSRILLLL  285
            D LFEC P SL P T SP     SG         +H   + + A Y  P LIP RIL LL
Sbjct  161  DRLFECLPSSLRPSTGSPGHQGDSGGTNPSHAHSDHHNGNLENAVYTPPTLIPPRILPLL  220

Query  284  HDLAQLMIRSGHQQQAFNIYR  222
            HDLAQ M+ +G QQQ    YR
Sbjct  221  HDLAQQMVHAGDQQQLLKDYR  241



>gb|KDP22763.1| hypothetical protein JCGZ_01980 [Jatropha curcas]
Length=647

 Score = 65.9 bits (159),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 36/76 (47%), Positives = 44/76 (58%), Gaps = 3/76 (4%)
 Frame = -2

Query  443  DCLFECFPQSLLPPTASPNLHVGS---GTKEHQTKSFKTADYHLPYLIPSRILLLLHDLA  273
            D LFEC P+S+ P + SP  H G       E    S +T  +    LIP RIL LLHDLA
Sbjct  161  DRLFECLPESMQPSSGSPANHNGGKHHNHSEQHNDSSETGGFKHLTLIPPRILPLLHDLA  220

Query  272  QLMIRSGHQQQAFNIY  225
            Q M+++GHQQQ   IY
Sbjct  221  QQMVQAGHQQQLHKIY  236



>ref|XP_008360595.1| PREDICTED: exocyst complex component EXO70A1-like [Malus domestica]
Length=633

 Score = 65.5 bits (158),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 35/74 (47%), Positives = 40/74 (54%), Gaps = 0/74 (0%)
 Frame = -2

Query  443  DCLFECFPQSLLPPTASPNLHVGSGTKEHQTKSFKTADYHLPYLIPSRILLLLHDLAQLM  264
            D LF+C P SL P  A           +H  KS K   Y    LIP R+L LLHDLAQ M
Sbjct  160  DRLFDCLPDSLRPDXAGQKNEASGKGSDHPNKSLKPVIYTPLTLIPPRVLPLLHDLAQQM  219

Query  263  IRSGHQQQAFNIYR  222
            + +GHQQQ F  YR
Sbjct  220  VLAGHQQQLFRTYR  233



>ref|XP_006445773.1| hypothetical protein CICLE_v10014543mg [Citrus clementina]
 ref|XP_006445774.1| hypothetical protein CICLE_v10014543mg [Citrus clementina]
 ref|XP_006485471.1| PREDICTED: exocyst complex component EXO70A1-like [Citrus sinensis]
 gb|ESR59013.1| hypothetical protein CICLE_v10014543mg [Citrus clementina]
 gb|ESR59014.1| hypothetical protein CICLE_v10014543mg [Citrus clementina]
Length=654

 Score = 65.5 bits (158),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 38/81 (47%), Positives = 46/81 (57%), Gaps = 7/81 (9%)
 Frame = -2

Query  443  DCLFECFPQSLLPPTASPNLHVGSGTK-------EHQTKSFKTADYHLPYLIPSRILLLL  285
            D LFEC P S+ P + SP  +  S  K       E      +TA +  P LIP RIL LL
Sbjct  164  DRLFECLPNSMRPSSGSPGHNGDSSHKSPSNHHSEQPNGDAETAVFTPPTLIPPRILPLL  223

Query  284  HDLAQLMIRSGHQQQAFNIYR  222
            HDLAQ M+++GHQQQ   IYR
Sbjct  224  HDLAQQMVQAGHQQQLQRIYR  244



>ref|XP_002315422.2| exocyst subunit EXO70 family protein [Populus trichocarpa]
 gb|EEF01593.2| exocyst subunit EXO70 family protein [Populus trichocarpa]
Length=647

 Score = 65.1 bits (157),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 45/76 (59%), Gaps = 2/76 (3%)
 Frame = -2

Query  443  DCLFECFPQSLLPPTASPNLHVGSGTK--EHQTKSFKTADYHLPYLIPSRILLLLHDLAQ  270
            D LFEC P+S+ P + SP    G      EHQ  + +T  +    LIP RIL LLHDLA 
Sbjct  161  DRLFECLPESMRPSSESPGNPFGGKNNHHEHQNGTSETGGFKHLTLIPPRILPLLHDLAL  220

Query  269  LMIRSGHQQQAFNIYR  222
             M+++G+QQQ   IYR
Sbjct  221  QMVQAGNQQQLLRIYR  236



>ref|XP_010442761.1| PREDICTED: exocyst complex component EXO70A1-like [Camelina sativa]
Length=633

 Score = 65.1 bits (157),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 33/74 (45%), Positives = 45/74 (61%), Gaps = 0/74 (0%)
 Frame = -2

Query  443  DCLFECFPQSLLPPTASPNLHVGSGTKEHQTKSFKTADYHLPYLIPSRILLLLHDLAQLM  264
            D LFEC P +L P +       G  + +   KS + A + +P +IP R+L LLHDLAQ M
Sbjct  160  DRLFECLPSNLRPSSEGEGGGGGGKSHDPHHKSLENAIFTVPTVIPPRVLPLLHDLAQQM  219

Query  263  IRSGHQQQAFNIYR  222
            +++GHQQQ F  YR
Sbjct  220  VQAGHQQQLFKTYR  233



>ref|XP_010444749.1| PREDICTED: exocyst complex component EXO70A1-like [Camelina sativa]
Length=633

 Score = 65.1 bits (157),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 33/74 (45%), Positives = 45/74 (61%), Gaps = 0/74 (0%)
 Frame = -2

Query  443  DCLFECFPQSLLPPTASPNLHVGSGTKEHQTKSFKTADYHLPYLIPSRILLLLHDLAQLM  264
            D LFEC P +L P +       G  + +   KS + A + +P +IP R+L LLHDLAQ M
Sbjct  160  DRLFECLPSNLRPSSEGEGGGGGGKSHDPHHKSLENAIFTVPTVIPPRVLPLLHDLAQQM  219

Query  263  IRSGHQQQAFNIYR  222
            +++GHQQQ F  YR
Sbjct  220  VQAGHQQQLFKTYR  233



>ref|XP_004303435.1| PREDICTED: exocyst complex component 7-like [Fragaria vesca subsp. 
vesca]
Length=631

 Score = 65.1 bits (157),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 36/74 (49%), Positives = 44/74 (59%), Gaps = 1/74 (1%)
 Frame = -2

Query  443  DCLFECFPQSLLPPTASPNLHVGSGTKEHQTKSFKTADYHLPYLIPSRILLLLHDLAQLM  264
            D LF+C P SL  P+A  +   G+G  E Q +  +   Y    LIP R+L LLHDLAQ M
Sbjct  160  DRLFDCLPDSL-RPSADQSKGDGNGKSEQQQRRLQPVIYTPLTLIPPRVLPLLHDLAQQM  218

Query  263  IRSGHQQQAFNIYR  222
              +GHQQQ F IYR
Sbjct  219  ALAGHQQQLFKIYR  232



>ref|XP_004978733.1| PREDICTED: exocyst complex component 7-like isoform X1 [Setaria 
italica]
Length=637

 Score = 64.7 bits (156),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 47/74 (64%), Gaps = 1/74 (1%)
 Frame = -2

Query  443  DCLFECFPQSLLPPTASPNLHVGSGTKEHQTKSFKTADYHLPYLIPSRILLLLHDLAQLM  264
            D LF+C P+SL P         GS + +H +K  +TA Y  P L+P RIL L++D+AQ +
Sbjct  163  DRLFDCLPKSLRPTKGDHETDGGSRS-DHPSKGLETAIYRTPTLVPPRILPLMNDIAQQL  221

Query  263  IRSGHQQQAFNIYR  222
            +++G+QQ  + IYR
Sbjct  222  VQAGNQQSCYKIYR  235



>ref|XP_010942405.1| PREDICTED: exocyst complex component EXO70A1-like [Elaeis guineensis]
Length=647

 Score = 64.7 bits (156),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 34/80 (43%), Positives = 45/80 (56%), Gaps = 7/80 (9%)
 Frame = -2

Query  443  DCLFECFPQSLLPPTASPNLH-------VGSGTKEHQTKSFKTADYHLPYLIPSRILLLL  285
            D LF+C P +L P + SP          +G+   EHQ K+ +TA Y  P LI  RIL LL
Sbjct  157  DRLFDCLPDALRPSSGSPGQQGDSDKNPLGTNNSEHQAKNLETAVYTPPVLIAPRILPLL  216

Query  284  HDLAQLMIRSGHQQQAFNIY  225
              LAQ ++++GHQ Q   IY
Sbjct  217  RKLAQQLVQAGHQHQCLKIY  236



>ref|XP_010490839.1| PREDICTED: exocyst complex component EXO70A1 isoform X2 [Camelina 
sativa]
Length=525

 Score = 64.3 bits (155),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 43/75 (57%), Gaps = 6/75 (8%)
 Frame = -2

Query  443  DCLFECFPQSLLPPTASPNLHVGSGT--KEHQTKSFKTADYHLPYLIPSRILLLLHDLAQ  270
            D LF+  P SL P +       G G     H     +TA Y LP LIPSR+L LLHDLAQ
Sbjct  45   DRLFDGLPNSLRPSSDGD----GGGKPHGAHHNDESETASYTLPILIPSRVLPLLHDLAQ  100

Query  269  LMIRSGHQQQAFNIY  225
             M+++GHQQQ   IY
Sbjct  101  QMVQAGHQQQLLQIY  115



>ref|XP_010452234.1| PREDICTED: exocyst complex component EXO70A1 [Camelina sativa]
Length=640

 Score = 64.3 bits (155),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 43/75 (57%), Gaps = 6/75 (8%)
 Frame = -2

Query  443  DCLFECFPQSLLPPTASPNLHVGSGT--KEHQTKSFKTADYHLPYLIPSRILLLLHDLAQ  270
            D LF+  P SL P +       G G     H     +TA Y LP LIPSR+L LLHDLAQ
Sbjct  160  DRLFDGLPNSLRPSSDGD----GGGKPHGAHHNDDTETASYTLPILIPSRVLPLLHDLAQ  215

Query  269  LMIRSGHQQQAFNIY  225
             M+++GHQQQ   IY
Sbjct  216  QMVQAGHQQQLLQIY  230



>ref|XP_010423699.1| PREDICTED: exocyst complex component EXO70A1-like [Camelina sativa]
 ref|XP_010490838.1| PREDICTED: exocyst complex component EXO70A1 isoform X1 [Camelina 
sativa]
Length=640

 Score = 64.3 bits (155),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 43/75 (57%), Gaps = 6/75 (8%)
 Frame = -2

Query  443  DCLFECFPQSLLPPTASPNLHVGSGT--KEHQTKSFKTADYHLPYLIPSRILLLLHDLAQ  270
            D LF+  P SL P +       G G     H     +TA Y LP LIPSR+L LLHDLAQ
Sbjct  160  DRLFDGLPNSLRPSSDGD----GGGKPHGAHHNDESETASYTLPILIPSRVLPLLHDLAQ  215

Query  269  LMIRSGHQQQAFNIY  225
             M+++GHQQQ   IY
Sbjct  216  QMVQAGHQQQLLQIY  230



>ref|XP_002450318.1| hypothetical protein SORBIDRAFT_05g003650 [Sorghum bicolor]
 gb|EES09306.1| hypothetical protein SORBIDRAFT_05g003650 [Sorghum bicolor]
Length=636

 Score = 64.3 bits (155),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 46/74 (62%), Gaps = 2/74 (3%)
 Frame = -2

Query  443  DCLFECFPQSLLPPTASPNLHVGSGTKEHQTKSFKTADYHLPYLIPSRILLLLHDLAQLM  264
            D LF+C P+SL P     +   G    +H +K  +TA Y  P LIP RIL L++D+AQ +
Sbjct  163  DRLFDCLPKSLRPTKG--DHEDGGSNSDHPSKGLETAVYRTPTLIPPRILPLMNDIAQQL  220

Query  263  IRSGHQQQAFNIYR  222
            +++G+QQ  + IYR
Sbjct  221  VQAGNQQTCYKIYR  234



>ref|XP_008798863.1| PREDICTED: exocyst complex component EXO70A1-like [Phoenix dactylifera]
Length=647

 Score = 64.3 bits (155),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 34/80 (43%), Positives = 44/80 (55%), Gaps = 7/80 (9%)
 Frame = -2

Query  443  DCLFECFPQSLLPPTASPNLH-------VGSGTKEHQTKSFKTADYHLPYLIPSRILLLL  285
            D LF+C P +L P + SP           G+   EHQ K+ +TA Y  P LI  RIL LL
Sbjct  157  DRLFDCLPDALRPSSGSPGQQRDSDKNPTGTNNSEHQAKNLETAVYTPPTLIAPRILPLL  216

Query  284  HDLAQLMIRSGHQQQAFNIY  225
              LAQ ++++GHQ Q   IY
Sbjct  217  RKLAQQLVQAGHQHQCLKIY  236



>gb|AEI26267.1| Exo70A1 [Brassica oleracea var. viridis]
Length=638

 Score = 63.9 bits (154),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 35/74 (47%), Positives = 41/74 (55%), Gaps = 2/74 (3%)
 Frame = -2

Query  443  DCLFECFPQSLLPPTASPNLHVGSGTKEHQTKSFKTADYHLPYLIPSRILLLLHDLAQLM  264
            D LF+  P SL P         G     H     +TA Y LP LIPSR+L LLHDLAQ M
Sbjct  160  DRLFDGLPNSLRPSADGEG--NGKSHGGHHNDDSETAAYTLPVLIPSRVLPLLHDLAQQM  217

Query  263  IRSGHQQQAFNIYR  222
            +++GHQQ    IYR
Sbjct  218  VQAGHQQMLLQIYR  231



>ref|XP_008375555.1| PREDICTED: exocyst complex component EXO70A1-like isoform X2 
[Malus domestica]
Length=583

 Score = 63.5 bits (153),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 38/80 (48%), Positives = 45/80 (56%), Gaps = 8/80 (10%)
 Frame = -2

Query  437  LFECFPQSLLPPTASP-NLHVGSGTK-------EHQTKSFKTADYHLPYLIPSRILLLLH  282
            LF+C P SL P + SP N    SG         EH   + + A Y  P LIP R+L LLH
Sbjct  165  LFDCLPNSLRPSSGSPGNQGDYSGKNPSSNHHPEHHNSNLENAVYTPPALIPPRVLPLLH  224

Query  281  DLAQLMIRSGHQQQAFNIYR  222
            DLAQ M ++GHQQQ   IYR
Sbjct  225  DLAQQMFQAGHQQQLLIIYR  244



>ref|NP_001147814.1| protein binding protein [Zea mays]
 gb|ACG28783.1| protein binding protein [Zea mays]
Length=634

 Score = 63.5 bits (153),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 44/74 (59%), Gaps = 3/74 (4%)
 Frame = -2

Query  443  DCLFECFPQSLLPPTASPNLHVGSGTKEHQTKSFKTADYHLPYLIPSRILLLLHDLAQLM  264
            D LF+C P+SL P       H   G   H +K  + A Y  P LIP RIL L++D+AQ +
Sbjct  162  DRLFDCLPKSLRPTKGD---HESDGGSHHPSKGLEAAVYRTPTLIPPRILPLMNDIAQQL  218

Query  263  IRSGHQQQAFNIYR  222
            +++G+QQ  + IYR
Sbjct  219  VQAGNQQTCYKIYR  232



>ref|XP_010695091.1| PREDICTED: exocyst complex component EXO70A1-like [Beta vulgaris 
subsp. vulgaris]
Length=653

 Score = 63.5 bits (153),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 43/75 (57%), Gaps = 1/75 (1%)
 Frame = -2

Query  443  DCLFECFPQSLLPPTASPNLHVGSGTKEH-QTKSFKTADYHLPYLIPSRILLLLHDLAQL  267
            D LFEC P S+ P + S       G K H  +K  + A Y  P LIP RIL LLH+LAQ 
Sbjct  168  DRLFECLPNSMRPSSGSHGDQADPGAKNHGDSKPSENAVYTPPALIPPRILPLLHNLAQQ  227

Query  266  MIRSGHQQQAFNIYR  222
            M+ +G+ QQ   IYR
Sbjct  228  MVEAGNHQQVNKIYR  242



>ref|XP_004249947.1| PREDICTED: exocyst complex component EXO70A1-like [Solanum lycopersicum]
Length=658

 Score = 63.5 bits (153),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 38/79 (48%), Positives = 45/79 (57%), Gaps = 8/79 (10%)
 Frame = -2

Query  437  LFECFPQSLLPPTASPNL-------HVGSGTKEHQTKSFKTADYHLPYLIPSRILLLLHD  279
            LFEC P S+ P T SP         H+ S   EH   +  T  Y  P LIP RIL LLHD
Sbjct  172  LFECLPTSMRPSTGSPGDQDSSSKNHLPSSHGEHNHGTDDTV-YTPPALIPPRILPLLHD  230

Query  278  LAQLMIRSGHQQQAFNIYR  222
            L+Q M+++GHQQQ   IYR
Sbjct  231  LSQQMVQAGHQQQLVKIYR  249



>gb|EMT29261.1| Exocyst complex component 7 [Aegilops tauschii]
Length=656

 Score = 63.5 bits (153),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 47/74 (64%), Gaps = 2/74 (3%)
 Frame = -2

Query  443  DCLFECFPQSLLPPTASPNLHVGSGTKEHQTKSFKTADYHLPYLIPSRILLLLHDLAQLM  264
            D LF+C P+SL P     + +      +H +K  +TA Y +P L+P RIL L++D+AQ +
Sbjct  163  DRLFDCLPKSLRPSKDDEDENANQS--DHPSKGLETAVYKIPTLVPPRILPLMNDIAQQL  220

Query  263  IRSGHQQQAFNIYR  222
            +++G+QQ  + IYR
Sbjct  221  VQAGNQQSCYKIYR  234



>ref|XP_006365689.1| PREDICTED: exocyst complex component 7-like [Solanum tuberosum]
Length=658

 Score = 63.5 bits (153),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 38/79 (48%), Positives = 45/79 (57%), Gaps = 8/79 (10%)
 Frame = -2

Query  437  LFECFPQSLLPPTASPNL-------HVGSGTKEHQTKSFKTADYHLPYLIPSRILLLLHD  279
            LFEC P S+ P T SP         H+ S   EH   +  T  Y  P LIP RIL LLHD
Sbjct  172  LFECLPTSMRPSTGSPGDQDSSNKNHLPSSHGEHNHGTDDTV-YTPPTLIPPRILPLLHD  230

Query  278  LAQLMIRSGHQQQAFNIYR  222
            L+Q M+++GHQQQ   IYR
Sbjct  231  LSQQMVQAGHQQQLVKIYR  249



>ref|XP_008375553.1| PREDICTED: exocyst complex component EXO70A1-like isoform X1 
[Malus domestica]
Length=654

 Score = 63.5 bits (153),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 38/80 (48%), Positives = 45/80 (56%), Gaps = 8/80 (10%)
 Frame = -2

Query  437  LFECFPQSLLPPTASP-NLHVGSGTK-------EHQTKSFKTADYHLPYLIPSRILLLLH  282
            LF+C P SL P + SP N    SG         EH   + + A Y  P LIP R+L LLH
Sbjct  165  LFDCLPNSLRPSSGSPGNQGDYSGKNPSSNHHPEHHNSNLENAVYTPPALIPPRVLPLLH  224

Query  281  DLAQLMIRSGHQQQAFNIYR  222
            DLAQ M ++GHQQQ   IYR
Sbjct  225  DLAQQMFQAGHQQQLLIIYR  244



>ref|XP_010482595.1| PREDICTED: exocyst complex component EXO70A1-like [Camelina sativa]
Length=632

 Score = 63.5 bits (153),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 34/74 (46%), Positives = 44/74 (59%), Gaps = 1/74 (1%)
 Frame = -2

Query  443  DCLFECFPQSLLPPTASPNLHVGSGTKEHQTKSFKTADYHLPYLIPSRILLLLHDLAQLM  264
            D LFEC P +L P +       G     H  KS + A + +P +IP R+L LLHDLAQ M
Sbjct  160  DRLFECLPSNLRPSSEGEGGGGGKSHDPHH-KSLENAIFTVPTVIPPRVLPLLHDLAQQM  218

Query  263  IRSGHQQQAFNIYR  222
            +++GHQQQ F  YR
Sbjct  219  VQAGHQQQLFKTYR  232



>gb|ACV92697.1| exocyst subunit EXO70 A1 [Brassica napus]
 emb|CDY10374.1| BnaCnng02750D [Brassica napus]
Length=638

 Score = 63.5 bits (153),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 35/74 (47%), Positives = 41/74 (55%), Gaps = 2/74 (3%)
 Frame = -2

Query  443  DCLFECFPQSLLPPTASPNLHVGSGTKEHQTKSFKTADYHLPYLIPSRILLLLHDLAQLM  264
            D LF+  P SL P         G     H     +TA Y LP LIPSR+L LLHDLAQ M
Sbjct  160  DRLFDGLPNSLRPSADGEG--NGKAHGGHHNDDSETAAYTLPVLIPSRVLPLLHDLAQQM  217

Query  263  IRSGHQQQAFNIYR  222
            +++GHQQ    IYR
Sbjct  218  VQAGHQQLLLQIYR  231



>gb|AGC65586.1| exocyst subunit EXO70A1 [Brassica rapa subsp. chinensis]
Length=638

 Score = 63.5 bits (153),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 35/74 (47%), Positives = 41/74 (55%), Gaps = 2/74 (3%)
 Frame = -2

Query  443  DCLFECFPQSLLPPTASPNLHVGSGTKEHQTKSFKTADYHLPYLIPSRILLLLHDLAQLM  264
            D LF+  P SL P         G     H     +TA Y LP LIPSR+L LLHDLAQ M
Sbjct  160  DRLFDGLPNSLRPSADGEG--NGKAHGGHHNDDSETAAYTLPVLIPSRVLPLLHDLAQQM  217

Query  263  IRSGHQQQAFNIYR  222
            +++GHQQ    IYR
Sbjct  218  VQAGHQQLLLQIYR  231



>ref|XP_009122692.1| PREDICTED: exocyst complex component EXO70A1 [Brassica rapa]
Length=638

 Score = 63.2 bits (152),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 35/74 (47%), Positives = 41/74 (55%), Gaps = 2/74 (3%)
 Frame = -2

Query  443  DCLFECFPQSLLPPTASPNLHVGSGTKEHQTKSFKTADYHLPYLIPSRILLLLHDLAQLM  264
            D LF+  P SL P         G     H     +TA Y LP LIPSR+L LLHDLAQ M
Sbjct  160  DRLFDGLPNSLRPSADGEG--NGKAHGGHHNDDSETAAYTLPVLIPSRVLPLLHDLAQQM  217

Query  263  IRSGHQQQAFNIYR  222
            +++GHQQ    IYR
Sbjct  218  VQAGHQQLLLQIYR  231



>emb|CDX70300.1| BnaA10g26490D [Brassica napus]
Length=632

 Score = 63.2 bits (152),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 35/74 (47%), Positives = 41/74 (55%), Gaps = 2/74 (3%)
 Frame = -2

Query  443  DCLFECFPQSLLPPTASPNLHVGSGTKEHQTKSFKTADYHLPYLIPSRILLLLHDLAQLM  264
            D LF+  P SL P         G     H     +TA Y LP LIPSR+L LLHDLAQ M
Sbjct  154  DRLFDGLPNSLRPSADGEG--NGKAHGGHHNDDSETAAYTLPVLIPSRVLPLLHDLAQQM  211

Query  263  IRSGHQQQAFNIYR  222
            +++GHQQ    IYR
Sbjct  212  VQAGHQQLLLQIYR  225



>ref|XP_006280174.1| hypothetical protein CARUB_v10026076mg [Capsella rubella]
 gb|EOA13072.1| hypothetical protein CARUB_v10026076mg [Capsella rubella]
Length=631

 Score = 63.2 bits (152),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 34/74 (46%), Positives = 43/74 (58%), Gaps = 2/74 (3%)
 Frame = -2

Query  443  DCLFECFPQSLLPPTASPNLHVGSGTKEHQTKSFKTADYHLPYLIPSRILLLLHDLAQLM  264
            D LFEC P +L P          S    H  KS + A + +P +IP R+L LLHDLAQ M
Sbjct  160  DRLFECLPSNLRPSPEGEGGGGKSHDPHH--KSLENAIFTVPTVIPPRVLPLLHDLAQQM  217

Query  263  IRSGHQQQAFNIYR  222
            +++GHQQQ F  YR
Sbjct  218  VQAGHQQQLFKTYR  231



>ref|XP_008677197.1| PREDICTED: protein binding protein isoform X1 [Zea mays]
Length=634

 Score = 63.2 bits (152),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 44/74 (59%), Gaps = 3/74 (4%)
 Frame = -2

Query  443  DCLFECFPQSLLPPTASPNLHVGSGTKEHQTKSFKTADYHLPYLIPSRILLLLHDLAQLM  264
            D LF+C P+SL P       H   G   H +K  + A Y  P LIP RIL L++D+AQ +
Sbjct  162  DRLFDCLPKSLRPTKGD---HETDGGSHHPSKGLEAAVYRTPTLIPPRILPLMNDIAQQL  218

Query  263  IRSGHQQQAFNIYR  222
            +++G+QQ  + IYR
Sbjct  219  VQAGNQQTCYKIYR  232



>ref|XP_011024156.1| PREDICTED: exocyst complex component EXO70A1-like isoform X1 
[Populus euphratica]
Length=647

 Score = 63.2 bits (152),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 36/76 (47%), Positives = 46/76 (61%), Gaps = 2/76 (3%)
 Frame = -2

Query  443  DCLFECFPQSLLPPTASP-NLHVGSGTK-EHQTKSFKTADYHLPYLIPSRILLLLHDLAQ  270
            D LFEC P+S+ P + SP N   G     EHQ  + +T  +    LIP RIL LLHDLA 
Sbjct  161  DRLFECLPESMRPSSESPGNPFSGKNNHHEHQNGASETGGFKHLTLIPPRILPLLHDLAL  220

Query  269  LMIRSGHQQQAFNIYR  222
             M+++G+QQQ   IYR
Sbjct  221  QMVQAGNQQQLLRIYR  236



>ref|XP_002864165.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH40424.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=631

 Score = 63.2 bits (152),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 34/74 (46%), Positives = 44/74 (59%), Gaps = 2/74 (3%)
 Frame = -2

Query  443  DCLFECFPQSLLPPTASPNLHVGSGTKEHQTKSFKTADYHLPYLIPSRILLLLHDLAQLM  264
            D LFEC P +L P +        S    H  KS + A + +P +IP R+L LLHDLAQ M
Sbjct  160  DRLFECLPSNLRPSSEGEGGGGKSHDPHH--KSLENAIFTVPTVIPPRVLPLLHDLAQQM  217

Query  263  IRSGHQQQAFNIYR  222
            +++GHQQQ F  YR
Sbjct  218  VQAGHQQQLFKSYR  231



>gb|EPS69172.1| hypothetical protein M569_05594, partial [Genlisea aurea]
Length=449

 Score = 62.8 bits (151),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 44/79 (56%), Gaps = 5/79 (6%)
 Frame = -2

Query  437  LFECFPQSLLPPTASPNLHVG-----SGTKEHQTKSFKTADYHLPYLIPSRILLLLHDLA  273
            LFEC P S+ P + S     G     +G  +H   S + + Y  P LIP RIL LLHDLA
Sbjct  172  LFECLPNSMRPSSGSAGDSAGKILPSNGHADHSNHSTENSVYTTPTLIPPRILPLLHDLA  231

Query  272  QLMIRSGHQQQAFNIYR*I  216
            Q M+ + +QQQ   IYR I
Sbjct  232  QQMVEASNQQQLQRIYRDI  250



>ref|XP_011024157.1| PREDICTED: exocyst complex component EXO70A1-like isoform X2 
[Populus euphratica]
Length=594

 Score = 62.8 bits (151),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 36/76 (47%), Positives = 46/76 (61%), Gaps = 2/76 (3%)
 Frame = -2

Query  443  DCLFECFPQSLLPPTASP-NLHVGSGTK-EHQTKSFKTADYHLPYLIPSRILLLLHDLAQ  270
            D LFEC P+S+ P + SP N   G     EHQ  + +T  +    LIP RIL LLHDLA 
Sbjct  108  DRLFECLPESMRPSSESPGNPFSGKNNHHEHQNGASETGGFKHLTLIPPRILPLLHDLAL  167

Query  269  LMIRSGHQQQAFNIYR  222
             M+++G+QQQ   IYR
Sbjct  168  QMVQAGNQQQLLRIYR  183



>ref|XP_010554525.1| PREDICTED: exocyst complex component EXO70A1 isoform X1 [Tarenaya 
hassleriana]
Length=647

 Score = 62.8 bits (151),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 36/78 (46%), Positives = 45/78 (58%), Gaps = 7/78 (9%)
 Frame = -2

Query  443  DCLFECFPQSLLPPTASPNLHVGSGTK----EHQTKSFKTADYHLPYLIPSRILLLLHDL  276
            D LF+  P SL P   S +   G  T     +H     +TA Y LP LIP R+L LLHDL
Sbjct  162  DQLFDGLPNSLRP---SSDQDGGGKTSHSHTDHHNNDSETASYTLPTLIPPRVLPLLHDL  218

Query  275  AQLMIRSGHQQQAFNIYR  222
            AQ M+++GHQQQ   IY+
Sbjct  219  AQQMVQAGHQQQLLKIYK  236



>ref|NP_195974.2| exocyst subunit exo70 family protein A1 [Arabidopsis thaliana]
 sp|Q9LZD3.1|E70A1_ARATH RecName: Full=Exocyst complex component EXO70A1; Short=AtExo70a1; 
AltName: Full=Exocyst subunit Exo70 family protein A1 [Arabidopsis 
thaliana]
 emb|CAB83315.1| putative protein [Arabidopsis thaliana]
 gb|AAL59977.1| unknown protein [Arabidopsis thaliana]
 gb|AAM91685.1| unknown protein [Arabidopsis thaliana]
 gb|AED90620.1| exocyst subunit exo70 family protein A1 [Arabidopsis thaliana]
Length=638

 Score = 62.8 bits (151),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 37/74 (50%), Positives = 44/74 (59%), Gaps = 2/74 (3%)
 Frame = -2

Query  443  DCLFECFPQSLLPPTASPNLHVGSGTKEHQTKSFKTADYHLPYLIPSRILLLLHDLAQLM  264
            D LF+  P SL P  +S     G     H     +TA Y LP LIPSR+L LLHDLAQ M
Sbjct  160  DRLFDGLPNSLRP--SSDGDGGGKPHGGHHNDDAETAAYTLPILIPSRVLPLLHDLAQQM  217

Query  263  IRSGHQQQAFNIYR  222
            +++GHQQQ   IYR
Sbjct  218  VQAGHQQQLLQIYR  231



>ref|XP_010554528.1| PREDICTED: exocyst complex component EXO70A1 isoform X3 [Tarenaya 
hassleriana]
Length=564

 Score = 62.8 bits (151),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 36/78 (46%), Positives = 45/78 (58%), Gaps = 7/78 (9%)
 Frame = -2

Query  443  DCLFECFPQSLLPPTASPNLHVGSGTK----EHQTKSFKTADYHLPYLIPSRILLLLHDL  276
            D LF+  P SL P   S +   G  T     +H     +TA Y LP LIP R+L LLHDL
Sbjct  79   DQLFDGLPNSLRP---SSDQDGGGKTSHSHTDHHNNDSETASYTLPTLIPPRVLPLLHDL  135

Query  275  AQLMIRSGHQQQAFNIYR  222
            AQ M+++GHQQQ   IY+
Sbjct  136  AQQMVQAGHQQQLLKIYK  153



>ref|XP_009341579.1| PREDICTED: exocyst complex component EXO70A1 [Pyrus x bretschneideri]
Length=634

 Score = 62.8 bits (151),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 43/80 (54%), Gaps = 8/80 (10%)
 Frame = -2

Query  437  LFECFPQSLLPPTASPNLHVGSGTK--------EHQTKSFKTADYHLPYLIPSRILLLLH  282
            LF+C P SL P + SP      G K        EH   + + A Y  P LIP R+L LLH
Sbjct  146  LFDCLPTSLRPSSGSPGNQGDYGGKNPSSNNHPEHHNGNLENAVYTPPALIPLRVLPLLH  205

Query  281  DLAQLMIRSGHQQQAFNIYR  222
            DLAQ M ++GH QQ   IYR
Sbjct  206  DLAQQMFQAGHHQQLLIIYR  225



>ref|NP_001119162.1| exocyst subunit exo70 family protein A1 [Arabidopsis thaliana]
 gb|AED90621.1| exocyst subunit exo70 family protein A1 [Arabidopsis thaliana]
Length=523

 Score = 62.4 bits (150),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 37/74 (50%), Positives = 44/74 (59%), Gaps = 2/74 (3%)
 Frame = -2

Query  443  DCLFECFPQSLLPPTASPNLHVGSGTKEHQTKSFKTADYHLPYLIPSRILLLLHDLAQLM  264
            D LF+  P SL P  +S     G     H     +TA Y LP LIPSR+L LLHDLAQ M
Sbjct  45   DRLFDGLPNSLRP--SSDGDGGGKPHGGHHNDDAETAAYTLPILIPSRVLPLLHDLAQQM  102

Query  263  IRSGHQQQAFNIYR  222
            +++GHQQQ   IYR
Sbjct  103  VQAGHQQQLLQIYR  116



>gb|KFK38381.1| hypothetical protein AALP_AA3G106300 [Arabis alpina]
Length=637

 Score = 62.8 bits (151),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 43/77 (56%), Gaps = 9/77 (12%)
 Frame = -2

Query  443  DCLFECFPQSLLPPTASPNLHVGSGTK---EHQTKSFKTADYHLPYLIPSRILLLLHDLA  273
            D LF+  P +L P         G G K    H     +T  Y LP LIP+R+L LLHDLA
Sbjct  160  DRLFDGLPNALRPSAD------GDGGKMPHGHHNDDSETGAYTLPILIPTRVLPLLHDLA  213

Query  272  QLMIRSGHQQQAFNIYR  222
            Q M+++GHQQQ   IYR
Sbjct  214  QQMVQAGHQQQLLQIYR  230



>gb|EMS50309.1| Exocyst complex component 7 [Triticum urartu]
Length=653

 Score = 62.0 bits (149),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 46/74 (62%), Gaps = 2/74 (3%)
 Frame = -2

Query  443  DCLFECFPQSLLPPTASPNLHVGSGTKEHQTKSFKTADYHLPYLIPSRILLLLHDLAQLM  264
            D LF+C P+SL P     + +      +H +K  +TA Y  P L+P RIL L++D+AQ +
Sbjct  170  DRLFDCLPKSLRPSKDDEDENANQS--DHPSKGLETAVYKTPTLVPPRILPLMNDIAQQL  227

Query  263  IRSGHQQQAFNIYR  222
            +++G+QQ  + IYR
Sbjct  228  VQAGNQQSCYKIYR  241



>ref|NP_001190216.1| exocyst subunit exo70 family protein A1 [Arabidopsis thaliana]
 gb|AED90622.1| exocyst subunit exo70 family protein A1 [Arabidopsis thaliana]
Length=664

 Score = 62.0 bits (149),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 37/74 (50%), Positives = 44/74 (59%), Gaps = 2/74 (3%)
 Frame = -2

Query  443  DCLFECFPQSLLPPTASPNLHVGSGTKEHQTKSFKTADYHLPYLIPSRILLLLHDLAQLM  264
            D LF+  P SL P  +S     G     H     +TA Y LP LIPSR+L LLHDLAQ M
Sbjct  186  DRLFDGLPNSLRP--SSDGDGGGKPHGGHHNDDAETAAYTLPILIPSRVLPLLHDLAQQM  243

Query  263  IRSGHQQQAFNIYR  222
            +++GHQQQ   IYR
Sbjct  244  VQAGHQQQLLQIYR  257



>ref|NP_200047.3| exocyst subunit exo70-A2 [Arabidopsis thaliana]
 gb|AED96203.1| exocyst subunit exo70-A2 [Arabidopsis thaliana]
Length=631

 Score = 62.0 bits (149),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 33/74 (45%), Positives = 44/74 (59%), Gaps = 2/74 (3%)
 Frame = -2

Query  443  DCLFECFPQSLLPPTASPNLHVGSGTKEHQTKSFKTADYHLPYLIPSRILLLLHDLAQLM  264
            D LFEC P +L P +        +    H  KS + A + +P +IP R+L LLHDLAQ M
Sbjct  160  DRLFECLPSNLRPSSEGEGGGGKTHDPHH--KSLENAIFTVPTVIPPRVLPLLHDLAQQM  217

Query  263  IRSGHQQQAFNIYR  222
            +++GHQQQ F  YR
Sbjct  218  VQAGHQQQLFKSYR  231



>ref|XP_006367154.1| PREDICTED: exocyst complex component 7-like [Solanum tuberosum]
Length=626

 Score = 62.0 bits (149),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 35/80 (44%), Positives = 45/80 (56%), Gaps = 8/80 (10%)
 Frame = -2

Query  443  DCLFECFPQSLLPPTA------SPNLHVGSGTKEHQTKSFKTADYHLPYLIPSRILLLLH  282
            D LFEC P S+ PP++      S   H+ +   E      +   +  P LIP RIL LLH
Sbjct  139  DRLFECLPNSMRPPSSPGHQDPSGKSHLSNSNAEQN--GAENTVFTPPTLIPPRILPLLH  196

Query  281  DLAQLMIRSGHQQQAFNIYR  222
            DLAQ M+++GHQQQ   IYR
Sbjct  197  DLAQQMVQAGHQQQFVKIYR  216



>dbj|BAB10531.1| unnamed protein product [Arabidopsis thaliana]
Length=608

 Score = 62.0 bits (149),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 33/74 (45%), Positives = 44/74 (59%), Gaps = 2/74 (3%)
 Frame = -2

Query  443  DCLFECFPQSLLPPTASPNLHVGSGTKEHQTKSFKTADYHLPYLIPSRILLLLHDLAQLM  264
            D LFEC P +L P +        +    H  KS + A + +P +IP R+L LLHDLAQ M
Sbjct  182  DRLFECLPSNLRPSSEGEGGGGKTHDPHH--KSLENAIFTVPTVIPPRVLPLLHDLAQQM  239

Query  263  IRSGHQQQAFNIYR  222
            +++GHQQQ F  YR
Sbjct  240  VQAGHQQQLFKSYR  253



>ref|XP_006398806.1| hypothetical protein EUTSA_v10012941mg [Eutrema salsugineum]
 gb|ESQ40259.1| hypothetical protein EUTSA_v10012941mg [Eutrema salsugineum]
Length=641

 Score = 61.6 bits (148),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 43/79 (54%), Gaps = 9/79 (11%)
 Frame = -2

Query  443  DCLFECFPQSLLPPTASPNLHVGSGTKE-----HQTKSFKTADYHLPYLIPSRILLLLHD  279
            D LF+  P +L P   +     G G        H     +TA Y LP LIPSR+L LLHD
Sbjct  160  DRLFDGLPNALRPSVDAD----GGGKSSMPHGGHHNDDSETAAYTLPILIPSRVLPLLHD  215

Query  278  LAQLMIRSGHQQQAFNIYR  222
            LAQ M+++GHQQ    IYR
Sbjct  216  LAQQMVQAGHQQLLLQIYR  234



>gb|ABA96523.1| retrotransposon protein, putative, unclassified, expressed [Oryza 
sativa Japonica Group]
Length=1244

 Score = 62.0 bits (149),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 29/74 (39%), Positives = 42/74 (57%), Gaps = 0/74 (0%)
 Frame = -2

Query  443  DCLFECFPQSLLPPTASPNLHVGSGTKEHQTKSFKTADYHLPYLIPSRILLLLHDLAQLM  264
            D LF+C P+    P    +   G    EH +K  +T     P L+P RIL LLHD+AQ +
Sbjct  163  DRLFDCLPKPPRAPKDDNDADGGHTHSEHPSKGLETGICRTPTLMPPRILPLLHDIAQQL  222

Query  263  IRSGHQQQAFNIYR  222
            +++G+QQ  + IYR
Sbjct  223  VQAGNQQSCYRIYR  236



>ref|XP_002864166.1| ATEXO70A3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH40425.1| ATEXO70A3 [Arabidopsis lyrata subsp. lyrata]
Length=575

 Score = 61.2 bits (147),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/72 (42%), Positives = 43/72 (60%), Gaps = 2/72 (3%)
 Frame = -2

Query  437  LFECFPQSLLPPTASPNLHVGSGTKEHQTKSFKTADYHLPYLIPSRILLLLHDLAQLMIR  258
            LFEC P +L P  +S        + + Q+   +  D+ +P +IP  +L LLHDLAQ M++
Sbjct  117  LFECLPSNLRP--SSDGASSDGKSYDPQSNGLEKDDFTVPTIIPPMVLPLLHDLAQQMVK  174

Query  257  SGHQQQAFNIYR  222
            +GHQQQ F  YR
Sbjct  175  AGHQQQLFETYR  186



>ref|XP_010262979.1| PREDICTED: exocyst complex component EXO70A1-like [Nelumbo nucifera]
Length=712

 Score = 61.6 bits (148),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 40/84 (48%), Positives = 46/84 (55%), Gaps = 12/84 (14%)
 Frame = -2

Query  443  DCLFECFPQSLLPPTAS--PNLHVGSGTK--------EHQTKSFKTADYHLPYLIPSRIL  294
            D LFE  P SL P + S  P     S  K        EHQ K  ++  Y  P LIP RIL
Sbjct  219  DRLFEGLPNSLRPGSGSGSPGHQADSTWKNPSSNNHHEHQNKGLES--YTPPTLIPPRIL  276

Query  293  LLLHDLAQLMIRSGHQQQAFNIYR  222
             LLHDLAQ M+++GHQQQ   IYR
Sbjct  277  PLLHDLAQQMVQAGHQQQLLIIYR  300



>ref|XP_008354827.1| PREDICTED: exocyst complex component EXO70A1-like [Malus domestica]
Length=653

 Score = 61.2 bits (147),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 35/80 (44%), Positives = 42/80 (53%), Gaps = 8/80 (10%)
 Frame = -2

Query  437  LFECFPQSLLPPTASPNLHVGSGTK--------EHQTKSFKTADYHLPYLIPSRILLLLH  282
            LF+C P SL P + SP      G K        EH   + + A Y  P LIP R+  LLH
Sbjct  165  LFDCLPTSLRPSSGSPGNQGDYGGKNPSSNNHPEHHNSNLENAVYTPPALIPLRVXPLLH  224

Query  281  DLAQLMIRSGHQQQAFNIYR  222
            DLAQ M ++GH QQ   IYR
Sbjct  225  DLAQQMFQAGHHQQLLIIYR  244



>ref|NP_001130310.1| uncharacterized protein LOC100191404 [Zea mays]
 gb|ACF78490.1| unknown [Zea mays]
Length=480

 Score = 60.8 bits (146),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 42/72 (58%), Gaps = 5/72 (7%)
 Frame = -2

Query  437  LFECFPQSLLPPTASPNLHVGSGTKEHQTKSFKTADYHLPYLIPSRILLLLHDLAQLMIR  258
            LF+CFP  LL    +          E  +KSF++A Y  P LIP RIL LLHD+A  +++
Sbjct  13   LFDCFPNPLLASEGNSR-----AVGEQLSKSFESATYRTPTLIPPRILPLLHDIAHQLVQ  67

Query  257  SGHQQQAFNIYR  222
             G+QQ  + IYR
Sbjct  68   DGNQQLCYRIYR  79



>dbj|BAJ96443.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=615

 Score = 60.8 bits (146),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/75 (40%), Positives = 49/75 (65%), Gaps = 3/75 (4%)
 Frame = -2

Query  443  DCLFECFPQSLLPPTASPNLHVGSGTK-EHQTKSFKTADYHLPYLIPSRILLLLHDLAQL  267
            D LF+C P+SL P  +  +   G+  + +H +K  +TA Y  P L+P RIL L++D+AQ 
Sbjct  163  DRLFDCLPKSLRP--SKDDTEPGNDNQSDHPSKGLETAVYRTPTLVPPRILPLMNDIAQQ  220

Query  266  MIRSGHQQQAFNIYR  222
            ++++G+QQ  + IYR
Sbjct  221  LVQAGNQQSCYKIYR  235



>dbj|BAJ95107.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=647

 Score = 60.8 bits (146),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/75 (40%), Positives = 49/75 (65%), Gaps = 3/75 (4%)
 Frame = -2

Query  443  DCLFECFPQSLLPPTASPNLHVGSGTK-EHQTKSFKTADYHLPYLIPSRILLLLHDLAQL  267
            D LF+C P+SL P  +  +   G+  + +H +K  +TA Y  P L+P RIL L++D+AQ 
Sbjct  163  DRLFDCLPKSLRP--SKDDTEPGNDNQSDHPSKGLETAVYRTPTLVPPRILPLMNDIAQQ  220

Query  266  MIRSGHQQQAFNIYR  222
            ++++G+QQ  + IYR
Sbjct  221  LVQAGNQQSCYKIYR  235



>gb|EYU19838.1| hypothetical protein MIMGU_mgv1a002571mg [Erythranthe guttata]
Length=657

 Score = 60.8 bits (146),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 47/80 (59%), Gaps = 12/80 (15%)
 Frame = -2

Query  437  LFECFPQSLLPPTASPNLHVGSGTK--------EHQTKSFKTADYHLPYLIPSRILLLLH  282
            LFEC P S+  P+ SP     SG K        +HQ  + + + Y  P LIP RIL LLH
Sbjct  172  LFECLPNSM-RPSGSPG---DSGGKIASSNSHSDHQNNTTENSIYTTPTLIPPRILPLLH  227

Query  281  DLAQLMIRSGHQQQAFNIYR  222
            DLAQ M+++G++QQ   IYR
Sbjct  228  DLAQQMVQAGNKQQLQKIYR  247



>ref|XP_004978329.1| PREDICTED: exocyst complex component 7-like [Setaria italica]
Length=729

 Score = 60.5 bits (145),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/74 (45%), Positives = 44/74 (59%), Gaps = 3/74 (4%)
 Frame = -2

Query  443  DCLFECFPQSLLPPTASPNLHVGSGTKEHQTKSFKTADYHLPYLIPSRILLLLHDLAQLM  264
            D LF C P+  L   AS       G    + KSF+TA Y  P +IPS ILLLLHD+A+ +
Sbjct  252  DRLFNCLPKHQL---ASKGDSEAVGEHIKKKKSFETAIYRNPTIIPSGILLLLHDIARQL  308

Query  263  IRSGHQQQAFNIYR  222
            ++ G+QQ  + IYR
Sbjct  309  VQDGNQQSCYRIYR  322



>ref|XP_004496114.1| PREDICTED: exocyst complex component 7-like [Cicer arietinum]
Length=653

 Score = 60.5 bits (145),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 36/79 (46%), Positives = 43/79 (54%), Gaps = 7/79 (9%)
 Frame = -2

Query  437  LFECFPQSLLPPTASPN---LHVGSGTKEHQTKSFK----TADYHLPYLIPSRILLLLHD  279
            LF+C P S+ P + SP     H G     H ++S      T  Y  P LIP RIL LLHD
Sbjct  163  LFDCLPNSMRPSSGSPGHEGDHNGKNPSNHHSESHNNGADTVVYTPPALIPPRILPLLHD  222

Query  278  LAQLMIRSGHQQQAFNIYR  222
            LAQ MI +GH+ Q   IYR
Sbjct  223  LAQQMIEAGHRPQLLKIYR  241



>ref|XP_006663839.1| PREDICTED: exocyst complex component EXO70A1-like [Oryza brachyantha]
Length=634

 Score = 60.1 bits (144),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 45/78 (58%), Gaps = 7/78 (9%)
 Frame = -2

Query  443  DCLFECFPQSLLPPTASPNLHVGSGT----KEHQTKSFKTADYHLPYLIPSRILLLLHDL  276
            D LF+C P+   PP A  + H   G      EH +K  +T     P LIP RIL LLHD+
Sbjct  154  DRLFDCLPK---PPRAPKSDHDADGGHSTHSEHPSKGLETGVCRTPTLIPPRILPLLHDI  210

Query  275  AQLMIRSGHQQQAFNIYR  222
            AQ ++++G+QQ  + IYR
Sbjct  211  AQQLVQAGNQQSCYRIYR  228



>ref|XP_010683605.1| PREDICTED: exocyst complex component EXO70A1-like [Beta vulgaris 
subsp. vulgaris]
Length=639

 Score = 59.7 bits (143),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 43/74 (58%), Gaps = 2/74 (3%)
 Frame = -2

Query  443  DCLFECFPQSLLPPTASPNLHVGSGTKEHQTKSFKTADYHLPYLIPSRILLLLHDLAQLM  264
            DCLF+C P SL P + + +   G        KS + A Y    L+P R+L LL++LA  M
Sbjct  162  DCLFDCLPNSLRPNSTTASQ--GDAASAENDKSTENAAYKTLDLVPPRVLPLLNNLASQM  219

Query  263  IRSGHQQQAFNIYR  222
            I++G+QQQ  + YR
Sbjct  220  IQAGYQQQILSTYR  233



>ref|XP_002871042.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH47301.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=636

 Score = 59.7 bits (143),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 36/74 (49%), Positives = 43/74 (58%), Gaps = 2/74 (3%)
 Frame = -2

Query  443  DCLFECFPQSLLPPTASPNLHVGSGTKEHQTKSFKTADYHLPYLIPSRILLLLHDLAQLM  264
            D LF+  P SL P  +S     G     H     +TA Y LP LIP R+L LLHDLAQ M
Sbjct  158  DRLFDGLPNSLRP--SSDGDGGGKPHGGHHNDDAETAAYTLPILIPLRVLPLLHDLAQQM  215

Query  263  IRSGHQQQAFNIYR  222
            +++GHQQQ   IYR
Sbjct  216  VQAGHQQQLLQIYR  229



>ref|XP_006287255.1| hypothetical protein CARUB_v10000445mg [Capsella rubella]
 gb|EOA20153.1| hypothetical protein CARUB_v10000445mg [Capsella rubella]
Length=638

 Score = 59.7 bits (143),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 43/73 (59%), Gaps = 2/73 (3%)
 Frame = -2

Query  443  DCLFECFPQSLLPPTASPNLHVGSGTKEHQTKSFKTADYHLPYLIPSRILLLLHDLAQLM  264
            D LF+  P SL P  +S     G     H     +TA Y LP LIPSR+L LLHDLAQ M
Sbjct  160  DRLFDGLPNSLRP--SSDGDGGGKPHGGHHNDESETASYTLPILIPSRVLPLLHDLAQQM  217

Query  263  IRSGHQQQAFNIY  225
            +++GHQQQ   IY
Sbjct  218  VQAGHQQQLKQIY  230



>gb|ABK25032.1| unknown [Picea sitchensis]
Length=647

 Score = 59.3 bits (142),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 33/77 (43%), Positives = 42/77 (55%), Gaps = 5/77 (6%)
 Frame = -2

Query  437  LFECFPQSLLPPTASP-NLHVGSGTK----EHQTKSFKTADYHLPYLIPSRILLLLHDLA  273
            LFEC P SL P + SP N    +G K    E      + + Y +P  IP RI+  LHDL 
Sbjct  162  LFECLPNSLRPSSGSPANQGDPNGRKISHHEQIANGTEGSTYTIPTFIPPRIIPQLHDLV  221

Query  272  QLMIRSGHQQQAFNIYR  222
            + M+ +GHQQQ   IYR
Sbjct  222  RRMVEAGHQQQCLKIYR  238



>ref|XP_003591688.1| Exocyst complex component EXO70 [Medicago truncatula]
 gb|AES61939.1| exocyst subunit exo70 family protein [Medicago truncatula]
Length=649

 Score = 58.9 bits (141),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 36/76 (47%), Positives = 44/76 (58%), Gaps = 5/76 (7%)
 Frame = -2

Query  437  LFECFPQSLLPPTASP-NLHVGSGTKEHQTKSFKTAD---YHLPYLIPSRILLLLHDLAQ  270
            LF+C P S+ P + SP N    SG   H + +   AD   Y  P LIP RIL LLHDLA+
Sbjct  163  LFDCLPNSMRPSSGSPGNEGEHSGKSNHHSDN-NNADAVVYTPPTLIPPRILPLLHDLAR  221

Query  269  LMIRSGHQQQAFNIYR  222
             MI +GH+ Q   IYR
Sbjct  222  QMIEAGHRPQLLTIYR  237



>ref|XP_007144229.1| hypothetical protein PHAVU_007G138700g [Phaseolus vulgaris]
 gb|ESW16223.1| hypothetical protein PHAVU_007G138700g [Phaseolus vulgaris]
Length=653

 Score = 58.5 bits (140),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 38/80 (48%), Positives = 45/80 (56%), Gaps = 9/80 (11%)
 Frame = -2

Query  437  LFECFPQSLLPPTASPNLHVG--SG---TKEHQTKSFKTAD---YHLPYLIPSRILLLLH  282
            LF+C P S+ P + SP+ H G  SG   +  H       AD   Y  P LIP R L LLH
Sbjct  163  LFDCLPNSMRPSSGSPH-HEGDPSGKIPSNHHPESHNNNADAVVYTPPALIPPRSLPLLH  221

Query  281  DLAQLMIRSGHQQQAFNIYR  222
            DLAQ M+ +GHQQQ   IYR
Sbjct  222  DLAQQMVEAGHQQQLLKIYR  241



>gb|EAY82341.1| hypothetical protein OsI_37551 [Oryza sativa Indica Group]
 gb|EAZ19722.1| hypothetical protein OsJ_35299 [Oryza sativa Japonica Group]
Length=728

 Score = 58.2 bits (139),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 42/74 (57%), Gaps = 0/74 (0%)
 Frame = -2

Query  443  DCLFECFPQSLLPPTASPNLHVGSGTKEHQTKSFKTADYHLPYLIPSRILLLLHDLAQLM  264
            D LF+C P+    P    +   G    EH +K  +T     P L+P RIL LLHD+AQ +
Sbjct  163  DRLFDCLPKPPRAPKDDNDADGGHTHSEHPSKGLETGICRTPTLMPPRILPLLHDIAQQL  222

Query  263  IRSGHQQQAFNIYR  222
            +++G+QQ  + IYR
Sbjct  223  VQAGNQQSCYRIYR  236



>ref|XP_003555696.2| PREDICTED: exocyst complex component EXO70A1-like [Glycine max]
Length=651

 Score = 58.2 bits (139),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 41/82 (50%), Gaps = 8/82 (10%)
 Frame = -2

Query  443  DCLFECFPQSLLPPTASPNLHVGSGTKEHQTK--------SFKTADYHLPYLIPSRILLL  288
            +CLF   P S+ P  ASP        K H +         +     Y LP LIP RIL L
Sbjct  161  ECLFGSLPNSMRPSAASPGRDGDPNGKNHSSNFHSELHKNNADAVQYTLPVLIPPRILPL  220

Query  287  LHDLAQLMIRSGHQQQAFNIYR  222
            L++L Q M+++GHQQQ    YR
Sbjct  221  LNNLTQQMVQAGHQQQLLKAYR  242



>gb|KHN48504.1| Exocyst complex component 7 [Glycine soja]
Length=650

 Score = 58.2 bits (139),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 41/82 (50%), Gaps = 8/82 (10%)
 Frame = -2

Query  443  DCLFECFPQSLLPPTASPNLHVGSGTKEHQT--------KSFKTADYHLPYLIPSRILLL  288
            +CLF   P S+ P  ASP        K H +         +     Y LP LIP RIL L
Sbjct  161  ECLFGSLPNSMRPSAASPGRDGDPNGKNHSSDFHSELHKNNADAVQYTLPVLIPPRILPL  220

Query  287  LHDLAQLMIRSGHQQQAFNIYR  222
            L++L Q M+++GHQQQ    YR
Sbjct  221  LNNLTQQMVQAGHQQQLLKAYR  242



>ref|XP_002442845.1| hypothetical protein SORBIDRAFT_08g003730 [Sorghum bicolor]
 gb|EES16683.1| hypothetical protein SORBIDRAFT_08g003730 [Sorghum bicolor]
Length=615

 Score = 57.8 bits (138),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 43/72 (60%), Gaps = 5/72 (7%)
 Frame = -2

Query  437  LFECFPQSLLPPTASPNLHVGSGTKEHQTKSFKTADYHLPYLIPSRILLLLHDLAQLMIR  258
            LF+C P+SL     +    VG    E  +KSF++A Y  P LIP RI  LLHD+A  +++
Sbjct  194  LFDCLPKSLSALEGTSQ-SVG----EQLSKSFESATYRTPILIPPRIFPLLHDIAHQLVQ  248

Query  257  SGHQQQAFNIYR  222
             G+QQ  + IYR
Sbjct  249  DGNQQSCYRIYR  260



>ref|XP_006606315.1| PREDICTED: exocyst complex component EXO70A1-like [Glycine max]
Length=648

 Score = 57.8 bits (138),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 37/77 (48%), Positives = 43/77 (56%), Gaps = 8/77 (10%)
 Frame = -2

Query  437  LFECFPQSLLPPTASPNLHVG--SGTKEHQTKSFKTAD---YHLPYLIPSRILLLLHDLA  273
            LF+C P S+ P  +SP  H G  SG   H       A+   Y  P LIP R L LLHDLA
Sbjct  163  LFDCLPNSMRP--SSPG-HEGDPSGKNHHSESHNNNAEAVVYTPPALIPPRFLPLLHDLA  219

Query  272  QLMIRSGHQQQAFNIYR  222
            Q M+ +GHQQQ   IYR
Sbjct  220  QQMVEAGHQQQLLKIYR  236



>gb|KHN00969.1| Exocyst complex component 7 [Glycine soja]
Length=648

 Score = 57.8 bits (138),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 37/77 (48%), Positives = 43/77 (56%), Gaps = 8/77 (10%)
 Frame = -2

Query  437  LFECFPQSLLPPTASPNLHVG--SGTKEHQTKSFKTAD---YHLPYLIPSRILLLLHDLA  273
            LF+C P S+ P  +SP  H G  SG   H       A+   Y  P LIP R L LLHDLA
Sbjct  163  LFDCLPNSMRP--SSPG-HEGDPSGKNHHSESHNNNAEAVVYTPPALIPPRFLPLLHDLA  219

Query  272  QLMIRSGHQQQAFNIYR  222
            Q M+ +GHQQQ   IYR
Sbjct  220  QQMVEAGHQQQLLKIYR  236



>ref|XP_010109193.1| Exocyst complex component 7 [Morus notabilis]
 gb|EXC21221.1| Exocyst complex component 7 [Morus notabilis]
Length=358

 Score = 57.0 bits (136),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 32/77 (42%), Positives = 39/77 (51%), Gaps = 3/77 (4%)
 Frame = -2

Query  443  DCLFECFPQSLLP---PTASPNLHVGSGTKEHQTKSFKTADYHLPYLIPSRILLLLHDLA  273
            D LF+C P SL P   P+   N   G     H  K  + A Y    LIP R+L LLHDLA
Sbjct  160  DRLFDCLPNSLRPSSTPSGHKNDSSGKSQSNHNNKQLQAAVYKPLTLIPPRVLPLLHDLA  219

Query  272  QLMIRSGHQQQAFNIYR  222
            Q M+ +G  Q+    YR
Sbjct  220  QQMVLAGSPQELLRAYR  236



>ref|XP_003577018.1| PREDICTED: exocyst complex component EXO70A1-like [Brachypodium 
distachyon]
Length=648

 Score = 57.8 bits (138),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 32/77 (42%), Positives = 46/77 (60%), Gaps = 5/77 (6%)
 Frame = -2

Query  443  DCLFECFPQSLLPPTASPNLHVGSGTK---EHQTKSFKTADYHLPYLIPSRILLLLHDLA  273
            D LF   P+  L   +  +  +G G +   EH +KS +TA Y  P LIP  IL LLH +A
Sbjct  165  DSLFVSPPK--LQLASKGDSEIGGGNRSQSEHPSKSLETAIYRTPTLIPPEILQLLHRIA  222

Query  272  QLMIRSGHQQQAFNIYR  222
            Q ++++G+QQ  +NIYR
Sbjct  223  QQLVQAGNQQSCYNIYR  239



>ref|XP_010473802.1| PREDICTED: exocyst complex component EXO70A1-like, partial [Camelina 
sativa]
Length=528

 Score = 57.4 bits (137),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 33/74 (45%), Positives = 42/74 (57%), Gaps = 12/74 (16%)
 Frame = -2

Query  443  DCLFECFPQSLLPPTASPNLHVGSGTKEHQTKSFKTADYHLPYLIPSRILLLLHDLAQLM  264
            D LFEC P +L P   SP+   G G+        + A Y +P  IP  +L LLHDLAQ M
Sbjct  70   DHLFECLPSNLWP---SPD---GEGS------GLEKAGYSVPTSIPPMVLPLLHDLAQQM  117

Query  263  IRSGHQQQAFNIYR  222
            +++GHQQQ    YR
Sbjct  118  VKAGHQQQLIKTYR  131



>ref|XP_010442762.1| PREDICTED: exocyst complex component EXO70A1-like [Camelina sativa]
Length=535

 Score = 55.8 bits (133),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 39/74 (53%), Gaps = 12/74 (16%)
 Frame = -2

Query  443  DCLFECFPQSLLPPTASPNLHVGSGTKEHQTKSFKTADYHLPYLIPSRILLLLHDLAQLM  264
            D LFEC P +L P         GSG         + ADY +P  IP  +L LLH LAQ M
Sbjct  77   DHLFECLPSNLRPSRDGE----GSG--------LEKADYSVPTSIPPMVLPLLHGLAQQM  124

Query  263  IRSGHQQQAFNIYR  222
            +++GHQQQ    YR
Sbjct  125  VKAGHQQQLIKTYR  138



>emb|CDY44373.1| BnaC02g03040D [Brassica napus]
Length=563

 Score = 55.5 bits (132),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 35/80 (44%), Positives = 43/80 (54%), Gaps = 11/80 (14%)
 Frame = -2

Query  443  DCLFECFPQSLLPPT------ASPNLHVGSGTKEHQTKSFKTADYHLPYLIPSRILLLLH  282
            D LF+  P SL P         SP  H G     H     +TA Y LP LIPSR+L LLH
Sbjct  104  DRLFDGLPNSLRPSADGDGSGKSPMPHGG-----HHHDDSETAAYTLPVLIPSRVLPLLH  158

Query  281  DLAQLMIRSGHQQQAFNIYR  222
            DLAQ M+++GH+Q     Y+
Sbjct  159  DLAQQMVQAGHKQLLLQNYK  178



>gb|EYU19837.1| hypothetical protein MIMGU_mgv1a0037321mg, partial [Erythranthe 
guttata]
Length=479

 Score = 54.7 bits (130),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 39/72 (54%), Gaps = 17/72 (24%)
 Frame = -2

Query  437  LFECFPQSLLPPTASPNLHVGSGTKEHQTKSFKTADYHLPYLIPSRILLLLHDLAQLMIR  258
            LFEC P S                 +HQ K+ +   Y  P LIP RIL LLHDLA+ M+R
Sbjct  173  LFECLPSS-----------------DHQHKAAENLKYTTPTLIPPRILPLLHDLAEQMVR  215

Query  257  SGHQQQAFNIYR  222
            +G++QQ   IYR
Sbjct  216  AGNKQQLQRIYR  227



>ref|XP_010482596.1| PREDICTED: exocyst complex component EXO70A1-like [Camelina sativa]
Length=535

 Score = 54.7 bits (130),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 42/74 (57%), Gaps = 12/74 (16%)
 Frame = -2

Query  443  DCLFECFPQSLLPPTASPNLHVGSGTKEHQTKSFKTADYHLPYLIPSRILLLLHDLAQLM  264
            D LFEC P +L P   SP+   G G+        + A+Y +P  IP  +L LLH LAQ M
Sbjct  77   DHLFECLPSNLRP---SPD---GEGS------GLEKANYSVPTSIPPMVLPLLHGLAQQM  124

Query  263  IRSGHQQQAFNIYR  222
            +++GHQQQ    YR
Sbjct  125  VKAGHQQQLIKTYR  138



>ref|XP_004307071.1| PREDICTED: exocyst complex component 7-like [Fragaria vesca subsp. 
vesca]
Length=643

 Score = 54.7 bits (130),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 41/77 (53%), Gaps = 5/77 (6%)
 Frame = -2

Query  437  LFECFPQSLLPPTASPNLHVGSG-----TKEHQTKSFKTADYHLPYLIPSRILLLLHDLA  273
            LF+C P SL P + SP              EH   +   A Y  P LIP R+L LLHDLA
Sbjct  158  LFDCLPNSLRPSSGSPGDSNAKNPSSNNHHEHHNSNLDNAVYTPPALIPPRVLPLLHDLA  217

Query  272  QLMIRSGHQQQAFNIYR  222
            Q M ++GHQQ+   IYR
Sbjct  218  QQMFQAGHQQKLLLIYR  234



>ref|XP_006589346.1| PREDICTED: exocyst complex component EXO70A1-like isoform X2 
[Glycine max]
Length=644

 Score = 54.7 bits (130),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 36/77 (47%), Positives = 42/77 (55%), Gaps = 8/77 (10%)
 Frame = -2

Query  437  LFECFPQSLLPPTASPNLHVG--SGTKEHQTKSFKTAD---YHLPYLIPSRILLLLHDLA  273
            LF+C P S+ P  +SP  H G  SG   H       A+   Y  P LIP R L LLHDLA
Sbjct  163  LFDCLPNSMRP--SSPG-HEGDPSGKNHHSESHNNNAEAVVYTPPALIPPRFLPLLHDLA  219

Query  272  QLMIRSGHQQQAFNIYR  222
            Q M+ +GHQQ    IYR
Sbjct  220  QQMVEAGHQQPLLKIYR  236



>ref|XP_003536279.1| PREDICTED: exocyst complex component EXO70A1-like isoform X1 
[Glycine max]
 gb|KHN37896.1| Exocyst complex component 7 [Glycine soja]
Length=640

 Score = 54.3 bits (129),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 36/77 (47%), Positives = 42/77 (55%), Gaps = 8/77 (10%)
 Frame = -2

Query  437  LFECFPQSLLPPTASPNLHVG--SGTKEHQTKSFKTAD---YHLPYLIPSRILLLLHDLA  273
            LF+C P S+ P  +SP  H G  SG   H       A+   Y  P LIP R L LLHDLA
Sbjct  163  LFDCLPNSMRP--SSPG-HEGDPSGKNHHSESHNNNAEAVVYTPPALIPPRFLPLLHDLA  219

Query  272  QLMIRSGHQQQAFNIYR  222
            Q M+ +GHQQ    IYR
Sbjct  220  QQMVEAGHQQPLLKIYR  236



>ref|XP_009402622.1| PREDICTED: exocyst complex component EXO70A1-like [Musa acuminata 
subsp. malaccensis]
Length=652

 Score = 52.8 bits (125),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 33/81 (41%), Positives = 41/81 (51%), Gaps = 7/81 (9%)
 Frame = -2

Query  443  DCLFECFPQSLLPPTASPNLHVGSGTK-------EHQTKSFKTADYHLPYLIPSRILLLL  285
            D LF   P+   P + S +    S          EHQ KS + A    P LIP RIL LL
Sbjct  157  DSLFGSLPEISQPLSGSLDQQSESAKNLSSTNHSEHQVKSSEAAALTPPKLIPPRILPLL  216

Query  284  HDLAQLMIRSGHQQQAFNIYR  222
            H LAQ ++++G QQQ   IYR
Sbjct  217  HKLAQQLVQAGRQQQCLKIYR  237



>emb|CDO99931.1| unnamed protein product [Coffea canephora]
Length=658

 Score = 52.0 bits (123),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 33/83 (40%), Positives = 43/83 (52%), Gaps = 9/83 (11%)
 Frame = -2

Query  443  DCLFECFPQSLLPPTASPNLHVGSGTKE---------HQTKSFKTADYHLPYLIPSRILL  291
            D LFE  P S+ P + SP     +  K          H   + + A Y  P L+P R+L 
Sbjct  167  DRLFEGLPSSMRPSSGSPGEQPDANGKNPSPNGQHHEHHHANAENAVYTPPTLVPPRVLP  226

Query  290  LLHDLAQLMIRSGHQQQAFNIYR  222
            LLHDLA  M+++GHQQQ   IYR
Sbjct  227  LLHDLALQMVQAGHQQQLLKIYR  249



>gb|EPS68385.1| hypothetical protein M569_06379, partial [Genlisea aurea]
Length=633

 Score = 52.0 bits (123),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 23/49 (47%), Positives = 35/49 (71%), Gaps = 0/49 (0%)
 Frame = -2

Query  368  TKEHQTKSFKTADYHLPYLIPSRILLLLHDLAQLMIRSGHQQQAFNIYR  222
            + E+Q K+ +   Y LP LIP R+L LLH+++  +I++ H+QQ FNIYR
Sbjct  183  SSENQHKAMENIVYQLPVLIPDRLLPLLHEMSHQLIQADHRQQVFNIYR  231



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3733082205876