BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c24284_g1_i2 len=570 path=[2266:0-182 326:183-208 352:209-253
980:254-255 982:256-331 707:332-338 714:339-384 3748:385-387
3891:388-404 543:405-479 125:480-508 3582:509-569]

Length=570
                                                                      Score     E

ref|XP_009768012.1|  PREDICTED: F-box protein At1g61340-like            134   1e-35   
ref|XP_009601231.1|  PREDICTED: F-box protein At1g61340-like            131   1e-34   
ref|XP_009603004.1|  PREDICTED: F-box protein At1g61340-like            129   9e-34   
ref|XP_004248377.1|  PREDICTED: F-box protein SKIP27                    128   3e-33   
ref|XP_006352592.1|  PREDICTED: F-box protein SKIP27-like isoform X1    127   7e-33   
ref|XP_004233817.1|  PREDICTED: F-box protein At1g61340                 125   2e-32   
ref|XP_009761690.1|  PREDICTED: F-box protein At1g61340-like            122   4e-31   
ref|XP_011096202.1|  PREDICTED: F-box protein At1g61340-like            122   4e-31   
emb|CDO99633.1|  unnamed protein product                                118   2e-29   
ref|XP_009606394.1|  PREDICTED: F-box protein SKIP27-like               117   4e-29   
ref|XP_006347182.1|  PREDICTED: F-box protein At1g61340-like            116   6e-29   
ref|XP_006467897.1|  PREDICTED: F-box protein At1g61340-like            117   7e-29   
ref|XP_006449212.1|  hypothetical protein CICLE_v10016832mg             116   9e-29   
ref|XP_009800564.1|  PREDICTED: F-box protein SKIP27-like               112   3e-27   
ref|XP_011043303.1|  PREDICTED: F-box protein At1g61340-like            112   4e-27   
gb|KDP20884.1|  hypothetical protein JCGZ_21355                         110   2e-26   
ref|XP_010277938.1|  PREDICTED: F-box protein SKIP27-like               107   9e-26   
ref|XP_011086115.1|  PREDICTED: F-box protein At1g61340-like            107   2e-25   
ref|XP_010268836.1|  PREDICTED: F-box protein At1g61340-like            107   2e-25   
ref|XP_003634996.1|  PREDICTED: F-box protein At1g61340-like            106   4e-25   
ref|XP_011001137.1|  PREDICTED: F-box protein At1g61340-like            104   3e-24   
ref|XP_002305655.1|  F-box family protein                               104   4e-24   Populus trichocarpa [western balsam poplar]
gb|EPS73155.1|  hypothetical protein M569_01603                         100   8e-24   
ref|XP_008364148.1|  PREDICTED: F-box protein At1g61340-like            103   9e-24   
ref|XP_006343266.1|  PREDICTED: F-box protein At1g61340-like            102   1e-23   
ref|XP_004234134.1|  PREDICTED: F-box protein At1g61340                 102   1e-23   
emb|CBI23311.3|  unnamed protein product                                105   2e-23   
gb|AFK39960.1|  unknown                                                 100   4e-23   
ref|XP_002524681.1|  conserved hypothetical protein                     102   6e-23   Ricinus communis
ref|XP_004504974.1|  PREDICTED: F-box protein At1g61340-like isof...  99.4    1e-22   
ref|XP_008371479.1|  PREDICTED: F-box protein SKIP27-like             99.8    2e-22   
ref|XP_003608235.1|  F-box protein SKIP27                             99.0    2e-22   
ref|XP_002316660.2|  hypothetical protein POPTR_0011s04260g           99.0    2e-22   Populus trichocarpa [western balsam poplar]
ref|XP_008383822.1|  PREDICTED: F-box protein SKIP27-like               100   2e-22   
ref|XP_010547200.1|  PREDICTED: F-box protein At1g61340               99.4    3e-22   
ref|XP_007025798.1|  F-box family protein, putative                   99.4    3e-22   
ref|XP_010476035.1|  PREDICTED: F-box protein At1g61340-like          99.0    3e-22   
ref|XP_007212141.1|  hypothetical protein PRUPE_ppa012223mg           99.0    3e-22   
ref|XP_010686285.1|  PREDICTED: F-box protein SKIP27                  99.0    4e-22   
gb|AFK44316.1|  unknown                                               98.2    5e-22   
ref|XP_010092634.1|  F-box protein SKIP27                             97.8    9e-22   
ref|XP_009375595.1|  PREDICTED: F-box protein At1g61340-like          98.6    9e-22   
gb|KHG02458.1|  F-box SKIP27 -like protein                            96.7    2e-21   
gb|KHG01654.1|  F-box SKIP27 -like protein                            97.1    2e-21   
ref|XP_006392009.1|  hypothetical protein EUTSA_v10023716mg           96.7    3e-21   
ref|XP_009104615.1|  PREDICTED: F-box protein At1g61340               95.5    8e-21   
ref|XP_006302767.1|  hypothetical protein CARUB_v10020889mg           94.7    3e-20   
ref|XP_010473341.1|  PREDICTED: F-box protein At1g61340-like          94.0    4e-20   
ref|XP_010418105.1|  PREDICTED: F-box protein At1g61340-like          92.8    8e-20   
ref|XP_008439907.1|  PREDICTED: F-box protein At4g05010-like          92.0    1e-19   
ref|XP_007159251.1|  hypothetical protein PHAVU_002G222100g           90.9    2e-19   
emb|CDY03828.1|  BnaC01g29450D                                        92.4    2e-19   
ref|XP_010458511.1|  PREDICTED: F-box protein At1g61340-like          90.9    3e-19   
ref|XP_004155583.1|  PREDICTED: F-box protein SKIP27-like             90.9    4e-19   
emb|CDY15010.1|  BnaCnng04130D                                        90.5    5e-19   
emb|CDX97944.1|  BnaA06g06950D                                        89.4    7e-19   
ref|XP_004134730.1|  PREDICTED: F-box protein SKIP27-like             90.1    7e-19   
ref|XP_002274518.1|  PREDICTED: F-box protein At1g61340-like          89.7    8e-19   Vitis vinifera
ref|XP_009148455.1|  PREDICTED: F-box protein At1g61340-like isof...  89.4    8e-19   
emb|CBI23307.3|  unnamed protein product                              87.8    1e-18   
ref|XP_003529294.1|  PREDICTED: F-box protein At1g61340-like          89.0    1e-18   
ref|XP_006303809.1|  hypothetical protein CARUB_v10012241mg           89.4    1e-18   
ref|XP_006417374.1|  hypothetical protein EUTSA_v10009722mg           88.2    2e-18   
ref|XP_010430148.1|  PREDICTED: F-box protein At1g61340-like          88.6    3e-18   
ref|XP_009148454.1|  PREDICTED: F-box protein At1g61340-like isof...  87.4    8e-18   
emb|CDY19351.1|  BnaC05g08600D                                        86.3    8e-18   
gb|AAO39934.1|  At1g61340                                             86.7    1e-17   Arabidopsis thaliana [mouse-ear cress]
ref|NP_176329.1|  F-box stress induced 1                              86.7    1e-17   Arabidopsis thaliana [mouse-ear cress]
emb|CDY72037.1|  BnaAnng39710D                                        86.7    2e-17   
ref|XP_010052379.1|  PREDICTED: F-box protein SKIP27-like             86.3    3e-17   
ref|XP_002888090.1|  F-box family protein                             85.5    3e-17   
ref|XP_010533863.1|  PREDICTED: F-box protein At1g61340-like          85.5    3e-17   
emb|CDX79068.1|  BnaA01g11350D                                        85.5    5e-17   
emb|CDX82831.1|  BnaC01g12810D                                        85.5    5e-17   
ref|XP_009134834.1|  PREDICTED: F-box protein SKIP27                  85.5    5e-17   
ref|XP_007148244.1|  hypothetical protein PHAVU_006G192100g           84.0    2e-16   
ref|NP_001185279.1|  F-box stress induced 1                           83.6    3e-16   
gb|KHN08585.1|  F-box protein                                         82.0    4e-16   
ref|XP_006595415.1|  PREDICTED: F-box protein At1g61340-like          81.6    5e-16   
ref|XP_010449053.1|  PREDICTED: F-box protein SKIP27-like             82.8    6e-16   
ref|XP_010439469.1|  PREDICTED: F-box protein SKIP27-like             82.8    6e-16   
ref|XP_010529398.1|  PREDICTED: F-box protein SKIP27                  82.4    7e-16   
ref|XP_006282705.1|  hypothetical protein CARUB_v10005669mg           82.0    1e-15   
gb|KHG11247.1|  F-box SKIP27 -like protein                            80.9    1e-15   
emb|CAA18715.1|  hypothetical protein                                 80.9    2e-15   Arabidopsis thaliana [mouse-ear cress]
gb|ACJ85993.1|  unknown                                               79.7    2e-15   Medicago truncatula
ref|XP_009114516.1|  PREDICTED: F-box protein At4g05010               80.1    3e-15   
ref|XP_010905570.1|  PREDICTED: F-box protein At1g61340-like          79.7    4e-15   
ref|NP_567629.1|  F-box stress induced protein 2                      80.5    4e-15   Arabidopsis thaliana [mouse-ear cress]
gb|EPS73870.1|  f-box family protein                                  78.2    4e-15   
emb|CDY16621.1|  BnaA09g19990D                                        79.3    5e-15   
emb|CDY44748.1|  BnaC09g22320D                                        77.8    2e-14   
gb|KFK28733.1|  hypothetical protein AALP_AA7G039900                  78.2    2e-14   
gb|AID21672.1|  At4g21510p-like protein                               78.2    2e-14   
ref|XP_008800393.1|  PREDICTED: F-box protein At1g61340-like          77.4    2e-14   
ref|XP_009416067.1|  PREDICTED: F-box protein SKIP27                  77.0    3e-14   
ref|XP_004486263.1|  PREDICTED: F-box protein SKIP27-like             75.5    7e-14   
gb|ADP89474.1|  FBS1                                                  74.3    8e-14   
ref|XP_006413772.1|  hypothetical protein EUTSA_v10026245mg           76.3    9e-14   
ref|XP_008806772.1|  PREDICTED: F-box protein At1g61340-like          75.1    2e-13   
ref|XP_002463023.1|  hypothetical protein SORBIDRAFT_02g036360        74.7    2e-13   Sorghum bicolor [broomcorn]
ref|XP_009134327.1|  PREDICTED: F-box protein At4g05010-like          73.6    5e-13   
ref|XP_002872727.1|  hypothetical protein ARALYDRAFT_911767           72.8    8e-13   
ref|XP_006288769.1|  hypothetical protein CARUB_v10002090mg           73.2    8e-13   
gb|KEH36515.1|  F-box protein                                         71.6    1e-12   
ref|XP_004486262.1|  PREDICTED: F-box protein At1g61340-like          71.6    1e-12   
ref|XP_009406493.1|  PREDICTED: F-box protein At1g61340-like          71.6    2e-12   
emb|CDX90883.1|  BnaA03g25630D                                        72.0    2e-12   
emb|CDY21323.1|  BnaC03g30070D                                        70.9    4e-12   
ref|XP_010538349.1|  PREDICTED: F-box protein SKIP27                  71.6    5e-12   
ref|XP_006396636.1|  hypothetical protein EUTSA_v10029012mg           70.5    7e-12   
ref|XP_010904959.1|  PREDICTED: F-box protein SKIP27-like             70.1    9e-12   
gb|KHN39612.1|  F-box protein                                         68.2    2e-11   
ref|NP_001267740.1|  uncharacterized protein LOC101786658             68.6    3e-11   
ref|NP_567282.1|  F-box protein                                       68.2    4e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006599757.1|  PREDICTED: F-box protein At1g61340-like          67.4    5e-11   
gb|AHN93176.1|  F-box domain-containing protein                       66.2    6e-11   
ref|XP_010422372.1|  PREDICTED: F-box protein At4g05010-like          67.4    6e-11   
gb|KHN00107.1|  F-box protein                                         67.4    7e-11   
ref|XP_003530987.1|  PREDICTED: F-box protein At1g61340-like          67.4    7e-11   
gb|AHN93174.1|  F-box domain-containing protein                       66.6    2e-10   
ref|XP_008345910.1|  PREDICTED: F-box protein SKIP27-like             65.5    2e-10   
gb|EMS57773.1|  F-box protein SKIP27                                  65.9    2e-10   
ref|NP_001152644.1|  F-box domain containing protein                  66.2    2e-10   Zea mays [maize]
ref|XP_010467813.1|  PREDICTED: F-box protein At4g05010-like          65.5    3e-10   
ref|XP_008345908.1|  PREDICTED: F-box protein SKIP27-like             64.3    3e-10   
ref|XP_006657832.1|  PREDICTED: F-box protein SKIP27-like             64.3    8e-10   
gb|AHN93177.1|  F-box domain-containing protein                       60.5    7e-09   
ref|XP_003562914.1|  PREDICTED: F-box protein SKIP27-like             61.2    8e-09   
gb|AHN93171.1|  F-box domain-containing protein                       61.2    9e-09   
ref|XP_010455837.1|  PREDICTED: F-box protein At4g05010-like          60.8    1e-08   
ref|XP_006284178.1|  hypothetical protein CARUB_v10005325mg           62.8    1e-08   
ref|XP_006841809.1|  hypothetical protein AMTR_s00003p00269410        61.2    1e-08   
ref|XP_006594621.1|  PREDICTED: F-box protein At1g61340-like          59.3    1e-08   
gb|AHN93170.1|  F-box domain-containing protein                       59.7    3e-08   
gb|AHN93175.1|  F-box domain-containing protein                       59.7    3e-08   
tpg|DAA63123.1|  TPA: hypothetical protein ZEAMMB73_674118            58.2    5e-08   
ref|XP_002966836.1|  hypothetical protein SELMODRAFT_408036           60.5    9e-08   
ref|XP_002961170.1|  hypothetical protein SELMODRAFT_402840           60.1    1e-07   
ref|XP_008653242.1|  PREDICTED: LOW QUALITY PROTEIN: F-box protei...  57.8    1e-07   
ref|NP_001148552.1|  F-box domain containing protein                  57.0    3e-07   Zea mays [maize]
ref|XP_011099883.1|  PREDICTED: F-box protein At4g35930               58.2    4e-07   
ref|XP_010446850.1|  PREDICTED: F-box protein At4g35930               58.2    4e-07   
ref|XP_010679881.1|  PREDICTED: F-box protein At4g35930               57.0    1e-06   
ref|XP_008664357.1|  PREDICTED: F-box protein At1g61340-like          54.7    2e-06   
ref|XP_006412041.1|  hypothetical protein EUTSA_v10025800mg           56.6    2e-06   
gb|KHN35537.1|  F-box protein                                         55.1    2e-06   
ref|NP_001147656.1|  F-box domain containing protein                  54.3    2e-06   Zea mays [maize]
ref|XP_009765885.1|  PREDICTED: F-box protein At4g35930-like          55.8    3e-06   
ref|XP_010436244.1|  PREDICTED: F-box protein At4g35930-like          54.7    3e-06   
gb|AHN93172.1|  F-box domain-containing protein                       53.9    3e-06   
emb|CDX72566.1|  BnaC07g45880D                                        55.5    3e-06   
ref|XP_009611042.1|  PREDICTED: F-box protein At4g35930-like          55.1    5e-06   
ref|XP_003547917.1|  PREDICTED: F-box protein At4g35930-like          55.1    5e-06   
gb|EPS63008.1|  hypothetical protein M569_11779                       55.1    6e-06   
ref|XP_009138398.1|  PREDICTED: F-box protein At4g35930               54.7    8e-06   
ref|XP_010548265.1|  PREDICTED: F-box protein At4g35930 isoform X2    54.3    8e-06   
ref|XP_008448525.1|  PREDICTED: F-box protein At4g35930               54.3    9e-06   
ref|XP_004146154.1|  PREDICTED: F-box protein At4g35930-like          54.3    9e-06   
emb|CBI29597.3|  unnamed protein product                              52.8    1e-05   
ref|XP_008803331.1|  PREDICTED: F-box protein At1g61340-like          52.0    1e-05   
gb|KHG28150.1|  hypothetical protein F383_15342                       52.8    2e-05   
ref|XP_002987341.1|  hypothetical protein SELMODRAFT_426127           52.0    2e-05   
ref|XP_008807143.1|  PREDICTED: F-box protein At4g35930-like          53.5    2e-05   
ref|XP_002989159.1|  hypothetical protein SELMODRAFT_427805           52.0    2e-05   
ref|XP_002869050.1|  predicted protein                                53.5    2e-05   
ref|XP_010933945.1|  PREDICTED: F-box protein At4g35930-like          51.2    2e-05   
gb|KDP23986.1|  hypothetical protein JCGZ_25374                       53.1    2e-05   
ref|XP_002269563.3|  PREDICTED: F-box protein At4g35930               52.4    2e-05   Vitis vinifera
ref|XP_008393913.1|  PREDICTED: F-box protein At4g35930-like          53.1    2e-05   
ref|XP_009379351.1|  PREDICTED: F-box protein At4g35930-like          53.1    2e-05   
ref|XP_007156187.1|  hypothetical protein PHAVU_003G265700g           52.8    3e-05   
gb|KHG28149.1|  hypothetical protein F383_15342                       52.8    3e-05   
ref|XP_007046629.1|  F-box family protein                             52.8    3e-05   
emb|CDP01862.1|  unnamed protein product                              52.8    4e-05   
ref|XP_010920109.1|  PREDICTED: F-box protein At4g35930 isoform X1    52.4    4e-05   
ref|XP_010548266.1|  PREDICTED: F-box protein At4g35930 isoform X3    52.4    4e-05   
gb|EYU30815.1|  hypothetical protein MIMGU_mgv1a011614mg              52.4    4e-05   
ref|XP_004287785.1|  PREDICTED: F-box protein At4g35930-like          52.4    5e-05   
ref|XP_003629266.1|  F-box protein                                    52.4    5e-05   
ref|XP_010548262.1|  PREDICTED: F-box protein At4g35930 isoform X1    52.0    6e-05   
ref|XP_010113310.1|  F-box protein                                    52.0    6e-05   
ref|XP_009413026.1|  PREDICTED: F-box protein At4g35930-like          52.0    6e-05   
ref|XP_011043150.1|  PREDICTED: F-box protein At4g35930               52.0    7e-05   
gb|EMS55625.1|  hypothetical protein TRIUR3_10151                     51.6    7e-05   
ref|XP_006383065.1|  hypothetical protein POPTR_0005s11220g           52.0    7e-05   
ref|XP_006661792.1|  PREDICTED: F-box protein At4g35930-like          51.6    8e-05   
ref|XP_004509385.1|  PREDICTED: F-box protein At4g35930-like isof...  51.6    8e-05   
ref|XP_004509386.1|  PREDICTED: F-box protein At4g35930-like isof...  51.6    8e-05   
ref|XP_003519858.1|  PREDICTED: F-box protein At4g35930-like          51.6    9e-05   
ref|NP_195318.2|  F-box protein                                       51.6    9e-05   Arabidopsis thaliana [mouse-ear cress]
emb|CAN71843.1|  hypothetical protein VITISV_036263                   51.6    9e-05   Vitis vinifera
ref|XP_010033518.1|  PREDICTED: F-box protein At4g35930               51.2    9e-05   
gb|ACF81677.1|  unknown                                               50.8    1e-04   Zea mays [maize]
ref|NP_001169959.1|  uncharacterized protein LOC100383858             50.8    1e-04   Zea mays [maize]
ref|XP_002531155.1|  conserved hypothetical protein                   50.8    1e-04   Ricinus communis
ref|XP_002467186.1|  hypothetical protein SORBIDRAFT_01g021140        50.4    2e-04   Sorghum bicolor [broomcorn]
ref|XP_004983038.1|  PREDICTED: F-box protein At4g35930-like          50.4    2e-04   
ref|XP_004234526.1|  PREDICTED: F-box protein At4g35930               50.1    2e-04   
ref|NP_001059985.1|  Os07g0561300                                     48.9    3e-04   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001132716.1|  uncharacterized protein LOC100194199             50.1    3e-04   Zea mays [maize]
ref|XP_007202456.1|  hypothetical protein PRUPE_ppa010075mg           50.1    3e-04   
ref|XP_008242043.1|  PREDICTED: F-box protein At4g35930               50.1    3e-04   
ref|XP_009400369.1|  PREDICTED: F-box protein At4g35930-like          49.7    3e-04   
ref|NP_001064681.1|  Os10g0438500                                     49.7    3e-04   Oryza sativa Japonica Group [Japonica rice]
gb|EEC67030.1|  hypothetical protein OsI_33755                        49.3    5e-04   Oryza sativa Indica Group [Indian rice]
ref|XP_009624359.1|  PREDICTED: F-box protein At4g35930               49.3    5e-04   
gb|KHG01213.1|  hypothetical protein F383_22992                       49.3    5e-04   
gb|KHG01212.1|  hypothetical protein F383_22992                       49.3    6e-04   
ref|XP_009383999.1|  PREDICTED: F-box protein At4g35930-like          48.9    6e-04   
ref|XP_006425397.1|  hypothetical protein CICLE_v10026280mg           48.9    6e-04   
ref|XP_006466997.1|  PREDICTED: F-box protein At4g35930-like isof...  48.9    6e-04   
ref|XP_010266005.1|  PREDICTED: F-box protein At4g35930               48.9    8e-04   
ref|XP_006340769.1|  PREDICTED: F-box protein At4g35930-like isof...  48.5    8e-04   
ref|XP_010234761.1|  PREDICTED: F-box protein At4g35930 isoform X2    48.5    9e-04   
ref|XP_003573963.1|  PREDICTED: F-box protein At4g35930 isoform X1    48.5    9e-04   
gb|EMT27013.1|  hypothetical protein F775_31785                       48.5    0.001   



>ref|XP_009768012.1| PREDICTED: F-box protein At1g61340-like [Nicotiana sylvestris]
Length=176

 Score =   134 bits (337),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 62/94 (66%), Positives = 79/94 (84%), Gaps = 3/94 (3%)
 Frame = -1

Query  492  QDVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTPRKTMDSQNVVVGFEDSM  313
            QD+LIRI+ GVDHDDL RLFHVS+TIRE T+IAK+WHFEY+TPRKT+  +N +   ED  
Sbjct  61   QDILIRIVCGVDHDDLKRLFHVSRTIREATVIAKRWHFEYATPRKTLGFKNAI---EDLG  117

Query  312  DYNEVEAPNAPRQTRVPKLRLSHKKLSGIAVALF  211
            ++N+VEAPNAPRQ ++ KL+LS KKL+ I+VALF
Sbjct  118  EFNDVEAPNAPRQLKIRKLKLSRKKLADISVALF  151



>ref|XP_009601231.1| PREDICTED: F-box protein At1g61340-like [Nicotiana tomentosiformis]
Length=182

 Score =   131 bits (330),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 60/94 (64%), Positives = 75/94 (80%), Gaps = 0/94 (0%)
 Frame = -1

Query  492  QDVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTPRKTMDSQNVVVGFEDSM  313
            QD+LIRI+ GVDHDDL RLFHVSK IRE T++AKKWHFEY+TPRKT+  +N     E+  
Sbjct  68   QDILIRIVCGVDHDDLKRLFHVSKAIREATVVAKKWHFEYNTPRKTVGFKNATTDMENWS  127

Query  312  DYNEVEAPNAPRQTRVPKLRLSHKKLSGIAVALF  211
            +  E EAPNAPRQ++VP+ RLS KKL+ I+V+LF
Sbjct  128  ESYESEAPNAPRQSKVPRSRLSRKKLADISVSLF  161



>ref|XP_009603004.1| PREDICTED: F-box protein At1g61340-like [Nicotiana tomentosiformis]
Length=171

 Score =   129 bits (323),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 59/94 (63%), Positives = 77/94 (82%), Gaps = 3/94 (3%)
 Frame = -1

Query  492  QDVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTPRKTMDSQNVVVGFEDSM  313
            QD+LIRI+ GVDHDDL RLFHVS+ IRE T+IAK+WHFEY+TPRKT+  +N +   ED  
Sbjct  61   QDILIRIVCGVDHDDLKRLFHVSRVIREATVIAKRWHFEYATPRKTLGFKNAI---EDLG  117

Query  312  DYNEVEAPNAPRQTRVPKLRLSHKKLSGIAVALF  211
            ++N+V+APNAPRQ ++ KL+LS KKL+ I+V LF
Sbjct  118  EFNDVDAPNAPRQLKIRKLKLSRKKLADISVTLF  151



>ref|XP_004248377.1| PREDICTED: F-box protein SKIP27 [Solanum lycopersicum]
Length=177

 Score =   128 bits (321),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 69/118 (58%), Positives = 88/118 (75%), Gaps = 1/118 (1%)
 Frame = -1

Query  564  TETSKHCREVsfpssekpsleslPQDVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKW  385
            T T K CR  SF +  K  LE+LPQD+LIRI+ GV+H+DL RLFHVSK IRE T++AK+W
Sbjct  40   TPTKKICRNNSFSTCVKSPLEALPQDILIRIVCGVEHEDLKRLFHVSKPIREATLVAKRW  99

Query  384  HFEYSTPRKTMDSQNVVVGFEDSMDYNEVEAPNAPRQTRVPKLRLSHKKLSGIAVALF  211
            HFEYSTP+KT+  +N     +D  + N+VE PNAPRQ + P+ RLS KKL+ I+VALF
Sbjct  100  HFEYSTPKKTLGFKN-ATDMDDWNESNDVELPNAPRQAKFPRTRLSQKKLADISVALF  156



>ref|XP_006352592.1| PREDICTED: F-box protein SKIP27-like isoform X1 [Solanum tuberosum]
 ref|XP_006352593.1| PREDICTED: F-box protein SKIP27-like isoform X2 [Solanum tuberosum]
 ref|XP_006352594.1| PREDICTED: F-box protein SKIP27-like isoform X3 [Solanum tuberosum]
Length=177

 Score =   127 bits (318),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 69/118 (58%), Positives = 88/118 (75%), Gaps = 1/118 (1%)
 Frame = -1

Query  564  TETSKHCREVsfpssekpsleslPQDVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKW  385
            T T K CR+ SF +  K  LE+LPQD+LIRI+ GV+HDDL RLFHVSK IRE T++AK+W
Sbjct  40   TPTKKICRKNSFSTCVKSPLEALPQDILIRIVCGVEHDDLKRLFHVSKPIREATLVAKRW  99

Query  384  HFEYSTPRKTMDSQNVVVGFEDSMDYNEVEAPNAPRQTRVPKLRLSHKKLSGIAVALF  211
            HFEYSTP KT+  +N     ++  + N VE PNAPRQ++ P+ RLS KKL+ I+VALF
Sbjct  100  HFEYSTPTKTLGFKN-ATDIDNWSESNNVEVPNAPRQSKFPRARLSRKKLADISVALF  156



>ref|XP_004233817.1| PREDICTED: F-box protein At1g61340 [Solanum lycopersicum]
Length=165

 Score =   125 bits (314),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 58/94 (62%), Positives = 77/94 (82%), Gaps = 3/94 (3%)
 Frame = -1

Query  492  QDVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTPRKTMDSQNVVVGFEDSM  313
            QD+LIR++ GVDHDDL RL+HVS+ IRE T+IAKK HFEY+TPRKT+  +N +   +DS 
Sbjct  59   QDILIRVLCGVDHDDLKRLYHVSRAIREATVIAKKLHFEYATPRKTVGFKNAI---DDSG  115

Query  312  DYNEVEAPNAPRQTRVPKLRLSHKKLSGIAVALF  211
            ++N++EAPN PRQ +V KLRLS KK++ I+VALF
Sbjct  116  EFNDIEAPNTPRQLKVRKLRLSKKKIADISVALF  149



>ref|XP_009761690.1| PREDICTED: F-box protein At1g61340-like [Nicotiana sylvestris]
Length=181

 Score =   122 bits (306),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 60/100 (60%), Positives = 73/100 (73%), Gaps = 13/100 (13%)
 Frame = -1

Query  492  QDVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTPRKTMDSQNVVVGFEDSM  313
            QD+LIRI+ GVDHDDL RLFHVSK IRE T++AKKWHFEY+TPRKT       VGF+ + 
Sbjct  68   QDILIRIVCGVDHDDLKRLFHVSKAIREATLVAKKWHFEYNTPRKT-------VGFKKAT  120

Query  312  DYN------EVEAPNAPRQTRVPKLRLSHKKLSGIAVALF  211
            D        E EAPNAPR ++ P+ RLS KKL+ I+V+LF
Sbjct  121  DMENWSGSYEAEAPNAPRPSKFPRSRLSRKKLADISVSLF  160



>ref|XP_011096202.1| PREDICTED: F-box protein At1g61340-like [Sesamum indicum]
Length=179

 Score =   122 bits (306),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 61/94 (65%), Positives = 74/94 (79%), Gaps = 4/94 (4%)
 Frame = -1

Query  492  QDVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTPRKTMDSQNVVVGFEDSM  313
            Q++LIRI+ GV+HDDL RL  VSK IRE T+IAK+ HF YSTPRKT+  QNV    E   
Sbjct  76   QEILIRILCGVEHDDLKRLCFVSKAIREATLIAKQSHFAYSTPRKTVGFQNV----EYFG  131

Query  312  DYNEVEAPNAPRQTRVPKLRLSHKKLSGIAVALF  211
            D+NEVEAPNAP+Q+RVP+ RLS KKL+ I+VALF
Sbjct  132  DFNEVEAPNAPKQSRVPRYRLSTKKLADISVALF  165



>emb|CDO99633.1| unnamed protein product [Coffea canephora]
Length=185

 Score =   118 bits (296),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 70/119 (59%), Positives = 90/119 (76%), Gaps = 4/119 (3%)
 Frame = -1

Query  564  TETSKHCR-EVsfpssekpsleslPQDVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKK  388
            T T K C  E SF +S+K +LE+LPQDVLIRI+ GV+HDDL RLF VSK++RE T+IAK+
Sbjct  49   TPTKKRCSYEASFFTSDKSTLEALPQDVLIRILCGVEHDDLKRLFFVSKSLREATLIAKQ  108

Query  387  WHFEYSTPRKTMDSQNVVVGFEDSMDYNEVEAPNAPRQTRVPKLRLSHKKLSGIAVALF  211
            WHF YSTPRKT+   N  +  E+  ++NE+E   APRQ R+P+ RLS KKL+ I+VALF
Sbjct  109  WHFAYSTPRKTLGFPN-AIDLENLDEFNEIE--QAPRQVRIPRARLSSKKLADISVALF  164



>ref|XP_009606394.1| PREDICTED: F-box protein SKIP27-like [Nicotiana tomentosiformis]
Length=164

 Score =   117 bits (292),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 69/118 (58%), Positives = 87/118 (74%), Gaps = 1/118 (1%)
 Frame = -1

Query  564  TETSKHCREVsfpssekpsleslPQDVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKW  385
            T T + C   SF ++EK  LESLP+D+LIRI+ GVDHDDL  LFHVS  IREVT+IAKK 
Sbjct  39   TPTKRFCSRNSFSTNEKSGLESLPKDILIRIVCGVDHDDLKSLFHVSTAIREVTLIAKKM  98

Query  384  HFEYSTPRKTMDSQNVVVGFEDSMDYNEVEAPNAPRQTRVPKLRLSHKKLSGIAVALF  211
            HFE+STPRKT+  +N     EDS + +EVE PNAP+  ++ + RLS KKL+ I+VALF
Sbjct  99   HFEFSTPRKTLPFRN-AFDMEDSGNSDEVEPPNAPKLPKIARSRLSRKKLAEISVALF  155



>ref|XP_006347182.1| PREDICTED: F-box protein At1g61340-like [Solanum tuberosum]
Length=173

 Score =   116 bits (291),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 57/94 (61%), Positives = 72/94 (77%), Gaps = 3/94 (3%)
 Frame = -1

Query  492  QDVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTPRKTMDSQNVVVGFEDSM  313
            QD+LIRI+ GVDHDDL RLF VS+ IRE  +IAK+ HFEY+TPRKT+  +N +   ED  
Sbjct  59   QDILIRIVCGVDHDDLKRLFRVSRAIREAAVIAKRLHFEYATPRKTVGFKNAI---EDLG  115

Query  312  DYNEVEAPNAPRQTRVPKLRLSHKKLSGIAVALF  211
            ++  VEAPNAPRQ +V KL+LS KK+  I+VALF
Sbjct  116  EFINVEAPNAPRQLKVRKLKLSKKKMDDISVALF  149



>ref|XP_006467897.1| PREDICTED: F-box protein At1g61340-like [Citrus sinensis]
 gb|KDO75717.1| hypothetical protein CISIN_1g029717mg [Citrus sinensis]
Length=189

 Score =   117 bits (292),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 73/94 (78%), Gaps = 1/94 (1%)
 Frame = -1

Query  492  QDVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTPRKTMDSQNVVVGFEDSM  313
            QD+LIRI+ GV+H+DL +LFHVS+ IRE T+IAK+WHF Y+TPRKT   +   + +ED +
Sbjct  83   QDILIRILCGVNHEDLKQLFHVSRPIREATLIAKQWHFAYNTPRKTRVFK-TSIDYEDPI  141

Query  312  DYNEVEAPNAPRQTRVPKLRLSHKKLSGIAVALF  211
            +  EVEAPNAPRQ R  K RL+ +KL+ I+VALF
Sbjct  142  ENAEVEAPNAPRQMRAYKSRLTSQKLADISVALF  175



>ref|XP_006449212.1| hypothetical protein CICLE_v10016832mg [Citrus clementina]
 gb|ESR62452.1| hypothetical protein CICLE_v10016832mg [Citrus clementina]
Length=190

 Score =   116 bits (291),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 73/94 (78%), Gaps = 1/94 (1%)
 Frame = -1

Query  492  QDVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTPRKTMDSQNVVVGFEDSM  313
            QD+LIRI+ GV+H+DL +LFHVS+ IRE T+IAK+WHF Y+TPRKT   +   + +ED +
Sbjct  83   QDILIRILCGVNHEDLKQLFHVSRPIREATLIAKQWHFAYNTPRKTRVFK-TSIDYEDPI  141

Query  312  DYNEVEAPNAPRQTRVPKLRLSHKKLSGIAVALF  211
            +  EVEAPNAPRQ R  K RL+ +KL+ I+VALF
Sbjct  142  ENAEVEAPNAPRQMRAYKSRLTSQKLADISVALF  175



>ref|XP_009800564.1| PREDICTED: F-box protein SKIP27-like [Nicotiana sylvestris]
Length=160

 Score =   112 bits (279),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 72/94 (77%), Gaps = 5/94 (5%)
 Frame = -1

Query  492  QDVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTPRKTMDSQNVVVGFEDSM  313
            +D+LIRI+ GVDHDDL  LFHVS  IREVT+IAK+ HFE+STPRKT+  +NV       +
Sbjct  63   KDILIRIVCGVDHDDLKSLFHVSTAIREVTLIAKRLHFEFSTPRKTLPFRNVF-----DV  117

Query  312  DYNEVEAPNAPRQTRVPKLRLSHKKLSGIAVALF  211
            D +EVE PNAP+ +++ + RLS K+L+ I+VALF
Sbjct  118  DTDEVEPPNAPKLSKITRSRLSRKRLAEISVALF  151



>ref|XP_011043303.1| PREDICTED: F-box protein At1g61340-like [Populus euphratica]
Length=189

 Score =   112 bits (280),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 57/106 (54%), Positives = 76/106 (72%), Gaps = 6/106 (6%)
 Frame = -1

Query  492  QDVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTPRKTMDSQNVVVGFEDSM  313
            QD+LIR++ GVDHDDL +LFHVSK IRE T+IAK+WHF YSTPRKT  +      F +  
Sbjct  84   QDILIRVLCGVDHDDLKQLFHVSKVIREATLIAKEWHFAYSTPRKTQ-AFRTRTDFGNPS  142

Query  312  DYNEVEAPNAPRQTRVPKLRLSHKKLSGIAVALF--P*KCCFGLYM  181
            + +E+EAPNAP+Q R  K +L+ K ++ ++VALF  P K   GL+M
Sbjct  143  ELDEIEAPNAPKQRRSYKSQLNRKSIADVSVALFASPKK---GLFM  185



>gb|KDP20884.1| hypothetical protein JCGZ_21355 [Jatropha curcas]
Length=181

 Score =   110 bits (275),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 51/94 (54%), Positives = 70/94 (74%), Gaps = 1/94 (1%)
 Frame = -1

Query  492  QDVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTPRKTMDSQNVVVGFEDSM  313
            QD+L++I+ GVDHDDL +LFHVS  IRE T++AKKWHF YSTP+KT  +    + FE+  
Sbjct  76   QDILVKILCGVDHDDLKQLFHVSTVIREATLVAKKWHFAYSTPKKT-PAFRTSIDFENPS  134

Query  312  DYNEVEAPNAPRQTRVPKLRLSHKKLSGIAVALF  211
            ++ ++EAPNAP+  R  K RL+ K L+ I+VALF
Sbjct  135  EFEDIEAPNAPKVPRSYKSRLNGKNLADISVALF  168



>ref|XP_010277938.1| PREDICTED: F-box protein SKIP27-like [Nelumbo nucifera]
Length=130

 Score =   107 bits (266),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 53/94 (56%), Positives = 66/94 (70%), Gaps = 1/94 (1%)
 Frame = -1

Query  492  QDVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTPRKTMDSQNVVVGFEDSM  313
            QD+LIR++  VDHDDL  LFHVSKTIRE T+IAK+WHF + TP K M  ++     ED  
Sbjct  34   QDLLIRVLCSVDHDDLKELFHVSKTIREATLIAKQWHFAFRTPVKPMGLRS-FGDLEDES  92

Query  312  DYNEVEAPNAPRQTRVPKLRLSHKKLSGIAVALF  211
             ++  EAPNAPRQ R    RL+ KKL+ I+VALF
Sbjct  93   KFDAQEAPNAPRQKRALGSRLNRKKLADISVALF  126



>ref|XP_011086115.1| PREDICTED: F-box protein At1g61340-like [Sesamum indicum]
Length=186

 Score =   107 bits (268),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 70/94 (74%), Gaps = 4/94 (4%)
 Frame = -1

Query  492  QDVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTPRKTMDSQNVVVGFEDSM  313
            Q++LIRI+  V+HDDL+RLF VS+ +RE T+IAKK HF +STPRKT+         ED  
Sbjct  76   QEILIRILCCVEHDDLTRLFFVSRAMREATLIAKKSHFAFSTPRKTLSFPKA----EDFA  131

Query  312  DYNEVEAPNAPRQTRVPKLRLSHKKLSGIAVALF  211
            ++N+VEAPNAP+Q RV   RLS KKL+ I+VALF
Sbjct  132  EFNDVEAPNAPKQQRVRLSRLSAKKLADISVALF  165



>ref|XP_010268836.1| PREDICTED: F-box protein At1g61340-like [Nelumbo nucifera]
Length=193

 Score =   107 bits (268),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 51/94 (54%), Positives = 67/94 (71%), Gaps = 0/94 (0%)
 Frame = -1

Query  492  QDVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTPRKTMDSQNVVVGFEDSM  313
            Q++L++++ GVDHDDL +LFHVSKTIRE T+IAK+ HF Y TP K++         EDS 
Sbjct  81   QEILVQVLCGVDHDDLKQLFHVSKTIREATLIAKQSHFAYCTPSKSLAGVRSFSVVEDSS  140

Query  312  DYNEVEAPNAPRQTRVPKLRLSHKKLSGIAVALF  211
              +  EAPNAPRQ R+   RL+ KKL+ I+VALF
Sbjct  141  KLDAEEAPNAPRQQRILGSRLNRKKLADISVALF  174



>ref|XP_003634996.1| PREDICTED: F-box protein At1g61340-like [Vitis vinifera]
Length=172

 Score =   106 bits (265),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 59/118 (50%), Positives = 84/118 (71%), Gaps = 1/118 (1%)
 Frame = -1

Query  564  TETSKHCREVsfpssekpsleslPQDVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKW  385
            T   + C E+    +EK  LE++PQD+LIRI+ GVDHDDL +LFHVS TIR+ T+IAKK 
Sbjct  51   TPLKRRCGEMVEEKAEKSMLEAMPQDILIRILCGVDHDDLKQLFHVSNTIRDATLIAKKS  110

Query  384  HFEYSTPRKTMDSQNVVVGFEDSMDYNEVEAPNAPRQTRVPKLRLSHKKLSGIAVALF  211
            HF YSTP K    ++  +  E+S  +++++ P+AP+Q+R  + RL  +KLSGIA+ALF
Sbjct  111  HFAYSTPSKVQTFRS-PLDPEESSGFDDLQTPDAPKQSRHFRSRLRGRKLSGIAIALF  167



>ref|XP_011001137.1| PREDICTED: F-box protein At1g61340-like [Populus euphratica]
Length=189

 Score =   104 bits (260),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 55/106 (52%), Positives = 75/106 (71%), Gaps = 6/106 (6%)
 Frame = -1

Query  492  QDVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTPRKTMDSQNVVVGFEDSM  313
            QD+LIR++  VDHDDL +LFHVSK IRE T+IAK+ HF YSTPRK+   ++     E+  
Sbjct  84   QDILIRVLCRVDHDDLKQLFHVSKVIREATLIAKESHFAYSTPRKSQGFRS-PFDLENPS  142

Query  312  DYNEVEAPNAPRQTRVPKLRLSHKKLSGIAVALF--P*KCCFGLYM  181
            + +E+EAPNAP+Q R  K RL+ K ++ ++VALF  P K   GL+M
Sbjct  143  ELDEIEAPNAPKQRRSYKSRLNRKSIADVSVALFASPKK---GLFM  185



>ref|XP_002305655.1| F-box family protein [Populus trichocarpa]
 gb|EEE86166.1| F-box family protein [Populus trichocarpa]
Length=189

 Score =   104 bits (259),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 55/106 (52%), Positives = 75/106 (71%), Gaps = 6/106 (6%)
 Frame = -1

Query  492  QDVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTPRKTMDSQNVVVGFEDSM  313
            QD+LIR++  VDHDDL +LFHVSK IRE T+IAK+ HF YSTPRK+   ++     E+  
Sbjct  84   QDILIRVLCRVDHDDLKQLFHVSKVIREATLIAKESHFAYSTPRKSQGFRS-PFDLENPG  142

Query  312  DYNEVEAPNAPRQTRVPKLRLSHKKLSGIAVALF--P*KCCFGLYM  181
            + +E+EAPNAP+Q R  K RL+ K ++ ++VALF  P K   GL+M
Sbjct  143  ELDEIEAPNAPKQRRSYKSRLNRKSIADVSVALFASPKK---GLFM  185



>gb|EPS73155.1| hypothetical protein M569_01603, partial [Genlisea aurea]
Length=100

 Score =   100 bits (250),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 51/95 (54%), Positives = 71/95 (75%), Gaps = 3/95 (3%)
 Frame = -1

Query  492  QDVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTPRKTMDSQNVVVGFEDSM  313
            Q++LIRII GV+HDDL  L  VSK+++E T+IAK+ HF +STPRKT+        +  S 
Sbjct  6    QEILIRIICGVEHDDLKHLLLVSKSMKEATLIAKQSHFAFSTPRKTLSFPKADEFY--ST  63

Query  312  DYNEVE-APNAPRQTRVPKLRLSHKKLSGIAVALF  211
            D +++E APNAP+Q+R+P+ RL+ KKLS I+VALF
Sbjct  64   DNDDIEAAPNAPKQSRLPRNRLTPKKLSAISVALF  98



>ref|XP_008364148.1| PREDICTED: F-box protein At1g61340-like [Malus domestica]
Length=206

 Score =   103 bits (258),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 70/96 (73%), Gaps = 3/96 (3%)
 Frame = -1

Query  492  QDVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTPRKTMDSQNVVVGFEDSM  313
            Q++L++I+ GVDHDDL +LFHVSK IREVT+IAK+WHF YSTP KT  +    + F D  
Sbjct  89   QEILLKIVCGVDHDDLKQLFHVSKAIREVTLIAKQWHFAYSTPSKT-PAFRTAIDFSDCN  147

Query  312  D-YNEVEAPNAPRQTRVPKLRL-SHKKLSGIAVALF  211
               +E+EAPNAP+Q R    +L + KKL+G++V LF
Sbjct  148  SCLDEIEAPNAPKQWRQMHRKLPNEKKLAGLSVNLF  183



>ref|XP_006343266.1| PREDICTED: F-box protein At1g61340-like [Solanum tuberosum]
Length=159

 Score =   102 bits (254),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 58/125 (46%), Positives = 86/125 (69%), Gaps = 14/125 (11%)
 Frame = -1

Query  564  TETSKHCREVsfpssekpsleslPQDVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKW  385
            T T + C + SF +++K  LE+LP+D+LI+I+   DHDDL  LFHVS+T+RE ++IAK W
Sbjct  39   TPTKRICSQTSFSTNDKSDLETLPKDLLIKIVCRADHDDLKSLFHVSRTLREASLIAKGW  98

Query  384  HFEYSTPRKTMDSQNVVVGFEDSMDYNEV-------EAPNAPRQTRVPKLRLSHKKLSGI  226
            HF++STPRKT+        F D++D  E+       +APNAP Q+++ + R + KKL+ I
Sbjct  99   HFDFSTPRKTL-------PFRDALDVEELGDIDEEEKAPNAPMQSKIARSRFNRKKLADI  151

Query  225  AVALF  211
            +VALF
Sbjct  152  SVALF  156



>ref|XP_004234134.1| PREDICTED: F-box protein At1g61340 [Solanum lycopersicum]
Length=159

 Score =   102 bits (254),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 58/119 (49%), Positives = 88/119 (74%), Gaps = 2/119 (2%)
 Frame = -1

Query  564  TETSKHCREVsfpssekpsleslPQDVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKW  385
            T T + C + SF + +K  LE+LP+D+LI+I+   DHDDL  LFHVS+T+RE ++IAK W
Sbjct  39   TPTKRICSQNSFSTDDKSDLETLPKDILIKIVCRADHDDLKSLFHVSRTLREASVIAKGW  98

Query  384  HFEYSTPRKTMDSQNVVVGFEDSMDYNEVE-APNAPRQTRVPKLRLSHKKLSGIAVALF  211
            HF++STP+KT+  ++  +  E+ +D +E E APNAP Q+++ + R + KKL+GI+VALF
Sbjct  99   HFDFSTPKKTLPFRD-ALDVEEFVDNDEEEKAPNAPMQSKMARSRFNSKKLAGISVALF  156



>emb|CBI23311.3| unnamed protein product [Vitis vinifera]
Length=430

 Score =   105 bits (261),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 59/118 (50%), Positives = 84/118 (71%), Gaps = 1/118 (1%)
 Frame = -1

Query  564  TETSKHCREVsfpssekpsleslPQDVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKW  385
            T   + C E+    +EK  LE++PQD+LIRI+ GVDHDDL +LFHVS TIR+ T+IAKK 
Sbjct  309  TPLKRRCGEMVEEKAEKSMLEAMPQDILIRILCGVDHDDLKQLFHVSNTIRDATLIAKKS  368

Query  384  HFEYSTPRKTMDSQNVVVGFEDSMDYNEVEAPNAPRQTRVPKLRLSHKKLSGIAVALF  211
            HF YSTP K    ++ +   E+S  +++++ P+AP+Q+R  + RL  +KLSGIA+ALF
Sbjct  369  HFAYSTPSKVQTFRSPLDP-EESSGFDDLQTPDAPKQSRHFRSRLRGRKLSGIAIALF  425



>gb|AFK39960.1| unknown [Lotus japonicus]
Length=154

 Score =   100 bits (249),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 51/93 (55%), Positives = 65/93 (70%), Gaps = 1/93 (1%)
 Frame = -1

Query  489  DVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTPRKTMDSQNVVVGFEDSMD  310
            DVLIR++ GVDH+DL +L HVSKTIRE T IA+ +HFEYSTP+K           ED+ +
Sbjct  59   DVLIRVLCGVDHEDLEQLLHVSKTIREATEIARDFHFEYSTPKKKTFGFRSPFDIEDANE  118

Query  309  YNEVEAPNAPRQTRVPKLRLSHKKLSGIAVALF  211
            + E+EAP AP +  V K +LS K L GI+VALF
Sbjct  119  FEEIEAPKAPLRKSV-KSKLSGKNLGGISVALF  150



>ref|XP_002524681.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF37700.1| conserved hypothetical protein [Ricinus communis]
Length=221

 Score =   102 bits (253),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 52/106 (49%), Positives = 72/106 (68%), Gaps = 5/106 (5%)
 Frame = -1

Query  492  QDVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTPRKTMDSQNVVVGFEDSM  313
            QD+L+R++  V+HDDL +LFHVS  IRE T++A+K HF YSTPRK    +  +   E+  
Sbjct  93   QDILVRVLCCVNHDDLKQLFHVSTAIREATLVARKLHFAYSTPRKIPAFRTPIASTENPT  152

Query  312  DYNEVEAPNAPRQTRVPKLRLSHKKLSGIAVALF--P*KCCFGLYM  181
            +++E EAPNAP+ +R  K RL+ K L  I+VALF  P K   GL+M
Sbjct  153  EFDEFEAPNAPKVSRCYKSRLNRKNLMDISVALFASPRK---GLFM  195



>ref|XP_004504974.1| PREDICTED: F-box protein At1g61340-like isoform X1 [Cicer arietinum]
 ref|XP_004504975.1| PREDICTED: F-box protein At1g61340-like isoform X2 [Cicer arietinum]
Length=155

 Score = 99.4 bits (246),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 49/94 (52%), Positives = 69/94 (73%), Gaps = 2/94 (2%)
 Frame = -1

Query  492  QDVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTPRKTMDSQNVVVGFEDSM  313
            QD+L+R++ GVDHDDL +LF+VS TIRE + IAK+ HFE++TP+K+  +  V   FE   
Sbjct  63   QDLLVRVLCGVDHDDLKQLFNVSTTIREASEIAKQMHFEFNTPKKSTIA--VRSPFEIEN  120

Query  312  DYNEVEAPNAPRQTRVPKLRLSHKKLSGIAVALF  211
             ++++EAPNAP   R  K RL+ K L+GI+VALF
Sbjct  121  GFDDIEAPNAPLLLRKSKPRLNAKSLAGISVALF  154



>ref|XP_008371479.1| PREDICTED: F-box protein SKIP27-like [Malus domestica]
Length=180

 Score = 99.8 bits (247),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 47/95 (49%), Positives = 68/95 (72%), Gaps = 1/95 (1%)
 Frame = -1

Query  492  QDVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTPRKTMDSQNVVVGFEDSM  313
            Q++LI+++ GVDHDDL RLF VSK IRE T++AK+WHF YSTP KT+  +  +   + + 
Sbjct  63   QEILIKVVCGVDHDDLKRLFRVSKAIREATLVAKQWHFAYSTPSKTLAFRTAIDLSDSNS  122

Query  312  DYNEVEAPNAPRQTRVPKLRL-SHKKLSGIAVALF  211
              +E+EAPNAP+Q R    +L + KKL+ ++V LF
Sbjct  123  SPDEIEAPNAPKQWRQMHRKLPNQKKLAELSVNLF  157



>ref|XP_003608235.1| F-box protein SKIP27 [Medicago truncatula]
 gb|ABD32592.1| At1g61340 [Medicago truncatula]
 gb|AES90432.1| F-box SKIP27-like protein [Medicago truncatula]
Length=161

 Score = 99.0 bits (245),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 48/94 (51%), Positives = 68/94 (72%), Gaps = 1/94 (1%)
 Frame = -1

Query  492  QDVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTPRKTMDSQNVVVGFEDSM  313
            QD+L+R++ GVDHDDL +LF+VS TI+E   IAK+ HFE+STP+K+  +       E+  
Sbjct  68   QDLLVRVLCGVDHDDLEQLFNVSTTIKEAGEIAKQMHFEFSTPKKSSVAVRSPFDIENGF  127

Query  312  DYNEVEAPNAPRQTRVPKLRLSHKKLSGIAVALF  211
            D +E+EAPNAP  ++  K RLS  KL+GI+V+LF
Sbjct  128  D-DEIEAPNAPLMSKKSKPRLSANKLAGISVSLF  160



>ref|XP_002316660.2| hypothetical protein POPTR_0011s04260g, partial [Populus trichocarpa]
 gb|EEE97272.2| hypothetical protein POPTR_0011s04260g, partial [Populus trichocarpa]
Length=158

 Score = 99.0 bits (245),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 45/75 (60%), Positives = 57/75 (76%), Gaps = 1/75 (1%)
 Frame = -1

Query  492  QDVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTPRKTMDSQNVVVGFEDSM  313
            QD+LIR++ GVDHDDL +LFHVSK IRE T+IAK+WHF YSTPRKT  +    + F +  
Sbjct  73   QDILIRVLCGVDHDDLKQLFHVSKVIREATLIAKEWHFAYSTPRKTQ-AFRTRIDFGNPS  131

Query  312  DYNEVEAPNAPRQTR  268
              +E+EAPNAP+Q R
Sbjct  132  GLDEIEAPNAPKQRR  146



>ref|XP_008383822.1| PREDICTED: F-box protein SKIP27-like [Malus domestica]
Length=207

 Score =   100 bits (248),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 47/95 (49%), Positives = 68/95 (72%), Gaps = 1/95 (1%)
 Frame = -1

Query  492  QDVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTPRKTMDSQNVVVGFEDSM  313
            Q++LI+++ GVDHDDL RLF VSK IRE T++AK+WHF YSTP KT+  +  +   + + 
Sbjct  90   QEILIKVVCGVDHDDLKRLFRVSKAIREATLVAKQWHFAYSTPSKTLAFRTAIDLSDSNS  149

Query  312  DYNEVEAPNAPRQTRVPKLRL-SHKKLSGIAVALF  211
              +E+EAPNAP+Q R    +L + KKL+ ++V LF
Sbjct  150  SPDEIEAPNAPKQWRQMHRKLPNQKKLAELSVNLF  184



>ref|XP_010547200.1| PREDICTED: F-box protein At1g61340 [Tarenaya hassleriana]
 ref|XP_010547209.1| PREDICTED: F-box protein At1g61340 [Tarenaya hassleriana]
Length=184

 Score = 99.4 bits (246),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 55/118 (47%), Positives = 79/118 (67%), Gaps = 0/118 (0%)
 Frame = -1

Query  564  TETSKHCREVsfpssekpsleslPQDVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKW  385
            T + + C E     SE   L+SLPQD+L+R++  V+HDDL +LFHVSKT+RE T+IAK+ 
Sbjct  66   TSSKRLCNEALVSDSETCRLQSLPQDILVRVLCHVEHDDLKQLFHVSKTVREATLIAKQS  125

Query  384  HFEYSTPRKTMDSQNVVVGFEDSMDYNEVEAPNAPRQTRVPKLRLSHKKLSGIAVALF  211
            HF YSTP+KT+         E +   +E+EAP APR  R  +  ++ K++SGI+V+LF
Sbjct  126  HFAYSTPKKTLVFHGGFNSDEPTDSGDEIEAPGAPRLKRFGRSLITSKEVSGISVSLF  183



>ref|XP_007025798.1| F-box family protein, putative [Theobroma cacao]
 gb|EOY28420.1| F-box family protein, putative [Theobroma cacao]
Length=184

 Score = 99.4 bits (246),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 50/94 (53%), Positives = 70/94 (74%), Gaps = 1/94 (1%)
 Frame = -1

Query  492  QDVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTPRKTMDSQNVVVGFEDSM  313
            QDVLIRII GVDH DL +LF+VSK+IRE T+IAK+ HF YSTP K + +    + FE+S 
Sbjct  91   QDVLIRIICGVDHKDLKQLFNVSKSIREATVIAKQSHFAYSTPTK-IKAFRTSIDFEESS  149

Query  312  DYNEVEAPNAPRQTRVPKLRLSHKKLSGIAVALF  211
            D +++EAPNAP+     + +++ +KL+ I+VALF
Sbjct  150  DLDDIEAPNAPKLKLRFQRKINRRKLADISVALF  183



>ref|XP_010476035.1| PREDICTED: F-box protein At1g61340-like [Camelina sativa]
Length=169

 Score = 99.0 bits (245),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 72/96 (75%), Gaps = 8/96 (8%)
 Frame = -1

Query  492  QDVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTPRKTMDSQNVVVGFEDSM  313
            QD+L+RII GV+H+DL +LF+VSKTIRE T+IAKKWHFEY+TPRKT+ S+    G E  +
Sbjct  79   QDILVRIICGVEHEDLKQLFNVSKTIREATLIAKKWHFEYTTPRKTLFSRR--SGLESMI  136

Query  312  DYNEVEAPNAPRQ--TRVPKLRLSHKKLSGIAVALF  211
            + ++++AP   +   +R+    L HKK+S I++ALF
Sbjct  137  EGDKIKAPLQKKYGFSRI----LCHKKVSKISMALF  168



>ref|XP_007212141.1| hypothetical protein PRUPE_ppa012223mg [Prunus persica]
 ref|XP_008224951.1| PREDICTED: F-box protein At1g61340-like [Prunus mume]
 gb|EMJ13340.1| hypothetical protein PRUPE_ppa012223mg [Prunus persica]
Length=179

 Score = 99.0 bits (245),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 52/95 (55%), Positives = 67/95 (71%), Gaps = 3/95 (3%)
 Frame = -1

Query  492  QDVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTPRKTMDSQNVVVGFEDSM  313
            Q++LI+I+ GV H+DL +LFHVSK IRE T+IAK+WHF YSTP KT   +  +    D M
Sbjct  81   QEILIKIVCGVHHEDLKQLFHVSKPIREATLIAKQWHFAYSTPSKTPAFRTAIDFSSDDM  140

Query  312  DYNEVEAPNAPRQTRVPKLRL-SHKKLSGIAVALF  211
            D  E+EAPNAP+Q R    +L S KKL+ I+V LF
Sbjct  141  D--EIEAPNAPKQWREQHRQLPSRKKLAEISVNLF  173



>ref|XP_010686285.1| PREDICTED: F-box protein SKIP27 [Beta vulgaris subsp. vulgaris]
Length=184

 Score = 99.0 bits (245),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 47/95 (49%), Positives = 70/95 (74%), Gaps = 1/95 (1%)
 Frame = -1

Query  492  QDVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTPRKTMDSQNVVVGFEDSM  313
            Q++LI++I GV+H+DL++LF VSKT+R+  +IAKK HF +STP KT   +N +    + M
Sbjct  67   QEILIKVICGVNHEDLNQLFSVSKTVRDAAIIAKKSHFAFSTPSKTKAFRNSIDLLNNPM  126

Query  312  DYNEVEAPNAPRQTR-VPKLRLSHKKLSGIAVALF  211
            D  ++EAPNAP+Q R + + R+  KKL+ I+VALF
Sbjct  127  DIEDIEAPNAPKQARKLNRPRICKKKLNHISVALF  161



>gb|AFK44316.1| unknown [Medicago truncatula]
Length=161

 Score = 98.2 bits (243),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 48/94 (51%), Positives = 67/94 (71%), Gaps = 1/94 (1%)
 Frame = -1

Query  492  QDVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTPRKTMDSQNVVVGFEDSM  313
            QD+L+R++ GVDHDDL  LF+VS TI+E   IAK+ HFE+STP+K+  +       E+  
Sbjct  68   QDLLVRVLCGVDHDDLEHLFNVSTTIKEAGEIAKQMHFEFSTPKKSSVAVRSPFDIENGF  127

Query  312  DYNEVEAPNAPRQTRVPKLRLSHKKLSGIAVALF  211
            D +E+EAPNAP  ++  K RLS  KL+GI+V+LF
Sbjct  128  D-DEIEAPNAPLMSKKSKPRLSANKLAGISVSLF  160



>ref|XP_010092634.1| F-box protein SKIP27 [Morus notabilis]
 gb|EXB51823.1| F-box protein SKIP27 [Morus notabilis]
Length=174

 Score = 97.8 bits (242),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 50/95 (53%), Positives = 68/95 (72%), Gaps = 2/95 (2%)
 Frame = -1

Query  492  QDVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTPRKTMDSQNVVVGFEDSM  313
             DVL+RI+ GVDH+DL++L HVSK+IRE T++AK+ HF YSTP+K + +    +  EDS 
Sbjct  80   NDVLVRILCGVDHEDLNQLSHVSKSIREATLVAKQSHFAYSTPKK-VRAFRTAIDLEDSG  138

Query  312  DY-NEVEAPNAPRQTRVPKLRLSHKKLSGIAVALF  211
            D  +E+E PNAP+Q+R  K RL  K L  I+V LF
Sbjct  139  DVGDEIETPNAPKQSRPIKSRLFGKNLDSISVNLF  173



>ref|XP_009375595.1| PREDICTED: F-box protein At1g61340-like [Pyrus x bretschneideri]
Length=208

 Score = 98.6 bits (244),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 51/96 (53%), Positives = 70/96 (73%), Gaps = 3/96 (3%)
 Frame = -1

Query  492  QDVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTPRKTMDSQNVVVGFEDS-  316
            Q++L++I+ GVDHDDL +LFHVSK IREVT+IAK+ HF YSTP KT  +    + F DS 
Sbjct  89   QEILLKIVCGVDHDDLKQLFHVSKAIREVTLIAKQCHFAYSTPSKT-PAFRTAIDFSDSN  147

Query  315  MDYNEVEAPNAPRQTRVPKLRLSH-KKLSGIAVALF  211
               +++EAPNAP+Q R    +L + KKL+G++V LF
Sbjct  148  CCLDDIEAPNAPKQWRQMHRKLPNGKKLAGLSVNLF  183



>gb|KHG02458.1| F-box SKIP27 -like protein [Gossypium arboreum]
Length=183

 Score = 96.7 bits (239),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 51/94 (54%), Positives = 68/94 (72%), Gaps = 2/94 (2%)
 Frame = -1

Query  492  QDVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTPRKTMDSQNVVVGFEDSM  313
            QD+LIRII GVDH+DL RL  VSK+IRE T+IAK+ HF YSTP K + +    + FE+  
Sbjct  91   QDLLIRIICGVDHEDLKRLLIVSKSIREATVIAKQLHFAYSTPTK-VKAFRTSIDFEEPS  149

Query  312  DYNEVEAPNAPRQTRVPKLRLSHKKLSGIAVALF  211
            + +E+EAPNAPRQ R  +  ++  KL+ I+VALF
Sbjct  150  ELDEIEAPNAPRQWRSHR-SINRNKLADISVALF  182



>gb|KHG01654.1| F-box SKIP27 -like protein [Gossypium arboreum]
 gb|KHG11714.1| F-box SKIP27 -like protein [Gossypium arboreum]
Length=191

 Score = 97.1 bits (240),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 55/102 (54%), Positives = 68/102 (67%), Gaps = 16/102 (16%)
 Frame = -1

Query  492  QDVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTPRKTMDSQNVVVGFEDSM  313
            QDVL++II GVDH+DL +LF VSK+IRE+T+IAKK HF YSTPRK       V  F  S+
Sbjct  93   QDVLVKIICGVDHEDLKQLFKVSKSIREITVIAKKMHFAYSTPRK-------VKAFRTSI  145

Query  312  DYNE--------VEAPNAPRQTRVPKLRLSHKKLSGIAVALF  211
            D  E         EAPNAPRQ R  +  ++ KKL+ I+VALF
Sbjct  146  DLEERSELEDGTEEAPNAPRQWRSYR-SINRKKLASISVALF  186



>ref|XP_006392009.1| hypothetical protein EUTSA_v10023716mg [Eutrema salsugineum]
 gb|ESQ29295.1| hypothetical protein EUTSA_v10023716mg [Eutrema salsugineum]
Length=181

 Score = 96.7 bits (239),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 60/117 (51%), Positives = 78/117 (67%), Gaps = 3/117 (3%)
 Frame = -1

Query  558  TSKHCREVsfpssekpsleslPQDVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHF  379
            T K C +     ++   LE LPQD+L+RII GV+H+DL +LFHVSKTIRE T+IAK+ HF
Sbjct  66   TKKLCDKTLVAVAQIRELEDLPQDILVRIICGVEHEDLKQLFHVSKTIREATLIAKQLHF  125

Query  378  EYSTPRKTMDSQNVVVGFEDSMDYNEVEAPNAPRQTRVPKLRLS-HKKLSGIAVALF  211
             YSTPRKT    N   G  D  D +E+EAP AP Q R    R++ +K  SG+++ALF
Sbjct  126  AYSTPRKTSVFHN-PFGLCDDND-DEIEAPGAPLQKRSRLSRINRNKDDSGVSMALF  180



>ref|XP_009104615.1| PREDICTED: F-box protein At1g61340 [Brassica rapa]
 emb|CDY47573.1| BnaA01g22590D [Brassica napus]
Length=180

 Score = 95.5 bits (236),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 49/95 (52%), Positives = 65/95 (68%), Gaps = 3/95 (3%)
 Frame = -1

Query  489  DVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTPRKTMDSQNVVVGFEDSMD  310
            D+L++II GV+H+DL +LFHVSKTIRE T+IAK+ HF YSTPRKT+  Q    G +   D
Sbjct  86   DILVKIICGVEHEDLKQLFHVSKTIREATLIAKQSHFAYSTPRKTLIFQLGRYGLDKPFD  145

Query  309  YNE--VEAPNAPRQTRVPKLRLSHKKLSGIAVALF  211
              E  +EAP AP Q R  ++  +    SG++VALF
Sbjct  146  LGEDKIEAPAAPLQKRYRRINRNEDN-SGVSVALF  179



>ref|XP_006302767.1| hypothetical protein CARUB_v10020889mg, partial [Capsella rubella]
 gb|EOA35665.1| hypothetical protein CARUB_v10020889mg, partial [Capsella rubella]
Length=232

 Score = 94.7 bits (234),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 51/99 (52%), Positives = 67/99 (68%), Gaps = 5/99 (5%)
 Frame = -1

Query  492  QDVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTPRKTMDSQNVVVG----F  325
            QD+L+RII GV+H+DL +L HVSKT++E T+IAK+ HF YSTPRKT    +   G    F
Sbjct  133  QDILVRIICGVEHEDLKQLCHVSKTMKEATLIAKQLHFAYSTPRKTSSFHHGRFGWDKPF  192

Query  324  EDSMDYNEVEAPNAPRQTRVPKLRLSH-KKLSGIAVALF  211
            +   D  E+EAP AP Q R    R++H K  SG++VALF
Sbjct  193  DAENDDEEIEAPGAPLQKRYRLSRVNHDKDDSGVSVALF  231



>ref|XP_010473341.1| PREDICTED: F-box protein At1g61340-like [Camelina sativa]
Length=189

 Score = 94.0 bits (232),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 50/98 (51%), Positives = 67/98 (68%), Gaps = 4/98 (4%)
 Frame = -1

Query  492  QDVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTPRKTMDSQNVVVGFEDSM  313
            QD+L+RII GVDH+DL +LF VSKTI+E T IAK+ HF YSTPRKT    +   G++   
Sbjct  91   QDILVRIICGVDHEDLKQLFQVSKTIKEATSIAKELHFAYSTPRKTSSFHHGGFGWDKPF  150

Query  312  DYN---EVEAPNAPRQTRVPKLRLS-HKKLSGIAVALF  211
            D +   E+EAP AP Q R    R++ ++  SG++VALF
Sbjct  151  DADNDEEIEAPGAPLQKRYRLSRINRNEDDSGVSVALF  188



>ref|XP_010418105.1| PREDICTED: F-box protein At1g61340-like [Camelina sativa]
Length=190

 Score = 92.8 bits (229),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 50/98 (51%), Positives = 66/98 (67%), Gaps = 4/98 (4%)
 Frame = -1

Query  492  QDVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTPRKTMDSQNVVVGFEDSM  313
            QD+L+RII GV+H+DL +LF VSKTI+E T IAK+ HF YSTPRKT    +   G++   
Sbjct  92   QDILVRIICGVEHEDLKQLFQVSKTIKEATSIAKELHFAYSTPRKTSSFHHGAFGWDKPF  151

Query  312  DY---NEVEAPNAPRQTRVPKLRLS-HKKLSGIAVALF  211
            D     E+EAP AP Q R    R++ ++  SGI+VALF
Sbjct  152  DAEYDEEIEAPGAPLQKRYRLSRINRNEDDSGISVALF  189



>ref|XP_008439907.1| PREDICTED: F-box protein At4g05010-like [Cucumis melo]
Length=190

 Score = 92.0 bits (227),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 49/94 (52%), Positives = 66/94 (70%), Gaps = 2/94 (2%)
 Frame = -1

Query  492  QDVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTPRKTMDSQNVVVGFEDSM  313
            Q++LIR++ GV+HDDL +L  VSKTI E T+IAK  HF YSTP K + +    +   DS 
Sbjct  81   QEILIRVLCGVEHDDLKQLIRVSKTISEATLIAKDSHFAYSTPSK-VRAFRTAIELNDSS  139

Query  312  DYNEVEAPNAPRQTRVPKLRLSHKKLSGIAVALF  211
            D++E+EAPNA R TR  +  L+ KKL+ I+VALF
Sbjct  140  DFDEIEAPNA-RPTRRFRSPLNRKKLAEISVALF  172



>ref|XP_007159251.1| hypothetical protein PHAVU_002G222100g [Phaseolus vulgaris]
 gb|ESW31245.1| hypothetical protein PHAVU_002G222100g [Phaseolus vulgaris]
Length=152

 Score = 90.9 bits (224),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/93 (47%), Positives = 64/93 (69%), Gaps = 2/93 (2%)
 Frame = -1

Query  489  DVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTPRKTMDSQNVVVGFEDSMD  310
            ++L++++ GVDH+DL +L  VSKTIRE T IA+K +FEYSTP+K     ++  G + + +
Sbjct  54   EILVKVLCGVDHEDLEQLVRVSKTIREATEIARKVNFEYSTPKKRTFPISIPFGVDGASE  113

Query  309  YNEVEAPNAPRQTRVPKLRLSHKKLSGIAVALF  211
            + E+EAPNAP   R PK +   K LS I +ALF
Sbjct  114  FQEIEAPNAP--LRRPKSKFIGKNLSSITMALF  144



>emb|CDY03828.1| BnaC01g29450D [Brassica napus]
Length=227

 Score = 92.4 bits (228),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 48/93 (52%), Positives = 64/93 (69%), Gaps = 3/93 (3%)
 Frame = -1

Query  483  LIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTPRKTMDSQNVVVGFEDSMDYN  304
            L++II GV+H+DL +LFHVSKTIRE T+IAK+ HF YSTPRKT+  Q    G +   D+ 
Sbjct  135  LVKIICGVEHEDLKQLFHVSKTIREATLIAKQSHFAYSTPRKTLVFQLGRYGLDKPFDFG  194

Query  303  E--VEAPNAPRQTRVPKLRLSHKKLSGIAVALF  211
            E  +EAP AP Q R  ++  +    SG++VALF
Sbjct  195  EDKIEAPAAPLQKRYRRINRNEDN-SGVSVALF  226



>ref|XP_010458511.1| PREDICTED: F-box protein At1g61340-like [Camelina sativa]
Length=167

 Score = 90.9 bits (224),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 48/96 (50%), Positives = 70/96 (73%), Gaps = 8/96 (8%)
 Frame = -1

Query  492  QDVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTPRKTMDSQNVVVGFEDSM  313
            QD+L+RII GV+H+ L +LF+VSKTIRE T+IAKK HFEY+TPRKT+ S+    G E  +
Sbjct  77   QDILVRIICGVEHEYLKQLFNVSKTIREATLIAKKSHFEYTTPRKTLFSRR--SGLESMI  134

Query  312  DYNEVEAPNAPRQ--TRVPKLRLSHKKLSGIAVALF  211
            + ++++AP   +   +R+    L HKK+S I++ALF
Sbjct  135  EGDKIKAPLQKKYGFSRI----LCHKKVSKISMALF  166



>ref|XP_004155583.1| PREDICTED: F-box protein SKIP27-like [Cucumis sativus]
Length=190

 Score = 90.9 bits (224),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 48/96 (50%), Positives = 66/96 (69%), Gaps = 6/96 (6%)
 Frame = -1

Query  492  QDVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTPRKTMDSQNVVVGFEDSM  313
            Q++LIR++ GV+HDDL +L  VSKTI E T+IAK  HF YSTP K    +   +  +DS 
Sbjct  81   QEILIRVLCGVEHDDLKQLIRVSKTINEATLIAKDSHFAYSTPSKVRRFRT-AIELDDSS  139

Query  312  DYNEVEAPNA--PRQTRVPKLRLSHKKLSGIAVALF  211
            D++E+EAPNA   R+ R P   L+ KKL+ I++ALF
Sbjct  140  DFDEIEAPNACPTRRFRTP---LNRKKLAEISIALF  172



>emb|CDY15010.1| BnaCnng04130D [Brassica napus]
Length=181

 Score = 90.5 bits (223),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 51/99 (52%), Positives = 65/99 (66%), Gaps = 10/99 (10%)
 Frame = -1

Query  489  DVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTPRKTMDSQ------NVVVG  328
            D+L+RII  V+H+DL +LFHVSKT+RE T+IAK+ HF YSTPRKT   Q      +   G
Sbjct  86   DILVRIICRVEHEDLKQLFHVSKTVREATLIAKQSHFAYSTPRKTSVFQHRRFSLDKPFG  145

Query  327  FEDSMDYNEVEAPNAPRQTRVPKLRLSHKKLSGIAVALF  211
              D  DY E+EAP AP Q R    R  ++  SG++VALF
Sbjct  146  LGDGDDY-EIEAPGAPLQKR---YRYRNEDDSGVSVALF  180



>emb|CDX97944.1| BnaA06g06950D [Brassica napus]
Length=147

 Score = 89.4 bits (220),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 51/96 (53%), Positives = 66/96 (69%), Gaps = 11/96 (11%)
 Frame = -1

Query  492  QDVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTPRKTMDSQNVVVGFEDSM  313
            QD+LIRII GV+H DL +LF+VSKTIRE T+IAKK HFEY TPRKT+        F + +
Sbjct  60   QDILIRIICGVEHGDLKQLFNVSKTIREATLIAKKSHFEYITPRKTLF-------FRNKV  112

Query  312  DY--NEVEAPNAPRQTRVPKLRLSHKKLSGIAVALF  211
            D+  NE E P   ++TR+ ++    KK S I+VALF
Sbjct  113  DHLGNETEVP-LKKKTRLSRIS-CEKKASKISVALF  146



>ref|XP_004134730.1| PREDICTED: F-box protein SKIP27-like [Cucumis sativus]
 gb|KGN49188.1| hypothetical protein Csa_6G516960 [Cucumis sativus]
Length=190

 Score = 90.1 bits (222),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 48/96 (50%), Positives = 66/96 (69%), Gaps = 6/96 (6%)
 Frame = -1

Query  492  QDVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTPRKTMDSQNVVVGFEDSM  313
            Q++LIR++ GV+HDDL +L  VSKTI E T+IAK  HF YSTP K    +   +  +DS 
Sbjct  81   QEILIRVLCGVEHDDLKQLIRVSKTINEATLIAKDSHFAYSTPSKVRRFRT-AIELDDSS  139

Query  312  DYNEVEAPNA--PRQTRVPKLRLSHKKLSGIAVALF  211
            D++E+EAPNA   R+ R P   L+ KKL+ I++ALF
Sbjct  140  DFDEIEAPNACPTRRFRTP---LNRKKLAEISIALF  172



>ref|XP_002274518.1| PREDICTED: F-box protein At1g61340-like [Vitis vinifera]
Length=172

 Score = 89.7 bits (221),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 57/118 (48%), Positives = 84/118 (71%), Gaps = 1/118 (1%)
 Frame = -1

Query  564  TETSKHCREVsfpssekpsleslPQDVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKW  385
            T   + C E+    +EK  LE++PQD+LIRI+ GVDHDDL +LFHVS TIR+ T+IAKK 
Sbjct  51   TPLKRRCGEMVEEKAEKSMLEAMPQDILIRILCGVDHDDLKQLFHVSNTIRDATLIAKKS  110

Query  384  HFEYSTPRKTMDSQNVVVGFEDSMDYNEVEAPNAPRQTRVPKLRLSHKKLSGIAVALF  211
            HF +STP K    ++  +  E+S  +++++ P+AP+Q+R  + RL  ++LSGIA+ALF
Sbjct  111  HFAFSTPSKVQTFRS-PLDPEESSGFDDLQTPDAPKQSRHFRSRLRGRRLSGIAIALF  167



>ref|XP_009148455.1| PREDICTED: F-box protein At1g61340-like isoform X2 [Brassica 
rapa]
 ref|XP_009148456.1| PREDICTED: F-box protein At1g61340-like isoform X2 [Brassica 
rapa]
Length=147

 Score = 89.4 bits (220),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 51/96 (53%), Positives = 66/96 (69%), Gaps = 11/96 (11%)
 Frame = -1

Query  492  QDVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTPRKTMDSQNVVVGFEDSM  313
            QD+LIRII GV+H DL +LF+VSKTIRE T+IAKK HFEY TPRKT+        F + +
Sbjct  60   QDILIRIICGVEHGDLKQLFNVSKTIREATLIAKKSHFEYITPRKTLF-------FRNKV  112

Query  312  DY--NEVEAPNAPRQTRVPKLRLSHKKLSGIAVALF  211
            D+  NE E P   ++TR+ ++    KK S I+VALF
Sbjct  113  DHLGNETEVP-LKKKTRLSRIS-CEKKASKISVALF  146



>emb|CBI23307.3| unnamed protein product [Vitis vinifera]
Length=113

 Score = 87.8 bits (216),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 49/94 (52%), Positives = 71/94 (76%), Gaps = 1/94 (1%)
 Frame = -1

Query  492  QDVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTPRKTMDSQNVVVGFEDSM  313
            QD+LIRI+ GVDHDDL +LFHVS TIR+ T+IAKK HF +STP K    ++ +   E+S 
Sbjct  16   QDILIRILCGVDHDDLKQLFHVSNTIRDATLIAKKSHFAFSTPSKVQTFRSPLDP-EESS  74

Query  312  DYNEVEAPNAPRQTRVPKLRLSHKKLSGIAVALF  211
             +++++ P+AP+Q+R  + RL  ++LSGIA+ALF
Sbjct  75   GFDDLQTPDAPKQSRHFRSRLRGRRLSGIAIALF  108



>ref|XP_003529294.1| PREDICTED: F-box protein At1g61340-like [Glycine max]
 gb|KHN07320.1| F-box protein [Glycine soja]
Length=155

 Score = 89.0 bits (219),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 45/93 (48%), Positives = 61/93 (66%), Gaps = 2/93 (2%)
 Frame = -1

Query  489  DVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTPRKTMDSQNVVVGFEDSMD  310
            DVLIR++ GVDH+DL +L  VSKT+RE   IA++ HFEYSTP+K   +       E +  
Sbjct  61   DVLIRVLCGVDHEDLEQLVRVSKTVREAAEIARRMHFEYSTPKKKTFALPKPFDIEGAGG  120

Query  309  YNEVEAPNAPRQTRVPKLRLSHKKLSGIAVALF  211
            + E++ PNAP   R PK +L  K L+ I+VALF
Sbjct  121  FEEIDTPNAP--LRKPKSKLIGKNLASISVALF  151



>ref|XP_006303809.1| hypothetical protein CARUB_v10012241mg [Capsella rubella]
 gb|EOA36707.1| hypothetical protein CARUB_v10012241mg [Capsella rubella]
Length=173

 Score = 89.4 bits (220),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 49/98 (50%), Positives = 66/98 (67%), Gaps = 12/98 (12%)
 Frame = -1

Query  492  QDVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTPRKTMDSQ---NVVVGFE  322
            QD+L++II GV+H+DL +LF+VSKTIRE T+IAKKWHFEY+TPRKT+ S+   + V+G  
Sbjct  83   QDILVKIICGVEHEDLKQLFNVSKTIREATLIAKKWHFEYTTPRKTLFSRSGIDAVIGSR  142

Query  321  DSMDYNEVEAPNAPRQTRVPKLRL-SHKKLSGIAVALF  211
            D +         AP   +    RL   K +S I+VALF
Sbjct  143  DKIK--------APLLKKYGFSRLICSKNVSKISVALF  172



>ref|XP_006417374.1| hypothetical protein EUTSA_v10009722mg [Eutrema salsugineum]
 gb|ESQ35727.1| hypothetical protein EUTSA_v10009722mg [Eutrema salsugineum]
Length=164

 Score = 88.2 bits (217),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 47/94 (50%), Positives = 68/94 (72%), Gaps = 6/94 (6%)
 Frame = -1

Query  489  DVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTPRKTMDSQNVVVGFEDSMD  310
            D+L+RII GV+H+DL +LF+VSKTIRE T+IAK WHFEYSTPRKT+  +    G +  +D
Sbjct  75   DILVRIICGVEHEDLKQLFNVSKTIREATLIAKNWHFEYSTPRKTLFFRG---GCDSMID  131

Query  309  Y-NEVEAPNAPRQTRVPKLRLSHKKLSGIAVALF  211
              +E++AP   ++ R  ++ +  KK S I++ALF
Sbjct  132  LGDEIQAP-ILKKYRFSRI-ICDKKFSKISMALF  163



>ref|XP_010430148.1| PREDICTED: F-box protein At1g61340-like [Camelina sativa]
Length=192

 Score = 88.6 bits (218),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 49/99 (49%), Positives = 64/99 (65%), Gaps = 5/99 (5%)
 Frame = -1

Query  492  QDVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTPRKTMDSQNVVVG----F  325
            QD+L+RII GV+H+DL +LF VSKTI+E T IAK+ HF YSTPRK         G    F
Sbjct  93   QDILVRIICGVEHEDLKQLFQVSKTIKEATSIAKELHFAYSTPRKASSFNLGGFGWDKRF  152

Query  324  EDSMDYNEVEAPNAPRQTRVPKLRLS-HKKLSGIAVALF  211
            +   D  E+EAP AP Q R    R++ ++  SG++VALF
Sbjct  153  DAENDDEEIEAPGAPLQKRYRLSRINRNEDDSGVSVALF  191



>ref|XP_009148454.1| PREDICTED: F-box protein At1g61340-like isoform X1 [Brassica 
rapa]
Length=195

 Score = 87.4 bits (215),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 52/94 (55%), Positives = 66/94 (70%), Gaps = 7/94 (7%)
 Frame = -1

Query  492  QDVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTPRKTMDSQNVVVGFEDSM  313
            QD+LIRII GV+H DL +LF+VSKTIRE T+IAKK HFEY TPRKT+  +N V    D +
Sbjct  108  QDILIRIICGVEHGDLKQLFNVSKTIREATLIAKKSHFEYITPRKTLFFRNKV----DHL  163

Query  312  DYNEVEAPNAPRQTRVPKLRLSHKKLSGIAVALF  211
              NE E P   ++TR+ ++    KK S I+VALF
Sbjct  164  G-NETEVP-LKKKTRLSRIS-CEKKASKISVALF  194



>emb|CDY19351.1| BnaC05g08600D [Brassica napus]
Length=147

 Score = 86.3 bits (212),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 49/96 (51%), Positives = 65/96 (68%), Gaps = 11/96 (11%)
 Frame = -1

Query  492  QDVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTPRKTMDSQNVVVGFEDSM  313
            QD+LIR+I GV+H DL +LF+VSKTIRE T+IAKK HFEY TPRKT+        F D +
Sbjct  60   QDILIRVICGVEHGDLKQLFNVSKTIREATLIAKKSHFEYITPRKTL-------FFRDEL  112

Query  312  DY--NEVEAPNAPRQTRVPKLRLSHKKLSGIAVALF  211
            D+  +E E P   ++ R+ ++    KK S I+VALF
Sbjct  113  DHLGDETEVP-LKKKCRLSRIS-CEKKASKISVALF  146



>gb|AAO39934.1| At1g61340 [Arabidopsis thaliana]
Length=185

 Score = 86.7 bits (213),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 52/98 (53%), Positives = 68/98 (69%), Gaps = 5/98 (5%)
 Frame = -1

Query  489  DVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTPRKTMDSQNVVVGFEDSM-  313
            D+L+RII GV+H+DL +LFHVSKTIRE TMIAK+ HF YSTPRKT    +   G+++   
Sbjct  87   DILVRIICGVEHEDLKQLFHVSKTIREATMIAKQSHFAYSTPRKTSVFHHGRFGWDNPFD  146

Query  312  ---DYNEVEAPNAPRQTRVPKLRLS-HKKLSGIAVALF  211
               D  E+EAP AP Q R    R++ +K  SG++VALF
Sbjct  147  VEDDDEEIEAPGAPLQKRYRLSRINRNKDDSGVSVALF  184



>ref|NP_176329.1| F-box stress induced 1 [Arabidopsis thaliana]
 sp|Q8GX77.1|FB316_ARATH RecName: Full=F-box protein At1g61340 [Arabidopsis thaliana]
 dbj|BAC43001.1| unknown protein [Arabidopsis thaliana]
 gb|AEE33822.1| F-box protein [Arabidopsis thaliana]
Length=185

 Score = 86.7 bits (213),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 53/98 (54%), Positives = 67/98 (68%), Gaps = 5/98 (5%)
 Frame = -1

Query  489  DVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTPRKTMDSQNVVVG----FE  322
            D+L+RII GV+H+DL +LFHVSKTIRE TMIAK+ HF YSTPRKT    +   G    F+
Sbjct  87   DILVRIICGVEHEDLKQLFHVSKTIREATMIAKQSHFAYSTPRKTSVFHHGRFGWDKPFD  146

Query  321  DSMDYNEVEAPNAPRQTRVPKLRLS-HKKLSGIAVALF  211
               D  E+EAP AP Q R    R++ +K  SG++VALF
Sbjct  147  VEDDDEEIEAPGAPLQKRYRLSRINRNKDDSGVSVALF  184



>emb|CDY72037.1| BnaAnng39710D [Brassica napus]
Length=214

 Score = 86.7 bits (213),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 49/98 (50%), Positives = 63/98 (64%), Gaps = 10/98 (10%)
 Frame = -1

Query  486  VLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTPRKTMDSQNVVVGFE-----  322
            +L+RII GV+H+DL +LFHVSK +RE T+IAK+ HF YSTPRKT   +    G +     
Sbjct  120  ILLRIICGVEHEDLKQLFHVSKAVREATLIAKQSHFAYSTPRKTSVFERSRFGLDKPSGL  179

Query  321  -DSMDYNEVEAPNAPRQTRVPKLRLSHKKLSGIAVALF  211
             D  DY E+EAP AP Q R    R   +  SG++VALF
Sbjct  180  GDGDDY-EIEAPAAPLQKRY---RSRDEDNSGVSVALF  213



>ref|XP_010052379.1| PREDICTED: F-box protein SKIP27-like [Eucalyptus grandis]
 gb|KCW76341.1| hypothetical protein EUGRSUZ_D00712 [Eucalyptus grandis]
Length=206

 Score = 86.3 bits (212),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 43/94 (46%), Positives = 61/94 (65%), Gaps = 3/94 (3%)
 Frame = -1

Query  492  QDVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTPRKTMDSQNVVVGFEDSM  313
            QD+LIRI+  V+H DL +L  VS+TI+E T++AK+WHF Y TP K    +N  +  ++  
Sbjct  98   QDILIRILCRVEHGDLKQLVRVSRTIKEATVVAKQWHFAYKTPTKIRAFRN-SIDLQNPS  156

Query  312  DYNEVEAPNAPRQTRVPKLRLSHKKLSGIAVALF  211
            D  E+EAPNAP   R  + R+S KKL+ +   LF
Sbjct  157  DCEEIEAPNAP--LRTFRSRISRKKLADVTAVLF  188



>ref|XP_002888090.1| F-box family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH64349.1| F-box family protein [Arabidopsis lyrata subsp. lyrata]
Length=186

 Score = 85.5 bits (210),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 52/99 (53%), Positives = 66/99 (67%), Gaps = 6/99 (6%)
 Frame = -1

Query  489  DVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTPRKTMDSQNVVVG----FE  322
            D+L+RII GVDH+DL +LFHVSKTIRE T+IAK+ HF Y+TPRKT    +   G    F+
Sbjct  87   DILVRIICGVDHEDLKQLFHVSKTIREATLIAKQSHFAYNTPRKTSVFHHGGFGWDKPFD  146

Query  321  DSMDYNEVEAPNAPRQTRVPKLRLSHKK--LSGIAVALF  211
               D  E+EAP AP Q R    R++  K   SG++VALF
Sbjct  147  VEDDDEEIEAPGAPLQKRYRLSRINRNKDDDSGVSVALF  185



>ref|XP_010533863.1| PREDICTED: F-box protein At1g61340-like [Tarenaya hassleriana]
Length=180

 Score = 85.5 bits (210),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 43/93 (46%), Positives = 65/93 (70%), Gaps = 1/93 (1%)
 Frame = -1

Query  489  DVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTPRKTMDSQNVVVGFEDSMD  310
            D+L+R++ GV+H+DL +LFHVSKTIRE T++AK  HF Y+TP+KT+  +  +     +  
Sbjct  86   DILVRVLCGVEHEDLKQLFHVSKTIREATLVAKHSHFAYTTPKKTLVFRGELNPDGPTER  145

Query  309  YNEVEAPNAPRQTRVPK-LRLSHKKLSGIAVAL  214
             +EVEAP AP+  R  + LR+  K+LS I++ L
Sbjct  146  GDEVEAPTAPKARRYRRNLRIKDKELSTISIHL  178



>emb|CDX79068.1| BnaA01g11350D [Brassica napus]
Length=207

 Score = 85.5 bits (210),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 47/95 (49%), Positives = 67/95 (71%), Gaps = 3/95 (3%)
 Frame = -1

Query  492  QDVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTPRKTMDSQNVVVGFED-S  316
            Q++LIR++ GVDH+DL  L  VSK+IRE ++IAK+ HF Y+TP+KT  S+N  + FED S
Sbjct  114  QELLIRVVCGVDHEDLKSLNIVSKSIREASLIAKELHFSYTTPKKTRASRN-QLAFEDSS  172

Query  315  MDYNEVEAPNAPRQTRVPKLRLSHKKLSGIAVALF  211
                +VE PNAP + R  K +   ++LS ++VALF
Sbjct  173  QQVEDVEPPNAPVRHRWTKAK-RKEELSNVSVALF  206



>emb|CDX82831.1| BnaC01g12810D [Brassica napus]
Length=207

 Score = 85.5 bits (210),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 47/95 (49%), Positives = 67/95 (71%), Gaps = 3/95 (3%)
 Frame = -1

Query  492  QDVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTPRKTMDSQNVVVGFED-S  316
            Q++LIR++ GVDH+DL  L  VSK+IRE ++IAK+ HF Y+TP+KT  S+N  + FED S
Sbjct  114  QELLIRVVCGVDHEDLKSLNIVSKSIREASLIAKELHFSYTTPKKTRASRN-QLAFEDSS  172

Query  315  MDYNEVEAPNAPRQTRVPKLRLSHKKLSGIAVALF  211
                +VE PNAP + R  K +   ++LS ++VALF
Sbjct  173  QQVEDVEPPNAPVRHRWTKAK-RKEELSNVSVALF  206



>ref|XP_009134834.1| PREDICTED: F-box protein SKIP27 [Brassica rapa]
Length=207

 Score = 85.5 bits (210),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 47/95 (49%), Positives = 67/95 (71%), Gaps = 3/95 (3%)
 Frame = -1

Query  492  QDVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTPRKTMDSQNVVVGFED-S  316
            Q++LIR++ GVDH+DL  L  VSK+IRE ++IAK+ HF Y+TP+KT  S+N  + FED S
Sbjct  114  QELLIRVVCGVDHEDLKSLNIVSKSIREASLIAKELHFSYTTPKKTRASRN-QLAFEDSS  172

Query  315  MDYNEVEAPNAPRQTRVPKLRLSHKKLSGIAVALF  211
                +VE PNAP + R  K +   ++LS ++VALF
Sbjct  173  QQVEDVEPPNAPVRHRWTKAK-RKEELSNVSVALF  206



>ref|XP_007148244.1| hypothetical protein PHAVU_006G192100g [Phaseolus vulgaris]
 gb|ESW20238.1| hypothetical protein PHAVU_006G192100g [Phaseolus vulgaris]
Length=225

 Score = 84.0 bits (206),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/94 (45%), Positives = 61/94 (65%), Gaps = 3/94 (3%)
 Frame = -1

Query  492  QDVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTPRKTMDSQNVVVGFEDSM  313
            Q++L++++ GVDH+DL +LFHVSKTIRE T+IAK  HFEYSTP+K   +       E+  
Sbjct  131  QEILVQVLCGVDHEDLKQLFHVSKTIREATLIAKDLHFEYSTPKKKTFAFLNPSDLENPN  190

Query  312  DYNEVEAPNAPRQTRVPKLRLSHKKLSGIAVALF  211
             + E+E P AP +   P+    +  L+ I +ALF
Sbjct  191  VFKEIETPKAPLRKSKPRW---NANLADITMALF  221



>ref|NP_001185279.1| F-box stress induced 1 [Arabidopsis thaliana]
 gb|AEE33823.1| F-box protein [Arabidopsis thaliana]
Length=231

 Score = 83.6 bits (205),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 52/97 (54%), Positives = 66/97 (68%), Gaps = 5/97 (5%)
 Frame = -1

Query  486  VLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTPRKTMDSQNVVVG----FED  319
            V++RII GV+H+DL +LFHVSKTIRE TMIAK+ HF YSTPRKT    +   G    F+ 
Sbjct  134  VIVRIICGVEHEDLKQLFHVSKTIREATMIAKQSHFAYSTPRKTSVFHHGRFGWDKPFDV  193

Query  318  SMDYNEVEAPNAPRQTRVPKLRLS-HKKLSGIAVALF  211
              D  E+EAP AP Q R    R++ +K  SG++VALF
Sbjct  194  EDDDEEIEAPGAPLQKRYRLSRINRNKDDSGVSVALF  230



>gb|KHN08585.1| F-box protein, partial [Glycine soja]
Length=156

 Score = 82.0 bits (201),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 44/86 (51%), Positives = 56/86 (65%), Gaps = 2/86 (2%)
 Frame = -1

Query  492  QDVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTPRKTMDSQNVVVGFEDSM  313
            QDVL++++ GVDH+DL +LFHVSKTIRE T + KK HF+ STP+K           ED  
Sbjct  57   QDVLVQVLCGVDHEDLKQLFHVSKTIREATTVVKKLHFDISTPKKKTFGFLNPFDLEDVN  116

Query  312  DYNEVEAPNAPRQTRVPKLRLSHKKL  235
             + E+EAPN  R  R  K RL+ KKL
Sbjct  117  GFEEIEAPN--RVLRKAKSRLNRKKL  140



>ref|XP_006595415.1| PREDICTED: F-box protein At1g61340-like [Glycine max]
Length=152

 Score = 81.6 bits (200),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 44/86 (51%), Positives = 56/86 (65%), Gaps = 2/86 (2%)
 Frame = -1

Query  492  QDVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTPRKTMDSQNVVVGFEDSM  313
            QDVL++++ GVDH+DL +LFHVSKTIRE T + KK HF+ STP+K           ED  
Sbjct  53   QDVLVQVLCGVDHEDLKQLFHVSKTIREATTVVKKLHFDISTPKKKTFGFLNPFDLEDVN  112

Query  312  DYNEVEAPNAPRQTRVPKLRLSHKKL  235
             + E+EAPN  R  R  K RL+ KKL
Sbjct  113  GFEEIEAPN--RVLRKAKSRLNRKKL  136



>ref|XP_010449053.1| PREDICTED: F-box protein SKIP27-like [Camelina sativa]
Length=223

 Score = 82.8 bits (203),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 46/97 (47%), Positives = 63/97 (65%), Gaps = 4/97 (4%)
 Frame = -1

Query  492  QDVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTPRKTMDSQNVVVGFE---  322
            QD+LIR+I GVDHDDL  L  VSK+IRE +++AK  HF Y+TPRKT   +N +   E   
Sbjct  127  QDLLIRVICGVDHDDLKSLKLVSKSIREASLVAKSLHFAYTTPRKTRAFRNSIDLEEVSD  186

Query  321  DSMDYNEVEAPNAPRQTRVPKLRLSHKKLSGIAVALF  211
             S   +++E PNAP   R  K +   ++LS ++VALF
Sbjct  187  SSRQEDDIEPPNAPHHYRWTKAK-RKEQLSSVSVALF  222



>ref|XP_010439469.1| PREDICTED: F-box protein SKIP27-like [Camelina sativa]
Length=223

 Score = 82.8 bits (203),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 46/97 (47%), Positives = 63/97 (65%), Gaps = 4/97 (4%)
 Frame = -1

Query  492  QDVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTPRKTMDSQNVV--VGFED  319
            QD+ IR+I GVDHDDL  L  VSK+IRE +++AK  HF Y+TPRKT   +N +    F D
Sbjct  127  QDLFIRVICGVDHDDLKSLKLVSKSIREASLVAKSLHFAYTTPRKTRAFRNSIDLEEFSD  186

Query  318  -SMDYNEVEAPNAPRQTRVPKLRLSHKKLSGIAVALF  211
             S   +++E PNAP   R  K +   ++LS ++VALF
Sbjct  187  SSRQEDDIEPPNAPNHYRWTKAK-RREQLSSVSVALF  222



>ref|XP_010529398.1| PREDICTED: F-box protein SKIP27 [Tarenaya hassleriana]
Length=201

 Score = 82.4 bits (202),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 45/99 (45%), Positives = 65/99 (66%), Gaps = 5/99 (5%)
 Frame = -1

Query  492  QDVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTPRKTMDSQNVVVGFEDSM  313
            QD+LIR++ GV+HDDL RLF VSK+++E   IAK+ HF +STP+KT   +N +   E S 
Sbjct  102  QDLLIRVLCGVNHDDLQRLFLVSKSVKEAASIAKRSHFAFSTPKKTPAFRNPIDFDEVSR  161

Query  312  DYNEV-EAPNAPRQTR----VPKLRLSHKKLSGIAVALF  211
            D ++V + PNAP Q +     P  +   K LS +++ALF
Sbjct  162  DSDDVIDPPNAPIQRKTYREAPWTKNKRKDLSSVSMALF  200



>ref|XP_006282705.1| hypothetical protein CARUB_v10005669mg [Capsella rubella]
 gb|EOA15603.1| hypothetical protein CARUB_v10005669mg [Capsella rubella]
Length=227

 Score = 82.0 bits (201),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 46/97 (47%), Positives = 62/97 (64%), Gaps = 4/97 (4%)
 Frame = -1

Query  492  QDVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTPRKTMDSQNVVVGFE---  322
            QD+LIR+I GVDHDDL  L  VS +IRE ++IAK+ HF Y+TPRKT   +N +   E   
Sbjct  131  QDLLIRVICGVDHDDLKSLKLVSTSIREASLIAKRLHFAYTTPRKTRAFRNSIKLEEISD  190

Query  321  DSMDYNEVEAPNAPRQTRVPKLRLSHKKLSGIAVALF  211
             S    ++E PNAP   R  K +   ++LS ++VALF
Sbjct  191  PSHQEEDIEPPNAPNHYRWTKAK-RKEQLSSVSVALF  226



>gb|KHG11247.1| F-box SKIP27 -like protein [Gossypium arboreum]
Length=174

 Score = 80.9 bits (198),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 46/97 (47%), Positives = 60/97 (62%), Gaps = 21/97 (22%)
 Frame = -1

Query  492  QDVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTPRKTMDSQNVVVGFEDSM  313
            QD++I+II GVDH+DL+RL  VSK+IRE  M+AK+ HF YSTP K       V  F+ S+
Sbjct  82   QDIIIKIICGVDHEDLNRLPIVSKSIREAAMVAKQLHFAYSTPTK-------VKAFKTSI  134

Query  312  DYN--------EVEAPNAPRQTRVPKLRLSHKKLSGI  226
            D++        E+EAPNAP+Q R      SH  L  I
Sbjct  135  DFDEQSESNDLELEAPNAPQQWR------SHSALQAI  165



>emb|CAA18715.1| hypothetical protein [Arabidopsis thaliana]
 emb|CAB81258.1| hypothetical protein [Arabidopsis thaliana]
Length=192

 Score = 80.9 bits (198),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 46/104 (44%), Positives = 62/104 (60%), Gaps = 18/104 (17%)
 Frame = -1

Query  492  QDVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTPRKTMDSQNVVVGFEDSM  313
            QD+LIR+I GVDH+DL  L  VSK+IRE +++AK  HF Y+TP+KT         F +S+
Sbjct  96   QDLLIRVICGVDHEDLKSLKLVSKSIREASLVAKTLHFAYTTPKKTR-------AFRNSI  148

Query  312  DYNEV----------EAPNAPRQTRVPKLRLSHKKLSGIAVALF  211
            D  EV          E PNAPR  R  K +   ++LS ++ ALF
Sbjct  149  DLEEVSDSRHQEDDIEPPNAPRHYRWTKAK-RKEQLSSVSAALF  191



>gb|ACJ85993.1| unknown [Medicago truncatula]
Length=144

 Score = 79.7 bits (195),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/78 (49%), Positives = 55/78 (71%), Gaps = 1/78 (1%)
 Frame = -1

Query  492  QDVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTPRKTMDSQNVVVGFEDSM  313
            QD+L+R++ GVDHDDL +LF+VS TI+E   IAK+ HFE+STP+K+  +       E+  
Sbjct  68   QDLLVRVLCGVDHDDLEQLFNVSTTIKEAGEIAKQMHFEFSTPKKSSVAVRSPFDIENGF  127

Query  312  DYNEVEAPNAPRQTRVPK  259
            D +E+EAPNAP  ++  K
Sbjct  128  D-DEIEAPNAPLMSKKSK  144



>ref|XP_009114516.1| PREDICTED: F-box protein At4g05010 [Brassica rapa]
Length=170

 Score = 80.1 bits (196),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 45/102 (44%), Positives = 63/102 (62%), Gaps = 12/102 (12%)
 Frame = -1

Query  492  QDVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTPRKTMDSQNVVVGFEDSM  313
            QD+LIR++  VDHDDL+RL  VSKTIR   + AKK HF+YSTP+KT+  ++ +V   +  
Sbjct  72   QDILIRVLCHVDHDDLARLKRVSKTIRNAVLEAKKSHFDYSTPKKTLSFRDPLVTLNEDS  131

Query  312  DYN-------EVEAPNAP-RQTRVPKLRLSHKKLSGIAVALF  211
            + N       E+E PNAP R+  V +       LS I++ LF
Sbjct  132  NSNSTSDQDDEIEPPNAPTRRKNVSR----ESDLSKISMVLF  169



>ref|XP_010905570.1| PREDICTED: F-box protein At1g61340-like [Elaeis guineensis]
 gb|ADO00336.1| F-box protein [Elaeis guineensis]
Length=178

 Score = 79.7 bits (195),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 45/94 (48%), Positives = 59/94 (63%), Gaps = 1/94 (1%)
 Frame = -1

Query  492  QDVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTPRKTMDSQNVVVGFEDSM  313
            QDVL+RI+  V+H DL +L  VSK +   T+IAK+ HF +STP      +      +  +
Sbjct  70   QDVLVRILCKVNHSDLKQLILVSKIVHGATLIAKEMHFAFSTPSSKPTFRREGNMGDIDL  129

Query  312  DYNEVEAPNAPRQTRVPKLRLSHKKLSGIAVALF  211
            + +E EAPNAP+Q RV K RL  K LS IAVALF
Sbjct  130  EVSE-EAPNAPKQRRVAKSRLGGKTLSSIAVALF  162



>ref|NP_567629.1| F-box stress induced protein 2 [Arabidopsis thaliana]
 sp|O65416.2|SKI27_ARATH RecName: Full=F-box protein SKIP27; AltName: Full=SKP1-interacting 
partner 27 [Arabidopsis thaliana]
 gb|ABK32197.1| At4g21510 [Arabidopsis thaliana]
 gb|AEE84461.1| F-box stress induced protein 2 [Arabidopsis thaliana]
Length=225

 Score = 80.5 bits (197),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 46/104 (44%), Positives = 62/104 (60%), Gaps = 18/104 (17%)
 Frame = -1

Query  492  QDVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTPRKTMDSQNVVVGFEDSM  313
            QD+LIR+I GVDH+DL  L  VSK+IRE +++AK  HF Y+TP+KT         F +S+
Sbjct  129  QDLLIRVICGVDHEDLKSLKLVSKSIREASLVAKTLHFAYTTPKKTR-------AFRNSI  181

Query  312  DYNEV----------EAPNAPRQTRVPKLRLSHKKLSGIAVALF  211
            D  EV          E PNAPR  R  K +   ++LS ++ ALF
Sbjct  182  DLEEVSDSRHQEDDIEPPNAPRHYRWTKAK-RKEQLSSVSAALF  224



>gb|EPS73870.1| f-box family protein, partial [Genlisea aurea]
Length=110

 Score = 78.2 bits (191),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 43/97 (44%), Positives = 63/97 (65%), Gaps = 4/97 (4%)
 Frame = -1

Query  492  QDVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTPRKTMDSQNVVVGFEDSM  313
            QD+LIRI+  V+HDDL RL  VS  ++E  + AK+ HF +STP+      N     ED +
Sbjct  15   QDLLIRIVCRVEHDDLKRLMLVSTAMKEAGLTAKELHFAFSTPKTRRRPLNFTKAEED-L  73

Query  312  DY--NEVEAPNAPRQTRVPKLR-LSHKKLSGIAVALF  211
             Y  +E EAPNAP ++R+ ++R L+ +KL+ I V+LF
Sbjct  74   RYSDDESEAPNAPGKSRLGRIRLLTSEKLASITVSLF  110



>emb|CDY16621.1| BnaA09g19990D [Brassica napus]
Length=170

 Score = 79.3 bits (194),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 44/102 (43%), Positives = 63/102 (62%), Gaps = 12/102 (12%)
 Frame = -1

Query  492  QDVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTPRKTMDSQNVVVGFEDSM  313
            QD+LIR++  VDHDDL+RL  VSKTIR   + AKK HF+YSTP+KT+  ++ +V   +  
Sbjct  72   QDILIRVLCHVDHDDLARLKRVSKTIRNAVLEAKKSHFDYSTPKKTLSFRDPLVTLNEDS  131

Query  312  DYN-------EVEAPNAP-RQTRVPKLRLSHKKLSGIAVALF  211
            + N       E+E PNAP R+  + +       LS I++ LF
Sbjct  132  NSNSTSDQDDEIEPPNAPTRRKNISR----ESDLSKISMVLF  169



>emb|CDY44748.1| BnaC09g22320D [Brassica napus]
Length=170

 Score = 77.8 bits (190),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 44/102 (43%), Positives = 62/102 (61%), Gaps = 12/102 (12%)
 Frame = -1

Query  492  QDVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTPRKTMDSQNVVVGFEDSM  313
            QD+LIR++  VDHDDL+RL  VSKTIR   + AKK HF+YSTP+K +  ++ +V   +  
Sbjct  72   QDILIRVLCHVDHDDLARLKRVSKTIRNAVLEAKKSHFDYSTPKKALSFRDPLVTLNEDS  131

Query  312  DYN-------EVEAPNAP-RQTRVPKLRLSHKKLSGIAVALF  211
            + N       E+E PNAP R+  V +       LS I++ LF
Sbjct  132  NSNSTSDQDDEIEPPNAPTRRKNVSR----ESGLSKISMVLF  169



>gb|KFK28733.1| hypothetical protein AALP_AA7G039900 [Arabis alpina]
Length=218

 Score = 78.2 bits (191),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 47/96 (49%), Positives = 64/96 (67%), Gaps = 5/96 (5%)
 Frame = -1

Query  492  QDVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTPRKTMDSQNVVVGFEDSM  313
            Q++LI++I  VDH+DL  L  VSK+I+E ++IAK  HF Y+TPRKT   +N  + FEDS 
Sbjct  125  QELLIKVIENVDHEDLISLCLVSKSIKEASLIAKSSHFAYTTPRKTRAFRN-PLDFEDS-  182

Query  312  DYNE--VEAPNAPRQTRVPKLRLSHKKLSGIAVALF  211
             Y E  +E P APR  R  K +   ++LS I+VALF
Sbjct  183  SYGEEDIEPPKAPRHYRWTKAK-RKEQLSSISVALF  217



>gb|AID21672.1| At4g21510p-like protein [Arabidopsis lyrata]
Length=231

 Score = 78.2 bits (191),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 44/97 (45%), Positives = 64/97 (66%), Gaps = 4/97 (4%)
 Frame = -1

Query  492  QDVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTPRKTMDSQNVVVGFE---  322
            Q++LIR+I GVDH+DL  L  VSK+IRE ++IAK+ HF Y+TP+KT   +N V   E   
Sbjct  135  QELLIRVICGVDHEDLKSLKLVSKSIREASLIAKRLHFAYTTPKKTRAFRNSVELEEISD  194

Query  321  DSMDYNEVEAPNAPRQTRVPKLRLSHKKLSGIAVALF  211
             S   ++++ PNAP   R  K +   ++LS ++VALF
Sbjct  195  SSHQEDDIKPPNAPSHYRWTKAK-RKEQLSSVSVALF  230



>ref|XP_008800393.1| PREDICTED: F-box protein At1g61340-like [Phoenix dactylifera]
Length=178

 Score = 77.4 bits (189),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 46/95 (48%), Positives = 58/95 (61%), Gaps = 3/95 (3%)
 Frame = -1

Query  492  QDVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTP-RKTMDSQNVVVGFEDS  316
            QDVL+RI+  V+H DL +L  VSK +   T+IAK+ HF +STP  K +  +   +G  D 
Sbjct  70   QDVLVRILCKVNHSDLKQLLLVSKIVHGATLIAKEMHFAFSTPSSKPIFRREGNIG--DF  127

Query  315  MDYNEVEAPNAPRQTRVPKLRLSHKKLSGIAVALF  211
                  EAPNAP+  RV K RL  K LS IAVALF
Sbjct  128  ASEVSEEAPNAPKGRRVAKSRLDRKTLSSIAVALF  162



>ref|XP_009416067.1| PREDICTED: F-box protein SKIP27 [Musa acuminata subsp. malaccensis]
Length=165

 Score = 77.0 bits (188),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 45/94 (48%), Positives = 58/94 (62%), Gaps = 9/94 (10%)
 Frame = -1

Query  492  QDVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTPRKTMDSQNVVVGFEDSM  313
            QD+L++I+  VDH DL +L  VSKT+   T+IAK+ HF +STP     S+ V    E S 
Sbjct  65   QDILVKILCKVDHSDLKQLVLVSKTVNGATLIAKRLHFAFSTP----SSKPVFRRHEIS-  119

Query  312  DYNEVEAPNAPRQTRVPKLRLSHKKLSGIAVALF  211
                 EAPNAP Q RV K RL   K+S +A+ALF
Sbjct  120  ----DEAPNAPMQQRVAKSRLDGGKVSSVAIALF  149



>ref|XP_004486263.1| PREDICTED: F-box protein SKIP27-like [Cicer arietinum]
Length=133

 Score = 75.5 bits (184),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 67/95 (71%), Gaps = 3/95 (3%)
 Frame = -1

Query  492  QDVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTPRK-TMDSQNVVVGFEDS  316
            QD+L+ ++ GVDHDDL +LFHVSKTIR+ T++ +K HF+++TP+K T+   N  +  + +
Sbjct  28   QDILLHVLCGVDHDDLKQLFHVSKTIRDATLLVEKSHFKFTTPKKNTLPFYNCDL-IDTN  86

Query  315  MDYNEVEAPNAPRQTRVPKLRLSHKKLSGIAVALF  211
              ++E+E  NAP + +  + + + ++LS I++ LF
Sbjct  87   YKFSEIEMSNAPLK-KPKESKFNSEELSEISMILF  120



>gb|ADP89474.1| FBS1, partial [Phaseolus vulgaris]
Length=98

 Score = 74.3 bits (181),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 30/45 (67%), Positives = 40/45 (89%), Gaps = 0/45 (0%)
 Frame = -1

Query  492  QDVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTPRK  358
            Q++L++++ GVDH+DL +LFHVSKTIRE T+IAK  HFEYSTP+K
Sbjct  53   QEILVQVLCGVDHEDLKQLFHVSKTIREATLIAKDLHFEYSTPKK  97



>ref|XP_006413772.1| hypothetical protein EUTSA_v10026245mg [Eutrema salsugineum]
 gb|ESQ55225.1| hypothetical protein EUTSA_v10026245mg [Eutrema salsugineum]
Length=209

 Score = 76.3 bits (186),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 42/94 (45%), Positives = 62/94 (66%), Gaps = 2/94 (2%)
 Frame = -1

Query  492  QDVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTPRKTMDSQNVVVGFEDSM  313
            Q++LIR+I GVDH+DL+ L  VSK+IRE ++IAK  HF Y+TP+KT  +    +  +D  
Sbjct  117  QELLIRVISGVDHEDLNSLNIVSKSIREASLIAKSLHFAYTTPKKTRQAFRNQIDLDDH-  175

Query  312  DYNEVEAPNAPRQTRVPKLRLSHKKLSGIAVALF  211
               ++E PNAP   R  K + S+++ S + VALF
Sbjct  176  QVEDIEPPNAPIHYRWTKAK-SNERESKVPVALF  208



>ref|XP_008806772.1| PREDICTED: F-box protein At1g61340-like [Phoenix dactylifera]
Length=172

 Score = 75.1 bits (183),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 44/95 (46%), Positives = 60/95 (63%), Gaps = 3/95 (3%)
 Frame = -1

Query  492  QDVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTP-RKTMDSQNVVVGFEDS  316
            QDV++RI+  V+H DL +L  VSK +   T+IAK+ HF +STP  + +  +    G  D 
Sbjct  70   QDVVVRILCKVNHSDLKQLLLVSKFVHGATLIAKEMHFAFSTPSSRPLFGRGRHTGDTDP  129

Query  315  MDYNEVEAPNAPRQTRVPKLRLSHKKLSGIAVALF  211
             + +E EAPNAP+Q RV + R   K LS IAVALF
Sbjct  130  -EVSE-EAPNAPKQQRVARSRFDEKTLSSIAVALF  162



>ref|XP_002463023.1| hypothetical protein SORBIDRAFT_02g036360 [Sorghum bicolor]
 gb|EER99544.1| hypothetical protein SORBIDRAFT_02g036360 [Sorghum bicolor]
Length=170

 Score = 74.7 bits (182),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 40/93 (43%), Positives = 59/93 (63%), Gaps = 7/93 (8%)
 Frame = -1

Query  492  QDVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTPRKTMDSQNVVVGFEDSM  313
            QDVLI+I+  V+H DL +L  VSK + E T++A++ HF++STP     +++V   F D  
Sbjct  74   QDVLIKILCKVNHSDLRQLLLVSKPVNEATIVARELHFKFSTP----SAKSV---FRDEE  126

Query  312  DYNEVEAPNAPRQTRVPKLRLSHKKLSGIAVAL  214
              ++ + P AP+Q RV + RL  K L GIAV L
Sbjct  127  TGDDEDGPGAPKQRRVARSRLRGKNLEGIAVNL  159



>ref|XP_009134327.1| PREDICTED: F-box protein At4g05010-like [Brassica rapa]
Length=178

 Score = 73.6 bits (179),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 44/99 (44%), Positives = 60/99 (61%), Gaps = 9/99 (9%)
 Frame = -1

Query  492  QDVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTPRKTMDSQNVVVGFEDSM  313
            QD+LIRI+  VDHDDL RL  VSKTIR   + AKK HF+YSTPRKT+  ++     E   
Sbjct  83   QDILIRILCHVDHDDLKRLKRVSKTIRNAVLEAKKSHFDYSTPRKTLPFRDPTSILEQDS  142

Query  312  DYNE----VEAPNAP-RQTRVPKLRLSHKKLSGIAVALF  211
              ++    +E PNAP R+ ++ +       LS I++ LF
Sbjct  143  SLSDQDDAMEPPNAPVRRRKINR----EADLSKISMVLF  177



>ref|XP_002872727.1| hypothetical protein ARALYDRAFT_911767 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48986.1| hypothetical protein ARALYDRAFT_911767 [Arabidopsis lyrata subsp. 
lyrata]
Length=161

 Score = 72.8 bits (177),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 40/98 (41%), Positives = 62/98 (63%), Gaps = 7/98 (7%)
 Frame = -1

Query  492  QDVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTPRKTMDSQNVVVGFEDSM  313
            QD+LIR++  VDH+DL+ L  VSKTIR+  + AKK HF++STP+K +  ++ ++  E+  
Sbjct  66   QDILIRVLCHVDHEDLATLKRVSKTIRKAVIEAKKSHFDFSTPKKRLPFRDAILVLEEDS  125

Query  312  DY----NEVEAPNAPRQTRVPKLRLSHKKLSGIAVALF  211
            D     +E+E PNAP + R+         LS I++ LF
Sbjct  126  DSSNQDDEMEPPNAPIRRRIIN---RESDLSKISMVLF  160



>ref|XP_006288769.1| hypothetical protein CARUB_v10002090mg [Capsella rubella]
 gb|EOA21667.1| hypothetical protein CARUB_v10002090mg [Capsella rubella]
Length=176

 Score = 73.2 bits (178),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 43/102 (42%), Positives = 60/102 (59%), Gaps = 11/102 (11%)
 Frame = -1

Query  492  QDVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTPRKTMDSQNVVVGFEDSM  313
            QD+LIR++  VDH+DLS L  VSKTIR+  + AKK HF+YSTP+K +  +  V+  E+  
Sbjct  77   QDILIRVLCHVDHEDLSTLKRVSKTIRKAVIEAKKSHFDYSTPKKRLPFREAVLIMEEDS  136

Query  312  DYN--------EVEAPNAPRQTRVPKLRLSHKKLSGIAVALF  211
            + N        E+E PNAP + R          LS I++ LF
Sbjct  137  NSNSDLSNQSDEIEPPNAPVRRRSIN---RESDLSNISMVLF  175



>gb|KEH36515.1| F-box protein [Medicago truncatula]
Length=120

 Score = 71.6 bits (174),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 41/101 (41%), Positives = 60/101 (59%), Gaps = 13/101 (13%)
 Frame = -1

Query  492  QDVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTPRKTMDSQNVVVGFEDSM  313
            QD+L+ ++ GVDHDDL +LFHVSK IRE T+I ++ HF++STP+K     N  +G  D  
Sbjct  28   QDILLHVLCGVDHDDLKQLFHVSKIIREATLIVEESHFKFSTPKK-----NNPIGSND--  80

Query  312  DYNEVEAPNAPRQTRVPKLRLSHKKLSGIAVALFP*KCCFG  190
                 E P AP + +  + +    +L  I++ LF  K C G
Sbjct  81   -----ETPKAPMK-KPKESKFYSDELRDISLVLFCPKDCIG  115



>ref|XP_004486262.1| PREDICTED: F-box protein At1g61340-like [Cicer arietinum]
Length=133

 Score = 71.6 bits (174),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 60/94 (64%), Gaps = 1/94 (1%)
 Frame = -1

Query  492  QDVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTPRKTMDSQNVVVGFEDSM  313
            QD+L+ ++ GVDHDDL +LFHVSKTIR+ T++ ++ HF+++TP+K           + + 
Sbjct  28   QDILLHVLCGVDHDDLKQLFHVSKTIRDATLLVEESHFKFTTPKKNTLPFYNCDPIDTND  87

Query  312  DYNEVEAPNAPRQTRVPKLRLSHKKLSGIAVALF  211
             ++E+E PN P + +    + +  +LS  +V LF
Sbjct  88   KFSEIEIPNTPLKKQKGS-KFNWDELSETSVILF  120



>ref|XP_009406493.1| PREDICTED: F-box protein At1g61340-like [Musa acuminata subsp. 
malaccensis]
Length=163

 Score = 71.6 bits (174),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/93 (40%), Positives = 56/93 (60%), Gaps = 0/93 (0%)
 Frame = -1

Query  489  DVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTPRKTMDSQNVVVGFEDSMD  310
            D+L++ +  VDH DL +L  VSKT+   T+IA++ HF +STP      +      +  +D
Sbjct  70   DILVKTLSKVDHSDLKQLLLVSKTVNGATLIARESHFVFSTPISKSLFKKQSNTIDSDLD  129

Query  309  YNEVEAPNAPRQTRVPKLRLSHKKLSGIAVALF  211
                EAP+AP Q RV + RL+  +LS +A+ALF
Sbjct  130  IINEEAPHAPNQQRVARSRLNGVQLSSVAIALF  162



>emb|CDX90883.1| BnaA03g25630D [Brassica napus]
Length=178

 Score = 72.0 bits (175),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 44/99 (44%), Positives = 62/99 (63%), Gaps = 9/99 (9%)
 Frame = -1

Query  492  QDVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTPRKTM---DSQNVVVGFE  322
            QD+LIR++  VDHDDL+RL  VSKTIR     AKK HF+YSTPRKT+   D  +++    
Sbjct  83   QDILIRVLCHVDHDDLARLKRVSKTIRNAVFEAKKSHFDYSTPRKTLPFRDPTSILKQDS  142

Query  321  DSMDYNE-VEAPNAP-RQTRVPKLRLSHKKLSGIAVALF  211
               D ++ +E PNAP R+ ++ +       LS I++ LF
Sbjct  143  SLSDQDDAMEPPNAPVRRRKINR----EADLSKISMVLF  177



>emb|CDY21323.1| BnaC03g30070D [Brassica napus]
Length=178

 Score = 70.9 bits (172),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 45/99 (45%), Positives = 62/99 (63%), Gaps = 9/99 (9%)
 Frame = -1

Query  492  QDVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTPRKTM---DSQNVVVGFE  322
            QD+LIR++  VDHDDL RL  VSKTIR     AKK HF+YSTPRKT+   D  +++    
Sbjct  83   QDILIRVLCHVDHDDLERLKRVSKTIRNAVFEAKKSHFDYSTPRKTLPFRDPTSILEQDS  142

Query  321  DSMDYNE-VEAPNAPRQTRVPKLRLSHKK-LSGIAVALF  211
               D +E +E PNAP    V + +++ +  LS I++ LF
Sbjct  143  SLSDQDEAMEPPNAP----VGRRKINRESDLSRISMVLF  177



>ref|XP_010538349.1| PREDICTED: F-box protein SKIP27 [Tarenaya hassleriana]
Length=233

 Score = 71.6 bits (174),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 53/71 (75%), Gaps = 1/71 (1%)
 Frame = -1

Query  489  DVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTPRKTMDSQNVVVGFEDSMD  310
            D+LIR++ GVDH+DL +LF VSK+I+E  ++A+K HF Y+TP+KT+  ++     E S D
Sbjct  129  DLLIRLLCGVDHEDLGKLFLVSKSIKEAAVMARKSHFAYTTPKKTLTFRDPTDFEEVSCD  188

Query  309  YN-EVEAPNAP  280
            ++ +++ PNAP
Sbjct  189  FDGDIDPPNAP  199



>ref|XP_006396636.1| hypothetical protein EUTSA_v10029012mg [Eutrema salsugineum]
 gb|ESQ38089.1| hypothetical protein EUTSA_v10029012mg [Eutrema salsugineum]
Length=178

 Score = 70.5 bits (171),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 42/99 (42%), Positives = 63/99 (64%), Gaps = 8/99 (8%)
 Frame = -1

Query  492  QDVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTPRKTMDSQN-VVVGFEDS  316
            QD+LI ++  VDH+DL+RL  VS TIR+  + AKK HF+YSTP+KT+  ++ +++  EDS
Sbjct  82   QDILICVLCHVDHEDLARLKRVSTTIRKAVLEAKKSHFDYSTPKKTLPFRDPLLILEEDS  141

Query  315  MDY----NEVEAPNAPRQTRVPKLRLSHKKLSGIAVALF  211
             +     +E+E PNAP + R          LS I++ LF
Sbjct  142  TNLSDQDDEIEPPNAPIRRRNNN---HESDLSKISMVLF  177



>ref|XP_010904959.1| PREDICTED: F-box protein SKIP27-like [Elaeis guineensis]
Length=169

 Score = 70.1 bits (170),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 43/95 (45%), Positives = 56/95 (59%), Gaps = 6/95 (6%)
 Frame = -1

Query  492  QDVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTPRKTMDSQNVVVGFEDSM  313
            QDVL+RI+  V++ DL  L  VSK +   T+IAK+ HF ++TP     S   V G E  M
Sbjct  64   QDVLVRILCKVNYSDLKELLLVSKFVHGATLIAKEVHFAFTTP-----SSKPVFGRERHM  118

Query  312  -DYNEVEAPNAPRQTRVPKLRLSHKKLSGIAVALF  211
             D +   +  AP+Q RV K R+  K LS IAVALF
Sbjct  119  GDIDSEVSEEAPKQLRVAKSRVDRKTLSSIAVALF  153



>gb|KHN39612.1| F-box protein, partial [Glycine soja]
Length=116

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 38/91 (42%), Positives = 55/91 (60%), Gaps = 3/91 (3%)
 Frame = -1

Query  480  IRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTPRKTMDSQNVVVGFEDSMDYNE  301
            ++++ GV+H+DL  LFHVSKTIRE TM+ K+ HF+  TP+K   +       E +  + E
Sbjct  3    VQVLCGVNHEDLKELFHVSKTIREATMMTKELHFDIKTPKKKKIAFLNTFDLEGAKGFKE  62

Query  300  VEAPNAPRQTRVPKLRLSHKKL-SGIAVALF  211
             +A N P   +  K RL  KKL + I+ ALF
Sbjct  63   KQALNGP--LKKTKSRLHRKKLDNNISQALF  91



>ref|NP_001267740.1| uncharacterized protein LOC101786658 [Setaria italica]
 gb|AGG82738.1| F-box protein [Setaria italica]
Length=170

 Score = 68.6 bits (166),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 36/93 (39%), Positives = 54/93 (58%), Gaps = 7/93 (8%)
 Frame = -1

Query  492  QDVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTPRKTMDSQNVVVGFEDSM  313
            QDVLI+++  V+H DL +L  VSK + E T++A++ HF+++TP           GF    
Sbjct  74   QDVLIKVLCKVNHSDLRQLLLVSKPVNEATVVARELHFKFATPSSK-------AGFRGDE  126

Query  312  DYNEVEAPNAPRQTRVPKLRLSHKKLSGIAVAL  214
            D  + + P AP Q RV + RL +K L  IA+ L
Sbjct  127  DGEDEDGPGAPMQRRVARSRLRNKNLDSIAINL  159



>ref|NP_567282.1| F-box protein [Arabidopsis thaliana]
 sp|Q9S9T6.1|FB220_ARATH RecName: Full=F-box protein At4g05010 [Arabidopsis thaliana]
 gb|AAD48976.1|AF162444_8 similar to Arabidopsis thaliana hypothetical protein GB:AL022603 
[Arabidopsis thaliana]
 emb|CAB81043.1| AT4g05010 [Arabidopsis thaliana]
 gb|AEE82458.1| F-box protein [Arabidopsis thaliana]
Length=164

 Score = 68.2 bits (165),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 43/121 (36%), Positives = 68/121 (56%), Gaps = 16/121 (13%)
 Frame = -1

Query  561  ETSKHCREVsfpssekpsleslPQDVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWH  382
            ET++ CR +              QD+LIR++  VDH+DL+ L  VSKTIR+  + AKK H
Sbjct  55   ETTESCRSLLETLH---------QDILIRVLCHVDHEDLATLKRVSKTIRKAVIEAKKSH  105

Query  381  FEYSTPRKTMDSQNVVVGFEDSMDY----NEVEAPNAPRQTRVPKLRLSHKKLSGIAVAL  214
            F+YSTP+K +  ++ ++  + + +     +E+E PNAP + R          LS I++ L
Sbjct  106  FDYSTPKKRLPFRDAILILDSNSNSSSQDDEMEPPNAPIRRRFIN---RESDLSKISMVL  162

Query  213  F  211
            F
Sbjct  163  F  163



>ref|XP_006599757.1| PREDICTED: F-box protein At1g61340-like [Glycine max]
Length=133

 Score = 67.4 bits (163),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 38/91 (42%), Positives = 55/91 (60%), Gaps = 3/91 (3%)
 Frame = -1

Query  480  IRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTPRKTMDSQNVVVGFEDSMDYNE  301
            ++++ GV+H+DL  LFHVSKTIRE TM+ K+ HF+  TP+K   +       E +  + E
Sbjct  20   VQVLCGVNHEDLKELFHVSKTIREATMMTKELHFDIKTPKKKKIAFLNTFDLEGAKGFKE  79

Query  300  VEAPNAPRQTRVPKLRLSHKKL-SGIAVALF  211
             +A N P   +  K RL  KKL + I+ ALF
Sbjct  80   KQALNGP--LKKTKSRLHRKKLDNNISQALF  108



>gb|AHN93176.1| F-box domain-containing protein, partial [Fargesia spathacea]
Length=103

 Score = 66.2 bits (160),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 37/93 (40%), Positives = 55/93 (59%), Gaps = 10/93 (11%)
 Frame = -1

Query  492  QDVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTPRKTMDSQNVVVGFEDSM  313
            QDVL++++  V+H DL +L  VSK + E T++A++ HF ++TP     S+    G E   
Sbjct  10   QDVLVKVLCKVNHSDLRQLLLVSKPVSEATVVARELHFAFATP----SSKAAFRGDE---  62

Query  312  DYNEVEAPNAPRQTRVPKLRLSHKKLSGIAVAL  214
               E E P AP+Q RV + R+  K L+ IAV L
Sbjct  63   ---EEEGPGAPKQHRVARSRVRGKNLASIAVNL  92



>ref|XP_010422372.1| PREDICTED: F-box protein At4g05010-like [Camelina sativa]
Length=168

 Score = 67.4 bits (163),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 42/102 (41%), Positives = 60/102 (59%), Gaps = 11/102 (11%)
 Frame = -1

Query  492  QDVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTPRKTMDSQNVVVGFED--  319
            QD+LIR++  VDH+DL  L  VSKTIR+  + AKK HF+YSTP+K +  ++ V+  E+  
Sbjct  69   QDILIRVLCHVDHEDLETLKRVSKTIRKAVIEAKKSHFDYSTPKKRLPFRDAVLIMEEDS  128

Query  318  ------SMDYNEVEAPNAPRQTRVPKLRLSHKKLSGIAVALF  211
                  S   +E+E PNAP + R          LS I++ LF
Sbjct  129  NSNWDSSSQSDEMEPPNAPIRRRTIN---RESDLSKISMVLF  167



>gb|KHN00107.1| F-box protein [Glycine soja]
Length=155

 Score = 67.4 bits (163),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 39/93 (42%), Positives = 58/93 (62%), Gaps = 2/93 (2%)
 Frame = -1

Query  489  DVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTPRKTMDSQNVVVGFEDSMD  310
            DVLIR++ GVDH+DL +L  VSKT+RE   +A++ HFEYSTP+K   +       E +  
Sbjct  61   DVLIRVLCGVDHEDLKQLVRVSKTVREAAEVARRMHFEYSTPKKKNFAIPKPFDIEGAGG  120

Query  309  YNEVEAPNAPRQTRVPKLRLSHKKLSGIAVALF  211
            + E++       ++ PK +L  K L+ I+VALF
Sbjct  121  FEEID--TPKAPSKKPKSKLIGKNLASISVALF  151



>ref|XP_003530987.1| PREDICTED: F-box protein At1g61340-like [Glycine max]
Length=155

 Score = 67.4 bits (163),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 38/93 (41%), Positives = 57/93 (61%), Gaps = 2/93 (2%)
 Frame = -1

Query  489  DVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTPRKTMDSQNVVVGFEDSMD  310
            DVLIR++ GVDH+DL +L  VSKT+RE   +A++ HFEYSTP+K   +       E +  
Sbjct  61   DVLIRVLCGVDHEDLKQLVRVSKTVREAAEVARRMHFEYSTPKKKNFAIPKPFDIEGAGG  120

Query  309  YNEVEAPNAPRQTRVPKLRLSHKKLSGIAVALF  211
            + E++       ++  K +L  K L+ I+VALF
Sbjct  121  FEEID--TPKAPSKKAKSKLIGKNLASISVALF  151



>gb|AHN93174.1| F-box domain-containing protein, partial [Fargesia nitida]
Length=175

 Score = 66.6 bits (161),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 37/93 (40%), Positives = 55/93 (59%), Gaps = 10/93 (11%)
 Frame = -1

Query  492  QDVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTPRKTMDSQNVVVGFEDSM  313
            QDVL++++  V+H DL +L  VSK + E T++A++ HF ++TP     S+    G E   
Sbjct  82   QDVLVKVLCKVNHSDLRQLLLVSKPVSEATVVARELHFAFATP----SSKAAFRGDE---  134

Query  312  DYNEVEAPNAPRQTRVPKLRLSHKKLSGIAVAL  214
               E E P AP+Q RV + R+  K L+ IAV L
Sbjct  135  ---EEEGPGAPKQHRVARSRVRGKNLASIAVNL  164



>ref|XP_008345910.1| PREDICTED: F-box protein SKIP27-like [Malus domestica]
 ref|XP_008345912.1| PREDICTED: F-box protein SKIP27-like [Malus domestica]
 ref|XP_008345913.1| PREDICTED: F-box protein SKIP27-like [Malus domestica]
 ref|XP_008345914.1| PREDICTED: F-box protein SKIP27-like [Malus domestica]
Length=129

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = -1

Query  492  QDVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHF  379
            Q++LI+++ GVDHDDL RLF VSK IRE T++AK+WHF
Sbjct  90   QEILIKVVCGVDHDDLKRLFRVSKAIREXTLVAKQWHF  127



>gb|EMS57773.1| F-box protein SKIP27 [Triticum urartu]
Length=164

 Score = 65.9 bits (159),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 53/94 (56%), Gaps = 13/94 (14%)
 Frame = -1

Query  492  QDVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTPRKTMDSQNVVVGFEDSM  313
            QDVL++++  V+H DL +L  VSK + E T++AK+ HF ++TP K             S 
Sbjct  72   QDVLVKVLCKVNHSDLRQLLLVSKPVSEATVVAKELHFAFATPSKA------------SA  119

Query  312  DYNEV-EAPNAPRQTRVPKLRLSHKKLSGIAVAL  214
            D  E  + P AP+Q RV + R     L+G+AV L
Sbjct  120  DGEEEDDGPGAPKQHRVARSRCRGMNLAGVAVNL  153



>ref|NP_001152644.1| F-box domain containing protein [Zea mays]
 gb|ACG48703.1| F-box domain containing protein [Zea mays]
Length=170

 Score = 66.2 bits (160),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 52/94 (55%), Gaps = 8/94 (9%)
 Frame = -1

Query  489  DVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTP--RKTMDSQNVVVGFEDS  316
            DVL+ I   V+H DL  L   SK+++E T++A++ HF++STP  +     +    G +D 
Sbjct  76   DVLVMIFCKVNHSDLRNLLLTSKSVKEATIVAREQHFKFSTPPAKSGFRDEETAAGDDDD  135

Query  315  MDYNEVEAPNAPRQTRVPKLRLSHKKLSGIAVAL  214
                  E P AP+Q RV + RL    LS IAV L
Sbjct  136  ------EGPGAPKQHRVARSRLGDTNLSSIAVNL  163



>ref|XP_010467813.1| PREDICTED: F-box protein At4g05010-like [Camelina sativa]
Length=166

 Score = 65.5 bits (158),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 41/101 (41%), Positives = 59/101 (58%), Gaps = 11/101 (11%)
 Frame = -1

Query  489  DVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTPRKTMDSQNVVVGFED---  319
            D+LIR++  VDH+DL  L  VSKTIR+  + AKK HF+YSTP+K +  ++ V+  E+   
Sbjct  68   DILIRVLCHVDHEDLDTLKRVSKTIRKAVIEAKKSHFDYSTPKKRLPFRDAVLIMEEDSN  127

Query  318  -----SMDYNEVEAPNAPRQTRVPKLRLSHKKLSGIAVALF  211
                 S   +E+E PNAP + R          LS I++ LF
Sbjct  128  SNWDSSSQSDEMEPPNAPIRRRTIN---RESDLSKISMVLF  165



>ref|XP_008345908.1| PREDICTED: F-box protein SKIP27-like [Malus domestica]
Length=102

 Score = 64.3 bits (155),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = -1

Query  492  QDVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHF  379
            Q++LI+++ GVDHDDL RLF VSK IRE T++AK+WHF
Sbjct  63   QEILIKVVCGVDHDDLKRLFRVSKAIREXTLVAKQWHF  100



>ref|XP_006657832.1| PREDICTED: F-box protein SKIP27-like [Oryza brachyantha]
Length=165

 Score = 64.3 bits (155),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 39/95 (41%), Positives = 57/95 (60%), Gaps = 9/95 (9%)
 Frame = -1

Query  492  QDVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTPRKTMDSQNVVVGFEDSM  313
            QDVLI+++  V++ DL +L  VSK +   T++AK+ HF ++TP     S+ V  G E+  
Sbjct  72   QDVLIKVLCKVNYSDLRQLLLVSKQVSAATLVAKEQHFAFATP----SSKPVFRGGEE--  125

Query  312  DYNEVEAPNAPRQTRVPKLR-LSHKKLSGIAVALF  211
               E EAP AP+Q RV +   L  K L+ I+V LF
Sbjct  126  --EEQEAPWAPKQRRVARSPILGKKNLASISVNLF  158



>gb|AHN93177.1| F-box domain-containing protein, partial [Fargesia spathacea]
Length=103

 Score = 60.5 bits (145),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 34/93 (37%), Positives = 52/93 (56%), Gaps = 10/93 (11%)
 Frame = -1

Query  492  QDVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTPRKTMDSQNVVVGFEDSM  313
            QDVL++++  V+H DL +L  VSK + E T++A++ HF ++TP            F    
Sbjct  10   QDVLVKVLCKVNHSDLRQLLLVSKPVSEATVVARELHFAFATPSSK-------AAFRGEE  62

Query  312  DYNEVEAPNAPRQTRVPKLRLSHKKLSGIAVAL  214
            +    E P AP+Q RV + R+  K L+ IAV L
Sbjct  63   EE---EGPGAPKQHRVARSRVRGKNLASIAVNL  92



>ref|XP_003562914.1| PREDICTED: F-box protein SKIP27-like [Brachypodium distachyon]
Length=166

 Score = 61.2 bits (147),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 37/93 (40%), Positives = 55/93 (59%), Gaps = 9/93 (10%)
 Frame = -1

Query  492  QDVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTPRKTMDSQNVVVGFEDSM  313
            QDVL++++  V+H DL +L  VSK + E T++AK+ HF ++TP     S+  V G     
Sbjct  72   QDVLVKVLCKVNHSDLRQLLLVSKLVSEATVVAKELHFAFATP-----SKAAVRG----E  122

Query  312  DYNEVEAPNAPRQTRVPKLRLSHKKLSGIAVAL  214
            +  E E P AP+Q RV + R   K L+ +AV L
Sbjct  123  EEEEDEGPGAPKQHRVARSRHRGKNLASLAVNL  155



>gb|AHN93171.1| F-box domain-containing protein, partial [Phyllostachys edulis]
Length=174

 Score = 61.2 bits (147),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 36/93 (39%), Positives = 55/93 (59%), Gaps = 9/93 (10%)
 Frame = -1

Query  492  QDVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTPRKTMDSQNVVVGFEDSM  313
            QDVL++++  V+H DL +L  VSK + E T++A++ HF ++TP     S+    G     
Sbjct  80   QDVLVKVLCKVNHSDLRQLLLVSKPVSEATVVARELHFAFATP----SSKAAFRG-----  130

Query  312  DYNEVEAPNAPRQTRVPKLRLSHKKLSGIAVAL  214
            +  E E P AP+Q RV + R+  K L+ IAV L
Sbjct  131  EEEEEEGPGAPKQHRVARSRVRGKNLASIAVNL  163



>ref|XP_010455837.1| PREDICTED: F-box protein At4g05010-like [Camelina sativa]
Length=166

 Score = 60.8 bits (146),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 41/102 (40%), Positives = 59/102 (58%), Gaps = 11/102 (11%)
 Frame = -1

Query  492  QDVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTPRKTMDSQNVVV------  331
            QD+LIR++  VDH+DL  L  VSKTIR+  + AKK HF+YSTP+K +  ++ V+      
Sbjct  67   QDILIRVLCHVDHEDLETLKLVSKTIRKAVIEAKKSHFDYSTPKKRLPFRDAVLINEEDS  126

Query  330  --GFEDSMDYNEVEAPNAPRQTRVPKLRLSHKKLSGIAVALF  211
                + S   +E+E PNAP + R          LS I++ LF
Sbjct  127  NSNSDSSSQSDEMEPPNAPIRRRTIN---RESDLSKISMVLF  165



>ref|XP_006284178.1| hypothetical protein CARUB_v10005325mg [Capsella rubella]
 gb|EOA17076.1| hypothetical protein CARUB_v10005325mg [Capsella rubella]
Length=306

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 34/106 (32%), Positives = 54/106 (51%), Gaps = 13/106 (12%)
 Frame = -1

Query  489  DVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTPRKTMDSQNVVV-------  331
            D+L++I+  + HD L  +FHVS+ IR+ TM+A+++HF Y+TP ++      V+       
Sbjct  152  DLLVKIVCHLHHDQLKAVFHVSQRIRKATMLARQYHFNYTTPDRSRQEMLSVLTPMPINR  211

Query  330  -GFEDSMDYNEVEA-----PNAPRQTRVPKLRLSHKKLSGIAVALF  211
              F    D+N   A     P AP+    P LR    ++  I   LF
Sbjct  212  WPFRSKGDWNPTMASSPHTPKAPKHAPRPPLRTQLTEMKQITAVLF  257



>ref|XP_006841809.1| hypothetical protein AMTR_s00003p00269410 [Amborella trichopoda]
 gb|ERN03484.1| hypothetical protein AMTR_s00003p00269410 [Amborella trichopoda]
Length=210

 Score = 61.2 bits (147),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 37/96 (39%), Positives = 55/96 (57%), Gaps = 4/96 (4%)
 Frame = -1

Query  489  DVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTPR-KTMDSQNVVVGFEDSM  313
            D+L++I+  V+H DL  L  VSK  RE   +A+K HF YSTP  K +  +N  +   +  
Sbjct  109  DILVKILCRVEHSDLKALSAVSKLFREAVKLARKVHFNYSTPNPKIIGVKNFELDVVEDS  168

Query  312  DYNEVEAPNAPRQTRVPKLRLSHKKLSGIAV--ALF  211
            ++  +  PNAP+Q R  KLRL + + S   +  ALF
Sbjct  169  NHERISTPNAPKQDRF-KLRLENMEASKYPLQRALF  203



>ref|XP_006594621.1| PREDICTED: F-box protein At1g61340-like [Glycine max]
Length=86

 Score = 59.3 bits (142),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 44/68 (65%), Gaps = 4/68 (6%)
 Frame = -1

Query  492  QDVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTPRKTMDSQNVVVGFEDSM  313
            +D+L++ + GVDH DL +LFHVSK IREVTM+AK+ HF+  TP KT    N      +  
Sbjct  20   RDILVQALCGVDHKDLKQLFHVSKMIREVTMMAKE-HFDICTP-KTFAFLNPFCSGANG-  76

Query  312  DYNEVEAP  289
             + E+E P
Sbjct  77   -FKEIETP  83



>gb|AHN93170.1| F-box domain-containing protein, partial [Phyllostachys edulis]
 gb|AHN93173.1| F-box domain-containing protein, partial [Phyllostachys nigra 
var. henonis]
Length=173

 Score = 59.7 bits (143),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 34/93 (37%), Positives = 52/93 (56%), Gaps = 10/93 (11%)
 Frame = -1

Query  492  QDVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTPRKTMDSQNVVVGFEDSM  313
            QDVL++++  V+H DL +L  VSK + E T++A++ HF ++TP            F    
Sbjct  80   QDVLVKVLCKVNHSDLRQLLLVSKPVSEATVVARELHFAFATPSSK-------AAFRGEE  132

Query  312  DYNEVEAPNAPRQTRVPKLRLSHKKLSGIAVAL  214
            +    E P AP+Q RV + R+  K L+ IAV L
Sbjct  133  EE---EGPGAPKQHRVARSRVRGKNLASIAVNL  162



>gb|AHN93175.1| F-box domain-containing protein, partial [Fargesia nitida]
Length=175

 Score = 59.7 bits (143),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 34/93 (37%), Positives = 52/93 (56%), Gaps = 10/93 (11%)
 Frame = -1

Query  492  QDVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTPRKTMDSQNVVVGFEDSM  313
            QDVL++++  V+H DL +L  VSK + E T++A++ HF ++TP            F    
Sbjct  82   QDVLVKVLCKVNHSDLRQLLLVSKPVSEATVVARELHFAFATPSSK-------AAFRGEE  134

Query  312  DYNEVEAPNAPRQTRVPKLRLSHKKLSGIAVAL  214
            +    E P AP+Q RV + R+  K L+ IAV L
Sbjct  135  EE---EGPGAPKQHRVARSRVRGKNLASIAVNL  164



>tpg|DAA63123.1| TPA: hypothetical protein ZEAMMB73_674118 [Zea mays]
 tpg|DAA63124.1| TPA: hypothetical protein ZEAMMB73_674118 [Zea mays]
Length=110

 Score = 58.2 bits (139),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 35/92 (38%), Positives = 50/92 (54%), Gaps = 6/92 (7%)
 Frame = -1

Query  489  DVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTPRKTMDSQNVVVGFEDSMD  310
            DVLI+I+  V++ DL  L  VSK ++E T+ A++ HF++STP      ++   G  D   
Sbjct  14   DVLIKILCKVNYSDLRHLLLVSKQVKEATIYARELHFKFSTPSAKPVFRDEEAGGGDDT-  72

Query  309  YNEVEAPNAPRQTRVPKLRLSHKKLSGIAVAL  214
                  P AP+Q R  K RL  + L  IAV L
Sbjct  73   -----CPCAPKQHRAAKSRLRGQNLERIAVNL  99



>ref|XP_002966836.1| hypothetical protein SELMODRAFT_408036 [Selaginella moellendorffii]
 gb|EFJ31435.1| hypothetical protein SELMODRAFT_408036 [Selaginella moellendorffii]
Length=383

 Score = 60.5 bits (145),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 57/102 (56%), Gaps = 11/102 (11%)
 Frame = -1

Query  489  DVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTPRKTMDSQNVV-VGFEDSM  313
            ++L+RI+  +DH+ L  +FHV +++R+  MIAK+ HF ++TP K  D + V       ++
Sbjct  243  ELLVRIVCRLDHNQLKPVFHVCRSLRQAVMIAKQCHFNFTTPGK--DHKTVSDAKLGQAL  300

Query  312  DY-NEVEA------PNAPRQT-RVPKLRLSHKKLSGIAVALF  211
             + NE  A      PNAP+   + PK R S   +  IA  LF
Sbjct  301  PFLNEFAAVGISTTPNAPKHAEKAPKPRYSMADMRQIAATLF  342



>ref|XP_002961170.1| hypothetical protein SELMODRAFT_402840 [Selaginella moellendorffii]
 gb|EFJ38709.1| hypothetical protein SELMODRAFT_402840 [Selaginella moellendorffii]
Length=383

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 57/102 (56%), Gaps = 11/102 (11%)
 Frame = -1

Query  489  DVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTPRKTMDSQNVV-VGFEDSM  313
            ++L+RI+  +DH+ L  +FHV +++R+  MIAK+ HF ++TP K  D + V       ++
Sbjct  243  ELLVRIVCRLDHNQLKPVFHVCRSLRQAVMIAKQCHFNFTTPGK--DHKTVSDAKLGQAL  300

Query  312  DY-NEVEA------PNAPRQT-RVPKLRLSHKKLSGIAVALF  211
             + NE  A      PNAP+   + PK R S   +  IA  LF
Sbjct  301  PFLNEFAAVGISTTPNAPKHAEKFPKPRYSMADMRQIAATLF  342



>ref|XP_008653242.1| PREDICTED: LOW QUALITY PROTEIN: F-box protein At4g05010-like 
[Zea mays]
Length=175

 Score = 57.8 bits (138),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/92 (39%), Positives = 53/92 (58%), Gaps = 6/92 (7%)
 Frame = -1

Query  489  DVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTPRKTMDSQNVVVGFEDSMD  310
            DVLI+I+  V++ DL  L  VSK ++E T+ A++ HF++STP     S   V   E++  
Sbjct  79   DVLIKILCKVNYSDLRHLLLVSKQVKEATIYARELHFKFSTP-----SAKPVFRDEEAGG  133

Query  309  YNEVEAPNAPRQTRVPKLRLSHKKLSGIAVAL  214
             ++   P AP+Q R  K RL  + L  IAV L
Sbjct  134  GDDT-CPCAPKQHRAAKSRLRGQNLERIAVNL  164



>ref|NP_001148552.1| F-box domain containing protein [Zea mays]
 gb|ACG32004.1| F-box domain containing protein [Zea mays]
Length=170

 Score = 57.0 bits (136),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 35/95 (37%), Positives = 54/95 (57%), Gaps = 10/95 (11%)
 Frame = -1

Query  489  DVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTPRKTMDSQNVVVGFED---  319
            DVL+ I + V+H DL  L  +SK++++ T++A++ HF++STP           GF D   
Sbjct  76   DVLVMIFYKVNHSDLRNLLLISKSVKDATILAREQHFKFSTP-------PAKSGFRDEET  128

Query  318  SMDYNEVEAPNAPRQTRVPKLRLSHKKLSGIAVAL  214
            +   ++ E P AP+Q RV +  L    LS IAV L
Sbjct  129  AGGDDDDEGPGAPKQHRVARSHLGDTNLSSIAVNL  163



>ref|XP_011099883.1| PREDICTED: F-box protein At4g35930 [Sesamum indicum]
Length=279

 Score = 58.2 bits (139),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 34/106 (32%), Positives = 51/106 (48%), Gaps = 13/106 (12%)
 Frame = -1

Query  489  DVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTPRKTMDS------------  346
            D+L++I+  + HD L  +FHVS+ IR+  +IA+++HF Y+TP +T               
Sbjct  129  DLLVKILCHLHHDQLRAVFHVSQKIRKAVIIARQFHFNYTTPDRTRQEMLNTMTPLPTDH  188

Query  345  -QNVVVGFEDSMDYNEVEAPNAPRQTRVPKLRLSHKKLSGIAVALF  211
               V  G    M      AP AP+    P  RL   ++  IA  LF
Sbjct  189  WPFVSKGGGKGMWITSPHAPKAPKHGPRPPSRLKFTEMRQIAAVLF  234



>ref|XP_010446850.1| PREDICTED: F-box protein At4g35930 [Camelina sativa]
 ref|XP_010446851.1| PREDICTED: F-box protein At4g35930 [Camelina sativa]
Length=308

 Score = 58.2 bits (139),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 33/106 (31%), Positives = 52/106 (49%), Gaps = 13/106 (12%)
 Frame = -1

Query  489  DVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTPRKTMDSQNVVV-------  331
            D+L++I+  + HD L  +FHVS+ IR+ TM+A+++HF Y+TP ++      V+       
Sbjct  154  DLLVKIVCHLHHDQLKAVFHVSQRIRKATMLARQYHFNYTTPDRSRQEMLSVMTPMPINR  213

Query  330  -GFEDSMDYN-----EVEAPNAPRQTRVPKLRLSHKKLSGIAVALF  211
              F    D N         P AP+    P LR    ++  I   LF
Sbjct  214  WPFRSIGDVNPRMVSSPHTPKAPKHAPRPPLRTKLSEMKQITAVLF  259



>ref|XP_010679881.1| PREDICTED: F-box protein At4g35930 [Beta vulgaris subsp. vulgaris]
Length=276

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 32/106 (30%), Positives = 56/106 (53%), Gaps = 13/106 (12%)
 Frame = -1

Query  489  DVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTP---RKTMDSQNVVVGFED  319
            D+L++++  + HD L  +FHVS+ IR   ++A+++HF Y+TP   R+ M +    +  E 
Sbjct  130  DLLVKVLCHLHHDQLRAVFHVSQRIRMAVIVARQFHFNYTTPDRSRQEMLTTMTPLATEH  189

Query  318  SMDYNEVEA----------PNAPRQTRVPKLRLSHKKLSGIAVALF  211
               +++ E           P APR    P  RL + ++  +A ALF
Sbjct  190  WPFFSKGEGRGFRLPSPHTPKAPRHGPRPPSRLKYTEMRQVAAALF  235



>ref|XP_008664357.1| PREDICTED: F-box protein At1g61340-like [Zea mays]
Length=170

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 35/92 (38%), Positives = 53/92 (58%), Gaps = 4/92 (4%)
 Frame = -1

Query  489  DVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTPRKTMDSQNVVVGFEDSMD  310
            DVL+ I   V+H DL  L   SK+++E T++A++ HF++STP     +++     E    
Sbjct  76   DVLVMIFCKVNHSDLRNLLLTSKSVKEATILAREQHFKFSTP----PAKSGFRDEETGGG  131

Query  309  YNEVEAPNAPRQTRVPKLRLSHKKLSGIAVAL  214
             ++ E P AP+Q RV + RL    LS IAV L
Sbjct  132  DDDDEGPGAPKQHRVARSRLGDTNLSSIAVNL  163



>ref|XP_006412041.1| hypothetical protein EUTSA_v10025800mg [Eutrema salsugineum]
 gb|ESQ53494.1| hypothetical protein EUTSA_v10025800mg [Eutrema salsugineum]
Length=308

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/106 (30%), Positives = 51/106 (48%), Gaps = 13/106 (12%)
 Frame = -1

Query  489  DVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTPRKTMDSQNVVV-------  331
            D+L++I+  + HD L  +FHVS+ IR+ T+IA+++HF Y+TP ++      V+       
Sbjct  154  DLLVKIVCHLHHDQLKAVFHVSQRIRKATLIARQYHFNYTTPDRSRQEMLSVITPMPINR  213

Query  330  -GFEDSMDYN-----EVEAPNAPRQTRVPKLRLSHKKLSGIAVALF  211
              F    D N         P AP+    P  R    ++  I   LF
Sbjct  214  WPFLSKEDGNLAIMPSPHTPKAPKHAPRPPCRTKFTEMKQITAVLF  259



>gb|KHN35537.1| F-box protein [Glycine soja]
Length=188

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/107 (30%), Positives = 50/107 (47%), Gaps = 13/107 (12%)
 Frame = -1

Query  489  DVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYS-------------TPRKTMD  349
            D+L++I+  + HD L  +FHVS+ IR+  +IA+++HF Y+             TPR T  
Sbjct  38   DLLVKILCHLHHDQLRAVFHVSQKIRKAVIIARQFHFNYTTPDRSRQEMLSTMTPRPTEH  97

Query  348  SQNVVVGFEDSMDYNEVEAPNAPRQTRVPKLRLSHKKLSGIAVALFP  208
               +  G    +       P APR    P  RL   ++  +   LFP
Sbjct  98   WPFLCKGDGKGVRIPSPHTPKAPRHGPRPPSRLKISEMRQVTAVLFP  144



>ref|NP_001147656.1| F-box domain containing protein [Zea mays]
 gb|ACG28271.1| F-box domain containing protein [Zea mays]
Length=170

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 34/92 (37%), Positives = 54/92 (59%), Gaps = 4/92 (4%)
 Frame = -1

Query  489  DVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTPRKTMDSQNVVVGFEDSMD  310
            DVL+ I   V+H DL  L  +SK++++ T++A++ HF++STP     +++     E    
Sbjct  76   DVLVMIFCKVNHSDLRNLLLISKSVKDATIVAREQHFKFSTP----PAKSGFRDEETGGG  131

Query  309  YNEVEAPNAPRQTRVPKLRLSHKKLSGIAVAL  214
             ++ E P AP+Q RV + RL    LS IAV L
Sbjct  132  DDDDEGPGAPKQHRVARSRLGDTNLSSIAVNL  163



>ref|XP_009765885.1| PREDICTED: F-box protein At4g35930-like [Nicotiana sylvestris]
 ref|XP_009765886.1| PREDICTED: F-box protein At4g35930-like [Nicotiana sylvestris]
 ref|XP_009765887.1| PREDICTED: F-box protein At4g35930-like [Nicotiana sylvestris]
 ref|XP_009765888.1| PREDICTED: F-box protein At4g35930-like [Nicotiana sylvestris]
Length=277

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 33/107 (31%), Positives = 51/107 (48%), Gaps = 13/107 (12%)
 Frame = -1

Query  489  DVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTP-RKTMDSQNVVVGFE---  322
            D+L++I+  + HD L  +FHVS  IR+  ++A+++HF Y+TP R   D    +  F    
Sbjct  127  DLLVKILCHLQHDQLKSVFHVSHKIRKAVILARQFHFNYTTPDRMGQDMLRTMTPFPADH  186

Query  321  ---------DSMDYNEVEAPNAPRQTRVPKLRLSHKKLSGIAVALFP  208
                      S   +    P AP+    P  RL   ++  IA  LFP
Sbjct  187  WSFASKGDGKSSWVHSPHTPKAPKHGPRPPSRLKFTEMEQIAAVLFP  233



>ref|XP_010436244.1| PREDICTED: F-box protein At4g35930-like [Camelina sativa]
Length=210

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 31/105 (30%), Positives = 50/105 (48%), Gaps = 13/105 (12%)
 Frame = -1

Query  486  VLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTPRKTMDSQNVV---------  334
            V +RI+  + HD L  +FHVS+ IR+ TM+A+++HF Y+TP ++      V         
Sbjct  57   VRVRIVCHLHHDQLKAVFHVSQRIRKATMLARQYHFNYTTPDRSRQEMLSVMTPMPINRW  116

Query  333  ----VGFEDSMDYNEVEAPNAPRQTRVPKLRLSHKKLSGIAVALF  211
                +G  +    +    P AP+    P LR    ++  I   LF
Sbjct  117  PFRSIGDGNPRMVSSPHTPKAPKHAPRPPLRTKLTEMKQITAVLF  161



>gb|AHN93172.1| F-box domain-containing protein, partial [Phyllostachys nidularia]
Length=156

 Score = 53.9 bits (128),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/87 (33%), Positives = 47/87 (54%), Gaps = 10/87 (11%)
 Frame = -1

Query  492  QDVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTPRKTMDSQNVVVGFEDSM  313
            QDVL++++  V+H DL +L  VSK + E T++A++ HF ++TP            F    
Sbjct  80   QDVLVKVLCKVNHSDLRQLLLVSKPVSEATVVARELHFAFATPSSK-------AAFRGEE  132

Query  312  DYNEVEAPNAPRQTRVPKLRLSHKKLS  232
            +      P AP+Q RV + R+  K L+
Sbjct  133  EEEG---PGAPKQHRVARSRVRGKNLA  156



>emb|CDX72566.1| BnaC07g45880D [Brassica napus]
Length=304

 Score = 55.5 bits (132),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 50/106 (47%), Gaps = 13/106 (12%)
 Frame = -1

Query  489  DVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTPRKTMDSQNVVV-------  331
            D+L++I+  + HD+L  +FHVS+ IR   +IA+++HF Y+TP ++      V+       
Sbjct  150  DLLVKIVCHLHHDELKAVFHVSQRIRAAAVIARQYHFNYTTPDRSRQEMLSVLTPMPINR  209

Query  330  ------GFEDSMDYNEVEAPNAPRQTRVPKLRLSHKKLSGIAVALF  211
                  G E+         P APR    P  R    ++  I   LF
Sbjct  210  WPFVSKGDENYRIMGSPHTPKAPRHAPRPPCRTKLAEMKQITAVLF  255



>ref|XP_009611042.1| PREDICTED: F-box protein At4g35930-like [Nicotiana tomentosiformis]
 ref|XP_009611043.1| PREDICTED: F-box protein At4g35930-like [Nicotiana tomentosiformis]
 ref|XP_009611044.1| PREDICTED: F-box protein At4g35930-like [Nicotiana tomentosiformis]
Length=277

 Score = 55.1 bits (131),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 34/107 (32%), Positives = 52/107 (49%), Gaps = 13/107 (12%)
 Frame = -1

Query  489  DVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTP-------RKTMDSQNV--  337
            D+L++I+  + HD L  +FHVS  IR+  ++A+++HF Y+TP        +TM    V  
Sbjct  127  DLLVKILCHLQHDQLKSVFHVSHKIRKAVILARQFHFNYTTPDRMRQDMLRTMTPLPVDH  186

Query  336  ----VVGFEDSMDYNEVEAPNAPRQTRVPKLRLSHKKLSGIAVALFP  208
                  G   S   +    P AP+    P  RL   ++  IA  LFP
Sbjct  187  WPFASKGDGKSSWVHSPHTPQAPKHGARPPSRLKFTEMEQIAAVLFP  233



>ref|XP_003547917.1| PREDICTED: F-box protein At4g35930-like [Glycine max]
Length=284

 Score = 55.1 bits (131),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 32/107 (30%), Positives = 50/107 (47%), Gaps = 13/107 (12%)
 Frame = -1

Query  489  DVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYS-------------TPRKTMD  349
            D+L++I+  + HD L  +FHVS+ IR+  +IA+++HF Y+             TPR T  
Sbjct  134  DLLVKILCHLHHDQLRAVFHVSQKIRKAVIIARQFHFNYTTPDRSRQEMLSTMTPRPTEH  193

Query  348  SQNVVVGFEDSMDYNEVEAPNAPRQTRVPKLRLSHKKLSGIAVALFP  208
               +  G    +       P APR    P  RL   ++  +   LFP
Sbjct  194  WPFLCKGDGKGVRIPSPHTPKAPRHGPRPPSRLKISEMRQVTAVLFP  240



>gb|EPS63008.1| hypothetical protein M569_11779 [Genlisea aurea]
Length=282

 Score = 55.1 bits (131),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 34/106 (32%), Positives = 54/106 (51%), Gaps = 13/106 (12%)
 Frame = -1

Query  489  DVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTP---RKTMDSQNVVVGFE-  322
            D+L++II  + HD L  +FHVS+ IR+  +IA++++F Y+TP   R+ M +    +  E 
Sbjct  125  DLLVKIICHLHHDQLRAVFHVSEKIRKAVIIARQFYFNYTTPDRSRQEMLNTKTPLPTEH  184

Query  321  ---------DSMDYNEVEAPNAPRQTRVPKLRLSHKKLSGIAVALF  211
                      ++      AP APR    P  RL   ++  IA  LF
Sbjct  185  WPFMSVKSGKAVWIQSPHAPKAPRHGPRPPSRLKFTEMKQIAAVLF  230



>ref|XP_009138398.1| PREDICTED: F-box protein At4g35930 [Brassica rapa]
Length=305

 Score = 54.7 bits (130),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 49/106 (46%), Gaps = 13/106 (12%)
 Frame = -1

Query  489  DVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTPRKTMDSQNVVV-------  331
            D+L++I+  + HD L  +FHVS+ IR   +IA+++HF Y+TP ++      V+       
Sbjct  151  DLLVKIVCHLHHDQLKAVFHVSQRIRAAAVIARQYHFNYTTPDRSRQEMLSVLTPMPINR  210

Query  330  ------GFEDSMDYNEVEAPNAPRQTRVPKLRLSHKKLSGIAVALF  211
                  G E+         P APR    P  R    ++  I   LF
Sbjct  211  WPFVSKGDENYRIMGSPHTPKAPRHAPRPPCRTKLAEMKQITAVLF  256



>ref|XP_010548265.1| PREDICTED: F-box protein At4g35930 isoform X2 [Tarenaya hassleriana]
Length=283

 Score = 54.3 bits (129),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 28/93 (30%), Positives = 49/93 (53%), Gaps = 3/93 (3%)
 Frame = -1

Query  489  DVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTPRKTMDSQNVVVGFEDSMD  310
            D+L++++  + HD L  +FHVS+ IR   ++AK ++F Y+TP +   S+  +    +   
Sbjct  149  DLLVKLLCHLHHDQLKAVFHVSQRIRRAVLLAKHYYFNYTTPDR---SRQEIKADGNPAF  205

Query  309  YNEVEAPNAPRQTRVPKLRLSHKKLSGIAVALF  211
               +  P APR    P  R+   ++  IA  LF
Sbjct  206  VPRLHTPKAPRHGPRPPSRIKIAEMKQIAAVLF  238



>ref|XP_008448525.1| PREDICTED: F-box protein At4g35930 [Cucumis melo]
Length=266

 Score = 54.3 bits (129),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 32/106 (30%), Positives = 49/106 (46%), Gaps = 13/106 (12%)
 Frame = -1

Query  489  DVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEY-------------STPRKTMD  349
            D+L++I+  + HD L  +FHVS+ IR+  ++A+++HF Y             +TPR T  
Sbjct  116  DLLVKILCHLHHDQLRAVFHVSQRIRKAVLLARQFHFNYTTPDRSRQEMLRITTPRPTEH  175

Query  348  SQNVVVGFEDSMDYNEVEAPNAPRQTRVPKLRLSHKKLSGIAVALF  211
               V  G            P APR    P  RL   ++  +A  LF
Sbjct  176  WPFVNKGDGKGFSLPSPHTPKAPRHGPRPPSRLKVSEMRQVAAVLF  221



>ref|XP_004146154.1| PREDICTED: F-box protein At4g35930-like [Cucumis sativus]
 ref|XP_004169345.1| PREDICTED: F-box protein At4g35930-like [Cucumis sativus]
 gb|KGN55645.1| hypothetical protein Csa_3G002650 [Cucumis sativus]
Length=266

 Score = 54.3 bits (129),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 32/106 (30%), Positives = 49/106 (46%), Gaps = 13/106 (12%)
 Frame = -1

Query  489  DVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEY-------------STPRKTMD  349
            D+L++I+  + HD L  +FHVS+ IR+  ++A+++HF Y             +TPR T  
Sbjct  116  DLLVKILCHLHHDQLRAVFHVSQRIRKAVLLARQFHFNYTTPDRSRQEMLRITTPRPTEH  175

Query  348  SQNVVVGFEDSMDYNEVEAPNAPRQTRVPKLRLSHKKLSGIAVALF  211
               V  G            P APR    P  RL   ++  +A  LF
Sbjct  176  WPFVNKGDGKGFSLPSPHTPKAPRHGPRPPSRLKVSEMRQVAAVLF  221



>emb|CBI29597.3| unnamed protein product [Vitis vinifera]
Length=174

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 54/106 (51%), Gaps = 13/106 (12%)
 Frame = -1

Query  489  DVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTPRKT----------MDSQN  340
            D+L++I+  + HD L  +FHVS+ IR+  ++A+++HF Y+TP ++          + +++
Sbjct  24   DLLVKILCHLHHDQLRAVFHVSQRIRKAVLLARQFHFNYTTPDRSRQEMLRTMTPLPTEH  83

Query  339  ---VVVGFEDSMDYNEVEAPNAPRQTRVPKLRLSHKKLSGIAVALF  211
               V  G    +       P APR    P  RL   ++  IA  LF
Sbjct  84   WPFVSKGDGKGVFLASPHTPKAPRHGPRPPSRLKVTEMRQIAAVLF  129



>ref|XP_008803331.1| PREDICTED: F-box protein At1g61340-like [Phoenix dactylifera]
Length=137

 Score = 52.0 bits (123),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 34/105 (32%), Positives = 58/105 (55%), Gaps = 7/105 (7%)
 Frame = -1

Query  489  DVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTPRKTMDSQNVVVGFEDSMD  310
            DVL++I+  ++HD+L     VSK+     ++A++ HF++STP      +  V+ F    D
Sbjct  11   DVLVQILCKLNHDELKPSLVVSKSFHNAALMAQQLHFDFSTPA----PKKAVMAFAGRKD  66

Query  309  YNEV-EAPNAPRQTRVPKL-RLSHKKLSGIAVALFP*K-CCFGLY  184
             +    AP+   ++R P+  +LS ++   IAV LFP   C  GL+
Sbjct  67   TDVTPSAPSMKLESRKPRTSKLSEEETRKIAVVLFPVADCKRGLF  111



>gb|KHG28150.1| hypothetical protein F383_15342 [Gossypium arboreum]
Length=195

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 35/106 (33%), Positives = 50/106 (47%), Gaps = 13/106 (12%)
 Frame = -1

Query  489  DVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTP---RKTMDSQNVVVGFE-  322
            D+L++I+  + HD L  +FHVS+ IR    +A+++HF Y+TP   R+ M S       E 
Sbjct  45   DLLVKILCHLHHDQLRAVFHVSQRIRRAVCLARQFHFNYTTPDRSRQEMLSTMTPRVTEH  104

Query  321  ---------DSMDYNEVEAPNAPRQTRVPKLRLSHKKLSGIAVALF  211
                      S        P APRQ   P  R+   +L  IA  LF
Sbjct  105  WPFLSKRDGKSNLIGSPHTPKAPRQGPRPPSRIKVTELRQIAAVLF  150



>ref|XP_002987341.1| hypothetical protein SELMODRAFT_426127 [Selaginella moellendorffii]
 gb|EFJ11656.1| hypothetical protein SELMODRAFT_426127 [Selaginella moellendorffii]
Length=166

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/119 (26%), Positives = 58/119 (49%), Gaps = 8/119 (7%)
 Frame = -1

Query  489  DVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTPRKTMDSQNVVVGFEDSMD  310
            ++L+RI+  + HD L   FHV +  R+  +IA++ HF++ TP +    +  ++    +  
Sbjct  24   ELLVRIVCSLHHDQLKPAFHVCRRFRQAVLIAQQSHFDFRTPNRERQVELELMTPRPNER  83

Query  309  Y-------NEVEAPNAPRQT-RVPKLRLSHKKLSGIAVALFP*KCCFGLYMSQKFPEAL  157
            +       ++   P APR   R P+ R++   L  +A  LFP     G+   +  P A+
Sbjct  84   WPFASRTSDQPTTPMAPRHAPRPPQARIALGDLKQVAANLFPGDYEHGIEEPRPAPRAI  142



>ref|XP_008807143.1| PREDICTED: F-box protein At4g35930-like [Phoenix dactylifera]
Length=266

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 34/106 (32%), Positives = 52/106 (49%), Gaps = 14/106 (13%)
 Frame = -1

Query  489  DVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTP---RKTMDSQNVVV----  331
            D+L++I+  + HD L  +FHVS+ +R   ++A++ HF Y+TP   R+ M S    +    
Sbjct  117  DLLVKILCHLHHDQLKAVFHVSQRVRAAVLLARQLHFNYTTPDRSRQEMLSTKTPLPTEH  176

Query  330  -GFEDSMDYNEVEA-----PNAPRQTRVPKLRLSHKKLSGIAVALF  211
              F    D N ++      P APR    P  RL    +  IA  LF
Sbjct  177  WPFVSKGDGNAIQGSSPHTPKAPRHGPRP-FRLRMMDMKQIAAVLF  221



>ref|XP_002989159.1| hypothetical protein SELMODRAFT_427805 [Selaginella moellendorffii]
 gb|EFJ09753.1| hypothetical protein SELMODRAFT_427805 [Selaginella moellendorffii]
Length=166

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/119 (26%), Positives = 58/119 (49%), Gaps = 8/119 (7%)
 Frame = -1

Query  489  DVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTPRKTMDSQNVVVGFEDSMD  310
            ++L+RI+  + HD L   FHV +  R+  +IA++ HF++ TP +    +  ++    +  
Sbjct  24   ELLVRIVCSLHHDQLKPAFHVCRRFRQAVLIAQESHFDFRTPNRERQVELELMTPRPNER  83

Query  309  Y-------NEVEAPNAPRQT-RVPKLRLSHKKLSGIAVALFP*KCCFGLYMSQKFPEAL  157
            +       ++   P APR   R P+ R++   L  +A  LFP     G+   +  P A+
Sbjct  84   WPFASRTSDQPTTPMAPRHAPRPPQARIALGDLKQVAANLFPGDYEHGIEEPRPAPRAI  142



>ref|XP_002869050.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH45309.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=301

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/105 (28%), Positives = 50/105 (48%), Gaps = 12/105 (11%)
 Frame = -1

Query  489  DVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTPRKTMDSQNVVV-------  331
            D+L++I+  + HD L  +FHVS+ IR  T++A+++HF Y+TP ++      V+       
Sbjct  148  DLLVKIVCHLHHDQLKAVFHVSQRIRMATILARQYHFNYTTPDRSRQEMLSVMTPMPINR  207

Query  330  -----GFEDSMDYNEVEAPNAPRQTRVPKLRLSHKKLSGIAVALF  211
                 G  +    +    P AP+    P  R    ++  I   LF
Sbjct  208  WPFRRGDGNPTMVSSPHTPKAPKHAPRPPFRTKLAEMKQITAVLF  252



>ref|XP_010933945.1| PREDICTED: F-box protein At4g35930-like [Elaeis guineensis]
Length=137

 Score = 51.2 bits (121),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 57/105 (54%), Gaps = 7/105 (7%)
 Frame = -1

Query  489  DVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTPRKTMDSQNVVVGFEDSMD  310
            D+L++I+  ++HD+L     VSK+     ++A++ HF++STP      +   + F D  D
Sbjct  11   DILVQILCKLNHDELKPSLVVSKSFHNAALMAQQLHFDFSTPA----PKKATMAFADMKD  66

Query  309  YNEVE-APNAPRQTRVPKL-RLSHKKLSGIAVALFP*K-CCFGLY  184
             +    AP+    +R P+  +LS ++   IAV LFP   C  GL+
Sbjct  67   MDMTPGAPSLKLGSRKPRTSKLSEEETRKIAVVLFPVADCKRGLF  111



>gb|KDP23986.1| hypothetical protein JCGZ_25374 [Jatropha curcas]
Length=267

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 36/129 (28%), Positives = 58/129 (45%), Gaps = 18/129 (14%)
 Frame = -1

Query  489  DVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYS-------------TPRKTMD  349
            D+L++I+  + HD L  +FHVS+ IR   ++A+++HF Y+             TPR T  
Sbjct  117  DLLVKILCHLHHDQLRPVFHVSRRIRRAVLLARQFHFNYTTPDRSRQEMLRTMTPRPTEH  176

Query  348  SQNVVVGFEDSMDYNEVEAPNAPRQTRVPKLRLSHKKLSGIAVAL-----FP*KCCFGLY  184
               V  G   +        P APR    P  R+   ++  IA  L     FP +C     
Sbjct  177  WPFVSKGEGKAAFLPSPHTPKAPRHGPRPPSRIKVTEMKQIAAVLFQDSAFPPRCMVPSA  236

Query  183  MSQKFPEAL  157
            +S+   ++L
Sbjct  237  LSKPLCKSL  245



>ref|XP_002269563.3| PREDICTED: F-box protein At4g35930, partial [Vitis vinifera]
Length=210

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 54/106 (51%), Gaps = 13/106 (12%)
 Frame = -1

Query  489  DVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTPRKT----------MDSQN  340
            D+L++I+  + HD L  +FHVS+ IR+  ++A+++HF Y+TP ++          + +++
Sbjct  60   DLLVKILCHLHHDQLRAVFHVSQRIRKAVLLARQFHFNYTTPDRSRQEMLRTMTPLPTEH  119

Query  339  ---VVVGFEDSMDYNEVEAPNAPRQTRVPKLRLSHKKLSGIAVALF  211
               V  G    +       P APR    P  RL   ++  IA  LF
Sbjct  120  WPFVSKGDGKGVFLASPHTPKAPRHGPRPPSRLKVTEMRQIAAVLF  165



>ref|XP_008393913.1| PREDICTED: F-box protein At4g35930-like [Malus domestica]
Length=261

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 32/106 (30%), Positives = 54/106 (51%), Gaps = 13/106 (12%)
 Frame = -1

Query  489  DVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTP-RKTMDSQNVVV------  331
            D+L++++  + HD L  LFHVS+ +R+  +IA++++F Y+TP R   +  N +       
Sbjct  115  DLLVKLLCHLHHDQLKALFHVSQRVRKAVVIARQFYFNYTTPDRSRQEMLNTMTPHRAEH  174

Query  330  -GFEDSMDYNEV-----EAPNAPRQTRVPKLRLSHKKLSGIAVALF  211
              F +  D N V       P AP+    P  RL   ++  +A  LF
Sbjct  175  WPFLNKGDGNGVWIRSPHTPKAPKHGPRPPSRLKVSEMRQVAAVLF  220



>ref|XP_009379351.1| PREDICTED: F-box protein At4g35930-like [Pyrus x bretschneideri]
 ref|XP_009379352.1| PREDICTED: F-box protein At4g35930-like [Pyrus x bretschneideri]
Length=261

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 32/106 (30%), Positives = 54/106 (51%), Gaps = 13/106 (12%)
 Frame = -1

Query  489  DVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTP-RKTMDSQNVVV------  331
            D+L++++  + HD L  LFHVS+ +R+  +IA++++F Y+TP R   +  N +       
Sbjct  115  DLLVKLLCHLHHDQLKALFHVSQRVRKAVVIARQFYFNYTTPDRSRQEMLNTMTPHPAEH  174

Query  330  -GFEDSMDYNEV-----EAPNAPRQTRVPKLRLSHKKLSGIAVALF  211
              F +  D N V       P AP+    P  RL   ++  +A  LF
Sbjct  175  WPFLNKGDGNGVWIRSPHTPKAPKHGPRPPSRLKVSEMRQVAAVLF  220



>ref|XP_007156187.1| hypothetical protein PHAVU_003G265700g [Phaseolus vulgaris]
 gb|ESW28181.1| hypothetical protein PHAVU_003G265700g [Phaseolus vulgaris]
Length=274

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 31/107 (29%), Positives = 51/107 (48%), Gaps = 13/107 (12%)
 Frame = -1

Query  489  DVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYS-------------TPRKTMD  349
            ++L++I+  + HD L  +FHVS+ +R+  MIA++++F Y+             TPR T  
Sbjct  124  ELLVKILCLLHHDQLRAVFHVSQRVRKAVMIARQFYFNYTTPDRSRQEMLSTMTPRPTEH  183

Query  348  SQNVVVGFEDSMDYNEVEAPNAPRQTRVPKLRLSHKKLSGIAVALFP  208
               +  G    +       P APR    P  RL   ++  +A  LFP
Sbjct  184  WPFLSKGDGKGVRVPSPHTPKAPRHGPRPPSRLKISEMRQVAAVLFP  230



>gb|KHG28149.1| hypothetical protein F383_15342 [Gossypium arboreum]
Length=267

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 34/114 (30%), Positives = 53/114 (46%), Gaps = 29/114 (25%)
 Frame = -1

Query  489  DVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTP---RKTM-----------  352
            D+L++I+  + HD L  +FHVS+ IR    +A+++HF Y+TP   R+ M           
Sbjct  117  DLLVKILCHLHHDQLRAVFHVSQRIRRAVCLARQFHFNYTTPDRSRQEMLSTMTPRVTEH  176

Query  351  -------DSQNVVVGFEDSMDYNEVEAPNAPRQTRVPKLRLSHKKLSGIAVALF  211
                   D ++ ++G            P APRQ   P  R+   +L  IA  LF
Sbjct  177  WPFLSKRDGKSNLIG--------SPHTPKAPRQGPRPPSRIKVTELRQIAAVLF  222



>ref|XP_007046629.1| F-box family protein [Theobroma cacao]
 gb|EOX90786.1| F-box family protein [Theobroma cacao]
Length=267

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 33/106 (31%), Positives = 50/106 (47%), Gaps = 13/106 (12%)
 Frame = -1

Query  489  DVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYS-------------TPRKTMD  349
            D+L++I+  + HD L  +FHVS+ IR+   +A+++HF Y+             TPR T  
Sbjct  117  DLLVKILCHLHHDQLRAVFHVSQRIRKAVCLARQFHFNYTTPDRSRQEMLSTMTPRPTEH  176

Query  348  SQNVVVGFEDSMDYNEVEAPNAPRQTRVPKLRLSHKKLSGIAVALF  211
               +  G   S+       P APR    P  R+   +L  IA  LF
Sbjct  177  WPFMSKGDGKSILMRSPHTPKAPRHGPRPPSRVKVTELRQIAAVLF  222



>emb|CDP01862.1| unnamed protein product [Coffea canephora]
Length=295

 Score = 52.8 bits (125),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 37/129 (29%), Positives = 59/129 (46%), Gaps = 18/129 (14%)
 Frame = -1

Query  489  DVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTPRKTMDSQNVVV-------  331
            D+L++I+  + HD L  +FHVS+ IR+  + A+++HF Y+TP +T       +       
Sbjct  145  DLLVKIMCHLHHDQLRAVFHVSQKIRKAVIQARQFHFNYTTPDRTRQEMLRTMTPLPTDH  204

Query  330  -GFEDSMDYNEV-----EAPNAPRQTRVPKLRLSHKKLSGIAVAL-----FP*KCCFGLY  184
              F    D   +       P APR    P  RL   ++  IA  L     FP +C     
Sbjct  205  WPFMSKGDGKGIWIPSPHTPKAPRHGPRPPSRLKFTEMRQIAAVLFQESAFPSRCLVPSA  264

Query  183  MSQKFPEAL  157
            +SQ   ++L
Sbjct  265  LSQPICKSL  273



>ref|XP_010920109.1| PREDICTED: F-box protein At4g35930 isoform X1 [Elaeis guineensis]
Length=266

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 38/107 (36%), Positives = 54/107 (50%), Gaps = 16/107 (15%)
 Frame = -1

Query  489  DVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTP---RKTMDSQNVVV----  331
            D+L++II  + HD L  +FHVS+ IR   + A++ HF Y+TP   R+ M S    +    
Sbjct  117  DLLVQIICHLHHDHLKAVFHVSQRIRAAVLQARQLHFNYTTPDRSRQEMLSAMTPLPTEH  176

Query  330  -GFEDSMDYNEVEA-----PNAPRQ-TRVPKLRLSHKKLSGIAVALF  211
              F    D N ++      P APR   R P+LR+   K   IA  LF
Sbjct  177  WPFVSKGDGNAIQGSTPHTPKAPRHGPRPPRLRMMDMK--QIAAVLF  221



>ref|XP_010548266.1| PREDICTED: F-box protein At4g35930 isoform X3 [Tarenaya hassleriana]
Length=268

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 33/106 (31%), Positives = 51/106 (48%), Gaps = 13/106 (12%)
 Frame = -1

Query  489  DVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTP---RKTMDSQNVVV----  331
            D+L++++  + HD L  +FHVS+ IR   ++AK ++F Y+TP   R+ M S         
Sbjct  118  DLLVKLLCHLHHDQLKAVFHVSQRIRRAVLLAKHYYFNYTTPDRSRQEMLSATTPRPIDH  177

Query  330  -GFEDSMDYN-----EVEAPNAPRQTRVPKLRLSHKKLSGIAVALF  211
              F    D N      +  P APR    P  R+   ++  IA  LF
Sbjct  178  WPFVSKADGNPAFVPRLHTPKAPRHGPRPPSRIKIAEMKQIAAVLF  223



>gb|EYU30815.1| hypothetical protein MIMGU_mgv1a011614mg [Erythranthe guttata]
Length=276

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 30/105 (29%), Positives = 52/105 (50%), Gaps = 12/105 (11%)
 Frame = -1

Query  489  DVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTP---RKTMDSQNVVVGFE-  322
            D+L++I+  + HD L  +FHVS+ IR+  +IA+++HF Y+TP   R+ M +    +  E 
Sbjct  127  DLLVKILCHLHHDQLRAVFHVSQKIRKAVVIARQFHFNYTTPDRSRQEMLNTKTPLPTEH  186

Query  321  --------DSMDYNEVEAPNAPRQTRVPKLRLSHKKLSGIAVALF  211
                        +     P AP+    P  RL   ++  ++  LF
Sbjct  187  WPFMSKGGGKGLFASPHTPKAPKHGPRPPSRLKFTEMRQVSAVLF  231



>ref|XP_004287785.1| PREDICTED: F-box protein At4g35930-like [Fragaria vesca subsp. 
vesca]
Length=310

 Score = 52.4 bits (124),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 50/106 (47%), Gaps = 13/106 (12%)
 Frame = -1

Query  489  DVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTP--------RKTMDSQNVV  334
            D+L++++  + HD L  +FHVS+ IR+  ++A+++HF Y+TP        R        V
Sbjct  160  DLLVKLLCHLHHDQLKPVFHVSQRIRKAVILARQYHFNYTTPDRSRQEMLRTMTPHPTEV  219

Query  333  VGFEDSMD-----YNEVEAPNAPRQTRVPKLRLSHKKLSGIAVALF  211
              F+   D           P APR    P  RL   ++  +A  LF
Sbjct  220  WPFKSKGDGKGTWIRSPHTPKAPRHGPRPPSRLKVSEIRQVAAVLF  265



>ref|XP_003629266.1| F-box protein [Medicago truncatula]
 gb|AET03742.1| F-box protein [Medicago truncatula]
Length=264

 Score = 52.4 bits (124),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 30/105 (29%), Positives = 51/105 (49%), Gaps = 12/105 (11%)
 Frame = -1

Query  489  DVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTPRK-------TMDSQ----  343
            D+L++I+  + HD L  +FHVS+ IR+  ++A+++HF Y+TP +       TM  +    
Sbjct  115  DLLVKILCCLHHDQLRAVFHVSQRIRKAVIVARQFHFNYTTPDRSRLEMLSTMTPRPSEH  174

Query  342  -NVVVGFEDSMDYNEVEAPNAPRQTRVPKLRLSHKKLSGIAVALF  211
               + G    +       P APR    P  RL   ++  +   LF
Sbjct  175  WPFLWGDGKGLRIPSPHTPKAPRHGPRPPSRLKVSEMRQVTAVLF  219



>ref|XP_010548262.1| PREDICTED: F-box protein At4g35930 isoform X1 [Tarenaya hassleriana]
 ref|XP_010548263.1| PREDICTED: F-box protein At4g35930 isoform X1 [Tarenaya hassleriana]
 ref|XP_010548264.1| PREDICTED: F-box protein At4g35930 isoform X1 [Tarenaya hassleriana]
Length=299

 Score = 52.0 bits (123),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 33/106 (31%), Positives = 51/106 (48%), Gaps = 13/106 (12%)
 Frame = -1

Query  489  DVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTP---RKTMDSQNVVV----  331
            D+L++++  + HD L  +FHVS+ IR   ++AK ++F Y+TP   R+ M S         
Sbjct  149  DLLVKLLCHLHHDQLKAVFHVSQRIRRAVLLAKHYYFNYTTPDRSRQEMLSATTPRPIDH  208

Query  330  -GFEDSMDYN-----EVEAPNAPRQTRVPKLRLSHKKLSGIAVALF  211
              F    D N      +  P APR    P  R+   ++  IA  LF
Sbjct  209  WPFVSKADGNPAFVPRLHTPKAPRHGPRPPSRIKIAEMKQIAAVLF  254



>ref|XP_010113310.1| F-box protein [Morus notabilis]
 gb|EXC35317.1| F-box protein [Morus notabilis]
Length=262

 Score = 52.0 bits (123),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 29/106 (27%), Positives = 52/106 (49%), Gaps = 13/106 (12%)
 Frame = -1

Query  489  DVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTPRKTMDSQNVVV-------  331
            D+L++++  + HD L  +FHVS+ +R+  +IA++++F Y+TP ++       +       
Sbjct  112  DLLVKVLCHLHHDQLRAVFHVSQRVRKAVLIARQFYFNYTTPDRSRQEMLRTMTPRPTEH  171

Query  330  -GFEDSMDYNEV-----EAPNAPRQTRVPKLRLSHKKLSGIAVALF  211
              F    D   +       P APRQ   P  RL   ++  +A  LF
Sbjct  172  WPFASKGDGKGIWLPSPHTPKAPRQGPRPPSRLKASEVRQVAAVLF  217



>ref|XP_009413026.1| PREDICTED: F-box protein At4g35930-like [Musa acuminata subsp. 
malaccensis]
Length=261

 Score = 52.0 bits (123),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 33/101 (33%), Positives = 52/101 (51%), Gaps = 8/101 (8%)
 Frame = -1

Query  489  DVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTP---RKTMDSQNVVVGFED  319
            D+L++I+  + HD L  +FHVS+ IR   ++A++ HF Y+TP   R+ M +    V  E 
Sbjct  116  DILVKILCHLHHDQLRAVFHVSQRIRTAVLLARQLHFNYTTPDRSRQEMLNTKTPVPTEH  175

Query  318  ----SMDYNEVEAPNAPRQTR-VPKLRLSHKKLSGIAVALF  211
                S    +   P+ P+  R  P+ RL    +  IA  LF
Sbjct  176  WPFVSKANGKRPTPHTPKAPRHGPRPRLHLMDMRQIAAVLF  216



>ref|XP_011043150.1| PREDICTED: F-box protein At4g35930 [Populus euphratica]
 ref|XP_011043152.1| PREDICTED: F-box protein At4g35930 [Populus euphratica]
 ref|XP_011043153.1| PREDICTED: F-box protein At4g35930 [Populus euphratica]
 ref|XP_011043154.1| PREDICTED: F-box protein At4g35930 [Populus euphratica]
Length=288

 Score = 52.0 bits (123),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 27/106 (25%), Positives = 52/106 (49%), Gaps = 13/106 (12%)
 Frame = -1

Query  489  DVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTPRKTMDSQNVVV-------  331
            ++L++I+  + HD L  +FHVS+ +R+  ++A+++HF Y+TP ++     + +       
Sbjct  138  ELLVKILCHLHHDQLRAVFHVSQRVRKAVLLARQFHFNYTTPDRSRQEMLLTMTPRPTEH  197

Query  330  ------GFEDSMDYNEVEAPNAPRQTRVPKLRLSHKKLSGIAVALF  211
                  G    +  +    P APR    P  R+   ++  IA  LF
Sbjct  198  WPFMSKGSGKGIFMSTPHTPKAPRHGPRPPSRIKITEMKSIAAVLF  243



>gb|EMS55625.1| hypothetical protein TRIUR3_10151 [Triticum urartu]
Length=267

 Score = 51.6 bits (122),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 37/107 (35%), Positives = 53/107 (50%), Gaps = 14/107 (13%)
 Frame = -1

Query  489  DVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTPRKTMDS--QNVVV-----  331
            D+LI+I+  + HD L  +FHVS  IR+   +A+++HF Y+TP ++     QN        
Sbjct  114  DLLIKIVCYLHHDQLKAVFHVSSRIRKAVELARQYHFNYTTPDRSRQELLQNKTPLRSEH  173

Query  330  -GFEDSMDYNEVEAPNAPRQTRVPK--LRLSHKKL---SGIAVALFP  208
              F   +D  +V     PR  + PK   R SH KL     I   LFP
Sbjct  174  WPFTSRIDGKDVRV-ATPRTPKAPKHGPRPSHFKLLDVKPITAVLFP  219



>ref|XP_006383065.1| hypothetical protein POPTR_0005s11220g [Populus trichocarpa]
 gb|ERP60862.1| hypothetical protein POPTR_0005s11220g [Populus trichocarpa]
Length=288

 Score = 52.0 bits (123),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 27/106 (25%), Positives = 52/106 (49%), Gaps = 13/106 (12%)
 Frame = -1

Query  489  DVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTPRKTMDSQNVVV-------  331
            ++L++I+  + HD L  +FHVS+ +R+  ++A+++HF Y+TP ++     + +       
Sbjct  138  ELLVKILCHLHHDQLRAVFHVSQRVRKAVLLARQFHFNYTTPDRSRQEMLLTMTPRPTEH  197

Query  330  ------GFEDSMDYNEVEAPNAPRQTRVPKLRLSHKKLSGIAVALF  211
                  G    +  +    P APR    P  R+   ++  IA  LF
Sbjct  198  WPFMSKGSGKGIFMSTPHTPKAPRHGPRPPSRIKITEMKSIAAVLF  243



>ref|XP_006661792.1| PREDICTED: F-box protein At4g35930-like [Oryza brachyantha]
Length=262

 Score = 51.6 bits (122),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 35/107 (33%), Positives = 54/107 (50%), Gaps = 14/107 (13%)
 Frame = -1

Query  489  DVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTP---RKTMDSQNVVV----  331
            ++LI+II  + HD L+ +FHVSK IR+   +A+++HF Y+TP   R+ +   +  +    
Sbjct  111  ELLIKIICCLHHDQLNIVFHVSKRIRKAVELARQYHFNYTTPDRSRQELLQHSTPLPTEH  170

Query  330  -GFEDSMDYNEVEAPNAPRQTRVPK-----LRLSHKKLSGIAVALFP  208
              F   +D  +V   + PR  R PK      RL       I   LFP
Sbjct  171  WPFMSRIDGKDVRI-STPRTPRAPKHAPRLARLELLDFKPITAVLFP  216



>ref|XP_004509385.1| PREDICTED: F-box protein At4g35930-like isoform X1 [Cicer arietinum]
Length=268

 Score = 51.6 bits (122),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 51/106 (48%), Gaps = 13/106 (12%)
 Frame = -1

Query  489  DVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTP---RKTMDSQN-------  340
            D+L++I+  + HD L  +FHVS+ IR+  ++A+++HF Y+TP   R+ M S         
Sbjct  118  DLLVKILCHLHHDQLRAVFHVSQRIRKAVIVARQFHFNYTTPDRSRQEMISTMTPRPSEH  177

Query  339  ---VVVGFEDSMDYNEVEAPNAPRQTRVPKLRLSHKKLSGIAVALF  211
               +  G    +       P APR    P  RL   ++  +   LF
Sbjct  178  WPFMCRGDGKGVRIPSPHTPKAPRHGPRPPSRLKVSEMRQVTAVLF  223



>ref|XP_004509386.1| PREDICTED: F-box protein At4g35930-like isoform X2 [Cicer arietinum]
Length=267

 Score = 51.6 bits (122),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 31/105 (30%), Positives = 51/105 (49%), Gaps = 12/105 (11%)
 Frame = -1

Query  489  DVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTP---RKTMDSQ--------  343
            D+L++I+  + HD L  +FHVS+ IR+  ++A+++HF Y+TP   R+ M S         
Sbjct  118  DLLVKILCHLHHDQLRAVFHVSQRIRKAVIVARQFHFNYTTPDRSRQEMISTMTPRPSEH  177

Query  342  -NVVVGFEDSMDYNEVEAPNAPRQTRVPKLRLSHKKLSGIAVALF  211
               + G    +       P APR    P  RL   ++  +   LF
Sbjct  178  WPFMWGDGKGVRIPSPHTPKAPRHGPRPPSRLKVSEMRQVTAVLF  222



>ref|XP_003519858.1| PREDICTED: F-box protein At4g35930-like [Glycine max]
Length=286

 Score = 51.6 bits (122),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 31/107 (29%), Positives = 51/107 (48%), Gaps = 13/107 (12%)
 Frame = -1

Query  489  DVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTP---RKTMDSQN-------  340
            D+L++I+  + HD L  +FHVS+ IR+  ++A+++HF  +TP   R+ M S         
Sbjct  136  DLLVKILCHLHHDQLRAVFHVSQRIRKAVIMARQFHFNNTTPDRSRQEMLSTTTPCPTEH  195

Query  339  ---VVVGFEDSMDYNEVEAPNAPRQTRVPKLRLSHKKLSGIAVALFP  208
               +  G    +       P APR    P  RL   ++  +   LFP
Sbjct  196  WPFLCKGDGKGIRIPSPHTPKAPRHGLRPSSRLKISEMQQVTAVLFP  242



>ref|NP_195318.2| F-box protein [Arabidopsis thaliana]
 sp|Q5XF11.1|FB248_ARATH RecName: Full=F-box protein At4g35930 [Arabidopsis thaliana]
 gb|AAU94368.1| At4g35930 [Arabidopsis thaliana]
 gb|AAV43787.1| At4g35930 [Arabidopsis thaliana]
 gb|AEE86592.1| F-box protein [Arabidopsis thaliana]
Length=321

 Score = 51.6 bits (122),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 29/105 (28%), Positives = 50/105 (48%), Gaps = 12/105 (11%)
 Frame = -1

Query  489  DVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTPRKTMDSQNVVV-------  331
            D+L++I+  + HD L  +FHVS+ IR  T++A+++HF Y+TP ++      V+       
Sbjct  168  DLLVKIVCHLHHDQLKAVFHVSQRIRMATILARQYHFNYTTPDRSRQEMLRVMTPVPINR  227

Query  330  -----GFEDSMDYNEVEAPNAPRQTRVPKLRLSHKKLSGIAVALF  211
                 G  +    +    P AP+    P  R    ++  I   LF
Sbjct  228  WPFRRGDGNPTMVSSPHTPKAPKHAPRPPSRTKLAEMKQITAVLF  272



>emb|CAN71843.1| hypothetical protein VITISV_036263 [Vitis vinifera]
Length=463

 Score = 51.6 bits (122),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 50/106 (47%), Gaps = 13/106 (12%)
 Frame = -1

Query  489  DVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTPRKTMDSQ-----------  343
            D+L++I+  + HD L  +FHVS+ IR+  ++A+++HF Y+TP ++               
Sbjct  313  DLLVKILCHLHHDQLRAVFHVSQRIRKAVLLARQFHFNYTTPDRSRQEMLRTMTPLPTEH  372

Query  342  --NVVVGFEDSMDYNEVEAPNAPRQTRVPKLRLSHKKLSGIAVALF  211
               V  G    +       P APR    P  RL   ++  IA  LF
Sbjct  373  WPFVSKGDGKGVFLASPHTPKAPRHGPRPPSRLKVTEMRQIAAVLF  418



>ref|XP_010033518.1| PREDICTED: F-box protein At4g35930 [Eucalyptus grandis]
 gb|KCW53200.1| hypothetical protein EUGRSUZ_J02473 [Eucalyptus grandis]
Length=265

 Score = 51.2 bits (121),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 29/105 (28%), Positives = 50/105 (48%), Gaps = 12/105 (11%)
 Frame = -1

Query  489  DVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTPRKTMDSQNVVV-------  331
            D+L++I+  + HD L  +FHVS+ +R+  +IA+++HF Y+TP ++       +       
Sbjct  116  DLLVKIMCHLHHDQLRAVFHVSQRVRKAVLIARQFHFNYTTPDRSRQEMLRTMTPRPTEH  175

Query  330  -----GFEDSMDYNEVEAPNAPRQTRVPKLRLSHKKLSGIAVALF  211
                 G    +       P APR    P  R+   ++  IA  LF
Sbjct  176  WPFKRGDGKGVFMPSPHTPKAPRHGPRPPSRIKLAEMRQIAAVLF  220



>gb|ACF81677.1| unknown [Zea mays]
Length=266

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 19/42 (45%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = -1

Query  489  DVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTP  364
            D+L++I+  + HD+L  +FHVSK IR+   +A+++HF Y+TP
Sbjct  112  DLLVKIMCCLHHDELKEVFHVSKRIRKAVELARQYHFNYTTP  153



>ref|NP_001169959.1| uncharacterized protein LOC100383858 [Zea mays]
 gb|ACN35359.1| unknown [Zea mays]
 gb|AFW68709.1| hypothetical protein ZEAMMB73_577625 [Zea mays]
Length=265

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 37/106 (35%), Positives = 56/106 (53%), Gaps = 13/106 (12%)
 Frame = -1

Query  489  DVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTP---RKTMDSQNVVVGFED  319
            D+LI+I+  + HD+L  +FHVSK IR+   +A+++HF Y+TP   R+ +      +  E 
Sbjct  112  DLLIKIMCCLHHDELKVVFHVSKRIRKAVQLAREFHFNYTTPDRSRQELLLNRTPLPTEH  171

Query  318  ----SMDYNEVEAPNAPRQTRVPK--LRLSHKKL---SGIAVALFP  208
                 ++  +V   + PR  R PK   RLS  KL     I   LFP
Sbjct  172  WPFLRINGKDVHV-STPRTPRAPKHAARLSRLKLVDVKPITAVLFP  216



>ref|XP_002531155.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF31240.1| conserved hypothetical protein [Ricinus communis]
Length=269

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/106 (30%), Positives = 48/106 (45%), Gaps = 13/106 (12%)
 Frame = -1

Query  489  DVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYS-------------TPRKTMD  349
            D+L++I+  + HD L  +FHVS+ IR   ++A+++HF Y+             TPR T  
Sbjct  119  DLLVKILCHLHHDQLRAVFHVSRRIRRAVVLARQFHFNYTTPDRSRQEILRVMTPRPTEH  178

Query  348  SQNVVVGFEDSMDYNEVEAPNAPRQTRVPKLRLSHKKLSGIAVALF  211
               V  G            P APR    P  R+   ++  IA  LF
Sbjct  179  WPFVSKGDGKGAFMPSPHTPKAPRHGPRPPSRVKVTEMKQIAAVLF  224



>ref|XP_002467186.1| hypothetical protein SORBIDRAFT_01g021140 [Sorghum bicolor]
 gb|EER94184.1| hypothetical protein SORBIDRAFT_01g021140 [Sorghum bicolor]
Length=265

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/45 (44%), Positives = 33/45 (73%), Gaps = 0/45 (0%)
 Frame = -1

Query  489  DVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTPRKT  355
            D+LI+I+  + HD L  +FHVSK IR+   +A+++HF Y+TP ++
Sbjct  112  DLLIKIMCCLHHDQLKAVFHVSKRIRKAVELARQYHFNYTTPDRS  156



>ref|XP_004983038.1| PREDICTED: F-box protein At4g35930-like [Setaria italica]
Length=264

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/42 (48%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = -1

Query  489  DVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTP  364
            D+LI+I+  + HD L  +FHVSK IR+   +A+++HF Y+TP
Sbjct  112  DLLIKIMCCLHHDQLKAVFHVSKRIRKAVELARQYHFNYTTP  153



>ref|XP_004234526.1| PREDICTED: F-box protein At4g35930 [Solanum lycopersicum]
 ref|XP_010317689.1| PREDICTED: F-box protein At4g35930 [Solanum lycopersicum]
Length=277

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/106 (28%), Positives = 50/106 (47%), Gaps = 13/106 (12%)
 Frame = -1

Query  489  DVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTPRKTMDS--QNVVVGFEDS  316
            D+L++++  + HD L  +FHVS+ IR+  + A+ +HF Y+TP +T     + +     D 
Sbjct  127  DLLVKLLCHLHHDQLKAVFHVSQKIRKAVIQARLFHFNYTTPDRTRQEMLRTMTPTPTDH  186

Query  315  MDY-----------NEVEAPNAPRQTRVPKLRLSHKKLSGIAVALF  211
              +           N    P AP+    P  RL   ++  IA  LF
Sbjct  187  WPFVSKENGKGAWINTPHTPKAPKHGPRPSPRLKFPEMRHIAAVLF  232



>ref|NP_001059985.1| Os07g0561300 [Oryza sativa Japonica Group]
 dbj|BAC83377.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAD31160.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF21899.1| Os07g0561300 [Oryza sativa Japonica Group]
 gb|EAZ04334.1| hypothetical protein OsI_26475 [Oryza sativa Indica Group]
 gb|EAZ40290.1| hypothetical protein OsJ_24735 [Oryza sativa Japonica Group]
 gb|ACA51873.1| MM724 [Oryza sativa Indica Group]
 dbj|BAG93233.1| unnamed protein product [Oryza sativa Japonica Group]
 emb|CAO94352.1| F-box protein [Oryza sativa Indica Group]
Length=168

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/43 (47%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = -1

Query  492  QDVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTP  364
            QDVLI+++  V+H DL  L  VSK + E T++A++ HF ++TP
Sbjct  72   QDVLIKVLCKVNHSDLRPLLLVSKQVSEATVVAREQHFAFATP  114



>ref|NP_001132716.1| uncharacterized protein LOC100194199 [Zea mays]
 gb|ACG36572.1| F-box domain containing protein [Zea mays]
 tpg|DAA49873.1| TPA: F-box domain containing protein [Zea mays]
Length=266

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 19/42 (45%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = -1

Query  489  DVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTP  364
            D+L++I+  + HD+L  +FHVSK IR+   +A+++HF Y+TP
Sbjct  112  DLLVKIMCCLHHDELKVVFHVSKRIRKAVELARQYHFNYTTP  153



>ref|XP_007202456.1| hypothetical protein PRUPE_ppa010075mg [Prunus persica]
 gb|EMJ03655.1| hypothetical protein PRUPE_ppa010075mg [Prunus persica]
Length=265

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/106 (26%), Positives = 51/106 (48%), Gaps = 13/106 (12%)
 Frame = -1

Query  489  DVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTP-RKTMDSQNVVV------  331
            D+L++++  + HD L  +FHVS+ +R+  ++A++++F Y+TP R   +  N +       
Sbjct  115  DLLVKVLCHLHHDQLKAVFHVSQRVRKAVLLARQFYFNYTTPDRSRQEMLNTMTPHPTEH  174

Query  330  ------GFEDSMDYNEVEAPNAPRQTRVPKLRLSHKKLSGIAVALF  211
                  G    +       P APR    P  RL   ++  +A  LF
Sbjct  175  WPFLSKGDGKGIFIRSPHTPKAPRHGPRPPSRLKVSEMRQVAAVLF  220



>ref|XP_008242043.1| PREDICTED: F-box protein At4g35930 [Prunus mume]
 ref|XP_008242044.1| PREDICTED: F-box protein At4g35930 [Prunus mume]
Length=265

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/106 (26%), Positives = 51/106 (48%), Gaps = 13/106 (12%)
 Frame = -1

Query  489  DVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTP-RKTMDSQNVVV------  331
            D+L++++  + HD L  +FHVS+ +R+  ++A++++F Y+TP R   +  N +       
Sbjct  115  DLLVKVLCHLHHDQLKAVFHVSQRVRKAVLLARQFYFNYTTPDRSRQEMLNTMTPHPTEH  174

Query  330  ------GFEDSMDYNEVEAPNAPRQTRVPKLRLSHKKLSGIAVALF  211
                  G    +       P APR    P  RL   ++  +A  LF
Sbjct  175  WPFLSKGDGKGIFIRSPHTPKAPRHGPRPPSRLKVSEMRQVAAVLF  220



>ref|XP_009400369.1| PREDICTED: F-box protein At4g35930-like [Musa acuminata subsp. 
malaccensis]
Length=263

 Score = 49.7 bits (117),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 49/105 (47%), Gaps = 13/105 (12%)
 Frame = -1

Query  489  DVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTP---RKTMDSQNVVVGFE-  322
            D+L++I+  + HD L  +FHV + +R   ++A+K HF Y+TP   R+ M      V  E 
Sbjct  115  DLLVKILCYLHHDQLRAVFHVCQQVRTAVLLARKQHFNYTTPDRSRQGMLRNRTPVPSEH  174

Query  321  --------DSMDYNEVEAPNAPRQTRVPKLRLSHKKLSGIAVALF  211
                      M  +    P APRQ   P  RL    +  I+  LF
Sbjct  175  WSFVRKEGKGMWVSSPHTPRAPRQGPRPP-RLHIMDMKQISAVLF  218



>ref|NP_001064681.1| Os10g0438500 [Oryza sativa Japonica Group]
 gb|AAP53951.2| F-box domain containing protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF26595.1| Os10g0438500 [Oryza sativa Japonica Group]
 dbj|BAG95885.1| unnamed protein product [Oryza sativa Japonica Group]
Length=262

 Score = 49.7 bits (117),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 34/107 (32%), Positives = 53/107 (50%), Gaps = 14/107 (13%)
 Frame = -1

Query  489  DVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTP---RKTMDSQNVVV----  331
            ++LI+II  + HD L+ +FHVSK IR+   +A+++HF Y+TP   R+ +      +    
Sbjct  111  ELLIKIICCLHHDQLNIVFHVSKRIRKAVELARQYHFNYTTPDRSRQELLQHTTPLPTEH  170

Query  330  -GFEDSMDYNEVEAPNAPRQTRVPK-----LRLSHKKLSGIAVALFP  208
              F   +D  +V   + PR  + PK      RL       I   LFP
Sbjct  171  WPFMSRIDGKDVRI-STPRTPKAPKHAPRLARLELLDFKPITAVLFP  216



>gb|EEC67030.1| hypothetical protein OsI_33755 [Oryza sativa Indica Group]
 gb|EEE51018.1| hypothetical protein OsJ_31651 [Oryza sativa Japonica Group]
Length=261

 Score = 49.3 bits (116),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 34/106 (32%), Positives = 53/106 (50%), Gaps = 13/106 (12%)
 Frame = -1

Query  489  DVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTP---RKTMDSQNVVVGFE-  322
            ++LI+II  + HD L+ +FHVSK IR+   +A+++HF Y+TP   R+ +      +  E 
Sbjct  111  ELLIKIICCLHHDQLNIVFHVSKRIRKAVELARQYHFNYTTPDRSRQELLQHTTPLPTEH  170

Query  321  ------DSMDYNEVEAPNAPRQTR-VPKL-RLSHKKLSGIAVALFP  208
                  D  D   +  P  P+  +  P+L RL       I   LFP
Sbjct  171  WPFMRIDGKDVR-ISTPRTPKAPKHAPRLARLELLDFKPITAVLFP  215



>ref|XP_009624359.1| PREDICTED: F-box protein At4g35930 [Nicotiana tomentosiformis]
Length=277

 Score = 49.3 bits (116),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 33/106 (31%), Positives = 50/106 (47%), Gaps = 13/106 (12%)
 Frame = -1

Query  489  DVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTP---RKTMDSQNVVV----  331
            D+L++I+  + HD L  +FHVS+ IR+  + A+ +HF Y+TP   R+ M      +    
Sbjct  127  DLLVKILCHLHHDQLKAVFHVSQKIRKAVIQARIFHFNYTTPDRMRQEMLRTMTPLPTDH  186

Query  330  -GFEDSMDYNEV-----EAPNAPRQTRVPKLRLSHKKLSGIAVALF  211
              F    D N         P AP+    P  RL   ++  IA  LF
Sbjct  187  WPFVSKEDRNGAWLPSPHTPKAPKHGPRPPSRLKFTEMRQIAAVLF  232



>gb|KHG01213.1| hypothetical protein F383_22992 [Gossypium arboreum]
Length=258

 Score = 49.3 bits (116),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 32/108 (30%), Positives = 50/108 (46%), Gaps = 17/108 (16%)
 Frame = -1

Query  489  DVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTPRKTMDSQNVVV-------  331
            D+L++I+  + HD L  +FHVS+ IR+    A+++HF Y+TP ++   Q V+        
Sbjct  108  DLLVKILCHLHHDQLRAVFHVSQRIRKAVSQARQFHFNYTTPDRS--RQEVLSTMTPRPT  165

Query  330  --------GFEDSMDYNEVEAPNAPRQTRVPKLRLSHKKLSGIAVALF  211
                    G    +       P APR    P  R+   +L  IA  LF
Sbjct  166  DHWPFTSKGEGKGIMLKSPHTPKAPRHGPRPPSRVKVTELRQIAAVLF  213



>gb|KHG01212.1| hypothetical protein F383_22992 [Gossypium arboreum]
Length=266

 Score = 49.3 bits (116),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 32/108 (30%), Positives = 50/108 (46%), Gaps = 17/108 (16%)
 Frame = -1

Query  489  DVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTPRKTMDSQNVVV-------  331
            D+L++I+  + HD L  +FHVS+ IR+    A+++HF Y+TP ++   Q V+        
Sbjct  116  DLLVKILCHLHHDQLRAVFHVSQRIRKAVSQARQFHFNYTTPDRS--RQEVLSTMTPRPT  173

Query  330  --------GFEDSMDYNEVEAPNAPRQTRVPKLRLSHKKLSGIAVALF  211
                    G    +       P APR    P  R+   +L  IA  LF
Sbjct  174  DHWPFTSKGEGKGIMLKSPHTPKAPRHGPRPPSRVKVTELRQIAAVLF  221



>ref|XP_009383999.1| PREDICTED: F-box protein At4g35930-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009384000.1| PREDICTED: F-box protein At4g35930-like [Musa acuminata subsp. 
malaccensis]
Length=265

 Score = 48.9 bits (115),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 19/42 (45%), Positives = 30/42 (71%), Gaps = 0/42 (0%)
 Frame = -1

Query  489  DVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTP  364
            D+LI+I+  + HD L  +FHVS+ IR   ++A++ HF Y+TP
Sbjct  116  DLLIKILCHLHHDQLRAVFHVSQRIRTAVLMARQLHFNYTTP  157



>ref|XP_006425397.1| hypothetical protein CICLE_v10026280mg [Citrus clementina]
 gb|ESR38637.1| hypothetical protein CICLE_v10026280mg [Citrus clementina]
Length=268

 Score = 48.9 bits (115),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 49/106 (46%), Gaps = 13/106 (12%)
 Frame = -1

Query  489  DVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYS-------------TPRKTMD  349
            D+L++I+  + HD L  +FHVS+ IR   +IA++++F Y+             TPR T  
Sbjct  118  DLLVKILCHLHHDQLRPVFHVSRKIRSAVVIARQFYFNYTTPDRSRQEMLQSMTPRPTER  177

Query  348  SQNVVVGFEDSMDYNEVEAPNAPRQTRVPKLRLSHKKLSGIAVALF  211
               V  G    +       P AP+    P  R+   ++  IA  LF
Sbjct  178  WPFVSKGEGRGVLMPSPHTPKAPKHGPRPPSRMKITEMRQIAAVLF  223



>ref|XP_006466997.1| PREDICTED: F-box protein At4g35930-like isoform X1 [Citrus sinensis]
 ref|XP_006466998.1| PREDICTED: F-box protein At4g35930-like isoform X2 [Citrus sinensis]
 gb|KDO71303.1| hypothetical protein CISIN_1g024421mg [Citrus sinensis]
 gb|KDO71304.1| hypothetical protein CISIN_1g024421mg [Citrus sinensis]
Length=268

 Score = 48.9 bits (115),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 49/106 (46%), Gaps = 13/106 (12%)
 Frame = -1

Query  489  DVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYS-------------TPRKTMD  349
            D+L++I+  + HD L  +FHVS+ IR   +IA++++F Y+             TPR T  
Sbjct  118  DLLVKILCHLHHDQLRPVFHVSRKIRSAVVIARQFYFNYTTPDRSRQEMLQIMTPRPTER  177

Query  348  SQNVVVGFEDSMDYNEVEAPNAPRQTRVPKLRLSHKKLSGIAVALF  211
               V  G    +       P AP+    P  R+   ++  IA  LF
Sbjct  178  WPFVSKGEGRGVLMPSPHTPKAPKHGPRPPSRMKITEMRQIAAVLF  223



>ref|XP_010266005.1| PREDICTED: F-box protein At4g35930 [Nelumbo nucifera]
 ref|XP_010266006.1| PREDICTED: F-box protein At4g35930 [Nelumbo nucifera]
 ref|XP_010266007.1| PREDICTED: F-box protein At4g35930 [Nelumbo nucifera]
Length=274

 Score = 48.9 bits (115),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 30/104 (29%), Positives = 52/104 (50%), Gaps = 10/104 (10%)
 Frame = -1

Query  489  DVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTP---RKTMDSQNVVV----  331
            D+L++I+  + HD+L  +F+VS+ +R+   +A   HF Y+TP   R+ M +    +    
Sbjct  127  DLLVKILCHLHHDELEAVFYVSQKLRKAVDLAMNCHFNYTTPDRSRQEMLNMKTPLPTER  186

Query  330  -GFEDSMDYNEV--EAPNAPRQTRVPKLRLSHKKLSGIAVALFP  208
              F    D  ++    P APR    P  RL+  ++   +  LFP
Sbjct  187  WPFMSKRDGKQICPHTPKAPRHGARPPSRLNITEMRKFSAVLFP  230



>ref|XP_006340769.1| PREDICTED: F-box protein At4g35930-like isoform X1 [Solanum tuberosum]
 ref|XP_006340770.1| PREDICTED: F-box protein At4g35930-like isoform X2 [Solanum tuberosum]
Length=277

 Score = 48.5 bits (114),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 49/106 (46%), Gaps = 13/106 (12%)
 Frame = -1

Query  489  DVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTP-RKTMDSQNVV-------  334
            D+L+ I+  + HD L  +FHVS+  R+   +A+++HF Y+TP R+  D    +       
Sbjct  127  DLLVNILCHLQHDQLKAVFHVSQKTRKAVTLARQFHFNYTTPDRRRQDMLGTMTPLPTDH  186

Query  333  VGFEDSMD-----YNEVEAPNAPRQTRVPKLRLSHKKLSGIAVALF  211
              F    D      +    P AP+    P  RL   ++  IA  LF
Sbjct  187  CPFASKGDGKGAWVHSPVTPQAPKHGPKPPSRLKFIEMEQIAAVLF  232



>ref|XP_010234761.1| PREDICTED: F-box protein At4g35930 isoform X2 [Brachypodium distachyon]
Length=263

 Score = 48.5 bits (114),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 20/42 (48%), Positives = 30/42 (71%), Gaps = 0/42 (0%)
 Frame = -1

Query  489  DVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTP  364
            D+LI+I+  + HD L  +FHVSK IR+    A+++HF Y+TP
Sbjct  113  DLLIKIVCYLHHDQLKAVFHVSKRIRKAVEQARQYHFNYTTP  154



>ref|XP_003573963.1| PREDICTED: F-box protein At4g35930 isoform X1 [Brachypodium distachyon]
 ref|XP_010234760.1| PREDICTED: F-box protein At4g35930 isoform X1 [Brachypodium distachyon]
Length=264

 Score = 48.5 bits (114),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 20/42 (48%), Positives = 30/42 (71%), Gaps = 0/42 (0%)
 Frame = -1

Query  489  DVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTP  364
            D+LI+I+  + HD L  +FHVSK IR+    A+++HF Y+TP
Sbjct  113  DLLIKIVCYLHHDQLKAVFHVSKRIRKAVEQARQYHFNYTTP  154



>gb|EMT27013.1| hypothetical protein F775_31785 [Aegilops tauschii]
Length=267

 Score = 48.5 bits (114),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 19/42 (45%), Positives = 30/42 (71%), Gaps = 0/42 (0%)
 Frame = -1

Query  489  DVLIRIIFGVDHDDLSRLFHVSKTIREVTMIAKKWHFEYSTP  364
            D+LI+I+  + HD L  +FHVS  IR+   +A+++HF Y+TP
Sbjct  114  DLLIKIVCYLHHDQLKAVFHVSSRIRKAVELARQYHFNYTTP  155



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 647059617100