BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c2428_g1_i1 len=842 path=[1:0-841]

Length=842
                                                                      Score     E

ref|XP_010110304.1|  Auxin-induced protein AUX22                        238   1e-74   
ref|XP_002517528.1|  Auxin-induced protein AUX22, putative              236   6e-74   Ricinus communis
ref|XP_007216003.1|  hypothetical protein PRUPE_ppa011935mg             235   1e-73   
gb|AFK39785.1|  unknown                                                 235   2e-73   
ref|XP_008228609.1|  PREDICTED: auxin-induced protein IAA6              233   1e-72   
ref|NP_001237849.1|  auxin-induced protein AUX22                        231   5e-72   
gb|KDP37177.1|  hypothetical protein JCGZ_06233                         229   6e-71   
ref|XP_009782641.1|  PREDICTED: auxin-induced protein AUX22-like        228   1e-70   
ref|XP_003528374.1|  PREDICTED: auxin-induced protein AUX22             228   1e-70   
ref|NP_001268086.1|  auxin-induced protein 22A-like                     228   2e-70   
emb|CAN70530.1|  hypothetical protein VITISV_010218                     226   6e-70   Vitis vinifera
sp|P32293.1|AX22A_VIGRR  RecName: Full=Auxin-induced protein 22A;...    226   9e-70   Vigna radiata var. radiata [golden gram]
ref|XP_009619832.1|  PREDICTED: auxin-induced protein AUX22-like        224   3e-69   
ref|XP_009339008.1|  PREDICTED: auxin-induced protein IAA6              223   7e-69   
ref|XP_011045350.1|  PREDICTED: auxin-induced protein AUX22             223   9e-69   
emb|CDO98080.1|  unnamed protein product                                223   1e-68   
ref|XP_009608400.1|  PREDICTED: auxin-induced protein AUX22-like        222   1e-68   
ref|NP_001266080.1|  IAA19                                              222   2e-68   
ref|XP_004302959.1|  PREDICTED: auxin-induced protein AUX22-like        222   2e-68   
ref|XP_006343104.1|  PREDICTED: auxin-induced protein AUX22-like        222   2e-68   
ref|XP_002299626.1|  hypothetical protein POPTR_0001s17780g             221   4e-68   Populus trichocarpa [western balsam poplar]
ref|XP_009802365.1|  PREDICTED: auxin-induced protein AUX22-like        220   9e-68   
gb|ACU19128.1|  unknown                                                 219   1e-67   Glycine max [soybeans]
ref|XP_009623794.1|  PREDICTED: auxin-induced protein AUX22-like        218   3e-67   
ref|XP_010254224.1|  PREDICTED: auxin-induced protein AUX22             218   7e-67   
ref|XP_008377581.1|  PREDICTED: auxin-induced protein IAA6              218   8e-67   
ref|XP_007150684.1|  hypothetical protein PHAVU_005G172900g             218   8e-67   
ref|NP_001236733.1|  uncharacterized protein LOC100305535               218   9e-67   
gb|KHN44138.1|  Auxin-induced protein 22C                               218   1e-66   
gb|ADG60257.1|  IAA19-like protein                                      216   3e-66   
ref|XP_010249883.1|  PREDICTED: auxin-induced protein AUX22             214   3e-65   
gb|KHM98781.1|  Auxin-induced protein 22C                               214   3e-65   
ref|XP_007024034.1|  Indole-3-acetic acid inducible 19                  212   2e-64   
ref|XP_011072282.1|  PREDICTED: auxin-induced protein IAA6              209   1e-63   
ref|XP_002304179.1|  auxin-induced protein 22A                          209   2e-63   Populus trichocarpa [western balsam poplar]
sp|P49680.1|IAA6_PEA  RecName: Full=Auxin-induced protein IAA6          208   4e-63   Pisum sativum [garden pea]
sp|O24541.1|AX22C_VIGRR  RecName: Full=Auxin-induced protein 22C;...    208   4e-63   Vigna radiata var. radiata [golden gram]
ref|XP_009802988.1|  PREDICTED: auxin-induced protein AUX22-like        207   5e-63   
ref|XP_004135828.1|  PREDICTED: auxin-induced protein AUX22-like        207   8e-63   
ref|XP_011080978.1|  PREDICTED: auxin-induced protein 22C-like          206   2e-62   
ref|XP_006427105.1|  hypothetical protein CICLE_v10026400mg             207   3e-62   
ref|XP_006465437.1|  PREDICTED: auxin-induced protein AUX22-like        206   4e-62   
ref|NP_001242293.1|  uncharacterized protein LOC100811879               206   4e-62   
gb|AFZ78623.1|  hypothetical protein                                    204   2e-61   
ref|XP_011000816.1|  PREDICTED: auxin-induced protein 22C-like          201   2e-60   
gb|AFK47060.1|  unknown                                                 201   2e-60   
ref|XP_008461049.1|  PREDICTED: auxin-induced protein IAA6 isofor...    203   3e-60   
ref|XP_010691247.1|  PREDICTED: auxin-induced protein IAA6-like         198   4e-59   
ref|XP_010465525.1|  PREDICTED: auxin-responsive protein IAA19          197   1e-58   
ref|XP_006356170.1|  PREDICTED: auxin-induced protein AUX22-like        196   2e-58   
ref|XP_010487381.1|  PREDICTED: auxin-responsive protein IAA19-like     196   3e-58   
ref|XP_006298605.1|  hypothetical protein CARUB_v10014689mg             195   6e-58   
ref|XP_010503141.1|  PREDICTED: auxin-responsive protein IAA19-like     195   7e-58   
ref|XP_002882951.1|  indoleacetic acid-induced protein 19               195   7e-58   
ref|NP_188173.1|  auxin-responsive protein IAA19                        194   2e-57   Arabidopsis thaliana [mouse-ear cress]
gb|EYU21566.1|  hypothetical protein MIMGU_mgv1a014881mg                193   3e-57   
gb|KFK38897.1|  hypothetical protein AALP_AA3G175100                    193   3e-57   
emb|CDY68807.1|  BnaA06g37420D                                          192   7e-57   
ref|XP_006406955.1|  hypothetical protein EUTSA_v10021556mg             192   8e-57   
emb|CDX82428.1|  BnaA03g33930D                                          192   9e-57   
emb|CDX75834.1|  BnaC03g39170D                                          191   2e-56   
gb|EYU24680.1|  hypothetical protein MIMGU_mgv1a026267mg                191   3e-56   
gb|AAM67069.1|  early auxin-induced protein IAA19                       191   3e-56   Arabidopsis thaliana [mouse-ear cress]
emb|CAA48299.1|  auxin-induced protein                                  189   7e-56   Pisum sativum [garden pea]
ref|XP_010545793.1|  PREDICTED: auxin-responsive protein IAA19          189   9e-56   
gb|ADB93646.2|  indole-3-acetic acid inducible 19                       189   1e-55   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010061973.1|  PREDICTED: auxin-induced protein 22C               189   1e-55   
ref|XP_009146230.1|  PREDICTED: auxin-responsive protein IAA19-like     189   2e-55   
emb|CDY21845.1|  BnaC01g36030D                                          189   2e-55   
ref|XP_009135447.1|  PREDICTED: auxin-responsive protein IAA19-like     188   3e-55   
emb|CDY26042.1|  BnaC06g05820D                                          188   3e-55   
ref|XP_009115446.1|  PREDICTED: auxin-responsive protein IAA19          188   4e-55   
ref|NP_175692.1|  indole-3-acetic acid 6                                188   4e-55   Arabidopsis thaliana [mouse-ear cress]
gb|ADB93649.2|  indole-3-acetic acid inducible 19                       187   5e-55   Arabidopsis thaliana [mouse-ear cress]
gb|ADB93645.2|  indole-3-acetic acid inducible 19                       187   5e-55   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008447488.1|  PREDICTED: auxin-induced protein 22A-like          187   1e-54   
gb|ADC29380.2|  indole-3-acetic acid inducible 6                        187   1e-54   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010535122.1|  PREDICTED: auxin-responsive protein IAA19          186   1e-54   
ref|XP_009147656.1|  PREDICTED: auxin-responsive protein IAA6           187   1e-54   
gb|AAM62583.1|  putative IAA6 protein                                   186   2e-54   Arabidopsis thaliana [mouse-ear cress]
gb|AAC49047.1|  IAA6                                                    186   2e-54   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002894404.1|  hypothetical protein ARALYDRAFT_474409             186   2e-54   
gb|KGN58115.1|  hypothetical protein Csa_3G516540                       186   2e-54   
gb|KFK35763.1|  hypothetical protein AALP_AA4G033200                    184   2e-53   
ref|XP_004506934.1|  PREDICTED: auxin-induced protein IAA6-like         183   8e-53   
gb|ADL70546.1|  indole-3-acetic acid inducible 6                        181   2e-52   
gb|ADL70540.1|  indole-3-acetic acid inducible 6                        180   3e-52   
ref|XP_010479813.1|  PREDICTED: auxin-responsive protein IAA6           179   5e-52   
ref|XP_006305683.1|  hypothetical protein CARUB_v10010401mg             177   3e-51   
gb|ADL70547.1|  indole-3-acetic acid inducible 6                        176   7e-51   
ref|XP_010462138.1|  PREDICTED: auxin-responsive protein IAA6-like      176   1e-50   
ref|XP_010500910.1|  PREDICTED: auxin-responsive protein IAA6-like      176   1e-50   
ref|XP_009589137.1|  PREDICTED: auxin-induced protein 22D-like          174   1e-49   
gb|ADL70537.1|  indole-3-acetic acid inducible 6                        171   6e-49   
gb|AAB84356.1|  IAA19                                                   170   6e-49   Arabidopsis thaliana [mouse-ear cress]
gb|ADL70536.1|  indole-3-acetic acid inducible 6                        171   1e-48   
sp|O24542.1|AX22D_VIGRR  RecName: Full=Auxin-induced protein 22D;...    170   3e-48   Vigna radiata var. radiata [golden gram]
ref|NP_001242395.1|  uncharacterized protein LOC100799875               170   5e-48   
emb|CDY32934.1|  BnaA09g16590D                                          169   6e-48   
gb|KHN03839.1|  Auxin-induced protein 22D                               169   6e-48   
ref|XP_009113982.1|  PREDICTED: auxin-responsive protein IAA4           169   7e-48   
gb|ADB93647.2|  indole-3-acetic acid inducible 19                       168   1e-47   Arabidopsis thaliana [mouse-ear cress]
emb|CDY69497.1|  BnaCnng63870D                                          168   1e-47   
ref|XP_009764468.1|  PREDICTED: auxin-induced protein 22D-like          167   3e-47   
ref|XP_010537941.1|  PREDICTED: auxin-induced protein 22C               166   3e-47   
gb|ADL70535.1|  indole-3-acetic acid inducible 6                        167   4e-47   
ref|XP_011082600.1|  PREDICTED: auxin-induced protein 22D-like          166   1e-46   
gb|KHN18839.1|  Auxin-induced protein 22D                               166   1e-46   
gb|AAD32144.1|AF123506_1  Nt-iaa4.3 deduced protein                     166   1e-46   Nicotiana tabacum [American tobacco]
gb|EPS68980.1|  hypothetical protein M569_05790                         165   2e-46   
ref|XP_009117817.1|  PREDICTED: auxin-responsive protein IAA5           164   3e-46   
gb|KDO58188.1|  hypothetical protein CISIN_1g048172mg                   163   5e-46   
gb|ADL70524.1|  indole-3-acetic acid inducible 5                        163   6e-46   
gb|ADL70542.1|  indole-3-acetic acid inducible 6                        163   8e-46   
ref|NP_001275532.1|  auxin-induced protein AUX22-like                   163   1e-45   
ref|XP_002892874.1|  hypothetical protein ARALYDRAFT_471758             162   1e-45   
ref|XP_006838869.1|  hypothetical protein AMTR_s00002p00266860          163   2e-45   
ref|XP_009612823.1|  PREDICTED: auxin-induced protein 22D-like          162   2e-45   
ref|XP_009786590.1|  PREDICTED: auxin-induced protein 22D-like          162   2e-45   
ref|NP_001242729.1|  uncharacterized protein LOC100780752               163   2e-45   
gb|AAD32145.1|AF123507_1  Nt-iaa4.5 deduced protein                     163   2e-45   Nicotiana tabacum [American tobacco]
ref|XP_007144687.1|  hypothetical protein PHAVU_007G176700g             162   3e-45   
gb|AFZ78615.1|  hypothetical protein                                    162   3e-45   
ref|XP_010278166.1|  PREDICTED: auxin-responsive protein IAA4-like      162   4e-45   
ref|XP_002307625.1|  auxin-induced protein 22B                          162   4e-45   Populus trichocarpa [western balsam poplar]
ref|XP_008447487.1|  PREDICTED: auxin-induced protein AUX22-like        162   4e-45   
ref|XP_011079948.1|  PREDICTED: auxin-induced protein 22D-like          162   5e-45   
gb|AAF71983.1|AC013453_8  auxin-induced protein AUX2-27                 161   5e-45   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006349740.1|  PREDICTED: auxin-induced protein 22D-like          161   6e-45   
ref|XP_002281696.1|  PREDICTED: auxin-induced protein 22D               161   8e-45   Vitis vinifera
gb|ADC29379.2|  indole-3-acetic acid inducible 6                        160   8e-45   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010476650.1|  PREDICTED: auxin-responsive protein IAA5-lik...    160   1e-44   
ref|NP_173011.1|  auxin-responsive protein IAA5                         159   1e-44   Arabidopsis thaliana [mouse-ear cress]
gb|ADL70522.1|  indole-3-acetic acid inducible 5                        159   1e-44   
ref|XP_004493738.1|  PREDICTED: auxin-induced protein 22E-like          160   2e-44   
ref|XP_009587946.1|  PREDICTED: auxin-induced protein 22E-like          160   2e-44   
ref|XP_010459100.1|  PREDICTED: auxin-responsive protein IAA5           158   3e-44   
ref|XP_009612692.1|  PREDICTED: auxin-responsive protein IAA4-like      159   4e-44   
ref|XP_006420092.1|  hypothetical protein CICLE_v10006002mg             159   4e-44   
ref|XP_008451269.1|  PREDICTED: auxin-induced protein 22D-like          159   4e-44   
ref|XP_006403206.1|  hypothetical protein EUTSA_v10003276mg             159   4e-44   
gb|KFK43813.1|  hypothetical protein AALP_AA1G176600                    158   5e-44   
gb|AAC49046.1|  IAA5                                                    158   5e-44   Arabidopsis thaliana [mouse-ear cress]
gb|KHG20616.1|  Auxin-induced 22D                                       159   6e-44   
emb|CDY50750.1|  BnaAnng10570D                                          162   8e-44   
gb|ADL70520.1|  indole-3-acetic acid inducible 4                        158   8e-44   
ref|XP_007143879.1|  hypothetical protein PHAVU_007G109700g             159   8e-44   
emb|CDY53305.1|  BnaA09g56620D                                          157   9e-44   
gb|ADL70513.1|  indole-3-acetic acid inducible 4                        158   9e-44   
emb|CAD30274.1|  IAA16 protein                                          159   9e-44   Gossypium hirsutum [American cotton]
gb|ADC29372.1|  indole-3-acetic acid inducible 4                        158   1e-43   Arabidopsis thaliana [mouse-ear cress]
gb|KFK31702.1|  hypothetical protein AALP_AA6G148000                    158   1e-43   
ref|NP_001266029.1|  IAA3 protein                                       158   1e-43   
gb|KHN05056.1|  Auxin-induced protein 22B                               158   1e-43   
ref|XP_009615053.1|  PREDICTED: auxin-responsive protein IAA4-like      157   2e-43   
ref|XP_007201847.1|  hypothetical protein PRUPE_ppa011843mg             157   3e-43   
ref|XP_002312567.1|  hypothetical protein POPTR_0008s16100g             158   3e-43   Populus trichocarpa [western balsam poplar]
ref|XP_010476649.1|  PREDICTED: auxin-responsive protein IAA5-lik...    156   3e-43   
ref|XP_004146959.1|  PREDICTED: auxin-induced protein 22D-like          157   3e-43   
ref|XP_006432924.1|  hypothetical protein CICLE_v10002569mg             157   4e-43   
gb|AAD32142.1|AF123504_1  Nt-iaa2.3 deduced protein                     156   4e-43   Nicotiana tabacum [American tobacco]
ref|XP_002520979.1|  Auxin-induced protein 22E, putative                157   5e-43   Ricinus communis
ref|XP_007034953.1|  AUX/IAA transcriptional regulator family pro...    156   5e-43   
ref|XP_002531289.1|  Auxin-induced protein 22D, putative                157   5e-43   Ricinus communis
ref|XP_009765454.1|  PREDICTED: auxin-responsive protein IAA4-like      156   5e-43   
ref|XP_006281167.1|  hypothetical protein CARUB_v10027201mg             156   5e-43   
ref|XP_011032399.1|  PREDICTED: auxin-responsive protein IAA16-like     158   6e-43   
ref|XP_002865407.1|  indoleacetic acid-induced protein 4                156   6e-43   
ref|XP_010529092.1|  PREDICTED: auxin-responsive protein IAA1-like      156   7e-43   
gb|ADB93648.2|  indole-3-acetic acid inducible 19                       155   7e-43   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008235329.1|  PREDICTED: auxin-induced protein 22D-like          156   7e-43   
ref|XP_011081682.1|  PREDICTED: auxin-responsive protein IAA14          156   7e-43   
ref|XP_006382798.1|  hypothetical protein POPTR_0005s05560g             158   7e-43   
emb|CAC84712.1|  aux/IAA protein                                        156   7e-43   Populus tremula x Populus tremuloides
ref|XP_011069469.1|  PREDICTED: auxin-induced protein 22C-like          154   7e-43   
ref|NP_199183.1|  auxin-responsive protein IAA4                         156   8e-43   Arabidopsis thaliana [mouse-ear cress]
gb|ADL70509.1|  indole-3-acetic acid inducible 4                        156   8e-43   
ref|XP_004288426.1|  PREDICTED: auxin-induced protein 22B-like          156   1e-42   
gb|AFK43880.1|  unknown                                                 155   1e-42   
ref|XP_010481836.1|  PREDICTED: auxin-responsive protein IAA4           155   1e-42   
ref|XP_006305735.1|  hypothetical protein CARUB_v10010519mg             154   1e-42   
gb|EPS58914.1|  hypothetical protein M569_15899                         153   1e-42   
ref|XP_010069174.1|  PREDICTED: auxin-induced protein 22B-like          156   1e-42   
ref|XP_011042428.1|  PREDICTED: auxin-induced protein 22E-like          155   1e-42   
ref|XP_006382797.1|  auxin-induced protein IAA4                         155   1e-42   
ref|XP_004495145.1|  PREDICTED: auxin-induced protein 22D-like is...    155   1e-42   
ref|XP_011027531.1|  PREDICTED: auxin-induced protein 22D               155   2e-42   
ref|XP_002279955.1|  PREDICTED: auxin-induced protein 22D               155   2e-42   Vitis vinifera
ref|XP_002517024.1|  Auxin-responsive protein IAA4, putative            155   2e-42   Ricinus communis
ref|XP_007030568.1|  AUX/IAA transcriptional regulator family pro...    155   2e-42   
ref|NP_001288939.1|  auxin-responsive protein IAA16                     156   2e-42   
ref|XP_010441996.1|  PREDICTED: auxin-responsive protein IAA4-like      155   2e-42   
ref|XP_010923480.1|  PREDICTED: auxin-induced protein 22D-like          155   2e-42   
emb|CDY53800.1|  BnaA06g01830D                                          154   2e-42   
gb|ADC29373.1|  indole-3-acetic acid inducible 4                        154   2e-42   Arabidopsis thaliana [mouse-ear cress]
emb|CAN74317.1|  hypothetical protein VITISV_013837                     155   3e-42   Vitis vinifera
gb|AAX63768.1|  auxin-responsive protein IAA                            155   3e-42   Populus tomentosa [Chinese white poplar]
gb|ADC29369.1|  indole-3-acetic acid inducible 4                        154   3e-42   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002319642.1|  auxin-induced protein IAA4                         155   3e-42   Populus trichocarpa [western balsam poplar]
ref|XP_011091109.1|  PREDICTED: auxin-induced protein 22D               154   3e-42   
ref|XP_011032400.1|  PREDICTED: auxin-induced protein 22B-like          154   4e-42   
ref|XP_010254225.1|  PREDICTED: auxin-responsive protein IAA1-like      155   4e-42   
gb|KDP23666.1|  hypothetical protein JCGZ_23499                         155   4e-42   
ref|XP_011038570.1|  PREDICTED: auxin-induced protein 22D-like          154   4e-42   
ref|XP_007024033.1|  AUX/IAA transcriptional regulator family pro...    154   4e-42   
ref|XP_009367751.1|  PREDICTED: auxin-induced protein 22D-like          154   4e-42   
gb|ADC29378.1|  indole-3-acetic acid inducible 5                        153   4e-42   Arabidopsis thaliana [mouse-ear cress]
gb|KDP40273.1|  hypothetical protein JCGZ_02271                         154   4e-42   
ref|XP_004139234.1|  PREDICTED: auxin-induced protein 22D-like          154   5e-42   
ref|XP_007145935.1|  hypothetical protein PHAVU_007G280300g             154   5e-42   
ref|XP_006443922.1|  hypothetical protein CICLE_v10022370mg             154   5e-42   
ref|XP_011073484.1|  PREDICTED: auxin-induced protein 22B-like          154   5e-42   
ref|XP_009776001.1|  PREDICTED: auxin-responsive protein IAA4-like      153   5e-42   
gb|AGM20676.1|  IAA4                                                    156   5e-42   
gb|KDP21371.1|  hypothetical protein JCGZ_21842                         154   6e-42   
gb|ACJ85999.1|  unknown                                                 154   6e-42   Medicago truncatula
ref|XP_003590532.1|  Auxin-induced protein                              154   6e-42   
ref|NP_001288048.1|  uncharacterized protein LOC103445716               153   6e-42   
gb|AAM21317.1|AF373100_1  auxin-regulated protein                       155   7e-42   Populus tremula x Populus tremuloides
ref|XP_008786091.1|  PREDICTED: auxin-induced protein 22D-like          154   8e-42   
ref|XP_004495146.1|  PREDICTED: auxin-induced protein 22D-like is...    153   1e-41   
gb|KHG05201.1|  Auxin-induced 22D                                       152   1e-41   
ref|XP_011026048.1|  PREDICTED: auxin-induced protein AUX28-like        154   1e-41   
ref|XP_006392862.1|  hypothetical protein EUTSA_v10012354mg             152   1e-41   
ref|XP_011026050.1|  PREDICTED: auxin-induced protein 22D-like          153   1e-41   
ref|XP_010532598.1|  PREDICTED: auxin-responsive protein IAA1           152   2e-41   
gb|AFZ78612.1|  hypothetical protein                                    153   2e-41   
emb|CBI36191.3|  unnamed protein product                                150   2e-41   
gb|ACJ86152.1|  unknown                                                 153   2e-41   Medicago truncatula
ref|XP_004302056.1|  PREDICTED: auxin-responsive protein IAA4-like      152   2e-41   
gb|AAQ74955.1|  Gbiaa-Re                                                152   2e-41   Gossypium barbadense [Egyptian cotton]
sp|O24543.1|AX22E_VIGRR  RecName: Full=Auxin-induced protein 22E;...    153   2e-41   Vigna radiata var. radiata [golden gram]
ref|XP_010033899.1|  PREDICTED: auxin-responsive protein IAA1           153   2e-41   
gb|KHG09585.1|  Auxin-induced 22B                                       152   2e-41   
ref|XP_002284121.1|  PREDICTED: auxin-induced protein 22D               152   2e-41   Vitis vinifera
ref|XP_006418151.1|  hypothetical protein EUTSA_v10008636mg             154   2e-41   
sp|P32294.1|AX22B_VIGRR  RecName: Full=Auxin-induced protein 22B;...    152   2e-41   Vigna radiata var. radiata [golden gram]
gb|KFK42765.1|  hypothetical protein AALP_AA1G036800                    152   2e-41   
ref|XP_004495393.1|  PREDICTED: auxin-induced protein 22B-like          152   2e-41   
gb|ABH01143.1|  auxin-regulated protein                                 154   2e-41   Populus tomentosa [Chinese white poplar]
ref|XP_008366873.1|  PREDICTED: auxin-responsive protein IAA3-like      152   3e-41   
ref|XP_009364491.1|  PREDICTED: auxin-responsive protein IAA4-like      152   3e-41   
emb|CDO99147.1|  unnamed protein product                                152   3e-41   
ref|XP_010522505.1|  PREDICTED: auxin-responsive protein IAA4-like      152   3e-41   
gb|AAL55414.1|  auxin-induced AUX/IAA1                                  151   3e-41   Antirrhinum majus [garden snapdragon]
ref|XP_009354869.1|  PREDICTED: auxin-induced protein 22D-like          151   3e-41   
ref|XP_007050424.1|  AUX/IAA transcriptional regulator family pro...    157   3e-41   
ref|XP_003591816.1|  Auxin-induced protein                              151   3e-41   
ref|XP_010024037.1|  PREDICTED: auxin-induced protein 22D-like          152   4e-41   
ref|XP_010249884.1|  PREDICTED: auxin-responsive protein IAA1           152   4e-41   
ref|XP_004289902.1|  PREDICTED: auxin-induced protein 22D-like          151   4e-41   
emb|CDY41894.1|  BnaC05g47100D                                          152   4e-41   
ref|XP_002300804.2|  auxin-induced protein 22B                          151   5e-41   Populus trichocarpa [western balsam poplar]
ref|NP_001280944.1|  auxin-induced protein 22D-like                     150   5e-41   
ref|XP_011082603.1|  PREDICTED: auxin-responsive protein IAA14-like     152   6e-41   
ref|XP_008808453.1|  PREDICTED: auxin-induced protein 22D-like          151   7e-41   
ref|NP_001237241.1|  uncharacterized protein LOC100527777               151   7e-41   
ref|XP_008372302.1|  PREDICTED: auxin-induced protein 22D-like          150   9e-41   
ref|XP_007162489.1|  hypothetical protein PHAVU_001G156500g             151   9e-41   
ref|XP_008788132.1|  PREDICTED: auxin-induced protein 22D-like          151   9e-41   
ref|XP_010917603.1|  PREDICTED: auxin-induced protein 22D-like          150   1e-40   
gb|ABY61921.1|  At1g04240                                               150   1e-40   Arabidopsis thaliana [mouse-ear cress]
gb|EYU46511.1|  hypothetical protein MIMGU_mgv1a014434mg                150   1e-40   
ref|XP_002302075.1|  auxin-induced protein aux28                        152   1e-40   Populus trichocarpa [western balsam poplar]
gb|ABY61905.1|  At1g04240                                               150   1e-40   Arabidopsis thaliana [mouse-ear cress]
gb|EYU17895.1|  hypothetical protein MIMGU_mgv1a014074mg                150   1e-40   
ref|NP_171920.1|  auxin-responsive protein IAA3                         150   1e-40   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001266037.1|  IAA1                                               150   1e-40   
gb|KHN30562.1|  Auxin-induced protein 22B                               150   1e-40   
ref|XP_003520159.1|  PREDICTED: auxin-induced protein 22B-like          150   1e-40   
gb|ABY61900.1|  At1g04240                                               150   1e-40   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006379864.1|  hypothetical protein POPTR_0008s16100g             151   1e-40   
ref|NP_001266082.1|  IAA22                                              150   1e-40   
ref|XP_006366663.1|  PREDICTED: auxin-responsive protein IAA16-like     150   2e-40   
ref|NP_001234694.1|  AUX/IAA 2                                          150   2e-40   
emb|CDY18213.1|  BnaC05g02360D                                          150   2e-40   
ref|NP_001266055.1|  IAA10 protein                                      150   2e-40   
gb|AFK42559.1|  unknown                                                 150   2e-40   
ref|XP_006362194.1|  PREDICTED: auxin-responsive protein IAA3-like      150   2e-40   
ref|XP_010674856.1|  PREDICTED: auxin-responsive protein IAA4-like      149   2e-40   
emb|CDY71748.1|  BnaCnng74250D                                          149   2e-40   
ref|XP_006366662.1|  PREDICTED: auxin-responsive protein IAA3-like      149   3e-40   
gb|AEX00362.1|  IAA21                                                   150   3e-40   
ref|XP_010917602.1|  PREDICTED: auxin-responsive protein IAA30 is...    151   3e-40   
ref|XP_010087759.1|  Auxin-responsive protein IAA4                      150   3e-40   
ref|XP_002517529.1|  Auxin-responsive protein IAA1, putative            150   3e-40   
ref|XP_002314656.2|  hypothetical protein POPTR_0010s08890g             152   3e-40   
gb|ADL70507.1|  indole-3-acetic acid inducible 3                        149   3e-40   
gb|ADL36579.1|  ARF domain class transcription factor                   149   3e-40   
gb|KFK39590.1|  hypothetical protein AALP_AA3G264100                    148   4e-40   
ref|XP_010475074.1|  PREDICTED: auxin-responsive protein IAA3-like      149   4e-40   
emb|CDY32536.1|  BnaA09g50600D                                          149   4e-40   
ref|XP_010679164.1|  PREDICTED: auxin-induced protein 22D               149   4e-40   
ref|XP_007205940.1|  hypothetical protein PRUPE_ppa011755mg             149   4e-40   
ref|XP_009145242.1|  PREDICTED: auxin-responsive protein IAA2           148   4e-40   
ref|XP_010274202.1|  PREDICTED: auxin-induced protein 22B               149   5e-40   
ref|XP_006356050.1|  PREDICTED: auxin-responsive protein IAA3-like      149   5e-40   
ref|XP_007050421.1|  Indole-3-acetic acid inducible 14 isoform 1        152   6e-40   
gb|KHF98784.1|  Auxin-induced 22D                                       148   6e-40   
ref|XP_006829606.1|  hypothetical protein AMTR_s00122p00019410          148   7e-40   
ref|XP_006838867.1|  hypothetical protein AMTR_s00002p00266760          150   7e-40   
gb|KFK23368.1|  hypothetical protein AALP_AAs59668U000200               147   7e-40   
ref|XP_006408158.1|  hypothetical protein EUTSA_v10021441mg             149   7e-40   
emb|CDY36883.1|  BnaC08g09640D                                          147   8e-40   
ref|XP_010441995.1|  PREDICTED: auxin-responsive protein IAA4-like      146   8e-40   
ref|NP_001287806.1|  auxin-responsive protein IAA3-like                 148   9e-40   
ref|XP_008218269.1|  PREDICTED: auxin-responsive protein IAA4-like      148   1e-39   
ref|XP_003521267.1|  PREDICTED: auxin-induced protein 22E-like          148   1e-39   
ref|NP_001266077.1|  IAA15                                              149   1e-39   
ref|NP_001266034.1|  IAA6 protein                                       150   1e-39   
emb|CDY10692.1|  BnaA05g16700D                                          147   1e-39   
gb|ADC29367.1|  indole-3-acetic acid inducible 3                        147   1e-39   
ref|NP_001290520.1|  auxin-responsive protein IAA1                      148   1e-39   
ref|XP_006408159.1|  hypothetical protein EUTSA_v10021441mg             149   1e-39   
ref|XP_006604480.1|  PREDICTED: auxin-induced protein 22E-like          148   1e-39   
emb|CDY53735.1|  BnaA08g30190D                                          147   1e-39   
ref|XP_008811586.1|  PREDICTED: auxin-responsive protein IAA1-like      148   1e-39   
gb|AFK42473.1|  unknown                                                 147   2e-39   
ref|XP_002892202.1|  hypothetical protein ARALYDRAFT_887587             147   2e-39   
ref|XP_010542916.1|  PREDICTED: auxin-responsive protein IAA4-like      147   2e-39   
ref|XP_009398378.1|  PREDICTED: auxin-responsive protein IAA4-like      147   2e-39   
ref|XP_010936161.1|  PREDICTED: auxin-induced protein 22D               147   2e-39   
dbj|BAJ34138.1|  unnamed protein product                                148   2e-39   
ref|XP_010925112.1|  PREDICTED: auxin-responsive protein IAA1-like      147   2e-39   
ref|XP_006343103.1|  PREDICTED: LOW QUALITY PROTEIN: auxin-respon...    149   3e-39   
gb|ABY61939.1|  At1g04240-like protein                                  147   3e-39   
ref|XP_009614298.1|  PREDICTED: auxin-responsive protein IAA27-like     149   3e-39   
ref|NP_001280973.1|  auxin-responsive protein IAA16                     148   3e-39   
ref|NP_001266042.1|  IAA2                                               145   3e-39   
ref|XP_007205640.1|  hypothetical protein PRUPE_ppa009254mg             150   3e-39   
ref|XP_002319075.1|  hypothetical protein POPTR_0013s03870g             148   3e-39   
emb|CBI28126.3|  unnamed protein product                                147   3e-39   
ref|XP_010457462.1|  PREDICTED: auxin-responsive protein IAA3           146   3e-39   
ref|XP_009774251.1|  PREDICTED: auxin-responsive protein IAA16-like     147   3e-39   
ref|XP_003637551.1|  Auxin-induced protein                              146   4e-39   
gb|AAD32147.1|AF123509_1  Nt-iaa4.1 deduced protein                     147   4e-39   
ref|XP_009118660.1|  PREDICTED: auxin-responsive protein IAA3           146   4e-39   
ref|XP_010323008.1|  PREDICTED: IAA2 isoform X1                         145   4e-39   
gb|AAD32143.1|AF123505_1  Nt-iaa2.5 deduced protein                     145   4e-39   
ref|XP_002284861.1|  PREDICTED: auxin-responsive protein IAA1-like      147   5e-39   
ref|XP_010418365.1|  PREDICTED: auxin-responsive protein IAA16          147   5e-39   
ref|XP_009364490.1|  PREDICTED: auxin-responsive protein IAA16          148   5e-39   
ref|XP_008455974.1|  PREDICTED: auxin-induced protein 22D-like          146   6e-39   
ref|XP_009119324.1|  PREDICTED: auxin-responsive protein IAA3-like      146   6e-39   
ref|XP_007030567.1|  Indoleacetic acid-induced protein 16               147   6e-39   
ref|XP_006414694.1|  hypothetical protein EUTSA_v10026385mg             145   7e-39   
ref|XP_006298436.1|  hypothetical protein CARUB_v10014507mg             147   7e-39   
gb|AEE25649.1|  auxin-responsive protein                                146   7e-39   
ref|XP_008809254.1|  PREDICTED: auxin-responsive protein IAA1-like      146   7e-39   
ref|XP_009418725.1|  PREDICTED: auxin-induced protein 22D-like          145   8e-39   
ref|XP_010485858.1|  PREDICTED: auxin-responsive protein IAA16-like     147   8e-39   
ref|XP_010483303.1|  PREDICTED: auxin-responsive protein IAA3-like      145   8e-39   
ref|XP_009108345.1|  PREDICTED: auxin-responsive protein IAA2-like      145   8e-39   
gb|KEH42778.1|  auxin-responsive AUX/IAA family protein                 147   8e-39   
gb|ABG81096.1|  AUX/IAA-like protein                                    145   9e-39   
ref|XP_011072281.1|  PREDICTED: auxin-responsive protein IAA1-like      145   9e-39   
gb|ADC29383.1|  indole-3-acetic acid inducible 6                        144   1e-38   
ref|XP_010551700.1|  PREDICTED: auxin-responsive protein IAA14          146   1e-38   
ref|XP_006406101.1|  hypothetical protein EUTSA_v10021641mg             145   1e-38   
emb|CDX94876.1|  BnaC03g43120D                                          144   1e-38   
ref|XP_010102293.1|  Auxin-responsive protein IAA3                      145   1e-38   
gb|KDP37176.1|  hypothetical protein JCGZ_06232                         146   1e-38   
gb|AFZ78614.1|  hypothetical protein                                    145   1e-38   
ref|XP_009135841.1|  PREDICTED: auxin-responsive protein IAA2-like      144   1e-38   
emb|CDY10346.1|  BnaC05g29330D                                          144   1e-38   
ref|XP_006352755.1|  PREDICTED: auxin-induced protein 22D-like          144   1e-38   
ref|XP_008341044.1|  PREDICTED: auxin-induced protein 22D-like          145   1e-38   
ref|XP_011030588.1|  PREDICTED: auxin-induced protein 22D-like          145   1e-38   
gb|ABY61938.1|  At1g04240-like protein                                  145   1e-38   
ref|XP_009399362.1|  PREDICTED: auxin-responsive protein IAA4-like      144   2e-38   
ref|NP_187124.1|  auxin-responsive protein IAA16                        146   2e-38   
ref|XP_010537943.1|  PREDICTED: auxin-responsive protein IAA15 is...    144   2e-38   
ref|XP_009611025.1|  PREDICTED: auxin-responsive protein IAA17-like     145   2e-38   
ref|XP_009398567.1|  PREDICTED: auxin-induced protein 22D-like          144   2e-38   
ref|XP_010537942.1|  PREDICTED: auxin-responsive protein IAA15 is...    144   2e-38   
gb|ADL70502.1|  indole-3-acetic acid inducible 3                        144   2e-38   
ref|XP_010110305.1|  Auxin-responsive protein IAA17                     145   2e-38   
ref|XP_003535418.1|  PREDICTED: auxin-induced protein 22B-like          142   3e-38   
ref|XP_004495391.1|  PREDICTED: auxin-responsive protein IAA14-li...    145   3e-38   
emb|CDY40837.1|  BnaC01g31190D                                          143   3e-38   
ref|XP_010551701.1|  PREDICTED: auxin-responsive protein IAA1-like      144   4e-38   
gb|ABM53873.1|  IAA5                                                    142   4e-38   
ref|XP_006343091.1|  PREDICTED: auxin-responsive protein IAA27-like     146   4e-38   
gb|KFK37887.1|  hypothetical protein AALP_AA3G042100                    145   4e-38   
ref|XP_007226262.1|  hypothetical protein PRUPE_ppa018535mg             144   4e-38   
ref|XP_004498012.1|  PREDICTED: auxin-induced protein IAA4-like         144   5e-38   
ref|XP_006350661.1|  PREDICTED: auxin-responsive protein IAA4-like      143   6e-38   
ref|XP_004134103.1|  PREDICTED: auxin-induced protein 22B-like          144   7e-38   
ref|XP_008218270.1|  PREDICTED: auxin-responsive protein IAA16          145   7e-38   
ref|XP_009782640.1|  PREDICTED: auxin-responsive protein IAA17-like     144   7e-38   
ref|XP_011038568.1|  PREDICTED: auxin-responsive protein IAA16-like     144   7e-38   
ref|XP_006305659.1|  hypothetical protein CARUB_v10010367mg             143   8e-38   
ref|NP_001266256.1|  uncharacterized protein LOC101255303               143   8e-38   
ref|NP_188943.1|  auxin-responsive protein IAA2                         142   8e-38   
ref|XP_009337290.1|  PREDICTED: auxin-induced protein 22D               143   8e-38   
gb|ADL70491.1|  indole-3-acetic acid inducible 2                        142   8e-38   
gb|AAB97164.1|  auxin-responsive protein IAA2                           142   8e-38   
emb|CDY10069.1|  BnaC08g43820D                                          142   9e-38   
gb|KEH27147.1|  auxin response factor                                   144   9e-38   
gb|AEE25654.1|  auxin-responsive protein                                144   1e-37   
ref|XP_004150434.1|  PREDICTED: auxin-induced protein 22B-like          142   1e-37   
ref|NP_001050713.2|  Os03g0633500                                       144   1e-37   
gb|KDP40274.1|  hypothetical protein JCGZ_02272                         144   1e-37   
ref|XP_004302055.1|  PREDICTED: auxin-responsive protein IAA16-like     144   1e-37   
gb|ADL70486.1|  indole-3-acetic acid inducible 2                        142   1e-37   
ref|XP_008810170.1|  PREDICTED: auxin-responsive protein IAA30-like     144   1e-37   
ref|XP_008224186.1|  PREDICTED: auxin-induced protein IAA4-like         142   1e-37   
gb|ADC29382.1|  indole-3-acetic acid inducible 6                        141   1e-37   
ref|XP_002884465.1|  indoleacetic acid-induced protein 16               144   1e-37   
ref|XP_010550916.1|  PREDICTED: LOW QUALITY PROTEIN: auxin-respon...    143   1e-37   
ref|XP_010463960.1|  PREDICTED: auxin-responsive protein IAA16-like     144   1e-37   
sp|Q75GK0.1|IAA11_ORYSJ  RecName: Full=Auxin-responsive protein I...    144   1e-37   
gb|KFK31703.1|  hypothetical protein AALP_AA6G148100                    143   1e-37   
gb|KHG19190.1|  Auxin-responsive IAA16 -like protein                    144   1e-37   
gb|KHG00541.1|  Auxin-responsive IAA16 -like protein                    143   1e-37   
ref|XP_002281771.1|  PREDICTED: auxin-responsive protein IAA16-like     144   1e-37   
emb|CAN63268.1|  hypothetical protein VITISV_013635                     143   2e-37   
gb|KDO53921.1|  hypothetical protein CISIN_1g029966mg                   140   2e-37   
ref|XP_008785900.1|  PREDICTED: auxin-responsive protein IAA1-like      142   2e-37   
ref|XP_006465436.1|  PREDICTED: auxin-responsive protein IAA17-like     142   2e-37   
ref|XP_006298679.1|  hypothetical protein CARUB_v10014772mg             141   2e-37   
ref|XP_010917600.1|  PREDICTED: auxin-responsive protein IAA30 is...    143   2e-37   
gb|KHN30563.1|  Auxin-responsive protein IAA14                          143   2e-37   
gb|KCW60452.1|  hypothetical protein EUGRSUZ_H03171                     140   3e-37   
gb|EYU46510.1|  hypothetical protein MIMGU_mgv1a013084mg                143   3e-37   
ref|XP_008362015.1|  PREDICTED: auxin-responsive protein IAA14-like     143   3e-37   
ref|XP_006443920.1|  hypothetical protein CICLE_v10022032mg             142   3e-37   
ref|XP_009111119.1|  PREDICTED: auxin-responsive protein IAA17          142   3e-37   
emb|CDY15493.1|  BnaA08g27770D                                          142   3e-37   
ref|XP_011079949.1|  PREDICTED: auxin-induced protein AUX28-like        143   3e-37   
sp|P49679.1|IAA4_PEA  RecName: Full=Auxin-induced protein IAA4          141   4e-37   
ref|XP_008391048.1|  PREDICTED: auxin-induced protein 22D               141   4e-37   
ref|XP_002531288.1|  Auxin-responsive protein IAA16, putative           143   5e-37   
ref|XP_006443921.1|  hypothetical protein CICLE_v10022032mg             142   5e-37   
ref|XP_008351274.1|  PREDICTED: auxin-induced protein 22D-like          141   5e-37   
ref|NP_001266085.1|  IAA23                                              140   5e-37   
ref|XP_009413916.1|  PREDICTED: auxin-responsive protein IAA30-like     142   5e-37   
gb|AFK47937.1|  unknown                                                 140   5e-37   
ref|XP_002885542.1|  indoleacetic acid-induced protein 2                140   5e-37   
ref|XP_008438589.1|  PREDICTED: auxin-responsive protein IAA4-like      141   5e-37   
ref|XP_007013279.1|  Indoleacetic acid-induced protein 16, putative     142   5e-37   
ref|XP_008451270.1|  PREDICTED: auxin-induced protein AUX28-like        142   6e-37   
gb|KDO58189.1|  hypothetical protein CISIN_1g044582mg                   141   6e-37   
gb|KHG04941.1|  Auxin-induced AUX28                                     142   6e-37   
gb|ADC29363.1|  indole-3-acetic acid inducible 2                        140   7e-37   
ref|NP_001275031.1|  auxin-responsive protein IAA14-like                141   7e-37   
gb|KHN31465.1|  Auxin-responsive protein IAA16                          142   7e-37   
gb|AFK37379.1|  unknown                                                 142   7e-37   
gb|AFK45766.1|  unknown                                                 142   7e-37   
ref|XP_002299625.1|  auxin-induced protein IAA4                         141   8e-37   
ref|XP_009107784.1|  PREDICTED: auxin-responsive protein IAA1           140   8e-37   
gb|KDO68557.1|  hypothetical protein CISIN_1g026823mg                   141   8e-37   
gb|EEC75792.1|  hypothetical protein OsI_12721                          139   8e-37   
ref|XP_003591806.1|  Indoleacetic acid-induced-like protein             141   1e-36   
emb|CDO98081.1|  unnamed protein product                                140   1e-36   
ref|XP_009416094.1|  PREDICTED: auxin-responsive protein IAA1-lik...    140   1e-36   
ref|XP_010466600.1|  PREDICTED: auxin-responsive protein IAA2 iso...    139   1e-36   
ref|XP_003521268.1|  PREDICTED: auxin-induced protein AUX28-like        142   1e-36   
ref|NP_001267662.1|  auxin-induced protein AUX28-like                   141   1e-36   
dbj|BAA85822.1|  Aux/IAA protein                                        139   1e-36   
ref|XP_009337294.1|  PREDICTED: auxin-responsive protein IAA14-like     141   1e-36   
ref|XP_004965976.1|  PREDICTED: auxin-responsive protein IAA23-li...    139   1e-36   
ref|XP_009761467.1|  PREDICTED: auxin-responsive protein IAA16          141   1e-36   
ref|NP_001237212.1|  uncharacterized protein LOC100499872               140   1e-36   
ref|XP_008377585.1|  PREDICTED: auxin-responsive protein IAA1           140   1e-36   
ref|XP_008449289.1|  PREDICTED: auxin-induced protein 22B               139   2e-36   
gb|KHN05057.1|  Auxin-responsive protein IAA14                          141   2e-36   
ref|XP_009591035.1|  PREDICTED: auxin-responsive protein IAA7-like      140   2e-36   
ref|XP_006605305.1|  PREDICTED: uncharacterized protein LOC100499...    140   2e-36   
gb|EMS51633.1|  Auxin-responsive protein IAA23                          139   2e-36   
ref|XP_009395806.1|  PREDICTED: auxin-responsive protein IAA1-like      140   2e-36   
ref|NP_001142395.1|  uncharacterized protein LOC100274569               141   2e-36   
ref|XP_003521753.1|  PREDICTED: auxin-responsive protein IAA16-like     141   2e-36   
gb|ADL36587.1|  ARF domain class transcription factor                   139   2e-36   
gb|EPS72871.1|  hypothetical protein M569_01882                         140   2e-36   
ref|XP_007162490.1|  hypothetical protein PHAVU_001G156600g             140   2e-36   
ref|XP_009786555.1|  PREDICTED: auxin-responsive protein IAA27-like     141   2e-36   
ref|NP_001275398.1|  auxin/indole-3-acetic acid 3                       140   2e-36   
ref|XP_003554705.1|  PREDICTED: auxin-responsive protein IAA16-li...    140   3e-36   
gb|AAP44407.1|  auxin-induced protein 4                                 140   3e-36   
ref|XP_009610435.1|  PREDICTED: auxin-responsive protein IAA16          140   3e-36   
ref|XP_004965975.1|  PREDICTED: auxin-responsive protein IAA23-li...    139   3e-36   
ref|XP_010512011.1|  PREDICTED: auxin-responsive protein IAA2-like      138   3e-36   
ref|XP_009416093.1|  PREDICTED: auxin-responsive protein IAA1-lik...    139   3e-36   
ref|NP_001235069.1|  uncharacterized protein LOC100500488               138   3e-36   
ref|XP_004302956.1|  PREDICTED: auxin-responsive protein IAA17-li...    139   4e-36   
ref|XP_004134097.1|  PREDICTED: auxin-responsive protein IAA14-li...    139   4e-36   
gb|AFZ78621.1|  hypothetical protein                                    139   4e-36   
ref|XP_002517023.1|  Auxin-responsive protein IAA7, putative            138   4e-36   
ref|NP_001280875.1|  auxin-responsive protein IAA14-like                140   4e-36   
ref|XP_008224185.1|  PREDICTED: auxin-responsive protein IAA14          140   4e-36   
gb|EAZ27868.1|  hypothetical protein OsJ_11821                          140   4e-36   
ref|XP_003568814.1|  PREDICTED: auxin-responsive protein IAA15-like     139   5e-36   
ref|NP_001240213.1|  auxin-induced protein ali50                        140   5e-36   
gb|AFK44192.1|  unknown                                                 140   5e-36   
ref|XP_010488344.1|  PREDICTED: auxin-responsive protein IAA2-like      139   5e-36   
gb|KEH43016.1|  auxin-responsive AUX/IAA family protein                 140   5e-36   
gb|KEH43017.1|  auxin-responsive AUX/IAA family protein                 139   8e-36   
gb|KHN44139.1|  Auxin-responsive protein IAA17                          140   8e-36   
gb|ABD98055.1|  auxin-regulated protein                                 139   8e-36   



>ref|XP_010110304.1| Auxin-induced protein AUX22 [Morus notabilis]
 gb|EXC25824.1| Auxin-induced protein AUX22 [Morus notabilis]
Length=189

 Score =   238 bits (606),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 124/182 (68%), Positives = 138/182 (76%), Gaps = 6/182 (3%)
 Frame = -3

Query  633  KSGLGLEITELRLGLPGSGHGGADKGTTGEKKRVFSEMIDG-GDDHDRsssnnnnnkkKQ  457
            K GLGLEITELRLGLPG G          EKKRVFSE+I G G D + S    +    K 
Sbjct  3    KEGLGLEITELRLGLPGGGQE-----IRNEKKRVFSEIIGGDGRDVEASGDRKSQTTSKN  57

Query  456  QVVGWPPVCSYRRKNNSDEGKKMYVKVSMDGAPFLRKIDLTTHKTYSHLLIALDNLFDCR  277
            QVVGWPPVCSYRRKN+ +  +K+YVKVSMDGAPFLRKIDL+ HK YS L IAL+ LF C 
Sbjct  58   QVVGWPPVCSYRRKNSFNNNEKVYVKVSMDGAPFLRKIDLSMHKGYSDLAIALEELFGCF  117

Query  276  GIGEALKDADSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRIMKRSEAKGIGLHAKN  97
            G+GE LKD DS E+APIYEDKDGDWMLVGDVPW MFVESCKRLRIMK+S+A G GL  K+
Sbjct  118  GMGEGLKDTDSCEFAPIYEDKDGDWMLVGDVPWEMFVESCKRLRIMKKSDAMGFGLEPKS  177

Query  96   FL  91
            FL
Sbjct  178  FL  179



>ref|XP_002517528.1| Auxin-induced protein AUX22, putative [Ricinus communis]
 gb|EEF44692.1| Auxin-induced protein AUX22, putative [Ricinus communis]
Length=194

 Score =   236 bits (602),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 125/195 (64%), Positives = 145/195 (74%), Gaps = 12/195 (6%)
 Frame = -3

Query  636  AKSGLGLEITELRLGLPGSGHGGADKGTTGEKKRVFSEMI--DGGDDHDRsssnnnnnkk  463
            AK GLGLEITELRLGLPG      D+G   EKKRVFSE+   +G      +++ +     
Sbjct  2    AKEGLGLEITELRLGLPG-----GDQGIKNEKKRVFSEVSGDEGNSASSTTTTCDQKIPT  56

Query  462  KQQVVGWPPVCSYRRKNNSDEGK-----KMYVKVSMDGAPFLRKIDLTTHKTYSHLLIAL  298
            K QVVGWPPVCSYR++N+ +E +     K+YVKVSMDGAPFLRKIDL THK YS L++AL
Sbjct  57   KSQVVGWPPVCSYRKRNSFNEKERLETSKLYVKVSMDGAPFLRKIDLGTHKEYSDLVLAL  116

Query  297  DNLFDCRGIGEALKDADSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRIMKRSEAKG  118
            + LF C GIG+ALKDADSS+Y PIYEDKDGDWMLVGDVPW MF ESCKRLRIMKRSEAK 
Sbjct  117  EKLFGCFGIGKALKDADSSDYVPIYEDKDGDWMLVGDVPWEMFTESCKRLRIMKRSEAKC  176

Query  117  IGLHAKNFLKEMSKE  73
             GL  K  LK ++ E
Sbjct  177  FGLQQKGALKGITNE  191



>ref|XP_007216003.1| hypothetical protein PRUPE_ppa011935mg [Prunus persica]
 gb|EMJ17202.1| hypothetical protein PRUPE_ppa011935mg [Prunus persica]
Length=190

 Score =   235 bits (600),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 130/191 (68%), Positives = 148/191 (77%), Gaps = 8/191 (4%)
 Frame = -3

Query  636  AKSGLGLEITELRLGLPGSGHGGADKGTTGEKKRVFSEMIDGGDDHDRsssnn--nnnkk  463
            AK GLGLEITELRLGL  SG    DK    EKKRVFS+ I GGD H+ S+S++    ++ 
Sbjct  2    AKEGLGLEITELRLGL-SSGPRLVDKN---EKKRVFSQ-IAGGDGHNNSTSSDDDRKSET  56

Query  462  KQQVVGWPPVCSYRRKNNS-DEGKKMYVKVSMDGAPFLRKIDLTTHKTYSHLLIALDNLF  286
            K QVVGWPPVCSYRRK NS +E  KMYVKVSMDGAPFLRKIDL+ H  Y+ L +AL+ LF
Sbjct  57   KNQVVGWPPVCSYRRKINSLNETSKMYVKVSMDGAPFLRKIDLSIHNQYADLAVALEKLF  116

Query  285  DCRGIGEALKDADSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRIMKRSEAKGIGLH  106
             C GIGE LKDA++ E+APIYEDKDGDWMLVGDVPW MF+ESCKRLRIMKRS+AKG GL 
Sbjct  117  GCFGIGEVLKDAENCEFAPIYEDKDGDWMLVGDVPWEMFIESCKRLRIMKRSDAKGFGLQ  176

Query  105  AKNFLKEMSKE  73
             K FLK   K+
Sbjct  177  PKGFLKATMKD  187



>gb|AFK39785.1| unknown [Lotus japonicus]
Length=188

 Score =   235 bits (599),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 125/183 (68%), Positives = 137/183 (75%), Gaps = 4/183 (2%)
 Frame = -3

Query  636  AKSGLGLEITELRLGLPGSGHGGADKGTTGEKKRVFSEMIDGGDDHDRsssnnnnnkkKQ  457
            AK GLGLEITELRLGLPG G   +DK    EKKRVFSE+  GG D +  S      KK +
Sbjct  2    AKEGLGLEITELRLGLPG-GERMSDKN---EKKRVFSEIEGGGGDENSRSGERRVEKKSE  57

Query  456  QVVGWPPVCSYRRKNNSDEGKKMYVKVSMDGAPFLRKIDLTTHKTYSHLLIALDNLFDCR  277
             VVGWPPVCSYR+KN+ +E  KMYVKVSMDGAPFLRKIDL+ HK YS L  AL+ LF C 
Sbjct  58   VVVGWPPVCSYRKKNSVNEASKMYVKVSMDGAPFLRKIDLSMHKGYSDLAFALEKLFGCY  117

Query  276  GIGEALKDADSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRIMKRSEAKGIGLHAKN  97
            G+ EALKDAD  E+ PIYEDKDGDWMLVGDVPW MF ESCKRLRIMKRS+AKG  L  K 
Sbjct  118  GMVEALKDADKCEHVPIYEDKDGDWMLVGDVPWEMFTESCKRLRIMKRSDAKGFSLQQKG  177

Query  96   FLK  88
             LK
Sbjct  178  SLK  180



>ref|XP_008228609.1| PREDICTED: auxin-induced protein IAA6 [Prunus mume]
Length=190

 Score =   233 bits (594),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 130/191 (68%), Positives = 146/191 (76%), Gaps = 8/191 (4%)
 Frame = -3

Query  636  AKSGLGLEITELRLGLPGSGHGGADKGTTGEKKRVFSEMIDGGDDHDRsss--nnnnnkk  463
            AK GLGLEITELRLGL  SG    DK    EKKRVFSE I GGD H+ S+S  ++  ++ 
Sbjct  2    AKEGLGLEITELRLGL-SSGPRLVDKN---EKKRVFSE-IAGGDGHNNSTSGDDDRKSET  56

Query  462  KQQVVGWPPVCSYRRKNNS-DEGKKMYVKVSMDGAPFLRKIDLTTHKTYSHLLIALDNLF  286
            K QVVGWPPVCSYRRK NS +E  KMYVKVSMDGAPFLRKIDL+ H  Y+ L +AL+ LF
Sbjct  57   KNQVVGWPPVCSYRRKINSLNETSKMYVKVSMDGAPFLRKIDLSIHNQYADLAVALEKLF  116

Query  285  DCRGIGEALKDADSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRIMKRSEAKGIGLH  106
             C GIG  LKDA++ E+APIYEDKDGDWMLVGDVPW MF ESCKRLRIMKRS+AKG GL 
Sbjct  117  GCFGIGSVLKDAENCEFAPIYEDKDGDWMLVGDVPWEMFTESCKRLRIMKRSDAKGFGLQ  176

Query  105  AKNFLKEMSKE  73
             K FLK   K+
Sbjct  177  PKGFLKATMKD  187



>ref|NP_001237849.1| auxin-induced protein AUX22 [Glycine max]
 sp|P13088.1|AUX22_SOYBN RecName: Full=Auxin-induced protein AUX22 [Glycine max]
 gb|AAA33944.1| auxin-regulated protein (Aux22) [Glycine max]
 gb|KHN47799.1| Auxin-induced protein AUX22 [Glycine soja]
Length=195

 Score =   231 bits (590),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 124/186 (67%), Positives = 140/186 (75%), Gaps = 3/186 (2%)
 Frame = -3

Query  636  AKSGLGLEITELRLGLPGSGHGGADKGTTGEKKRVFSEMIDGGDDHDRsss--nnnnnkk  463
            AK GLGLEITELRLGLP + H  +      EKKR FSE+ DG  D + SS   +      
Sbjct  2    AKEGLGLEITELRLGLPDAEHQVSVVNKKNEKKRAFSEIDDGVGDENSSSGGGDRKMETN  61

Query  462  KQQVVGWPPVCSYRRKNNSDEG-KKMYVKVSMDGAPFLRKIDLTTHKTYSHLLIALDNLF  286
            K QVVGWPPVCSYR+KN+ +EG  KMYVKVSMDGAPFLRKIDL  HK YS L +ALD LF
Sbjct  62   KSQVVGWPPVCSYRKKNSMNEGASKMYVKVSMDGAPFLRKIDLGLHKGYSDLALALDKLF  121

Query  285  DCRGIGEALKDADSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRIMKRSEAKGIGLH  106
             C G+ EALK+AD+SE+ PIYEDKDGDWMLVGDVPW MF+ESCKRLRIMK+S+AKG GL 
Sbjct  122  GCYGMVEALKNADNSEHVPIYEDKDGDWMLVGDVPWEMFMESCKRLRIMKKSDAKGFGLQ  181

Query  105  AKNFLK  88
             K  LK
Sbjct  182  PKGSLK  187



>gb|KDP37177.1| hypothetical protein JCGZ_06233 [Jatropha curcas]
Length=195

 Score =   229 bits (583),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 122/191 (64%), Positives = 140/191 (73%), Gaps = 10/191 (5%)
 Frame = -3

Query  636  AKSGLGLEITELRLGLPGSG-HGGADKG--TTGEKKRVFSEMIDGGDDHDRsssnnnnnk  466
            A  GLGLEITELRLGLPG+     A +G     EKKRVFS++   GD    ++ +     
Sbjct  2    ATEGLGLEITELRLGLPGAAVETAATEGFINKNEKKRVFSQV--SGDKGSSTTVDRKMIP  59

Query  465  kKQQVVGWPPVCSYRRKNNSDE-----GKKMYVKVSMDGAPFLRKIDLTTHKTYSHLLIA  301
             K QVVGWPPVCSYR+KN+ +E       KMYVKVSMDGAPFLRKIDL  HK YS L++A
Sbjct  60   TKSQVVGWPPVCSYRKKNSFNEKERVENSKMYVKVSMDGAPFLRKIDLGIHKEYSDLIVA  119

Query  300  LDNLFDCRGIGEALKDADSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRIMKRSEAK  121
            L+ LF C  IG+ALKDADSS+Y PIYEDKDGDWML+GDVPW MF+ESCKRLRIMK SEAK
Sbjct  120  LEKLFGCFDIGKALKDADSSDYVPIYEDKDGDWMLLGDVPWEMFIESCKRLRIMKSSEAK  179

Query  120  GIGLHAKNFLK  88
            G GL  K+ LK
Sbjct  180  GFGLQPKSGLK  190



>ref|XP_009782641.1| PREDICTED: auxin-induced protein AUX22-like [Nicotiana sylvestris]
Length=181

 Score =   228 bits (580),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 119/186 (64%), Positives = 140/186 (75%), Gaps = 14/186 (8%)
 Frame = -3

Query  618  LEITELRLGLPGSGHGGADKGTTGEKKRVFSEMI----DGGDDHDRsssnnnnnkkKQQV  451
            LEITELRLGLPG       K    EKKRV+SE+     +  ++ +    N    + K QV
Sbjct  5    LEITELRLGLPGG------KIEKSEKKRVYSEITSSDQNSSNNVNYDDDNYKYCQNKNQV  58

Query  450  VGWPPVCSYRRKNNSDEGKKMYVKVSMDGAPFLRKIDLTTHKTYSHLLIALDNLFDCRGI  271
            VGWPPVCSYR+KN+     KMYVKVSMDGAPFLRK+DL+ HK YS L++AL+ LFDC GI
Sbjct  59   VGWPPVCSYRKKNSF----KMYVKVSMDGAPFLRKVDLSNHKDYSQLVMALEKLFDCYGI  114

Query  270  GEALKDADSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRIMKRSEAKGIGLHAKNFL  91
            GEAL+DAD SEY PIYEDKDGDWML+GDVPW MF ESCKRLRIMKRS+AK IG+ A++FL
Sbjct  115  GEALEDADKSEYVPIYEDKDGDWMLLGDVPWQMFSESCKRLRIMKRSDAKVIGIGARDFL  174

Query  90   KEMSKE  73
            K MS+E
Sbjct  175  KGMSQE  180



>ref|XP_003528374.1| PREDICTED: auxin-induced protein AUX22 [Glycine max]
 gb|KHN01366.1| Auxin-induced protein AUX22 [Glycine soja]
Length=187

 Score =   228 bits (580),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 120/183 (66%), Positives = 136/183 (74%), Gaps = 5/183 (3%)
 Frame = -3

Query  636  AKSGLGLEITELRLGLPGSGHGGADKGTTGEKKRVFSEMIDGGDDHDRsssnnnnnkkKQ  457
            AK GLGLEITELRLGLP + H         EKKR FS++    D++  S  +      K 
Sbjct  2    AKEGLGLEITELRLGLPDAEH--VTVVNKNEKKRAFSQI---DDENSSSGGDRKIKTNKS  56

Query  456  QVVGWPPVCSYRRKNNSDEGKKMYVKVSMDGAPFLRKIDLTTHKTYSHLLIALDNLFDCR  277
            QVVGWPPVCSYR+KN+ +EG KMYVKVSMDGAPFLRKIDL  HK YS L +ALD LF   
Sbjct  57   QVVGWPPVCSYRKKNSMNEGSKMYVKVSMDGAPFLRKIDLGLHKGYSDLALALDKLFGSY  116

Query  276  GIGEALKDADSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRIMKRSEAKGIGLHAKN  97
            G+ EALK+AD+SE+ PIYEDKDGDWMLVGDVPW MF+ESCKRLRIMKRS+AKG GL  K 
Sbjct  117  GMVEALKNADNSEHVPIYEDKDGDWMLVGDVPWEMFMESCKRLRIMKRSDAKGFGLQPKG  176

Query  96   FLK  88
             LK
Sbjct  177  SLK  179



>ref|NP_001268086.1| auxin-induced protein 22A-like [Vitis vinifera]
 gb|ADR80322.1| indole-3-acetic acid-induced protein 19 [Vitis vinifera]
Length=192

 Score =   228 bits (580),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 124/193 (64%), Positives = 140/193 (73%), Gaps = 14/193 (7%)
 Frame = -3

Query  627  GLGLEITELRLGLPG---SGH-GGADKGTTGEKKRVFSEMIDGGDDHDRsssnnnnnkkK  460
             LGLEITELRLGLPG   S H  G +     EKKRVFSEM   GD    +++     + K
Sbjct  2    ALGLEITELRLGLPGHADSNHLAGVNAVERNEKKRVFSEM--SGDSS--ATTCERKAQNK  57

Query  459  QQVVGWPPVCSYRRKNNSD-----EGKKMYVKVSMDGAPFLRKIDLTTHKTYSHLLIALD  295
             QVVGWPPVCSYRRKN+ +     E  KMYVKVSMDGAPFLRKIDL++H+ Y +L+ A +
Sbjct  58   NQVVGWPPVCSYRRKNSFNDKDRTEATKMYVKVSMDGAPFLRKIDLSSHQGYFNLVTAFE  117

Query  294  NLFDCRGIGEALKDADSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRIMKRSEAKGI  115
             LF C GIGEALKDADSSEY PIYEDKDGDWMLVGDVPW MF+ESCKRLRI K+SE K  
Sbjct  118  ELFGCFGIGEALKDADSSEYIPIYEDKDGDWMLVGDVPWEMFIESCKRLRIKKKSETKNF  177

Query  114  GLHAKNFLKEMSK  76
            GL   N LKE+ K
Sbjct  178  GLQL-NSLKELQK  189



>emb|CAN70530.1| hypothetical protein VITISV_010218 [Vitis vinifera]
Length=192

 Score =   226 bits (576),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 124/193 (64%), Positives = 140/193 (73%), Gaps = 14/193 (7%)
 Frame = -3

Query  627  GLGLEITELRLGLPG---SGH-GGADKGTTGEKKRVFSEMIDGGDDHDRsssnnnnnkkK  460
             LGLEITELRLGLPG   S H  G +     EKKRVFSEM   GD    +++     + K
Sbjct  2    ALGLEITELRLGLPGHADSHHPAGVNAVERNEKKRVFSEM--SGDSS--ATTCERKAQNK  57

Query  459  QQVVGWPPVCSYRRKNNSD-----EGKKMYVKVSMDGAPFLRKIDLTTHKTYSHLLIALD  295
             QVVGWPPVCSYRRKN+ +     E  KMYVKVSMDGAPFLRKIDL++H+ Y +L+ A +
Sbjct  58   NQVVGWPPVCSYRRKNSFNDKDRTEATKMYVKVSMDGAPFLRKIDLSSHQGYFNLVTAFE  117

Query  294  NLFDCRGIGEALKDADSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRIMKRSEAKGI  115
             LF C GIGEALKDADSSEY PIYEDKDGDWMLVGDVPW MF+ESCKRLRI K+SE K  
Sbjct  118  ELFGCFGIGEALKDADSSEYIPIYEDKDGDWMLVGDVPWEMFIESCKRLRIKKKSETKNF  177

Query  114  GLHAKNFLKEMSK  76
            GL   N LKE+ K
Sbjct  178  GLQL-NSLKELQK  189



>sp|P32293.1|AX22A_VIGRR RecName: Full=Auxin-induced protein 22A; AltName: Full=Indole-3-acetic 
acid-induced protein ARG3 [Vigna radiata var. radiata]
 dbj|BAA03308.1| hypothetical protein [Vigna radiata var. radiata]
Length=194

 Score =   226 bits (575),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 117/185 (63%), Positives = 139/185 (75%), Gaps = 2/185 (1%)
 Frame = -3

Query  636  AKSGLGLEITELRLGLPGSGHGG-ADKGTTGEKKRVFSEMIDGGDDHDRsssnnnnnkkK  460
            AK GLGLEITELRLGLP + H   A+K    + KRVFSE+ D GD++  S    +   + 
Sbjct  2    AKEGLGLEITELRLGLPDAEHVAVANKNGEKKNKRVFSEIDDVGDENSSSGGGGDRKMEN  61

Query  459  Q-QVVGWPPVCSYRRKNNSDEGKKMYVKVSMDGAPFLRKIDLTTHKTYSHLLIALDNLFD  283
            + QVVGWPPVCSYR+KN+ +E  KMYVKVSMDGAPFLRK+DL  HK YS L  AL+ LF 
Sbjct  62   KNQVVGWPPVCSYRKKNSVNEASKMYVKVSMDGAPFLRKMDLGMHKGYSDLAFALEKLFG  121

Query  282  CRGIGEALKDADSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRIMKRSEAKGIGLHA  103
            C G+ EALK+ ++ E+ PIYEDKDGDWMLVGDVPW MF+ESCKRLRIMKR++AKG GL  
Sbjct  122  CYGMVEALKNVENGEHVPIYEDKDGDWMLVGDVPWEMFMESCKRLRIMKRADAKGFGLQP  181

Query  102  KNFLK  88
            K  LK
Sbjct  182  KGSLK  186



>ref|XP_009619832.1| PREDICTED: auxin-induced protein AUX22-like [Nicotiana tomentosiformis]
Length=181

 Score =   224 bits (570),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 118/186 (63%), Positives = 140/186 (75%), Gaps = 14/186 (8%)
 Frame = -3

Query  618  LEITELRLGLPGSGHGGADKGTTGEKKRVFSEMI----DGGDDHDRsssnnnnnkkKQQV  451
            LEITELRLGLPG       K    EKKRV+SE+     +  ++ +    N N  + K + 
Sbjct  5    LEITELRLGLPGG------KLEKNEKKRVYSEITSSDQNSSNNVNYDDGNYNYCQNKNEF  58

Query  450  VGWPPVCSYRRKNNSDEGKKMYVKVSMDGAPFLRKIDLTTHKTYSHLLIALDNLFDCRGI  271
            VGWPPVCSYR+KN+     KMYVKVSMDGAPFLRK+DL+ HK YS L++AL+ LFDC GI
Sbjct  59   VGWPPVCSYRKKNSF----KMYVKVSMDGAPFLRKVDLSNHKDYSQLVMALEKLFDCYGI  114

Query  270  GEALKDADSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRIMKRSEAKGIGLHAKNFL  91
            GEAL+DAD SEY PIYEDKDGDWML+GDVPW MF ESCKRLRIMKRS+AK IG+ A++FL
Sbjct  115  GEALEDADKSEYVPIYEDKDGDWMLLGDVPWQMFSESCKRLRIMKRSDAKVIGIGARDFL  174

Query  90   KEMSKE  73
            K MS+E
Sbjct  175  KGMSQE  180



>ref|XP_009339008.1| PREDICTED: auxin-induced protein IAA6 [Pyrus x bretschneideri]
Length=189

 Score =   223 bits (568),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 127/191 (66%), Positives = 142/191 (74%), Gaps = 8/191 (4%)
 Frame = -3

Query  636  AKSGLGLEITELRLGLPGSGHGGADKGTTGEKKRVFSEMIDGGDDHDRsss--nnnnnkk  463
            AK GLGLEITELRLGL  SG    DK    EKKR FS+ IDGGD    ++S     N + 
Sbjct  2    AKEGLGLEITELRLGL-CSGPSLVDKN---EKKRAFSK-IDGGDGRYSTTSGDYPKNGQT  56

Query  462  KQQVVGWPPVCSYRRKNNS-DEGKKMYVKVSMDGAPFLRKIDLTTHKTYSHLLIALDNLF  286
            K +VVGWPP+CSYR K NS +E  KMYVKVSMDGAPFLRKIDL+ H  Y+ L +AL+ LF
Sbjct  57   KNEVVGWPPLCSYRMKINSLNETSKMYVKVSMDGAPFLRKIDLSMHNEYADLALALEKLF  116

Query  285  DCRGIGEALKDADSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRIMKRSEAKGIGLH  106
             C GIGE LKDAD+ E+APIYEDKDGDWMLVGDVPW MFVESCKRLRIMKRS+AKG GL 
Sbjct  117  GCYGIGEVLKDADNCEFAPIYEDKDGDWMLVGDVPWEMFVESCKRLRIMKRSDAKGFGLQ  176

Query  105  AKNFLKEMSKE  73
             K F K   +E
Sbjct  177  HKGFRKATMEE  187



>ref|XP_011045350.1| PREDICTED: auxin-induced protein AUX22 [Populus euphratica]
Length=188

 Score =   223 bits (568),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 117/184 (64%), Positives = 135/184 (73%), Gaps = 14/184 (8%)
 Frame = -3

Query  624  LGLEITELRLGLPGSGHGGADKGTTGEKKRVFSEMIDGGDDHDRsssnnnnnkkKQQVVG  445
            LGLEITELRLG PGS     +KG   EKKRVFSE+         S+++    +   QVVG
Sbjct  5    LGLEITELRLGPPGS-----EKGPKNEKKRVFSEL----SGEANSTTDGRKTQTTSQVVG  55

Query  444  WPPVCSYRRKN-----NSDEGKKMYVKVSMDGAPFLRKIDLTTHKTYSHLLIALDNLFDC  280
            WPPVCSYR+KN     +S E  K+YVKVSMDGAPFLRK+DL  HK YS L++AL+ LF C
Sbjct  56   WPPVCSYRKKNSFNEKDSHETSKIYVKVSMDGAPFLRKVDLGMHKEYSDLVVALEKLFGC  115

Query  279  RGIGEALKDADSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRIMKRSEAKGIGLHAK  100
             GIG+ALKD D  EY PIYEDKDGDWMLVGDVPW MF+ESCKRLRIMKRSEAKG GL ++
Sbjct  116  FGIGKALKDTDDCEYVPIYEDKDGDWMLVGDVPWEMFIESCKRLRIMKRSEAKGFGLQSR  175

Query  99   NFLK  88
              L+
Sbjct  176  GALQ  179



>emb|CDO98080.1| unnamed protein product [Coffea canephora]
Length=191

 Score =   223 bits (567),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 125/194 (64%), Positives = 142/194 (73%), Gaps = 9/194 (5%)
 Frame = -3

Query  636  AKSGLGLEITELRLGLPGSGHGGADKGT--TGEKKRVFSEMI-DGGDDHDRsssnnnnnk  466
            AK GLGLEITELRLGLPG   GG D+    TG KKR FSE+  D   +  RS+   +   
Sbjct  2    AKDGLGLEITELRLGLPG---GGFDQVMLKTG-KKRAFSEIEEDHHQNGKRSNEAKSEII  57

Query  465  kKQQVVGWPPVCSYRRK--NNSDEGKKMYVKVSMDGAPFLRKIDLTTHKTYSHLLIALDN  292
             K QVVGWPPVCS+RRK   N  E  K+YVKVSMDGAPFLRKIDL   K YS L + L+ 
Sbjct  58   PKNQVVGWPPVCSHRRKISFNGQESTKLYVKVSMDGAPFLRKIDLAAQKCYSDLQLNLER  117

Query  291  LFDCRGIGEALKDADSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRIMKRSEAKGIG  112
            LF C GIGEAL DADSSE  PIYEDKDGDWML+GDVPW MF+ESC RLRIMKR++AKGIG
Sbjct  118  LFGCYGIGEALNDADSSECVPIYEDKDGDWMLLGDVPWTMFIESCIRLRIMKRTDAKGIG  177

Query  111  LHAKNFLKEMSKEG  70
            +H K+ LK  S++G
Sbjct  178  IHPKSSLKGTSRDG  191



>ref|XP_009608400.1| PREDICTED: auxin-induced protein AUX22-like [Nicotiana tomentosiformis]
Length=178

 Score =   222 bits (565),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 117/180 (65%), Positives = 137/180 (76%), Gaps = 12/180 (7%)
 Frame = -3

Query  618  LEITELRLGLPGSGHGGADKGTTGEKKRVFSEMIDGGDDHDRsssnnnnnkkKQQVVGWP  439
             EITELRLGLPG      +K ++  KKR F E+    DD   S+++N   + K QVVGWP
Sbjct  5    FEITELRLGLPG------EKPSSFGKKRAFFEI---DDDSKSSNNDNTKCQNKNQVVGWP  55

Query  438  PVCSYRRKNN---SDEGKKMYVKVSMDGAPFLRKIDLTTHKTYSHLLIALDNLFDCRGIG  268
            PVC+YRRKN+    +   KMYVKVSMDGAPFLRK+DL THK YS L++AL+ LFDC GIG
Sbjct  56   PVCAYRRKNSFNGRESSSKMYVKVSMDGAPFLRKLDLNTHKGYSELVMALEKLFDCYGIG  115

Query  267  EALKDADSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRIMKRSEAKGIGLHAKNFLK  88
            +AL+DA+SSEY PIYEDKDGDWMLVGDVPW MF ESCKRLRI K+S+A  IGL AKNFLK
Sbjct  116  KALEDAESSEYVPIYEDKDGDWMLVGDVPWEMFTESCKRLRIKKKSDANVIGLRAKNFLK  175



>ref|NP_001266080.1| IAA19 [Solanum lycopersicum]
 gb|AEX00361.1| IAA19 [Solanum lycopersicum]
Length=192

 Score =   222 bits (566),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 121/193 (63%), Positives = 146/193 (76%), Gaps = 17/193 (9%)
 Frame = -3

Query  618  LEITELRLGLPGSGHGGADKGTTGEKKRVFSEMIDG------GDDHDRsssnnnnnkkKQ  457
            LEITELRLGLPG   G  +K    EKKRV+SE+          ++++   +NN   + K 
Sbjct  5    LEITELRLGLPG---GILEKN---EKKRVYSEITTSDRNSSSSNNNNNVEANNYKCQYKN  58

Query  456  QVVGWPPVCSYRRKNN-----SDEGKKMYVKVSMDGAPFLRKIDLTTHKTYSHLLIALDN  292
            +VVGWPPVC+YR+KN+     ++   KMYVKVSMDGAPFLRK+DL+THK Y  L++AL+ 
Sbjct  59   EVVGWPPVCAYRKKNSFNGREAESNNKMYVKVSMDGAPFLRKVDLSTHKGYDQLVMALEK  118

Query  291  LFDCRGIGEALKDADSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRIMKRSEAKGIG  112
            LFDC GIGEAL+DAD SE+ PIYEDKDGDWMLVGDVPW MF ESCKRLRIMKRSEAK IG
Sbjct  119  LFDCYGIGEALEDADKSEFVPIYEDKDGDWMLVGDVPWIMFSESCKRLRIMKRSEAKVIG  178

Query  111  LHAKNFLKEMSKE  73
            L A++FLK MS+E
Sbjct  179  LGARDFLKGMSQE  191



>ref|XP_004302959.1| PREDICTED: auxin-induced protein AUX22-like [Fragaria vesca subsp. 
vesca]
Length=195

 Score =   222 bits (566),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 127/198 (64%), Positives = 139/198 (70%), Gaps = 19/198 (10%)
 Frame = -3

Query  633  KSGLGLEITELRLGLPGSGHGGADKGTTGEKKRVFSEMI---------DGGDDHDRsssn  481
            K GLGLEITELRLGLP SG    D     EKKRVFSE+            GD  D     
Sbjct  3    KEGLGLEITELRLGLP-SGPSLGD--NIKEKKRVFSEINGGGDGNGANTTGDRDD-----  54

Query  480  nnnnkkKQQVVGWPPVCSYRRKNNS-DEGKKMYVKVSMDGAPFLRKIDLTTHKTYSHLLI  304
                + K QVVGWPPVCSYRRK NS  E  KMYVKVSMDGAPFLRK+DL  H  Y+ L++
Sbjct  55   YRKGQAKSQVVGWPPVCSYRRKVNSLSETSKMYVKVSMDGAPFLRKLDLGMHSCYADLVV  114

Query  303  ALDNLFDCRGIGEALKDADSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRIMKRSEA  124
            AL+ LF C GIGE LKDADS E+APIYEDKDGDWMLVGDVPW MF+ESCKRLRIMKRS+A
Sbjct  115  ALEKLFGCFGIGEVLKDADSCEFAPIYEDKDGDWMLVGDVPWEMFLESCKRLRIMKRSDA  174

Query  123  KGIG-LHAKNFLKEMSKE  73
            KG G L +K FLK   K+
Sbjct  175  KGFGILESKGFLKATMKD  192



>ref|XP_006343104.1| PREDICTED: auxin-induced protein AUX22-like [Solanum tuberosum]
Length=195

 Score =   222 bits (566),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 121/196 (62%), Positives = 143/196 (73%), Gaps = 20/196 (10%)
 Frame = -3

Query  618  LEITELRLGLPGSGHGGADKGTTGEKKRVFSEMIDG---------GDDHDRsssnnnnnk  466
            LEITELRLGLPG       K    EKKRV+SE+            G+  D   ++N   +
Sbjct  5    LEITELRLGLPGG------KLEKNEKKRVYSEITTSDRNSSNNVNGNVVDGVEADNYKCQ  58

Query  465  kKQQVVGWPPVCSYRRKNNSD-----EGKKMYVKVSMDGAPFLRKIDLTTHKTYSHLLIA  301
             K +VVGWPPVC+YR+KN+ +        KMYVKVSMDGAPFLRK+DL+THK Y+ L++A
Sbjct  59   NKNEVVGWPPVCAYRKKNSFNGREAGSNSKMYVKVSMDGAPFLRKVDLSTHKGYAQLVMA  118

Query  300  LDNLFDCRGIGEALKDADSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRIMKRSEAK  121
            L+ LFDC GIGEAL+DAD SE+ PIYEDKDGDWMLVGDVPW MF ESCKRLRIMKRSEAK
Sbjct  119  LEKLFDCYGIGEALEDADKSEFVPIYEDKDGDWMLVGDVPWQMFSESCKRLRIMKRSEAK  178

Query  120  GIGLHAKNFLKEMSKE  73
             IGL A++FLK MS+E
Sbjct  179  VIGLGARDFLKGMSQE  194



>ref|XP_002299626.1| hypothetical protein POPTR_0001s17780g [Populus trichocarpa]
 gb|EEE84431.1| hypothetical protein POPTR_0001s17780g [Populus trichocarpa]
Length=189

 Score =   221 bits (563),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 116/185 (63%), Positives = 134/185 (72%), Gaps = 14/185 (8%)
 Frame = -3

Query  624  LGLEITELRLGLPGSGHGGADKGTTGEKKRVFSEMIDGGDDHDRsssnnnnnkkKQQVVG  445
            LGLEITELRLG PGS     + G   EKKRVFSE+         S+++    +   QVVG
Sbjct  5    LGLEITELRLGPPGS-----ENGPKNEKKRVFSEL----SGEANSTTDGRKTQTTSQVVG  55

Query  444  WPPVCSYRRKN-----NSDEGKKMYVKVSMDGAPFLRKIDLTTHKTYSHLLIALDNLFDC  280
            WPPVCSYR+KN     +S E  K+YVKVSMDGAPFLRK+DL  HK YS L++AL+ LF C
Sbjct  56   WPPVCSYRKKNSFNEKDSHETSKIYVKVSMDGAPFLRKVDLGMHKEYSDLVVALEKLFGC  115

Query  279  RGIGEALKDADSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRIMKRSEAKGIGLHAK  100
             GIG+ALKD D  EY PIYEDKDGDWMLVGDVPW MF+ESCKRLRIMKRSEAKG GL  +
Sbjct  116  FGIGKALKDTDDCEYVPIYEDKDGDWMLVGDVPWEMFIESCKRLRIMKRSEAKGFGLQPR  175

Query  99   NFLKE  85
              L++
Sbjct  176  GALQQ  180



>ref|XP_009802365.1| PREDICTED: auxin-induced protein AUX22-like [Nicotiana sylvestris]
Length=178

 Score =   220 bits (560),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 115/180 (64%), Positives = 135/180 (75%), Gaps = 12/180 (7%)
 Frame = -3

Query  618  LEITELRLGLPGSGHGGADKGTTGEKKRVFSEMIDGGDDHDRsssnnnnnkkKQQVVGWP  439
             EITELRLGLPG       K  + EKKR F E+    DD   S+++N   + K QV+GWP
Sbjct  5    FEITELRLGLPGG------KPISFEKKRTFFEI---DDDSKSSNNDNTKCQNKNQVIGWP  55

Query  438  PVCSYRRKNN---SDEGKKMYVKVSMDGAPFLRKIDLTTHKTYSHLLIALDNLFDCRGIG  268
            PVC+YR KN+    +   KMYVKVSMDGAPFLRK+DL THK YS L++AL+ LFDC GIG
Sbjct  56   PVCAYRNKNSFNGRESSSKMYVKVSMDGAPFLRKLDLNTHKGYSELVLALEKLFDCYGIG  115

Query  267  EALKDADSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRIMKRSEAKGIGLHAKNFLK  88
            +AL+DA+SSEY PIYEDKDGDWMLVGDVPW MF ESCKRLRI KRS+A  IG+ AKNFL+
Sbjct  116  KALEDAESSEYVPIYEDKDGDWMLVGDVPWEMFTESCKRLRIKKRSDANVIGVRAKNFLR  175



>gb|ACU19128.1| unknown [Glycine max]
Length=169

 Score =   219 bits (559),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 115/173 (66%), Positives = 131/173 (76%), Gaps = 5/173 (3%)
 Frame = -3

Query  636  AKSGLGLEITELRLGLPGSGHGGADKGTTGEKKRVFSEMIDGGDDHDRsssnnnnnkkKQ  457
            AK GLGLEITELRLGLP + H         EKKR FS++    D++  S  +      K 
Sbjct  2    AKEGLGLEITELRLGLPDAEH--VTVVNKNEKKRAFSQI---DDENSSSGGDRKIKTNKS  56

Query  456  QVVGWPPVCSYRRKNNSDEGKKMYVKVSMDGAPFLRKIDLTTHKTYSHLLIALDNLFDCR  277
            QVVGWPPVCSYR+KN+ +EG KMYVKVSMDGAPFLRKIDL  HK YS L +ALD LF   
Sbjct  57   QVVGWPPVCSYRKKNSMNEGSKMYVKVSMDGAPFLRKIDLGLHKGYSDLALALDKLFGSY  116

Query  276  GIGEALKDADSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRIMKRSEAKG  118
            G+ EALK+AD+SE+ PIYEDKDGDWMLVGDVPW MF+ESCKRLRIMKRS+AKG
Sbjct  117  GMVEALKNADNSEHVPIYEDKDGDWMLVGDVPWEMFMESCKRLRIMKRSDAKG  169



>ref|XP_009623794.1| PREDICTED: auxin-induced protein AUX22-like [Nicotiana tomentosiformis]
Length=179

 Score =   218 bits (556),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 115/186 (62%), Positives = 133/186 (72%), Gaps = 16/186 (9%)
 Frame = -3

Query  618  LEITELRLGLPGSGHGGADKGTTGEKKRVFSEMIDGGDDHDRsssnnnnnkkKQQVVGWP  439
            LEITELRLG+PG            EKKRVFSE+ +     + +  ++     K QVVGWP
Sbjct  5    LEITELRLGIPG------------EKKRVFSEIDNDRSSSNVNDDDDVKCHNKNQVVGWP  52

Query  438  PVCSYRRKN----NSDEGKKMYVKVSMDGAPFLRKIDLTTHKTYSHLLIALDNLFDCRGI  271
            PVC+YRRKN    NS EG KMYVKVS+DG PFLRK+DL T K YS  ++ L+ LF C GI
Sbjct  53   PVCAYRRKNYSFNNSCEGSKMYVKVSLDGVPFLRKVDLGTQKDYSEFVMNLEKLFGCYGI  112

Query  270  GEALKDADSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRIMKRSEAKGIGLHAKNFL  91
             EA+KD DSSEY PIYEDKDGDWML+GDVPW MF ESCKRLRIMKRS+AK IG+  K+FL
Sbjct  113  CEAVKDGDSSEYIPIYEDKDGDWMLLGDVPWEMFTESCKRLRIMKRSDAKVIGIRTKDFL  172

Query  90   KEMSKE  73
            K M KE
Sbjct  173  KGMYKE  178



>ref|XP_010254224.1| PREDICTED: auxin-induced protein AUX22 [Nelumbo nucifera]
Length=181

 Score =   218 bits (554),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 117/177 (66%), Positives = 130/177 (73%), Gaps = 9/177 (5%)
 Frame = -3

Query  624  LGLEITELRLGLPGSGHGGADKGTTGEKKRVFSEMIDGGDDHDRsssnnnnnkkKQQVVG  445
            LGLEITELRLGLPG    G       EKKR FSE+    DD   SSS +  +K K QVVG
Sbjct  4    LGLEITELRLGLPG----GNPAKEKNEKKRAFSEI---ADDEHSSSSGDRKSKTKAQVVG  56

Query  444  WPPVCSYRRKNN--SDEGKKMYVKVSMDGAPFLRKIDLTTHKTYSHLLIALDNLFDCRGI  271
            WPPVCSYR+KNN    E  KMYVKVSMDGAPFLRKIDL THK YS L ++ + LF C GI
Sbjct  57   WPPVCSYRKKNNVHEKESAKMYVKVSMDGAPFLRKIDLNTHKGYSDLAVSFEKLFGCFGI  116

Query  270  GEALKDADSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRIMKRSEAKGIGLHAK  100
            G   +D+DSSEY PIYEDKDGDWM+VGD PW MF ESCKRLRIMKRS+AKG GL ++
Sbjct  117  GGVWEDSDSSEYIPIYEDKDGDWMMVGDTPWEMFTESCKRLRIMKRSDAKGFGLQSR  173



>ref|XP_008377581.1| PREDICTED: auxin-induced protein IAA6 [Malus domestica]
Length=190

 Score =   218 bits (555),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 124/191 (65%), Positives = 141/191 (74%), Gaps = 8/191 (4%)
 Frame = -3

Query  636  AKSGLGLEITELRLGLPGSGHGGADKGTTGEKKRVFSEMIDGGDDHDRsss--nnnnnkk  463
            AK GLGLEITELRLGL  SG    DK    EKKR FS+ IDGGD    +++     N + 
Sbjct  2    AKEGLGLEITELRLGL-CSGPSLVDKN---EKKRAFSK-IDGGDGRYSTTAGDYPKNGQT  56

Query  462  KQQVVGWPPVCSYRRKNNS-DEGKKMYVKVSMDGAPFLRKIDLTTHKTYSHLLIALDNLF  286
            K +VVGWPPVCSYR K NS +E  KMYVKVSMDGAPFLRKIDL+ H  Y+ L +AL+ LF
Sbjct  57   KNEVVGWPPVCSYRMKINSLNETTKMYVKVSMDGAPFLRKIDLSMHNEYADLALALEKLF  116

Query  285  DCRGIGEALKDADSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRIMKRSEAKGIGLH  106
               GIGE LK+AD+ E+APIYEDKDGDWMLVGDVPW MFVESCKRLRIMKRSEAKG GL 
Sbjct  117  GYYGIGEVLKNADNCEFAPIYEDKDGDWMLVGDVPWEMFVESCKRLRIMKRSEAKGFGLQ  176

Query  105  AKNFLKEMSKE  73
             K   ++ + E
Sbjct  177  HKEGFRKATME  187



>ref|XP_007150684.1| hypothetical protein PHAVU_005G172900g [Phaseolus vulgaris]
 gb|ESW22678.1| hypothetical protein PHAVU_005G172900g [Phaseolus vulgaris]
Length=183

 Score =   218 bits (554),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 117/184 (64%), Positives = 131/184 (71%), Gaps = 13/184 (7%)
 Frame = -3

Query  633  KSGLGLEITELRLGLPGSGHGGADKGTTGEKKRVFSEMI--DGGDDHDRsssnnnnnkkK  460
            K  LGLEITELRLGLPG    G       +KKRVFS+++  +   + DR           
Sbjct  3    KEDLGLEITELRLGLPG----GEKTEKETKKKRVFSDIVGENSSSEEDRKKETK------  52

Query  459  QQVVGWPPVCSYRRKNNSDEGKKMYVKVSMDGAPFLRKIDLTTHKTYSHLLIALDNLFDC  280
             QVVGWPPVCSYR+KN+ +E K MYVKVSMDGAPFLRKIDL  HK YS    ALDN F C
Sbjct  53   NQVVGWPPVCSYRKKNSVNEAK-MYVKVSMDGAPFLRKIDLAMHKGYSDFAFALDNFFGC  111

Query  279  RGIGEALKDADSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRIMKRSEAKGIGLHAK  100
             GIGEALKDA+++E+ PIYEDKDGDWMLVGDVPW MF ESCKRLRIMKRS+AKG  L  K
Sbjct  112  YGIGEALKDAENAEHVPIYEDKDGDWMLVGDVPWEMFTESCKRLRIMKRSDAKGFDLQPK  171

Query  99   NFLK  88
              LK
Sbjct  172  GSLK  175



>ref|NP_001236733.1| uncharacterized protein LOC100305535 [Glycine max]
 gb|ACU13262.1| unknown [Glycine max]
Length=189

 Score =   218 bits (554),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 117/183 (64%), Positives = 135/183 (74%), Gaps = 5/183 (3%)
 Frame = -3

Query  633  KSGLGLEIT-ELRLGLPGSGHGGADKGTTGEKKRVFSEMIDGGDDHDRsssnnnnnkkKQ  457
            K  +GLEIT ELRLGLPG    G ++     KKRVFSE+    DD + SS  +   + K 
Sbjct  3    KEAVGLEITTELRLGLPGGELPGKNEKI---KKRVFSEIQAHDDDENSSSEQDRKIQTKN  59

Query  456  QVVGWPPVCSYRRKNNSDEGKKMYVKVSMDGAPFLRKIDLTTHKTYSHLLIALDNLFDCR  277
            QVVGWPPVCSYR+KN  +E  KMYVKVSMDGAPFLRKIDL  HK YS L++AL+  F C 
Sbjct  60   QVVGWPPVCSYRKKNTVNE-TKMYVKVSMDGAPFLRKIDLAMHKGYSELVLALEKFFGCY  118

Query  276  GIGEALKDADSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRIMKRSEAKGIGLHAKN  97
            GI EALKDA+++E+ PIYEDKDGDWMLVGDVPW MF+ESCKRLRIMK S+AKG  L  K 
Sbjct  119  GIREALKDAENAEHVPIYEDKDGDWMLVGDVPWEMFIESCKRLRIMKGSDAKGFDLQPKG  178

Query  96   FLK  88
             LK
Sbjct  179  SLK  181



>gb|KHN44138.1| Auxin-induced protein 22C [Glycine soja]
Length=189

 Score =   218 bits (554),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 117/183 (64%), Positives = 134/183 (73%), Gaps = 5/183 (3%)
 Frame = -3

Query  633  KSGLGLEIT-ELRLGLPGSGHGGADKGTTGEKKRVFSEMIDGGDDHDRsssnnnnnkkKQ  457
            K  +GLEIT ELRLGLPG   G         KKRVFS++    DD + SS  +   + K 
Sbjct  3    KEAVGLEITTELRLGLPG---GELPDKNEKIKKRVFSDIQAHDDDENSSSEQDRKIQTKN  59

Query  456  QVVGWPPVCSYRRKNNSDEGKKMYVKVSMDGAPFLRKIDLTTHKTYSHLLIALDNLFDCR  277
            QVVGWPPVCSYR+KN  +E  KMYVKVSMDGAPFLRKIDL  HK YS L++AL+  F C 
Sbjct  60   QVVGWPPVCSYRKKNTVNE-TKMYVKVSMDGAPFLRKIDLAMHKGYSELVLALEKFFGCY  118

Query  276  GIGEALKDADSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRIMKRSEAKGIGLHAKN  97
            GI EALKDA+++E+ PIYEDKDGDWMLVGDVPW MF+ESCKRLRIMKRS+AKG  L  K 
Sbjct  119  GIREALKDAENAEHVPIYEDKDGDWMLVGDVPWEMFIESCKRLRIMKRSDAKGFDLQPKG  178

Query  96   FLK  88
             LK
Sbjct  179  SLK  181



>gb|ADG60257.1| IAA19-like protein [Nicotiana tabacum]
Length=175

 Score =   216 bits (550),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 114/186 (61%), Positives = 132/186 (71%), Gaps = 16/186 (9%)
 Frame = -3

Query  618  LEITELRLGLPGSGHGGADKGTTGEKKRVFSEMIDGGDDHDRsssnnnnnkkKQQVVGWP  439
            LEITELRLG+PG            EKKRVFSE+ +     + +  ++     K QVVGWP
Sbjct  1    LEITELRLGIPG------------EKKRVFSEIDNDRSSSNVNDDDDVKCHNKNQVVGWP  48

Query  438  PVCSYRRKN----NSDEGKKMYVKVSMDGAPFLRKIDLTTHKTYSHLLIALDNLFDCRGI  271
            PVC+YRRKN    N  EG KMYVKVS+DG PFLRK+DL T K YS  ++ L+ LF C GI
Sbjct  49   PVCAYRRKNYSFNNICEGSKMYVKVSLDGVPFLRKVDLGTQKDYSEFVMNLEKLFGCYGI  108

Query  270  GEALKDADSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRIMKRSEAKGIGLHAKNFL  91
             EA+KD DSSEY PIYEDKDGDWML+GDVPW MF ESCKRLRIMKRS+AK IG+  K+FL
Sbjct  109  CEAVKDGDSSEYIPIYEDKDGDWMLLGDVPWEMFTESCKRLRIMKRSDAKVIGIRTKDFL  168

Query  90   KEMSKE  73
            K M KE
Sbjct  169  KGMYKE  174



>ref|XP_010249883.1| PREDICTED: auxin-induced protein AUX22 [Nelumbo nucifera]
Length=194

 Score =   214 bits (545),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 113/179 (63%), Positives = 128/179 (72%), Gaps = 8/179 (4%)
 Frame = -3

Query  630  SGLGLEITELRLGLPGSGHGGADKGTTGEKKRVFSEMIDGGDDHDRsssnnnnnkkKQQV  451
            + LGLEITELRLGLPG    G       EKKR FSE+ +  D++  +S  +   + K Q+
Sbjct  2    TSLGLEITELRLGLPG----GCPPKEKNEKKREFSEIAE--DENSSNSGGDRKTQTKTQI  55

Query  450  VGWPPVCSYRRKNN--SDEGKKMYVKVSMDGAPFLRKIDLTTHKTYSHLLIALDNLFDCR  277
            VGWPPVCSYR+KNN    E  K YVKVSMDGAPFLRKIDL THK Y  L  A + LF C 
Sbjct  56   VGWPPVCSYRKKNNVHEKETAKNYVKVSMDGAPFLRKIDLNTHKGYPDLAAAFEKLFGCF  115

Query  276  GIGEALKDADSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRIMKRSEAKGIGLHAK  100
            GIG   KD+DSSEY PIYEDKDGDWMLVGD PW MF ESCKRLRIMKRSEAK +GL ++
Sbjct  116  GIGGVWKDSDSSEYIPIYEDKDGDWMLVGDTPWEMFTESCKRLRIMKRSEAKDVGLQSR  174



>gb|KHM98781.1| Auxin-induced protein 22C [Glycine soja]
Length=187

 Score =   214 bits (544),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 118/183 (64%), Positives = 131/183 (72%), Gaps = 7/183 (4%)
 Frame = -3

Query  633  KSGLGLEIT-ELRLGLPGSGHGGADKGTTGEKKRVFSEMIDGGDDHDRsssnnnnnkkKQ  457
            K G+GLEIT ELRLGLPG   G         KKRVFSE+  G  D + SS  +   + K 
Sbjct  3    KEGVGLEITTELRLGLPG---GELPDKNEKMKKRVFSEINQG--DENSSSEEDRKIQTKN  57

Query  456  QVVGWPPVCSYRRKNNSDEGKKMYVKVSMDGAPFLRKIDLTTHKTYSHLLIALDNLFDCR  277
            QVVGWPPVCSYR+KN  +E  KMYVKVSMDGAPFLRKIDL  HK YS L +AL+  F C 
Sbjct  58   QVVGWPPVCSYRKKNTINE-TKMYVKVSMDGAPFLRKIDLAMHKGYSELALALEKFFGCY  116

Query  276  GIGEALKDADSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRIMKRSEAKGIGLHAKN  97
            GIG ALKD ++ E  PIYEDKDGDWMLVGDVPW MF+ESCKRLRIMKRS+AKG  L  K 
Sbjct  117  GIGSALKDEENVEQVPIYEDKDGDWMLVGDVPWEMFIESCKRLRIMKRSDAKGFDLQPKG  176

Query  96   FLK  88
             LK
Sbjct  177  SLK  179



>ref|XP_007024034.1| Indole-3-acetic acid inducible 19 [Theobroma cacao]
 gb|EOY26656.1| Indole-3-acetic acid inducible 19 [Theobroma cacao]
Length=191

 Score =   212 bits (539),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 116/183 (63%), Positives = 133/183 (73%), Gaps = 14/183 (8%)
 Frame = -3

Query  636  AKSGLGLEITELRLGLPGSGHGGADKGT-TGEKKRVFSEMIDGGDDHDRsssnnnnnkkK  460
            AK GLGLEITELRLGLPG G   A  G    EKKRVFSE+ +  D+ +   SN+   + K
Sbjct  2    AKEGLGLEITELRLGLPGGGAHSAQHGMDKNEKKRVFSEISE--DNENGKISNDQKMQSK  59

Query  459  QQVVGWPPVCSYRRKNNSDE------GKKMYVKVSMDGAPFLRKIDLTTHKTYSHLLIAL  298
             QVVGWPPVCSYR+KN+  E        K+YVKVSMDGAPFLRKIDL  HK YS L  AL
Sbjct  60   SQVVGWPPVCSYRKKNSFSEKLDGSKASKIYVKVSMDGAPFLRKIDLGMHKGYSDLATAL  119

Query  297  DNLFDCRGIGEALKDADSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRIMKRSEAKG  118
            + LF     GEAL+DA+S E+ PIYEDKDGDWML GDVPW MF+ESCKRLRIMKR++AKG
Sbjct  120  EMLF-----GEALRDAESCEFVPIYEDKDGDWMLAGDVPWEMFIESCKRLRIMKRADAKG  174

Query  117  IGL  109
             G+
Sbjct  175  FGV  177



>ref|XP_011072282.1| PREDICTED: auxin-induced protein IAA6 [Sesamum indicum]
Length=184

 Score =   209 bits (533),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 117/188 (62%), Positives = 136/188 (72%), Gaps = 14/188 (7%)
 Frame = -3

Query  642  MAAKSGLGLEITELRLGLPGSGHGGADKGTTGEKKRVFSEMIDGGDDHDRsssnnnnnkk  463
            M   SGLGLE TELRLGLPG G          EKKR FS++       +++++       
Sbjct  1    MDRSSGLGLE-TELRLGLPGGGEV-----EKNEKKRAFSDI---SGGEEKAAAAAGAGNN  51

Query  462  KQQVVGWPPVCSYRRKNNSDEGKKMYVKVSMDGAPFLRKIDLTTHKTYSHLLIALDNLFD  283
            K QVVGWPPVC+YRRKN S  G KMYVKVSMDGAPFLRKIDL++HK YS LL+AL+ LF 
Sbjct  52   KNQVVGWPPVCAYRRKN-SFNGVKMYVKVSMDGAPFLRKIDLSSHKGYSDLLMALEQLFG  110

Query  282  CRGIGEALKDADSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRIMKRSEAKGIGLHA  103
            C GI EAL+DAD  EY PIYEDKD DWML+GDVPW MF+ESCKRLRIMKRS+AKG    A
Sbjct  111  CFGIAEALEDADKCEYVPIYEDKDTDWMLLGDVPWEMFIESCKRLRIMKRSDAKG----A  166

Query  102  KNFLKEMS  79
            K+ LK ++
Sbjct  167  KDLLKALA  174



>ref|XP_002304179.1| auxin-induced protein 22A [Populus trichocarpa]
 gb|EEE79158.1| auxin-induced protein 22A [Populus trichocarpa]
Length=184

 Score =   209 bits (532),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 117/190 (62%), Positives = 136/190 (72%), Gaps = 19/190 (10%)
 Frame = -3

Query  624  LGLEITELRLGLPGSGHGGADKGTTGEKKRVFSEMIDGGDDHDRsssnnnnnkkKQQVVG  445
            LGLEITELRLGLPGS     D G   +KKRVFSE+    +    S++++   + K QVVG
Sbjct  5    LGLEITELRLGLPGS-----DDGHKNDKKRVFSEVSGEAN----STTDDRKVQTKSQVVG  55

Query  444  WPPVCSYRR------KNNSDEGKKMYVKVSMDGAPFLRKIDLTTHKTYSHLLIALDNLFD  283
            WPPVCSYR+      ++   E  K+YVKVSMDGAPFLRKIDL  HK YS L++AL+ LF 
Sbjct  56   WPPVCSYRKNISFNERDRHHETSKIYVKVSMDGAPFLRKIDLGMHKEYSDLVVALERLFG  115

Query  282  CRGIGEALKDADSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRIMKRSEAKGIGLHA  103
            C GIG+ALKD    EY PIYEDKDGDWMLVGDVPW MF ESCKRLRIMK SEAKG GL  
Sbjct  116  CYGIGKALKD----EYVPIYEDKDGDWMLVGDVPWEMFFESCKRLRIMKSSEAKGFGLQP  171

Query  102  KNFLKEMSKE  73
            +  LK +SK+
Sbjct  172  RGALKGISKD  181



>sp|P49680.1|IAA6_PEA RecName: Full=Auxin-induced protein IAA6 [Pisum sativum]
 emb|CAA48300.1| auxin-induced protein [Pisum sativum]
Length=179

 Score =   208 bits (529),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 119/183 (65%), Positives = 137/183 (75%), Gaps = 8/183 (4%)
 Frame = -3

Query  636  AKSGLGLEITELRLGLPGSGHGGADKGTTGEKKRVFSEMIDGGDDHDRsssnnnnnkkKQ  457
            A+ GLGLEITELRLGL         +    EKKR+FSE IDGG + +  S +  +  KK 
Sbjct  2    AREGLGLEITELRLGL------SCGEPKKNEKKRMFSE-IDGGVEENGGSGDRKSVDKKN  54

Query  456  QVVGWPPVCSYRRKNNSDEGKKMYVKVSMDGAPFLRKIDLTTHKTYSHLLIALDNLFDCR  277
            QVVGWPPVCSYR+KN  +EG KMY+KVSMDGAP+LRKIDL  HK Y  L +AL+ LFDC 
Sbjct  55   QVVGWPPVCSYRKKN-MNEGSKMYMKVSMDGAPYLRKIDLCLHKGYLELALALEKLFDCC  113

Query  276  GIGEALKDADSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRIMKRSEAKGIGLHAKN  97
            GI EALKDA++ E+ PIYEDKDGDWMLVGDVPW MF+ESCKRLRIMKRS+AKG  L  K 
Sbjct  114  GIEEALKDAENCEHVPIYEDKDGDWMLVGDVPWEMFIESCKRLRIMKRSDAKGFDLQPKG  173

Query  96   FLK  88
             LK
Sbjct  174  SLK  176



>sp|O24541.1|AX22C_VIGRR RecName: Full=Auxin-induced protein 22C; AltName: Full=Indole-3-acetic 
acid-induced protein ARG12 [Vigna radiata var. radiata]
 dbj|BAA20847.1| Aux22c [Vigna radiata]
Length=188

 Score =   208 bits (530),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 118/183 (64%), Positives = 133/183 (73%), Gaps = 6/183 (3%)
 Frame = -3

Query  633  KSGLGLEITELRLGLPGSG-HGGADKGTTGEKKRVFSEMIDGGDDHDRsssnnnnnkkKQ  457
            K  LGLEITELRLGLPG+G     DK     KKRVFS++    +  + SS  +   + K 
Sbjct  3    KEDLGLEITELRLGLPGAGGENNTDKDKNKNKKRVFSDI----EGENSSSEEDGKKETKN  58

Query  456  QVVGWPPVCSYRRKNNSDEGKKMYVKVSMDGAPFLRKIDLTTHKTYSHLLIALDNLFDCR  277
            QVVGWPPVCSYR+KN  +E  K+YVKVSMDGAPFLRKIDL  HK YS L  ALD  F C 
Sbjct  59   QVVGWPPVCSYRKKNTVNE-PKLYVKVSMDGAPFLRKIDLAMHKGYSDLAFALDKFFGCY  117

Query  276  GIGEALKDADSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRIMKRSEAKGIGLHAKN  97
            GI EALKDA+++E+ PIYEDKDGDWMLVGDVPW MF ESCKRLRIMKRS+AKG  L  K 
Sbjct  118  GICEALKDAENAEHVPIYEDKDGDWMLVGDVPWEMFRESCKRLRIMKRSDAKGFDLQPKG  177

Query  96   FLK  88
             LK
Sbjct  178  SLK  180



>ref|XP_009802988.1| PREDICTED: auxin-induced protein AUX22-like [Nicotiana sylvestris]
Length=172

 Score =   207 bits (528),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 109/182 (60%), Positives = 129/182 (71%), Gaps = 15/182 (8%)
 Frame = -3

Query  618  LEITELRLGLPGSGHGGADKGTTGEKKRVFSEMIDGGDDHDRsssnnnnnkkKQQVVGWP  439
            LEITELRLG+PG            EKKRVFS++    +  + +  ++     K +VVGWP
Sbjct  5    LEITELRLGIPG------------EKKRVFSDIDSDRNSSNVNDDDDVKCHNKNRVVGWP  52

Query  438  PVCSYRRKNNSDEGKKMYVKVSMDGAPFLRKIDLTTHKTYSHLLIALDNLFDCRGIGEAL  259
            PVC+YRRKN S    KMYVKVSMDG PFLRK+DL     YS  ++ L+ LF C GI EAL
Sbjct  53   PVCAYRRKNYS---SKMYVKVSMDGVPFLRKVDLGIQNDYSEFVMNLEKLFGCYGICEAL  109

Query  258  KDADSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRIMKRSEAKGIGLHAKNFLKEMS  79
            K+ DSSEY PIYEDKDGDWML+GDVPW MF ESCKRLRIMKRS+AK IG+  K+FLK MS
Sbjct  110  KEGDSSEYIPIYEDKDGDWMLLGDVPWEMFTESCKRLRIMKRSDAKVIGIRTKDFLKGMS  169

Query  78   KE  73
            K+
Sbjct  170  KD  171



>ref|XP_004135828.1| PREDICTED: auxin-induced protein AUX22-like [Cucumis sativus]
 ref|XP_004169365.1| PREDICTED: auxin-induced protein AUX22-like [Cucumis sativus]
 gb|KGN45331.1| hypothetical protein Csa_7G440550 [Cucumis sativus]
Length=194

 Score =   207 bits (528),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 111/198 (56%), Positives = 134/198 (68%), Gaps = 22/198 (11%)
 Frame = -3

Query  636  AKSGLGLEITELRLGLPGSGHGGADKGTTGEKKRVFSEMIDGG------DDHDRsssnnn  475
            AK  LG EITELRLGL   G+   +     EKKR F ++++G       +D +R    N+
Sbjct  2    AKESLGFEITELRLGLGLPGNSNKN-----EKKRAFDDIVNGDHEPTRDNDDNRVGRKNS  56

Query  474  nnkkKQQVVGWPPVCSYRRKNN-----------SDEGKKMYVKVSMDGAPFLRKIDLTTH  328
            N   K QVVGWPPVCSYR++N+            +E  KMYVK+SMDGAPFLRK+DL +H
Sbjct  57   NTTSKGQVVGWPPVCSYRKRNSFGEKESSSLLHENENSKMYVKISMDGAPFLRKLDLGSH  116

Query  327  KTYSHLLIALDNLFDCRGIGEALKDADSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRL  148
            K YS L +AL+ LF C G G+ LK  +S +Y PIYEDKDGDWMLVGDVPW MF+ESCKRL
Sbjct  117  KGYSDLALALEKLFACFGTGKTLKHGESCDYVPIYEDKDGDWMLVGDVPWEMFIESCKRL  176

Query  147  RIMKRSEAKGIGLHAKNF  94
            RIMKRSEAKG GL  K+ 
Sbjct  177  RIMKRSEAKGFGLQFKDL  194



>ref|XP_011080978.1| PREDICTED: auxin-induced protein 22C-like [Sesamum indicum]
Length=170

 Score =   206 bits (524),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 111/182 (61%), Positives = 130/182 (71%), Gaps = 19/182 (10%)
 Frame = -3

Query  633  KSGLGLEITELRLGLPGSGHGGADKGTTGEKKRVFSEMIDGGDDHDRsssnnnnnkkKQQ  454
            K+G+G   TELRLGLPG    G + G   EKKR FS+   GG++ +             Q
Sbjct  3    KNGVGSLETELRLGLPG----GGEVGIKNEKKRGFSDFYGGGENKN-------------Q  45

Query  453  VVGWPPVCSYRRKNNSDEGKKMYVKVSMDGAPFLRKIDLTTHKTYSHLLIALDNLFDCRG  274
            VVGWPPV +YRRKN    G KMYVKVSMDGAPFLRK+DL+ HK YS L+ AL+ LF C G
Sbjct  46   VVGWPPVAAYRRKNVFT-GGKMYVKVSMDGAPFLRKVDLSMHKGYSELVKALEELFGCHG  104

Query  273  IGEALKDADSS-EYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRIMKRSEAKGIGLHAKN  97
            IGEALKD +   EY PIYEDKDGDWML+GDVPW MF ESCKRLRIMKR++A G+G+HAK+
Sbjct  105  IGEALKDEEEKCEYVPIYEDKDGDWMLLGDVPWQMFRESCKRLRIMKRADANGVGVHAKD  164

Query  96   FL  91
             L
Sbjct  165  PL  166



>ref|XP_006427105.1| hypothetical protein CICLE_v10026400mg [Citrus clementina]
 gb|ESR40345.1| hypothetical protein CICLE_v10026400mg [Citrus clementina]
Length=233

 Score =   207 bits (528),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 115/196 (59%), Positives = 134/196 (68%), Gaps = 12/196 (6%)
 Frame = -3

Query  657  LWLIDMAAKSGLGLEITELRLGLPG-----SGHGGADKGTTGEKKRVFSEMIDGGDDHDR  493
            L L+       + LEITELRLGLPG     SG   +      EKKR FS++ D  + +  
Sbjct  33   LTLVHQQLAIAMELEITELRLGLPGRDGCDSGLNSSSNNNKNEKKRAFSDICD--EANYE  90

Query  492  sssnnnnnkkKQQVVGWPPVCSYRRKNNSDE-----GKKMYVKVSMDGAPFLRKIDLTTH  328
            ++     N  K QVVGWPPVCSYRRKN+ +E       KMYVKVSMDGAPFLRKIDL  H
Sbjct  91   TNGERKINPTKSQVVGWPPVCSYRRKNSFNEKDGGESSKMYVKVSMDGAPFLRKIDLGMH  150

Query  327  KTYSHLLIALDNLFDCRGIGEALKDADSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRL  148
            + Y  L ++L+ LF C G+ EALKDADSSE+ PIYEDKDGDWML GDVPW MF E+CKRL
Sbjct  151  QGYPDLAMSLEKLFGCFGLSEALKDADSSEFVPIYEDKDGDWMLAGDVPWEMFAETCKRL  210

Query  147  RIMKRSEAKGIGLHAK  100
            RIMKRSEAKG GLH +
Sbjct  211  RIMKRSEAKGFGLHPR  226



>ref|XP_006465437.1| PREDICTED: auxin-induced protein AUX22-like [Citrus sinensis]
Length=190

 Score =   206 bits (524),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 114/185 (62%), Positives = 131/185 (71%), Gaps = 12/185 (6%)
 Frame = -3

Query  624  LGLEITELRLGLPG-----SGHGGADKGTTGEKKRVFSEMIDGGDDHDRsssnnnnnkkK  460
            + LEITELRLGLPG     SG   +      EKKR FS++ D  + +  ++     N  K
Sbjct  1    MELEITELRLGLPGRDGCDSGLNSSSNNNKNEKKRAFSDICD--EANYETNGERKINPTK  58

Query  459  QQVVGWPPVCSYRRKNNSDE-----GKKMYVKVSMDGAPFLRKIDLTTHKTYSHLLIALD  295
             QVVGWPPVCSYRRKN+ +E       KMYVKVSMDGAPFLRKIDL  H+ Y  L +AL+
Sbjct  59   SQVVGWPPVCSYRRKNSFNEKDRVESSKMYVKVSMDGAPFLRKIDLGMHQGYPDLAMALE  118

Query  294  NLFDCRGIGEALKDADSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRIMKRSEAKGI  115
             LF C G+ EALKDADSSE+ PIYEDKDGDWML GDVPW MF E+CKRLRIMKRSEAKG 
Sbjct  119  KLFGCFGLSEALKDADSSEFVPIYEDKDGDWMLAGDVPWEMFAETCKRLRIMKRSEAKGF  178

Query  114  GLHAK  100
            GLH +
Sbjct  179  GLHPR  183



>ref|NP_001242293.1| uncharacterized protein LOC100811879 [Glycine max]
 gb|ACU21371.1| unknown [Glycine max]
Length=187

 Score =   206 bits (523),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 115/183 (63%), Positives = 128/183 (70%), Gaps = 7/183 (4%)
 Frame = -3

Query  633  KSGLGLEIT-ELRLGLPGSGHGGADKGTTGEKKRVFSEMIDGGDDHDRsssnnnnnkkKQ  457
            K G+GLEIT ELRLGLPG   G         KKRVFSE+  G  D + SS  +   + K 
Sbjct  3    KEGVGLEITTELRLGLPG---GELPDKNEKMKKRVFSEINQG--DENSSSEEDRKIQTKN  57

Query  456  QVVGWPPVCSYRRKNNSDEGKKMYVKVSMDGAPFLRKIDLTTHKTYSHLLIALDNLFDCR  277
            QVVGWPPVCSYR+KN  +E  KMYVKVSMDGAPFLRKIDL   K YS L +AL+  F C 
Sbjct  58   QVVGWPPVCSYRKKNTINE-TKMYVKVSMDGAPFLRKIDLAMRKGYSELALALEKFFGCY  116

Query  276  GIGEALKDADSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRIMKRSEAKGIGLHAKN  97
            GIG ALKD ++    PIYEDKDGDWMLVGDVPW MF+ESCKRLRIMKRS+AKG     K 
Sbjct  117  GIGSALKDEENVVQVPIYEDKDGDWMLVGDVPWEMFIESCKRLRIMKRSDAKGFDPQPKG  176

Query  96   FLK  88
             LK
Sbjct  177  SLK  179



>gb|AFZ78623.1| hypothetical protein [Populus tomentosa]
Length=183

 Score =   204 bits (519),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 117/191 (61%), Positives = 129/191 (68%), Gaps = 22/191 (12%)
 Frame = -3

Query  624  LGLEITELRLGLPGSGHGGADKGTTGEKKRVFSEMIDGGDD--HDRsssnnnnnkkKQQV  451
            LGLEITELRLGLPGS     D G   +KKRVFSE+    +    DR            QV
Sbjct  5    LGLEITELRLGLPGS-----DDGHKNDKKRVFSEVSGEANSPTDDRKVQAK------SQV  53

Query  450  VGWPPVCSYRRK---NNSD--EGKKMYVKVSMDGAPFLRKIDLTTHKTYSHLLIALDNLF  286
            VGWPPVCSYR+    N  D  E  K+YVKVSMDGAPFLRKIDL   K YS L++AL+ LF
Sbjct  54   VGWPPVCSYRKNISFNERDRLETSKIYVKVSMDGAPFLRKIDLGMQKEYSDLVVALERLF  113

Query  285  DCRGIGEALKDADSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRIMKRSEAKGIGLH  106
             C G G+ALKD    EY PIYEDKDGDWMLVGDVPW MF ESCKRLRIMK SEAKG GL 
Sbjct  114  GCFGTGKALKD----EYVPIYEDKDGDWMLVGDVPWEMFFESCKRLRIMKSSEAKGFGLQ  169

Query  105  AKNFLKEMSKE  73
             +  LK +SK+
Sbjct  170  PRGALKGISKD  180



>ref|XP_011000816.1| PREDICTED: auxin-induced protein 22C-like [Populus euphratica]
Length=183

 Score =   201 bits (512),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 116/189 (61%), Positives = 133/189 (70%), Gaps = 18/189 (10%)
 Frame = -3

Query  624  LGLEITELRLGLPGSGHGGADKGTTGEKKRVFSEMIDGGDDHDRsssnnnnnkkKQQVVG  445
            LGLEITELRLGLPGS     D G   +KKRVFSE+    +    S++++   + K QVVG
Sbjct  5    LGLEITELRLGLPGS-----DDGHKNDKKRVFSEVSGEAN----STTDDRKVQTKSQVVG  55

Query  444  WPPVCSYRRK---NNSD--EGKKMYVKVSMDGAPFLRKIDLTTHKTYSHLLIALDNLFDC  280
            WPPVCSYR+    N  D  E  K+YVKVSMDGAPFLRKIDL  HK YS L++AL+ LF C
Sbjct  56   WPPVCSYRKNISFNERDRHETSKIYVKVSMDGAPFLRKIDLGMHKEYSDLVVALERLFGC  115

Query  279  RGIGEALKDADSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRIMKRSEAKGIGLHAK  100
             GIG+A KD    EY PIYEDKDGDWMLVGD PW MF ESCKRLRIMK SEAKG GL  +
Sbjct  116  YGIGKASKD----EYVPIYEDKDGDWMLVGDGPWEMFFESCKRLRIMKSSEAKGFGLQPR  171

Query  99   NFLKEMSKE  73
              LK + K+
Sbjct  172  GALKGIPKD  180



>gb|AFK47060.1| unknown [Medicago truncatula]
 gb|KEH28764.1| auxin-responsive AUX/IAA family protein [Medicago truncatula]
Length=178

 Score =   201 bits (511),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 117/183 (64%), Positives = 135/183 (74%), Gaps = 9/183 (5%)
 Frame = -3

Query  636  AKSGLGLEITELRLGLPGSGHGGADKGTTGEKKRVFSEMIDGGDDHDRsssnnnnnkkKQ  457
            A+ G GLEITELRLGLP        +    EKKR+FSE+   G + +   S +   +KK 
Sbjct  2    AREGFGLEITELRLGLP------CGEPQKNEKKRMFSEI--DGGEEENGGSGDQKIEKKN  53

Query  456  QVVGWPPVCSYRRKNNSDEGKKMYVKVSMDGAPFLRKIDLTTHKTYSHLLIALDNLFDCR  277
            QVVGWPPVCSYR+KN  +EG KMY+KVSMDGAP+LRKIDL  HK Y  L +AL+ LF C 
Sbjct  54   QVVGWPPVCSYRKKN-MNEGSKMYMKVSMDGAPYLRKIDLGLHKGYLELALALEKLFGCC  112

Query  276  GIGEALKDADSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRIMKRSEAKGIGLHAKN  97
            GI EALKDAD+ E+ PIYEDKDGDWMLVGDVPW MF+ESCKRLRIMKRS+AKG GL  K 
Sbjct  113  GIEEALKDADNCEHVPIYEDKDGDWMLVGDVPWEMFIESCKRLRIMKRSDAKGFGLQPKG  172

Query  96   FLK  88
             LK
Sbjct  173  SLK  175



>ref|XP_008461049.1| PREDICTED: auxin-induced protein IAA6 isoform X1 [Cucumis melo]
Length=261

 Score =   203 bits (517),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 113/205 (55%), Positives = 137/205 (67%), Gaps = 22/205 (11%)
 Frame = -3

Query  657  LWLIDMAAKSGLGLEITELRLGLPGSGHGGADKGTTGEKKRVFSEMIDGGD----DHDRs  490
            +      AK  LGL+ITELRLGL     G +DK    EKKR ++++++GG     D D  
Sbjct  62   VLFFQQMAKESLGLDITELRLGL--GLPGNSDKN---EKKRAYNDIVNGGHEPTRDGDDV  116

Query  489  ssnnnnnkkKQQVVGWPPVCSYRRKNN------------SDEGKKMYVKVSMDGAPFLRK  346
               N+N   K QVVGWPPVCSYR++N+             +E  KMYVK+SMDGAPFLRK
Sbjct  117  GRKNSNATSKGQVVGWPPVCSYRKRNSFGEKESSSSLPHENENSKMYVKISMDGAPFLRK  176

Query  345  IDLTTHKTYSHLLIALDNLFDCRG-IGEALKDADSSEYAPIYEDKDGDWMLVGDVPWGMF  169
            +DL +HK YS L +AL+ LF C G  G+ LK  +S +Y PIYEDKDGDWMLVGDVPW MF
Sbjct  177  LDLGSHKDYSDLAVALEKLFGCFGSTGKTLKHGESCDYVPIYEDKDGDWMLVGDVPWEMF  236

Query  168  VESCKRLRIMKRSEAKGIGLHAKNF  94
            +ESCKRLRIMKRSEAKG GL  K+ 
Sbjct  237  IESCKRLRIMKRSEAKGFGLQFKDL  261



>ref|XP_010691247.1| PREDICTED: auxin-induced protein IAA6-like [Beta vulgaris subsp. 
vulgaris]
Length=187

 Score =   198 bits (503),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 103/187 (55%), Positives = 125/187 (67%), Gaps = 14/187 (7%)
 Frame = -3

Query  636  AKSGLGLEITELRLGLPGSGHGGA---DKGTTGEKKRVFSEMIDGGDDHDRsssnnnnnk  466
            +K+G   EITELRLGLPG               EKKRVFS+++ G  +        +   
Sbjct  2    SKAGFEHEITELRLGLPGGNIRVVCDDQVEIKNEKKRVFSDIVGGHTEK------VSVAN  55

Query  465  kKQQVVGWPPVCSYRRKNNSDE-----GKKMYVKVSMDGAPFLRKIDLTTHKTYSHLLIA  301
             K   VGWPPVCSYRR++  +E       K  VK+SMDG PFLRKID+  ++ YS L  A
Sbjct  56   NKSAAVGWPPVCSYRRRSIGNEKECIEASKRLVKISMDGVPFLRKIDVNCYQQYSDLTSA  115

Query  300  LDNLFDCRGIGEALKDADSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRIMKRSEAK  121
            ++NLF C GI EALKDAD+ EY PIYEDKDGDW+LVGDVPW MFV+SCKRLRIMKR++AK
Sbjct  116  VENLFSCSGISEALKDADNCEYVPIYEDKDGDWLLVGDVPWNMFVDSCKRLRIMKRADAK  175

Query  120  GIGLHAK  100
            G GL +K
Sbjct  176  GFGLQSK  182



>ref|XP_010465525.1| PREDICTED: auxin-responsive protein IAA19 [Camelina sativa]
Length=197

 Score =   197 bits (501),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 110/196 (56%), Positives = 125/196 (64%), Gaps = 23/196 (12%)
 Frame = -3

Query  633  KSGLGLEITELRLGLPGSGHGGADKGTTGEKKRVFSEMI--DGGDDHDRsssnnnnn---  469
            K GLGLEITELRLGLPG      D      KKR F+EMI    G + D+  S   ++   
Sbjct  3    KEGLGLEITELRLGLPGR-----DVAEKMMKKRAFTEMIMTSSGSNSDQCESGVVSSGGD  57

Query  468  --------kkKQQVVGWPPVCSYRRKNNSDEGKKM-----YVKVSMDGAPFLRKIDLTTH  328
                      K QVVGWPPVCSYRRKN+  +         YVKVSMDG P+LRK+DL + 
Sbjct  58   VEKVNDSPAAKSQVVGWPPVCSYRRKNSCKDASTTKVGLGYVKVSMDGVPYLRKMDLGSS  117

Query  327  KTYSHLLIALDNLFDCRGIGEALKDADSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRL  148
            + Y  L  ALD LF  RGIG ALKD D+ EY  IYEDKDGDWML GDVPWGMF+ESCKRL
Sbjct  118  QGYDDLAFALDKLFGIRGIGVALKDGDNCEYVTIYEDKDGDWMLAGDVPWGMFIESCKRL  177

Query  147  RIMKRSEAKGIGLHAK  100
            RIMKRS+A G GL  +
Sbjct  178  RIMKRSDATGFGLQPR  193



>ref|XP_006356170.1| PREDICTED: auxin-induced protein AUX22-like [Solanum tuberosum]
Length=176

 Score =   196 bits (498),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 115/179 (64%), Positives = 129/179 (72%), Gaps = 21/179 (12%)
 Frame = -3

Query  618  LEITELRLGLPGSGHGGADKGTTGEKKRVFSEMIDGGDDHDRsssnnnnnkkKQQVVGWP  439
            LEITELRLGL  S        +  EKKRVFSE+     D DRSS+N N++ K  QVVGWP
Sbjct  5    LEITELRLGLIPS--------SKNEKKRVFSEI-----DSDRSSTNVNDDDK-NQVVGWP  50

Query  438  PVCSYRRKNNSDEG--KKMYVKVSMDGAPFLRKIDLTTHKTYSHLLIALDNLFDCRGIGE  265
            PVC YRRKNN+     KKMYVKVSMDGAPFLRK+DL+ HK YS  ++ L+ LF   GI E
Sbjct  51   PVCGYRRKNNNSNARSKKMYVKVSMDGAPFLRKVDLSIHKDYSGFVMNLEKLFHFYGICE  110

Query  264  ALKDADSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRIMKRSEAKGIGLHAKNFLK  88
                  SSEY PIYEDKDGDWMLVGDVPW MF ESCKRLRIMKRS+AK IGL  ++FLK
Sbjct  111  G-----SSEYIPIYEDKDGDWMLVGDVPWLMFSESCKRLRIMKRSDAKVIGLRTEDFLK  164



>ref|XP_010487381.1| PREDICTED: auxin-responsive protein IAA19-like [Camelina sativa]
Length=197

 Score =   196 bits (498),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 110/196 (56%), Positives = 124/196 (63%), Gaps = 23/196 (12%)
 Frame = -3

Query  633  KSGLGLEITELRLGLPGSGHGGADKGTTGEKKRVFSEMI--DGGDDHDR-----------  493
            K GLGLEITELRLGLPG      D      KKR F+EMI    G   D+           
Sbjct  3    KEGLGLEITELRLGLPGR-----DVAEKMMKKRAFTEMIMTSSGSSSDQCESGVVSFGGD  57

Query  492  sssnnnnnkkKQQVVGWPPVCSYRRKNNSDEGKKM-----YVKVSMDGAPFLRKIDLTTH  328
                N++   K QVVGWPPVCSYRRKN+  +         YVKVSMDG P+LRK+DL + 
Sbjct  58   VEKVNDSPAAKSQVVGWPPVCSYRRKNSCKDASTTKVGIGYVKVSMDGVPYLRKMDLGSS  117

Query  327  KTYSHLLIALDNLFDCRGIGEALKDADSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRL  148
            + Y  L  ALD LF  RGIG ALKD D+ EY  IYEDKDGDWML GDVPWGMF+ESCKRL
Sbjct  118  QGYDDLAFALDKLFGIRGIGVALKDGDNCEYVTIYEDKDGDWMLAGDVPWGMFIESCKRL  177

Query  147  RIMKRSEAKGIGLHAK  100
            RIMKRS+A G GL  +
Sbjct  178  RIMKRSDATGFGLQPR  193



>ref|XP_006298605.1| hypothetical protein CARUB_v10014689mg [Capsella rubella]
 gb|EOA31503.1| hypothetical protein CARUB_v10014689mg [Capsella rubella]
Length=197

 Score =   195 bits (496),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 109/196 (56%), Positives = 125/196 (64%), Gaps = 23/196 (12%)
 Frame = -3

Query  633  KSGLGLEITELRLGLPGSGHGGADKGTTGEKKRVFSEMI--DGGDDHDRsssnnnnn---  469
            K GLGLEITELRLGLPG      D      KKR F+EMI    G + ++  S   ++   
Sbjct  3    KEGLGLEITELRLGLPGR-----DVAEKMMKKRAFTEMIMTSSGSNSEQCESGVVSSGGD  57

Query  468  --------kkKQQVVGWPPVCSYRRKNNSDEGKKM-----YVKVSMDGAPFLRKIDLTTH  328
                      K QVVGWPPVCSYRRKN+  +         YVKVSMDG P+LRK+DL + 
Sbjct  58   VEKVNDSPAAKSQVVGWPPVCSYRRKNSCKDASAAKVGLGYVKVSMDGVPYLRKMDLGSS  117

Query  327  KTYSHLLIALDNLFDCRGIGEALKDADSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRL  148
            + Y  L  ALD LF  RGIG ALKD D+ EY  IYEDKDGDWML GDVPWGMF+ESCKRL
Sbjct  118  QGYDDLAFALDKLFGFRGIGVALKDGDNCEYVTIYEDKDGDWMLAGDVPWGMFIESCKRL  177

Query  147  RIMKRSEAKGIGLHAK  100
            RIMKRS+A G GL  +
Sbjct  178  RIMKRSDATGFGLQPR  193



>ref|XP_010503141.1| PREDICTED: auxin-responsive protein IAA19-like [Camelina sativa]
Length=197

 Score =   195 bits (496),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 109/196 (56%), Positives = 123/196 (63%), Gaps = 23/196 (12%)
 Frame = -3

Query  633  KSGLGLEITELRLGLPGSGHGGADKGTTGEKKRVFSEMI--DGGDDHDRsssnnnnn---  469
            K GLGLEITELRLGLPG      D      KKR F+EMI    G   D+  S   ++   
Sbjct  3    KEGLGLEITELRLGLPGR-----DVAEKMMKKRAFTEMIMTSSGSSSDQCESGVVSSGGD  57

Query  468  --------kkKQQVVGWPPVCSYRRKNNSDEGKKM-----YVKVSMDGAPFLRKIDLTTH  328
                      K QVVGWPPVCSYRRKN+  +         YVKVSMDG P+LRK+DL + 
Sbjct  58   VEKVNDSPAAKSQVVGWPPVCSYRRKNSCKDASTTKVGLGYVKVSMDGVPYLRKMDLGSS  117

Query  327  KTYSHLLIALDNLFDCRGIGEALKDADSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRL  148
            + Y  L  ALD LF  RGIG A KD D+ EY  IYEDKDGDWML GDVPWGMF+ESCKRL
Sbjct  118  QGYDDLAFALDKLFGIRGIGVAFKDGDNCEYVTIYEDKDGDWMLAGDVPWGMFIESCKRL  177

Query  147  RIMKRSEAKGIGLHAK  100
            RIMKRS+A G GL  +
Sbjct  178  RIMKRSDATGFGLQPR  193



>ref|XP_002882951.1| indoleacetic acid-induced protein 19 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59210.1| indoleacetic acid-induced protein 19 [Arabidopsis lyrata subsp. 
lyrata]
Length=197

 Score =   195 bits (496),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 109/196 (56%), Positives = 124/196 (63%), Gaps = 23/196 (12%)
 Frame = -3

Query  633  KSGLGLEITELRLGLPGSGHGGADKGTTGEKKRVFSEM--IDGGDDHDRsssnnnnn---  469
            K GLGLEITELRLGLPG      D      KKR F+EM     G + D+  S   ++   
Sbjct  3    KEGLGLEITELRLGLPGR-----DVAEKMIKKRAFTEMNMTSSGSNSDQCESGVVSSGGD  57

Query  468  --------kkKQQVVGWPPVCSYRRKNNSDEGKKM-----YVKVSMDGAPFLRKIDLTTH  328
                      K QVVGWPPVCSYRRKN+  E         YVKVSMDG P+LRK+DL + 
Sbjct  58   VEKVNDSPAAKSQVVGWPPVCSYRRKNSCKEAATTKVGLGYVKVSMDGVPYLRKMDLGSS  117

Query  327  KTYSHLLIALDNLFDCRGIGEALKDADSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRL  148
            + Y  L  ALD LF  RGIG ALKD D+ EY  IYEDKDGDWML GDVPWGMF+ESCKRL
Sbjct  118  QDYDDLAFALDKLFGFRGIGVALKDGDNCEYVTIYEDKDGDWMLAGDVPWGMFIESCKRL  177

Query  147  RIMKRSEAKGIGLHAK  100
            RIM+RS+A G GL  +
Sbjct  178  RIMRRSDASGFGLQPR  193



>ref|NP_188173.1| auxin-responsive protein IAA19 [Arabidopsis thaliana]
 sp|O24409.2|IAA19_ARATH RecName: Full=Auxin-responsive protein IAA19; AltName: Full=Indoleacetic 
acid-induced protein 19; AltName: Full=Protein MASSUGU 
2 [Arabidopsis thaliana]
 gb|AAF35420.1| early auxin-induced protein, IAA19 [Arabidopsis thaliana]
 dbj|BAB02383.1| auxin-regulated protein, IAA19 [Arabidopsis thaliana]
 gb|AAT67082.1| IAA19 [Arabidopsis thaliana]
 gb|ABD42984.1| At3g15540 [Arabidopsis thaliana]
 gb|AEE75690.1| auxin-responsive protein IAA19 [Arabidopsis thaliana]
Length=197

 Score =   194 bits (493),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 109/196 (56%), Positives = 124/196 (63%), Gaps = 23/196 (12%)
 Frame = -3

Query  633  KSGLGLEITELRLGLPGSGHGGADKGTTGEKKRVFSEM--IDGGDDHDRsssnnnnn---  469
            K GLGLEITELRLGLPG      D      KKR F+EM     G + D+  S   ++   
Sbjct  3    KEGLGLEITELRLGLPGR-----DVAEKMMKKRAFTEMNMTSSGSNSDQCESGVVSSGGD  57

Query  468  --------kkKQQVVGWPPVCSYRRKNNSDEGKKM-----YVKVSMDGAPFLRKIDLTTH  328
                      K QVVGWPPVCSYR+KN+  E         YVKVSMDG P+LRK+DL + 
Sbjct  58   AEKVNDSPAAKSQVVGWPPVCSYRKKNSCKEASTTKVGLGYVKVSMDGVPYLRKMDLGSS  117

Query  327  KTYSHLLIALDNLFDCRGIGEALKDADSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRL  148
            + Y  L  ALD LF  RGIG ALKD D+ EY  IYEDKDGDWML GDVPWGMF+ESCKRL
Sbjct  118  QGYDDLAFALDKLFGFRGIGVALKDGDNCEYVTIYEDKDGDWMLAGDVPWGMFLESCKRL  177

Query  147  RIMKRSEAKGIGLHAK  100
            RIMKRS+A G GL  +
Sbjct  178  RIMKRSDATGFGLQPR  193



>gb|EYU21566.1| hypothetical protein MIMGU_mgv1a014881mg [Erythranthe guttata]
Length=175

 Score =   193 bits (490),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 99/158 (63%), Positives = 118/158 (75%), Gaps = 12/158 (8%)
 Frame = -3

Query  546  EKKRVFSEMIDGGDDHDRsssnnnnnkkKQQVVGWPPVCSYRRKNNSDEGKKMYVKVSMD  367
            EKKRVFS+MI GG++           K    VVGWPPV +YRRK       KMYVKVSMD
Sbjct  24   EKKRVFSDMISGGEEE----------KAVVAVVGWPPVRAYRRKIGGGGVGKMYVKVSMD  73

Query  366  GAPFLRKIDLTTHKTYSHLLIALDNLFDCRGIGEALKDADSSEYAPIYEDKDGDWMLVGD  187
            GAPFLRKIDLT HK YS L ++++ LF C GI EALKD+++SEY+PIYEDKDGDWML+GD
Sbjct  74   GAPFLRKIDLTNHKCYSDLFVSIEQLFGCFGIEEALKDSENSEYSPIYEDKDGDWMLLGD  133

Query  186  VPWGMFVESCKRLRIMKRSEAKGIGLHAKNFLKEMSKE  73
            VPW MFV+SCKR+RIMKRS+A   GL A + LKE+ K+
Sbjct  134  VPWEMFVDSCKRMRIMKRSDAN--GLQAIDLLKELGKK  169



>gb|KFK38897.1| hypothetical protein AALP_AA3G175100 [Arabis alpina]
Length=193

 Score =   193 bits (491),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 109/196 (56%), Positives = 124/196 (63%), Gaps = 27/196 (14%)
 Frame = -3

Query  633  KSGLGLEITELRLGLPGSGHGGADKGTTGEKKRVFSEMI--DGGDDHDRsssnnnnn---  469
            K G  LEITELRLGLPG             KKR F+EMI    G + D+  S   ++   
Sbjct  3    KGGFELEITELRLGLPGRDVA---------KKRGFTEMIMTSSGSNSDQCESGVVSSGGE  53

Query  468  --------kkKQQVVGWPPVCSYRRKNNSDEGKKM-----YVKVSMDGAPFLRKIDLTTH  328
                      K QVVGWPPVCSYRRKN+S E         YVKVSMDG P+LRK+DL ++
Sbjct  54   VEKVNDSPAAKSQVVGWPPVCSYRRKNSSKEATTTKVGLGYVKVSMDGVPYLRKMDLGSN  113

Query  327  KTYSHLLIALDNLFDCRGIGEALKDADSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRL  148
            + Y  L  ALD LF  RGIG ALKD D+ EY  IYEDKDGDWML GDVPWGMF+ESCKRL
Sbjct  114  QGYDDLAFALDKLFGFRGIGVALKDGDNCEYVTIYEDKDGDWMLAGDVPWGMFIESCKRL  173

Query  147  RIMKRSEAKGIGLHAK  100
            RIMKRS+A G GL  +
Sbjct  174  RIMKRSDATGFGLQPR  189



>emb|CDY68807.1| BnaA06g37420D [Brassica napus]
Length=196

 Score =   192 bits (489),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 107/187 (57%), Positives = 126/187 (67%), Gaps = 10/187 (5%)
 Frame = -3

Query  636  AKSGLGLEITELRLGLPGSGHGGADKGTTGEKKRVFSEMI-------DGGDDHDRsssnn  478
            AK GLGLEITELRLGLP   +G      + + KRVFSEM+       DG +    S  ++
Sbjct  2    AKEGLGLEITELRLGLPVDNNGERLVSGSKKTKRVFSEMMISSSLDTDGANSVVSSVEDD  61

Query  477  nnnkkKQQVVGWPPVCSYR-RKNNSDEGKKM--YVKVSMDGAPFLRKIDLTTHKTYSHLL  307
            +  K K Q VGWPPVCSYR +KNN+ E  K   YVKVSM G P+LRK+DL T K Y+HL 
Sbjct  62   SVPKDKSQAVGWPPVCSYRTKKNNNKESSKAIGYVKVSMCGVPYLRKVDLGTSKGYTHLA  121

Query  306  IALDNLFDCRGIGEALKDADSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRIMKRSE  127
              L+ LFDC G+G ALK+ +  EY  IYEDKD DWMLVGDVPW MF ESC RLRI+KRS+
Sbjct  122  TVLEKLFDCLGLGVALKEGEKFEYVIIYEDKDRDWMLVGDVPWEMFKESCMRLRIVKRSD  181

Query  126  AKGIGLH  106
            A G GL 
Sbjct  182  ATGFGLQ  188



>ref|XP_006406955.1| hypothetical protein EUTSA_v10021556mg [Eutrema salsugineum]
 gb|ESQ48408.1| hypothetical protein EUTSA_v10021556mg [Eutrema salsugineum]
Length=198

 Score =   192 bits (489),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 108/197 (55%), Positives = 124/197 (63%), Gaps = 24/197 (12%)
 Frame = -3

Query  633  KSGLGLEITELRLGLPGSGHGGADKGTTGEKKRVFSEMI--DGGDDHDR-----------  493
            K GL LEITELRLGLPG      D      KKR F+EMI    G + D+           
Sbjct  3    KDGLELEITELRLGLPGR-----DVAEKLMKKRAFTEMIMTSSGSNSDQCESGVVSSGGD  57

Query  492  -sssnnnnnkkKQQVVGWPPVCSYRRKNNSDEGKKM-----YVKVSMDGAPFLRKIDLTT  331
                 +++   K QVVGWPPVCSYR+KN+  E         YVKVSMDG P+LRK+DL +
Sbjct  58   VEKVASDSPAAKSQVVGWPPVCSYRKKNSCKETSTTKVGLGYVKVSMDGVPYLRKMDLGS  117

Query  330  HKTYSHLLIALDNLFDCRGIGEALKDADSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKR  151
             + Y  L  ALD LF  RGIG ALKD D+ EY  IYEDKDGDWML GDVPWGMF+ESCKR
Sbjct  118  SQGYYDLAFALDKLFGFRGIGVALKDGDNCEYVTIYEDKDGDWMLAGDVPWGMFIESCKR  177

Query  150  LRIMKRSEAKGIGLHAK  100
            LRIMKRS+A G GL  +
Sbjct  178  LRIMKRSDATGFGLQPR  194



>emb|CDX82428.1| BnaA03g33930D [Brassica napus]
Length=194

 Score =   192 bits (488),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 109/196 (56%), Positives = 124/196 (63%), Gaps = 26/196 (13%)
 Frame = -3

Query  633  KSGLGLEITELRLGLPGSGHGGADKGTTGEKKRVFSEMI--DGGDDHDRsssnnnnn---  469
            K GLGLEITELRLGLPG+            KKR F+EMI    G + D+  S   ++   
Sbjct  3    KGGLGLEITELRLGLPGT--------EKMMKKRGFTEMIMTSSGSNSDQCESGVVSSGGD  54

Query  468  --------kkKQQVVGWPPVCSYRRKNNSDEGKKM-----YVKVSMDGAPFLRKIDLTTH  328
                      K QVVGWPPVCSYRRKN+  E         YVKVSMDG P+LRK+DL + 
Sbjct  55   VEKVNESPVAKSQVVGWPPVCSYRRKNSCKEVSTTKVGLGYVKVSMDGVPYLRKMDLGSS  114

Query  327  KTYSHLLIALDNLFDCRGIGEALKDADSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRL  148
            + Y  L  ALD LF   GIG ALKD D+ EY  IYEDKDGDWML GDVPWGMF+ESCKRL
Sbjct  115  QGYDDLAFALDKLFSFHGIGVALKDGDNCEYVTIYEDKDGDWMLAGDVPWGMFIESCKRL  174

Query  147  RIMKRSEAKGIGLHAK  100
            RIMKRS+A G GL  +
Sbjct  175  RIMKRSDATGFGLQPR  190



>emb|CDX75834.1| BnaC03g39170D [Brassica napus]
Length=194

 Score =   191 bits (485),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 109/196 (56%), Positives = 124/196 (63%), Gaps = 26/196 (13%)
 Frame = -3

Query  633  KSGLGLEITELRLGLPGSGHGGADKGTTGEKKRVFSEMI--DGGDDHDRsss--------  484
            K GLGLEITELRLGLPG+            KKR F+EMI    G + D+  S        
Sbjct  3    KDGLGLEITELRLGLPGT--------EKMMKKRGFTEMIMASSGSNSDQCESGVVSSGGD  54

Query  483  ---nnnnnkkKQQVVGWPPVCSYRRKNNSDEGKKM-----YVKVSMDGAPFLRKIDLTTH  328
                + +   K QVVGWPPVCSYRRKN+  E         YVKVSMDG P+LRK+DL + 
Sbjct  55   VGKVSESPVAKSQVVGWPPVCSYRRKNSCKEVSTTKVGLGYVKVSMDGVPYLRKMDLGSS  114

Query  327  KTYSHLLIALDNLFDCRGIGEALKDADSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRL  148
            + Y  L  ALD LF   GIG ALKD D+ EY  IYEDKDGDWML GDVPWGMF+ESCKRL
Sbjct  115  QGYDDLAFALDKLFGFHGIGVALKDGDNCEYVTIYEDKDGDWMLAGDVPWGMFIESCKRL  174

Query  147  RIMKRSEAKGIGLHAK  100
            RIMKRS+A G GL  +
Sbjct  175  RIMKRSDATGFGLQPR  190



>gb|EYU24680.1| hypothetical protein MIMGU_mgv1a026267mg [Erythranthe guttata]
Length=186

 Score =   191 bits (484),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 116/192 (60%), Positives = 132/192 (69%), Gaps = 14/192 (7%)
 Frame = -3

Query  633  KSGLGLEITELRLGLPGSGHGGAD-KGTTGEKKRVFSEMIDGGDDHDRsssnnnnnkkKQ  457
            K G GLE TELRLGLPG G GG   +    EKKRVFSE    G+            + K 
Sbjct  3    KIGAGLE-TELRLGLPGGGGGGGGCEVEKNEKKRVFSEFCGEGEGK--------VAENKI  53

Query  456  QVVGWPPVCSYRRKNNS--DEGKKMYVKVSMDGAPFLRKIDLTTHKTYSHLLIALDNLFD  283
            +VVGWPPV +YRRKN+     G KMYVKVSMDGAPFLRKIDL+ H+ YS L+ AL+ LF 
Sbjct  54   EVVGWPPVAAYRRKNSGRFSGGGKMYVKVSMDGAPFLRKIDLSMHEGYSELVNALEQLFG  113

Query  282  CRG-IGEALKDADSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRIMKRSE-AKGIGL  109
            C G IGEALK+ D   Y PIYEDKD DWML+GDVPW MF E+CKRLRIMKR + A G GL
Sbjct  114  CFGNIGEALKEEDECAYVPIYEDKDEDWMLLGDVPWQMFSETCKRLRIMKREDAANGFGL  173

Query  108  HAKNFLKEMSKE  73
            HAK+ LK +S E
Sbjct  174  HAKDLLKGLSNE  185



>gb|AAM67069.1| early auxin-induced protein IAA19 [Arabidopsis thaliana]
Length=197

 Score =   191 bits (485),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 107/196 (55%), Positives = 123/196 (63%), Gaps = 23/196 (12%)
 Frame = -3

Query  633  KSGLGLEITELRLGLPGSGHGGADKGTTGEKKRVFSEM--IDGGDDHDRsssnnnnn---  469
            K GLGLEITELRLGLPG      D      KKR F+EM     G + D+  S   ++   
Sbjct  3    KEGLGLEITELRLGLPGR-----DVAEKMMKKRAFTEMNMTSSGSNSDQCESGVVSSGGD  57

Query  468  --------kkKQQVVGWPPVCSYRRKNNSDEGKKM-----YVKVSMDGAPFLRKIDLTTH  328
                      K QVVGWPPVCSYR+KN+  E         YVKVSMDG P+LRK+DL + 
Sbjct  58   AEKVNDSPAAKSQVVGWPPVCSYRKKNSCKEASTTKVGLGYVKVSMDGVPYLRKMDLGSS  117

Query  327  KTYSHLLIALDNLFDCRGIGEALKDADSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRL  148
            + Y  L  +LD LF  RGIG ALKD D+ EY  IYEDKDGDWML GD PWGMF+ESCKRL
Sbjct  118  QGYDDLAFSLDKLFGFRGIGVALKDGDNCEYVTIYEDKDGDWMLAGDXPWGMFLESCKRL  177

Query  147  RIMKRSEAKGIGLHAK  100
            RIMKRS+A G GL  +
Sbjct  178  RIMKRSDATGFGLQPR  193



>emb|CAA48299.1| auxin-induced protein [Pisum sativum]
Length=156

 Score =   189 bits (479),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 105/153 (69%), Positives = 121/153 (79%), Gaps = 2/153 (1%)
 Frame = -3

Query  546  EKKRVFSEMIDGGDDHDRsssnnnnnkkKQQVVGWPPVCSYRRKNNSDEGKKMYVKVSMD  367
            EKKR+FSE IDGG + +  S +  +  KK QVVGWPPVCSYR+KN  +EG KMY+KVSMD
Sbjct  3    EKKRMFSE-IDGGVEENGGSGDRKSVDKKNQVVGWPPVCSYRKKN-MNEGSKMYMKVSMD  60

Query  366  GAPFLRKIDLTTHKTYSHLLIALDNLFDCRGIGEALKDADSSEYAPIYEDKDGDWMLVGD  187
            GAP+LRKIDL  HK Y  L +AL+ LFDC GI EALKDA++ E+ PIYEDKDGDWMLVGD
Sbjct  61   GAPYLRKIDLCLHKGYLELALALEKLFDCCGIEEALKDAENCEHVPIYEDKDGDWMLVGD  120

Query  186  VPWGMFVESCKRLRIMKRSEAKGIGLHAKNFLK  88
            VPW MF+ESCKRLRIMKRS+AKG  L  K  LK
Sbjct  121  VPWEMFIESCKRLRIMKRSDAKGFDLQPKGSLK  153



>ref|XP_010545793.1| PREDICTED: auxin-responsive protein IAA19 [Tarenaya hassleriana]
Length=181

 Score =   189 bits (480),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 105/179 (59%), Positives = 124/179 (69%), Gaps = 10/179 (6%)
 Frame = -3

Query  627  GLGLEITELRLGLPGSGHGGADKGTTGEKKRVFSEMIDGGDDHDRsssnnnnnkkKQ-QV  451
            GLGLEITELRLGLPG    G +K T   KKRVFSEM   G++ D       ++   +  V
Sbjct  2    GLGLEITELRLGLPG--DNGGEKETF--KKRVFSEMSSEGENDDIFGQVVVSSPAAKIPV  57

Query  450  VGWPPVCSYRRKNNS--DEGKKMYVKVSMDGAPFLR---KIDLTTHKTYSHLLIALDNLF  286
            VGWPPVCSYRR+N+S  D+  K YVKVSMDG P+ R   K+DL ++  Y  L  AL+ LF
Sbjct  58   VGWPPVCSYRRRNSSCRDQASKGYVKVSMDGIPYRRILLKMDLVSNHGYDDLAFALEKLF  117

Query  285  DCRGIGEALKDADSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRIMKRSEAKGIGL  109
             C GI  ALKD +  EY  IYEDKDGDWML GDVPW MF+ESCKRLR+MKRS+A G+GL
Sbjct  118  GCTGIVVALKDGEKCEYVTIYEDKDGDWMLAGDVPWQMFIESCKRLRVMKRSDATGLGL  176



>gb|ADB93646.2| indole-3-acetic acid inducible 19 [Arabidopsis thaliana]
Length=187

 Score =   189 bits (480),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 107/190 (56%), Positives = 121/190 (64%), Gaps = 23/190 (12%)
 Frame = -3

Query  633  KSGLGLEITELRLGLPGSGHGGADKGTTGEKKRVFSEM--IDGGDDHDRsssnnnnn---  469
            K GLGLEITELRLGLPG      D      KKR F+EM     G + D+  S   ++   
Sbjct  3    KEGLGLEITELRLGLPGR-----DVAEKMMKKRAFTEMNMTSSGSNSDQCESGVVSSGGD  57

Query  468  --------kkKQQVVGWPPVCSYRRKNNSDEGKKM-----YVKVSMDGAPFLRKIDLTTH  328
                      K QVVGWPPVCSYR+KN+  E         YVKVSMDG P+LRK+DL + 
Sbjct  58   AEKVNDSPAAKSQVVGWPPVCSYRKKNSCKEASTTKVGLGYVKVSMDGVPYLRKMDLGSS  117

Query  327  KTYSHLLIALDNLFDCRGIGEALKDADSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRL  148
            + Y  L  ALD LF  RGIG ALKD D+ EY  IYEDKDGDWML GDVPWGMF+ESCKRL
Sbjct  118  QGYDDLAFALDKLFGFRGIGVALKDGDNCEYVTIYEDKDGDWMLAGDVPWGMFLESCKRL  177

Query  147  RIMKRSEAKG  118
            RIMKRS+A G
Sbjct  178  RIMKRSDATG  187



>ref|XP_010061973.1| PREDICTED: auxin-induced protein 22C [Eucalyptus grandis]
Length=194

 Score =   189 bits (480),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 105/197 (53%), Positives = 129/197 (65%), Gaps = 22/197 (11%)
 Frame = -3

Query  642  MAAKSGLGLEI-TELRLGLPGSGHGGADKGTTGEKKRVFSEMIDGGDDHDRsssnnnnnk  466
            M  +  +GLEI TELRLGLPG+    ++K       RVFSE+       ++ S+      
Sbjct  1    MGKRGAVGLEIMTELRLGLPGAAKPSSNK-------RVFSEI---STTEEKGSTEEPKAP  50

Query  465  kKQQVVGWPPVCSYRRKNNSDE----------GKKMYVKVSMDGAPFLRKIDLTTHKTYS  316
             K QVVGWPPVCSYR++N+ ++          G K YVKVSMDGA +LRKIDL+  K YS
Sbjct  51   AKNQVVGWPPVCSYRQRNSFNKEKVDRAEAGAGSKAYVKVSMDGALYLRKIDLSMQKGYS  110

Query  315  HLLIALDNLFDCRGIGEALKDADSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRIMK  136
             L  +L+ LF C GIGEAL   + +EY  IYEDKDGDWMLVGDVPW MF+ESC+RLRIMK
Sbjct  111  DLAFSLEKLFGCHGIGEALNGGEGAEYKLIYEDKDGDWMLVGDVPWEMFMESCRRLRIMK  170

Query  135  RSEAKGIG-LHAKNFLK  88
            RSEAK    L  ++FLK
Sbjct  171  RSEAKDFAILQTRDFLK  187



>ref|XP_009146230.1| PREDICTED: auxin-responsive protein IAA19-like [Brassica rapa]
Length=194

 Score =   189 bits (479),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 109/193 (56%), Positives = 122/193 (63%), Gaps = 20/193 (10%)
 Frame = -3

Query  633  KSGLGLEITELRLGLPGSGHGGADKGTTGEKKRVFSEMI--DGGDDHDRs--------ss  484
            K G+  EITELRLGLPG      D      KKR F+EMI    G + D S          
Sbjct  3    KGGVEHEITELRLGLPGR-----DVTEKMMKKRGFTEMIMTSSGSNSDESGVVSGGDVEK  57

Query  483  nnnnnkkKQQVVGWPPVCSYRRKNNSDEGKKM-----YVKVSMDGAPFLRKIDLTTHKTY  319
             N +   K QVVGWPPVCSYRRKNN  E         YVKVSMDG P+LRK+DL + + Y
Sbjct  58   INESPTAKSQVVGWPPVCSYRRKNNCKEAWTTKVGLGYVKVSMDGVPYLRKMDLGSSQGY  117

Query  318  SHLLIALDNLFDCRGIGEALKDADSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRIM  139
              L  ALD LF  RGIG ALKD D+ +Y  IYEDKDGDWML GDVPWGMF+ESCKRLRIM
Sbjct  118  DDLAFALDKLFGVRGIGVALKDGDNCKYVTIYEDKDGDWMLAGDVPWGMFIESCKRLRIM  177

Query  138  KRSEAKGIGLHAK  100
            KRS+A G GL  +
Sbjct  178  KRSDATGFGLQPR  190



>emb|CDY21845.1| BnaC01g36030D [Brassica napus]
Length=197

 Score =   189 bits (480),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 108/196 (55%), Positives = 122/196 (62%), Gaps = 23/196 (12%)
 Frame = -3

Query  633  KSGLGLEITELRLGLPGSGHGGADKGTTGEKKRVFSEMI--DGGDDHDR-----------  493
            K GL LEITELRLGLPG      D      KKR F+EMI    G + ++           
Sbjct  3    KDGLELEITELRLGLPGR-----DVTEKMMKKRGFTEMIMTSSGSNSEQCESGVVSSGVD  57

Query  492  sssnnnnnkkKQQVVGWPPVCSYRRKNNSDEGKKM-----YVKVSMDGAPFLRKIDLTTH  328
                N     K QVVGWPPVCSYRRKN+  E         YVKVSMDG P+LRK+DL ++
Sbjct  58   VEKVNETPAVKTQVVGWPPVCSYRRKNSCKEVSTTKVGLGYVKVSMDGVPYLRKMDLGSN  117

Query  327  KTYSHLLIALDNLFDCRGIGEALKDADSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRL  148
            + Y  L  ALD LF   GIG ALKD D+ EY  IYEDKDGDWML GDVPWGMF+ESC+RL
Sbjct  118  QGYDDLAFALDKLFGFHGIGVALKDGDNCEYVTIYEDKDGDWMLAGDVPWGMFIESCRRL  177

Query  147  RIMKRSEAKGIGLHAK  100
            RIMKRSEA G GL  +
Sbjct  178  RIMKRSEATGFGLQPR  193



>ref|XP_009135447.1| PREDICTED: auxin-responsive protein IAA19-like [Brassica rapa]
Length=194

 Score =   188 bits (478),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 108/196 (55%), Positives = 123/196 (63%), Gaps = 26/196 (13%)
 Frame = -3

Query  633  KSGLGLEITELRLGLPGSGHGGADKGTTGEKKRVFSEMI--DGGDDHDRsssnnnnn---  469
            K GLGLEITELRLGLPG+            KKR F+EMI    G + D+  S   ++   
Sbjct  3    KGGLGLEITELRLGLPGT--------EKMMKKRGFTEMIMTSSGSNSDQCESGVVSSGGD  54

Query  468  --------kkKQQVVGWPPVCSYRRKNNSDEGKKM-----YVKVSMDGAPFLRKIDLTTH  328
                      K QVVGWPPVCSYR KN+  E         YVKVSMDG P+LRK+DL + 
Sbjct  55   VEKVNESPVAKSQVVGWPPVCSYRWKNSCKEVSTTKVGLGYVKVSMDGVPYLRKMDLGSS  114

Query  327  KTYSHLLIALDNLFDCRGIGEALKDADSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRL  148
            + Y  L  ALD LF   GIG ALKD D+ EY  IYEDKDGDWML GDVPWGMF+ESCKRL
Sbjct  115  QGYDDLAFALDKLFSFHGIGVALKDGDNCEYVTIYEDKDGDWMLAGDVPWGMFIESCKRL  174

Query  147  RIMKRSEAKGIGLHAK  100
            RIMKRS+A G GL  +
Sbjct  175  RIMKRSDATGFGLQPR  190



>emb|CDY26042.1| BnaC06g05820D [Brassica napus]
Length=196

 Score =   188 bits (478),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 106/187 (57%), Positives = 125/187 (67%), Gaps = 10/187 (5%)
 Frame = -3

Query  636  AKSGLGLEITELRLGLPGSGHGGADKGTTGEKKRVFSEMI-------DGGDDHDRsssnn  478
            AK GLGLEITELRLGLP   +G      + + KRVFSEM+       DG +    S  ++
Sbjct  2    AKEGLGLEITELRLGLPVDNNGERLVSGSKKTKRVFSEMMISSSLDTDGANSVVSSVEDD  61

Query  477  nnnkkKQQVVGWPPVCSYR-RKNNSDEGKKM--YVKVSMDGAPFLRKIDLTTHKTYSHLL  307
            +  K K Q VGWPPVCSYR +KNN+ E  K   YVKVSM G P+LRKIDL + K Y+HL 
Sbjct  62   SVPKDKSQAVGWPPVCSYRTKKNNNKELSKAIGYVKVSMYGVPYLRKIDLGSSKGYTHLA  121

Query  306  IALDNLFDCRGIGEALKDADSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRIMKRSE  127
              L+ LF C G+G ALK+ +  EY  IYEDKD DWMLVGDVPW MF ESC RLRI+KRS+
Sbjct  122  TVLEKLFGCLGLGVALKEGEKFEYVIIYEDKDRDWMLVGDVPWQMFKESCMRLRIVKRSD  181

Query  126  AKGIGLH  106
            A G GL 
Sbjct  182  ATGFGLQ  188



>ref|XP_009115446.1| PREDICTED: auxin-responsive protein IAA19 [Brassica rapa]
 emb|CDY20135.1| BnaA01g28670D [Brassica napus]
Length=197

 Score =   188 bits (477),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 108/198 (55%), Positives = 121/198 (61%), Gaps = 23/198 (12%)
 Frame = -3

Query  633  KSGLGLEITELRLGLPGSGHGGADKGTTGEKKRVFSEMI--DGGDDHDR-----------  493
            K GL LEITELRLGLPG      D      KKR F+EMI    G + ++           
Sbjct  3    KDGLELEITELRLGLPGR-----DVTEKMMKKRGFTEMIMTSSGSNSEQCESGVVSSGVD  57

Query  492  sssnnnnnkkKQQVVGWPPVCSYRRKNNSDEGKKM-----YVKVSMDGAPFLRKIDLTTH  328
                N     K QVVGWPPVCSYRRKN+  E         YVKVSMDG P+LRK+DL + 
Sbjct  58   VEKVNETPAVKTQVVGWPPVCSYRRKNSCKEVSTTKVGLGYVKVSMDGVPYLRKMDLGSS  117

Query  327  KTYSHLLIALDNLFDCRGIGEALKDADSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRL  148
            + Y  L  ALD LF   GIG ALKD D+ EY  IYEDKDGDWML GDVPWGMF+ESC+RL
Sbjct  118  QGYDDLAFALDKLFGFHGIGVALKDGDNCEYVTIYEDKDGDWMLAGDVPWGMFIESCRRL  177

Query  147  RIMKRSEAKGIGLHAKNF  94
            RIMKRSEA G GL  +  
Sbjct  178  RIMKRSEATGFGLQPRGL  195



>ref|NP_175692.1| indole-3-acetic acid 6 [Arabidopsis thaliana]
 sp|Q38824.2|IAA6_ARATH RecName: Full=Auxin-responsive protein IAA6; AltName: Full=Indoleacetic 
acid-induced protein 6 [Arabidopsis thaliana]
 gb|AAG52268.1|AC019018_5 putative IAA6 protein; 42631-41742 [Arabidopsis thaliana]
 gb|AAG53996.1|AF336915_1 IAA6 [Arabidopsis thaliana]
 dbj|BAH30343.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE32858.1| indole-3-acetic acid 6 [Arabidopsis thaliana]
Length=189

 Score =   188 bits (477),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 103/187 (55%), Positives = 125/187 (67%), Gaps = 11/187 (6%)
 Frame = -3

Query  636  AKSGLGLEITELRLGLPGSGHGGADK-GTTGEKKRVFSEMIDGG--DDHDRsssnnnnn-  469
            AK GL LEITELRLGLPG  +      G++ +KKRV S+M+     D  + +S  ++   
Sbjct  2    AKEGLALEITELRLGLPGDNYSEISVCGSSKKKKRVLSDMMTSSALDTENENSVVSSVED  61

Query  468  ----kkKQQVVGWPPVCSYRRKNNSDEGKKM--YVKVSMDGAPFLRKIDLTTHKTYSHLL  307
                  K Q VGWPPVCSYRRK N++E  K   YVKVSMDG P++RKIDL +  +Y +L+
Sbjct  62   ESLPVVKSQAVGWPPVCSYRRKKNNEEASKAIGYVKVSMDGVPYMRKIDLGSSNSYINLV  121

Query  306  IALDNLFDCRGIGEALKDADSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRIMKRSE  127
              L+NLF C GIG A K+    EY  IYEDKD DWMLVGDVPW MF ESCKRLRI+KRS+
Sbjct  122  TVLENLFGCLGIGVA-KEGKKCEYIIIYEDKDRDWMLVGDVPWQMFKESCKRLRIVKRSD  180

Query  126  AKGIGLH  106
            A G GL 
Sbjct  181  ATGFGLQ  187



>gb|ADB93649.2| indole-3-acetic acid inducible 19 [Arabidopsis thaliana]
Length=187

 Score =   187 bits (476),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 106/190 (56%), Positives = 121/190 (64%), Gaps = 23/190 (12%)
 Frame = -3

Query  633  KSGLGLEITELRLGLPGSGHGGADKGTTGEKKRVFSEM--IDGGDDHDRsssnnnnn---  469
            K GLGLEITELRLGLPG      D      KKR F+EM     G + D+  S   ++   
Sbjct  3    KEGLGLEITELRLGLPGR-----DVAEKMIKKRAFTEMNMTSSGSNSDQCESGVVSSGGD  57

Query  468  --------kkKQQVVGWPPVCSYRRKNNSDEGKKM-----YVKVSMDGAPFLRKIDLTTH  328
                      K QVVGWPPVCSYR+KN+  E         YVKVSMDG P+LRK+DL + 
Sbjct  58   AEKVNDSPAAKSQVVGWPPVCSYRKKNSCKEASTTKVGLGYVKVSMDGVPYLRKMDLGSS  117

Query  327  KTYSHLLIALDNLFDCRGIGEALKDADSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRL  148
            + Y  L  +LD LF  RGIG ALKD D+ EY  IYEDKDGDWML GDVPWGMF+ESCKRL
Sbjct  118  QGYDDLAFSLDKLFGFRGIGVALKDGDNCEYVTIYEDKDGDWMLAGDVPWGMFLESCKRL  177

Query  147  RIMKRSEAKG  118
            RIMKRS+A G
Sbjct  178  RIMKRSDATG  187



>gb|ADB93645.2| indole-3-acetic acid inducible 19 [Arabidopsis thaliana]
Length=187

 Score =   187 bits (475),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 106/190 (56%), Positives = 121/190 (64%), Gaps = 23/190 (12%)
 Frame = -3

Query  633  KSGLGLEITELRLGLPGSGHGGADKGTTGEKKRVFSEM--IDGGDDHDRsssnnnnn---  469
            K GLGLEITELRLGLPG      D      KKR F+EM     G + D+  S   ++   
Sbjct  3    KEGLGLEITELRLGLPGR-----DVAEKMIKKRAFTEMNMTSSGSNSDQCESGVVSSGGD  57

Query  468  --------kkKQQVVGWPPVCSYRRKNNSDEGKKM-----YVKVSMDGAPFLRKIDLTTH  328
                      K QVVGWPPVCSYR+KN+  E         YVKVSMDG P+LRK+DL + 
Sbjct  58   AEKVNDSPAAKTQVVGWPPVCSYRKKNSCKEASTTKVGLGYVKVSMDGVPYLRKMDLGSS  117

Query  327  KTYSHLLIALDNLFDCRGIGEALKDADSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRL  148
            + Y  L  +LD LF  RGIG ALKD D+ EY  IYEDKDGDWML GDVPWGMF+ESCKRL
Sbjct  118  QGYDDLAFSLDKLFGFRGIGVALKDGDNCEYVTIYEDKDGDWMLAGDVPWGMFLESCKRL  177

Query  147  RIMKRSEAKG  118
            RIMKRS+A G
Sbjct  178  RIMKRSDATG  187



>ref|XP_008447488.1| PREDICTED: auxin-induced protein 22A-like [Cucumis melo]
Length=187

 Score =   187 bits (474),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 107/193 (55%), Positives = 128/193 (66%), Gaps = 35/193 (18%)
 Frame = -3

Query  636  AKSGLGLEITELRLGLPGSG--HGGADKGTTGEKKRVFSEMI----DGGDDHDRsssnnn  475
            A +G+ LEITELRLGLPGSG  H  + K    EKKRVFSE      DGGD          
Sbjct  2    ASNGVELEITELRLGLPGSGSCHTSSSKN---EKKRVFSESSSTNNDGGDRR--------  50

Query  474  nnkkKQQVVGWPPVCSYRRKNN---------SDEGKKMYVKVSMDGAPFLRKIDLTTHKT  322
               K+ QVVGWPPVCS+RR+N+           E  KMYVK+ MDGAP+LRK+DL +HK 
Sbjct  51   -FPKRNQVVGWPPVCSHRRRNSGSSNNKGLSETEAPKMYVKIGMDGAPYLRKVDLGSHKG  109

Query  321  YSHLLIALDNLFDCRGIGEALKDADSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRI  142
            YS L++A++NLF     G AL     S++  IYED+DGDWML+GDVPW MF+ESCKRLRI
Sbjct  110  YSDLVVAMENLF-----GSAL---GCSDFVLIYEDRDGDWMLLGDVPWNMFIESCKRLRI  161

Query  141  MKRSEAKGIGLHA  103
            MKRSEAKG  +H 
Sbjct  162  MKRSEAKGFEIHV  174



>gb|ADC29380.2| indole-3-acetic acid inducible 6 [Arabidopsis thaliana]
Length=188

 Score =   187 bits (474),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 102/187 (55%), Positives = 125/187 (67%), Gaps = 11/187 (6%)
 Frame = -3

Query  636  AKSGLGLEITELRLGLPGSGHGGADK-GTTGEKKRVFSEMIDGG--DDHDRsssnnnnn-  469
            AK GL LEITELRLGLPG  +      G++ +KKRV S+M+     D  + +S  ++   
Sbjct  1    AKEGLALEITELRLGLPGDNYSEISVCGSSKKKKRVLSDMMTSSALDTENENSVVSSVED  60

Query  468  ----kkKQQVVGWPPVCSYRRKNNSDEGKKM--YVKVSMDGAPFLRKIDLTTHKTYSHLL  307
                  K Q VGWPPVCSYRRK N++E  K   YVKVSMDG P++RKIDL +  +Y +L+
Sbjct  61   ESLPVVKSQAVGWPPVCSYRRKKNNEEASKAIGYVKVSMDGVPYMRKIDLGSSNSYINLV  120

Query  306  IALDNLFDCRGIGEALKDADSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRIMKRSE  127
              L+NLF C GIG A K+    EY  IYEDKD DWM+VGDVPW MF ESCKRLRI+KRS+
Sbjct  121  TVLENLFGCLGIGVA-KEGKKCEYIIIYEDKDRDWMIVGDVPWQMFKESCKRLRIVKRSD  179

Query  126  AKGIGLH  106
            A G GL 
Sbjct  180  ATGFGLQ  186



>ref|XP_010535122.1| PREDICTED: auxin-responsive protein IAA19 [Tarenaya hassleriana]
Length=178

 Score =   186 bits (472),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 100/176 (57%), Positives = 121/176 (69%), Gaps = 7/176 (4%)
 Frame = -3

Query  627  GLGLEITELRLGLPGSGHGGADKGTTGEKKRVFSEMIDGGDDHDRsssnnnnnkkKQ-QV  451
            GLGLEITELRLGLPG   G  +      KKRVFSEM   G++ + +     ++   +  V
Sbjct  2    GLGLEITELRLGLPGDDGGKKET----FKKRVFSEMSAEGENEEVAGDKVVSSPAAKFPV  57

Query  450  VGWPPVCSYRRKNNS--DEGKKMYVKVSMDGAPFLRKIDLTTHKTYSHLLIALDNLFDCR  277
            VGWPPVCSYR KN+   D+  K YVKVSMDG P+LRK+DL +   Y  L +AL+ LF C 
Sbjct  58   VGWPPVCSYRSKNSGWRDQASKGYVKVSMDGVPYLRKMDLGSTHGYDDLSLALEKLFGCI  117

Query  276  GIGEALKDADSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRIMKRSEAKGIGL  109
            GIG ALKD +  EY   YEDKDGDWML GDVPW MF+ESC+R+RIMKRS+A G G+
Sbjct  118  GIGVALKDGEKCEYVTTYEDKDGDWMLAGDVPWQMFMESCRRMRIMKRSDATGFGI  173



>ref|XP_009147656.1| PREDICTED: auxin-responsive protein IAA6 [Brassica rapa]
Length=203

 Score =   187 bits (474),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 108/194 (56%), Positives = 126/194 (65%), Gaps = 17/194 (9%)
 Frame = -3

Query  636  AKSGLGLEITELRLGLPGSGHGGADKGTTGEKKRVFSEM-IDGGDDHDRsssnnnnn---  469
            AK GLGLEITELRLGLP   +G      + + KRVFSEM I    D D ++S  ++    
Sbjct  2    AKEGLGLEITELRLGLPVDNNGERLVSGSKKTKRVFSEMMISSSLDTDGANSVVSSVDIV  61

Query  468  ----------kkKQQVVGWPPVCSYR-RKNNSDEGKKM--YVKVSMDGAPFLRKIDLTTH  328
                      K K Q VGWPPVCSYR +KNN+ E  K   YVKVSM G P+LRK+DL T 
Sbjct  62   TGEVEDDSVPKDKSQAVGWPPVCSYRTKKNNNKESSKAIGYVKVSMCGVPYLRKVDLGTS  121

Query  327  KTYSHLLIALDNLFDCRGIGEALKDADSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRL  148
            K Y+HL   L+ LFDC G+G ALK+ +  EY  IYEDKD DWMLVGDVPW MF ESC RL
Sbjct  122  KGYTHLATVLEKLFDCLGLGVALKEGEKFEYVIIYEDKDRDWMLVGDVPWEMFKESCMRL  181

Query  147  RIMKRSEAKGIGLH  106
            RI+KRS+A G GL 
Sbjct  182  RIVKRSDATGFGLQ  195



>gb|AAM62583.1| putative IAA6 protein [Arabidopsis thaliana]
Length=189

 Score =   186 bits (473),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 102/187 (55%), Positives = 124/187 (66%), Gaps = 11/187 (6%)
 Frame = -3

Query  636  AKSGLGLEITELRLGLPGSGHGGADK-GTTGEKKRVFSEMIDGG--DDHDRsssnnnnn-  469
            AK GL LEITELRLG+PG  +      G++ +KKRV S+M+     D  + +S  ++   
Sbjct  2    AKEGLALEITELRLGIPGDNYSEISICGSSKKKKRVLSDMMTSSSLDTENENSVVSSVED  61

Query  468  ----kkKQQVVGWPPVCSYRRKNNSDEGKKM--YVKVSMDGAPFLRKIDLTTHKTYSHLL  307
                  K Q VGWPPVCSYRRK N++E  K   YVKVSMDG P++RKIDL +   Y +L+
Sbjct  62   ESLPVVKSQAVGWPPVCSYRRKKNNEEASKAIGYVKVSMDGVPYMRKIDLGSSNNYINLV  121

Query  306  IALDNLFDCRGIGEALKDADSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRIMKRSE  127
              L+NLF C GIG A K+    EY  IYEDKD DWMLVGDVPW MF ESCKRLRI+KRS+
Sbjct  122  TVLENLFGCLGIGVA-KEGKKCEYIIIYEDKDRDWMLVGDVPWQMFKESCKRLRIVKRSD  180

Query  126  AKGIGLH  106
            A G GL 
Sbjct  181  ATGFGLQ  187



>gb|AAC49047.1| IAA6 [Arabidopsis thaliana]
Length=189

 Score =   186 bits (472),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 102/187 (55%), Positives = 124/187 (66%), Gaps = 11/187 (6%)
 Frame = -3

Query  636  AKSGLGLEITELRLGLPGSGHGGADK-GTTGEKKRVFSEMIDGG--DDHDRsssnnnnn-  469
            AK GL LEITELRLGLPG  +      G++ + KRV S+M+     D  + +S  ++   
Sbjct  2    AKEGLALEITELRLGLPGDNYSEISVCGSSKKNKRVLSDMMTSSALDTENENSVVSSVED  61

Query  468  ----kkKQQVVGWPPVCSYRRKNNSDEGKKM--YVKVSMDGAPFLRKIDLTTHKTYSHLL  307
                  K Q VGWPPVCSYRRK N++E  K   YVKVSMDG P++RKIDL +  +Y +L+
Sbjct  62   ESLPVVKSQAVGWPPVCSYRRKKNNEEASKAIGYVKVSMDGVPYMRKIDLGSSNSYINLV  121

Query  306  IALDNLFDCRGIGEALKDADSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRIMKRSE  127
              L+NLF C GIG A K+    EY  IYEDKD DWMLVGDVPW MF ESCKRLRI+KRS+
Sbjct  122  TVLENLFGCLGIGVA-KEGKKCEYIIIYEDKDRDWMLVGDVPWQMFKESCKRLRIVKRSD  180

Query  126  AKGIGLH  106
            A G GL 
Sbjct  181  ATGFGLQ  187



>ref|XP_002894404.1| hypothetical protein ARALYDRAFT_474409 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH70663.1| hypothetical protein ARALYDRAFT_474409 [Arabidopsis lyrata subsp. 
lyrata]
Length=188

 Score =   186 bits (472),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 99/186 (53%), Positives = 122/186 (66%), Gaps = 10/186 (5%)
 Frame = -3

Query  636  AKSGLGLEITELRLGLPGSGHGGADKGTTGEKKRVFSEMIDGGDDHDRsssnnnnnkkKQ  457
            AK GLGLEITELRLGLPG  +       +  KKRV S+M+     +  + +   ++ + +
Sbjct  2    AKEGLGLEITELRLGLPGDNYSEISIWGSKNKKRVLSDMMTSSSLNTENENGVVSSAEDE  61

Query  456  -------QVVGWPPVCSYRRKNNSDEGKKM--YVKVSMDGAPFLRKIDLTTHKTYSHLLI  304
                   Q VGWPPVCSYRR+ N++E  K   YVKVSMDG P+LRKIDL +   Y++L  
Sbjct  62   SLPVVKSQAVGWPPVCSYRRQKNNEEASKAIGYVKVSMDGVPYLRKIDLGSSNGYNNLAT  121

Query  303  ALDNLFDCRGIGEALKDADSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRIMKRSEA  124
             L+NLF C G+G A K+    EY  IYEDKD DWMLVGDVPW MF ESCKRLRI+KRS+A
Sbjct  122  VLENLFGCLGLGVA-KEGKKCEYIIIYEDKDRDWMLVGDVPWQMFKESCKRLRIVKRSDA  180

Query  123  KGIGLH  106
             G GL 
Sbjct  181  TGFGLQ  186



>gb|KGN58115.1| hypothetical protein Csa_3G516540 [Cucumis sativus]
Length=187

 Score =   186 bits (471),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 107/191 (56%), Positives = 127/191 (66%), Gaps = 31/191 (16%)
 Frame = -3

Query  636  AKSGLGLEITELRLGLPGSGHGGADKGTTGEKKRVFSEMI----DGGDDHDRsssnnnnn  469
            A +G+ LEITELRLGLPGSG G     +  EKKRVF E      DGGD            
Sbjct  2    ASNGVELEITELRLGLPGSG-GCRTSSSKNEKKRVFCESSSTNNDGGDQ---------PF  51

Query  468  kkKQQVVGWPPVCSYRRK-----NNSD----EGKKMYVKVSMDGAPFLRKIDLTTHKTYS  316
             K+ QVVGWPPVCS+RR+     NN D    E  K+YVK+SMDGAP+LRK+DL +HK YS
Sbjct  52   PKRNQVVGWPPVCSHRRRSSGSGNNKDLSETETPKIYVKISMDGAPYLRKVDLGSHKGYS  111

Query  315  HLLIALDNLFDCRGIGEALKDADSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRIMK  136
             L++A++NLF     G AL     S++  IYED+DGDWMLVGDVPW MFVESCKRLRIMK
Sbjct  112  DLVVAMENLF-----GSAL---GCSDFVLIYEDRDGDWMLVGDVPWNMFVESCKRLRIMK  163

Query  135  RSEAKGIGLHA  103
            R+E KG  +H 
Sbjct  164  RTEVKGFEIHV  174



>gb|KFK35763.1| hypothetical protein AALP_AA4G033200 [Arabis alpina]
Length=199

 Score =   184 bits (467),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 105/194 (54%), Positives = 123/194 (63%), Gaps = 19/194 (10%)
 Frame = -3

Query  636  AKSGLGLEITELRLGLPGSGHGGADKGTTG-EKKRVFSEMIDGG-----DDHDRsssnnn  475
            AK GLG+EITELRLGLPG  +   ++   G  KKR FSE +        D++   SS N 
Sbjct  2    AKEGLGIEITELRLGLPGDNN--RERSVCGSNKKRAFSETMSSSSLATKDENSVVSSANI  59

Query  474  nnkkKQ---------QVVGWPPVCSYRRKNNSDEGKKM--YVKVSMDGAPFLRKIDLTTH  328
               K +         QVVGWPPVCSYRRK  ++E  K   YVKVSMDG P+LRKIDL + 
Sbjct  60   LANKVEDDSSPAVKSQVVGWPPVCSYRRKKKNEEATKAIGYVKVSMDGVPYLRKIDLGSS  119

Query  327  KTYSHLLIALDNLFDCRGIGEALKDADSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRL  148
              Y+HL   L++LF C G+G  LK  +  EY  IYEDKDGDWMLVGDVPW MF ESCKRL
Sbjct  120  HGYTHLATVLEDLFGCLGLGVVLKKGEMCEYVIIYEDKDGDWMLVGDVPWQMFRESCKRL  179

Query  147  RIMKRSEAKGIGLH  106
            RI+KRS   G GL 
Sbjct  180  RIVKRSCGTGFGLQ  193



>ref|XP_004506934.1| PREDICTED: auxin-induced protein IAA6-like [Cicer arietinum]
Length=239

 Score =   183 bits (465),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 116/236 (49%), Positives = 131/236 (56%), Gaps = 60/236 (25%)
 Frame = -3

Query  636  AKSGLGLEITELRLGLPGSGHGGADKGTTGEKKRVFSEMIDGGDDHDRsssnnnnnkkKQ  457
            A+ GLG EITELRLGLPG   G        EKKR+FSE+   GD+++   S +    KK 
Sbjct  2    AREGLGFEITELRLGLPG---GEPPSVVKNEKKRMFSEINGEGDENE--CSGDRKIDKKN  56

Query  456  QVVGWPPVCSYRRKNNSDEGKKMYVKVSMDGAPFLRKIDLTTHKTY--------------  319
            QVVGWPPVCSYR+KN  +EG KMY+KVSMDGAPFLRKIDL  HK Y              
Sbjct  57   QVVGWPPVCSYRKKNTMNEGSKMYMKVSMDGAPFLRKIDLGMHKGYLELALALEKLFDCC  116

Query  318  ------------SHLLIALDNLFDCRGIG-----------------------------EA  262
                         H+ I  D   D   +G                             EA
Sbjct  117  GIEEALKDGDNCEHVPIYEDKDGDWMLVGDVPWELINPKHLIIIKPLYKKDGNKPTKEEA  176

Query  261  LKDADSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRIMKRSEAKGIGLHAKNF  94
            LKD D+ E+ PIYEDKDGDWMLVGDVPW MFVESCKRLRIMKRS+AKG GL  K  
Sbjct  177  LKDGDNCEHVPIYEDKDGDWMLVGDVPWEMFVESCKRLRIMKRSDAKGFGLQQKRI  232



>gb|ADL70546.1| indole-3-acetic acid inducible 6 [Arabidopsis thaliana]
Length=183

 Score =   181 bits (458),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 99/182 (54%), Positives = 121/182 (66%), Gaps = 11/182 (6%)
 Frame = -3

Query  621  GLEITELRLGLPGSGHGGADK-GTTGEKKRVFSEMIDGG--DDHDRsssnnnnn-----k  466
             LEITELRLGLPG  +      G++ +KKRV S+M+     D  + +S  ++        
Sbjct  1    ALEITELRLGLPGDNYSEISVCGSSKKKKRVLSDMMTSSALDTENENSVVSSVEDESLPV  60

Query  465  kKQQVVGWPPVCSYRRKNNSDEGKKM--YVKVSMDGAPFLRKIDLTTHKTYSHLLIALDN  292
             K Q VGWPPVCSYRRK N++E  K   YVKVSMDG P++RKIDL +  +Y +L+  L+N
Sbjct  61   VKSQAVGWPPVCSYRRKKNNEEASKAIGYVKVSMDGVPYMRKIDLGSSNSYINLVTVLEN  120

Query  291  LFDCRGIGEALKDADSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRIMKRSEAKGIG  112
            LF C GIG A K+    EY  IYEDKD DWMLVGDVPW MF ESCKRLRI+KRS+A G G
Sbjct  121  LFGCLGIGVA-KEGKKCEYIIIYEDKDRDWMLVGDVPWQMFKESCKRLRIVKRSDATGFG  179

Query  111  LH  106
            L 
Sbjct  180  LQ  181



>gb|ADL70540.1| indole-3-acetic acid inducible 6 [Arabidopsis thaliana]
 gb|ADL70543.1| indole-3-acetic acid inducible 6 [Arabidopsis thaliana]
Length=182

 Score =   180 bits (456),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 99/181 (55%), Positives = 121/181 (67%), Gaps = 11/181 (6%)
 Frame = -3

Query  618  LEITELRLGLPGSGHGGADK-GTTGEKKRVFSEMIDGG--DDHDRsssnnnnn-----kk  463
            LEITELRLGLPG  +      G++ +KKRV S+M+     D  + +S  ++         
Sbjct  1    LEITELRLGLPGDNYSEISVCGSSKKKKRVLSDMMTSSALDTENENSVVSSVEDESLPVV  60

Query  462  KQQVVGWPPVCSYRRKNNSDEGKKM--YVKVSMDGAPFLRKIDLTTHKTYSHLLIALDNL  289
            K Q VGWPPVCSYRRK N++E  K   YVKVSMDG P++RKIDL +  +Y +L+  L+NL
Sbjct  61   KSQAVGWPPVCSYRRKKNNEEASKAIGYVKVSMDGVPYMRKIDLGSSNSYINLVTVLENL  120

Query  288  FDCRGIGEALKDADSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRIMKRSEAKGIGL  109
            F C GIG A K+    EY  IYEDKD DWMLVGDVPW MF ESCKRLRI+KRS+A G GL
Sbjct  121  FGCLGIGVA-KEGKKCEYIIIYEDKDRDWMLVGDVPWQMFKESCKRLRIVKRSDATGFGL  179

Query  108  H  106
             
Sbjct  180  Q  180



>ref|XP_010479813.1| PREDICTED: auxin-responsive protein IAA6 [Camelina sativa]
Length=181

 Score =   179 bits (455),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 97/180 (54%), Positives = 122/180 (68%), Gaps = 10/180 (6%)
 Frame = -3

Query  636  AKSGLGLEITELRLGLPGSGHGGADKGTTGEKKRVFSEMIDGG--DDHDRsssnnnnn--  469
            AK  LG+EITELRLGLPG  +       + +KKRV S+M+     D  D +S  ++    
Sbjct  2    AKESLGIEITELRLGLPGDNYSEISVCGSKKKKRVLSDMMTSSSLDTEDENSLVSSVEDN  61

Query  468  ---kkKQQVVGWPPVCSYRRKNNSDEGKKM--YVKVSMDGAPFLRKIDLTTHKTYSHLLI  304
                 K Q VGWPPVCSYRRK N++E  K   YVKVSMDG P+LRKIDL +  +Y++L  
Sbjct  62   SSPVVKSQAVGWPPVCSYRRKKNNEEACKAIGYVKVSMDGVPYLRKIDLGSSNSYNNLAT  121

Query  303  ALDNLFDCRGIGEALKDADSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRIMKRSEA  124
             L+NLF C G+G A K+ ++ E+  IYEDKD DWMLVGDVPW MF ESCKRL+I+KRS+A
Sbjct  122  VLENLFGCLGLGVA-KEGENCEHITIYEDKDRDWMLVGDVPWQMFKESCKRLKIVKRSDA  180



>ref|XP_006305683.1| hypothetical protein CARUB_v10010401mg [Capsella rubella]
 gb|EOA38581.1| hypothetical protein CARUB_v10010401mg [Capsella rubella]
Length=182

 Score =   177 bits (450),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 103/187 (55%), Positives = 126/187 (67%), Gaps = 16/187 (9%)
 Frame = -3

Query  636  AKSGLGLEITELRLGLPGSGHGGADKGTTGEKKRVFSEM-----IDGGDDHD--Rsssnn  478
            AK GLGLEITELRLGLPG  +  + K     KKRV S+M     +D  D++    S  +N
Sbjct  2    AKEGLGLEITELRLGLPGDNYSESKK-----KKRVLSDMMTSSSVDTEDENGVVSSVEDN  56

Query  477  nnnkkKQQVVGWPPVCSYRRKNNSDE--GKKM-YVKVSMDGAPFLRKIDLTTHKTYSHLL  307
            ++   K Q VGWPPVCSYRRK N++E   K + YVKVSMDG P+LRK+DL +  +Y +L 
Sbjct  57   SSPVMKSQAVGWPPVCSYRRKKNNEELASKAIGYVKVSMDGLPYLRKVDLGSSNSYDNLA  116

Query  306  IALDNLFDCRGIGEALKDADSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRIMKRSE  127
              L++LF C G+G A  +    EY  IYEDKD DWMLVGDVPW MF ESCKRLRI+KRS+
Sbjct  117  TVLEDLFGCLGLGVA-NEGKKCEYIIIYEDKDRDWMLVGDVPWQMFKESCKRLRIVKRSD  175

Query  126  AKGIGLH  106
            A G GL 
Sbjct  176  ATGFGLS  182



>gb|ADL70547.1| indole-3-acetic acid inducible 6 [Arabidopsis thaliana]
Length=178

 Score =   176 bits (447),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 97/179 (54%), Positives = 119/179 (66%), Gaps = 11/179 (6%)
 Frame = -3

Query  612  ITELRLGLPGSGHGGADK-GTTGEKKRVFSEMIDGG--DDHDRsssnnnnn-----kkKQ  457
            ITELRLGLPG  +      G++ +KKRV S+M+     D  + +S  ++         K 
Sbjct  1    ITELRLGLPGDNYSEISVCGSSKKKKRVLSDMMTSSALDTENENSVVSSVEDESLPVVKS  60

Query  456  QVVGWPPVCSYRRKNNSDEGKKM--YVKVSMDGAPFLRKIDLTTHKTYSHLLIALDNLFD  283
            Q VGWPPVCSYRRK N++E  K   YVKVSMDG P++RKIDL +  +Y +L+  L+NLF 
Sbjct  61   QAVGWPPVCSYRRKKNNEEASKAIGYVKVSMDGVPYMRKIDLGSSNSYLNLVTVLENLFG  120

Query  282  CRGIGEALKDADSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRIMKRSEAKGIGLH  106
            C GIG A K+    EY  IYEDKD DWMLVGDVPW MF ESCKRLRI+KRS+A G GL 
Sbjct  121  CLGIGVA-KEGKKCEYIIIYEDKDRDWMLVGDVPWQMFKESCKRLRIVKRSDATGFGLQ  178



>ref|XP_010462138.1| PREDICTED: auxin-responsive protein IAA6-like [Camelina sativa]
Length=181

 Score =   176 bits (446),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 96/179 (54%), Positives = 121/179 (68%), Gaps = 10/179 (6%)
 Frame = -3

Query  636  AKSGLGLEITELRLGLPGSGHGGADKGTTGEKKRVFSEMIDGG--DDHDRsssnnnnn--  469
            AK GL +EITELRLGLPG  +       + +KKRV S+M+     D  D +S  ++    
Sbjct  2    AKGGLEIEITELRLGLPGDNYSEISVCGSKKKKRVLSDMMTSSSFDTEDENSLVSSVEDN  61

Query  468  ---kkKQQVVGWPPVCSYRRKNNSDEGKKM--YVKVSMDGAPFLRKIDLTTHKTYSHLLI  304
                 K Q VGWPPVCSYRRK N++E  K   YVKVSMDG P+LRKIDL +  +Y++L+ 
Sbjct  62   SSPVVKSQAVGWPPVCSYRRKKNNEEACKAIGYVKVSMDGVPYLRKIDLGSSNSYNNLVT  121

Query  303  ALDNLFDCRGIGEALKDADSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRIMKRSE  127
             L+NLFDC  +G A K+ +  E+  IYEDKD DWMLVGDVPW MF ESCKRL+I+KRS+
Sbjct  122  VLENLFDCLCLGVA-KEGEKCEHIIIYEDKDRDWMLVGDVPWQMFKESCKRLKIVKRSD  179



>ref|XP_010500910.1| PREDICTED: auxin-responsive protein IAA6-like [Camelina sativa]
Length=180

 Score =   176 bits (446),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 97/180 (54%), Positives = 121/180 (67%), Gaps = 11/180 (6%)
 Frame = -3

Query  636  AKSGLGLEITELRLGLPGSGHGGADKGTTGEKKRVFSEMIDGG--DDHDRsssnnnnn--  469
            AK GLG+E TELRLGLPG  +       + +KKRV S+M+     D  D SS  ++    
Sbjct  2    AKEGLGIESTELRLGLPGDNYSEISVCGSKKKKRVLSDMMTSSSLDTEDESSLLSSVEDN  61

Query  468  ---kkKQQVVGWPPVCSYRRKNNSDEGKKM--YVKVSMDGAPFLRKIDLTTHKTYSHLLI  304
                 K Q VGWPPVCSYRRK N++E  K+  YVKVSMDG P+LRKIDL +  +Y++L  
Sbjct  62   SSPVVKSQAVGWPPVCSYRRKKNNEEACKVIGYVKVSMDGVPYLRKIDLGSSNSYNNLAT  121

Query  303  ALDNLFDCRGIGEALKDADSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRIMKRSEA  124
             L+NLF C G+G A  + +  E+  IYEDKD DWMLVGDVPW MF ESCKRL+I+KRS+A
Sbjct  122  VLENLFGCLGLGVA--EGEKCEHIIIYEDKDRDWMLVGDVPWQMFKESCKRLKIVKRSDA  179



>ref|XP_009589137.1| PREDICTED: auxin-induced protein 22D-like [Nicotiana tomentosiformis]
Length=193

 Score =   174 bits (440),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 96/183 (52%), Positives = 112/183 (61%), Gaps = 14/183 (8%)
 Frame = -3

Query  624  LGLEITELRLGLPGSGH-----GGADKGTTGEKKRVFSEMIDGGDDHDRsssnnnnnkkK  460
            L LE TELRLGLPG          A       KKR  SEM +     +    +    K  
Sbjct  11   LNLEATELRLGLPGINEPEKQSSSASTSAKYSKKRTSSEMDNSSSGKENEQDSAPAPKA-  69

Query  459  QQVVGWPPVCSYRR------KNNSDEGKKMYVKVSMDGAPFLRKIDLTTHKTYSHLLIAL  298
             QVVGWPPV SYR+      K+ SD    MY+KVSMDGAP+LRKIDL  +K+Y  LL AL
Sbjct  70   -QVVGWPPVRSYRKNVLQVKKSESDNSSGMYLKVSMDGAPYLRKIDLKVYKSYPELLKAL  128

Query  297  DNLFDCR-GIGEALKDADSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRIMKRSEAK  121
             N+F C  G+    +  + SEYAP YEDKDGDWMLVGDVPW MF+ SC+RLRIMK SEAK
Sbjct  129  QNMFKCTIGVYTEREGYNGSEYAPTYEDKDGDWMLVGDVPWDMFINSCRRLRIMKGSEAK  188

Query  120  GIG  112
            G+ 
Sbjct  189  GLA  191



>gb|ADL70537.1| indole-3-acetic acid inducible 6 [Arabidopsis thaliana]
Length=181

 Score =   171 bits (434),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 95/180 (53%), Positives = 121/180 (67%), Gaps = 11/180 (6%)
 Frame = -3

Query  615  EITELRLGLPGSGHGGADK-GTTGEKKRVFSEMIDGGDDHDRsssnnnnnkkKQ------  457
            EITELRLGLPG+ +      G++ +KKRV S+M+        + ++  ++ + +      
Sbjct  1    EITELRLGLPGNNYSEISVCGSSKKKKRVLSDMMSSSSLDTENENSVVSSVEDESLPVVK  60

Query  456  -QVVGWPPVCSYRRKNNSDEGKKM--YVKVSMDGAPFLRKIDLTTHKTYSHLLIALDNLF  286
             Q VGWPPVCSYRRK N++E  K   YVKVSMDG P++RKIDL +  +Y +L+  L+NLF
Sbjct  61   SQAVGWPPVCSYRRKKNNEEASKAIGYVKVSMDGVPYMRKIDLGSSNSYINLVTVLENLF  120

Query  285  DCRGIGEALKDADSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRIMKRSEAKGIGLH  106
             C GIG A K+    EY  IYEDKD DWMLVGDVPW MF ESCKRLRI+KRS+A G GL 
Sbjct  121  GCLGIGVA-KEGKKCEYIIIYEDKDRDWMLVGDVPWQMFKESCKRLRIVKRSDATGFGLQ  179



>gb|AAB84356.1| IAA19, partial [Arabidopsis thaliana]
Length=145

 Score =   170 bits (431),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 82/125 (66%), Positives = 92/125 (74%), Gaps = 5/125 (4%)
 Frame = -3

Query  459  QQVVGWPPVCSYRRKNNSDEGKKM-----YVKVSMDGAPFLRKIDLTTHKTYSHLLIALD  295
             QVVGWPPVCSYR+KN+  E         YVKVSMDG P+LRK+DL + + Y  L  ALD
Sbjct  17   SQVVGWPPVCSYRKKNSCKEASTTKVGLGYVKVSMDGVPYLRKMDLGSSQGYDDLAFALD  76

Query  294  NLFDCRGIGEALKDADSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRIMKRSEAKGI  115
             LF  RGIG ALKD D+ EY  IYEDKDGDWML GDVPWGMF+ESCKRLRIMKRS+A G 
Sbjct  77   KLFGFRGIGVALKDGDNCEYVTIYEDKDGDWMLAGDVPWGMFLESCKRLRIMKRSDATGF  136

Query  114  GLHAK  100
            GL  +
Sbjct  137  GLQPR  141



>gb|ADL70536.1| indole-3-acetic acid inducible 6 [Arabidopsis thaliana]
 gb|ADL70541.1| indole-3-acetic acid inducible 6 [Arabidopsis thaliana]
 gb|ADL70544.1| indole-3-acetic acid inducible 6 [Arabidopsis thaliana]
Length=177

 Score =   171 bits (432),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 94/176 (53%), Positives = 116/176 (66%), Gaps = 11/176 (6%)
 Frame = -3

Query  603  LRLGLPGSGHGGADK-GTTGEKKRVFSEMIDGG--DDHDRsssnnnnn-----kkKQQVV  448
            LRLGLPG  +      G++ +KKRV S+M+     D  + +S  ++         K Q V
Sbjct  1    LRLGLPGDNYSEISVCGSSKKKKRVLSDMMTSSALDTENENSVVSSVEDESLPVVKSQAV  60

Query  447  GWPPVCSYRRKNNSDEGKKM--YVKVSMDGAPFLRKIDLTTHKTYSHLLIALDNLFDCRG  274
            GWPPVCSYRRK N++E  K   YVKVSMDG P++RKIDL +  +Y +L+  L+NLF C G
Sbjct  61   GWPPVCSYRRKKNNEEASKAIGYVKVSMDGVPYMRKIDLGSSNSYINLVTVLENLFGCLG  120

Query  273  IGEALKDADSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRIMKRSEAKGIGLH  106
            IG A K+    EY  IYEDKD DWMLVGDVPW MF ESCKRLRI+KRS+A G GL 
Sbjct  121  IGVA-KEGKKCEYIIIYEDKDRDWMLVGDVPWQMFKESCKRLRIVKRSDATGFGLQ  175



>sp|O24542.1|AX22D_VIGRR RecName: Full=Auxin-induced protein 22D; AltName: Full=Indole-3-acetic 
acid-induced protein ARG13 [Vigna radiata var. radiata]
 dbj|BAA20848.1| Aux22d [Vigna radiata]
Length=193

 Score =   170 bits (430),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 98/181 (54%), Positives = 113/181 (62%), Gaps = 11/181 (6%)
 Frame = -3

Query  624  LGLEITELRLGLPGSGHGGADKGTTGEKKRVFSEMIDG---GDDHDRsssnnnnnkkKQQ  454
            L L+ TELRLGLPGS      + T    KR   E  D     +  D +  +N     K Q
Sbjct  12   LNLKATELRLGLPGSDEP-EKRATARSNKRSSPEASDEESISNGSDVTKEDNVVPPAKAQ  70

Query  453  VVGWPPVCSYRRKN------NSDEGKKMYVKVSMDGAPFLRKIDLTTHKTYSHLLIALDN  292
            VVGWPP+ SYR+ N         EG  MYVKVSM GAP+LRKIDL  +K+Y  LL AL+N
Sbjct  71   VVGWPPIRSYRKNNVQQKKEEESEGNGMYVKVSMAGAPYLRKIDLKVYKSYPELLKALEN  130

Query  291  LFDC-RGIGEALKDADSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRIMKRSEAKGI  115
            +F C  G     +  + SEYAP YEDKDGDWMLVGDVPW MFV SCKRLRIMK SEAKG+
Sbjct  131  MFKCIFGEYSEREGYNGSEYAPTYEDKDGDWMLVGDVPWNMFVSSCKRLRIMKGSEAKGL  190

Query  114  G  112
            G
Sbjct  191  G  191



>ref|NP_001242395.1| uncharacterized protein LOC100799875 [Glycine max]
 gb|ACU18630.1| unknown [Glycine max]
Length=197

 Score =   170 bits (430),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 101/188 (54%), Positives = 117/188 (62%), Gaps = 17/188 (9%)
 Frame = -3

Query  624  LGLEITELRLGLPGSGHGG------ADKGTT---GEKKRVFS-EMIDGGDDHDRsssnnn  475
            L LE TELRLGLPGS   G      ++K ++    E++R+    M   G D      +N 
Sbjct  8    LNLEATELRLGLPGSDEPGKRSIVRSNKRSSTEASEEERISKGNMNSNGSDITSDDQDNL  67

Query  474  nnkkKQQVVGWPPVCSYRR------KNNSDEGKKMYVKVSMDGAPFLRKIDLTTHKTYSH  313
                K QVVGWPPV SYR+      K    EG  MYVKVSM GAP+LRKIDL  +K+Y  
Sbjct  68   VPPAKAQVVGWPPVRSYRKNTLQQKKEEQGEGSGMYVKVSMAGAPYLRKIDLNVYKSYPE  127

Query  312  LLIALDNLFDCR-GIGEALKDADSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRIMK  136
            LL AL N+F C  G     +  + SEYAP YEDKDGDWMLVGDVPW MFV SCKRLRIMK
Sbjct  128  LLKALGNMFKCTFGEYSEREGYNGSEYAPTYEDKDGDWMLVGDVPWNMFVSSCKRLRIMK  187

Query  135  RSEAKGIG  112
             SEAKG+G
Sbjct  188  ASEAKGLG  195



>emb|CDY32934.1| BnaA09g16590D [Brassica napus]
Length=191

 Score =   169 bits (429),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 95/182 (52%), Positives = 116/182 (64%), Gaps = 15/182 (8%)
 Frame = -3

Query  624  LGLEITELRLGLPGSGHGGADK----GTTGEKKRVFSEMIDGGDDHDRsssnnnnnkkKQ  457
            + L+ TELRLGLPG+  GG ++          KR F E      D + +      +  K 
Sbjct  11   VNLKATELRLGLPGTEDGGEEERQKVSCCKSNKRAFPET---EKDIESTGKTETASPPKA  67

Query  456  QVVGWPPVCSYRRKN-----NSDEGKKMYVKVSMDGAPFLRKIDLTTHKTYSHLLIALDN  292
            Q+VGWPPV SYR+ N     N  EG+ MYVKVSMDGAP+LRKIDLT +K Y  L+ +L+N
Sbjct  68   QIVGWPPVRSYRKNNIQTKKNESEGQGMYVKVSMDGAPYLRKIDLTVYKQYPELMKSLEN  127

Query  291  LFDCRGIGEALKDA--DSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRIMKRSEAKG  118
            +F    +GE  +      SE+ P YEDKDGDWMLVGDVPW MFV SCKRLRIMK SEAKG
Sbjct  128  MFKF-SVGEYCEREGYKGSEFVPTYEDKDGDWMLVGDVPWEMFVSSCKRLRIMKGSEAKG  186

Query  117  IG  112
            +G
Sbjct  187  LG  188



>gb|KHN03839.1| Auxin-induced protein 22D [Glycine soja]
Length=197

 Score =   169 bits (429),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 101/189 (53%), Positives = 112/189 (59%), Gaps = 19/189 (10%)
 Frame = -3

Query  624  LGLEITELRLGLPGSGHGGADKGTTGEKKRVFSE-----------MIDGGDDHDRsssnn  478
            L LE TELRLGLPGS   G  +      KR  +E           M   G D      +N
Sbjct  8    LNLEATELRLGLPGSDEPGK-RSIVRSNKRSSTEASEEECISKGNMNSNGSDITSDDQDN  66

Query  477  nnnkkKQQVVGWPPVCSYRR------KNNSDEGKKMYVKVSMDGAPFLRKIDLTTHKTYS  316
                 K QVVGWPPV SYR+      K    EG  MYVKVSM GAP+LRKIDL  +K+Y 
Sbjct  67   LVPPAKAQVVGWPPVRSYRKNTLQQKKEEQGEGSGMYVKVSMAGAPYLRKIDLNVYKSYP  126

Query  315  HLLIALDNLFDCR-GIGEALKDADSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRIM  139
             LL AL N+F C  G     +  + SEYAP YEDKDGDWMLVGDVPW MFV SCKRLRIM
Sbjct  127  ELLKALGNMFKCTFGEYSEREGYNGSEYAPTYEDKDGDWMLVGDVPWNMFVSSCKRLRIM  186

Query  138  KRSEAKGIG  112
            K SEAKG+G
Sbjct  187  KASEAKGLG  195



>ref|XP_009113982.1| PREDICTED: auxin-responsive protein IAA4 [Brassica rapa]
Length=191

 Score =   169 bits (428),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 95/182 (52%), Positives = 116/182 (64%), Gaps = 15/182 (8%)
 Frame = -3

Query  624  LGLEITELRLGLPGSGHGGADK----GTTGEKKRVFSEMIDGGDDHDRsssnnnnnkkKQ  457
            + L+ TELRLGLPG+  GG ++          KR F E      D + +      +  K 
Sbjct  11   VNLKATELRLGLPGTEDGGEEERQKVSCCKSNKRAFPET---EKDIESTGKTKPASPPKA  67

Query  456  QVVGWPPVCSYRRKN-----NSDEGKKMYVKVSMDGAPFLRKIDLTTHKTYSHLLIALDN  292
            Q+VGWPPV SYR+ N     N  EG+ MYVKVSMDGAP+LRKIDLT +K Y  L+ +L+N
Sbjct  68   QIVGWPPVRSYRKNNIQTKKNESEGQGMYVKVSMDGAPYLRKIDLTVYKQYPELMKSLEN  127

Query  291  LFDCRGIGEALKDA--DSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRIMKRSEAKG  118
            +F    +GE  +      SE+ P YEDKDGDWMLVGDVPW MFV SCKRLRIMK SEAKG
Sbjct  128  MFKF-SVGEYCERERYKGSEFVPTYEDKDGDWMLVGDVPWEMFVSSCKRLRIMKGSEAKG  186

Query  117  IG  112
            +G
Sbjct  187  LG  188



>gb|ADB93647.2| indole-3-acetic acid inducible 19 [Arabidopsis thaliana]
Length=175

 Score =   168 bits (426),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 96/178 (54%), Positives = 110/178 (62%), Gaps = 23/178 (13%)
 Frame = -3

Query  633  KSGLGLEITELRLGLPGSGHGGADKGTTGEKKRVFSEM--IDGGDDHDRsssnnnnn---  469
            K GLGLEITELRLGLPG      D      KKR F+EM     G + D+  S   ++   
Sbjct  3    KEGLGLEITELRLGLPGR-----DVAEKMIKKRAFTEMNMTSSGSNSDQCESGVVSSGGD  57

Query  468  --------kkKQQVVGWPPVCSYRRKNNSDEGKKM-----YVKVSMDGAPFLRKIDLTTH  328
                      K QVVGWPPVCSYR+KN+  E         YVKVSMDG P+LRK+DL + 
Sbjct  58   AEKVNDSPAAKTQVVGWPPVCSYRKKNSCKEASTTKVGLGYVKVSMDGVPYLRKMDLGSS  117

Query  327  KTYSHLLIALDNLFDCRGIGEALKDADSSEYAPIYEDKDGDWMLVGDVPWGMFVESCK  154
            + Y  L  +LD LF  RGIG ALKD D+ EY  IYEDKDGDWML GDVPWGMF+ESCK
Sbjct  118  QGYDDLAFSLDKLFGFRGIGVALKDGDNCEYVTIYEDKDGDWMLAGDVPWGMFLESCK  175



>emb|CDY69497.1| BnaCnng63870D [Brassica napus]
Length=191

 Score =   168 bits (426),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 97/185 (52%), Positives = 117/185 (63%), Gaps = 21/185 (11%)
 Frame = -3

Query  624  LGLEITELRLGLPGSGHGGADK----GTTGEKKRVFSEMIDGGDDHDRsssnnnnnkkKQ  457
            + L+ TELRLGLPG+  GG ++          KR F E      D + +      +  K 
Sbjct  11   VNLKATELRLGLPGTEDGGEEERQKVSCCKSNKRAFPET---EKDIESTGKAETASPPKA  67

Query  456  QVVGWPPVCSYRRKN-----NSDEGKKMYVKVSMDGAPFLRKIDLTTHKTYSHLLIALDN  292
            Q+VGWPPV SYR+ N     N  EG+ MYVKVSMDGAP+LRKIDLT +K Y  L+ +L+N
Sbjct  68   QIVGWPPVRSYRKNNIQTKKNESEGQGMYVKVSMDGAPYLRKIDLTVYKQYPELMKSLEN  127

Query  291  LFDCRGIG-----EALKDADSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRIMKRSE  127
            +F    +G     E  KD   SE+ P YEDKDGDWMLVGDVPW MFV SCKRLRIMK SE
Sbjct  128  MFKF-SVGKYCEREGYKD---SEFVPTYEDKDGDWMLVGDVPWEMFVSSCKRLRIMKGSE  183

Query  126  AKGIG  112
            AKG+G
Sbjct  184  AKGLG  188



>ref|XP_009764468.1| PREDICTED: auxin-induced protein 22D-like [Nicotiana sylvestris]
Length=193

 Score =   167 bits (424),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 93/183 (51%), Positives = 111/183 (61%), Gaps = 14/183 (8%)
 Frame = -3

Query  624  LGLEITELRLGLPG-----SGHGGADKGTTGEKKRVFSEMIDGGDDHDRsssnnnnnkkK  460
            L L+ TELRLGLPG          A       KKR  SEM +     +    +    K  
Sbjct  11   LNLKATELRLGLPGIDEPEKQSSSASTSAKYSKKRTSSEMDNSSSGKENEQDSAPAPKA-  69

Query  459  QQVVGWPPVCSYRR------KNNSDEGKKMYVKVSMDGAPFLRKIDLTTHKTYSHLLIAL  298
             QVVGWPPV SYR+      K+ SD    MY+KVSMDGAP+LRKIDL  + +Y  LL AL
Sbjct  70   -QVVGWPPVRSYRKNVLQVKKSESDNSSGMYLKVSMDGAPYLRKIDLKVYNSYPELLKAL  128

Query  297  DNLFDCR-GIGEALKDADSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRIMKRSEAK  121
             N+F C  G+    +  + S+YAP YEDKDGDWMLVGDVPW MF+ SC+RLRIMK SEAK
Sbjct  129  QNMFKCTIGVYTEREGYNGSDYAPTYEDKDGDWMLVGDVPWDMFLNSCRRLRIMKGSEAK  188

Query  120  GIG  112
            G+ 
Sbjct  189  GLA  191



>ref|XP_010537941.1| PREDICTED: auxin-induced protein 22C [Tarenaya hassleriana]
Length=158

 Score =   166 bits (421),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 95/176 (54%), Positives = 113/176 (64%), Gaps = 27/176 (15%)
 Frame = -3

Query  636  AKSGLGLEITELRLGLPGSGHGGADKGTTGEKKRVFSEMIDGGDDHDRsssnnnnnkkKQ  457
            A   LGLEITELRLGLPGSG           KKR+  E  +G +  +           K 
Sbjct  2    ANEALGLEITELRLGLPGSG-----------KKRISPES-EGKNGRE----------AKS  39

Query  456  QVVGWPPVCSYRRKNNSDE--GKKMYVKVSMDGAPFLRKIDLTTHKTYSHLLIALDNLFD  283
            QVVGWPPVCSYRRKN+ ++   K  YVKV +DGAPFLRKIDL  +K Y  L  AL++LF 
Sbjct  40   QVVGWPPVCSYRRKNSFEQENPKSTYVKVCVDGAPFLRKIDLGMYKGYEDLAAALEDLFG  99

Query  282  CRGIGEALKDADSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRIMKRSEAKGI  115
              GIG   K+ +  EY PIYEDKDGDWML GDVPW MF+ +CKRLR+MK S+A+  
Sbjct  100  FSGIG---KERERREYVPIYEDKDGDWMLAGDVPWEMFIGTCKRLRLMKISDAEAF  152



>gb|ADL70535.1| indole-3-acetic acid inducible 6 [Arabidopsis thaliana]
Length=175

 Score =   167 bits (422),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 92/174 (53%), Positives = 114/174 (66%), Gaps = 11/174 (6%)
 Frame = -3

Query  597  LGLPGSGHGGADK-GTTGEKKRVFSEMIDGG--DDHDRsssnnnnn-----kkKQQVVGW  442
            LGLPG  +      G++ +KKRV S+M+     D  + +S  ++         K Q VGW
Sbjct  1    LGLPGDNYSEISVCGSSKKKKRVLSDMMTSSALDTENENSVVSSVEDESLPVVKSQAVGW  60

Query  441  PPVCSYRRKNNSDEGKKM--YVKVSMDGAPFLRKIDLTTHKTYSHLLIALDNLFDCRGIG  268
            PPVCSYRRK N++E  K   YVKVSMDG P++RKIDL +  +Y +L+  L+NLF C GIG
Sbjct  61   PPVCSYRRKKNNEEASKAIGYVKVSMDGVPYMRKIDLGSSNSYINLVTVLENLFGCLGIG  120

Query  267  EALKDADSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRIMKRSEAKGIGLH  106
             A K+    EY  IYEDKD DWMLVGDVPW MF ESCKRLRI+KRS+A G GL 
Sbjct  121  VA-KEGKKCEYIIIYEDKDRDWMLVGDVPWQMFKESCKRLRIVKRSDATGFGLQ  173



>ref|XP_011082600.1| PREDICTED: auxin-induced protein 22D-like [Sesamum indicum]
Length=182

 Score =   166 bits (419),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 95/184 (52%), Positives = 115/184 (63%), Gaps = 11/184 (6%)
 Frame = -3

Query  642  MAAKSGLGLEITELRLGLPGSGHGGADKGTTGEKKRVFSEMIDGGDDHDRsssnnnnnkk  463
            M  +S L L+ TELRLGLPG         +  +K +  S  +D   +H  S  +      
Sbjct  1    MEFESDLNLKATELRLGLPGRDESEEQSSSCVKKNKRSSSEMDSSSEHQESGPSAPKA--  58

Query  462  KQQVVGWPPVCSYRR------KNNSDEGKKMYVKVSMDGAPFLRKIDLTTHKTYSHLLIA  301
              QVVGWPPV SYR+      K    +G  M+VKVSMDGAP+LRKIDL  +K Y  LL A
Sbjct  59   --QVVGWPPVRSYRKNVLQQQKKPESDGSGMFVKVSMDGAPYLRKIDLKCYKNYFDLLKA  116

Query  300  LDNLFDCR-GIGEALKDADSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRIMKRSEA  124
            L+N+F C  G+    +  + SEYAP YEDKDGDWMLVGDVPW MF+ SCKRLRIMK SEA
Sbjct  117  LENMFKCTIGVYSEREGYNGSEYAPTYEDKDGDWMLVGDVPWDMFITSCKRLRIMKGSEA  176

Query  123  KGIG  112
            KG+G
Sbjct  177  KGLG  180



>gb|KHN18839.1| Auxin-induced protein 22D [Glycine soja]
Length=202

 Score =   166 bits (421),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 99/194 (51%), Positives = 110/194 (57%), Gaps = 28/194 (14%)
 Frame = -3

Query  624  LGLEITELRLGLPGSGHGGADKGTTGEKKRV----FSEMIDGG------------DDHDR  493
            L LE TELRLGLPGS            K+        E I  G            DD D 
Sbjct  12   LNLEATELRLGLPGSDEPEKRSAVRSNKRSSPEASEEECISKGNMNSSDGSDITSDDQDN  71

Query  492  sssnnnnnkkKQQVVGWPPVCSYRR------KNNSDEGKKMYVKVSMDGAPFLRKIDLTT  331
                        QVVGWPPV SYR+      K    EG  MYVKVSM+GAP+LRKIDL  
Sbjct  72   VVPPAKA-----QVVGWPPVRSYRKNSLQQKKEEQAEGAGMYVKVSMEGAPYLRKIDLKV  126

Query  330  HKTYSHLLIALDNLFDCR-GIGEALKDADSSEYAPIYEDKDGDWMLVGDVPWGMFVESCK  154
            +K+Y  LL AL+N+F C  G     +  + SEYAP YEDKDGDWMLVGDVPW MFV SCK
Sbjct  127  YKSYPELLKALENMFKCTFGQYSEREGYNGSEYAPTYEDKDGDWMLVGDVPWNMFVSSCK  186

Query  153  RLRIMKRSEAKGIG  112
            RLRIMK SEAKG+G
Sbjct  187  RLRIMKGSEAKGLG  200



>gb|AAD32144.1|AF123506_1 Nt-iaa4.3 deduced protein [Nicotiana tabacum]
Length=202

 Score =   166 bits (421),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 96/186 (52%), Positives = 111/186 (60%), Gaps = 16/186 (9%)
 Frame = -3

Query  624  LGLEITELRLGLPGSGH-----GGADKGTTGEKKRVFSEMIDGGDDHDRsssnnnnnkkK  460
            L LE TELRLGLPG          A       KKR  SEM +     +    +    K  
Sbjct  11   LNLEATELRLGLPGINEPEKQSSSASTSAKYSKKRTSSEMDNSSSGKENEQDSAPAPKA-  69

Query  459  QQVVGWPPVCSYRR------KNNSDEGKKMYVKVSMDGAPFLRKIDLTTHKTYSHLLIAL  298
             QVVGWPPV SYR+      K+ SD    MY+KVSMDG  +LRKIDL  +K+Y  LL AL
Sbjct  70   -QVVGWPPVRSYRKNVLQVKKSESDNSSGMYLKVSMDGGTYLRKIDLKVYKSYPELLKAL  128

Query  297  DNLFDCR-GIGEALKDADSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRIMKRSEAK  121
             N+F C  G+    +  + SEYAP YEDKD DWMLVGDVPW MF+ SC+RLRIMK SEAK
Sbjct  129  QNMFKCTIGVYTEREGYNGSEYAPTYEDKDRDWMLVGDVPWDMFINSCRRLRIMKGSEAK  188

Query  120  GIGLHA  103
              GLHA
Sbjct  189  --GLHA  192



>gb|EPS68980.1| hypothetical protein M569_05790, partial [Genlisea aurea]
Length=183

 Score =   165 bits (418),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 94/184 (51%), Positives = 123/184 (67%), Gaps = 20/184 (11%)
 Frame = -3

Query  624  LGLEITELRLGLPGSGHGGADKGTTG--EKKRVFSEMIDGGDDHDRsssnnnnnkkKQQV  451
            L LE TELRLGLPG     +   T+     KR  SE+       +++SSN +   +KQQV
Sbjct  5    LNLEATELRLGLPGGDEMRSSASTSSLFHIKRSSSEI-------EKNSSNGSCPVQKQQV  57

Query  450  VGWPPVCSYR--------RKNNSDEGKKMYVKVSMDGAPFLRKIDLTTHKTYSHLLIALD  295
            VGWPPV S+R        RK++S+ G  ++VKVSMDGAP+LRKIDL  +K YS LL AL+
Sbjct  58   VGWPPVRSFRKNALLQQGRKDDSENGSGIFVKVSMDGAPYLRKIDLRFYKNYSDLLKALE  117

Query  294  NLFDCR---GIGEALKDADSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRIMKRSEA  124
            ++F C+    +   ++  ++SEYAP YEDKDGDWML GDVPW MFV  C+R+RIM+ SEA
Sbjct  118  DMFKCKIGKSVYSEMEGYNASEYAPTYEDKDGDWMLAGDVPWEMFVTCCRRMRIMRASEA  177

Query  123  KGIG  112
            KG+G
Sbjct  178  KGLG  181



>ref|XP_009117817.1| PREDICTED: auxin-responsive protein IAA5 [Brassica rapa]
Length=156

 Score =   164 bits (414),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 98/175 (56%), Positives = 110/175 (63%), Gaps = 20/175 (11%)
 Frame = -3

Query  642  MAAKSGLGLEITELRLGLPGSGHGGADKGTTGEKKRVFSEMIDGGDDHDRsssnnnnnkk  463
            MA +S L  EITELRLGLPG      D   TG KKRV SE+          S        
Sbjct  1    MANESNLAHEITELRLGLPG------DIIVTG-KKRVSSEV---------ESELKCEPAT  44

Query  462  KQQVVGWPPVCSYRRKNNSDEGKKMYVKVSMDGAPFLRKIDLTTHKTYSHLLIALDNLFD  283
            K QVVGWPPVCS+RRKN+ +E +  YVKVS+DGA FLRKIDL  +K Y  L  AL  LF 
Sbjct  45   KSQVVGWPPVCSFRRKNSLEETRTAYVKVSVDGAAFLRKIDLKMYKRYQDLASALQILFG  104

Query  282  CR-GIGEALKDADSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRIMKRSEAK  121
            C     + LK+   SE  PIYED+DGDWML GDVPW MFV SCKRLR+MKRS  K
Sbjct  105  CFITFDDTLKE---SECVPIYEDRDGDWMLAGDVPWEMFVASCKRLRVMKRSVMK  156



>gb|KDO58188.1| hypothetical protein CISIN_1g048172mg [Citrus sinensis]
Length=158

 Score =   163 bits (413),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 94/159 (59%), Positives = 109/159 (69%), Gaps = 12/159 (8%)
 Frame = -3

Query  624  LGLEITELRLGLPG-----SGHGGADKGTTGEKKRVFSEMIDGGDDHDRsssnnnnnkkK  460
            + LEITELRLGLPG     SG   +      EKKR FS++ D  + +  ++     N  K
Sbjct  1    MELEITELRLGLPGRDGCDSGLNSSSNNNKNEKKRAFSDICD--EANYETNGERKINPTK  58

Query  459  QQVVGWPPVCSYRRKNNSDE-----GKKMYVKVSMDGAPFLRKIDLTTHKTYSHLLIALD  295
             QVVGWPPVCSYRRKN+ +E       KMYVKVSMDGAPFLRKIDL  H+ Y  L +AL+
Sbjct  59   SQVVGWPPVCSYRRKNSFNEKDRVESSKMYVKVSMDGAPFLRKIDLGMHQGYPDLAMALE  118

Query  294  NLFDCRGIGEALKDADSSEYAPIYEDKDGDWMLVGDVPW  178
             LF C G+ EALKDADSSE+ PIYEDKDGDWML GDVPW
Sbjct  119  KLFGCFGLSEALKDADSSEFVPIYEDKDGDWMLAGDVPW  157



>gb|ADL70524.1| indole-3-acetic acid inducible 5 [Arabidopsis thaliana]
Length=163

 Score =   163 bits (413),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 101/182 (55%), Positives = 114/182 (63%), Gaps = 26/182 (14%)
 Frame = -3

Query  642  MAAKSG-LGLEITELRLGLPGSGHGGADKGTTGE----KKRVFSEM-IDGGDDHDRsssn  481
            MA +S  LGLEITELRLGLPG      D   +GE    KKR F E+ ID   +  +    
Sbjct  1    MANESNNLGLEITELRLGLPG------DIVVSGESISGKKRAFPEVEIDLKCEPAKK---  51

Query  480  nnnnkkKQQVVGWPPVCSYRRKNNSDEGKKMYVKVSMDGAPFLRKIDLTTHKTYSHLLIA  301
                    QVVGWPPVCSYRRKN+ +  K  YVKVS+DGA FLRKIDL  +K Y  L  A
Sbjct  52   -------SQVVGWPPVCSYRRKNSLERTKSSYVKVSVDGAAFLRKIDLEMYKCYQDLASA  104

Query  300  LDNLFDCR-GIGEALKDADSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRIMKRSEA  124
            L  LF C     + LK+   SE  PIYEDKDGDWML GDVPW MF+ SCKRLRIMKRS  
Sbjct  105  LQILFGCYINFDDTLKE---SECVPIYEDKDGDWMLAGDVPWEMFLGSCKRLRIMKRSCN  161

Query  123  KG  118
            +G
Sbjct  162  RG  163



>gb|ADL70542.1| indole-3-acetic acid inducible 6 [Arabidopsis thaliana]
 gb|ADL70545.1| indole-3-acetic acid inducible 6 [Arabidopsis thaliana]
Length=173

 Score =   163 bits (413),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 90/172 (52%), Positives = 112/172 (65%), Gaps = 11/172 (6%)
 Frame = -3

Query  591  LPGSGHGGADK-GTTGEKKRVFSEMIDGG--DDHDRsssnnnnn-----kkKQQVVGWPP  436
            LPG  +      G++ +KKRV S+M+     D  + +S  ++         K Q VGWPP
Sbjct  1    LPGDNYSEISVCGSSKKKKRVLSDMMTSSALDTENENSVVSSVEDESLPVVKSQAVGWPP  60

Query  435  VCSYRRKNNSDEGKKM--YVKVSMDGAPFLRKIDLTTHKTYSHLLIALDNLFDCRGIGEA  262
            VCSYRRK N++E  K   YVKVSMDG P++RKIDL +  +Y +L+  L+NLF C GIG A
Sbjct  61   VCSYRRKKNNEEASKAIGYVKVSMDGVPYMRKIDLGSSNSYINLVTVLENLFGCLGIGVA  120

Query  261  LKDADSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRIMKRSEAKGIGLH  106
             K+    EY  IYEDKD DWMLVGDVPW MF ESCKRLRI+KRS+A G GL 
Sbjct  121  -KEGKKCEYIIIYEDKDRDWMLVGDVPWQMFKESCKRLRIVKRSDATGFGLQ  171



>ref|NP_001275532.1| auxin-induced protein AUX22-like [Cucumis sativus]
 dbj|BAA85820.1| Aux/IAA protein [Cucumis sativus]
 gb|KGN58114.1| hypothetical protein Csa_3G516530 [Cucumis sativus]
Length=188

 Score =   163 bits (413),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 98/198 (49%), Positives = 121/198 (61%), Gaps = 28/198 (14%)
 Frame = -3

Query  651  LIDMAAKSGLGLEITELRLGLPGSGHGGADKGTTGEKKRVFSEMIDGGDDHDRsssnnnn  472
            +  +AAK GL LEITELRLGLPG            EKKRVFSE+    +  D+S S   +
Sbjct  1    MTQVAAK-GLDLEITELRLGLPGDCCSLISTSKNNEKKRVFSEV----EVEDKSRSKGED  55

Query  471  nkkKQQVVGWPPVCSYRRKN---------------NSDEGKKMYVKVSMDGAPFLRKIDL  337
              +++QVVGWPPVCSYRR+N               N    K+MYVKVS +G PFLRK+DL
Sbjct  56   EGRRKQVVGWPPVCSYRRRNSFKGKGEQCESEEIMNMGMKKQMYVKVSFEGTPFLRKVDL  115

Query  336  TTHKTYSHLLIALDNLFDCRGIGEALKDADSSEYAPIYEDKDGDWMLVGDVPWGMFVESC  157
               K Y  L+ A++ LF    IG         EY   YED+DGDWMLVGDVPW MF+ESC
Sbjct  116  GMVKGYGDLVGAMEKLFG-SPIG-------CYEYTVTYEDRDGDWMLVGDVPWKMFIESC  167

Query  156  KRLRIMKRSEAKGIGLHA  103
            KRLRIMK++E KG  +++
Sbjct  168  KRLRIMKKTEGKGSEMNS  185



>ref|XP_002892874.1| hypothetical protein ARALYDRAFT_471758 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69133.1| hypothetical protein ARALYDRAFT_471758 [Arabidopsis lyrata subsp. 
lyrata]
Length=164

 Score =   162 bits (410),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 98/177 (55%), Positives = 112/177 (63%), Gaps = 15/177 (8%)
 Frame = -3

Query  642  MAAKS-GLGLEITELRLGLPGSGHGGADKGTTGEKKRVFSEMIDGGDDHDRsssnnnnnk  466
            MA +S  LGLEITELRLGLPG     + +   G KKR   E+          S+      
Sbjct  1    MANESDNLGLEITELRLGLPGDIIVVSGQSILG-KKRASPEV---------ESNMKCEPA  50

Query  465  kKQQVVGWPPVCSYRRKNNSDEGKKMYVKVSMDGAPFLRKIDLTTHKTYSHLLIALDNLF  286
             K QVVGWPPVCSYRRKN+ ++ K  YVKVS+DGA FLRKIDL  +K Y  L  AL  LF
Sbjct  51   TKSQVVGWPPVCSYRRKNSLEQTKSSYVKVSVDGAAFLRKIDLEMYKCYQDLASALQILF  110

Query  285  DCR-GIGEALKDADSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRIMKRSEAKG  118
             C     + LK+   SE  PIYEDKDGDWML GDVPW MF+ SCKRLRIMKRS  +G
Sbjct  111  GCSINFDDTLKE---SECVPIYEDKDGDWMLAGDVPWEMFLGSCKRLRIMKRSCNRG  164



>ref|XP_006838869.1| hypothetical protein AMTR_s00002p00266860 [Amborella trichopoda]
 gb|ERN01438.1| hypothetical protein AMTR_s00002p00266860 [Amborella trichopoda]
Length=205

 Score =   163 bits (413),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 97/191 (51%), Positives = 111/191 (58%), Gaps = 19/191 (10%)
 Frame = -3

Query  624  LGLEITELRLGLPGSGHGGADKGTTGEKKRVFSEMID-----GGDDHDRsssnnnnnkkK  460
            L  E TELRLGLPG     +   T    KRVFS+  D        +             K
Sbjct  11   LNFEETELRLGLPGCDDSSS--LTQKGSKRVFSDTTDDVRSKPSPNCTAQIEREGAPVAK  68

Query  459  QQVVGWPPVCSYRRKNN----------SDEGKKMYVKVSMDGAPFLRKIDLTTHKTYSHL  310
             QVVGWPPV S  RKNN            E    YVKVSMDGAP+LRKIDL  +K Y  L
Sbjct  69   AQVVGWPPVRSSYRKNNLHVTNSMKKTEPEAPGFYVKVSMDGAPYLRKIDLKNYKGYQDL  128

Query  309  LIALDNLFDCRGIGEALKD--ADSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRIMK  136
            L AL+N+F C  IG+  K   + +SEY P YEDKDGDWMLVGDVPW MF+ SCKRLRIMK
Sbjct  129  LKALENMFSCFTIGDFAKKEGSKTSEYVPTYEDKDGDWMLVGDVPWEMFIFSCKRLRIMK  188

Query  135  RSEAKGIGLHA  103
             S+A G+G +A
Sbjct  189  GSDAIGLGSNA  199



>ref|XP_009612823.1| PREDICTED: auxin-induced protein 22D-like [Nicotiana tomentosiformis]
Length=178

 Score =   162 bits (410),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 90/182 (49%), Positives = 113/182 (62%), Gaps = 21/182 (12%)
 Frame = -3

Query  633  KSGLGLEITELRLGLPGSGHGGADKGTTGE-------KKRVFSEMIDGGDDHDRsssnnn  475
            K  L L+ TELRLGLPGS +      ++          KR+ SEM +G ++         
Sbjct  8    KDDLNLKATELRLGLPGSDNEVEKPASSTSLIAAKVSNKRLSSEMDNGKNNES-------  60

Query  474  nnkkKQQVVGWPPVCSYRRKNNSDEGKKMYVKVSMDGAPFLRKIDLTTHKTYSHLLIALD  295
                K QVVGWPPV SYR+    +  +  YVKVSMDGA +LRKIDL  +K+Y+ LL AL+
Sbjct  61   --TSKAQVVGWPPVRSYRK----NVLQASYVKVSMDGAAYLRKIDLNLYKSYTELLKALE  114

Query  294  NLFDCR-GIGEALKDADSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRIMKRSEAKG  118
            N+F C  G+    +  + S+Y P YEDKDGDWML GDVPW MF+ SCKRLRIMK SEAKG
Sbjct  115  NMFKCSIGVYSEREGYNGSDYVPTYEDKDGDWMLAGDVPWDMFINSCKRLRIMKGSEAKG  174

Query  117  IG  112
            + 
Sbjct  175  LA  176



>ref|XP_009786590.1| PREDICTED: auxin-induced protein 22D-like [Nicotiana sylvestris]
Length=177

 Score =   162 bits (410),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 92/181 (51%), Positives = 111/181 (61%), Gaps = 20/181 (11%)
 Frame = -3

Query  633  KSGLGLEITELRLGLPGSG------HGGADKGTTGEKKRVFSEMIDGGDDHDRsssnnnn  472
            K  L L+ TELRLGLPGS           + G     KR+ SEM +G  D          
Sbjct  8    KDDLNLKATELRLGLPGSDDQHEKPSSSTNFGAKVSNKRLSSEMDNGNTDE---------  58

Query  471  nkkKQQVVGWPPVCSYRRKNNSDEGKKMYVKVSMDGAPFLRKIDLTTHKTYSHLLIALDN  292
               K QVVGWPPV SYR+    +  +  YVKVSMDGA +LRKIDL  +K+YS LL AL+N
Sbjct  59   PVPKAQVVGWPPVRSYRK----NVLQASYVKVSMDGAAYLRKIDLNLYKSYSQLLEALEN  114

Query  291  LFDCR-GIGEALKDADSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRIMKRSEAKGI  115
            +F C  G+    +  + S+Y P YEDKDGDWML GDVPW MF+ SCKRLRIMK S+AKG+
Sbjct  115  MFKCSIGVYSEREGYNGSDYVPTYEDKDGDWMLAGDVPWDMFINSCKRLRIMKGSDAKGL  174

Query  114  G  112
             
Sbjct  175  A  175



>ref|NP_001242729.1| uncharacterized protein LOC100780752 [Glycine max]
 gb|ACU18346.1| unknown [Glycine max]
Length=202

 Score =   163 bits (412),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 98/190 (52%), Positives = 111/190 (58%), Gaps = 20/190 (11%)
 Frame = -3

Query  624  LGLEITELRLGLPGSGHGGADKGTTGEKKRVFSEMID------------GGDDHDRsssn  481
            L LE TELRLGLPGS      +      KR   E  +             G D      +
Sbjct  12   LNLEATELRLGLPGSDEP-EKRSAVRSNKRSSPEASEEECISKGNMNSSDGSDITSDDQD  70

Query  480  nnnnkkKQQVVGWPPVCSYRR------KNNSDEGKKMYVKVSMDGAPFLRKIDLTTHKTY  319
            N     K QVVGWPPV SYR+      K    EG  MYVKVSM+GAP+LRKIDL  +K+Y
Sbjct  71   NVVPPAKAQVVGWPPVRSYRKNSLQQKKEEQAEGAGMYVKVSMEGAPYLRKIDLKVYKSY  130

Query  318  SHLLIALDNLFDCR-GIGEALKDADSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRI  142
              LL AL+N+F C  G     +  + SEYAP YEDKDGDWMLVGDVPW MFV SCKRLRI
Sbjct  131  PELLKALENMFKCTFGQYSEREGYNGSEYAPTYEDKDGDWMLVGDVPWNMFVSSCKRLRI  190

Query  141  MKRSEAKGIG  112
            MK S AKG+G
Sbjct  191  MKGSGAKGLG  200



>gb|AAD32145.1|AF123507_1 Nt-iaa4.5 deduced protein [Nicotiana tabacum]
Length=195

 Score =   163 bits (412),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 94/186 (51%), Positives = 111/186 (60%), Gaps = 16/186 (9%)
 Frame = -3

Query  624  LGLEITELRLGLPG-----SGHGGADKGTTGEKKRVFSEMIDGGDDHDRsssnnnnnkkK  460
            L L+ TELRLGLPG          A       KKR  SEM +     +    +    K  
Sbjct  11   LNLKATELRLGLPGIDEPEKQSSSASTSAKYSKKRTSSEMDNSSSGKENEQDSAPAPKA-  69

Query  459  QQVVGWPPVCSYRR------KNNSDEGKKMYVKVSMDGAPFLRKIDLTTHKTYSHLLIAL  298
             QVVGWPPV SYR+      K+ SD    MY+KVSMDG  +LRKIDL  + +Y  LL AL
Sbjct  70   -QVVGWPPVRSYRKNVLQIKKSESDNSSGMYLKVSMDGGTYLRKIDLKVYNSYPELLKAL  128

Query  297  DNLFDCR-GIGEALKDADSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRIMKRSEAK  121
             N+F C  G+    +  + S+YAP YEDKDGDWMLVGDVPW MF+ SC+RLRIMK SEAK
Sbjct  129  QNMFKCTIGVYTEREGYNGSDYAPTYEDKDGDWMLVGDVPWDMFLNSCRRLRIMKGSEAK  188

Query  120  GIGLHA  103
              GLHA
Sbjct  189  --GLHA  192



>ref|XP_007144687.1| hypothetical protein PHAVU_007G176700g [Phaseolus vulgaris]
 gb|ESW16681.1| hypothetical protein PHAVU_007G176700g [Phaseolus vulgaris]
Length=196

 Score =   162 bits (411),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 95/187 (51%), Positives = 116/187 (62%), Gaps = 20/187 (11%)
 Frame = -3

Query  624  LGLEITELRLGLPGSGH-------GGADKGTTGE--KKRVFSEMIDGGDDHDRsssnnnn  472
            L LE TELRLGLPG+            +K ++ E  ++   S + D   DH     +N  
Sbjct  12   LNLEATELRLGLPGTDEPEKRAIAARTNKRSSPEASEEECISNVSDVTSDHQ----DNVV  67

Query  471  nkkKQQVVGWPPVCSYRR------KNNSDEGKKMYVKVSMDGAPFLRKIDLTTHKTYSHL  310
               K QVVGWPP+ SYR+      K    EG  MYVKVSM GAP+LRKIDL  +++Y  L
Sbjct  68   PPAKAQVVGWPPIRSYRKNSLQQKKEEQSEGNGMYVKVSMAGAPYLRKIDLRVYQSYPQL  127

Query  309  LIALDNLFDC-RGIGEALKDADSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRIMKR  133
            L AL+N+F C  G     +  + SE+AP YEDKDGDWMLVGDVPW MFV SCKRLRIMK 
Sbjct  128  LKALENMFKCIFGEYSEREGYNGSEHAPTYEDKDGDWMLVGDVPWHMFVSSCKRLRIMKG  187

Query  132  SEAKGIG  112
            SEA+G+G
Sbjct  188  SEAQGLG  194



>gb|AFZ78615.1| hypothetical protein [Populus tomentosa]
Length=196

 Score =   162 bits (411),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 101/198 (51%), Positives = 127/198 (64%), Gaps = 20/198 (10%)
 Frame = -3

Query  648  IDMAAKSGLGLEITELRLGLPGSGHGGADKGTTGEK--KRVFSEMIDGGDDHDRsssn--  481
            + +A ++ L L+ TELRLGLPG+G    +KG +G +  KR F E  + G  + +S +   
Sbjct  3    VGVAYENDLNLKATELRLGLPGTGCTN-EKGVSGARTNKRPFPETREEGGANGKSDAQHD  61

Query  480  --nnnnkkKQQVVGWPPVCSYRRKNNSDEGKK--------MYVKVSMDGAPFLRKIDLTT  331
                 +  K Q+VGWPP+ SYR+  NS + KK        MYVKVSMDGAP+LRKIDL  
Sbjct  62   DQETASAPKVQIVGWPPIRSYRK--NSFQPKKAEDEAAAGMYVKVSMDGAPYLRKIDLKV  119

Query  330  HKTYSHLLIALDNLFDCRGIGE--ALKDADSSEYAPIYEDKDGDWMLVGDVPWGMFVESC  157
            +K Y  LL AL+N+F    IGE    +    SEYAP YEDKDGDWMLVGDVPW MF+ SC
Sbjct  120  YKGYPELLKALENMFKLT-IGEYSEREGYKGSEYAPTYEDKDGDWMLVGDVPWDMFLSSC  178

Query  156  KRLRIMKRSEAKGIGLHA  103
            K+LRIMK SEA G+G  A
Sbjct  179  KKLRIMKGSEAIGLGCGA  196



>ref|XP_010278166.1| PREDICTED: auxin-responsive protein IAA4-like [Nelumbo nucifera]
Length=198

 Score =   162 bits (410),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 94/189 (50%), Positives = 114/189 (60%), Gaps = 18/189 (10%)
 Frame = -3

Query  624  LGLEITELRLGLPGSGHGGADKGTTG---EKKRVFSEMI-------DGGDDHDRsssnnn  475
            L L+ TELRLGLPG+    +DK T       KR  SE         + G    R+     
Sbjct  11   LNLKATELRLGLPGTDD--SDKQTPSGVRSNKRTLSETTEECRSKSNSGTSDARNDDTET  68

Query  474  nnkkKQQVVGWPPVCSYRR-----KNNSDEGKKMYVKVSMDGAPFLRKIDLTTHKTYSHL  310
                K QVVGWPP+ SYR+     K    E   +YVKVSMDGAP+LRKIDL ++K Y  L
Sbjct  69   APAAKAQVVGWPPIRSYRKNSFQPKKTEAEAAGIYVKVSMDGAPYLRKIDLKSYKGYPEL  128

Query  309  LIALDNLFDCR-GIGEALKDADSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRIMKR  133
            L AL+N+F    G     +  + S+YAP YEDKDGDWMLVGDVPW MF+ SCKRLRIMK 
Sbjct  129  LKALENMFKFTIGQYSEREGYNGSDYAPTYEDKDGDWMLVGDVPWEMFISSCKRLRIMKG  188

Query  132  SEAKGIGLH  106
            SEA+G+G +
Sbjct  189  SEARGLGSY  197



>ref|XP_002307625.1| auxin-induced protein 22B [Populus trichocarpa]
 gb|EEE94621.1| auxin-induced protein 22B [Populus trichocarpa]
Length=195

 Score =   162 bits (410),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 96/195 (49%), Positives = 121/195 (62%), Gaps = 19/195 (10%)
 Frame = -3

Query  642  MAAKSGLGLEITELRLGLPGSGHGGADKGTTG--EKKRVFSEMID--------GGDDHDR  493
            MA +S L L+ TELRLGLPGS        T      KR   E+ +            +  
Sbjct  1    MAYESDLNLKATELRLGLPGSDEPEKPSTTPSVRSNKRASPEISEESRSKGSSSVSSNVE  60

Query  492  sssnnnnnkkKQQVVGWPPVCSYRR------KNNSDEGKKMYVKVSMDGAPFLRKIDLTT  331
            +   ++    K QVVGWPP+ SYR+      KN+  +G  MYVKVS+DGAP+LRKIDL  
Sbjct  61   NGERDSAPPAKAQVVGWPPIRSYRKNCLQPKKNDQVDGAGMYVKVSVDGAPYLRKIDLKV  120

Query  330  HKTYSHLLIALDNLFDCRGIGEALKDA--DSSEYAPIYEDKDGDWMLVGDVPWGMFVESC  157
            +K+Y  LL AL+N+F    IGE  ++   + SE+AP YEDKDGDWMLVGDVPW MF+ SC
Sbjct  121  YKSYPELLKALENMFKLT-IGEYSENEGYNGSEFAPTYEDKDGDWMLVGDVPWDMFISSC  179

Query  156  KRLRIMKRSEAKGIG  112
            KRLRIMK SEA+G+G
Sbjct  180  KRLRIMKGSEARGLG  194



>ref|XP_008447487.1| PREDICTED: auxin-induced protein AUX22-like [Cucumis melo]
Length=187

 Score =   162 bits (409),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 95/197 (48%), Positives = 121/197 (61%), Gaps = 27/197 (14%)
 Frame = -3

Query  651  LIDMAAKSGLGLEITELRLGLPGSGHGGADKGTTGEKKRVFSEMIDGGDDHDRsssnnnn  472
            +  MAAK GL LEITELRLGLPG            EKKRVFSE+    +  D+S +   +
Sbjct  1    MTQMAAK-GLDLEITELRLGLPGDCGSLISTSKNNEKKRVFSEV----EVEDKSRAKGED  55

Query  471  nkkKQQVVGWPPVCSYRRKNN-------SDEG-------KKMYVKVSMDGAPFLRKIDLT  334
              +++QVVGWPPVCSYR++++         EG       K+MYVKVS +G PFLRK+DL 
Sbjct  56   EGRRKQVVGWPPVCSYRQRSSFKGKGECESEGIMNMGMKKQMYVKVSFEGTPFLRKVDLG  115

Query  333  THKTYSHLLIALDNLFDCRGIGEALKDADSSEYAPIYEDKDGDWMLVGDVPWGMFVESCK  154
              K Y  L+ A++ LF               EY   YED+DGDWMLVGDVPW MF+ESCK
Sbjct  116  MVKGYGDLVGAMEKLFG--------SPIGCYEYTVTYEDRDGDWMLVGDVPWKMFIESCK  167

Query  153  RLRIMKRSEAKGIGLHA  103
            RLRIMK++E KG  +++
Sbjct  168  RLRIMKKTEGKGSEMNS  184



>ref|XP_011079948.1| PREDICTED: auxin-induced protein 22D-like [Sesamum indicum]
Length=198

 Score =   162 bits (410),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 97/192 (51%), Positives = 117/192 (61%), Gaps = 18/192 (9%)
 Frame = -3

Query  639  AAKSGLGLEITELRLGLPGSGH--------GGADKGTTGEKKRVFSEMIDGGDDHDRsss  484
            A ++ L L+ TELRLGLPG+ +          +        KR  SEM DG     +   
Sbjct  7    AFENDLNLKATELRLGLPGTDNEPDHQQSSSSSSSQLIKNNKRSCSEM-DGARQTGQQQE  65

Query  483  nnnnnkkKQQVVGWPPVCSYRR-------KNNSDEGKKMYVKVSMDGAPFLRKIDLTTHK  325
            +     K Q VVGWPPV +YR+       K  SD G  M+VKVSMDGAP+LRKIDL  +K
Sbjct  66   SGAPAPKAQ-VVGWPPVRNYRKNVLEQQKKPESDTGSGMFVKVSMDGAPYLRKIDLKFYK  124

Query  324  TYSHLLIALDNLFDCR-GIGEALKDADSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRL  148
             Y  LL AL+N+F C  G+    +  + SEYAP YEDKDGDWMLVGDVPW MFV SC+RL
Sbjct  125  NYLDLLKALENMFKCTIGVYSEREGYNGSEYAPTYEDKDGDWMLVGDVPWDMFVTSCRRL  184

Query  147  RIMKRSEAKGIG  112
            RIMK SEAKG+ 
Sbjct  185  RIMKGSEAKGLA  196



>gb|AAF71983.1|AC013453_8 auxin-induced protein AUX2-27 [Arabidopsis thaliana]
 emb|CAA37527.1| Aux2-27 protein [Arabidopsis thaliana]
Length=174

 Score =   161 bits (407),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 101/184 (55%), Positives = 113/184 (61%), Gaps = 26/184 (14%)
 Frame = -3

Query  642  MAAKSG-LGLEITELRLGLPGSGHGGADKGTTGE----KKRVFSEM-IDGGDDHDRsssn  481
            MA +S  LGLEITELRLGLPG      D   +GE    KKR   E+ ID   +  +    
Sbjct  1    MANESNNLGLEITELRLGLPG------DIVVSGESISGKKRASPEVEIDLKCEPAKK---  51

Query  480  nnnnkkKQQVVGWPPVCSYRRKNNSDEGKKMYVKVSMDGAPFLRKIDLTTHKTYSHLLIA  301
                    QVVGWPPVCSYRRKN+ +  K  YVKVS+DGA FLRKIDL  +K Y  L  A
Sbjct  52   -------SQVVGWPPVCSYRRKNSLERTKSSYVKVSVDGAAFLRKIDLEMYKCYQDLASA  104

Query  300  LDNLFDCR-GIGEALKDADSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRIMKRSEA  124
            L  LF C     + LK+   SE  PIYEDKDGDWML GDVPW MF+ SCKRLRIMKRS  
Sbjct  105  LQILFGCYINFDDTLKE---SECVPIYEDKDGDWMLAGDVPWEMFLGSCKRLRIMKRSYV  161

Query  123  KGIG  112
             G G
Sbjct  162  PGFG  165



>ref|XP_006349740.1| PREDICTED: auxin-induced protein 22D-like [Solanum tuberosum]
Length=183

 Score =   161 bits (408),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 88/177 (50%), Positives = 107/177 (60%), Gaps = 14/177 (8%)
 Frame = -3

Query  618  LEITELRLGLPGS-GHGGADKGTTGEKKRVFSEMIDGGDDHDRsssnnnnnkkKQQVVGW  442
            LE TELRLGLPG          T    K+  S  ++  +  D             QVVGW
Sbjct  11   LEATELRLGLPGIIDESSTSTSTAKNSKKRPSSSVNENEQQDSPPPPKA------QVVGW  64

Query  441  PPVCSYRRKNNS------DEGKKMYVKVSMDGAPFLRKIDLTTHKTYSHLLIALDNLFDC  280
            PPV SYR+ + S      +    MY+KVSMDGAP+LRKIDL  +K+Y  LL AL N+F C
Sbjct  65   PPVRSYRKNHVSKLSESDNNSSGMYLKVSMDGAPYLRKIDLKVYKSYQELLKALQNMFKC  124

Query  279  R-GIGEALKDADSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRIMKRSEAKGIG  112
              G+    +  + S+YAP YEDKDGDWMLVGDVPW MF+ SCKRLRI+K SEAKG+ 
Sbjct  125  TIGVYSEREGYNGSDYAPTYEDKDGDWMLVGDVPWEMFISSCKRLRIIKGSEAKGLA  181



>ref|XP_002281696.1| PREDICTED: auxin-induced protein 22D [Vitis vinifera]
 emb|CBI17931.3| unnamed protein product [Vitis vinifera]
Length=186

 Score =   161 bits (407),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 95/179 (53%), Positives = 112/179 (63%), Gaps = 12/179 (7%)
 Frame = -3

Query  630  SGLGLEITELRLGLPGSGHGGADKGTT-GEKKRVFSEMIDGGDDHDRsssnnn---nnkk  463
            +GL LE TELRLGLPG+        T+   KKR   EM +       S  ++        
Sbjct  9    NGLNLEATELRLGLPGTNEPEKQSSTSVRSKKRASPEMAEETRSKSSSCISDADDDAPPP  68

Query  462  KQQVVGWPPVCSYRR-----KNNSDEGKKMYVKVSMDGAPFLRKIDLTTHKTYSHLLIAL  298
            K QVVGWPPV SYR+     +    EG  MYVKVSMDGAP+LRKIDL  +K+Y  LL AL
Sbjct  69   KAQVVGWPPVRSYRKNSFQQRKGEAEGAGMYVKVSMDGAPYLRKIDLKVYKSYPELLNAL  128

Query  297  DNLFDCRGIGEALKDA--DSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRIMKRSE  127
            +N+F  R IGE  +    + S+Y P YEDKDGDWMLVGDVPW MF+ SCKRLRIMK SE
Sbjct  129  ENMFKFR-IGEYSEREGYNGSDYTPAYEDKDGDWMLVGDVPWEMFISSCKRLRIMKGSE  186



>gb|ADC29379.2| indole-3-acetic acid inducible 6 [Arabidopsis thaliana]
Length=171

 Score =   160 bits (406),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 86/160 (54%), Positives = 108/160 (68%), Gaps = 10/160 (6%)
 Frame = -3

Query  558  GTTGEKKRVFSEMIDGG--DDHDRsssnnnnn-----kkKQQVVGWPPVCSYRRKNNSDE  400
            G++ +KKRV S+M+     D  + +S  ++         K Q VGWPPVCSYRRK N++E
Sbjct  11   GSSKKKKRVLSDMMTSSALDTENENSVVSSVEDESLPVVKSQAVGWPPVCSYRRKKNNEE  70

Query  399  GKKM--YVKVSMDGAPFLRKIDLTTHKTYSHLLIALDNLFDCRGIGEALKDADSSEYAPI  226
              K   YVKVSMDG P++RKIDL +  +Y +L+  L+NLF C GIG A K+    EY  I
Sbjct  71   ASKAIGYVKVSMDGVPYMRKIDLGSSNSYINLVTVLENLFGCLGIGVA-KEGKKCEYIII  129

Query  225  YEDKDGDWMLVGDVPWGMFVESCKRLRIMKRSEAKGIGLH  106
            YEDKD DWMLVGDVPW +F ESCKRLRI+KRS+A G GL 
Sbjct  130  YEDKDRDWMLVGDVPWQIFKESCKRLRIVKRSDATGFGLQ  169



>ref|XP_010476650.1| PREDICTED: auxin-responsive protein IAA5-like isoform X2 [Camelina 
sativa]
Length=159

 Score =   160 bits (404),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 95/177 (54%), Positives = 111/177 (63%), Gaps = 20/177 (11%)
 Frame = -3

Query  642  MAAKSG-LGLEITELRLGLPGSGHGGADKGTTGEKKRVFSEMIDGGDDHDRsssnnnnnk  466
            MA +S  LGL ITELRLGLPG      D      KKRV  E+     + D          
Sbjct  1    MANESSILGLAITELRLGLPG------DDTIVSGKKRVSPEV-----ERD----LKCEPA  45

Query  465  kKQQVVGWPPVCSYRRKNNSDEGKKMYVKVSMDGAPFLRKIDLTTHKTYSHLLIALDNLF  286
             K QVVGWPP+CSYRRKN+ ++ K  YVKVS+DGA FLRKIDL  ++ Y  L  AL +LF
Sbjct  46   TKSQVVGWPPICSYRRKNSLEQTKSTYVKVSVDGAAFLRKIDLEMYECYQDLASALQSLF  105

Query  285  DCR-GIGEALKDADSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRIMKRSEAKG  118
             C     + LK+   SE  PIYED+DGDWML GDVPW MF+ SCKRLRIMKRS  +G
Sbjct  106  GCSLNFDDTLKE---SECVPIYEDRDGDWMLAGDVPWEMFLGSCKRLRIMKRSCNRG  159



>ref|NP_173011.1| auxin-responsive protein IAA5 [Arabidopsis thaliana]
 sp|P33078.3|IAA5_ARATH RecName: Full=Auxin-responsive protein IAA5; AltName: Full=Auxin-induced 
protein AUX2-27; AltName: Full=Indoleacetic acid-induced 
protein 5 [Arabidopsis thaliana]
 gb|AAN13012.1| putative auxin-induced protein IAA5 [Arabidopsis thaliana]
 gb|ADC29374.2| indole-3-acetic acid inducible 5 [Arabidopsis thaliana]
 gb|ADC29375.2| indole-3-acetic acid inducible 5 [Arabidopsis thaliana]
 gb|ADC29376.2| indole-3-acetic acid inducible 5 [Arabidopsis thaliana]
 gb|ADC29377.2| indole-3-acetic acid inducible 5 [Arabidopsis thaliana]
 gb|ADL70523.1| indole-3-acetic acid inducible 5 [Arabidopsis thaliana]
 gb|ADL70525.1| indole-3-acetic acid inducible 5 [Arabidopsis thaliana]
 gb|ADL70526.1| indole-3-acetic acid inducible 5 [Arabidopsis thaliana]
 gb|ADL70527.1| indole-3-acetic acid inducible 5 [Arabidopsis thaliana]
 gb|ADL70528.1| indole-3-acetic acid inducible 5 [Arabidopsis thaliana]
 gb|ADL70529.1| indole-3-acetic acid inducible 5 [Arabidopsis thaliana]
 gb|ADL70530.1| indole-3-acetic acid inducible 5 [Arabidopsis thaliana]
 gb|ADL70531.1| indole-3-acetic acid inducible 5 [Arabidopsis thaliana]
 gb|ADL70532.1| indole-3-acetic acid inducible 5 [Arabidopsis thaliana]
 gb|ADL70533.1| indole-3-acetic acid inducible 5 [Arabidopsis thaliana]
 gb|ADL70534.1| indole-3-acetic acid inducible 5 [Arabidopsis thaliana]
 gb|AEE29337.1| auxin-responsive protein IAA5 [Arabidopsis thaliana]
Length=163

 Score =   159 bits (403),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 100/182 (55%), Positives = 113/182 (62%), Gaps = 26/182 (14%)
 Frame = -3

Query  642  MAAKSG-LGLEITELRLGLPGSGHGGADKGTTGE----KKRVFSEM-IDGGDDHDRsssn  481
            MA +S  LGLEITELRLGLPG      D   +GE    KKR   E+ ID   +  +    
Sbjct  1    MANESNNLGLEITELRLGLPG------DIVVSGESISGKKRASPEVEIDLKCEPAKK---  51

Query  480  nnnnkkKQQVVGWPPVCSYRRKNNSDEGKKMYVKVSMDGAPFLRKIDLTTHKTYSHLLIA  301
                    QVVGWPPVCSYRRKN+ +  K  YVKVS+DGA FLRKIDL  +K Y  L  A
Sbjct  52   -------SQVVGWPPVCSYRRKNSLERTKSSYVKVSVDGAAFLRKIDLEMYKCYQDLASA  104

Query  300  LDNLFDCR-GIGEALKDADSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRIMKRSEA  124
            L  LF C     + LK+   SE  PIYEDKDGDWML GDVPW MF+ SCKRLRIMKRS  
Sbjct  105  LQILFGCYINFDDTLKE---SECVPIYEDKDGDWMLAGDVPWEMFLGSCKRLRIMKRSCN  161

Query  123  KG  118
            +G
Sbjct  162  RG  163



>gb|ADL70522.1| indole-3-acetic acid inducible 5 [Arabidopsis thaliana]
Length=163

 Score =   159 bits (403),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 102/181 (56%), Positives = 113/181 (62%), Gaps = 24/181 (13%)
 Frame = -3

Query  642  MAAKSG-LGLEITELRLGLPGSGHGGADKGTTGE----KKRVFSEMIDGGDDHDRsssnn  478
            MA +S  LGLEITELRLGLPG      D   +GE    KKR   E+     D D      
Sbjct  1    MANESNNLGLEITELRLGLPG------DIVVSGESISGKKRASPEV-----DID----LK  45

Query  477  nnnkkKQQVVGWPPVCSYRRKNNSDEGKKMYVKVSMDGAPFLRKIDLTTHKTYSHLLIAL  298
                KK QVVGWPPVCSYRRKN+ +  K  YVKVS+DGA FLRKIDL  +K Y  L  AL
Sbjct  46   CEPAKKSQVVGWPPVCSYRRKNSLERTKSSYVKVSVDGAAFLRKIDLEMYKCYQDLASAL  105

Query  297  DNLFDCR-GIGEALKDADSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRIMKRSEAK  121
              LF C     + LK+   SE  PIYEDKDGDWML GDVPW MF+ SCKRLRIMKRS  +
Sbjct  106  QILFGCYINFDDTLKE---SECVPIYEDKDGDWMLAGDVPWEMFLGSCKRLRIMKRSCNR  162

Query  120  G  118
            G
Sbjct  163  G  163



>ref|XP_004493738.1| PREDICTED: auxin-induced protein 22E-like [Cicer arietinum]
Length=192

 Score =   160 bits (406),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 92/187 (49%), Positives = 113/187 (60%), Gaps = 20/187 (11%)
 Frame = -3

Query  624  LGLEITELRLGLPGSGHGGADKGTTGEKKRVFSEMIDGGD-----------DHDRsssnn  478
            + L+ TELRLGLPGS     +       KR   E  +              D D+S+   
Sbjct  8    MNLKDTELRLGLPGSDEHSCNVSVVRNNKRSSPETSNNVSSNASSNSSTTTDDDQSTVQP  67

Query  477  nnnkkKQQVVGWPPVCSYRR----KNNSDEGKKMYVKVSMDGAPFLRKIDLTTHKTYSHL  310
                   QVVGWPP+ SYR+    +N  ++G  MYVKVSM GAP+LRKIDL  +K+YS L
Sbjct  68   TKV----QVVGWPPIRSYRKNSLQQNKVEDGGGMYVKVSMAGAPYLRKIDLQVYKSYSEL  123

Query  309  LIALDNLFDCR-GIGEALKDADSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRIMKR  133
            LIAL NLF C  G     +  + SEYAP YEDKDGDWMLVGDVPW MF+ SCKRL+I+K 
Sbjct  124  LIALQNLFKCTFGEYSEREGYNGSEYAPTYEDKDGDWMLVGDVPWNMFISSCKRLKIVKG  183

Query  132  SEAKGIG  112
            SE+KG+ 
Sbjct  184  SESKGLA  190



>ref|XP_009587946.1| PREDICTED: auxin-induced protein 22E-like [Nicotiana tomentosiformis]
Length=187

 Score =   160 bits (404),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 97/187 (52%), Positives = 115/187 (61%), Gaps = 13/187 (7%)
 Frame = -3

Query  642  MAAKSGLGLEITELRLGLPGSG-HGGADKGTTGEKKRVFSEMIDGGD-DHDRsssnnnnn  469
            M  ++ L L+ TELRLGLPG+             KKR  SEM +  + +HD+  S+    
Sbjct  1    METENDLNLKATELRLGLPGTELEPCTSLAAKISKKRCLSEMDNSLNINHDQQDSSPAPK  60

Query  468  kkKQQVVGWPPVCSYRR------KNNSDEGKKMYVKVSMDGAPFLRKIDLTTHKTYSHLL  307
                Q+VGWPPV SYR+      K ++D    MYVKVSMDGAP+LRKIDL  +K+Y  L 
Sbjct  61   A---QIVGWPPVRSYRKNIIKAEKLDTDVSSGMYVKVSMDGAPYLRKIDLRVYKSYQELF  117

Query  306  IALDNLFD-CRGIGEALKDADS-SEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRIMKR  133
              LDNLF    GI    K   S S+Y P YEDKDGDWMLVGDVPW MF  SCKRLRIMK 
Sbjct  118  KFLDNLFKHPTGIYSENKGYTSGSDYVPTYEDKDGDWMLVGDVPWDMFSNSCKRLRIMKG  177

Query  132  SEAKGIG  112
            SEAKG+ 
Sbjct  178  SEAKGLA  184



>ref|XP_010459100.1| PREDICTED: auxin-responsive protein IAA5 [Camelina sativa]
Length=159

 Score =   158 bits (400),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 96/177 (54%), Positives = 109/177 (62%), Gaps = 20/177 (11%)
 Frame = -3

Query  642  MAAKSG-LGLEITELRLGLPGSGHGGADKGTTGEKKRVFSEMIDGGDDHDRsssnnnnnk  466
            MA +S  LGL ITELRLGLPG      D      KKRV  E+     + D          
Sbjct  1    MANESSILGLAITELRLGLPG------DDTIVSGKKRVSPEV-----ERD----LECEAA  45

Query  465  kKQQVVGWPPVCSYRRKNNSDEGKKMYVKVSMDGAPFLRKIDLTTHKTYSHLLIALDNLF  286
             K QVVGWPPVCSYRRKN+ ++ K  YVKVS+DGA FLRKIDL  +K Y  L  AL  L 
Sbjct  46   TKSQVVGWPPVCSYRRKNSLEQTKSSYVKVSVDGAAFLRKIDLEMYKCYQDLASALQILL  105

Query  285  DCR-GIGEALKDADSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRIMKRSEAKG  118
             C     + LK+   SE  PIYED+DGDWML GDVPW MF+ SCKRLRIMKRS  +G
Sbjct  106  GCSLNFDDTLKE---SECVPIYEDRDGDWMLAGDVPWEMFLGSCKRLRIMKRSCNRG  159



>ref|XP_009612692.1| PREDICTED: auxin-responsive protein IAA4-like [Nicotiana tomentosiformis]
Length=194

 Score =   159 bits (403),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 95/190 (50%), Positives = 119/190 (63%), Gaps = 12/190 (6%)
 Frame = -3

Query  648  IDMAAKSGLGLEITELRLGLPGSGHGGADK---GTTGEKKRVFSEMIDGGDDHDRsssn-  481
            I +A +  L L+ TELRLGLPGS    +++     +   KR   +  D  +D +  SS+ 
Sbjct  3    ILVAHQKDLNLKATELRLGLPGSEDQESEQEILSNSKNNKRALPQSADDAEDCESKSSSD  62

Query  480  -nnnnkkKQQVVGWPPVCSYRRKN----NSDEGKKMYVKVSMDGAPFLRKIDLTTHKTYS  316
                   K Q+VGWPPV SYR+ N     ++    MYVKVSMDGAP+LRKIDL  +K Y 
Sbjct  63   VKAPPVSKAQIVGWPPVRSYRKNNIQPKKTETESGMYVKVSMDGAPYLRKIDLKMYKCYP  122

Query  315  HLLIALDNLFDCRGIGEALKDA--DSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRI  142
             LL AL+N+F    IGE  +      SE+AP YEDKDGD MLVGDVPW MF+ SCKRLRI
Sbjct  123  ELLKALENMFKL-TIGEYSEREGYKCSEFAPAYEDKDGDLMLVGDVPWEMFMSSCKRLRI  181

Query  141  MKRSEAKGIG  112
            MK SEA+G+G
Sbjct  182  MKGSEARGLG  191



>ref|XP_006420092.1| hypothetical protein CICLE_v10006002mg [Citrus clementina]
 ref|XP_006489502.1| PREDICTED: auxin-induced protein 22D-like [Citrus sinensis]
 gb|ESR33332.1| hypothetical protein CICLE_v10006002mg [Citrus clementina]
 gb|KDO53920.1| hypothetical protein CISIN_1g029966mg [Citrus sinensis]
Length=184

 Score =   159 bits (402),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 92/176 (52%), Positives = 110/176 (63%), Gaps = 11/176 (6%)
 Frame = -3

Query  624  LGLEITELRLGLPGSGHGGADKGTTGEKKRVFSEMIDGGDDHDRsssnnnnnkkKQQVVG  445
            L L+ TELRLGLPGS     ++  T   KR   +  D  D  D+S    +  K   QVVG
Sbjct  11   LNLKATELRLGLPGSDE---NEQQTRNNKRSLPDTPDDLDTKDKSDEAASVAKA--QVVG  65

Query  444  WPPVCSYRR-----KNNSDEGKKMYVKVSMDGAPFLRKIDLTTHKTYSHLLIALDNLFDC  280
            WPP+ SYR+     K N  E   +YVKVSMDGAP+LRKIDL  +  Y  LL AL+N+F  
Sbjct  66   WPPIRSYRKNSLQQKKNEGECAGIYVKVSMDGAPYLRKIDLKLYNGYPELLKALENMFKF  125

Query  279  R-GIGEALKDADSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRIMKRSEAKGI  115
              G+    +    SEY P YEDKDGDWMLVGDVPW MF+ SCKRLRIMK SEA+G+
Sbjct  126  TVGVYSEREGYKGSEYEPTYEDKDGDWMLVGDVPWEMFMSSCKRLRIMKGSEARGL  181



>ref|XP_008451269.1| PREDICTED: auxin-induced protein 22D-like [Cucumis melo]
Length=197

 Score =   159 bits (403),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 97/186 (52%), Positives = 123/186 (66%), Gaps = 18/186 (10%)
 Frame = -3

Query  624  LGLEITELRLGLPGSGHGGADKGT-TGEKKRVFSEMIDGGDDHDRsssnnnnnkkKQ---  457
            L  + TELRLGLPGS     D+ T +   KR FSE ID   +   S++ N  ++  Q   
Sbjct  13   LNFQATELRLGLPGSDE--PDRRTESKSNKRPFSE-IDKESNSSISNNGNCLDQTSQPPP  69

Query  456  ---QVVGWPPVCSYRR------KNNSDEGKKMYVKVSMDGAPFLRKIDLTTHKTYSHLLI  304
               QVVGWPPV SYR+      K+ ++     YVKVSMDGAP+LRKIDLT +K+Y+ L+ 
Sbjct  70   SKAQVVGWPPVRSYRKNYLAGKKSETESSSGGYVKVSMDGAPYLRKIDLTIYKSYTELVK  129

Query  303  ALDNLFDCRGIGEALKDA--DSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRIMKRS  130
            AL+N+F     G + K+   + S+YAP YEDKDGDWMLVGDVPW MF+ SCKRLRIMK S
Sbjct  130  ALENMFKFNLGGYSEKEGFNNGSDYAPTYEDKDGDWMLVGDVPWEMFISSCKRLRIMKGS  189

Query  129  EAKGIG  112
            EA+G+G
Sbjct  190  EARGLG  195



>ref|XP_006403206.1| hypothetical protein EUTSA_v10003276mg [Eutrema salsugineum]
 gb|ESQ44659.1| hypothetical protein EUTSA_v10003276mg [Eutrema salsugineum]
Length=190

 Score =   159 bits (402),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 88/178 (49%), Positives = 112/178 (63%), Gaps = 8/178 (4%)
 Frame = -3

Query  624  LGLEITELRLGLPGSGHGGADKGTTGEKKRVFSEMIDGGDDHDRsssnnnnnkkKQQVVG  445
            + L+ TELRLGLPG+  G  ++       +     +   +    S+     +  K Q+VG
Sbjct  11   VNLKATELRLGLPGTEDGCEEEKEKVSCGKSNKRALPETEKEIESTGKTEASPPKAQIVG  70

Query  444  WPPVCSYRR-----KNNSDEGKKMYVKVSMDGAPFLRKIDLTTHKTYSHLLIALDNLFDC  280
            WPPV SYR+     K N  EG+ MYVKVSMDGAP+LRKIDLT +K Y  L+ +L+N+F  
Sbjct  71   WPPVRSYRKNSFQTKKNESEGQGMYVKVSMDGAPYLRKIDLTVYKQYPELMKSLENMFKF  130

Query  279  RGIGEALKDA--DSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRIMKRSEAKGIG  112
              +GE  +      S++ P YEDKDGDWMLVGDVPW MFV SCKRLRIMK SE KG+G
Sbjct  131  -SVGEYFEREGYKGSDFVPTYEDKDGDWMLVGDVPWEMFVSSCKRLRIMKGSEVKGLG  187



>gb|KFK43813.1| hypothetical protein AALP_AA1G176600 [Arabis alpina]
Length=164

 Score =   158 bits (400),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 92/172 (53%), Positives = 111/172 (65%), Gaps = 20/172 (12%)
 Frame = -3

Query  642  MAAKSGLGLEITELRLGLPGSGHGGADKGTTGEKKRVFSEMIDGGDDHDRsssnnnnnkk  463
            MA +S LGLEITELRLGLPG      D   +G+K+   +  ++ G+  +R++        
Sbjct  1    MANESNLGLEITELRLGLPG------DIIVSGKKRA--APKVETGEKCERATK-------  45

Query  462  KQQVVGWPPVCSYRRKNNSDEGKKMYVKVSMDGAPFLRKIDLTTHKTYSHLLIALDNLFD  283
              QVVGWPPV SYRRKN+ +  K  YVKVS DGA  LRKIDL  ++ Y  L  AL  LF 
Sbjct  46   -SQVVGWPPVRSYRRKNSFERTKNSYVKVSADGAAVLRKIDLEMYQCYQDLASALQILFG  104

Query  282  CR-GIGEALKDADSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRIMKRS  130
            C     + +K+   SE  PIYEDKDGDWMLVGDVPW MF+ SCKRLRIMKRS
Sbjct  105  CLINFDDTVKE---SECVPIYEDKDGDWMLVGDVPWEMFIGSCKRLRIMKRS  153



>gb|AAC49046.1| IAA5, partial [Arabidopsis thaliana]
Length=158

 Score =   158 bits (399),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 97/175 (55%), Positives = 109/175 (62%), Gaps = 25/175 (14%)
 Frame = -3

Query  624  LGLEITELRLGLPGSGHGGADKGTTGE----KKRVFSEM-IDGGDDHDRsssnnnnnkkK  460
            LGLEITELRLGLPG      D   +GE    KKR   E+ ID   +  +           
Sbjct  3    LGLEITELRLGLPG------DIVVSGESISGKKRASPEVEIDLKCEPAKK----------  46

Query  459  QQVVGWPPVCSYRRKNNSDEGKKMYVKVSMDGAPFLRKIDLTTHKTYSHLLIALDNLFDC  280
             QVVGWPPVCSYRRKN+ +  K  YVKVS+DGA FLRKIDL  +K Y  L  AL  LF C
Sbjct  47   SQVVGWPPVCSYRRKNSLERTKSSYVKVSVDGAAFLRKIDLEMYKCYQDLASALQILFGC  106

Query  279  R-GIGEALKDADSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRIMKRSEAKG  118
                 + LK+   SE  PIYEDKDGDWML GDVPW MF+ SCKRLRIMKRS  +G
Sbjct  107  YINFDDTLKE---SECVPIYEDKDGDWMLAGDVPWEMFLGSCKRLRIMKRSCNRG  158



>gb|KHG20616.1| Auxin-induced 22D [Gossypium arboreum]
 gb|KHG26249.1| Auxin-induced 22D [Gossypium arboreum]
Length=184

 Score =   159 bits (401),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 88/179 (49%), Positives = 114/179 (64%), Gaps = 9/179 (5%)
 Frame = -3

Query  624  LGLEITELRLGLPGSGHGGADKGTTGEKKRVFSEMI-DGGDDHDRsssnnnnnkkKQQVV  448
            L L+ TELRLGLPGS      +      KR  S+++ +G          +     K Q+V
Sbjct  5    LNLKATELRLGLPGSDEP-ERQMIPRPNKRTLSDIVSEGSRSTTEEDHQDTAPPAKLQIV  63

Query  447  GWPPVCSYRR------KNNSDEGKKMYVKVSMDGAPFLRKIDLTTHKTYSHLLIALDNLF  286
            GWPPV SYR+      K+  + G  MYVKVS+DGAP+LRKIDL  +++Y  LL+AL+N+F
Sbjct  64   GWPPVRSYRKNCLQGKKDEVEGGTGMYVKVSVDGAPYLRKIDLKVYRSYPQLLLALENMF  123

Query  285  DCR-GIGEALKDADSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRIMKRSEAKGIG  112
                G     +  + S+YAP YED+DGDWMLVGDVPW MF+ SCKRLRIMK SEA+G+G
Sbjct  124  KLTIGAYSEREGYNGSDYAPTYEDRDGDWMLVGDVPWEMFISSCKRLRIMKGSEARGLG  182



>emb|CDY50750.1| BnaAnng10570D [Brassica napus]
Length=291

 Score =   162 bits (409),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 107/272 (39%), Positives = 131/272 (48%), Gaps = 53/272 (19%)
 Frame = -3

Query  762  LIKPLYIPSSIQFCLSFKTSARSIKFP--EN*KNI-C*LWLIDMAAKSGLGLEITELRLG  592
            +  PL+      FCLS  ++    +    +N KN+     L    +   +  E TELRLG
Sbjct  13   IFSPLFQTHLTSFCLSLSSNVLVFERTNQKNQKNLETRQSLFSSLSSKMINFEATELRLG  72

Query  591  LPGSGHGGADKGTTGEKKRVFSEMID-------------GGDDHDRsssnnnnnkkKQQV  451
            LPG  HGG D       KR FSE +D              G D +           K QV
Sbjct  73   LPGGNHGG-DMAMKNNGKRGFSETVDLKLNLSSTALDSVSGVDLENMKEKVVKPPAKAQV  131

Query  450  VGWPPVCSYRRK----------------------NNSDEGKKMYVKVSMDGAPFLRKIDL  337
            VGWPPV S+R+                       N +      YVKVSMDGAP+LRKIDL
Sbjct  132  VGWPPVRSFRKNVMSGQKPTAGDAAEGTEKTSSSNGATSSAAAYVKVSMDGAPYLRKIDL  191

Query  336  TTHKTYSHLLIALDNLFDCRGIG----EALKD----------ADSSEYAPIYEDKDGDWM  199
              +KTY  L  AL  +F    IG    + +KD           + S+Y P YEDKDGDWM
Sbjct  192  KLYKTYQDLSDALSKMFSSFTIGNYGPQGMKDFMNESRLIDLLNGSDYVPTYEDKDGDWM  251

Query  198  LVGDVPWGMFVESCKRLRIMKRSEAKGIGLHA  103
            LVGDVPWGMFV+SCKR+RIMK SEA G+   A
Sbjct  252  LVGDVPWGMFVDSCKRIRIMKGSEAIGLAPRA  283



>gb|ADL70520.1| indole-3-acetic acid inducible 4 [Arabidopsis thaliana]
Length=186

 Score =   158 bits (400),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 90/178 (51%), Positives = 112/178 (63%), Gaps = 13/178 (7%)
 Frame = -3

Query  624  LGLEITELRLGLPGSGHGGADKGTTGEKKRVFSEMIDGGDDHDRsssnnnnnkkKQQVVG  445
            + L+ TELRLGLPG+    +        KRV  E  D   + + +      +  K Q+VG
Sbjct  11   VNLKATELRLGLPGTEETVS---CGKSNKRVLPE--DTEKEIESTGKTETASPPKAQIVG  65

Query  444  WPPVCSYRRKN-----NSDEGKKMYVKVSMDGAPFLRKIDLTTHKTYSHLLIALDNLFDC  280
            WPPV SYR+ N     N  EG+  YVKVSMDGAP+LRKIDLT +K Y  L+ +L+N+F  
Sbjct  66   WPPVRSYRKNNIQTKKNESEGQGNYVKVSMDGAPYLRKIDLTMYKQYPELMKSLENMFKF  125

Query  279  RGIGEALKDA--DSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRIMKRSEAKGIG  112
              +GE  +      S++ P YEDKDGDWMLVGDVPW MFV SCKRLRIMK SE KG+G
Sbjct  126  -SVGEYFEREGYKGSDFVPTYEDKDGDWMLVGDVPWEMFVSSCKRLRIMKGSEVKGLG  182



>ref|XP_007143879.1| hypothetical protein PHAVU_007G109700g [Phaseolus vulgaris]
 gb|ESW15873.1| hypothetical protein PHAVU_007G109700g [Phaseolus vulgaris]
Length=193

 Score =   159 bits (401),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 89/181 (49%), Positives = 113/181 (62%), Gaps = 11/181 (6%)
 Frame = -3

Query  624  LGLEITELRLGLPGSGHGGADKGTTGEK---KRVFSEM----IDGGDDHDRsssnnnnnk  466
            L L+ TELRLGLPG+            +   KR  +E     +  G +  ++        
Sbjct  11   LNLKATELRLGLPGTEESEGKTLPAAVRITNKRPLNETSEETLSKGSNAPKTVQTEAAPP  70

Query  465  kKQQVVGWPPVCSYRRKN-NSDEGKKMYVKVSMDGAPFLRKIDLTTHKTYSHLLIALDNL  289
             K ++VGWPP+ SYR+ +   +EG  +YVKVSMDGAP+LRKIDL  +  Y+ LLIAL+ +
Sbjct  71   AKAKIVGWPPIRSYRKNSLQENEGAGIYVKVSMDGAPYLRKIDLKVYGGYTQLLIALETM  130

Query  288  FDCRGIGEALKDA--DSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRIMKRSEAKGI  115
            F    IGE  +      S+YAP YEDKDGDWMLVGDVPW MFV SCKRLRIMK SEA+G+
Sbjct  131  FKLT-IGEYSEKEGYKGSDYAPTYEDKDGDWMLVGDVPWDMFVTSCKRLRIMKGSEARGL  189

Query  114  G  112
            G
Sbjct  190  G  190



>emb|CDY53305.1| BnaA09g56620D [Brassica napus]
Length=157

 Score =   157 bits (398),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 97/176 (55%), Positives = 110/176 (63%), Gaps = 21/176 (12%)
 Frame = -3

Query  642  MAAKSGLGLEITELRLGLPGSGHGGADKGTTGEKKRVFSEMIDGGDDHDRsssnnnnnkk  463
            MA +S L  EITELRLGLPG      D   TG KKRV SE+          S        
Sbjct  1    MADESNLAHEITELRLGLPG------DIIVTG-KKRVSSEV---------ESELKCEPAT  44

Query  462  KQQVVGWPPVCSYRRKNNSDEGKKMYVKV-SMDGAPFLRKIDLTTHKTYSHLLIALDNLF  286
            K QVVGWPPVCS+RRKN+ +E +  YVKV S+DGA FLR+IDL  +K Y  L  AL  LF
Sbjct  45   KSQVVGWPPVCSFRRKNSLEETRTAYVKVRSVDGAAFLREIDLKMYKRYQDLASALQILF  104

Query  285  DCR-GIGEALKDADSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRIMKRSEAK  121
             C     + LK+   SE  PIYED+DGDWML GDVPW MFV SCKRLR+MKRS  K
Sbjct  105  GCFITFDDTLKE---SECVPIYEDRDGDWMLAGDVPWEMFVASCKRLRVMKRSVMK  157



>gb|ADL70513.1| indole-3-acetic acid inducible 4 [Arabidopsis thaliana]
Length=186

 Score =   158 bits (400),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 90/178 (51%), Positives = 112/178 (63%), Gaps = 13/178 (7%)
 Frame = -3

Query  624  LGLEITELRLGLPGSGHGGADKGTTGEKKRVFSEMIDGGDDHDRsssnnnnnkkKQQVVG  445
            + L+ TELRLGLPG+    +        KRV  E  D   + + +      +  K Q+VG
Sbjct  11   VNLKATELRLGLPGTEETVS---CGKSNKRVLPE--DTEKEIESTGKTETASPPKAQIVG  65

Query  444  WPPVCSYRRKN-----NSDEGKKMYVKVSMDGAPFLRKIDLTTHKTYSHLLIALDNLFDC  280
            WPPV SYR+ N     N  EG+  YVKVSMDGAP+LRKIDLT +K Y  L+ +L+N+F  
Sbjct  66   WPPVRSYRKNNIQIKKNESEGQGNYVKVSMDGAPYLRKIDLTMYKQYPELMKSLENMFKF  125

Query  279  RGIGEALKDA--DSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRIMKRSEAKGIG  112
              +GE  +      S++ P YEDKDGDWMLVGDVPW MFV SCKRLRIMK SE KG+G
Sbjct  126  -SVGEYFEREGYKGSDFVPTYEDKDGDWMLVGDVPWEMFVSSCKRLRIMKGSEVKGLG  182



>emb|CAD30274.1| IAA16 protein [Gossypium hirsutum]
 gb|KHF99239.1| Auxin-responsive IAA16 -like protein [Gossypium arboreum]
Length=208

 Score =   159 bits (402),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 91/190 (48%), Positives = 113/190 (59%), Gaps = 20/190 (11%)
 Frame = -3

Query  627  GLGLEITELRLGLPGSGHGGADKGTTGEKKRVFSEMIDG--GDDHDRs------ssnnnn  472
            GL  E TEL LGLPG     +D G     KR FSE +D   GD++              +
Sbjct  16   GLNFEATELTLGLPGEPRVTSDGGAKLGSKRGFSETVDLKLGDNNQEVKLGHSLQEAAKS  75

Query  471  nkkKQQVVGWPPVCSYRRKNNSDEGKKM--YVKVSMDGAPFLRKIDLTTHKTYSHLLIAL  298
               K QVVGWPPV  + ++     GKK   YVKV++DGAP+LRK+DL  + +Y  LL +L
Sbjct  76   PVSKTQVVGWPPVRGFAKR-----GKKSCKYVKVAVDGAPYLRKVDLEIYNSYQQLLTSL  130

Query  297  DNLFDCRGIGEALKD-----ADSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRIMKR  133
            +++F C  I   L +      +  EY P YEDKDGDWMLVGDVPW MFVESCKRLR+MK 
Sbjct  131  EDMFSCFTIRNYLNEKKIDQVNGIEYMPTYEDKDGDWMLVGDVPWQMFVESCKRLRLMKS  190

Query  132  SEAKGIGLHA  103
            SEA G+GL  
Sbjct  191  SEAVGLGLKT  200



>gb|ADC29372.1| indole-3-acetic acid inducible 4 [Arabidopsis thaliana]
Length=186

 Score =   158 bits (400),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 90/178 (51%), Positives = 111/178 (62%), Gaps = 13/178 (7%)
 Frame = -3

Query  624  LGLEITELRLGLPGSGHGGADKGTTGEKKRVFSEMIDGGDDHDRsssnnnnnkkKQQVVG  445
            + L+ TELRLGLPG+    +        KRV  E  D   + + +         K Q+VG
Sbjct  11   VNLKATELRLGLPGTEETVS---CGKSNKRVLPE--DTEKEIESTGKTETAPPPKAQIVG  65

Query  444  WPPVCSYRRKN-----NSDEGKKMYVKVSMDGAPFLRKIDLTTHKTYSHLLIALDNLFDC  280
            WPPV SYR+ N     N  EG+  YVKVSMDGAP+LRKIDLT +K Y  L+ +L+N+F  
Sbjct  66   WPPVRSYRKNNIQTKKNESEGQGNYVKVSMDGAPYLRKIDLTMYKQYPELMKSLENMFKF  125

Query  279  RGIGEALKDA--DSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRIMKRSEAKGIG  112
              +GE  +      S++ P YEDKDGDWMLVGDVPW MFV SCKRLRIMK SE KG+G
Sbjct  126  -SVGEYFEREGYKGSDFVPTYEDKDGDWMLVGDVPWEMFVSSCKRLRIMKGSEVKGLG  182



>gb|KFK31702.1| hypothetical protein AALP_AA6G148000 [Arabis alpina]
Length=190

 Score =   158 bits (400),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 90/179 (50%), Positives = 113/179 (63%), Gaps = 10/179 (6%)
 Frame = -3

Query  624  LGLEITELRLGLPGSGHGGADKGT-TGEKKRVFSEMIDGGDDHDRsssnnnnnkkKQQVV  448
            + L+ TELRLGLPG+     +K T     KR      D  ++   + +   +   K Q+V
Sbjct  11   VNLKATELRLGLPGTEEEEKEKVTCVKSNKRSLPNDTDK-ENESNNKTETTSPPPKAQIV  69

Query  447  GWPPVCSYRRKN-----NSDEGKKMYVKVSMDGAPFLRKIDLTTHKTYSHLLIALDNLFD  283
            GWPPV SYR+ N     N  EG  +YVKVSMDGAP+LRKIDLT +K Y  L+ +L+N+F 
Sbjct  70   GWPPVRSYRKNNIQTKKNETEGSGIYVKVSMDGAPYLRKIDLTVYKQYPELMKSLENMFK  129

Query  282  CRGIGEALKDA--DSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRIMKRSEAKGIG  112
               +GE  +      S++ P YEDKDGDWMLVGDVPW MFV SCKRLRIMK SE KG+G
Sbjct  130  F-SVGEYFEREGYKGSDFVPTYEDKDGDWMLVGDVPWEMFVTSCKRLRIMKGSEVKGLG  187



>ref|NP_001266029.1| IAA3 protein [Solanum lycopersicum]
 gb|AEX00349.1| IAA3 [Solanum lycopersicum]
Length=185

 Score =   158 bits (399),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 88/179 (49%), Positives = 111/179 (62%), Gaps = 16/179 (9%)
 Frame = -3

Query  618  LEITELRLGLPG---SGHGGADKGTTGEKKRVFSEMIDGGDDHDRsssnnnnnkkKQQVV  448
            LE TELRLGLPG        +   +   +KR  S  ++  +  D      +    K QVV
Sbjct  11   LEATELRLGLPGIINDESSTSTSTSKNSRKRPSSSSVNENEQQD------SAPAPKAQVV  64

Query  447  GWPPVCSYRRKNNS------DEGKKMYVKVSMDGAPFLRKIDLTTHKTYSHLLIALDNLF  286
            GWPPV SYR+ + S      +    MY+KVSMDGAP+LRKIDL  +K+Y  LL AL ++F
Sbjct  65   GWPPVRSYRKNHVSKLSESDNNSSGMYLKVSMDGAPYLRKIDLQVYKSYQELLKALQSMF  124

Query  285  DCR-GIGEALKDADSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRIMKRSEAKGIG  112
             C  G+    +  + S+YAP YEDKDGDWMLVGDVPW MF+ SCKRLRI+K SEAKG+ 
Sbjct  125  KCTIGVYSEREGYNGSDYAPTYEDKDGDWMLVGDVPWEMFISSCKRLRIIKGSEAKGLA  183



>gb|KHN05056.1| Auxin-induced protein 22B [Glycine soja]
Length=194

 Score =   158 bits (399),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 91/184 (49%), Positives = 113/184 (61%), Gaps = 11/184 (6%)
 Frame = -3

Query  633  KSGLGLEITELRLGLPGSGHGGADKGTTGEK---KRVFSEMID----GGDDHDRsssnnn  475
            ++ L L+ TELRLGLPG+        + G +   KR  +E  D     G           
Sbjct  9    QTDLNLKATELRLGLPGTEESEDKTLSAGARINNKRPLTETSDECASNGTSSAPHEKTET  68

Query  474  nnkkKQQVVGWPPVCSYRRKN-NSDEGKKMYVKVSMDGAPFLRKIDLTTHKTYSHLLIAL  298
                K ++VGWPP+ SYR+ +    EG  +YVKVSMDGAPFLRKIDL  +  Y+ LL +L
Sbjct  69   APPAKTKIVGWPPIRSYRKNSLQESEGAGIYVKVSMDGAPFLRKIDLKVYGGYTQLLKSL  128

Query  297  DNLFDCRGIGEALKDA--DSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRIMKRSEA  124
            +N+F    IGE  +      S+YAP YEDKDGDWMLVGDVPW MFV SCKRLRIMK SEA
Sbjct  129  ENMFKLT-IGEHSEKEGYKGSDYAPTYEDKDGDWMLVGDVPWDMFVTSCKRLRIMKGSEA  187

Query  123  KGIG  112
            +G+G
Sbjct  188  RGLG  191



>ref|XP_009615053.1| PREDICTED: auxin-responsive protein IAA4-like [Nicotiana tomentosiformis]
Length=179

 Score =   157 bits (397),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 95/183 (52%), Positives = 117/183 (64%), Gaps = 17/183 (9%)
 Frame = -3

Query  642  MAAKSGLGLEITELRLGLPGSGHGGADKGTTGEKKRVFSEMIDGGDDHDRsssnnnnnkk  463
            MA +  L L+ TELRLGLPG+     D+      K     + +  +D D        +KK
Sbjct  5    MAHEKDLNLKATELRLGLPGT----EDESIVSSSKNKKRGLPESAEDED------CESKK  54

Query  462  KQQVVGWPPVCSYRRKNNSDEGKK----MYVKVSMDGAPFLRKIDLTTHKTYSHLLIALD  295
            K Q+VGWPPV SYR+ N   +  +    MYVKVSMDGAP+LRKIDL  +K YS LL AL+
Sbjct  55   KTQIVGWPPVRSYRKNNIQPKKTETECGMYVKVSMDGAPYLRKIDLKMYKGYSELLKALE  114

Query  294  NLFDCRGIGEALKDA--DSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRIMKRSEAK  121
            N+F    IGE  +    + SE+AP YEDKDGD MLVGDVPW MF+ SCKRLRIMK SEA+
Sbjct  115  NMFKL-SIGEYSEREGYNGSEFAPAYEDKDGDLMLVGDVPWDMFLSSCKRLRIMKGSEAR  173

Query  120  GIG  112
            G+G
Sbjct  174  GLG  176



>ref|XP_007201847.1| hypothetical protein PRUPE_ppa011843mg [Prunus persica]
 gb|EMJ03046.1| hypothetical protein PRUPE_ppa011843mg [Prunus persica]
Length=193

 Score =   157 bits (397),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 88/182 (48%), Positives = 109/182 (60%), Gaps = 18/182 (10%)
 Frame = -3

Query  624  LGLEITELRLGLPGSGHGGADK-GTTGEKKR--------VFSEMIDGGDDHDRsssnnnn  472
            L  + TELRLGLPGS     +K   T    R          +E      DH       + 
Sbjct  14   LNFKATELRLGLPGSTEEPENKQAATPPPPRNNKRSSPDPTAEECCTNSDH------TDA  67

Query  471  nkkKQQVVGWPPVCSYRRKNNSDEGKKMYVKVSMDGAPFLRKIDLTTHKTYSHLLIALDN  292
               K Q+VGWPPV SYR+ +      + YVKVS+DGAP+LRKIDL  +K+Y  LL AL+N
Sbjct  68   PPTKTQIVGWPPVRSYRKNSMQARKPEAYVKVSVDGAPYLRKIDLKVYKSYPELLKALEN  127

Query  291  LFDCRGIG---EALKDADSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRIMKRSEAK  121
            +F+   IG   E     + S++AP YEDKDGDWMLVGDVPW MFV SCKRLRIMK +EA+
Sbjct  128  MFNLSNIGNYSETQGYINGSDFAPTYEDKDGDWMLVGDVPWNMFVSSCKRLRIMKGTEAR  187

Query  120  GI  115
            G+
Sbjct  188  GL  189



>ref|XP_002312567.1| hypothetical protein POPTR_0008s16100g [Populus trichocarpa]
 gb|EEE89934.1| hypothetical protein POPTR_0008s16100g [Populus trichocarpa]
Length=207

 Score =   158 bits (399),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 103/207 (50%), Positives = 128/207 (62%), Gaps = 31/207 (15%)
 Frame = -3

Query  642  MAAKSGLGLEITELRLGLPGSGHGGADKGTTGEK--KRVFSEMIDGG----------DDH  499
            +A ++ L L+ TELRLGLPG+G    +KG +G +  KR F E  + G          DD 
Sbjct  5    VAYENDLNLKETELRLGLPGTGCTN-EKGVSGARNNKRPFPETREEGGANGKSDAQHDDQ  63

Query  498  DRsssnnnnnkkKQ-----QVVGWPPVCSYRRKNNSDEGKK--------MYVKVSMDGAP  358
            + +S+ N  +         Q+VGWPP+ SYR+  NS + KK        MYVKVSMDGAP
Sbjct  64   ETASAPNTYSFDMHATCRVQIVGWPPIRSYRK--NSLQPKKAEDEAAAGMYVKVSMDGAP  121

Query  357  FLRKIDLTTHKTYSHLLIALDNLFDCRGIGE--ALKDADSSEYAPIYEDKDGDWMLVGDV  184
            +LRKIDL  +K Y  LL AL+N+F    IGE    +    SEYAP YEDKDGDWMLVGDV
Sbjct  122  YLRKIDLKVYKGYPELLKALENMFKLT-IGEYSEREGYKGSEYAPTYEDKDGDWMLVGDV  180

Query  183  PWGMFVESCKRLRIMKRSEAKGIGLHA  103
            PW MF+ SCK+LRIMK SEA G+G  A
Sbjct  181  PWDMFLSSCKKLRIMKGSEAIGLGCGA  207



>ref|XP_010476649.1| PREDICTED: auxin-responsive protein IAA5-like isoform X1 [Camelina 
sativa]
Length=166

 Score =   156 bits (395),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 94/181 (52%), Positives = 108/181 (60%), Gaps = 21/181 (12%)
 Frame = -3

Query  642  MAAKSG-LGLEITELRLGLPGSGHGGADKGTTGEKKRVFSEMIDGGDDHDRsssnnnnnk  466
            MA +S  LGL ITELRLGLPG      D      KKRV  E+     + D          
Sbjct  1    MANESSILGLAITELRLGLPG------DDTIVSGKKRVSPEV-----ERD----LKCEPA  45

Query  465  kKQQVVGWPPVCSYRRKNNSDEGKKMYVKVSMDGAPFLRKIDLTTHKTYSHLLIALDNLF  286
             K QVVGWPP+CSYRRKN+ ++ K  YVKVS+DGA FLRKIDL  ++ Y  L  AL +LF
Sbjct  46   TKSQVVGWPPICSYRRKNSLEQTKSTYVKVSVDGAAFLRKIDLEMYECYQDLASALQSLF  105

Query  285  DCR-----GIGEALKDADSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRIMKRSEAK  121
             C        G        SE  PIYED+DGDWML GDVPW MF+ SCKRLRIMKRS  +
Sbjct  106  GCSLNFVFMYGNEDDTLKESECVPIYEDRDGDWMLAGDVPWEMFLGSCKRLRIMKRSCNR  165

Query  120  G  118
            G
Sbjct  166  G  166



>ref|XP_004146959.1| PREDICTED: auxin-induced protein 22D-like [Cucumis sativus]
 ref|XP_004170581.1| PREDICTED: auxin-induced protein 22D-like [Cucumis sativus]
 gb|KGN44764.1| hypothetical protein Csa_7G378530 [Cucumis sativus]
Length=196

 Score =   157 bits (397),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 93/184 (51%), Positives = 119/184 (65%), Gaps = 15/184 (8%)
 Frame = -3

Query  624  LGLEITELRLGLPGSGHGGADKGTTGEKKRVFSEMIDGGDDHDRsssnnnnnkkKQ----  457
            L  + TELRLGLPGS      +  +   KR FSE ID  ++   S   N+ ++  Q    
Sbjct  13   LNFQATELRLGLPGSDDTNR-RTESKSNKRPFSE-IDKENNSSVSDVGNHIDQTSQPPPS  70

Query  456  --QVVGWPPVCSYRR------KNNSDEGKKMYVKVSMDGAPFLRKIDLTTHKTYSHLLIA  301
              QVVGWPPV SYR+      K+  +     YVKVSMDGAP+LRKIDLT +K+Y+ L+ A
Sbjct  71   KAQVVGWPPVRSYRKNCLAVKKSEIESSSGGYVKVSMDGAPYLRKIDLTVYKSYTDLVKA  130

Query  300  LDNLFDCRGIGEALKDA-DSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRIMKRSEA  124
            L+N+F     G + ++  + S+Y P YEDKDGDWMLVGDVPW MF+ SCKRLRIMK SEA
Sbjct  131  LENMFKFNLGGYSEREGFNGSDYVPTYEDKDGDWMLVGDVPWEMFISSCKRLRIMKGSEA  190

Query  123  KGIG  112
            +G+G
Sbjct  191  RGLG  194



>ref|XP_006432924.1| hypothetical protein CICLE_v10002569mg [Citrus clementina]
 ref|XP_006471683.1| PREDICTED: auxin-induced protein 22D-like [Citrus sinensis]
 gb|ESR46164.1| hypothetical protein CICLE_v10002569mg [Citrus clementina]
 gb|KDO48909.1| hypothetical protein CISIN_1g029427mg [Citrus sinensis]
Length=193

 Score =   157 bits (396),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 89/191 (47%), Positives = 115/191 (60%), Gaps = 15/191 (8%)
 Frame = -3

Query  642  MAAKSGLGLEITELRLGLPGSGHGGADKGTTG-------EKKRVFSEMIDGGDDHDRsss  484
            MA +  L LE TELRLGLPG+    ++K +         +  R  S  +     +   S 
Sbjct  1    MAFERDLNLEATELRLGLPGTQESRSNKRSLPDMNIVDDQDHRSGSSRVIANASNATKSE  60

Query  483  nnnnnkkKQQVVGWPPVCSYRR-----KNNSDEGKKMYVKVSMDGAPFLRKIDLTTHKTY  319
                   K QVVGWPP+ SYR+     K +  E   +YVKVSMDGAP+LRKI L  +K Y
Sbjct  61   EETTPPSKTQVVGWPPIRSYRKNSLQAKKSEAEASGIYVKVSMDGAPYLRKIHLNIYKDY  120

Query  318  SHLLIALDNLFDCRGIGEALKDA--DSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLR  145
              LL AL+++F  + +GE  +    + SE+ P YEDKDGDWMLVGDVPW MF+ SCKRLR
Sbjct  121  PELLKALEDMFKFK-VGEYSESEGYNGSEFVPTYEDKDGDWMLVGDVPWEMFITSCKRLR  179

Query  144  IMKRSEAKGIG  112
            +MK SEA+G+G
Sbjct  180  VMKGSEARGLG  190



>gb|AAD32142.1|AF123504_1 Nt-iaa2.3 deduced protein [Nicotiana tabacum]
Length=179

 Score =   156 bits (395),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 94/183 (51%), Positives = 117/183 (64%), Gaps = 17/183 (9%)
 Frame = -3

Query  642  MAAKSGLGLEITELRLGLPGSGHGGADKGTTGEKKRVFSEMIDGGDDHDRsssnnnnnkk  463
            MA +  L L+ TELRLGLPG+     D+      K     + +  +D D        +KK
Sbjct  5    MAHEKDLNLKATELRLGLPGT----EDESIVSSSKNKKRGLPESAEDED------CESKK  54

Query  462  KQQVVGWPPVCSYRRKNNSDEGKK----MYVKVSMDGAPFLRKIDLTTHKTYSHLLIALD  295
            K Q+VGWPPV SYR+ N   +  +    MYVKVSMDGAP+LRKIDL  +K Y+ LL AL+
Sbjct  55   KTQIVGWPPVRSYRKNNIQPKKTETECGMYVKVSMDGAPYLRKIDLKMYKGYAELLKALE  114

Query  294  NLFDCRGIGEALKDA--DSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRIMKRSEAK  121
            N+F    IGE  +    + SE+AP YEDKDGD MLVGDVPW MF+ SCKRLRIMK SEA+
Sbjct  115  NMFKL-SIGEYSEREGYNGSEFAPAYEDKDGDLMLVGDVPWDMFLSSCKRLRIMKGSEAR  173

Query  120  GIG  112
            G+G
Sbjct  174  GLG  176



>ref|XP_002520979.1| Auxin-induced protein 22E, putative [Ricinus communis]
 gb|EEF41396.1| Auxin-induced protein 22E, putative [Ricinus communis]
Length=196

 Score =   157 bits (396),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 93/199 (47%), Positives = 119/199 (60%), Gaps = 29/199 (15%)
 Frame = -3

Query  642  MAAKSGLGLEITELRLGLPGSGHGGADKGTTG-------------EKKRVFSEMIDGG--  508
            MA    L L+ TELRLGLPGS      + T+              E+ R  S +  G   
Sbjct  1    MAYHGDLNLKATELRLGLPGSDEPDQKQPTSSVTRGIKRASPELSEESRTRSNITSGSIV  60

Query  507  -DDHDRsssnnnnnkkKQQVVGWPPVCSYRR-----KNNSDEGKKMYVKVSMDGAPFLRK  346
             +D +  +S         QVVGWPP+ SYR+     K +  EG  MYVKVS+DGAP+LRK
Sbjct  61   ENDEEHCASPAKA-----QVVGWPPIRSYRKNYFQTKQSEGEGAGMYVKVSVDGAPYLRK  115

Query  345  IDLTTHKTYSHLLIALDNLFDCRGIGEALKDA--DSSEYAPIYEDKDGDWMLVGDVPWGM  172
            ID+  + +Y  LL AL+N+F  + IGE  +    + S+YAP YEDKDGDWMLVGDVPWGM
Sbjct  116  IDIKVYNSYPELLKALENMFKLK-IGEYSEREGYNGSDYAPTYEDKDGDWMLVGDVPWGM  174

Query  171  FVESCKRLRIMKRSEAKGI  115
            F+ SCKRLRI+K SE +G+
Sbjct  175  FISSCKRLRIVKGSEGRGL  193



>ref|XP_007034953.1| AUX/IAA transcriptional regulator family protein [Theobroma cacao]
 gb|EOY05879.1| AUX/IAA transcriptional regulator family protein [Theobroma cacao]
Length=192

 Score =   156 bits (395),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 92/186 (49%), Positives = 116/186 (62%), Gaps = 10/186 (5%)
 Frame = -3

Query  642  MAAKSGLGLEITELRLGLPGSGHGGADK-GTTGEKKRVFSEMIDG-GDDHDRsssnnnnn  469
            +A ++ L L+ TELRLGLPG+             KKR   +  +  G +    + N    
Sbjct  5    VAYENDLNLKATELRLGLPGTDEREEQSVSNVRNKKRPLQDADEEFGANGKSDAQNETAP  64

Query  468  kkKQQVVGWPPVCSYRRKN-----NSDEGKKMYVKVSMDGAPFLRKIDLTTHKTYSHLLI  304
              K Q+VGWPP+ SYR+ N     +  +G  +YVKVSMDGAP+LRKIDL  +  Y+ LL 
Sbjct  65   PAKAQIVGWPPIRSYRKNNFQPKKSESDGPGIYVKVSMDGAPYLRKIDLKVYTGYAELLQ  124

Query  303  ALDNLFDCRGIGEALKDA--DSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRIMKRS  130
            AL+N+F    IGE  +      S+YAP YEDKDGDWMLVGDVPW MFV SCKRLRIMK S
Sbjct  125  ALENMFKFT-IGEYSEREGYKGSDYAPTYEDKDGDWMLVGDVPWDMFVTSCKRLRIMKGS  183

Query  129  EAKGIG  112
            EA+G+G
Sbjct  184  EARGLG  189



>ref|XP_002531289.1| Auxin-induced protein 22D, putative [Ricinus communis]
 gb|EEF31102.1| Auxin-induced protein 22D, putative [Ricinus communis]
Length=200

 Score =   157 bits (396),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 93/189 (49%), Positives = 118/189 (62%), Gaps = 18/189 (10%)
 Frame = -3

Query  624  LGLEITELRLGLPGSGHGGADKGTTGE-KKRVFSEMIDGGDDHDRsssnnnnnkkKQ---  457
            L LE TELRL LPG+     +   T +  KR F +M D   +   +S+ +N+ K  Q   
Sbjct  9    LNLEATELRLALPGTTAATEESHVTAKCNKRSFPDMNDDRSESRNNSNVSNDKKGDQETT  68

Query  456  ------QVVGWPPVCSYR------RKNNSDE-GKKMYVKVSMDGAPFLRKIDLTTHKTYS  316
                  QVVGWPPV SYR      RK  ++  G  +YVKVSMDGAP+LRKIDL  +K Y+
Sbjct  69   SPPTKAQVVGWPPVRSYRKNCFQARKTEAEAAGNGIYVKVSMDGAPYLRKIDLKVYKCYT  128

Query  315  HLLIALDNLFDCR-GIGEALKDADSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRIM  139
             L  AL+++F  + G     +  + SE+ P YEDKDGDWMLVGDVPW MF+ SCKRLRIM
Sbjct  129  ELFQALEDMFKFKVGKFSEREGYNGSEFVPTYEDKDGDWMLVGDVPWDMFINSCKRLRIM  188

Query  138  KRSEAKGIG  112
            K SEA+G+G
Sbjct  189  KGSEARGLG  197



>ref|XP_009765454.1| PREDICTED: auxin-responsive protein IAA4-like [Nicotiana sylvestris]
Length=194

 Score =   156 bits (395),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 92/187 (49%), Positives = 117/187 (63%), Gaps = 12/187 (6%)
 Frame = -3

Query  639  AAKSGLGLEITELRLGLPGSGHGGADK---GTTGEKKRVFSEMIDGGDDHDRsssn--nn  475
            A +  L L+ TELRLGLPG+    +++     +   KR   +  D  +D +  SS+    
Sbjct  6    AHQKVLNLKATELRLGLPGTEDQESEQEILSNSKNNKRALPQSADDAEDCESKSSSDVKT  65

Query  474  nnkkKQQVVGWPPVCSYRRKN----NSDEGKKMYVKVSMDGAPFLRKIDLTTHKTYSHLL  307
                K Q+VGWPPV SYR+ N     ++    MYVKVSMDGAP+LRKIDL  +K Y  LL
Sbjct  66   PPVSKAQIVGWPPVRSYRKNNIQPKKTETESGMYVKVSMDGAPYLRKIDLKMYKCYPELL  125

Query  306  IALDNLFDCRGIGEALKDA--DSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRIMKR  133
             AL+N+F    IGE  +      SE+AP YEDKDGD MLVGDVPW MF+ +CKRLRIMK 
Sbjct  126  KALENMFKL-TIGEYSEREGYKCSEFAPAYEDKDGDLMLVGDVPWEMFMSTCKRLRIMKG  184

Query  132  SEAKGIG  112
            SEA+G+G
Sbjct  185  SEARGLG  191



>ref|XP_006281167.1| hypothetical protein CARUB_v10027201mg [Capsella rubella]
 gb|EOA14065.1| hypothetical protein CARUB_v10027201mg [Capsella rubella]
Length=186

 Score =   156 bits (395),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 89/178 (50%), Positives = 112/178 (63%), Gaps = 12/178 (7%)
 Frame = -3

Query  624  LGLEITELRLGLPGSGHGGADKGTTGEKKRVFSEMIDGGDDHDRsssnnnnnkkKQQVVG  445
            + L+ TELRLGLPG+       G +   KR   +  D   + + +      +  K Q+VG
Sbjct  11   VNLKATELRLGLPGTEEETVPCGKSN--KRALPD--DTEKEIESTGKTETASPPKAQIVG  66

Query  444  WPPVCSYRR-----KNNSDEGKKMYVKVSMDGAPFLRKIDLTTHKTYSHLLIALDNLFDC  280
            WPPV SYR+     K N  EG+  YVKVSMDGAP+LRKIDLT +K Y  L+ +L+N+F  
Sbjct  67   WPPVRSYRKNSIQTKKNESEGQGNYVKVSMDGAPYLRKIDLTVYKKYPELMKSLENMFKF  126

Query  279  RGIGEALKDA--DSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRIMKRSEAKGIG  112
              +GE  +      S++ P YEDKDGDWMLVGDVPW MFV SCKRLRIMK SE KG+G
Sbjct  127  -SVGEYSEREGYKGSDFVPTYEDKDGDWMLVGDVPWEMFVSSCKRLRIMKGSEVKGLG  183



>ref|XP_011032399.1| PREDICTED: auxin-responsive protein IAA16-like [Populus euphratica]
Length=249

 Score =   158 bits (399),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 101/228 (44%), Positives = 123/228 (54%), Gaps = 52/228 (23%)
 Frame = -3

Query  630  SGLGLEITELRLGLPGSGHGGAD-KGTTGEKKRVFSEMID------------GGDDHDRs  490
            S +  E TELRLGLPG    G D +      KR FSE +D             G D ++ 
Sbjct  14   SMINFEETELRLGLPGGVSNGNDAEAAKSNGKRGFSETVDLKLNLSTKETGKDGSDQEKV  73

Query  489  ssnnnnnk----------kKQQVVGWPPVCSYRR------KNNSDEGKKM---------Y  385
            ++                 K QVVGWPP+ S+R+      KNN+DEG+K          +
Sbjct  74   ATKEKTVAPRPNDPAKPPSKAQVVGWPPIRSFRKNVMAVQKNNNDEGEKASSSGTTGAAF  133

Query  384  VKVSMDGAPFLRKIDLTTHKTYSHLLIALDNLFDCRGIG----EALKD----------AD  247
            VKVSMDGAP+LRK+DL  +K+Y  L  AL  +F    IG    +  KD           +
Sbjct  134  VKVSMDGAPYLRKVDLKLYKSYRELSDALGKMFSSFTIGNCGSQGTKDFMNESKLIDLLN  193

Query  246  SSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRIMKRSEAKGIGLHA  103
            SSEY P YEDKDGDWMLVGDVPWGMFV+SCKRLRIMK SEA G+   A
Sbjct  194  SSEYVPTYEDKDGDWMLVGDVPWGMFVDSCKRLRIMKGSEAIGLAPRA  241



>ref|XP_002865407.1| indoleacetic acid-induced protein 4 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41666.1| indoleacetic acid-induced protein 4 [Arabidopsis lyrata subsp. 
lyrata]
Length=185

 Score =   156 bits (394),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 88/178 (49%), Positives = 114/178 (64%), Gaps = 13/178 (7%)
 Frame = -3

Query  624  LGLEITELRLGLPGSGHGGADKGTTGEKKRVFSEMIDGGDDHDRsssnnnnnkkKQQVVG  445
            + L+ TELRLGLPG+     ++  +  K    + + D   + + +  N   +  K Q+VG
Sbjct  11   VNLKATELRLGLPGT-----EETVSCGKSNKRALLDDTEKEIESTGKNETASPPKAQIVG  65

Query  444  WPPVCSYRRKN-----NSDEGKKMYVKVSMDGAPFLRKIDLTTHKTYSHLLIALDNLFDC  280
            WPPV SYR+ N     N  EG+  YVKVSMDGAP+LRKIDLT +K Y  L+ +L+N+F  
Sbjct  66   WPPVRSYRKNNIQTKKNESEGQGNYVKVSMDGAPYLRKIDLTMYKQYPELMKSLENMFKF  125

Query  279  RGIGEALKDA--DSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRIMKRSEAKGIG  112
              +GE  +      S++ P YEDKDGDWMLVGDVPW MFV SCKRLRIMK SE KG+G
Sbjct  126  -SVGEYFEREGYKGSDFVPTYEDKDGDWMLVGDVPWEMFVSSCKRLRIMKGSEVKGLG  182



>ref|XP_010529092.1| PREDICTED: auxin-responsive protein IAA1-like [Tarenaya hassleriana]
 ref|XP_010540311.1| PREDICTED: auxin-responsive protein IAA1-like [Tarenaya hassleriana]
 ref|XP_010552452.1| PREDICTED: auxin-responsive protein IAA1-like [Tarenaya hassleriana]
Length=184

 Score =   156 bits (394),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 95/182 (52%), Positives = 116/182 (64%), Gaps = 16/182 (9%)
 Frame = -3

Query  630  SGLGLEITELRLGLPGSGHG-GADKGTTGEKKRVFSEMIDGGDDHDRsssnnnnnkkKQQ  454
            +GL L+ TELRLGLPG+      D       KR F       DD D++  ++  +K   Q
Sbjct  7    NGLNLKDTELRLGLPGTEENLEQDVSCVRGNKRPFQ----NKDDQDQNQESSPPSKT--Q  60

Query  453  VVGWPPVCSYRRKN-----NSDEGKKMYVKVSMDGAPFLRKIDLTTHKTYSHLLIALDNL  289
            +VGWPPV SYR+ N     N D+G+ +YVKVSMDGAP+LRKIDL  +K Y  LL AL+ +
Sbjct  61   IVGWPPVRSYRKNNVQSRKNEDKGQGIYVKVSMDGAPYLRKIDLKMYKDYPELLNALEKM  120

Query  288  FDCRGIGEALKDA--DSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRIMKRSEA-KG  118
            F+   IGE  +      S Y P YEDKDGDWMLVGDVPW MF  SCKRLRIMK SEA +G
Sbjct  121  FNF-AIGEYSEREGYKGSGYVPTYEDKDGDWMLVGDVPWEMFSSSCKRLRIMKASEARRG  179

Query  117  IG  112
            +G
Sbjct  180  LG  181



>gb|ADB93648.2| indole-3-acetic acid inducible 19 [Arabidopsis thaliana]
Length=168

 Score =   155 bits (393),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 91/171 (53%), Positives = 103/171 (60%), Gaps = 23/171 (13%)
 Frame = -3

Query  633  KSGLGLEITELRLGLPGSGHGGADKGTTGEKKRVFSEM--IDGGDDHDRsssnnnnn---  469
            K GLGLEITELRLGLPG      D      KKR F+EM     G + D+  S   ++   
Sbjct  3    KEGLGLEITELRLGLPGR-----DVAEKMIKKRAFTEMNMTSSGSNSDQCESGVVSSGGD  57

Query  468  --------kkKQQVVGWPPVCSYRRKNNSDEGKKM-----YVKVSMDGAPFLRKIDLTTH  328
                      K QVVGWPPVCSYR+KN+  E         YVKVSMDG P+LRK+DL + 
Sbjct  58   AEKVNDSPAAKSQVVGWPPVCSYRKKNSCKEASTTKVGLGYVKVSMDGVPYLRKMDLGSS  117

Query  327  KTYSHLLIALDNLFDCRGIGEALKDADSSEYAPIYEDKDGDWMLVGDVPWG  175
            + Y  L  ALD LF  RGIG ALKD D+ EY  IYEDKDGDWML GDVPWG
Sbjct  118  QGYDDLAFALDKLFGFRGIGVALKDGDNCEYVTIYEDKDGDWMLAGDVPWG  168



>ref|XP_008235329.1| PREDICTED: auxin-induced protein 22D-like [Prunus mume]
Length=193

 Score =   156 bits (395),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 88/182 (48%), Positives = 109/182 (60%), Gaps = 18/182 (10%)
 Frame = -3

Query  624  LGLEITELRLGLPGSGHGGADKGTTG-----EKKRV----FSEMIDGGDDHDRsssnnnn  472
            L  + TELRLGLPGS     +K           KR      +E      DH       + 
Sbjct  14   LNFKATELRLGLPGSTEEPENKQAATPPLPRNNKRSSPDPTAEECCTNSDH------IDA  67

Query  471  nkkKQQVVGWPPVCSYRRKNNSDEGKKMYVKVSMDGAPFLRKIDLTTHKTYSHLLIALDN  292
               K Q+VGWPPV SYR+ +      + YVKVS+DGAP+LRKIDL  +K+Y  LL AL+N
Sbjct  68   PPTKAQIVGWPPVRSYRKNSMQARKPEAYVKVSVDGAPYLRKIDLKVYKSYPELLKALEN  127

Query  291  LFDCRGIG---EALKDADSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRIMKRSEAK  121
            +F+   IG   E     + S++AP YEDKDGDWMLVGDVPW MFV SCKRLRIMK +EA+
Sbjct  128  MFNLSNIGNYSETQGYINGSDFAPTYEDKDGDWMLVGDVPWNMFVSSCKRLRIMKGTEAR  187

Query  120  GI  115
            G+
Sbjct  188  GL  189



>ref|XP_011081682.1| PREDICTED: auxin-responsive protein IAA14 [Sesamum indicum]
Length=197

 Score =   156 bits (395),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 93/186 (50%), Positives = 115/186 (62%), Gaps = 18/186 (10%)
 Frame = -3

Query  609  TELRLGLPGSGHGGADKGTTGEKKRVFSEMIDG--GDDHDRsssnnnnnkkKQQVVGWPP  436
            TEL LGLPG G   +  G+    KR FSE +D   G   D   S +     K QVVGWPP
Sbjct  21   TELTLGLPG-GQKTSKSGS----KRGFSETVDLRLGSSCDDEVSVSTPPPSKAQVVGWPP  75

Query  435  VCSYRRKNNSDEGKKMYVKVSMDGAPFLRKIDLTTHKTYSHLLIALDNLFDCRGIGEALK  256
            V SYR KN     K  YVKV++DGAP+LRK+DL  + +Y  LL AL+ +F C  I   + 
Sbjct  76   VRSYR-KNMMKNCK--YVKVAVDGAPYLRKVDLEIYTSYQQLLAALEEMFTCLTICNVVN  132

Query  255  D------ADSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRIMKRSEAKGIGLHAKNF  94
            +      ++ +EY P YED+DGDWMLVGDVPW MFVESCKR+R+MK SEA  +GL  K  
Sbjct  133  ERKIMDSSNGTEYVPTYEDRDGDWMLVGDVPWKMFVESCKRMRLMKSSEA--VGLAPKTS  190

Query  93   LKEMSK  76
             K +SK
Sbjct  191  SKGLSK  196



>ref|XP_006382798.1| hypothetical protein POPTR_0005s05560g [Populus trichocarpa]
 gb|ABK94241.1| unknown [Populus trichocarpa]
 gb|ERP60595.1| hypothetical protein POPTR_0005s05560g [Populus trichocarpa]
Length=250

 Score =   158 bits (399),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 101/229 (44%), Positives = 122/229 (53%), Gaps = 53/229 (23%)
 Frame = -3

Query  630  SGLGLEITELRLGLPGSGHGGAD-KGTTGEKKRVFSEMID------------GGDDHDRs  490
            S +  E TELRLGLPG    G D +   G  KR FSE +D             G D ++ 
Sbjct  14   SMINYEETELRLGLPGGASNGNDGEAAKGNGKRGFSETVDLKLNLSTKETGKDGSDQEKV  73

Query  489  ssnnnnnk----------kKQQVVGWPPVCSYRR------KNNSDEGKKM----------  388
                               K QVVGWPP+ S+R+      KN++DEG+K           
Sbjct  74   VMKEKTVAPRPNDPAKPPSKAQVVGWPPIRSFRKNVMAVQKNSNDEGEKASSSGTTGTAA  133

Query  387  YVKVSMDGAPFLRKIDLTTHKTYSHLLIALDNLFDCRGIG----EALKD----------A  250
            +VKVSMDGAP+LRK+DL  +K+Y  L  AL  +F    IG    +  KD           
Sbjct  134  FVKVSMDGAPYLRKVDLKLYKSYRELSDALGKMFSSFTIGNCGSQGTKDFMNESKLIDLL  193

Query  249  DSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRIMKRSEAKGIGLHA  103
            +SSEY P YEDKDGDWMLVGDVPWGMFV+SCKRLRIMK SEA G+   A
Sbjct  194  NSSEYVPTYEDKDGDWMLVGDVPWGMFVDSCKRLRIMKGSEAIGLAPRA  242



>emb|CAC84712.1| aux/IAA protein [Populus tremula x Populus tremuloides]
Length=204

 Score =   156 bits (395),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 91/202 (45%), Positives = 120/202 (59%), Gaps = 26/202 (13%)
 Frame = -3

Query  642  MAAKSGLGLEITELRLGLPGSGHGGADKGTTG-----EKKRVFSEMIDGGDDHDRsssnn  478
            M  +  L L+ TELRLGLPG+    ++K T         KR   +M +      R +S+ 
Sbjct  1    MEFERDLNLDATELRLGLPGTATRQSEKQTPNSNLAKSNKRSLPDMNEDPAGSSRENSST  60

Query  477  nnnkkKQ-------------QVVGWPPVCSYRR-----KNNSDEGKKMYVKVSMDGAPFL  352
             ++ +++             QVVGWPP+ SYR+     K    E   +YVKVSMDGAP+L
Sbjct  61   VSSNEEKSHDQETAPPPIKAQVVGWPPIRSYRKNCLQAKKQEAEAAGLYVKVSMDGAPYL  120

Query  351  RKIDLTTHKTYSHLLIALDNLFDCRGIGEALKDA--DSSEYAPIYEDKDGDWMLVGDVPW  178
            RKIDL  +K Y  LL AL+ +F  + +GE  +    + SE+ P YEDKDGDWMLVGDVPW
Sbjct  121  RKIDLKVYKGYPELLKALEEMFKSK-VGEYSEREGYNGSEHVPTYEDKDGDWMLVGDVPW  179

Query  177  GMFVESCKRLRIMKRSEAKGIG  112
             MF+ SCKRLRIMK SEA+G+G
Sbjct  180  DMFINSCKRLRIMKESEARGLG  201



>ref|XP_011069469.1| PREDICTED: auxin-induced protein 22C-like, partial [Sesamum indicum]
Length=137

 Score =   154 bits (390),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 89/147 (61%), Positives = 103/147 (70%), Gaps = 10/147 (7%)
 Frame = -3

Query  642  MAAKSGLGLEITELRLGLPGSGHGGADKGTTGEKKRVFSEMIDGGDDHDRsssnnnnnkk  463
            M   SGLGLE TELRLGLPG G     +    EKKR FS++       +++++       
Sbjct  1    MDRSSGLGLE-TELRLGLPGGG-----EVEKNEKKRAFSDI---SGGEEKAAAAAGAGNN  51

Query  462  KQQVVGWPPVCSYRRKNNSDEGKKMYVKVSMDGAPFLRKIDLTTHKTYSHLLIALDNLFD  283
            K QVVGWPPVC+YRRKN S  G KMYVKVSMDGAPFLRKIDL++HK YS LL+AL+ LF 
Sbjct  52   KNQVVGWPPVCAYRRKN-SFNGVKMYVKVSMDGAPFLRKIDLSSHKGYSDLLMALEQLFG  110

Query  282  CRGIGEALKDADSSEYAPIYEDKDGDW  202
            C GI EAL+DAD  EY PIYEDKD DW
Sbjct  111  CFGIAEALEDADKCEYVPIYEDKDTDW  137



>ref|NP_199183.1| auxin-responsive protein IAA4 [Arabidopsis thaliana]
 sp|P33077.2|IAA4_ARATH RecName: Full=Auxin-responsive protein IAA4; AltName: Full=Auxin-induced 
protein AUX2-11; AltName: Full=Indoleacetic acid-induced 
protein 4 [Arabidopsis thaliana]
 emb|CAA37526.1| Aux2-11 protein [Arabidopsis thaliana]
 gb|AAA16571.1| auxin-responsive protein, partial [Arabidopsis thaliana]
 dbj|BAB11297.1| auxin-induced protein AUX2-11 [Arabidopsis thaliana]
 gb|AAO64788.1| At5g43700 [Arabidopsis thaliana]
 dbj|BAE99545.1| IAA4 [Arabidopsis thaliana]
 gb|ADC29370.1| indole-3-acetic acid inducible 4 [Arabidopsis thaliana]
 gb|ADC29371.1| indole-3-acetic acid inducible 4 [Arabidopsis thaliana]
 gb|ADL70510.1| indole-3-acetic acid inducible 4 [Arabidopsis thaliana]
 gb|ADL70511.1| indole-3-acetic acid inducible 4 [Arabidopsis thaliana]
 gb|ADL70512.1| indole-3-acetic acid inducible 4 [Arabidopsis thaliana]
 gb|ADL70514.1| indole-3-acetic acid inducible 4 [Arabidopsis thaliana]
 gb|ADL70515.1| indole-3-acetic acid inducible 4 [Arabidopsis thaliana]
 gb|ADL70516.1| indole-3-acetic acid inducible 4 [Arabidopsis thaliana]
 gb|ADL70517.1| indole-3-acetic acid inducible 4 [Arabidopsis thaliana]
 gb|ADL70518.1| indole-3-acetic acid inducible 4 [Arabidopsis thaliana]
 gb|ADL70519.1| indole-3-acetic acid inducible 4 [Arabidopsis thaliana]
 gb|ADL70521.1| indole-3-acetic acid inducible 4 [Arabidopsis thaliana]
 gb|AED94998.1| auxin-responsive protein IAA4 [Arabidopsis thaliana]
Length=186

 Score =   156 bits (394),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 88/178 (49%), Positives = 112/178 (63%), Gaps = 13/178 (7%)
 Frame = -3

Query  624  LGLEITELRLGLPGSGHGGADKGTTGEKKRVFSEMIDGGDDHDRsssnnnnnkkKQQVVG  445
            + L+ TELRLGLPG+    +        KRV  E  +   + + +      +  K Q+VG
Sbjct  11   VNLKATELRLGLPGTEETVS---CGKSNKRVLPEATE--KEIESTGKTETASPPKAQIVG  65

Query  444  WPPVCSYRRKN-----NSDEGKKMYVKVSMDGAPFLRKIDLTTHKTYSHLLIALDNLFDC  280
            WPPV SYR+ N     +  EG+  YVKVSMDGAP+LRKIDLT +K Y  L+ +L+N+F  
Sbjct  66   WPPVRSYRKNNVQTKKSESEGQGNYVKVSMDGAPYLRKIDLTMYKQYPELMKSLENMFKF  125

Query  279  RGIGEALKDA--DSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRIMKRSEAKGIG  112
              +GE  +      S++ P YEDKDGDWMLVGDVPW MFV SCKRLRIMK SE KG+G
Sbjct  126  -SVGEYFEREGYKGSDFVPTYEDKDGDWMLVGDVPWEMFVSSCKRLRIMKGSEVKGLG  182



>gb|ADL70509.1| indole-3-acetic acid inducible 4 [Arabidopsis thaliana]
Length=186

 Score =   156 bits (394),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 88/178 (49%), Positives = 112/178 (63%), Gaps = 13/178 (7%)
 Frame = -3

Query  624  LGLEITELRLGLPGSGHGGADKGTTGEKKRVFSEMIDGGDDHDRsssnnnnnkkKQQVVG  445
            + L+ TELRLGLPG+    +        KRV  E  +   + + +      +  K Q+VG
Sbjct  11   VNLKATELRLGLPGTEETVS---CGKSNKRVLPEATE--KEIESTGKTEAASPPKAQIVG  65

Query  444  WPPVCSYRRKN-----NSDEGKKMYVKVSMDGAPFLRKIDLTTHKTYSHLLIALDNLFDC  280
            WPPV SYR+ N     +  EG+  YVKVSMDGAP+LRKIDLT +K Y  L+ +L+N+F  
Sbjct  66   WPPVRSYRKNNVQTKKSESEGQGNYVKVSMDGAPYLRKIDLTMYKQYPELMKSLENMFKF  125

Query  279  RGIGEALKDA--DSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRIMKRSEAKGIG  112
              +GE  +      S++ P YEDKDGDWMLVGDVPW MFV SCKRLRIMK SE KG+G
Sbjct  126  -SVGEYFEREGYKGSDFVPTYEDKDGDWMLVGDVPWEMFVSSCKRLRIMKGSEVKGLG  182



>ref|XP_004288426.1| PREDICTED: auxin-induced protein 22B-like [Fragaria vesca subsp. 
vesca]
Length=199

 Score =   156 bits (394),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 93/190 (49%), Positives = 117/190 (62%), Gaps = 24/190 (13%)
 Frame = -3

Query  624  LGLEITELRLGLPGSG----HGGADKGTTGEKKRVFSEMID-------GGDDHDRsssnn  478
            L L+ TELRLGLPGS        A   +T  KKRV  E  +       G DD ++ ++  
Sbjct  12   LNLKATELRLGLPGSDASEEQAAAPVPSTLNKKRVVPEKSEEEIGSKRGTDDAEKITAPP  71

Query  477  nnnkkKQQVVGWPPVCSYRR------KNNSDEGKKMYVKVSMDGAPFLRKIDLTTHKTYS  316
                   Q+VGWPPV SYR+      KN+  E   +YVKVSMDGAP+LRKIDL  +K Y 
Sbjct  72   AKA----QIVGWPPVRSYRKNCLQASKNSEAETPGIYVKVSMDGAPYLRKIDLKVYKGYP  127

Query  315  HLLIALDNLFDCRGIGEALKDA--DSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRI  142
             LL  L+++F    +G+  +      S+YAP YEDKDGDWMLVGDVPW MF+ SCK+LRI
Sbjct  128  DLLKGLESMFKFT-VGQYTEREGYKGSDYAPTYEDKDGDWMLVGDVPWEMFMSSCKKLRI  186

Query  141  MKRSEAKGIG  112
            MK SEA+G+G
Sbjct  187  MKGSEARGLG  196



>gb|AFK43880.1| unknown [Lotus japonicus]
Length=177

 Score =   155 bits (392),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 90/171 (53%), Positives = 113/171 (66%), Gaps = 12/171 (7%)
 Frame = -3

Query  618  LEITELRLGLPGSGHGGADKGTTGEKKRVFSEMIDGGDDHDRsssnnnnnkkKQQVVGWP  439
            L+ TELRLGLPG+    ++K T    KR  +E  +G +       + +    K ++VGWP
Sbjct  14   LKATELRLGLPGTEE--SEKKTN---KRPLNETSEGSNAQQ--VESGSAPPSKAKIVGWP  66

Query  438  PVCSYRRKNNSDEGKKMYVKVSMDGAPFLRKIDLTTHKTYSHLLIALDNLFDCRGIGEAL  259
            P+ SYR+K     G  +YVKVSMDGAP+LRKIDL  +  YS LL A++N+F    IGE  
Sbjct  67   PIRSYRKKEVEAAG--VYVKVSMDGAPYLRKIDLRIYGGYSELLKAVENMFKLT-IGEYS  123

Query  258  KDA--DSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRIMKRSEAKGIG  112
            +      SE+AP YEDKDGDWMLVGDVPW MFV SCKRLRIMK SEA+G+G
Sbjct  124  EKEGYKGSEFAPTYEDKDGDWMLVGDVPWEMFVTSCKRLRIMKGSEARGLG  174



>ref|XP_010481836.1| PREDICTED: auxin-responsive protein IAA4 [Camelina sativa]
Length=186

 Score =   155 bits (393),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 88/178 (49%), Positives = 112/178 (63%), Gaps = 12/178 (7%)
 Frame = -3

Query  624  LGLEITELRLGLPGSGHGGADKGTTGEKKRVFSEMIDGGDDHDRsssnnnnnkkKQQVVG  445
            + L+ TELRLGLPG+     +  + G+  +      D   + + +      +  K Q+VG
Sbjct  11   VNLKATELRLGLPGT----EETVSCGKSNKRALPDDDTEKEIESTGKTETASPPKAQIVG  66

Query  444  WPPVCSYRR-----KNNSDEGKKMYVKVSMDGAPFLRKIDLTTHKTYSHLLIALDNLFDC  280
            WPPV SYRR     K N  EG+  YVKVSMDGAP+LRKIDLT +K Y  L+ +L+N+F  
Sbjct  67   WPPVRSYRRNSIQTKKNESEGQGNYVKVSMDGAPYLRKIDLTVYKKYPELMKSLENMFKF  126

Query  279  RGIGEALKDA--DSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRIMKRSEAKGIG  112
              +GE  +      S++ P YEDKDGDWMLVGDVPW MFV SCKRLRIMK SE KG+G
Sbjct  127  -SVGEYFEREGYKGSDFVPTYEDKDGDWMLVGDVPWEMFVSSCKRLRIMKGSEVKGLG  183



>ref|XP_006305735.1| hypothetical protein CARUB_v10010519mg [Capsella rubella]
 gb|EOA38633.1| hypothetical protein CARUB_v10010519mg [Capsella rubella]
Length=158

 Score =   154 bits (390),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 90/177 (51%), Positives = 109/177 (62%), Gaps = 21/177 (12%)
 Frame = -3

Query  642  MAAKSG-LGLEITELRLGLPGSGHGGADKGTTGEKKRVFSEMIDGGDDHDRsssnnnnnk  466
            MA +S  LGL ITELRLGLPG       K  + E +R        G   +R++       
Sbjct  1    MANESSILGLAITELRLGLPGDITVSGKKRASPEAER--------GLKCERATK------  46

Query  465  kKQQVVGWPPVCSYRRKNNSDEGKKMYVKVSMDGAPFLRKIDLTTHKTYSHLLIALDNLF  286
               Q VGWPPVCSYRRKN+ ++ K  YVKVS+DGA FLRKIDL  ++ Y  L  AL +LF
Sbjct  47   --SQAVGWPPVCSYRRKNSLEQTKTSYVKVSVDGAAFLRKIDLEIYECYRDLASALQSLF  104

Query  285  DCRGIGEALKDAD-SSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRIMKRSEAKG  118
             C     +  DA   SE  PIYED+DGDWML GDVPW +F+ SCKRLRIMKR+  +G
Sbjct  105  GC---SISFDDASKESECVPIYEDRDGDWMLAGDVPWELFLGSCKRLRIMKRTCNRG  158



>gb|EPS58914.1| hypothetical protein M569_15899, partial [Genlisea aurea]
Length=128

 Score =   153 bits (387),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 76/125 (61%), Positives = 92/125 (74%), Gaps = 9/125 (7%)
 Frame = -3

Query  459  QQVVGWPPVCSYRR--------KNNSDEGKKMYVKVSMDGAPFLRKIDLTTHKTYSHLLI  304
            QQVVGWPPV S+R+        K  S+ G  ++VKVSMDGAP+LRKIDL  +  Y  LL 
Sbjct  2    QQVVGWPPVRSFRKNALLQQGKKGESENGSGIFVKVSMDGAPYLRKIDLKFYNNYVDLLK  61

Query  303  ALDNLFDCR-GIGEALKDADSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRIMKRSE  127
            AL+N+F C+ G+    +  ++SEYAP YEDKDGDWMLVGDVPW MFV SCKR+RIMK SE
Sbjct  62   ALENMFKCKIGVYSEREGYNASEYAPTYEDKDGDWMLVGDVPWEMFVNSCKRMRIMKASE  121

Query  126  AKGIG  112
            AKG+G
Sbjct  122  AKGLG  126



>ref|XP_010069174.1| PREDICTED: auxin-induced protein 22B-like [Eucalyptus grandis]
 gb|KCW57436.1| hypothetical protein EUGRSUZ_H00216 [Eucalyptus grandis]
Length=204

 Score =   156 bits (394),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 97/186 (52%), Positives = 113/186 (61%), Gaps = 19/186 (10%)
 Frame = -3

Query  624  LGLEITELRLGLPGSGHGGADKGTTGEKKRVFSEMIDG---------GDDHDRsssnnnn  472
            L LE TELRLGLPG+   G  K  TG  KR+FSE  D             HD    +   
Sbjct  20   LNLEETELRLGLPGTEESGQKKSRTG--KRLFSESSDVSGSSKGSCVAPHHDEDHESAPA  77

Query  471  nkkKQQVVGWPPVCSYRR-----KNNSDEGKKMYVKVSMDGAPFLRKIDLTTHKTYSHLL  307
             K   Q+VGWPPV SYR+     K    EG  +YVKVS+DGAP+LRKIDL  +  Y  LL
Sbjct  78   PKA--QIVGWPPVRSYRKSALQPKKAEAEGPGIYVKVSVDGAPYLRKIDLKVYGGYPELL  135

Query  306  IALDNLFDCR-GIGEALKDADSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRIMKRS  130
             AL+N+F    G     +    SEYAP YEDKDGDWMLVGDVPW MF+ SCK+LRIMK S
Sbjct  136  KALENMFKLTIGDYSEREGYKGSEYAPTYEDKDGDWMLVGDVPWEMFILSCKKLRIMKES  195

Query  129  EAKGIG  112
            EA+G+G
Sbjct  196  EARGLG  201



>ref|XP_011042428.1| PREDICTED: auxin-induced protein 22E-like [Populus euphratica]
Length=194

 Score =   155 bits (393),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 95/191 (50%), Positives = 120/191 (63%), Gaps = 18/191 (9%)
 Frame = -3

Query  642  MAAKSGLGLEITELRLGLPGSGHGGADKGTTG--EKKRVFSEMIDGGDDHDRsssnn---  478
            MA +S L L+ TELRLGLPGS        T      KR   E+ +       S S+N   
Sbjct  5    MAYESDLNLKATELRLGLPGSDEPEKPSTTPSVRSNKRASPEISESRSKGSSSVSSNVEN  64

Query  477  ----nnnkkKQQVVGWPPVCSYRR------KNNSDEGKKMYVKVSMDGAPFLRKIDLTTH  328
                +    K QVVGWPP+ SYR+      KN+  +G  +YVKVS+DGAP+LRKIDL  +
Sbjct  65   GERDSATPAKTQVVGWPPIRSYRKNCLQPKKNDQVDGAGVYVKVSVDGAPYLRKIDLNVY  124

Query  327  KTYSHLLIALDNLFDCRGIGEALKDA--DSSEYAPIYEDKDGDWMLVGDVPWGMFVESCK  154
            K+Y  LL AL+++F+   IGE  ++   + SE+AP YEDKDGDWMLVGDVPW MF+ SCK
Sbjct  125  KSYPELLKALESMFELT-IGEYSENEGYNGSEFAPTYEDKDGDWMLVGDVPWDMFISSCK  183

Query  153  RLRIMKRSEAK  121
            RLRIMK SEA+
Sbjct  184  RLRIMKGSEAR  194



>ref|XP_006382797.1| auxin-induced protein IAA4 [Populus trichocarpa]
 gb|ERP60594.1| auxin-induced protein IAA4 [Populus trichocarpa]
Length=201

 Score =   155 bits (393),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 91/199 (46%), Positives = 114/199 (57%), Gaps = 23/199 (12%)
 Frame = -3

Query  642  MAAKSGLGLEITELRLGLPGSGHGGADKGT-----TGEKKRVFSEMIDGG----------  508
            M  +  L LE TELRLGLPG+     +K T     T   KR   +M +            
Sbjct  1    MEFERDLNLEATELRLGLPGTATEQLEKQTPNSNVTKSNKRSLPDMNEDSAGRRESSSVS  60

Query  507  DDHDRsssnnnnnkkKQQVVGWPPVCSYRR-----KNNSDEGKKMYVKVSMDGAPFLRKI  343
             +  +S         K QVVGWPP+ SYR+     +    E   +YVKVSMDGAP+LRKI
Sbjct  61   SNDKKSHEQETAPPTKTQVVGWPPIRSYRKNCLQARKLEAEAAGLYVKVSMDGAPYLRKI  120

Query  342  DLTTHKTYSHLLIALDNLFDCRGIGEALKDA--DSSEYAPIYEDKDGDWMLVGDVPWGMF  169
            DL  +K Y  LL  ++ +F  + +GE  +    + SEY P YEDKDGDWMLVGDVPW MF
Sbjct  121  DLKVYKGYPELLEVVEEMFKFK-VGEYSEREGYNGSEYVPTYEDKDGDWMLVGDVPWEMF  179

Query  168  VESCKRLRIMKRSEAKGIG  112
            + SCKRLRIMK SEA+G+G
Sbjct  180  INSCKRLRIMKESEARGLG  198



>ref|XP_004495145.1| PREDICTED: auxin-induced protein 22D-like isoform X1 [Cicer arietinum]
Length=203

 Score =   155 bits (393),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 91/192 (47%), Positives = 117/192 (61%), Gaps = 23/192 (12%)
 Frame = -3

Query  624  LGLEITELRLGLPGSGH-------------GGADKGTTGEKKRVFSEMIDGGDD--HDRs  490
            +  + TELRLGLPG                       T E + +    ++  +   HD+ 
Sbjct  12   MNFKATELRLGLPGVDEMEKVPSNYSVLRSNKRSSPETSEVESINKTNLNTSNTICHDQD  71

Query  489  ssnnnnnkkKQQVVGWPPVCSYRRKNNSDEGKK-----MYVKVSMDGAPFLRKIDLTTHK  325
            ++  +N   + QVVGWPP+ SYR+  NS + KK     MYVKVSM GAP+LRKIDL  +K
Sbjct  72   NAPPSNGVCRAQVVGWPPIRSYRK--NSLQQKKGEEVGMYVKVSMAGAPYLRKIDLKVYK  129

Query  324  TYSHLLIALDNLFDCR-GIGEALKDADSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRL  148
            +YS LL AL+N+F C  G     +  + SE+AP YEDKDGDWMLVGDVPW MF+ SCKRL
Sbjct  130  SYSELLKALENMFKCTFGEYSEREGYNGSEFAPTYEDKDGDWMLVGDVPWEMFMSSCKRL  189

Query  147  RIMKRSEAKGIG  112
            R+MK SEAKG+G
Sbjct  190  RVMKGSEAKGLG  201



>ref|XP_011027531.1| PREDICTED: auxin-induced protein 22D [Populus euphratica]
 ref|XP_011029892.1| PREDICTED: auxin-induced protein 22D-like [Populus euphratica]
Length=196

 Score =   155 bits (392),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 98/196 (50%), Positives = 124/196 (63%), Gaps = 20/196 (10%)
 Frame = -3

Query  642  MAAKSGLGLEITELRLGLPGSGHGGADKGTTGEK--KRVFSEMIDGGDDHDRsssn----  481
            +A ++ L L+ TELRLGLPG+G    +KG +G +  KR F E  + G  + +S +     
Sbjct  5    VAYENDLNLKATELRLGLPGTGCTN-EKGDSGARNNKRPFPETREEGGANGKSDAQHDDQ  63

Query  480  nnnnkkKQQVVGWPPVCSYRRKNNSDEGKK--------MYVKVSMDGAPFLRKIDLTTHK  325
               +  K Q+VGWPP+ SYR+  NS + KK        MYVKVS+DGAP+LRKIDL  +K
Sbjct  64   ETASAPKVQIVGWPPIRSYRK--NSFQPKKAEDEAAAGMYVKVSVDGAPYLRKIDLKVYK  121

Query  324  TYSHLLIALDNLFDCRGIGE--ALKDADSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKR  151
             Y   L AL+N+     IGE    +    SEYAP YEDKDGDWMLVGDVPW MF+ SCK+
Sbjct  122  GYPEFLKALENMLKLT-IGEYSEREGYKGSEYAPTYEDKDGDWMLVGDVPWDMFLSSCKK  180

Query  150  LRIMKRSEAKGIGLHA  103
            LRIMK SEA G+G  A
Sbjct  181  LRIMKGSEAIGLGCGA  196



>ref|XP_002279955.1| PREDICTED: auxin-induced protein 22D [Vitis vinifera]
 emb|CBI34154.3| unnamed protein product [Vitis vinifera]
Length=199

 Score =   155 bits (392),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 93/192 (48%), Positives = 111/192 (58%), Gaps = 27/192 (14%)
 Frame = -3

Query  624  LGLEITELRLGLPGS--GHGGADKGTTGEKKRVFSEM------------IDGGDDHDRss  487
            L LE TELRLGLPG+      A        KR   +M             D G  H  ++
Sbjct  11   LNLEATELRLGLPGTKKPEKQAPPSLKTSNKRALPDMNEESGSGNNSSVSDDGKSHRETA  70

Query  486  snnnnnkkKQQVVGWPPVCSYRR------KNNSDEGKKMYVKVSMDGAPFLRKIDLTTHK  325
                      QVVGWPPV SYR+      K  ++EG+  Y+KVSMDGAP+LRKIDL  +K
Sbjct  71   PAPKA-----QVVGWPPVRSYRKSCFQPKKTEAEEGR-TYLKVSMDGAPYLRKIDLKVYK  124

Query  324  TYSHLLIALDNLFDCR-GIGEALKDADSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRL  148
             Y  LL AL+ +F    G     +  + SEYAP YEDKDGDWMLVGDVPW MF+ SCKRL
Sbjct  125  GYPELLKALEEMFKFSVGQYSEREGYNGSEYAPTYEDKDGDWMLVGDVPWNMFISSCKRL  184

Query  147  RIMKRSEAKGIG  112
            RIMK SEA+G+G
Sbjct  185  RIMKGSEARGLG  196



>ref|XP_002517024.1| Auxin-responsive protein IAA4, putative [Ricinus communis]
 gb|EEF45187.1| Auxin-responsive protein IAA4, putative [Ricinus communis]
Length=191

 Score =   155 bits (392),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 95/186 (51%), Positives = 111/186 (60%), Gaps = 11/186 (6%)
 Frame = -3

Query  642  MAAKSGLGLEITELRLGLPGS--GHGGADKGTTGEKKRVFSEMIDGGDDHDRsssnnnnn  469
            +A ++ L L+ TELRLGLPG+      A    T   KR   E  D   +   S       
Sbjct  5    VAYENDLNLKATELRLGLPGTERNEEQAALSCTRNNKRPLPETRDECGEKA-SDYTETAP  63

Query  468  kkKQQVVGWPPVCSYRRKN-----NSDEGKKMYVKVSMDGAPFLRKIDLTTHKTYSHLLI  304
              K Q+VGWPPV SYR+ N        E    YVKVSMDGAP+LRKIDL  +K Y  LL 
Sbjct  64   PPKAQIVGWPPVRSYRKNNLQTKQTEAESSGRYVKVSMDGAPYLRKIDLKVYKGYKELLK  123

Query  303  ALDNLFDCRGIGEALKDA--DSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRIMKRS  130
            AL ++F    IGE  +      SEYAP YEDKDGDWMLVGDVPW MF+ SCKRLRIMK S
Sbjct  124  ALQSMFKF-TIGEYSEREGYKGSEYAPTYEDKDGDWMLVGDVPWDMFMSSCKRLRIMKGS  182

Query  129  EAKGIG  112
            EA+G+G
Sbjct  183  EARGLG  188



>ref|XP_007030568.1| AUX/IAA transcriptional regulator family protein isoform 1 [Theobroma 
cacao]
 gb|EOY11070.1| AUX/IAA transcriptional regulator family protein isoform 1 [Theobroma 
cacao]
Length=192

 Score =   155 bits (392),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 91/191 (48%), Positives = 114/191 (60%), Gaps = 16/191 (8%)
 Frame = -3

Query  642  MAAKSGLGLEITELRLGLPGSGHGGADKGTTGEKKRVFSEMID---GGDDHD----Rsss  484
            MA +  L L+ T LRLGLPG+        +    KR   +M +    GD+ +    R   
Sbjct  1    MAFEKDLNLDATALRLGLPGTSEEQTS-ASGKSNKRALPDMNEESVSGDNSNVADARKCD  59

Query  483  nnnnnkkKQQVVGWPPVCSYRR-----KNNSDEGKKMYVKVSMDGAPFLRKIDLTTHKTY  319
                   K QVVGWPP+ SYR+     K    E   +YVKVSMDGAP+LRKIDL  +K Y
Sbjct  60   QETAPPSKAQVVGWPPIRSYRKNCLQPKKTEAEAAGIYVKVSMDGAPYLRKIDLKVYKGY  119

Query  318  SHLLIALDNLFDCRGIGEALKDA--DSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLR  145
              LL AL+++F  + +GE  +    + SE+ P YEDKDGDWMLVGDVPW MF  SCKRLR
Sbjct  120  PELLKALEDMFKFK-VGEYSEREGYNGSEFVPTYEDKDGDWMLVGDVPWEMFTNSCKRLR  178

Query  144  IMKRSEAKGIG  112
            IMK SEA+G+G
Sbjct  179  IMKGSEARGLG  189



>ref|NP_001288939.1| auxin-responsive protein IAA16 [Brassica rapa]
 gb|ABV89663.1| indoleacetic acid-induced protein 16 [Brassica rapa]
Length=231

 Score =   156 bits (395),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 96/223 (43%), Positives = 113/223 (51%), Gaps = 50/223 (22%)
 Frame = -3

Query  624  LGLEITELRLGLPGSGHGGADKGTTGEKKRVFSEMID-------------GGDDHDRsss  484
            +  E TELRLGLPG  HGG D       KR FSE +D              G D +    
Sbjct  2    INFEATELRLGLPGGNHGG-DMAMKNNGKRGFSETVDLKLNLSSTALDSVSGVDLENMKE  60

Query  483  nnnnnkkKQQVVGWPPVCSYRRK----------------------NNSDEGKKMYVKVSM  370
                   K QVVGWPPV S+R+                       N +      YVKVSM
Sbjct  61   KVVKPPAKAQVVGWPPVRSFRKNVMSGQKPTAGDATEGTEKTSSSNGATSSAAAYVKVSM  120

Query  369  DGAPFLRKIDLTTHKTYSHLLIALDNLFDCRGIG----EALKD----------ADSSEYA  232
            DGAP+LRKIDL  +KTY  L  AL  +F    +G    + +KD           + S+Y 
Sbjct  121  DGAPYLRKIDLKLYKTYQDLSDALSKMFSSFTLGNYGPQGMKDFMNESRLIDLLNGSDYV  180

Query  231  PIYEDKDGDWMLVGDVPWGMFVESCKRLRIMKRSEAKGIGLHA  103
            P YEDKDGDWMLVGDVPWGMFV+SCKR+RIMK SEA G+   A
Sbjct  181  PTYEDKDGDWMLVGDVPWGMFVDSCKRIRIMKGSEAIGLAPRA  223



>ref|XP_010441996.1| PREDICTED: auxin-responsive protein IAA4-like [Camelina sativa]
Length=186

 Score =   155 bits (391),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 87/178 (49%), Positives = 112/178 (63%), Gaps = 12/178 (7%)
 Frame = -3

Query  624  LGLEITELRLGLPGSGHGGADKGTTGEKKRVFSEMIDGGDDHDRsssnnnnnkkKQQVVG  445
            + L+ TELRLGLPG+     +  + G+  +      D   + + +      +  K Q+VG
Sbjct  11   VNLKATELRLGLPGT----EETISCGKSNKRALPDDDTEKEIESTGKTETASPPKAQIVG  66

Query  444  WPPVCSYRR-----KNNSDEGKKMYVKVSMDGAPFLRKIDLTTHKTYSHLLIALDNLFDC  280
            WPPV SYRR     K N  EG+  YVKVSMDGAP+LRKIDLT +K Y  L+ +L+N+F  
Sbjct  67   WPPVRSYRRNSIQTKKNESEGQGNYVKVSMDGAPYLRKIDLTVYKKYPELMKSLENMFKF  126

Query  279  RGIGEALKDA--DSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRIMKRSEAKGIG  112
              +GE  +      S++ P YEDKDGDWML+GDVPW MFV SCKRLRIMK SE KG+G
Sbjct  127  -SVGEYFEREGYKGSDFVPTYEDKDGDWMLIGDVPWEMFVSSCKRLRIMKGSEVKGLG  183



>ref|XP_010923480.1| PREDICTED: auxin-induced protein 22D-like [Elaeis guineensis]
Length=196

 Score =   155 bits (391),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 90/185 (49%), Positives = 116/185 (63%), Gaps = 18/185 (10%)
 Frame = -3

Query  621  GLEITELRLGLPG--SGHGGADKGTTGEKKRVFSEMIDGGDDHDRsssnnnnnkkKQ---  457
             L+ TELRLGLPG  +    A     G K+ +     +   D  +S   + +N++ Q   
Sbjct  10   NLKATELRLGLPGIDAPEKPAPVSPRGSKRALLKANEECWPDTSKSLEADTSNQEAQPMA  69

Query  456  --QVVGWPPVCSYRRKNNSDEGKK-------MYVKVSMDGAPFLRKIDLTTHKTYSHLLI  304
              QV+GWPP+ SYR+  NS + +K       ++VKVSMDGAP+LRKIDL  +K Y  L  
Sbjct  70   KAQVIGWPPIRSYRK--NSFKARKAEVEAAGLFVKVSMDGAPYLRKIDLKVYKGYKELRE  127

Query  303  ALDNLFDCRGIGE--ALKDADSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRIMKRS  130
            ALDN+F C   GE   ++  + SEYA  YEDKDGDWMLVGDVPW MF+ SCKRLRIM+RS
Sbjct  128  ALDNMFRCFSTGELSGMEGCNGSEYAITYEDKDGDWMLVGDVPWEMFISSCKRLRIMRRS  187

Query  129  EAKGI  115
            EA G+
Sbjct  188  EATGM  192



>emb|CDY53800.1| BnaA06g01830D [Brassica napus]
Length=188

 Score =   154 bits (390),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 90/163 (55%), Positives = 107/163 (66%), Gaps = 11/163 (7%)
 Frame = -3

Query  636  AKSGLGLEITELRLGLPGSGHGGADKGTTGEKKRVFSEMI-------DGGDDHDRsssnn  478
            AK GLGLEITELRLGLP   +G      + + KRVFSEM+       DG +    S  ++
Sbjct  2    AKEGLGLEITELRLGLPVDNNGERLVSGSKKTKRVFSEMMISSSLDTDGANSVVSSVEDD  61

Query  477  nnnkkKQQVVGWPPVCSYR-RKNNSDEGKKM--YVKVSMDGAPFLRKIDLTTHKTYSHLL  307
            +  K K Q VGWPPVCSYR +KNN+ E  K   YVKVSM G P+LRK+DL T K Y+HL 
Sbjct  62   SVPKDKSQAVGWPPVCSYRTKKNNNKESSKAIGYVKVSMCGVPYLRKVDLGTSKGYTHLA  121

Query  306  IALDNLFDCRGIGEALKDADSSEYAPIYEDKDGDWMLVGDVPW  178
              L+ LFDC G+  ALK+ +  EY  IYEDKD DWMLVGDVPW
Sbjct  122  TVLEKLFDCLGL-VALKEGEKFEYVIIYEDKDRDWMLVGDVPW  163



>gb|ADC29373.1| indole-3-acetic acid inducible 4 [Arabidopsis thaliana]
Length=186

 Score =   154 bits (390),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 87/178 (49%), Positives = 111/178 (62%), Gaps = 13/178 (7%)
 Frame = -3

Query  624  LGLEITELRLGLPGSGHGGADKGTTGEKKRVFSEMIDGGDDHDRsssnnnnnkkKQQVVG  445
            + L+ TELRLGLPG+    +        KRV  E  +   + + +      +  K Q+VG
Sbjct  11   VNLKATELRLGLPGTEETVS---CGKSNKRVLPEATE--KEIESTGKTETASPPKAQIVG  65

Query  444  WPPVCSYRRKN-----NSDEGKKMYVKVSMDGAPFLRKIDLTTHKTYSHLLIALDNLFDC  280
            WPPV SYR+ N     +  EG+  YVKVSMDGAP+LRKIDLT +K Y  L+ +L+N+F  
Sbjct  66   WPPVRSYRKNNVQTKKSESEGQGNYVKVSMDGAPYLRKIDLTMYKQYPELMKSLENMFKF  125

Query  279  RGIGEALKDA--DSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRIMKRSEAKGIG  112
              +GE  +      S++ P YEDKDGDWMLVGDVPW MFV SCKRLRIMK SE KG+ 
Sbjct  126  -SVGEYFEREGYKGSDFVPTYEDKDGDWMLVGDVPWEMFVSSCKRLRIMKGSEVKGLA  182



>emb|CAN74317.1| hypothetical protein VITISV_013837 [Vitis vinifera]
Length=206

 Score =   155 bits (392),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 94/194 (48%), Positives = 113/194 (58%), Gaps = 24/194 (12%)
 Frame = -3

Query  624  LGLEITELRLGLPGS--GHGGADKGTTGEKKRVFSEM------------IDGGDDHDRss  487
            L LE TELRLGLPG+      A        KR   +M             D G  H  ++
Sbjct  11   LNLEATELRLGLPGTKKPEKQAPPSLKTSNKRALPDMNEESGSGNNSSVSDDGKSHRETA  70

Query  486  snnnnn--kkKQQVVGWPPVCSYR------RKNNSDEGKKMYVKVSMDGAPFLRKIDLTT  331
                N     + QVVGWPPV SYR      +K  ++EG + Y+KVSMDGAP+LRKIDL  
Sbjct  71   PAPKNAVYNYRAQVVGWPPVRSYRKSCFQPKKTEAEEG-RTYLKVSMDGAPYLRKIDLKV  129

Query  330  HKTYSHLLIALDNLFDCR-GIGEALKDADSSEYAPIYEDKDGDWMLVGDVPWGMFVESCK  154
            +K Y  LL AL+ +F    G     +  + SEYAP YEDKDGDWMLVGDVPW MF+ SCK
Sbjct  130  YKGYPELLKALEEMFKFSVGQYSEREGYNGSEYAPTYEDKDGDWMLVGDVPWNMFISSCK  189

Query  153  RLRIMKRSEAKGIG  112
            RLRIMK SEA+G+G
Sbjct  190  RLRIMKGSEARGLG  203



>gb|AAX63768.1| auxin-responsive protein IAA [Populus tomentosa]
Length=201

 Score =   155 bits (391),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 90/199 (45%), Positives = 114/199 (57%), Gaps = 23/199 (12%)
 Frame = -3

Query  642  MAAKSGLGLEITELRLGLPGSGHGGADKGT-----TGEKKRVFSEMIDGG----------  508
            M  +  L LE TELRLGLPG+     +K T     T   KR   +M +            
Sbjct  1    MEFERDLNLEATELRLGLPGTATQQLEKQTPSSNVTKSNKRSLPDMNEDSAGRSESSSVS  60

Query  507  DDHDRsssnnnnnkkKQQVVGWPPVCSYRR-----KNNSDEGKKMYVKVSMDGAPFLRKI  343
             +  +S         + +VVGWPP+ SYR+     K    E   +YVKVSMDGAP+LRKI
Sbjct  61   SNDKKSDEQETAPPTETRVVGWPPIRSYRKNCLQAKKLEAEAAGLYVKVSMDGAPYLRKI  120

Query  342  DLTTHKTYSHLLIALDNLFDCRGIGEALKDA--DSSEYAPIYEDKDGDWMLVGDVPWGMF  169
            DL  +K Y  LL  ++ +F  + +GE  +    + SEY P YEDKDGDWMLVGDVPW MF
Sbjct  121  DLKVYKGYPELLEVVEEMFKFK-VGEPSEREGYNGSEYVPTYEDKDGDWMLVGDVPWEMF  179

Query  168  VESCKRLRIMKRSEAKGIG  112
            + SCKRLRIMK SEA+G+G
Sbjct  180  INSCKRLRIMKESEARGLG  198



>gb|ADC29369.1| indole-3-acetic acid inducible 4 [Arabidopsis thaliana]
Length=186

 Score =   154 bits (390),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 87/178 (49%), Positives = 111/178 (62%), Gaps = 13/178 (7%)
 Frame = -3

Query  624  LGLEITELRLGLPGSGHGGADKGTTGEKKRVFSEMIDGGDDHDRsssnnnnnkkKQQVVG  445
            + L+ TELRLGLPG+    +        KRV  E  +   + + +      +  K Q+VG
Sbjct  11   VNLKATELRLGLPGTEETVS---CGKSNKRVLPEATE--KEIESTGKTETASPPKAQIVG  65

Query  444  WPPVCSYRRKN-----NSDEGKKMYVKVSMDGAPFLRKIDLTTHKTYSHLLIALDNLFDC  280
            WPPV SYR+ N     +  EG+  YVKVSMDGAP+LRKIDLT +K Y  L+ +L+N+F  
Sbjct  66   WPPVRSYRKNNVLTKKSESEGQGNYVKVSMDGAPYLRKIDLTMYKQYPELMKSLENMFKF  125

Query  279  RGIGEALKDA--DSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRIMKRSEAKGIG  112
              +GE  +      S++ P YEDKDGDWMLVGDVPW MFV SCKRLRIMK SE KG+ 
Sbjct  126  -SVGEYFEREGYKGSDFVPTYEDKDGDWMLVGDVPWEMFVSSCKRLRIMKGSEVKGLA  182



>ref|XP_002319642.1| auxin-induced protein IAA4 [Populus trichocarpa]
 gb|EEE95565.1| auxin-induced protein IAA4 [Populus trichocarpa]
 gb|AFZ78613.1| hypothetical protein [Populus tomentosa]
Length=203

 Score =   155 bits (391),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 92/201 (46%), Positives = 119/201 (59%), Gaps = 25/201 (12%)
 Frame = -3

Query  642  MAAKSGLGLEITELRLGLPGSGHGGADKGTTGEK-----KRVFSEMIDGGDDHDRsssnn  478
            M  +  L L+ TELRLGLPG+    ++K T         KR   +M +      R +S+ 
Sbjct  1    MEFERDLNLDATELRLGLPGTATKQSEKQTPNSNLAKSNKRSLPDMNEEPAGSSRENSST  60

Query  477  nnnkkKQ------------QVVGWPPVCSYRR-----KNNSDEGKKMYVKVSMDGAPFLR  349
             ++  K+            QVVGWPP+ SYR+     K    E   +YVKVSMDGAP+LR
Sbjct  61   VSSNDKKSHDQETAPPIKAQVVGWPPIRSYRKNCLQAKKLEAEAAGLYVKVSMDGAPYLR  120

Query  348  KIDLTTHKTYSHLLIALDNLFDCRGIGEALKDA--DSSEYAPIYEDKDGDWMLVGDVPWG  175
            KIDL  +K Y  LL AL+ +F  + +GE  +    + SE+ P YEDKDGDWMLVGDVPW 
Sbjct  121  KIDLKVYKGYPELLKALEEMFKSK-VGEYSEREGYNGSEHVPTYEDKDGDWMLVGDVPWD  179

Query  174  MFVESCKRLRIMKRSEAKGIG  112
            MF+ SCKRLRIMK SEA+G+G
Sbjct  180  MFINSCKRLRIMKESEARGLG  200



>ref|XP_011091109.1| PREDICTED: auxin-induced protein 22D [Sesamum indicum]
Length=194

 Score =   154 bits (390),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 93/187 (50%), Positives = 113/187 (60%), Gaps = 11/187 (6%)
 Frame = -3

Query  642  MAAKSGLGLEITELRLGLPGSGHGGADKGTTGEKKRVFSEMID----GGDDHDRsssnnn  475
            MA +S L L+ TELRLGLPG+             KR   E ++     G    +SS +  
Sbjct  6    MAHESDLNLKATELRLGLPGTDECEEMVSAAKNNKRASPESVEECGSKGTCAAKSSEHET  65

Query  474  nnkkKQQVVGWPPVCSYRRKN----NSDEGKKMYVKVSMDGAPFLRKIDLTTHKTYSHLL  307
                K Q+VGWPPV SYR+ N     ++    +YVKVSMDGAP+LRKIDL  +  Y  LL
Sbjct  66   APAPKAQIVGWPPVRSYRKNNLQPKKTESESGIYVKVSMDGAPYLRKIDLKVYNGYPELL  125

Query  306  IALDNLFDCRGIGEALKDA--DSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRIMKR  133
             AL+ +F    IGE  +      SEYAP YEDKDGD MLVGDVPW MF+ SCKRLRIMK 
Sbjct  126  KALETMFKLT-IGEYSEREGYKGSEYAPAYEDKDGDLMLVGDVPWDMFMSSCKRLRIMKG  184

Query  132  SEAKGIG  112
            SEA+G+G
Sbjct  185  SEARGLG  191



>ref|XP_011032400.1| PREDICTED: auxin-induced protein 22B-like [Populus euphratica]
Length=201

 Score =   154 bits (390),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 91/199 (46%), Positives = 113/199 (57%), Gaps = 23/199 (12%)
 Frame = -3

Query  642  MAAKSGLGLEITELRLGLPGSGHGGADKGT-----TGEKKRVFSEMIDGG----------  508
            M  +  L LE TELRLGLP +     +K T     T   KR   +M +            
Sbjct  1    MEFERDLNLEATELRLGLPSTATEQLEKQTPNSNVTKSNKRSLPDMNEDSAARRESSSVS  60

Query  507  DDHDRsssnnnnnkkKQQVVGWPPVCSYRR-----KNNSDEGKKMYVKVSMDGAPFLRKI  343
             +  +S         K QVVGWPP+ SYR+     +    E   +YVKVSMDGAP+LRKI
Sbjct  61   SNDKKSHEQETAPPSKTQVVGWPPIRSYRKNCLQARKLEAEAAGLYVKVSMDGAPYLRKI  120

Query  342  DLTTHKTYSHLLIALDNLFDCRGIGEALKDA--DSSEYAPIYEDKDGDWMLVGDVPWGMF  169
            DL  +K Y  LL  L+ +F  + +GE  +    + SEY P YEDKDGDWMLVGDVPW MF
Sbjct  121  DLKVYKGYPELLEVLEGMFKFK-VGEYSEREGYNGSEYVPTYEDKDGDWMLVGDVPWEMF  179

Query  168  VESCKRLRIMKRSEAKGIG  112
            + SCKRLRIMK SEA+G+G
Sbjct  180  INSCKRLRIMKESEARGLG  198



>ref|XP_010254225.1| PREDICTED: auxin-responsive protein IAA1-like [Nelumbo nucifera]
Length=212

 Score =   155 bits (391),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 86/190 (45%), Positives = 110/190 (58%), Gaps = 20/190 (11%)
 Frame = -3

Query  630  SGLGLEITELRLGLPGSGHGGADKGTTGEKKRVFSEMID---GGDDHDR--------sss  484
            +GL  + TEL LGLPG      +       KR FSE +D   G    +R         S 
Sbjct  16   TGLNFKETELTLGLPGEARSQTETIAKNNSKRGFSETVDLNLGSCSKNRIEDQGESEVSG  75

Query  483  nnnnnkkKQQVVGWPPVCSYRRKNNSDEGKKMYVKVSMDGAPFLRKIDLTTHKTYSHLLI  304
             +     K QVVGWPPV S+R+   +      YVKV++DGAP+LRK+DL T+ +Y  LL 
Sbjct  76   ASKPPSSKAQVVGWPPVRSFRK---NVLKSCTYVKVAVDGAPYLRKVDLETYGSYQQLLS  132

Query  303  ALDNLFDCRGIGEALKDA------DSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRI  142
            AL+ +F C  I   L ++      + +EY P YEDKDGDWMLVGDVPW MFV SCKR+R+
Sbjct  133  ALEEMFTCFTIRNVLNESKLMDPVNGTEYVPTYEDKDGDWMLVGDVPWKMFVASCKRIRL  192

Query  141  MKRSEAKGIG  112
            MK SEA G+ 
Sbjct  193  MKSSEAVGLA  202



>gb|KDP23666.1| hypothetical protein JCGZ_23499 [Jatropha curcas]
Length=204

 Score =   155 bits (391),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 97/194 (50%), Positives = 116/194 (60%), Gaps = 24/194 (12%)
 Frame = -3

Query  624  LGLEITELRLGLPG-SGHGGADKGT---TGEK--KRVFSEMIDGGDD----------HDR  493
            L L+ TELRLGLPG S     DK T   T  K  KR   +M D              + +
Sbjct  9    LHLDATELRLGLPGTSDQDQLDKQTLIPTNPKCNKRSLPDMNDENSSSRDINNSNVSNQK  68

Query  492  sssnnnnnkkKQQVVGWPPVCSYRR-----KNNSDEGKKMYVKVSMDGAPFLRKIDLTTH  328
             +        K QVVGWPP+ SYR+     K    EG  +YVKVSMDGAP+LRKIDL  +
Sbjct  69   KTDQETAPPAKAQVVGWPPIRSYRKNCFQAKKMEAEGSGIYVKVSMDGAPYLRKIDLKLY  128

Query  327  KTYSHLLIALDNLFDCRGIGEALKDA--DSSEYAPIYEDKDGDWMLVGDVPWGMFVESCK  154
            K YS LL AL+++F    +GE  +    + SEYAP YEDKDGDWMLVGDVPW MF+ SCK
Sbjct  129  KDYSELLKALEDMFKFE-VGEYSEREGYNGSEYAPTYEDKDGDWMLVGDVPWDMFINSCK  187

Query  153  RLRIMKRSEAKGIG  112
            RLRIMK SEA+G+ 
Sbjct  188  RLRIMKGSEARGLS  201



>ref|XP_011038570.1| PREDICTED: auxin-induced protein 22D-like [Populus euphratica]
Length=203

 Score =   154 bits (390),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 92/201 (46%), Positives = 120/201 (60%), Gaps = 25/201 (12%)
 Frame = -3

Query  642  MAAKSGLGLEITELRLGLPGSGHGGADKGT-----TGEKKRVFSEMIDGGDDHDRsssnn  478
            M  +  L L+ TELRLGLPG+    ++K T         KR   +M +      R +S+ 
Sbjct  1    MEFERDLNLDATELRLGLPGTATKQSEKQTPHSNLAKSNKRSLPDMNEEPAGSSRENSST  60

Query  477  nnnkkKQ------------QVVGWPPVCSYRR-----KNNSDEGKKMYVKVSMDGAPFLR  349
             ++  K+            QVVGWPP+ SYR+     K    E   +YVKVSMDGAP+LR
Sbjct  61   VSSNDKKSHDQETASPIKAQVVGWPPIRSYRKNCLQAKKLEAEAAGLYVKVSMDGAPYLR  120

Query  348  KIDLTTHKTYSHLLIALDNLFDCRGIGEALKDA--DSSEYAPIYEDKDGDWMLVGDVPWG  175
            KIDL  +K Y  LL AL+ +F  + +GE  +    + SE+ P YEDKDGDWMLVGDVPW 
Sbjct  121  KIDLKVYKGYPELLKALEEMFKSK-VGEYSEREGYNGSEHVPTYEDKDGDWMLVGDVPWD  179

Query  174  MFVESCKRLRIMKRSEAKGIG  112
            MF++SCKRLRIMK SEA+G+G
Sbjct  180  MFIDSCKRLRIMKESEARGLG  200



>ref|XP_007024033.1| AUX/IAA transcriptional regulator family protein [Theobroma cacao]
 gb|EOY26655.1| AUX/IAA transcriptional regulator family protein [Theobroma cacao]
Length=202

 Score =   154 bits (390),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 87/187 (47%), Positives = 109/187 (58%), Gaps = 17/187 (9%)
 Frame = -3

Query  630  SGLGLEITELRLGLPGSGHGGADKGTTGEKKRVFSEMID--------GGDDHDRsssnnn  475
            +GL  E TEL LGLPG     +D       KR F E +D        G    D   +  +
Sbjct  8    AGLNFEATELTLGLPGKSKVTSDGEAKSGTKRGFLETVDLNLGDKKCGQSQTDVQEAAKS  67

Query  474  nnkkKQQVVGWPPVCSYRRKNNSDEGKKMYVKVSMDGAPFLRKIDLTTHKTYSHLLIALD  295
            +   K QVVGWPPV + R KN     K  YVKV++DGAP+LRK+DL  + +Y  LL +L+
Sbjct  68   SPVSKAQVVGWPPVRALR-KNAMKSCK--YVKVAVDGAPYLRKVDLEMYNSYQQLLSSLE  124

Query  294  NLFDCRGIGEALKD------ADSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRIMKR  133
            ++F C  I   L +       +  EY P YEDKDGDWMLVGDVPW MFV+SCKRLR+MK 
Sbjct  125  DMFSCFTIRNCLNEKKIVDQVNGLEYVPTYEDKDGDWMLVGDVPWQMFVDSCKRLRLMKS  184

Query  132  SEAKGIG  112
            SEA G+ 
Sbjct  185  SEAIGLA  191



>ref|XP_009367751.1| PREDICTED: auxin-induced protein 22D-like [Pyrus x bretschneideri]
Length=173

 Score =   154 bits (388),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 84/175 (48%), Positives = 110/175 (63%), Gaps = 13/175 (7%)
 Frame = -3

Query  624  LGLEITELRLGLPGSGHGGADKGTTGE----KKRVFSEMIDGGDDHDRsssnnnnnkkKQ  457
            L  + TELRLGLPGS     +K         K    +      ++   SS+  +    K 
Sbjct  5    LNFKATELRLGLPGSSEEHENKKAATSPPIAKNNKRASPDSAAEECSTSSNLIDAPPTKT  64

Query  456  QVVGWPPVCSYRRKNNSDEGKKMYVKVSMDGAPFLRKIDLTTHKTYSHLLIALDNLFDCR  277
            QVVGWPP+ SYR+  NS + ++ YVKVS+DGAP+LRKIDL  + +Y  L+ AL+ +F+  
Sbjct  65   QVVGWPPIRSYRK--NSLQLREAYVKVSVDGAPYLRKIDLKVYNSYPELIKALEKMFN--  120

Query  276  GIGEALKDADSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRIMKRSEAKGIG  112
                 L + + S++AP YEDKDGDWMLVGDVPW MFV SCKRLRIMK SEA+G+ 
Sbjct  121  -----LANINGSDFAPTYEDKDGDWMLVGDVPWNMFVSSCKRLRIMKGSEARGLS  170



>gb|ADC29378.1| indole-3-acetic acid inducible 5 [Arabidopsis thaliana]
Length=156

 Score =   153 bits (386),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 96/175 (55%), Positives = 108/175 (62%), Gaps = 26/175 (15%)
 Frame = -3

Query  642  MAAKSG-LGLEITELRLGLPGSGHGGADKGTTGE----KKRVFSEM-IDGGDDHDRsssn  481
            MA +S  LGLEITELRLGLPG      D   +GE    KKR   E+ ID   +  +    
Sbjct  1    MANESNNLGLEITELRLGLPG------DIVVSGESISGKKRASPEVEIDLKCEPAKK---  51

Query  480  nnnnkkKQQVVGWPPVCSYRRKNNSDEGKKMYVKVSMDGAPFLRKIDLTTHKTYSHLLIA  301
                    QVVGWPPVCSYRRKN+ +  K  YVKVS+DGA FLRKIDL  +K Y  L  A
Sbjct  52   -------SQVVGWPPVCSYRRKNSLERTKSSYVKVSVDGAAFLRKIDLEMYKCYQDLASA  104

Query  300  LDNLFDCR-GIGEALKDADSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRIM  139
            L  LF C     + LK+   SE  PIYEDKDGDWML GDVPW MF+ SCKRLRIM
Sbjct  105  LQILFGCYINFDDTLKE---SECVPIYEDKDGDWMLAGDVPWEMFLGSCKRLRIM  156



>gb|KDP40273.1| hypothetical protein JCGZ_02271 [Jatropha curcas]
Length=192

 Score =   154 bits (389),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 96/193 (50%), Positives = 118/193 (61%), Gaps = 24/193 (12%)
 Frame = -3

Query  642  MAAKSGLGLEITELRLGLPGSGHGGADKGTTGEKKRV--------FSEMID-GGDDHDRs  490
            +A ++ L L+ TELRLGLPG+  G A   T   K+ +         +E ID   +D D  
Sbjct  5    VAYENDLNLKATELRLGLPGT-EGQAVSCTRNNKRPLPETREENGATEKIDTSNNDSD--  61

Query  489  ssnnnnnkkKQQVVGWPPVCSYRR-----KNNSDEGKKMYVKVSMDGAPFLRKIDLTTHK  325
                +    K Q+VGWPP+ SYR+     K    E   MYVKVSMDGAP+LRKIDL  +K
Sbjct  62   ----SPPAPKAQIVGWPPIRSYRKNSLQTKKTEAESCGMYVKVSMDGAPYLRKIDLKVYK  117

Query  324  TYSHLLIALDNLFDCRGIGEALKDA--DSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKR  151
             Y  LL AL+N+F    +GE  K      SE+ P YEDKDGDWMLVGDVPW MF+ SCKR
Sbjct  118  GYEKLLKALENMFKFT-MGEYSKREGYKGSEFVPTYEDKDGDWMLVGDVPWEMFMSSCKR  176

Query  150  LRIMKRSEAKGIG  112
            LRIMK SEA+G+G
Sbjct  177  LRIMKGSEARGLG  189



>ref|XP_004139234.1| PREDICTED: auxin-induced protein 22D-like [Cucumis sativus]
 ref|XP_004172949.1| PREDICTED: auxin-induced protein 22D-like [Cucumis sativus]
 gb|KGN60809.1| hypothetical protein Csa_2G011420 [Cucumis sativus]
Length=197

 Score =   154 bits (389),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 90/196 (46%), Positives = 118/196 (60%), Gaps = 22/196 (11%)
 Frame = -3

Query  642  MAAKSGLGLEITELRLGLPGSG---HGGADKGTTGEKKRVFSEMIDGGDDHDRsssnnnn  472
            MA +  L LE TELRLGLPG+       +    T   KR          +  R  +++ +
Sbjct  1    MAFEKDLNLEATELRLGLPGTSPDDQSNSPINRTNSNKRALPSDDQNSSESRREINSDTS  60

Query  471  nkkKQ-------QVVGWPPVCSYRRKNNSDEGKK-------MYVKVSMDGAPFLRKIDLT  334
               ++       QVVGWPPV S+R+  NS + KK       M++KVSMDGAPFLRK+DL 
Sbjct  61   KCSQENTPPTKAQVVGWPPVRSFRK--NSLQAKKKEETAAGMFIKVSMDGAPFLRKVDLK  118

Query  333  THKTYSHLLIALDNLFDCRGIGEALKDA--DSSEYAPIYEDKDGDWMLVGDVPWGMFVES  160
             ++ Y  LL AL+N+F    +G+  +    + SE+ P YEDKDGDWMLVGDVPW MF+ S
Sbjct  119  IYQGYPDLLQALENMFKF-SLGKFCEREGYNGSEFVPTYEDKDGDWMLVGDVPWEMFMSS  177

Query  159  CKRLRIMKRSEAKGIG  112
            CK+LRIMK SEAKG+G
Sbjct  178  CKKLRIMKGSEAKGLG  193



>ref|XP_007145935.1| hypothetical protein PHAVU_007G280300g [Phaseolus vulgaris]
 gb|ESW17929.1| hypothetical protein PHAVU_007G280300g [Phaseolus vulgaris]
Length=192

 Score =   154 bits (389),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 93/191 (49%), Positives = 114/191 (60%), Gaps = 16/191 (8%)
 Frame = -3

Query  642  MAAKSGLGLEITELRLGLPGSGHGGADKG-----TTGEKKRVFSEM------IDGGDDHD  496
            M  +S L L+ TELRLGLPG+     DK           KR   E       I     H 
Sbjct  1    MVFESDLNLKATELRLGLPGTEEK-EDKNLHAHVVVRNNKRQVRETSQDSVSISKASHHQ  59

Query  495  RsssnnnnnkkKQQVVGWPPVCSYRRKNNSD-EGKKMYVKVSMDGAPFLRKIDLTTHKTY  319
            +     +    K ++VGWPP+ SYR+ +  + EG  +YVKVSMDGAP+LRKIDL  ++ Y
Sbjct  60   QRVDTLSAPPPKAKIVGWPPIRSYRKNSVQEGEGDGIYVKVSMDGAPYLRKIDLKVYRGY  119

Query  318  SHLLIALDNLFDCRGIGEALKDA--DSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLR  145
              LL AL+ +F    IG+  +      SEYAP YEDKDGDWMLVGDVPW MFV SCKRLR
Sbjct  120  PELLKALETMFKL-AIGDYSEREGYKGSEYAPTYEDKDGDWMLVGDVPWDMFVISCKRLR  178

Query  144  IMKRSEAKGIG  112
            IMK SEA+G+G
Sbjct  179  IMKGSEARGLG  189



>ref|XP_006443922.1| hypothetical protein CICLE_v10022370mg [Citrus clementina]
 ref|XP_006479599.1| PREDICTED: auxin-induced protein 22D-like [Citrus sinensis]
 gb|ESR57162.1| hypothetical protein CICLE_v10022370mg [Citrus clementina]
Length=194

 Score =   154 bits (389),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 90/188 (48%), Positives = 111/188 (59%), Gaps = 26/188 (14%)
 Frame = -3

Query  618  LEITELRLGLPGSGHGGADKGTTGEKKRVFSEM----------IDGGDDHDRsssnnnnn  469
            L+ TELRLGLPGS             KR  SE+           + GDD +R S+     
Sbjct  12   LKATELRLGLPGSDKPSV---RANNNKRASSEISQESKSNSCAFNAGDDDERDSAPPAKA  68

Query  468  kkKQQVVGWPPVCSYRRK--------NNSDEGKKMYVKVSMDGAPFLRKIDLTTHKTYSH  313
                QVVGWPP+ SYR+         + S+  + MYVKVSMDGAP+LRKIDL  +  Y  
Sbjct  69   ----QVVGWPPIRSYRKNTLQVQAKTSESELCRGMYVKVSMDGAPYLRKIDLKVYTCYPE  124

Query  312  LLIALDNLFDCR-GIGEALKDADSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRIMK  136
            LL AL+N+F    G     +  + S+YAP YEDKDGDWMLVGDVPW MF+ +CKRLRIM+
Sbjct  125  LLNALENMFQLTIGKYSEREGYNGSDYAPTYEDKDGDWMLVGDVPWDMFITTCKRLRIMR  184

Query  135  RSEAKGIG  112
             SEAKG+ 
Sbjct  185  GSEAKGLA  192



>ref|XP_011073484.1| PREDICTED: auxin-induced protein 22B-like [Sesamum indicum]
Length=190

 Score =   154 bits (388),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 91/183 (50%), Positives = 112/183 (61%), Gaps = 6/183 (3%)
 Frame = -3

Query  642  MAAKSGLGLEITELRLGLPGSGHGGADKGTTGEKKRVFSEMI-DGGDDHDRsssnnnnnk  466
            M+  S L L+ TELRLGLPG+      +      KR   E   D G    +S  + N   
Sbjct  5    MSHASDLNLKATELRLGLPGTDERDDVESVARNNKRALPESANDSGSKGGKSIDHENAPA  64

Query  465  kKQQVVGWPPVCSYRRKN----NSDEGKKMYVKVSMDGAPFLRKIDLTTHKTYSHLLIAL  298
             K Q+VGWPPV SYR+ N     ++    MYVKVSMDGAP+LRKIDL+ +  Y+ LL AL
Sbjct  65   PKAQIVGWPPVRSYRKNNLEAKKTETETGMYVKVSMDGAPYLRKIDLSIYNGYAELLKAL  124

Query  297  DNLFDCR-GIGEALKDADSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRIMKRSEAK  121
            +++F    G     +    SEYAP YEDKDGD MLVGDVPW MF+ SCKRLRIMK S+A 
Sbjct  125  ESMFKLTIGDYSEREGYKGSEYAPAYEDKDGDLMLVGDVPWDMFMSSCKRLRIMKGSDAS  184

Query  120  GIG  112
            G+G
Sbjct  185  GLG  187



>ref|XP_009776001.1| PREDICTED: auxin-responsive protein IAA4-like [Nicotiana sylvestris]
Length=179

 Score =   153 bits (387),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 93/183 (51%), Positives = 115/183 (63%), Gaps = 17/183 (9%)
 Frame = -3

Query  642  MAAKSGLGLEITELRLGLPGSGHGGADKGTTGEKKRVFSEMIDGGDDHDRsssnnnnnkk  463
            MA +  L L+ TELRLGLPG+     D+      K     + +  ++ D         KK
Sbjct  5    MAHEKDLNLKATELRLGLPGT----EDESIVSSSKNNKRGLPESAEEED------CEPKK  54

Query  462  KQQVVGWPPVCSYRRKNNSDEGKK----MYVKVSMDGAPFLRKIDLTTHKTYSHLLIALD  295
            K Q+VGWPPV SYR+ N   +  +    MYVKVSMDGAP+LRKIDL  +K YS LL AL+
Sbjct  55   KTQIVGWPPVRSYRKNNIQPKKTETECGMYVKVSMDGAPYLRKIDLEMYKGYSELLKALE  114

Query  294  NLFDCRGIGEALKDA--DSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRIMKRSEAK  121
            N+F    IGE  +      SE+AP YEDKDGD MLVGDVPW MF+ SCKRLRIMK +EA+
Sbjct  115  NMFKL-NIGEYSEREGYKGSEFAPAYEDKDGDLMLVGDVPWDMFLSSCKRLRIMKGAEAR  173

Query  120  GIG  112
            G+G
Sbjct  174  GLG  176



>gb|AGM20676.1| IAA4 [Populus tomentosa]
Length=278

 Score =   156 bits (395),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 91/199 (46%), Positives = 114/199 (57%), Gaps = 23/199 (12%)
 Frame = -3

Query  642  MAAKSGLGLEITELRLGLPGSGHGGADKGT-----TGEKKRVFSEMIDGG----------  508
            M  +  L LE TELRLGLPG+     +K T     T   KR   +M +            
Sbjct  78   MEFERDLNLEATELRLGLPGTATEQLEKQTPNSNVTKSNKRSLPDMNEDSAGRRESSSVS  137

Query  507  DDHDRsssnnnnnkkKQQVVGWPPVCSYRR-----KNNSDEGKKMYVKVSMDGAPFLRKI  343
             +  +S         K QVVGWPP+ SYR+     +    E   +YVKVSMDGAP+LRKI
Sbjct  138  SNDKKSHEQETAPPTKTQVVGWPPIRSYRKNCLQARKLEAEAAGLYVKVSMDGAPYLRKI  197

Query  342  DLTTHKTYSHLLIALDNLFDCRGIGEALKDA--DSSEYAPIYEDKDGDWMLVGDVPWGMF  169
            DL  +K Y  LL  ++ +F  + +GE  +    + SEY P YEDKDGDWMLVGDVPW MF
Sbjct  198  DLKVYKGYPELLEVVEEMFKFK-VGEPSEREGYNGSEYVPTYEDKDGDWMLVGDVPWEMF  256

Query  168  VESCKRLRIMKRSEAKGIG  112
            + SCKRLRIMK SEA+G+G
Sbjct  257  INSCKRLRIMKESEARGLG  275



>gb|KDP21371.1| hypothetical protein JCGZ_21842 [Jatropha curcas]
Length=197

 Score =   154 bits (389),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 96/201 (48%), Positives = 114/201 (57%), Gaps = 32/201 (16%)
 Frame = -3

Query  642  MAAKSGLGLEITELRLGLPGSGHGG------------------ADKGTTGEKKRVFSEMI  517
            MA +  L L+ TELRLGLPGS                      +++  T       S   
Sbjct  1    MAYEGDLHLKATELRLGLPGSDESDKKQSIPCVRSNKRASPEISEESRTRSNGSSVSNCE  60

Query  516  DGGDDHDRsssnnnnnkkKQQVVGWPPVCSYRR-----KNNSDEGKKMYVKVSMDGAPFL  352
             G DD D           K QVVGWPP+ SYR+     K N  EG  MYVKVS+DGAP+L
Sbjct  61   SGSDDRD------CGPPAKAQVVGWPPIRSYRKNCFQAKRNEGEGGCMYVKVSVDGAPYL  114

Query  351  RKIDLTTHKTYSHLLIALDNLFDCRGIGEALKDA--DSSEYAPIYEDKDGDWMLVGDVPW  178
            RKIDL  +K+Y  LL AL+N+F    IGE  +    + S YAP YEDKDGDWMLVGDVPW
Sbjct  115  RKIDLKMYKSYPELLKALENMFKLT-IGEYSEREGYNGSNYAPTYEDKDGDWMLVGDVPW  173

Query  177  GMFVESCKRLRIMKRSEAKGI  115
             MF+ SCKRLRIM+ SEA G+
Sbjct  174  EMFICSCKRLRIMRGSEATGL  194



>gb|ACJ85999.1| unknown [Medicago truncatula]
Length=204

 Score =   154 bits (389),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 92/187 (49%), Positives = 117/187 (63%), Gaps = 21/187 (11%)
 Frame = -3

Query  609  TELRLGLPGSG-----HGGA----DKGTTGEKKRVFSEMID--GGDDH-----DRsssnn  478
            TELRLGLPGS      +GG+    +K +   +  V  E I    GD +     DR    +
Sbjct  16   TELRLGLPGSDDEQSCNGGSIVRSNKRSFSPETSVEEESISKSSGDSNSTTTSDRDHDQD  75

Query  477  nnnkkKQQVVGWPPVCSY----RRKNNSDEGKKMYVKVSMDGAPFLRKIDLTTHKTYSHL  310
            +    K QVVGWPP+ S+     ++N  ++G  MYVKVSM GAP+LRKIDL  +K+YS L
Sbjct  76   SVQPTKVQVVGWPPIRSFWKNSLQQNKVEDGNGMYVKVSMAGAPYLRKIDLKVYKSYSEL  135

Query  309  LIALDNLFDCR-GIGEALKDADSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRIMKR  133
            L  L+N+F C  G     +  + SEYAP YEDKDGDWMLVGDVPW MF+ SCKRL+I+K 
Sbjct  136  LKVLENMFKCTFGEYSEREGYNGSEYAPTYEDKDGDWMLVGDVPWNMFISSCKRLKIVKG  195

Query  132  SEAKGIG  112
            SEAKG+ 
Sbjct  196  SEAKGLA  202



>ref|XP_003590532.1| Auxin-induced protein [Medicago truncatula]
 gb|ACJ86030.1| unknown [Medicago truncatula]
 gb|AES60783.1| auxin-responsive AUX/IAA family protein [Medicago truncatula]
 gb|AFK44378.1| unknown [Medicago truncatula]
Length=204

 Score =   154 bits (389),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 95/197 (48%), Positives = 116/197 (59%), Gaps = 26/197 (13%)
 Frame = -3

Query  633  KSGLGLEITELRLGLPGSGHG---GADKGTTGEKKRVFSEMID-------------GGDD  502
            ++ + L+ TELRLGLPGS        +       KR   E                 G  
Sbjct  9    QTEMNLKATELRLGLPGSDEVEKLPCNFSVLRNNKRSSPEEASDVDSISKSKLNSSNGSS  68

Query  501  HDRsssnnnnnkkKQQVVGWPPVCSYRRKNNSDEGKK-----MYVKVSMDGAPFLRKIDL  337
            H  +   +N    K QVVGWPP+ SYR+  NS + KK     MY+KVSM GAP+LRKIDL
Sbjct  69   HTTNDDQDNAPPSKAQVVGWPPIRSYRK--NSLQQKKGEEVGMYLKVSMAGAPYLRKIDL  126

Query  336  TTHKTYSHLLIALDNLFDCRGIGEALKDA--DSSEYAPIYEDKDGDWMLVGDVPWGMFVE  163
              +K+YS LL  L+N+F C  IGE  +    + SE+ P YEDKDGDWMLVGDVPW MF+ 
Sbjct  127  KVYKSYSELLKVLENMFKCT-IGEYSEREGYNGSEFVPTYEDKDGDWMLVGDVPWEMFMS  185

Query  162  SCKRLRIMKRSEAKGIG  112
            SCKRLRIMK SEAKG+G
Sbjct  186  SCKRLRIMKGSEAKGLG  202



>ref|NP_001288048.1| uncharacterized protein LOC103445716 [Malus domestica]
 gb|AGP04987.1| Aux/IAA [Malus domestica]
Length=173

 Score =   153 bits (387),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 84/175 (48%), Positives = 109/175 (62%), Gaps = 13/175 (7%)
 Frame = -3

Query  624  LGLEITELRLGLPGSGHGGADKGTTGE----KKRVFSEMIDGGDDHDRsssnnnnnkkKQ  457
            L  + TELRLGLPGS     +K         K    +      ++   SS   +    K 
Sbjct  5    LNFKATELRLGLPGSSEEPENKKAAPSPPMAKNNKRASPDSAAEECSTSSDPIDVPPTKT  64

Query  456  QVVGWPPVCSYRRKNNSDEGKKMYVKVSMDGAPFLRKIDLTTHKTYSHLLIALDNLFDCR  277
            QVVGWPP+ SYR+  NS + ++ YVKVS+DGAP+LRKIDL  + +Y  L+ AL+ +F+  
Sbjct  65   QVVGWPPIRSYRK--NSLQLREAYVKVSVDGAPYLRKIDLKVYNSYPELIKALEKMFN--  120

Query  276  GIGEALKDADSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRIMKRSEAKGIG  112
                 L + + S++AP YEDKDGDWMLVGDVPW MFV SCKRLRIMK SEA+G+ 
Sbjct  121  -----LANINGSDFAPTYEDKDGDWMLVGDVPWNMFVSSCKRLRIMKGSEARGLS  170



>gb|AAM21317.1|AF373100_1 auxin-regulated protein [Populus tremula x Populus tremuloides]
Length=249

 Score =   155 bits (392),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 100/228 (44%), Positives = 121/228 (53%), Gaps = 52/228 (23%)
 Frame = -3

Query  630  SGLGLEITELRLGLPGSGHGGAD-KGTTGEKKRVFSEMID------------GGDDHDRs  490
            S +  E TELRLGLPG    G D +      KR FSE +D             G D ++ 
Sbjct  14   SMMNFEETELRLGLPGGVSNGNDSEAAKSNGKRGFSETVDLKLNLSTKETGKDGSDQEKV  73

Query  489  ssnnnnnk----------kKQQVVGWPPVCSYRR------KNNSDEGKKM---------Y  385
                               K QVVGWPP+ S+R+      KN++DEG+K          +
Sbjct  74   VMKEKTVAPRPNDPAKPPSKAQVVGWPPIRSFRKNVMAVQKNSNDEGEKASSSGATGAAF  133

Query  384  VKVSMDGAPFLRKIDLTTHKTYSHLLIALDNLFDCRGIG----EALKD----------AD  247
            VKVSMDGAP+LRK+DL  +K+Y  L  AL  +F    IG    +  KD           +
Sbjct  134  VKVSMDGAPYLRKVDLKLYKSYRELSDALGKMFSSFTIGNCGSQGTKDFMNESKLIDLLN  193

Query  246  SSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRIMKRSEAKGIGLHA  103
            SSEY P YEDKDGDWMLVGDVPWGMFV+SCKRLRIMK SEA G+   A
Sbjct  194  SSEYVPTYEDKDGDWMLVGDVPWGMFVDSCKRLRIMKGSEAIGLAPRA  241



>ref|XP_008786091.1| PREDICTED: auxin-induced protein 22D-like [Phoenix dactylifera]
Length=196

 Score =   154 bits (388),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 90/196 (46%), Positives = 117/196 (60%), Gaps = 22/196 (11%)
 Frame = -3

Query  648  IDMAAKSGLGLEITELRLGLPGSGHGGADKGTTGEKKRVFSEMIDGGDDHDR--------  493
            +++AA     L+ TELRLGLPGS     +K      +     +++  ++H          
Sbjct  1    MEVAASDLDNLKATELRLGLPGSD--ALEKPAPASPRGSKRALLEANEEHRPGKSKSLEA  58

Query  492  -sssnnnnnkkKQQVVGWPPVCSYRRKNNSDEGKK-------MYVKVSMDGAPFLRKIDL  337
             S         K QVVGWPP+ SYR+  NS + +K       ++VKVSMDGAP+LRKIDL
Sbjct  59   DSRDQEAQPVAKAQVVGWPPIRSYRK--NSFQARKAEVEAAGLFVKVSMDGAPYLRKIDL  116

Query  336  TTHKTYSHLLIALDNLFDCRGIGE--ALKDADSSEYAPIYEDKDGDWMLVGDVPWGMFVE  163
              +K Y  L  ALDN+F C  IGE   ++  +  EYA  YEDKDGDWMLVGDVPW MF+ 
Sbjct  117  KLYKGYEELREALDNMFRCFSIGELSGMEGCNGPEYAITYEDKDGDWMLVGDVPWEMFIS  176

Query  162  SCKRLRIMKRSEAKGI  115
            SCKRLRIMK +EA+G+
Sbjct  177  SCKRLRIMKGAEARGM  192



>ref|XP_004495146.1| PREDICTED: auxin-induced protein 22D-like isoform X2 [Cicer arietinum]
Length=199

 Score =   153 bits (387),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 93/188 (49%), Positives = 117/188 (62%), Gaps = 19/188 (10%)
 Frame = -3

Query  624  LGLEITELRLGLPG--------SGHG--GADKGTTGEKKRVFS-EMIDGGDDHDRsssnn  478
            +  + TELRLGLPG        S +    ++K ++ E   V S    +    +      +
Sbjct  12   MNFKATELRLGLPGVDEMEKVPSNYSVLRSNKRSSPETSEVESINKTNLNTSNTICHDQD  71

Query  477  nnnkkKQQVVGWPPVCSYRRKNNSDEGKK-----MYVKVSMDGAPFLRKIDLTTHKTYSH  313
            N    K QVVGWPP+ SYR+  NS + KK     MYVKVSM GAP+LRKIDL  +K+YS 
Sbjct  72   NAPPSKAQVVGWPPIRSYRK--NSLQQKKGEEVGMYVKVSMAGAPYLRKIDLKVYKSYSE  129

Query  312  LLIALDNLFDCR-GIGEALKDADSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRIMK  136
            LL AL+N+F C  G     +  + SE+AP YEDKDGDWMLVGDVPW MF+ SCKRLR+MK
Sbjct  130  LLKALENMFKCTFGEYSEREGYNGSEFAPTYEDKDGDWMLVGDVPWEMFMSSCKRLRVMK  189

Query  135  RSEAKGIG  112
             SEAKG+G
Sbjct  190  GSEAKGLG  197



>gb|KHG05201.1| Auxin-induced 22D [Gossypium arboreum]
Length=183

 Score =   152 bits (385),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 89/186 (48%), Positives = 114/186 (61%), Gaps = 15/186 (8%)
 Frame = -3

Query  642  MAAKSGLGLEITELRLGLPGSGHGGADKGTTGEKKRVFSEMID-GGDDHDRsssnnnnnk  466
            M  +  L L+ TELRLGLPGS    +++      KR   +M D  G    +         
Sbjct  1    MVFEKDLNLDATELRLGLPGS----SEESLRISNKRALPDMNDDSGVAAAKKCDQETAPP  56

Query  465  kKQQVVGWPPVCSYRRKNNSDEGKK-------MYVKVSMDGAPFLRKIDLTTHKTYSHLL  307
             K QVVGWPP+ SYR+  NS + KK       MYVKVSMDGAP+LRKIDL  +K Y  L 
Sbjct  57   TKAQVVGWPPIRSYRK--NSLQTKKIEAETSGMYVKVSMDGAPYLRKIDLKVYKGYPELF  114

Query  306  IALDNLFDCR-GIGEALKDADSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRIMKRS  130
             AL+++F  + G     +  + SE+ P YEDKDGDWMLVGDVPW MF+ +CKRLRI++ S
Sbjct  115  KALEDMFKFKVGKYSEREGYNGSEFVPTYEDKDGDWMLVGDVPWEMFINACKRLRIVRGS  174

Query  129  EAKGIG  112
            EA+G+G
Sbjct  175  EARGLG  180



>ref|XP_011026048.1| PREDICTED: auxin-induced protein AUX28-like [Populus euphratica]
Length=237

 Score =   154 bits (389),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 103/232 (44%), Positives = 129/232 (56%), Gaps = 55/232 (24%)
 Frame = -3

Query  624  LGLEITELRLGLPGSGHGGADKGTTGE--KKRVFSEMID-----------GGDDHDRsss  484
            +G E TELRLGLPG+G GGA+    GE  +KR FSE +D            G +H+++ S
Sbjct  9    MGFEETELRLGLPGNG-GGAE----GEMVRKRGFSETVDLKLKLSSKERGAGPNHEKTRS  63

Query  483  nnnnnk----------kKQQVVGWPPVCSYRR------KNNSDE-------GKKMYVKVS  373
                             K QVVGWPPV S+R+      K+++D+       G   +VKVS
Sbjct  64   LQREKNILATDPAKPPAKAQVVGWPPVRSFRKNMLAVQKSSTDQECEKVPGGNATFVKVS  123

Query  372  MDGAPFLRKIDLTTHKTYSHLLIALDNLFDCRGIGEA----LKD----------ADSSEY  235
            MDGAP+LRK+DL  +KTY  L  AL+ +F    IG      LKD           + ++Y
Sbjct  124  MDGAPYLRKVDLKMYKTYQELSGALEEMFSSFTIGNCGSHGLKDFLNESKLIDLLNGTDY  183

Query  234  APIYEDKDGDWMLVGDVPWGMFVESCKRLRIMKRSEAKGIGLHAKNFLKEMS  79
             P YEDKDGDWMLVGDVPW MFVESCKRLRIMK +EA G+   A    K  S
Sbjct  184  VPTYEDKDGDWMLVGDVPWDMFVESCKRLRIMKGTEATGLAPRAMEKCKNRS  235



>ref|XP_006392862.1| hypothetical protein EUTSA_v10012354mg [Eutrema salsugineum]
 gb|ESQ30148.1| hypothetical protein EUTSA_v10012354mg [Eutrema salsugineum]
Length=159

 Score =   152 bits (383),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 93/180 (52%), Positives = 104/180 (58%), Gaps = 31/180 (17%)
 Frame = -3

Query  636  AKSGLGLEITELRLGLPGSGHGGADKGTTGEKKRVFSEMIDGGDDHDRsssnnnnnkkKQ  457
            AK GLGLEITELRLGLPG  +   ++   G    V    I   +  D     +     K 
Sbjct  2    AKEGLGLEITELRLGLPGDNN--CERLVCGSNSIVSLVDIVAAEVED-----DIRPTAKS  54

Query  456  QVVGWPPVCSYR-RKNNSDEGKKM--YVKVSMDGAPFLRKIDLTTHKTYSHLLIALDNLF  286
            QVVGWPPVCSYR  KNNS E  K   YVKV MDG P+LRKIDL                 
Sbjct  55   QVVGWPPVCSYRINKNNSKEVSKAKGYVKVRMDGVPYLRKIDLRVL--------------  100

Query  285  DCRGIGEALKDADSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRIMKRSEAKGIGLH  106
                   ALK+ +  EY  IYEDKDGDWMLVGDVPW MF ESCKRLRI+KRS+A G+GL 
Sbjct  101  -------ALKECEKFEYVIIYEDKDGDWMLVGDVPWQMFKESCKRLRIVKRSDATGLGLQ  153



>ref|XP_011026050.1| PREDICTED: auxin-induced protein 22D-like [Populus euphratica]
Length=199

 Score =   153 bits (386),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 95/195 (49%), Positives = 120/195 (62%), Gaps = 19/195 (10%)
 Frame = -3

Query  642  MAAKSGLGLEITELRLGLPGSGHGGADKGTTG--EKKRVFSEMIDGGDDHDRsssnnnnn  469
            MA +  L L+ TELRLGLPGS        T      KR   E+ +       SS ++N  
Sbjct  5    MAYERHLNLKATELRLGLPGSDEPEKPSTTPSFRSNKRASPEISEESRSKGSSSLSSNVE  64

Query  468  k--------kKQQVVGWPPVCSYRR------KNNSDEGKKMYVKVSMDGAPFLRKIDLTT  331
                      K QVVGWPP+ SYR+      KN+  +G  MYVKVS+DGAP+LRKIDL  
Sbjct  65   NCEGDGAPPAKAQVVGWPPIRSYRKNCLQPKKNDRVDGAGMYVKVSVDGAPYLRKIDLKV  124

Query  330  HKTYSHLLIALDNLFDCRGIGEALKDA--DSSEYAPIYEDKDGDWMLVGDVPWGMFVESC  157
            +K+Y  LL AL+++F    IGE  +    + S++AP YEDKDGDWMLVGDVPW MF+ +C
Sbjct  125  YKSYPELLKALEDMFKL-TIGEYSEKEGYNESDFAPTYEDKDGDWMLVGDVPWDMFISTC  183

Query  156  KRLRIMKRSEAKGIG  112
            KRLRIMK SEA+G+G
Sbjct  184  KRLRIMKGSEARGLG  198



>ref|XP_010532598.1| PREDICTED: auxin-responsive protein IAA1 [Tarenaya hassleriana]
Length=183

 Score =   152 bits (385),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 92/181 (51%), Positives = 111/181 (61%), Gaps = 15/181 (8%)
 Frame = -3

Query  630  SGLGLEITELRLGLPGSGHGGA-DKGTTGEKKRVFSEMIDGGDDHDRsssnnnnnkkKQQ  454
            +GL L+ TELRLGLPG+      D       KR F       DD D++  +    K   Q
Sbjct  7    NGLNLKDTELRLGLPGTDENRERDVSCFTSNKRQFQ----SKDDQDQNQESAPPTKT--Q  60

Query  453  VVGWPPVCSYRRKN-----NSDEGKKMYVKVSMDGAPFLRKIDLTTHKTYSHLLIALDNL  289
            +VGWPPV SYR+ N     N +    +YVKVSMDGAP+LRKIDL  +K Y  LL AL+++
Sbjct  61   IVGWPPVRSYRKNNVQVRKNEEIHAGIYVKVSMDGAPYLRKIDLKMYKNYPDLLAALEDM  120

Query  288  FDCRGIGEALKDA--DSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRIMKRSEAKGI  115
            F    IGE  +      S + P YEDKDGDWMLVGDVPW MF  SCKRLRIMK SEA+G+
Sbjct  121  FKF-TIGEYSEREGYKGSGFVPTYEDKDGDWMLVGDVPWDMFSSSCKRLRIMKGSEARGL  179

Query  114  G  112
            G
Sbjct  180  G  180



>gb|AFZ78612.1| hypothetical protein [Populus tomentosa]
Length=204

 Score =   153 bits (386),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 89/202 (44%), Positives = 119/202 (59%), Gaps = 26/202 (13%)
 Frame = -3

Query  642  MAAKSGLGLEITELRLGLPGSGHGGADKGTTG-----EKKRVFSEMIDGGDDHDRsssnn  478
            M  +  L L+ TELRLGLPG+    ++K T         KR   +M +      R +S+ 
Sbjct  1    MEFERDLNLDATELRLGLPGTATKQSEKQTPNSNLAKSNKRSLPDMNEEPAGSSRENSST  60

Query  477  nnnkkKQ-------------QVVGWPPVCSYRR-----KNNSDEGKKMYVKVSMDGAPFL  352
             ++ +++             QVVGWPP+ SYR+     +    E   +YVKVSMDGAP+L
Sbjct  61   VSSNEEKSHDQETAPPPIKAQVVGWPPIRSYRKNCLQARKLEAEAAGLYVKVSMDGAPYL  120

Query  351  RKIDLTTHKTYSHLLIALDNLFDCRGIGEALKDA--DSSEYAPIYEDKDGDWMLVGDVPW  178
            RKIDL  +K Y  LL  ++ +F  + +GE  +    + SEY P YEDKDGDWMLVGDVPW
Sbjct  121  RKIDLKVYKGYPELLEVVEEMFKFK-VGEYSEREGYNGSEYVPTYEDKDGDWMLVGDVPW  179

Query  177  GMFVESCKRLRIMKRSEAKGIG  112
             MF+ SCKRLRIMK SEA+G+G
Sbjct  180  EMFINSCKRLRIMKESEARGLG  201



>emb|CBI36191.3| unnamed protein product [Vitis vinifera]
Length=101

 Score =   150 bits (378),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 72/99 (73%), Positives = 81/99 (82%), Gaps = 1/99 (1%)
 Frame = -3

Query  372  MDGAPFLRKIDLTTHKTYSHLLIALDNLFDCRGIGEALKDADSSEYAPIYEDKDGDWMLV  193
            MDGAPFLRKIDL++H+ Y +L+ A + LF C GIGEALKDADSSEY PIYEDKDGDWMLV
Sbjct  1    MDGAPFLRKIDLSSHQGYFNLVTAFEELFGCFGIGEALKDADSSEYIPIYEDKDGDWMLV  60

Query  192  GDVPWGMFVESCKRLRIMKRSEAKGIGLHAKNFLKEMSK  76
            GDVPW MF+ESCKRLRI K+SE K  GL   N LKE+ K
Sbjct  61   GDVPWEMFIESCKRLRIKKKSETKNFGLQL-NSLKELQK  98



>gb|ACJ86152.1| unknown [Medicago truncatula]
Length=204

 Score =   153 bits (386),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 95/197 (48%), Positives = 115/197 (58%), Gaps = 26/197 (13%)
 Frame = -3

Query  633  KSGLGLEITELRLGLPGSGHG---GADKGTTGEKKRVFSEMID-------------GGDD  502
            ++ + L+ TELRLGLPGS        +       KR   E                 G  
Sbjct  9    QTEMNLKATELRLGLPGSDEVEKLPCNFSVLRNNKRSSPEEASDVDSISKSKLNSSNGSS  68

Query  501  HDRsssnnnnnkkKQQVVGWPPVCSYRRKNNSDEGKK-----MYVKVSMDGAPFLRKIDL  337
            H  +   +N    K QVVGWPP+ SYR+  NS + KK     MY KVSM GAP+LRKIDL
Sbjct  69   HTTNDDQDNAPPSKAQVVGWPPIRSYRK--NSLQQKKGEEVGMYSKVSMAGAPYLRKIDL  126

Query  336  TTHKTYSHLLIALDNLFDCRGIGEALKDA--DSSEYAPIYEDKDGDWMLVGDVPWGMFVE  163
              +K+YS LL  L+N+F C  IGE  +    + SE+ P YEDKDGDWMLVGDVPW MF+ 
Sbjct  127  KVYKSYSELLKVLENMFKCT-IGEYSEREGYNGSEFVPTYEDKDGDWMLVGDVPWEMFMS  185

Query  162  SCKRLRIMKRSEAKGIG  112
            SCKRLRIMK SEAKG+G
Sbjct  186  SCKRLRIMKGSEAKGLG  202



>ref|XP_004302056.1| PREDICTED: auxin-responsive protein IAA4-like [Fragaria vesca 
subsp. vesca]
Length=181

 Score =   152 bits (384),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 90/182 (49%), Positives = 110/182 (60%), Gaps = 22/182 (12%)
 Frame = -3

Query  624  LGLEITELRLGLPGSGHGGADKGTTGEKKRVFSEMIDGGDDHDRsssnnnnnkkKQQVVG  445
            L LE TELRLGLPG+     ++  T  K+ +  E         +   +        QVVG
Sbjct  8    LNLEATELRLGLPGTKE--TEQQKTNNKRALPVEHESNASSAPKPPPSKA------QVVG  59

Query  444  WPPVCSYRRKNNSDEGKK-------MYVKVSMDGAPFLRKIDLTTHKTYSHLLIALDNLF  286
            WPPV SYR+  N  E KK       M+VKVSMDGAP+LRK+DL  +K Y  LL AL+ +F
Sbjct  60   WPPVKSYRK--NCFEAKKTEGESGGMFVKVSMDGAPYLRKMDLKVYKGYPELLKALEEMF  117

Query  285  DCRGIGE----ALKDADSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRIMKRSEAKG  118
              + +GE     L   + SE+ P YEDKDGDWML+GDVPW MF  SCKRLRIMK SEAKG
Sbjct  118  KFK-VGEYCEKELGYNNRSEFVPTYEDKDGDWMLLGDVPWEMFFTSCKRLRIMKGSEAKG  176

Query  117  IG  112
            +G
Sbjct  177  LG  178



>gb|AAQ74955.1| Gbiaa-Re [Gossypium barbadense]
Length=190

 Score =   152 bits (385),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 90/186 (48%), Positives = 110/186 (59%), Gaps = 24/186 (13%)
 Frame = -3

Query  624  LGLEITELRLGLPGSGHGGADKGTTGEKKRVFSEMIDG--------GDDHDRsssnnnnn  469
            L L  TELRLGLPG+             KR   ++ D          DD + ++      
Sbjct  11   LNLRATELRLGLPGT----EPVSIVRSNKRSLQQVADDDCGVNGCRSDDQNETAPPPPKA  66

Query  468  kkKQQVVGWPPVCSYRRKN-----NSDEGKKMYVKVSMDGAPFLRKIDLTTHKTYSHLLI  304
                Q+VGWPP+ SYR+ N     N  EG  +YVKVSMDGAP+LRKIDL  +  Y  LL 
Sbjct  67   ----QIVGWPPIRSYRKNNIQTKKNESEGGGIYVKVSMDGAPYLRKIDLKIYSGYPELLQ  122

Query  303  ALDNLFDCRGIGE--ALKDADSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRIMKRS  130
            A++N+F    IGE    +    S+YAP YEDKDGDWMLVGDVPW MF+ SCKRLRIMK S
Sbjct  123  AIENMFKFT-IGEYSEREGYKGSDYAPTYEDKDGDWMLVGDVPWEMFITSCKRLRIMKGS  181

Query  129  EAKGIG  112
            EA+G+G
Sbjct  182  EARGLG  187



>sp|O24543.1|AX22E_VIGRR RecName: Full=Auxin-induced protein 22E; AltName: Full=Indole-3-acetic 
acid-induced protein ARG14 [Vigna radiata var. radiata]
 dbj|BAA20849.1| Aux22e [Vigna radiata]
Length=203

 Score =   153 bits (386),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 93/194 (48%), Positives = 111/194 (57%), Gaps = 23/194 (12%)
 Frame = -3

Query  624  LGLEITELRLGLPGSGHGGADKGTTGEKKRVFSEMIDGGDDHDRsssnn-----------  478
            L L  TELRLGLPGS      +  +G   R  ++      +  R  SN            
Sbjct  8    LNLRATELRLGLPGSDEPQEKRPCSGSVVRSSNKRSSPELEESRCKSNINSDSSDSTTTS  67

Query  477  -----nnnkkKQQVVGWPPVCSYRR------KNNSDEGKKMYVKVSMDGAPFLRKIDLTT  331
                 +    K QVVGWPP+ S+R+      K    +G  MY+KVSM GAP+LRKIDL  
Sbjct  68   DHNEDSVQPAKVQVVGWPPIRSFRKNSLQQKKVEQGDGTGMYLKVSMAGAPYLRKIDLKV  127

Query  330  HKTYSHLLIALDNLFDCR-GIGEALKDADSSEYAPIYEDKDGDWMLVGDVPWGMFVESCK  154
            +K+Y  LL AL NLF C  G     +  + SEYAP YEDKDGDWMLVGDVPW MFV SCK
Sbjct  128  YKSYPELLKALQNLFKCTFGEYSEREGYNGSEYAPTYEDKDGDWMLVGDVPWNMFVSSCK  187

Query  153  RLRIMKRSEAKGIG  112
            RLRI+K SEAKG+G
Sbjct  188  RLRIIKGSEAKGLG  201



>ref|XP_010033899.1| PREDICTED: auxin-responsive protein IAA1 [Eucalyptus grandis]
 gb|KCW53763.1| hypothetical protein EUGRSUZ_J03016 [Eucalyptus grandis]
Length=215

 Score =   153 bits (386),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 92/192 (48%), Positives = 110/192 (57%), Gaps = 33/192 (17%)
 Frame = -3

Query  615  EITELRLGLPGSGHGGADKGTTGEKKRVFSEMID------GGDDH------------DRs  490
            EITELRLGLPG   G +  GT    KR FS+ +D      G DD             D  
Sbjct  22   EITELRLGLPGENRGKS--GT----KRGFSKTVDLDASAVGRDDEANNSPVGGARVKDEV  75

Query  489  ssnnnnnkkKQQVVGWPPVCSYRRKNNSDEGKKMYVKVSMDGAPFLRKIDLTTHKTYSHL  310
            S        K Q VGWPPV ++R+   S      YVKV++DGAP+LRK+DL  + +Y  L
Sbjct  76   SGAAKPPAAKTQAVGWPPVKAFRK---SVMKSCKYVKVAVDGAPYLRKVDLEAYDSYQQL  132

Query  309  LIALDNLFDCRGIGEALKD------ADSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRL  148
            L AL+ LF C  I     +      A+ +E+ P YEDKDGDWMLVGDVPW MFVESCKRL
Sbjct  133  LAALEKLFSCFSICNYASERKIVDPANGAEFLPTYEDKDGDWMLVGDVPWKMFVESCKRL  192

Query  147  RIMKRSEAKGIG  112
            R MK SEA G+G
Sbjct  193  RFMKSSEATGLG  204



>gb|KHG09585.1| Auxin-induced 22B [Gossypium arboreum]
Length=200

 Score =   152 bits (385),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 94/194 (48%), Positives = 111/194 (57%), Gaps = 29/194 (15%)
 Frame = -3

Query  624  LGLEITELRLGLPGSGHGGADKGTTG---EKKRVFSE-------------MIDGGDDHDR  493
            L L  TELRLGLPG G     + T       KR   E              + G DD D 
Sbjct  11   LNLMATELRLGLPGCGDDEPQRKTNPSIRNNKRTVPEISEVSSSESNSSITMSGSDDQD-  69

Query  492  sssnnnnnkkKQQVVGWPPVCSYRR------KNNSDEGKKMYVKVSMDGAPFLRKIDLTT  331
                 +    K+QVVGWPP+ S R+      K N  EG  MYVKVS+DGAP+LRKIDL  
Sbjct  70   -----SPPPAKEQVVGWPPIRSNRKNCLQSSKRNEVEGMGMYVKVSVDGAPYLRKIDLKV  124

Query  330  HKTYSHLLIALDNLFDCR-GIGEALKDADSSEYAPIYEDKDGDWMLVGDVPWGMFVESCK  154
            +  Y  LL AL+N+F    G     +  + S+YAP YEDKDGDWMLVGDVPW MF+ SCK
Sbjct  125  YGGYPQLLKALENMFKLTIGAYSKREGYNGSDYAPTYEDKDGDWMLVGDVPWEMFISSCK  184

Query  153  RLRIMKRSEAKGIG  112
            RLRIMK SEA+G+G
Sbjct  185  RLRIMKGSEARGLG  198



>ref|XP_002284121.1| PREDICTED: auxin-induced protein 22D [Vitis vinifera]
 emb|CBI26356.3| unnamed protein product [Vitis vinifera]
Length=192

 Score =   152 bits (384),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 91/188 (48%), Positives = 109/188 (58%), Gaps = 8/188 (4%)
 Frame = -3

Query  642  MAAKSGLGLEITELRLGLPG--SGHGGADKGTTGEKKRVFSEMIDGGDDHDRsssnnnnn  469
            +A +S L L+ TELRLGLPG       A  G    K+       + G     +    N  
Sbjct  5    VAYESDLNLKATELRLGLPGRDEAEKEALSGVRNNKRASPDTSDECGSKGSSNGDRENAP  64

Query  468  kkKQQVVGWPPVCSYRR-----KNNSDEGKKMYVKVSMDGAPFLRKIDLTTHKTYSHLLI  304
              K QVVGWPP+ S+R+     K    E   M+VKVSMDGAP+LRKIDL  +K Y  LL 
Sbjct  65   ATKAQVVGWPPIRSFRKNSFQPKKTEAEAAGMFVKVSMDGAPYLRKIDLKVYKGYPELLQ  124

Query  303  ALDNLFDCR-GIGEALKDADSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRIMKRSE  127
            AL N+F    G     +    SEY P YEDKDGDWMLVGDVPW MF+ SCKRLRIMK S+
Sbjct  125  ALQNMFKFTIGDYSEREGYKGSEYVPTYEDKDGDWMLVGDVPWDMFMSSCKRLRIMKGSD  184

Query  126  AKGIGLHA  103
            A+G+G  A
Sbjct  185  ARGLGCGA  192



>ref|XP_006418151.1| hypothetical protein EUTSA_v10008636mg [Eutrema salsugineum]
 gb|ESQ36504.1| hypothetical protein EUTSA_v10008636mg [Eutrema salsugineum]
Length=239

 Score =   154 bits (388),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 87/179 (49%), Positives = 114/179 (64%), Gaps = 10/179 (6%)
 Frame = -3

Query  621  GLEITELRLGLPGSGHGGADKGTTGEKKRVFSEMIDGGDDHDRsssnnnnnkkKQQVVGW  442
             L+ TELRLGLPG+ +   ++       +  S      +    +     +  +K Q+VGW
Sbjct  59   NLKETELRLGLPGTDNVSEERERVSSCNKRASPSDTENEIESSTRKTETSPPRKAQIVGW  118

Query  441  PPVCSYRR------KNNSD-EGKKMYVKVSMDGAPFLRKIDLTTHKTYSHLLIALDNLFD  283
            PPV SYR+      KN SD EG+ +YVKVSMDGAP+LRKIDL+ ++ YS LL AL+ +F 
Sbjct  119  PPVRSYRKNIIETKKNESDHEGQGIYVKVSMDGAPYLRKIDLSCYQRYSELLKALEMMFK  178

Query  282  CRGIGEALKDA--DSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRIMKRSEAKGIG  112
               +GE  +      S++ P YEDKDGDWML+GDVPW MFV +CKRLRIMK SEAKG+G
Sbjct  179  F-SVGEYFEREGYKGSDFVPTYEDKDGDWMLIGDVPWEMFVCTCKRLRIMKGSEAKGLG  236



>sp|P32294.1|AX22B_VIGRR RecName: Full=Auxin-induced protein 22B; AltName: Full=Indole-3-acetic 
acid-induced protein ARG4 [Vigna radiata var. radiata]
 dbj|BAA03309.1| hypothetical protein [Vigna radiata var. radiata]
Length=196

 Score =   152 bits (384),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 90/187 (48%), Positives = 114/187 (61%), Gaps = 14/187 (7%)
 Frame = -3

Query  633  KSGLGLEITELRLGLPGSGHGGADKGTT-----GEKKRVF-----SEMIDGGDDHDRsss  484
            +S L L+ TELRLGLPG+     +   T       K++V      S  I     H +   
Sbjct  8    ESDLNLKATELRLGLPGTEEKEDNNLRTHAVLRNNKRQVRETSQDSVSISKASHHQQHVE  67

Query  483  nnnnnkkKQQVVGWPPVCSYRRKNNSD-EGKKMYVKVSMDGAPFLRKIDLTTHKTYSHLL  307
              +    K ++VGWPP+ SYR+ +  + EG  ++VKVSMDGAP+LRK+DL  +  Y  LL
Sbjct  68   TVSAPPPKAKIVGWPPIRSYRKNSVQEGEGDGIFVKVSMDGAPYLRKVDLKVYGGYPELL  127

Query  306  IALDNLFDCRGIGEALKDA--DSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRIMKR  133
             AL+ +F    IGE  +      SEYAP YEDKDGDWMLVGDVPW MFV SCKRLRIMK 
Sbjct  128  KALETMFKL-AIGEYSEREGYKGSEYAPTYEDKDGDWMLVGDVPWDMFVTSCKRLRIMKG  186

Query  132  SEAKGIG  112
            SEA+G+G
Sbjct  187  SEARGLG  193



>gb|KFK42765.1| hypothetical protein AALP_AA1G036800 [Arabis alpina]
Length=179

 Score =   152 bits (383),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 90/179 (50%), Positives = 112/179 (63%), Gaps = 15/179 (8%)
 Frame = -3

Query  624  LGLEITELRLGLPGSGHGGADKGTTGEKKRVFSEMIDGGDDHDRsssnnnnnkkKQQVVG  445
            + L+ TELRLGLPG+ +   +       KR         ++ + SS       +K Q+VG
Sbjct  5    VNLKATELRLGLPGTHNVCEETEKVSCNKRALPN--SDTENENESSKTETFPPRKAQIVG  62

Query  444  WPPVCSYRR------KNNSDEGKKMYVKVSMDGAPFLRKIDLTTHKTYSHLLIALDNLFD  283
            WPPV SYR+      KN SD     YVKVSMDGAP+LRKIDL+ +K YS LL AL+ +F 
Sbjct  63   WPPVRSYRKNNIQTKKNESDH----YVKVSMDGAPYLRKIDLSCYKGYSELLKALEMMFK  118

Query  282  CRGIGEALKDA--DSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRIMKRSEAKGIG  112
               +GE  +      SE+ P YEDKDGDWML+GDVPW MFV +CKRLRIMK SEAKG+G
Sbjct  119  -FFVGEYFEREGYKGSEFVPTYEDKDGDWMLIGDVPWEMFVCTCKRLRIMKGSEAKGLG  176



>ref|XP_004495393.1| PREDICTED: auxin-induced protein 22B-like [Cicer arietinum]
Length=183

 Score =   152 bits (383),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 89/181 (49%), Positives = 117/181 (65%), Gaps = 9/181 (5%)
 Frame = -3

Query  642  MAAKSGLGLEITELRLGLPGSGHGGADKGTTGEKKRVFSEMIDGGDDHD-Rsssnnnnnk  466
            +A ++ L L+ TELRLGLPG+            K+     +I+   + D +SS+ +    
Sbjct  5    VAYQTDLNLKATELRLGLPGTEETLLSVSVKNNKR----PLIETSKECDSKSSNTDAAPP  60

Query  465  kKQQVVGWPPVCSYRRKNNSD-EGKKMYVKVSMDGAPFLRKIDLTTHKTYSHLLIALDNL  289
             K ++VGWPP+ SYR+ +  + E   +YVKVS+DGAP+LRKIDL  +  YS LL AL+N+
Sbjct  61   SKAKIVGWPPIRSYRKNSLQEAEASGIYVKVSLDGAPYLRKIDLRVYGGYSQLLKALENM  120

Query  288  FDCRGIGEALKDA--DSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRIMKRSEAKGI  115
            F    IG+  +      S+Y P YEDKDGDWMLVGDVPW MFV SCKRLRIMK SEA+GI
Sbjct  121  FKLT-IGDYSEKEGYKGSDYEPTYEDKDGDWMLVGDVPWDMFVTSCKRLRIMKGSEARGI  179

Query  114  G  112
            G
Sbjct  180  G  180



>gb|ABH01143.1| auxin-regulated protein [Populus tomentosa]
Length=258

 Score =   154 bits (389),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 98/230 (43%), Positives = 126/230 (55%), Gaps = 54/230 (23%)
 Frame = -3

Query  630  SGLGLEITELRLGLPGSGHGGAD---KGTTGEKKRVFSEMID------------GGDDHD  496
            S +  E TELRLGLPG    G D     + G++ + FSE +D             G D +
Sbjct  14   SMMNFEETELRLGLPGGVSNGNDPEAAKSNGKRGQRFSETVDLKLNLSTKDTGKDGSDQE  73

Query  495  Rsssnnnnnk----------kKQQVVGWPPVCSYRR------KNNSDEGKKM--------  388
            +++                  K QVVGWPP+ S+R+      KN++DEG+K         
Sbjct  74   KAAMKEKAVAPRPNDPAKPPSKAQVVGWPPIRSFRKNVMAVQKNSNDEGEKASSSGATGA  133

Query  387  -YVKVSMDGAPFLRKIDLTTHKTYSHLLIALDNLFDCRGIG--------EALKDA-----  250
             +VKVSMDGAP+LRK+DL  +K+Y  L  AL  +F    IG        E + ++     
Sbjct  134  AFVKVSMDGAPYLRKVDLKLYKSYRELSDALGKMFSSFTIGNCGSQGTKEFMNESKLIDL  193

Query  249  -DSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRIMKRSEAKGIGLHA  103
             +SSEY P YEDKDGDWMLVGDVPWGMFV+SCKRLRIMK SEA G+   A
Sbjct  194  LNSSEYVPTYEDKDGDWMLVGDVPWGMFVDSCKRLRIMKGSEAIGLAPRA  243



>ref|XP_008366873.1| PREDICTED: auxin-responsive protein IAA3-like [Malus domestica]
Length=197

 Score =   152 bits (384),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 90/188 (48%), Positives = 119/188 (63%), Gaps = 21/188 (11%)
 Frame = -3

Query  618  LEITELRLGLPGSGHGGADKGTT-----GEKKRVFSEMIDGGDDHDRsssnnnnnkkKQ-  457
            LE TELRLGLPG+     +  +T       K+ +  +M D  +D+D SS+  ++ +  Q 
Sbjct  8    LEATELRLGLPGTKDSEQNTYSTTLISKSNKRPLQPDMND--EDNDSSSAKRSDQQISQP  65

Query  456  -----QVVGWPPVCSYRR-----KNNSDEGKKMYVKVSMDGAPFLRKIDLTTHKTYSHLL  307
                 QVVGWPPV SYR+     K    E   +YVK+SMDGAP+LRKIDL  ++ Y+ LL
Sbjct  66   PPSKAQVVGWPPVRSYRKTCLQAKKTEAEAAGIYVKISMDGAPYLRKIDLKVYRGYTELL  125

Query  306  IALDNLFDCRGIGEALKDA---DSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRIMK  136
             AL+++F  +      KD    + SE+ P YED+DGDWML+GDVPW MF+ SCKRLRIMK
Sbjct  126  KALEDMFKFKVGDYCEKDLGYNNRSEFVPTYEDRDGDWMLLGDVPWEMFIASCKRLRIMK  185

Query  135  RSEAKGIG  112
             SEAKG+G
Sbjct  186  GSEAKGLG  193



>ref|XP_009364491.1| PREDICTED: auxin-responsive protein IAA4-like [Pyrus x bretschneideri]
Length=197

 Score =   152 bits (384),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 91/191 (48%), Positives = 117/191 (61%), Gaps = 21/191 (11%)
 Frame = -3

Query  618  LEITELRLGLPGSGHGGADKGTT-----GEKKRVFSEMIDGGDDHDRsssnnnnnkkKQ-  457
            LE TELRLGLPG+     +  +T       K+ +  +M D  +D D SS+  ++ +  Q 
Sbjct  8    LEATELRLGLPGTKDSEQNTSSTTLISKSNKRPLQPDMND--EDKDSSSAKRSDQQISQP  65

Query  456  -----QVVGWPPVCSYRR-----KNNSDEGKKMYVKVSMDGAPFLRKIDLTTHKTYSHLL  307
                 QVVGWPPV  YR+     K    E   +YVK+SMDGAP+LRKIDL  ++ Y  LL
Sbjct  66   PPSKAQVVGWPPVRQYRKNCLQAKKTEAEAAGIYVKISMDGAPYLRKIDLKVYRGYPELL  125

Query  306  IALDNLFDCRGIGEALKDA---DSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRIMK  136
             AL+++F  +      KD    + SE+ P YEDKDGDWML+GDVPW MF+ SCKRLRIMK
Sbjct  126  KALEDMFKFKVGDYCEKDLGYNNRSEFVPTYEDKDGDWMLLGDVPWEMFIASCKRLRIMK  185

Query  135  RSEAKGIGLHA  103
             SEAKG+G  A
Sbjct  186  GSEAKGLGCCA  196



>emb|CDO99147.1| unnamed protein product [Coffea canephora]
Length=194

 Score =   152 bits (384),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 93/190 (49%), Positives = 115/190 (61%), Gaps = 16/190 (8%)
 Frame = -3

Query  642  MAAKSGLGLEITELRLGLPGSGHGGADKGT-TGEKKRVFSEMIDGGDDHD----Rsssnn  478
            +A ++ L L+ TELRLGLPG+     +  + T   KR   E  +    +D    +     
Sbjct  5    VAHENDLNLKATELRLGLPGTDESEKESASCTKNNKRSLPECAEESAKNDDLDAQHGDRE  64

Query  477  nnnkkKQQVVGWPPVCSYRRKNNSDEGKK------MYVKVSMDGAPFLRKIDLTTHKTYS  316
                 K Q+VGWPPV SYR+  NS + KK       YVKVSMDGAP+LRKIDL  +K Y 
Sbjct  65   AAPAAKAQIVGWPPVRSYRK--NSLQQKKAEAETGFYVKVSMDGAPYLRKIDLKLYKGYP  122

Query  315  HLLIALDNLFDCRGIGEALKDA--DSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRI  142
              L AL+N+F    IGE  +      SEYAP YEDKDGD MLVGDVPW MF+ SCK+LRI
Sbjct  123  EFLKALENMFKLT-IGEYSEREGYRGSEYAPAYEDKDGDLMLVGDVPWEMFMSSCKKLRI  181

Query  141  MKRSEAKGIG  112
            MK SEA+G+G
Sbjct  182  MKGSEARGLG  191



>ref|XP_010522505.1| PREDICTED: auxin-responsive protein IAA4-like [Tarenaya hassleriana]
Length=193

 Score =   152 bits (384),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 91/180 (51%), Positives = 111/180 (62%), Gaps = 11/180 (6%)
 Frame = -3

Query  624  LGLEITELRLGLPGSGHGGADK---GTTGEKKRVFSEMIDGGDDHDRsssnnnnnkkKQQ  454
            + L+ TELRLGLPG+  G   K         KR  S+     +       N      K Q
Sbjct  13   VNLKATELRLGLPGTDDGCDVKEMVSCVKSNKRALSDTEK--EIASTGLKNQTAPPPKAQ  70

Query  453  VVGWPPVCSYRR-----KNNSDEGKKMYVKVSMDGAPFLRKIDLTTHKTYSHLLIALDNL  289
            +VGWPPV SYR+     K +  EG+ +YVKVSMDGAP+LRKIDLTT+K Y  LL AL+++
Sbjct  71   IVGWPPVRSYRKNSLQPKKSESEGQGIYVKVSMDGAPYLRKIDLTTYKGYPELLKALESM  130

Query  288  FD-CRGIGEALKDADSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRIMKRSEAKGIG  112
            F    G     +    S++ P +EDKDGDWMLVGDVPW MFV SCKRLRIMK SEAKG+G
Sbjct  131  FKFSAGEYSEREGYKGSDFVPTHEDKDGDWMLVGDVPWEMFVSSCKRLRIMKGSEAKGLG  190



>gb|AAL55414.1| auxin-induced AUX/IAA1 [Antirrhinum majus]
Length=172

 Score =   151 bits (382),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 83/165 (50%), Positives = 102/165 (62%), Gaps = 8/165 (5%)
 Frame = -3

Query  609  TELRLGLPGSGHGGADKGTT---GEKKRVFSEMIDGGDDHDRsssnnnnnkkKQQVVGWP  439
            TELRLGLPG+        ++      KR  SEM  G          +     K QVVGWP
Sbjct  3    TELRLGLPGTDESEPQTSSSIKNNNNKRSSSEM-QGSCQKSTQQEESIAPAPKAQVVGWP  61

Query  438  PVCSYRR---KNNSDEGKKMYVKVSMDGAPFLRKIDLTTHKTYSHLLIALDNLFDCR-GI  271
            PV S+R+   K +  +G  M+VKVSMDGAP+LRKIDL  +  Y  LL AL+N+F C  G+
Sbjct  62   PVRSFRKNVMKASESDGSGMFVKVSMDGAPYLRKIDLKFYNNYFDLLKALENMFKCTIGV  121

Query  270  GEALKDADSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRIMK  136
                +  + SE+AP YEDKDGDWMLVGDVPW MF+ SCKRLRIM+
Sbjct  122  YSEREGYNGSEFAPTYEDKDGDWMLVGDVPWDMFITSCKRLRIMQ  166



>ref|XP_009354869.1| PREDICTED: auxin-induced protein 22D-like [Pyrus x bretschneideri]
Length=175

 Score =   151 bits (382),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 84/180 (47%), Positives = 106/180 (59%), Gaps = 23/180 (13%)
 Frame = -3

Query  624  LGLEITELRLGLPGSGH------GGADKGTTGEKKRV----FSEMIDGGDDHDRsssnnn  475
            L  + TELRLGLPGS          A    T   KR      +E      DH       +
Sbjct  5    LNFKATELRLGLPGSSEEPENKKAAASPPMTKNNKRASPDSTAEECCTNSDH------ID  58

Query  474  nnkkKQQVVGWPPVCSYRRKNNSDEGKKMYVKVSMDGAPFLRKIDLTTHKTYSHLLIALD  295
                K QVVGWPP+ SYR+ +   +   +YVKVS+DGAP+LRKIDL  + +Y  L+ AL+
Sbjct  59   APPTKTQVVGWPPIRSYRKNSLQLQKSDVYVKVSVDGAPYLRKIDLKIYNSYPELIKALE  118

Query  294  NLFDCRGIGEALKDADSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRIMKRSEAKGI  115
             +F+       L + + S++AP YEDKDGDWMLVGDVPW MFV SC RLRIMK SEA+G+
Sbjct  119  KMFN-------LANINGSDFAPTYEDKDGDWMLVGDVPWSMFVSSCNRLRIMKGSEARGL  171



>ref|XP_007050424.1| AUX/IAA transcriptional regulator family protein [Theobroma cacao]
 gb|EOX94581.1| AUX/IAA transcriptional regulator family protein [Theobroma cacao]
Length=406

 Score =   157 bits (398),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 95/196 (48%), Positives = 118/196 (60%), Gaps = 29/196 (15%)
 Frame = -3

Query  633  KSGLGLEITELRLGLPGSGHGGADKGTTG----------------EKKRVFSEMIDGGDD  502
            ++ L L+ TELRLGLPGS     +K +T                   K  +     G DD
Sbjct  216  QNDLNLKATELRLGLPGSDE--PEKQSTPCIRNNKRSSSEISEESRSKSSYCVTEAGNDD  273

Query  501  HDRsssnnnnnkkKQQVVGWPPVCSYRR-----KNNSDEGKKMYVKVSMDGAPFLRKIDL  337
            H      +     K QVVGWPP+ SYR+     KNN  EG  MYVKVS+DGAP+LRKIDL
Sbjct  274  HQ-----DTAPPVKAQVVGWPPIRSYRKNCLQTKNNEVEGAGMYVKVSVDGAPYLRKIDL  328

Query  336  TTHKTYSHLLIALDNLFDCR-GIGEALKDADSSEYAPIYEDKDGDWMLVGDVPWGMFVES  160
              +++Y+ LL AL+N+F    G     +  + S+YAP YEDKDGDWMLVGDVPW MF+ S
Sbjct  329  KVYRSYAGLLKALENMFKLTVGAYSEREGYNGSDYAPTYEDKDGDWMLVGDVPWEMFISS  388

Query  159  CKRLRIMKRSEAKGIG  112
            CKRLRIMK SEA+G+G
Sbjct  389  CKRLRIMKGSEARGLG  404



>ref|XP_003591816.1| Auxin-induced protein [Medicago truncatula]
 gb|AES62067.1| auxin response factor [Medicago truncatula]
 gb|AFK41948.1| unknown [Medicago truncatula]
 gb|KEH42781.1| auxin response factor [Medicago truncatula]
Length=178

 Score =   151 bits (382),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 83/178 (47%), Positives = 112/178 (63%), Gaps = 6/178 (3%)
 Frame = -3

Query  642  MAAKSGLGLEITELRLGLPGSGHGGADKGTTGEKKRVFSEMIDGGDDHDRsssnnnnnkk  463
            +A ++ L ++ TELRLGLPG+      K     K+ +     D G      +S++     
Sbjct  5    VAYENDLNMKATELRLGLPGTEQNEEQKAKISNKRPLTETSKDSGS----KTSDDAAPPS  60

Query  462  KQQVVGWPPVCSYRRKN-NSDEGKKMYVKVSMDGAPFLRKIDLTTHKTYSHLLIALDNLF  286
            K ++VGWPP+ SYR+ +    E   +YVKVS+DGAP+LRKIDL  +  Y+ LL AL+++F
Sbjct  61   KAKIVGWPPIRSYRKNSLQEAEASGIYVKVSLDGAPYLRKIDLRVYGGYAQLLKALESMF  120

Query  285  DCRGIGEALKDA-DSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRLRIMKRSEAKGI  115
                   + K+    SEY P YEDKDGDWMLVGDVPW MFV SCKRLRIMK +EA+G+
Sbjct  121  KLTIGNYSEKEGYKGSEYEPTYEDKDGDWMLVGDVPWEMFVTSCKRLRIMKGTEARGV  178



>ref|XP_010024037.1| PREDICTED: auxin-induced protein 22D-like [Eucalyptus grandis]
 gb|KCW60451.1| hypothetical protein EUGRSUZ_H03171 [Eucalyptus grandis]
Length=203

 Score =   152 bits (384),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 92/192 (48%), Positives = 118/192 (61%), Gaps = 24/192 (13%)
 Frame = -3

Query  624  LGLEITELRLGLPGSGHGGADKGTTGEKKRVFSE---MID-----GGDDHDRsssnn--n  475
            L +E TELRLGLPG+    A      E ++  +    ++D       +D  R+   +  +
Sbjct  12   LNMEATELRLGLPGTASSTAVTDQEPEARQARNNKRSLVDRREEEASEDASRALPKDHDS  71

Query  474  nnkkKQQVVGWPPVCSYRRKNNSDEGKK---------MYVKVSMDGAPFLRKIDLTTHKT  322
                K Q+VGWPP+ SYR+  N+ + KK         +YVKVSMDGAP+LRKIDL  +K 
Sbjct  72   APSSKAQIVGWPPIRSYRK--NTLQTKKTEAETSSSGIYVKVSMDGAPYLRKIDLNVYKG  129

Query  321  YSHLLIALDNLFDCRGIGEALKDA--DSSEYAPIYEDKDGDWMLVGDVPWGMFVESCKRL  148
            YS LL AL N+F    IGE  +      SE+AP YEDKDGDWMLVGDVPW MF+ SCKRL
Sbjct  130  YSDLLKALQNMFKFT-IGEYSEREGYKGSEFAPTYEDKDGDWMLVGDVPWEMFMTSCKRL  188

Query  147  RIMKRSEAKGIG  112
            RIM+ SEA+G+G
Sbjct  189  RIMRGSEARGLG  200



>ref|XP_010249884.1| PREDICTED: auxin-responsive protein IAA1 [Nelumbo nucifera]
Length=217

 Score =   152 bits (385),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 86/196 (44%), Positives = 109/196 (56%), Gaps = 27/196 (14%)
 Frame = -3

Query  630  SGLGLEITELRLGLPGSGHGGADKGTTGEKKRVFSEMID-----GGDDHDRsssnnnnnk  466
            +GL  + TEL LGLPG     A+   +   KR FSE +D           R  S      
Sbjct  15   TGLNFKETELTLGLPGESRTQAEI-VSKNSKRGFSETVDLNLGSSSSSETRGRSQVEEQG  73

Query  465  kKQ------------QVVGWPPVCSYRRKNNSDEGKKMYVKVSMDGAPFLRKIDLTTHKT  322
            + +            QVVGWPPV S+R+          YVKV++DGAP+LRK+DL T+ +
Sbjct  74   ESEAPCAGKPPASKAQVVGWPPVRSFRKNALKS---CTYVKVAVDGAPYLRKVDLETYSS  130

Query  321  YSHLLIALDNLFDCRGIGEALKD------ADSSEYAPIYEDKDGDWMLVGDVPWGMFVES  160
            Y  LL AL+N+F C  I   L +       + +EY P YEDKDGDWMLVGDVPW MFV S
Sbjct  131  YQQLLSALENMFTCFTIRNVLNERKLMDPVNGTEYVPTYEDKDGDWMLVGDVPWKMFVAS  190

Query  159  CKRLRIMKRSEAKGIG  112
            CKR+R+MK SEA G+ 
Sbjct  191  CKRIRLMKSSEAVGLA  206



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1665811349545