BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c24282_g1_i1 len=1357 path=[1813:0-176 1989:177-190 484:191-227
2039:228-238 2050:239-624 2435:625-721 264:722-753 2562:754-799
71:800-843 2651:844-921 2729:922-957 2765:958-1078 2886:1079-1114
2922:1115-1143 2951:1144-1356]

Length=1357
                                                                      Score     E

ref|XP_011006371.1|  PREDICTED: purine permease 3                       373   1e-122   
gb|EYU21537.1|  hypothetical protein MIMGU_mgv1a018814mg                373   1e-122   
ref|XP_002285717.1|  PREDICTED: purine permease 1                       370   1e-121   Vitis vinifera
ref|XP_002307351.2|  PURINE PERMEASE 1 family protein                   368   1e-120   Populus trichocarpa [western balsam poplar]
gb|KDP41439.1|  hypothetical protein JCGZ_15846                         367   3e-120   
gb|KHG22236.1|  Purine permease 1 -like protein                         367   4e-120   
gb|EYU34537.1|  hypothetical protein MIMGU_mgv1a022801mg                366   5e-120   
ref|XP_002285718.1|  PREDICTED: purine permease 1                       365   2e-119   Vitis vinifera
ref|XP_008219366.1|  PREDICTED: purine permease 3-like                  365   3e-119   
gb|KHG06856.1|  Purine permease 1 -like protein                         363   2e-118   
ref|XP_007018134.1|  Purine permease 3                                  362   3e-118   
gb|KHG13700.1|  Purine permease 3 -like protein                         362   4e-118   
ref|XP_004152618.1|  PREDICTED: purine permease 3-like                  360   2e-117   
ref|XP_007223326.1|  hypothetical protein PRUPE_ppa007339mg             360   3e-117   
ref|XP_002285719.1|  PREDICTED: purine permease 1-like                  359   4e-117   Vitis vinifera
ref|XP_002513994.1|  purine transporter, putative                       358   1e-116   Ricinus communis
ref|XP_008219368.1|  PREDICTED: purine permease 3-like                  357   4e-116   
ref|XP_008444876.1|  PREDICTED: purine permease 3-like                  356   9e-116   
ref|XP_007227615.1|  hypothetical protein PRUPE_ppa022492mg             356   1e-115   
ref|XP_006364706.1|  PREDICTED: purine permease 3-like                  355   2e-115   
ref|XP_004164781.1|  PREDICTED: purine permease 3-like                  355   2e-115   
ref|XP_004152619.1|  PREDICTED: purine permease 3-like                  355   2e-115   
ref|XP_009615076.1|  PREDICTED: purine permease 3-like                  354   4e-115   
emb|CDP01126.1|  unnamed protein product                                353   5e-115   
ref|XP_004242795.1|  PREDICTED: purine permease 3-like                  354   6e-115   
ref|XP_004299691.1|  PREDICTED: purine permease 3-like                  353   9e-115   
ref|XP_004501676.1|  PREDICTED: purine permease 1-like isoform X1       352   3e-114   
ref|XP_004299692.1|  PREDICTED: purine permease 3-like                  352   5e-114   
ref|XP_010060063.1|  PREDICTED: purine permease 3-like isoform X1       350   2e-113   
ref|XP_010060067.1|  PREDICTED: purine permease 1-like                  349   4e-113   
ref|XP_009765499.1|  PREDICTED: purine permease 1-like                  348   7e-113   
ref|XP_008444875.1|  PREDICTED: purine permease 3-like                  348   1e-112   
ref|XP_008338896.1|  PREDICTED: purine permease 3-like                  348   1e-112   
ref|XP_009373619.1|  PREDICTED: purine permease 3-like                  348   2e-112   
ref|XP_009373503.1|  PREDICTED: purine permease 3-like                  347   3e-112   
emb|CDP08377.1|  unnamed protein product                                346   5e-112   
gb|KCW66598.1|  hypothetical protein EUGRSUZ_F00392                     349   1e-111   
emb|CDP19267.1|  unnamed protein product                                345   2e-111   
ref|XP_009611006.1|  PREDICTED: purine permease 1-like                  345   2e-111   
ref|XP_009603730.1|  PREDICTED: purine permease 3-like                  344   3e-111   
ref|XP_006366415.1|  PREDICTED: purine permease 3-like                  343   5e-111   
ref|XP_004252714.1|  PREDICTED: purine permease 3-like                  343   8e-111   
gb|AES73111.2|  purine permease-like protein                            343   1e-110   
ref|XP_006433898.1|  hypothetical protein CICLE_v10001546mg             342   2e-110   
ref|XP_009605309.1|  PREDICTED: purine permease 1-like                  342   3e-110   
ref|XP_009763953.1|  PREDICTED: purine permease 3-like                  340   6e-110   
ref|XP_003602860.1|  Purine permease                                    343   8e-110   
ref|XP_010098679.1|  Purine permease 3                                  341   1e-109   
ref|XP_009776518.1|  PREDICTED: purine permease 1-like                  339   2e-109   
ref|XP_009795252.1|  PREDICTED: purine permease 1-like                  338   3e-109   
gb|EPS65699.1|  hypothetical protein M569_09078                         336   1e-108   
ref|XP_010064227.1|  PREDICTED: purine permease 3-like                  338   1e-108   
gb|ADP30798.1|  nicotine uptake permease 1                              337   3e-108   
ref|XP_009621473.1|  PREDICTED: purine permease 3-like                  336   3e-108   
ref|XP_009588639.1|  PREDICTED: purine permease 3-like                  336   5e-108   
ref|XP_007042880.1|  Purine permease 3                                  338   5e-108   
ref|XP_009598031.1|  PREDICTED: purine permease 1-like                  335   6e-108   
ref|XP_009769306.1|  PREDICTED: purine permease 1-like                  335   6e-108   
gb|AES73112.2|  purine permease-like protein                            336   8e-108   
ref|XP_009783837.1|  PREDICTED: purine permease 3-like                  334   2e-107   
ref|XP_009762239.1|  PREDICTED: purine permease 1-like                  333   3e-107   
ref|XP_009766753.1|  PREDICTED: purine permease 3-like                  333   4e-107   
ref|XP_010538168.1|  PREDICTED: purine permease 1-like                  332   2e-106   
ref|XP_006472532.1|  PREDICTED: purine permease 1-like                  332   3e-106   
ref|XP_009609429.1|  PREDICTED: purine permease 3-like                  331   3e-106   
ref|XP_006357923.1|  PREDICTED: purine permease 3-like                  329   9e-106   
ref|XP_008446590.1|  PREDICTED: purine permease 3-like                  330   1e-105   
ref|XP_010060066.1|  PREDICTED: purine permease 1-like                  330   2e-105   
gb|EYU21538.1|  hypothetical protein MIMGU_mgv1a020196mg                328   5e-105   
ref|XP_002531513.1|  purine transporter, putative                       329   5e-105   Ricinus communis
ref|XP_010266586.1|  PREDICTED: purine permease 3-like                  328   6e-105   
ref|XP_003522775.1|  PREDICTED: purine permease 1-like                  328   8e-105   
gb|EPS67422.1|  hypothetical protein M569_07351                         325   1e-104   
ref|XP_010322002.1|  PREDICTED: LOW QUALITY PROTEIN: purine perme...    327   1e-104   
ref|XP_009770717.1|  PREDICTED: purine permease 1-like                  327   1e-104   
ref|XP_007018133.1|  Purine permease 3, putative                        328   2e-104   
ref|XP_004490401.1|  PREDICTED: purine permease 1-like                  325   1e-103   
ref|XP_010939717.1|  PREDICTED: purine permease 3-like isoform X2       325   1e-103   
ref|XP_004237961.1|  PREDICTED: purine permease 1-like                  325   2e-103   
ref|XP_007042882.1|  Purine permease 3 isoform 2                        323   4e-103   
ref|XP_010266597.1|  PREDICTED: purine permease 3-like                  322   1e-102   
emb|CDP11456.1|  unnamed protein product                                322   1e-102   
gb|KDP40942.1|  hypothetical protein JCGZ_24941                         322   2e-102   
ref|XP_009599635.1|  PREDICTED: purine permease 1-like                  321   3e-102   
ref|XP_006338103.1|  PREDICTED: purine permease 1-like                  321   3e-102   
ref|XP_010675382.1|  PREDICTED: purine permease 3-like                  322   4e-102   
ref|XP_004237962.1|  PREDICTED: purine permease 3-like                  319   1e-101   
ref|XP_010509839.1|  PREDICTED: purine permease 2-like                  319   1e-101   
ref|XP_011072345.1|  PREDICTED: LOW QUALITY PROTEIN: purine perme...    318   2e-101   
ref|XP_007141230.1|  hypothetical protein PHAVU_008G178300g             318   2e-101   
gb|KDP40961.1|  hypothetical protein JCGZ_24960                         323   2e-101   
ref|XP_008812221.1|  PREDICTED: purine permease 3-like                  318   3e-101   
ref|XP_003615204.1|  Purine permease                                    318   4e-101   
ref|XP_009401279.1|  PREDICTED: purine permease 1-like                  318   5e-101   
ref|XP_007042881.1|  Purine permease 3 isoform 1                        317   6e-101   
ref|XP_010413817.1|  PREDICTED: purine permease 2-like                  317   8e-101   
gb|AAF64547.1|AF078531_1  purine permease                               317   8e-101   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006410518.1|  hypothetical protein EUTSA_v10017788mg             318   9e-101   
ref|NP_174144.1|  purine permease 1                                     317   1e-100   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002893512.1|  ATPUP3                                             317   1e-100   
ref|XP_010460601.1|  PREDICTED: purine permease 1                       316   2e-100   
ref|XP_010509841.1|  PREDICTED: purine permease 2-like                  316   2e-100   
ref|XP_010244044.1|  PREDICTED: purine permease 1-like                  316   3e-100   
ref|XP_004146629.1|  PREDICTED: purine permease 3-like                  315   4e-100   
ref|XP_006295883.1|  hypothetical protein CARUB_v10025013mg             315   4e-100   
gb|KGN64615.1|  hypothetical protein Csa_1G071290                       316   4e-100   
ref|NP_174143.1|  purine permease 3                                     315   6e-100   Arabidopsis thaliana [mouse-ear cress]
gb|KFK44702.1|  hypothetical protein AALP_AA1G292000                    315   9e-100   
ref|XP_008812219.1|  PREDICTED: purine permease 3-like                  314   2e-99    
ref|XP_010939715.1|  PREDICTED: purine permease 3-like                  314   2e-99    
ref|XP_006357924.1|  PREDICTED: purine permease 3-like                  314   2e-99    
ref|XP_010478191.1|  PREDICTED: purine permease 1-like                  313   2e-99    
ref|XP_010469434.1|  PREDICTED: purine permease 2-like                  313   2e-99    
gb|EYU38177.1|  hypothetical protein MIMGU_mgv1a023817mg                313   4e-99    
ref|XP_006415682.1|  hypothetical protein EUTSA_v10008037mg             312   6e-99    
ref|XP_010499327.1|  PREDICTED: purine permease 1-like isoform X1       312   6e-99    
emb|CDY35722.1|  BnaC03g58430D                                          312   8e-99    
ref|XP_006338102.1|  PREDICTED: purine permease 1-like                  312   8e-99    
ref|XP_009148632.1|  PREDICTED: purine permease 2-like                  313   1e-98    
ref|XP_009380886.1|  PREDICTED: purine permease 3-like                  312   1e-98    
emb|CDY27947.1|  BnaCnng05320D                                          311   1e-98    
ref|XP_007136297.1|  hypothetical protein PHAVU_009G034400g             311   2e-98    
ref|XP_010509840.1|  PREDICTED: purine permease 2-like                  312   2e-98    
ref|XP_010413821.1|  PREDICTED: purine permease 2                       310   3e-98    
emb|CDX94595.1|  BnaC07g10630D                                          310   7e-98    
ref|XP_009102926.1|  PREDICTED: purine permease 3                       310   7e-98    
ref|XP_006305220.1|  hypothetical protein CARUB_v10009586mg             309   1e-97    
emb|CDY29741.1|  BnaA01g19250D                                          310   1e-97    
ref|XP_010538169.1|  PREDICTED: purine permease 3-like                  308   2e-97    
ref|XP_009109746.1|  PREDICTED: purine permease 1-like                  308   5e-97    
ref|XP_006357925.1|  PREDICTED: purine permease 3-like                  306   7e-97    
ref|XP_009109745.1|  PREDICTED: purine permease 1                       306   9e-97    
ref|XP_006305203.1|  hypothetical protein CARUB_v10009570mg             307   9e-97    
ref|XP_002893513.1|  hypothetical protein ARALYDRAFT_890360             306   1e-96    
emb|CDY12422.1|  BnaC08g09110D                                          307   1e-96    
ref|XP_002881298.1|  ATPUP2                                             306   2e-96    
gb|KFK44691.1|  hypothetical protein AALP_AA1G290900                    305   4e-96    
ref|XP_009143832.1|  PREDICTED: purine permease 2 isoform X1            303   2e-95    
ref|XP_004957086.1|  PREDICTED: purine permease 3-like                  301   9e-95    
ref|NP_973592.1|  purine permease 2                                     300   2e-94    Arabidopsis thaliana [mouse-ear cress]
emb|CDY16284.1|  BnaC01g23190D                                          301   3e-94    
dbj|BAJ86755.1|  predicted protein                                      300   6e-94    
ref|XP_003519187.1|  PREDICTED: purine permease 1-like                  299   6e-94    
ref|XP_008806390.1|  PREDICTED: purine permease 3-like                  300   8e-94    
ref|XP_010549316.1|  PREDICTED: purine permease 3                       298   2e-93    
ref|XP_009143833.1|  PREDICTED: purine permease 2 isoform X2            296   1e-92    
ref|XP_010460596.1|  PREDICTED: purine permease 3                       296   2e-92    
ref|XP_002462515.1|  hypothetical protein SORBIDRAFT_02g027100          296   2e-92    Sorghum bicolor [broomcorn]
emb|CDY17197.1|  BnaA05g09910D                                          295   2e-92    
ref|XP_010942638.1|  PREDICTED: purine permease 3-like isoform X2       296   2e-92    
emb|CDP16579.1|  unnamed protein product                                292   3e-92    
ref|XP_006841259.1|  hypothetical protein AMTR_s00135p00097090          294   1e-91    
ref|XP_010549318.1|  PREDICTED: purine permease 3-like                  293   2e-91    
ref|XP_010499329.1|  PREDICTED: purine permease 3-like                  293   2e-91    
ref|XP_010942637.1|  PREDICTED: purine permease 3-like isoform X1       296   2e-91    
gb|AAC69140.1|  hypothetical protein                                    292   6e-91    Arabidopsis thaliana [mouse-ear cress]
ref|NP_180931.2|  purine permease 2                                     291   7e-91    Arabidopsis thaliana [mouse-ear cress]
gb|EPS72255.1|  hypothetical protein M569_02503                         287   8e-91    
ref|NP_001131978.1|  uncharacterized protein LOC100193377               291   9e-91    Zea mays [maize]
ref|XP_006358992.1|  PREDICTED: purine permease 1-like                  290   4e-90    
gb|EAZ09425.1|  hypothetical protein OsI_31698                          290   5e-90    Oryza sativa Indica Group [Indian rice]
ref|NP_001063424.1|  Os09g0467300                                       290   5e-90    Oryza sativa Japonica Group [Japonica rice]
dbj|BAJ94351.1|  predicted protein                                      290   7e-90    
ref|XP_003579811.2|  PREDICTED: purine permease 3-like                  289   8e-90    
ref|NP_001063425.1|  Os09g0467400                                       288   3e-89    Oryza sativa Japonica Group [Japonica rice]
ref|XP_008667169.1|  PREDICTED: uncharacterized protein LOC100193...    287   4e-89    
ref|XP_006661330.1|  PREDICTED: purine permease 3-like                  287   9e-89    
ref|XP_008652812.1|  PREDICTED: purine permease 3-like                  286   9e-89    
ref|XP_010478189.1|  PREDICTED: purine permease 3-like                  285   2e-88    
ref|XP_009113691.1|  PREDICTED: purine permease 1-like                  284   5e-88    
dbj|BAJ88843.1|  predicted protein                                      285   1e-87    
dbj|BAJ87663.1|  predicted protein                                      284   2e-87    
gb|EPS58788.1|  hypothetical protein M569_16026                         281   2e-87    
emb|CDX90135.1|  BnaA08g18490D                                          281   4e-87    
ref|XP_003578263.2|  PREDICTED: purine permease 3-like                  283   7e-87    
dbj|BAK04933.1|  predicted protein                                      281   1e-86    
dbj|BAD19737.1|  putative purine permease                               281   2e-86    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006841261.1|  hypothetical protein AMTR_s00135p00099660          281   2e-86    
gb|EEC84724.1|  hypothetical protein OsI_31699                          280   2e-86    Oryza sativa Indica Group [Indian rice]
ref|XP_010926344.1|  PREDICTED: purine permease 3-like isoform X1       280   5e-86    
ref|XP_010263028.1|  PREDICTED: purine permease 1-like                  277   3e-85    
ref|XP_010234593.1|  PREDICTED: purine permease 3-like isoform X1       278   4e-85    
ref|XP_004959530.1|  PREDICTED: purine permease 1-like                  278   4e-85    
gb|EMT19524.1|  Purine permease 3                                       275   8e-85    
gb|KFK31021.1|  hypothetical protein AALP_AA6G057800                    275   9e-85    
ref|XP_008667894.1|  PREDICTED: PUP1 isoform X1                         276   1e-84    
ref|NP_001147096.1|  PUP1                                               276   1e-84    Zea mays [maize]
gb|KCW51603.1|  hypothetical protein EUGRSUZ_J01095                     273   1e-84    
tpg|DAA61854.1|  TPA: hypothetical protein ZEAMMB73_233624              272   8e-83    
emb|CDY35721.1|  BnaC03g58420D                                          267   7e-82    
ref|XP_004158055.1|  PREDICTED: LOW QUALITY PROTEIN: purine perme...    266   1e-81    
ref|XP_004959525.1|  PREDICTED: purine permease 3-like                  269   2e-81    
emb|CDY15687.1|  BnaA07g08580D                                          265   2e-81    
ref|XP_010263027.1|  PREDICTED: purine permease 3-like                  266   8e-81    
gb|EPS74474.1|  hypothetical protein M569_00285                         264   8e-81    
ref|XP_010234594.1|  PREDICTED: purine permease 3-like isoform X2       261   1e-78    
ref|XP_006841262.1|  hypothetical protein AMTR_s00135p00100890          259   2e-78    
gb|ABR16841.1|  unknown                                                 259   5e-78    Picea sitchensis
ref|XP_006661332.1|  PREDICTED: purine permease 3-like                  255   7e-78    
ref|XP_009631999.1|  PREDICTED: purine permease 1-like                  258   9e-78    
ref|XP_010247465.1|  PREDICTED: purine permease 3-like                  258   1e-77    
ref|XP_002301070.2|  hypothetical protein POPTR_0002s09980g             256   2e-77    Populus trichocarpa [western balsam poplar]
emb|CDP01096.1|  unnamed protein product                                255   1e-76    
ref|XP_002513954.1|  purine transporter, putative                       255   1e-76    Ricinus communis
ref|XP_009762898.1|  PREDICTED: purine permease 3-like                  253   4e-76    
ref|XP_002462514.1|  hypothetical protein SORBIDRAFT_02g027090          250   1e-74    Sorghum bicolor [broomcorn]
ref|XP_006360267.1|  PREDICTED: purine permease 1-like                  248   5e-74    
gb|EEE69873.1|  hypothetical protein OsJ_29687                          246   2e-73    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010248452.1|  PREDICTED: purine permease 3-like                  243   2e-72    
ref|XP_008795222.1|  PREDICTED: purine permease 3-like                  243   5e-72    
ref|XP_011016754.1|  PREDICTED: purine permease 1-like                  242   7e-72    
ref|XP_010098677.1|  Purine permease 3                                  239   9e-72    
gb|KHN08969.1|  Purine permease 1                                       236   2e-71    
ref|XP_009801738.1|  PREDICTED: purine permease 1-like isoform X1       240   2e-71    
gb|KCW66597.1|  hypothetical protein EUGRSUZ_F00391                     236   1e-70    
ref|XP_006360266.1|  PREDICTED: purine permease 1-like                  238   3e-70    
ref|XP_004252530.1|  PREDICTED: purine permease 1-like                  237   1e-69    
ref|XP_009789614.1|  PREDICTED: purine permease 1-like                  222   3e-65    
ref|XP_006661331.1|  PREDICTED: purine permease 3-like                  220   2e-64    
gb|EMS63809.1|  Purine permease 3                                       219   7e-64    
emb|CDY46618.1|  BnaA09g27450D                                          217   9e-64    
ref|XP_009801739.1|  PREDICTED: purine permease 1-like isoform X2       216   6e-63    
ref|XP_009801740.1|  PREDICTED: purine permease 1-like isoform X3       214   1e-62    
ref|XP_010418647.1|  PREDICTED: purine permease 2-like                  213   7e-62    
ref|XP_003602861.1|  Purine permease                                    212   3e-61    
ref|XP_006415683.1|  hypothetical protein EUTSA_v10009673mg             211   4e-60    
emb|CBI19192.3|  unnamed protein product                                210   5e-60    
ref|XP_010939716.1|  PREDICTED: purine permease 1-like isoform X1       212   1e-59    
ref|XP_004985414.1|  PREDICTED: purine permease 3-like                  210   2e-59    
ref|XP_002977419.1|  hypothetical protein SELMODRAFT_417455             207   5e-58    
ref|XP_002977418.1|  hypothetical protein SELMODRAFT_417454             206   2e-57    
ref|XP_002465736.1|  hypothetical protein SORBIDRAFT_01g044690          204   5e-57    Sorghum bicolor [broomcorn]
gb|EPS58881.1|  hypothetical protein M569_15932                         201   9e-57    
ref|XP_008651823.1|  PREDICTED: purine permease 3                       202   4e-56    
gb|ABR16480.1|  unknown                                                 201   6e-56    Picea sitchensis
ref|NP_001136854.1|  hypothetical protein                               201   1e-55    Zea mays [maize]
dbj|BAG88745.1|  unnamed protein product                                197   1e-55    Oryza sativa Japonica Group [Japonica rice]
gb|EYU34538.1|  hypothetical protein MIMGU_mgv1a019697mg                192   4e-55    
dbj|BAJ96346.1|  predicted protein                                      197   3e-54    
ref|XP_002975003.1|  hypothetical protein SELMODRAFT_232471             194   4e-54    
ref|XP_008779125.1|  PREDICTED: purine permease 1-like                  192   5e-54    
emb|CDY72169.1|  BnaCnng76300D                                          192   6e-54    
dbj|BAJ95836.1|  predicted protein                                      192   2e-52    
ref|NP_001049213.1|  Os03g0187800                                       192   2e-52    Oryza sativa Japonica Group [Japonica rice]
gb|EAY88839.1|  hypothetical protein OsI_10311                          192   2e-52    Oryza sativa Indica Group [Indian rice]
ref|XP_006373040.1|  hypothetical protein POPTR_0017s07610g             188   2e-52    
gb|EEE69876.1|  hypothetical protein OsJ_29691                          188   2e-52    Oryza sativa Japonica Group [Japonica rice]
gb|KHN08292.1|  Purine permease 1                                       185   2e-52    
ref|XP_004979831.1|  PREDICTED: purine permease 3-like                  189   9e-52    
tpg|DAA40289.1|  TPA: hypothetical protein ZEAMMB73_258363              186   2e-51    
gb|EEC84725.1|  hypothetical protein OsI_31703                          186   2e-51    Oryza sativa Indica Group [Indian rice]
gb|EAZ09428.1|  hypothetical protein OsI_31702                          184   1e-50    Oryza sativa Indica Group [Indian rice]
gb|EMS56378.1|  hypothetical protein TRIUR3_06439                       187   2e-50    
ref|NP_001063426.2|  Os09g0467500                                       182   3e-50    Oryza sativa Japonica Group [Japonica rice]
ref|XP_004985416.1|  PREDICTED: purine permease 3-like                  183   4e-49    
gb|EMT19334.1|  Purine permease 3                                       178   3e-48    
ref|XP_010098678.1|  Purine permease 1                                  181   5e-48    
ref|XP_004959524.1|  PREDICTED: purine permease 2-like                  176   9e-48    
gb|KEH37326.1|  triose-phosphate transporter family protein             180   1e-47    
ref|XP_002993859.1|  hypothetical protein SELMODRAFT_236829             177   1e-47    
ref|XP_009380885.1|  PREDICTED: purine permease 1-like                  174   3e-47    
gb|AFK45074.1|  unknown                                                 177   4e-47    
ref|XP_004959529.1|  PREDICTED: purine permease 2-like                  174   5e-47    
gb|AFK38153.1|  unknown                                                 176   8e-47    
ref|XP_010941200.1|  PREDICTED: probable purine permease 11             176   1e-46    
ref|XP_004985415.1|  PREDICTED: purine permease 3-like                  176   2e-46    
ref|XP_003551696.2|  PREDICTED: probable purine permease 11-like ...    174   4e-46    
ref|XP_006602851.1|  PREDICTED: probable purine permease 11-like ...    174   5e-46    
ref|XP_002991403.1|  hypothetical protein SELMODRAFT_236291             173   6e-46    
ref|XP_004959528.1|  PREDICTED: purine permease 2-like                  171   6e-46    
tpg|DAA43787.1|  TPA: hypothetical protein ZEAMMB73_057798              171   1e-45    
ref|XP_004248513.1|  PREDICTED: probable purine permease 4              174   2e-45    
ref|XP_002973993.1|  hypothetical protein SELMODRAFT_232165             171   3e-45    
ref|XP_004245857.1|  PREDICTED: probable purine permease 11             171   7e-45    
ref|XP_008652813.1|  PREDICTED: purine permease 2-like                  168   7e-45    
ref|XP_004492883.1|  PREDICTED: probable purine permease 11-like ...    171   1e-44    
ref|XP_002983502.1|  hypothetical protein SELMODRAFT_118529             169   1e-44    
ref|XP_004492882.1|  PREDICTED: probable purine permease 11-like ...    171   1e-44    
ref|XP_006354634.1|  PREDICTED: probable purine permease 11-like        170   2e-44    
ref|XP_011007507.1|  PREDICTED: probable purine permease 10             170   3e-44    
ref|XP_006859063.1|  hypothetical protein AMTR_s00068p00197770          169   3e-44    
ref|XP_002462517.1|  hypothetical protein SORBIDRAFT_02g027120          167   3e-44    
ref|XP_003561966.2|  PREDICTED: purine permease 3-like                  169   5e-44    
ref|XP_010926345.1|  PREDICTED: purine permease 1-like isoform X2       166   6e-44    
ref|XP_003558629.1|  PREDICTED: purine permease 3-like                  169   6e-44    
ref|XP_009759913.1|  PREDICTED: probable purine permease 4              169   6e-44    
ref|NP_001241384.1|  uncharacterized protein LOC100819409               168   8e-44    
ref|XP_008450620.1|  PREDICTED: probable purine permease 11 isofo...    168   8e-44    
ref|XP_009400212.1|  PREDICTED: probable purine permease 11             168   8e-44    
ref|XP_010055380.1|  PREDICTED: probable purine permease 11             168   9e-44    
ref|XP_006358606.1|  PREDICTED: probable purine permease 11-like        168   1e-43    
ref|XP_007218138.1|  hypothetical protein PRUPE_ppa007245mg             167   1e-43    
ref|XP_007138880.1|  hypothetical protein PHAVU_009G245400g             169   1e-43    
gb|KGN66057.1|  hypothetical protein Csa_1G569340                       167   2e-43    
ref|XP_007218139.1|  hypothetical protein PRUPE_ppa007245mg             167   2e-43    
ref|XP_004953494.1|  PREDICTED: probable purine permease 11-like        167   2e-43    
gb|KDP45955.1|  hypothetical protein JCGZ_11858                         167   3e-43    
ref|XP_002454455.1|  hypothetical protein SORBIDRAFT_04g031400          167   3e-43    
ref|XP_006647707.1|  PREDICTED: probable purine permease 11-like        167   4e-43    
ref|XP_010677220.1|  PREDICTED: probable purine permease 11             167   4e-43    
ref|XP_008229522.1|  PREDICTED: probable purine permease 11             166   5e-43    
ref|XP_010056479.1|  PREDICTED: probable purine permease 11 isofo...    165   8e-43    
ref|XP_003550935.1|  PREDICTED: probable purine permease 11-like        166   8e-43    
ref|XP_002320858.2|  purine permease family protein                     166   8e-43    
gb|KDP28910.1|  hypothetical protein JCGZ_14681                         166   9e-43    
ref|XP_008677756.1|  PREDICTED: uncharacterized protein LOC100502...    166   1e-42    
ref|XP_004229705.1|  PREDICTED: probable purine permease 11             165   1e-42    
gb|KHN21034.1|  Putative purine permease 9                              165   1e-42    
ref|XP_010110511.1|  hypothetical protein L484_023343                   165   2e-42    
ref|XP_008232299.1|  PREDICTED: probable purine permease 11 isofo...    164   2e-42    
ref|XP_010056477.1|  PREDICTED: probable purine permease 11 isofo...    165   2e-42    
ref|XP_010056475.1|  PREDICTED: probable purine permease 11 isofo...    165   2e-42    
ref|XP_007039598.1|  Drug/metabolite transporter superfamily protein    163   3e-42    
ref|XP_008232298.1|  PREDICTED: probable purine permease 11 isofo...    164   3e-42    
ref|XP_002298513.2|  hypothetical protein POPTR_0001s34550g             164   4e-42    
ref|XP_008225352.1|  PREDICTED: probable purine permease 10             164   6e-42    
ref|XP_006662363.1|  PREDICTED: probable purine permease 11-like        163   7e-42    
ref|XP_002447006.1|  hypothetical protein SORBIDRAFT_06g026780          163   8e-42    
ref|XP_010247691.1|  PREDICTED: probable purine permease 11 isofo...    163   1e-41    
emb|CDP05635.1|  unnamed protein product                                157   1e-41    
ref|XP_004248514.2|  PREDICTED: probable purine permease 4              162   1e-41    
ref|XP_008677755.1|  PREDICTED: uncharacterized protein LOC100502...    165   1e-41    
ref|XP_007139692.1|  hypothetical protein PHAVU_008G051100g             163   1e-41    
ref|XP_010460900.1|  PREDICTED: probable purine permease 4              162   1e-41    
gb|KHN26582.1|  Putative purine permease 4                              162   1e-41    
ref|XP_009622283.1|  PREDICTED: probable purine permease 4 isofor...    162   1e-41    
dbj|BAG93087.1|  unnamed protein product                                161   2e-41    
emb|CDP13405.1|  unnamed protein product                                162   2e-41    
ref|XP_010478523.1|  PREDICTED: probable purine permease 4 isofor...    162   3e-41    
ref|XP_002870060.1|  purine permease family protein                     160   3e-41    
ref|XP_002462516.1|  hypothetical protein SORBIDRAFT_02g027110          159   3e-41    
ref|XP_007211409.1|  hypothetical protein PRUPE_ppa006967mg             161   4e-41    
ref|XP_003534853.1|  PREDICTED: probable purine permease 4-like         162   4e-41    
ref|XP_008784692.1|  PREDICTED: probable purine permease 11             161   4e-41    
ref|XP_006826553.1|  hypothetical protein AMTR_s02825p00003100          157   5e-41    
ref|XP_004976629.1|  PREDICTED: probable purine permease 11-like ...    161   5e-41    
ref|XP_004976628.1|  PREDICTED: probable purine permease 11-like ...    161   5e-41    
ref|XP_009799236.1|  PREDICTED: probable purine permease 4              161   5e-41    
ref|XP_007155747.1|  hypothetical protein PHAVU_003G228300g             161   6e-41    
dbj|BAD07671.1|  putative purine permease                               160   7e-41    
ref|NP_001047783.1|  Os02g0689200                                       160   8e-41    
ref|XP_010260818.1|  PREDICTED: probable purine permease 4              160   1e-40    
ref|XP_011018650.1|  PREDICTED: probable purine permease 11 isofo...    160   1e-40    
gb|KDP20127.1|  hypothetical protein JCGZ_05896                         160   1e-40    
ref|XP_011018648.1|  PREDICTED: probable purine permease 11 isofo...    160   1e-40    
gb|EMT19164.1|  hypothetical protein F775_05921                         160   1e-40    
ref|XP_010674210.1|  PREDICTED: probable purine permease 11 isofo...    159   1e-40    
gb|EAZ24234.1|  hypothetical protein OsJ_07985                          160   2e-40    
ref|XP_010674209.1|  PREDICTED: probable purine permease 11 isofo...    159   2e-40    
ref|XP_010924628.1|  PREDICTED: probable purine permease 4              158   3e-40    
gb|EEC73811.1|  hypothetical protein OsI_08525                          159   3e-40    
dbj|BAJ95311.1|  predicted protein                                      159   3e-40    
ref|XP_010499636.1|  PREDICTED: probable purine permease 4 isofor...    159   4e-40    
gb|KDO38040.1|  hypothetical protein CISIN_1g0167861mg                  158   4e-40    
gb|KHN40504.1|  Putative purine permease 11                             156   4e-40    
gb|KCW75957.1|  hypothetical protein EUGRSUZ_D00325                     159   5e-40    
ref|XP_010052098.1|  PREDICTED: probable purine permease 9              159   5e-40    
ref|XP_008450621.1|  PREDICTED: probable purine permease 11 isofo...    156   6e-40    
ref|XP_004135778.1|  PREDICTED: probable purine permease 10-like        156   6e-40    
ref|XP_009787219.1|  PREDICTED: purine permease 1-like                  152   9e-40    
ref|XP_009622284.1|  PREDICTED: probable purine permease 4 isofor...    157   1e-39    
ref|XP_002526505.1|  ATPUP11, putative                                  157   1e-39    
gb|AGV54805.1|  purine permease 4-like protein                          157   1e-39    
ref|XP_004246178.1|  PREDICTED: probable purine permease 11             157   1e-39    
ref|XP_010244043.1|  PREDICTED: purine permease 1-like                  150   2e-39    
ref|XP_003570128.1|  PREDICTED: probable purine permease 11 isofo...    157   2e-39    
ref|XP_007138881.1|  hypothetical protein PHAVU_009G245500g             157   2e-39    
ref|XP_010235835.1|  PREDICTED: probable purine permease 11 isofo...    157   2e-39    
ref|XP_010680002.1|  PREDICTED: probable purine permease 11             157   2e-39    
ref|XP_007214484.1|  hypothetical protein PRUPE_ppa020615mg             155   2e-39    
ref|XP_008371579.1|  PREDICTED: probable purine permease 10             157   2e-39    
ref|XP_006368464.1|  hypothetical protein POPTR_0001s03050g             157   2e-39    
ref|XP_008225353.1|  PREDICTED: probable purine permease 9              156   2e-39    
ref|XP_009766627.1|  PREDICTED: probable purine permease 11 isofo...    156   2e-39    
ref|XP_009766626.1|  PREDICTED: probable purine permease 11 isofo...    156   2e-39    
ref|XP_010663907.1|  PREDICTED: probable purine permease 11             156   3e-39    
emb|CDP06315.1|  unnamed protein product                                156   3e-39    
ref|XP_010918723.1|  PREDICTED: probable purine permease 4              155   3e-39    
ref|XP_010092275.1|  hypothetical protein L484_021136                   156   3e-39    
gb|KDO85409.1|  hypothetical protein CISIN_1g0170172mg                  155   3e-39    
ref|XP_006305130.1|  hypothetical protein CARUB_v10009499mg             155   3e-39    
gb|KFK41670.1|  hypothetical protein AALP_AA2G157700                    156   4e-39    
gb|KCW71838.1|  hypothetical protein EUGRSUZ_E00319                     154   4e-39    
ref|XP_006464375.1|  PREDICTED: probable purine permease 11-like ...    155   4e-39    
gb|KDP37934.1|  hypothetical protein JCGZ_04577                         156   4e-39    
ref|XP_006445484.1|  hypothetical protein CICLE_v10020615mg             155   5e-39    
ref|XP_006464373.1|  PREDICTED: probable purine permease 11-like ...    155   5e-39    
ref|XP_008671258.1|  PREDICTED: probable purine permease 11             155   6e-39    
ref|XP_008460053.1|  PREDICTED: probable purine permease 11             155   6e-39    
ref|XP_004961267.1|  PREDICTED: probable purine permease 4-like         155   7e-39    
tpg|DAA37453.1|  TPA: hypothetical protein ZEAMMB73_016243              155   7e-39    
ref|XP_009604158.1|  PREDICTED: probable purine permease 11 isofo...    154   9e-39    
ref|XP_008799578.1|  PREDICTED: LOW QUALITY PROTEIN: probable pur...    154   9e-39    
ref|XP_006445485.1|  hypothetical protein CICLE_v10020615mg             153   9e-39    
ref|XP_003593723.1|  hypothetical protein MTR_2g015470                  155   9e-39    
emb|CDP09375.1|  unnamed protein product                                154   9e-39    
ref|XP_009604157.1|  PREDICTED: probable purine permease 11 isofo...    154   9e-39    
ref|XP_006352648.1|  PREDICTED: probable purine permease 4-like         155   9e-39    
gb|ADN34099.1|  purine transmembrane transporter                        154   1e-38    
ref|XP_006654764.1|  PREDICTED: probable purine permease 4-like         154   1e-38    
ref|XP_006445483.1|  hypothetical protein CICLE_v10020615mg             154   1e-38    
ref|XP_010247689.1|  PREDICTED: probable purine permease 11             154   1e-38    
ref|XP_004508992.1|  PREDICTED: probable purine permease 10-like        156   1e-38    
gb|EYU35321.1|  hypothetical protein MIMGU_mgv1a008781mg                154   1e-38    
gb|KGN46286.1|  hypothetical protein Csa_6G079800                       154   1e-38    
ref|XP_010439889.1|  PREDICTED: probable purine permease 9              154   1e-38    
ref|XP_004145022.1|  PREDICTED: probable purine permease 11-like        154   1e-38    
ref|XP_010274633.1|  PREDICTED: probable purine permease 11             152   2e-38    
ref|XP_004160684.1|  PREDICTED: probable purine permease 11-like        154   2e-38    
gb|EMS67133.1|  hypothetical protein TRIUR3_29861                       147   2e-38    
ref|XP_008225422.1|  PREDICTED: probable purine permease 9              154   2e-38    
ref|XP_006436828.1|  hypothetical protein CICLE_v10031810mg             154   2e-38    
gb|KDO85410.1|  hypothetical protein CISIN_1g0170172mg                  152   3e-38    
ref|XP_006414134.1|  hypothetical protein EUTSA_v10025416mg             153   3e-38    
gb|EYU19429.1|  hypothetical protein MIMGU_mgv1a018240mg                152   3e-38    
ref|XP_010655638.1|  PREDICTED: probable purine permease 10 isofo...    152   3e-38    
ref|XP_007209387.1|  hypothetical protein PRUPE_ppa009106mg             151   4e-38    
ref|XP_006282809.1|  hypothetical protein CARUB_v10006525mg             153   4e-38    
ref|XP_009775721.1|  PREDICTED: probable purine permease 11             153   4e-38    
ref|XP_002272204.1|  PREDICTED: probable purine permease 10 isofo...    152   5e-38    
ref|XP_009407088.1|  PREDICTED: probable purine permease 4              153   6e-38    
gb|EPS62038.1|  hypothetical protein M569_12755                         151   7e-38    
gb|KDO59449.1|  hypothetical protein CISIN_1g017963mg                   152   8e-38    
ref|XP_010676487.1|  PREDICTED: probable purine permease 4              152   8e-38    
ref|XP_006307602.1|  hypothetical protein CARUB_v10009226mg             153   8e-38    
gb|KHN31656.1|  Putative purine permease 9                              152   9e-38    
ref|XP_010519027.1|  PREDICTED: probable purine permease 4              152   9e-38    
ref|XP_006453625.1|  hypothetical protein CICLE_v10008754mg             151   1e-37    
ref|XP_006602140.1|  PREDICTED: probable purine permease 9-like i...    151   1e-37    
ref|XP_011089061.1|  PREDICTED: probable purine permease 4              152   1e-37    
ref|XP_007025157.1|  Purine permease 10, putative                       151   2e-37    
ref|XP_004232602.1|  PREDICTED: probable purine permease 4              152   2e-37    
ref|XP_007034137.1|  Purine permease 4                                  151   2e-37    
ref|XP_008444266.1|  PREDICTED: probable purine permease 10             151   2e-37    
ref|XP_004293485.1|  PREDICTED: probable purine permease 9-like i...    151   2e-37    
ref|XP_009421222.1|  PREDICTED: probable purine permease 11             151   2e-37    
ref|XP_010919838.1|  PREDICTED: probable purine permease 11             151   2e-37    
ref|XP_004293484.1|  PREDICTED: probable purine permease 9-like i...    151   2e-37    
ref|XP_006473996.1|  PREDICTED: probable purine permease 5-like         150   2e-37    
ref|NP_193556.1|  putative purine permease 9                            150   2e-37    
gb|ACU17999.1|  unknown                                                 151   2e-37    
ref|XP_009591151.1|  PREDICTED: probable purine permease 11             150   2e-37    
ref|XP_010434561.1|  PREDICTED: probable purine permease 9              150   3e-37    
ref|XP_010517569.1|  PREDICTED: probable purine permease 9              150   3e-37    
ref|XP_006358633.1|  PREDICTED: probable purine permease 11-like        150   3e-37    
ref|XP_010557496.1|  PREDICTED: probable purine permease 11             150   3e-37    
ref|XP_006602139.1|  PREDICTED: probable purine permease 9-like i...    151   3e-37    
gb|EMS61796.1|  hypothetical protein TRIUR3_08587                       144   3e-37    
ref|XP_010941192.1|  PREDICTED: probable purine permease 11             150   3e-37    
ref|XP_008383566.1|  PREDICTED: probable purine permease 9              150   3e-37    
ref|XP_003532171.1|  PREDICTED: probable purine permease 9-like         151   4e-37    
ref|XP_003551463.1|  PREDICTED: probable purine permease 9-like i...    151   4e-37    
ref|XP_004307271.1|  PREDICTED: probable purine permease 11-like        151   4e-37    
ref|XP_008811388.1|  PREDICTED: probable purine permease 11             150   5e-37    
gb|KEH34049.1|  purine permease                                         149   5e-37    
ref|XP_007212398.1|  hypothetical protein PRUPE_ppa016371mg             149   5e-37    
emb|CAN64869.1|  hypothetical protein VITISV_041328                     149   6e-37    
emb|CAE04316.1|  OSJNBb0016D16.7                                        149   7e-37    
ref|XP_010677223.1|  PREDICTED: probable purine permease 11             149   7e-37    
ref|XP_003547402.1|  PREDICTED: probable purine permease 4-like         149   7e-37    
ref|XP_006579668.1|  PREDICTED: probable purine permease 11-like        148   7e-37    
ref|XP_008226761.1|  PREDICTED: probable purine permease 10             149   7e-37    
ref|XP_008364183.1|  PREDICTED: probable purine permease 9              149   7e-37    
ref|XP_009353822.1|  PREDICTED: probable purine permease 10             149   8e-37    
ref|XP_009614957.1|  PREDICTED: probable purine permease 4              148   9e-37    
ref|XP_011031685.1|  PREDICTED: probable purine permease 11             149   9e-37    
gb|KHN47749.1|  Putative purine permease 4                              148   9e-37    
gb|AFK34280.1|  unknown                                                 149   1e-36    
ref|XP_002870061.1|  ATPUP10                                            149   1e-36    
ref|XP_004488230.1|  PREDICTED: probable purine permease 4-like         148   1e-36    
ref|XP_008383506.1|  PREDICTED: probable purine permease 9              149   1e-36    
ref|XP_002274345.2|  PREDICTED: probable purine permease 10             149   1e-36    
ref|XP_010091784.1|  hypothetical protein L484_003844                   149   2e-36    
ref|XP_009782581.1|  PREDICTED: probable purine permease 10 isofo...    148   2e-36    
ref|XP_009782582.1|  PREDICTED: probable purine permease 10 isofo...    148   2e-36    
gb|EPS58880.1|  hypothetical protein M569_15931                         141   2e-36    
ref|XP_006364822.1|  PREDICTED: probable purine permease 4-like         149   2e-36    
sp|O49726.2|PUP9_ARATH  RecName: Full=Probable purine permease 9;...    148   2e-36    
dbj|BAG87378.1|  unnamed protein product                                146   4e-36    
ref|XP_002263453.2|  PREDICTED: probable purine permease 4              147   4e-36    
ref|XP_010941193.1|  PREDICTED: probable purine permease 11             147   4e-36    
ref|XP_010434560.1|  PREDICTED: probable purine permease 10             147   4e-36    
gb|KHN42588.1|  Putative purine permease 5                              146   4e-36    
ref|NP_001183852.1|  uncharacterized protein LOC100502445               144   4e-36    
ref|XP_004295378.1|  PREDICTED: probable purine permease 9-like         147   5e-36    
ref|XP_008450056.1|  PREDICTED: probable purine permease 10 isofo...    147   5e-36    
ref|XP_003581578.2|  PREDICTED: probable purine permease 11 isofo...    148   5e-36    
ref|XP_004295379.1|  PREDICTED: probable purine permease 9-like         147   5e-36    
ref|XP_009608565.1|  PREDICTED: probable purine permease 9 isofor...    147   5e-36    
ref|XP_009608566.1|  PREDICTED: probable purine permease 10 isofo...    147   5e-36    
gb|KFK28500.1|  hypothetical protein AALP_AA7G004000                    147   5e-36    
emb|CBI30830.3|  unnamed protein product                                149   5e-36    
ref|XP_010240326.1|  PREDICTED: probable purine permease 11 isofo...    148   5e-36    
ref|XP_002441494.1|  hypothetical protein SORBIDRAFT_09g028020          147   5e-36    
ref|XP_010517571.1|  PREDICTED: probable purine permease 10             147   6e-36    
gb|EYU40318.1|  hypothetical protein MIMGU_mgv1a008679mg                146   6e-36    
ref|XP_006592598.1|  PREDICTED: probable purine permease 5-like i...    146   6e-36    
ref|XP_010100973.1|  hypothetical protein L484_010628                   147   6e-36    
dbj|BAK04769.1|  predicted protein                                      147   6e-36    
ref|XP_011083977.1|  PREDICTED: probable purine permease 5              146   6e-36    



>ref|XP_011006371.1| PREDICTED: purine permease 3 [Populus euphratica]
Length=356

 Score =   373 bits (958),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 203/351 (58%), Positives = 260/351 (74%), Gaps = 6/351 (2%)
 Frame = -1

Query  1273  EVSEGKGNMRRRLFLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFI  1094
             E ++ K  M++ L L+ N +++ IG CGG L++RLYFI GG R+W S  L T GWPI  I
Sbjct  5     EETQVKTTMKKAL-LIFNCLVLSIGNCGGPLIMRLYFIHGGKRVWLSAWLETGGWPIILI  63

Query  1093  PLaaayytrrrhttttaasiftiTRNTFlaaaalgvllGIINYLYTYGVSKLPVSTSALI  914
             P+A +Y+ RR    TT           F+AAA +GVL G+ +YLY YGV++LPVSTSALI
Sbjct  64    PIALSYFHRRATDPTTRLFYMK--PPLFIAAATIGVLTGLDDYLYAYGVARLPVSTSALI  121

Query  913   AASQLAFTAGGAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAFL  734
              A+QLAFTAG AFLLVKQ+FT++S+NAVVLLT GAGVLA+ +  D+PA ES +EY+  F+
Sbjct  122   IATQLAFTAGFAFLLVKQKFTSYSINAVVLLTVGAGVLAMHTGSDKPAHESSREYILGFI  181

Query  733   MTLASAALYGALLPCIELTYIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQAI  554
             MTL +AALYG +LP +ELTY K RQ + YTLV+E QMVM L AT FCTVGML+NKDFQAI
Sbjct  182   MTLVAAALYGLILPLVELTYKKSRQEMNYTLVMEIQMVMCLLATVFCTVGMLINKDFQAI  241

Query  553   SREARGFEIGEANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLTEVFAV  374
              REAR FE+GE  YYVV+V +A+IWQ  F+GA G I   SSLLSGI+++A +  TE+ +V
Sbjct  242   PREARNFELGEVKYYVVLVWSAIIWQCFFLGAIGVIFSASSLLSGILISALLPATEILSV  301

Query  373   VFYGEKFGSEKGISLTLSLWGIVSYFYGEMKNGDNNKKEELQIQVTNMEPN  221
             +F+ EKF +EKG++L LSLWG VSYFYGEMK    NKK++L    T+M P+
Sbjct  302   IFFQEKFQAEKGVALGLSLWGFVSYFYGEMK---ENKKKKLAAPETSMAPS  349



>gb|EYU21537.1| hypothetical protein MIMGU_mgv1a018814mg [Erythranthe guttata]
Length=354

 Score =   373 bits (958),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 195/347 (56%), Positives = 259/347 (75%), Gaps = 10/347 (3%)
 Frame = -1

Query  1243  RRLFLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIPLaaayytrr  1064
             +R+FL++N I++ +G CGG L++RLYF+ GG R+WFS+ L T GWPI   PL  +Y  RR
Sbjct  2     KRVFLIINCIILAVGNCGGPLIMRLYFVHGGKRIWFSSWLETGGWPIILAPLIVSYTRRR  61

Query  1063  rhttttaasiftiTRNTFlaaaalgvllGIINYLYTYGVSKLPVSTSALIAASQLAFTAG  884
             R      A ++ +    F+AAA +GVL G  +YLY YGV+KLPVSTSALI ASQLAFTA 
Sbjct  62    RTAAAGKAELYLMKPRVFVAAAVIGVLTGFDDYLYAYGVAKLPVSTSALIVASQLAFTAV  121

Query  883   GAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAFLMTLASAALYG  704
              AFL+VKQ FTA+SVNAVVLLT GA VL + ++GDRP GES KEY+  FL+T+A+AALYG
Sbjct  122   FAFLMVKQEFTAYSVNAVVLLTLGAVVLGLHTSGDRPEGESSKEYMVGFLLTVAAAALYG  181

Query  703   ALLPCIELTYIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQAISREARGFEIG  524
              +LP +ELTY K +Q+++YTLVLE Q+VM +FAT+FCTVGMLVN DFQAI+REAR +E+G
Sbjct  182   FILPAVELTYKKAKQAVSYTLVLEMQLVMCVFATSFCTVGMLVNNDFQAIAREARAYELG  241

Query  523   EANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLTEVFAVVFYGEKFGSE  344
             E  YY+VV+ +A++WQ  F+GA G I Y SSLLSGI++   +  TE+ A++FY EKF +E
Sbjct  242   ETKYYIVVLWSAIVWQCFFLGAIGVIFYSSSLLSGIVITVLLPATEILAIIFYHEKFQAE  301

Query  343   KGISLTLSLWGIVSYFYGEMK----------NGDNNKKEELQIQVTN  233
             KG+SL LSLWG +SYFYGEMK          +  N++ +  + ++T+
Sbjct  302   KGLSLFLSLWGFISYFYGEMKKDKNKNKNNIDQSNDQTQATETELTH  348



>ref|XP_002285717.1| PREDICTED: purine permease 1 [Vitis vinifera]
 emb|CAN64392.1| hypothetical protein VITISV_015235 [Vitis vinifera]
Length=349

 Score =   370 bits (951),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 201/349 (58%), Positives = 256/349 (73%), Gaps = 11/349 (3%)
 Frame = -1

Query  1255  GNMRRRLFLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIPLaaay  1076
              NMR+ L L+LN +++ IG CGG +++RLYF+RGG R+WFS+ L TAGWP+  +PL   Y
Sbjct  7     SNMRKAL-LVLNCVILSIGNCGGPMVMRLYFVRGGERIWFSSWLETAGWPLILVPLIITY  65

Query  1075  ytrrrhttttaasiftiTRNTFlaaaalgvllGIINYLYTYGVSKLPVSTSALIAASQLA  896
               RR    + A   F      F+A+A +GVL G  +YLY YGV+KLPVSTSALI ASQLA
Sbjct  66    IHRRTKQGSHAKLFFMK-PPLFVASAVIGVLTGFDDYLYAYGVAKLPVSTSALIIASQLA  124

Query  895   FTAGGAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAFLMTLASA  716
             FTA  AFLLVKQ+FT++SVNA+ LL+ GAGVLA+ ++ DRPA ES KEY   F+MTLA+A
Sbjct  125   FTAAFAFLLVKQKFTSYSVNAIFLLSIGAGVLALHTSSDRPANESNKEYYLGFVMTLAAA  184

Query  715   ALYGALLPCIELTYIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQAISREARG  536
             ALYG +LP +ELTY K +Q++TY+LV+E QMVM  FAT FCTVGMLVN DFQAISREA+ 
Sbjct  185   ALYGFILPLVELTYKKAKQAITYSLVMEIQMVMCFFATVFCTVGMLVNNDFQAISREAKE  244

Query  535   FEIGEANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLTEVFAVVFYGEK  356
             +E+GEA YY+VVV   +IWQ  F+GA G I   SSL+ GI++A  + +TE+ AV+F+ EK
Sbjct  245   YELGEAKYYLVVVWNGIIWQCFFLGAIGVIFSASSLVCGIVIAVLLPVTEILAVIFFQEK  304

Query  355   FGSEKGISLTLSLWGIVSYFYGEMKNGDNNKKEELQIQVTNMEPNETLP  209
             F +EKG+SL LSLWG VSYFYGE+K  D+ KK+       N  P   LP
Sbjct  305   FQAEKGVSLALSLWGFVSYFYGEIK--DSKKKK-------NPTPETELP  344



>ref|XP_002307351.2| PURINE PERMEASE 1 family protein [Populus trichocarpa]
 gb|EEE94347.2| PURINE PERMEASE 1 family protein [Populus trichocarpa]
Length=356

 Score =   368 bits (945),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 201/351 (57%), Positives = 256/351 (73%), Gaps = 6/351 (2%)
 Frame = -1

Query  1273  EVSEGKGNMRRRLFLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFI  1094
             E ++GK  M++ L L+ N +++ IG CGG L++RLYFI GG R+W S  L T GWPI  I
Sbjct  5     EETQGKTTMKKTL-LIFNCLILSIGNCGGPLIMRLYFIHGGKRIWLSAWLETGGWPIILI  63

Query  1093  PLaaayytrrrhttttaasiftiTRNTFlaaaalgvllGIINYLYTYGVSKLPVSTSALI  914
             PLA +Y+ RR    TT           F+AAA +GVL G+ +YLY YGV++LPVSTSALI
Sbjct  64    PLAISYFHRRATDPTTKLFYMK--PPLFIAAAIIGVLTGLDDYLYAYGVARLPVSTSALI  121

Query  913   AASQLAFTAGGAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAFL  734
              A+QLAFTAG AFLLVKQ+FT++S+NAVVLLT GAGVLA+ +  D+PA ES +EY+  F+
Sbjct  122   IATQLAFTAGFAFLLVKQKFTSYSINAVVLLTVGAGVLAMHTGSDKPAHESSREYILGFI  181

Query  733   MTLASAALYGALLPCIELTYIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQAI  554
             +TL +AALYG ++P +ELTY K RQ + YTLV+E QM+M L AT FCTVGML+NKDFQAI
Sbjct  182   LTLVAAALYGFIMPLVELTYKKSRQEMNYTLVMEIQMIMCLLATVFCTVGMLINKDFQAI  241

Query  553   SREARGFEIGEANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLTEVFAV  374
              REAR +E+GE  YYVV+V +A+IWQ  F+GA G I   SSLLSGII+   +  TE+ AV
Sbjct  242   PREARNYELGEVKYYVVMVWSAIIWQCFFLGAIGVIFCASSLLSGIIITVLLPATEILAV  301

Query  373   VFYGEKFGSEKGISLTLSLWGIVSYFYGEMKNGDNNKKEELQIQVTNMEPN  221
             +F+ EKF  EKG++L LSLWG VSYFYGEMK    NKK++     T M P+
Sbjct  302   IFFQEKFQVEKGVALGLSLWGFVSYFYGEMK---ENKKKKPAAPETLMAPS  349



>gb|KDP41439.1| hypothetical protein JCGZ_15846 [Jatropha curcas]
Length=359

 Score =   367 bits (943),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 197/351 (56%), Positives = 258/351 (74%), Gaps = 4/351 (1%)
 Frame = -1

Query  1279  KMEVSEGKGNMRRRLFLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPIN  1100
             K +    K  MRR L L+LN +++ IG CGG L++RLYFI GG R+W S+ L TAGWPI 
Sbjct  5     KEKPQPAKATMRRAL-LVLNCVILSIGNCGGPLIMRLYFIHGGKRVWLSSWLETAGWPII  63

Query  1099  FIPLaaayytrrrhttttaasiftiTRNTFlaaaalgvllGIINYLYTYGVSKLPVSTSA  920
             FIPL  +Y+ RR  T  T A +F +  + FLAA  +G+L G  +YLY YGV++LPVSTS+
Sbjct  64    FIPLLISYFHRRSTTDPTTAKLFYMKPSLFLAATGIGILTGFDDYLYAYGVARLPVSTSS  123

Query  919   LIAASQLAFTAGGAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAA  740
             LI A+QLAFTAG AFLLVKQ+FT++S+NAVVLLT GAGVLA+ ++ DRP  ESKKEY   
Sbjct  124   LIIATQLAFTAGFAFLLVKQKFTSYSINAVVLLTVGAGVLALHTSSDRPEHESKKEYNLG  183

Query  739   FLMTLASAALYGALLPCIELTYIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQ  560
             F+MTL +A LYG +LP +ELTY K +Q ++YTLV+E QM+M LFAT  CTVGMLVN DF+
Sbjct  184   FVMTLGAAVLYGLILPLVELTYRKAKQEISYTLVMEIQMIMCLFATVVCTVGMLVNNDFK  243

Query  559   AISREARGFEIGEANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLTEVF  380
              I REA+ FE+GE  YYV++V +A+IWQ  F+GA G +   SSL SG+++A  + +TE+ 
Sbjct  244   VIPREAKEFELGETKYYVIMVWSAIIWQCFFLGAIGIVFCASSLASGVVIAVLLPVTEIL  303

Query  379   AVVFYGEKFGSEKGISLTLSLWGIVSYFYGEMKNGDNNKKEELQIQVTNME  227
             AV+FY EKF +EKG++L LSLWG +SYFYGE+K    +KK  L  ++   E
Sbjct  304   AVIFYQEKFQAEKGVALALSLWGFLSYFYGEIK---QSKKTNLTSEIETSE  351



>gb|KHG22236.1| Purine permease 1 -like protein [Gossypium arboreum]
Length=357

 Score =   367 bits (941),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 198/353 (56%), Positives = 258/353 (73%), Gaps = 3/353 (1%)
 Frame = -1

Query  1276  MEVSEGKGNMRRRLFLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINF  1097
             MEV +G G +R+ L L++N I++ IG CGG L+ RLYFI GGNR+WFS+ L TAG PI  
Sbjct  1     MEVKDG-GTIRKAL-LVINCIILSIGNCGGPLITRLYFIHGGNRIWFSSWLQTAGCPIIL  58

Query  1096  IPLaaayytrrrhttttaasift-iTRNTFlaaaalgvllGIINYLYTYGVSKLPVSTSA  920
             +P+A AY  R R    T+ +    + R  F+AA  LG+L G+ NY Y+YG+S+LPVSTS+
Sbjct  59    LPIACAYVHRSRTADPTSENKVFCMERPLFIAAIVLGILSGLDNYFYSYGLSRLPVSTSS  118

Query  919   LIAASQLAFTAGGAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAA  740
             LI ASQLAFTAG AFLLVKQ+FTA+S+NAV LLT GAGVLA+ S+ DRPA ES KEY+  
Sbjct  119   LIIASQLAFTAGFAFLLVKQKFTAYSINAVFLLTIGAGVLALHSSSDRPANESNKEYILG  178

Query  739   FLMTLASAALYGALLPCIELTYIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQ  560
             F+MTLA+AALYG +LP +ELTY K +Q ++Y LV+E Q+VM L ATAFCTVGMLVN DF+
Sbjct  179   FVMTLAAAALYGFILPLVELTYKKAKQEISYALVMEIQLVMCLVATAFCTVGMLVNNDFK  238

Query  559   AISREARGFEIGEANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLTEVF  380
              I REAR FE+GE  YY+V + +A+IWQ  F+GA G +   SSLLSG++++  + +TE+ 
Sbjct  239   VIGREAREFELGETKYYIVAIFSAIIWQFFFLGAIGVVFCASSLLSGVVISVLLPVTEIL  298

Query  379   AVVFYGEKFGSEKGISLTLSLWGIVSYFYGEMKNGDNNKKEELQIQVTNMEPN  221
             AV F+ EKF +EKG+SL LSLWG +SYFYG++K     K        + + PN
Sbjct  299   AVFFFNEKFQAEKGVSLALSLWGFLSYFYGDIKRIKTKKPTPETEMASPLPPN  351



>gb|EYU34537.1| hypothetical protein MIMGU_mgv1a022801mg, partial [Erythranthe 
guttata]
Length=349

 Score =   366 bits (940),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 192/347 (55%), Positives = 258/347 (74%), Gaps = 10/347 (3%)
 Frame = -1

Query  1243  RRLFLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIPLaaayytrr  1064
             +R+ L++N I++ +G CGG L++RLYF+ GG R+WFS+ L T GWPI  +PL  +Y  RR
Sbjct  2     KRVLLIINCIILAVGNCGGPLIMRLYFVHGGKRIWFSSWLETGGWPILLVPLLVSYNRRR  61

Query  1063  rhttttaasiftiTRNTFlaaaalgvllGIINYLYTYGVSKLPVSTSALIAASQLAFTAG  884
             R   +  A ++ +    FLAAA +GVL G  +YLY YGV+KLPVSTSALI ASQLAFTA 
Sbjct  62    RTAASGKAELYLMKPRVFLAAAVIGVLTGFDDYLYAYGVAKLPVSTSALIIASQLAFTAA  121

Query  883   GAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAFLMTLASAALYG  704
              AFL+VKQ FTA+SVN+VVLLT GA VL + +NGDRP GES KEY+  F +T+A+AAL G
Sbjct  122   FAFLMVKQEFTAYSVNSVVLLTLGAVVLGLHTNGDRPEGESSKEYMVGFFLTVAAAALCG  181

Query  703   ALLPCIELTYIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQAISREARGFEIG  524
              +LP +ELTY K +Q+++YTLVLE Q+VM +FAT+FCT+GMLVN DFQAI+REAR +E+G
Sbjct  182   FILPAVELTYKKAKQAVSYTLVLEMQLVMCVFATSFCTLGMLVNNDFQAIAREARAYELG  241

Query  523   EANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLTEVFAVVFYGEKFGSE  344
             E  YY+VV+ +A++WQ  F+GA G I Y SSLLSGI++   +  TE+ A++FY EKF +E
Sbjct  242   ETKYYIVVLWSAIVWQCFFLGAIGVIFYSSSLLSGIVITVLLPATEILAIIFYHEKFQAE  301

Query  343   KGISLTLSLWGIVSYFYGEMK----------NGDNNKKEELQIQVTN  233
             KG+SL LSLWG +SYFYGEMK          +  N++ +  + ++T+
Sbjct  302   KGLSLFLSLWGFISYFYGEMKKDKNKNKNNIDQSNDQTQATETELTH  348



>ref|XP_002285718.1| PREDICTED: purine permease 1 [Vitis vinifera]
Length=351

 Score =   365 bits (937),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 196/356 (55%), Positives = 255/356 (72%), Gaps = 10/356 (3%)
 Frame = -1

Query  1276  MEVSEGKGNMRRRLFLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINF  1097
             MEV     +  R+  L+L+ +++ IG CGG L++RLYF+RGG R+WFS+ L TAGWP+  
Sbjct  1     MEVEAQLSSNTRKALLVLSCVILSIGHCGGPLVMRLYFVRGGERIWFSSWLETAGWPLIL  60

Query  1096  IPLaaayytrrrhttttaasiftiTRNTFlaaaalgvllGIINYLYTYGVSKLPVSTSAL  917
             +PL   Y  RR    + A   F      F+A+A +GVL  + +YLY YGV+KLPVST AL
Sbjct  61    VPLIITYMHRRTKQGSHAKLFFMK-PPLFVASAVIGVLTALDDYLYAYGVAKLPVSTIAL  119

Query  916   IAASQLAFTAGGAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAF  737
             I ASQLAFTA  AFLLVKQ+FT++SVNA+ LL+ GAGVLA+ ++ DRPA ES KEY   F
Sbjct  120   IIASQLAFTAAFAFLLVKQKFTSYSVNAIFLLSIGAGVLALHTSSDRPANESNKEYYLGF  179

Query  736   LMTLASAALYGALLPCIELTYIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQA  557
              MTLA+AALYG +LP +ELTY K +Q++TY+LV+E QMVM  FAT FCTVGMLVN DFQA
Sbjct  180   FMTLAAAALYGFILPLVELTYKKAKQAITYSLVMEIQMVMCFFATFFCTVGMLVNNDFQA  239

Query  556   ISREARGFEIGEANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLTEVFA  377
             I REA+ +E+GEA YY+VVV   ++WQ  ++GA G I   SSL++GI+LA  + +TE+ A
Sbjct  240   IPREAKEYELGEAKYYLVVVWNGIMWQCFYLGAIGVIFCASSLVAGIVLAVLLPVTEILA  299

Query  376   VVFYGEKFGSEKGISLTLSLWGIVSYFYGEMKNGDNNKKEELQIQVTNMEPNETLP  209
             V+F+ +KF +EKG+SL LSLWG VSYFYGE+K  D+ KK+       N  P   LP
Sbjct  300   VIFFHDKFQAEKGVSLALSLWGFVSYFYGEIK--DSKKKK-------NPTPETELP  346



>ref|XP_008219366.1| PREDICTED: purine permease 3-like [Prunus mume]
Length=368

 Score =   365 bits (937),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 194/343 (57%), Positives = 254/343 (74%), Gaps = 3/343 (1%)
 Frame = -1

Query  1276  MEVS--EGKGNMRRRLFLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPI  1103
             ME S  E +    +R  L+L+ +++ IG CGG L++RLYFI GGNR+W S+ L T GWPI
Sbjct  1     MEASHEEKRNASLKRALLILSCVLLSIGTCGGPLIMRLYFIHGGNRVWLSSWLETGGWPI  60

Query  1102  NFIPLaaayytrrrhttttaasiftiTRNTFlaaaalgvllGIINYLYTYGVSKLPVSTS  923
              FIP+A AYY RR     +    F      F+A+A +G++ G+ +YLY YGV++LPVSTS
Sbjct  61    IFIPIALAYYHRRTTEGPSTKLFFMKL-PLFIASAVIGLITGLDDYLYAYGVARLPVSTS  119

Query  922   ALIAASQLAFTAGGAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVA  743
             ALI A+QLAFTA  AFLLVKQ+FT++S NAVVLLT GA VL + ++ DRP GES K+Y+A
Sbjct  120   ALIIAAQLAFTALFAFLLVKQKFTSYSTNAVVLLTIGAAVLGLNTSADRPKGESDKQYIA  179

Query  742   AFLMTLASAALYGALLPCIELTYIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDF  563
              FLMT+A+AALYG +LP +ELTY K +Q++TY LVLE QMVM LFAT FCTVGML++ DF
Sbjct  180   GFLMTVAAAALYGFVLPLVELTYKKAKQTITYALVLEIQMVMCLFATIFCTVGMLIDNDF  239

Query  562   QAISREARGFEIGEANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLTEV  383
             + I REAR F +GE  YYVV+V++A++WQ  F+GA G I   SSLLSGI++A  + +TE+
Sbjct  240   KVIPREARNFGLGEGTYYVVLVLSAIVWQTFFLGAIGVIFCASSLLSGIVIAVLLPITEI  299

Query  382   FAVVFYGEKFGSEKGISLTLSLWGIVSYFYGEMKNGDNNKKEE  254
              AV+FY EKF +EKG++L LSLWG VSYFYGE+K     + E+
Sbjct  300   LAVIFYHEKFQAEKGVALALSLWGFVSYFYGEIKYSKQRENEK  342



>gb|KHG06856.1| Purine permease 1 -like protein [Gossypium arboreum]
Length=374

 Score =   363 bits (931),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 199/359 (55%), Positives = 259/359 (72%), Gaps = 4/359 (1%)
 Frame = -1

Query  1279  KMEVSEGK--GNMRRRLFLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWP  1106
             +MEV E K  G   R+  L++N I++ IG CG  L++RLYFI GGNR+WF + L TAG P
Sbjct  13    QMEVKEPKHDGTTMRKALLVINCIILSIGNCGSPLIMRLYFIHGGNRIWFLSWLETAGCP  72

Query  1105  INFIPLaaayytrrrhtttta-asiftiTRNTFlaaaalgvllGIINYLYTYGVSKLPVS  929
             I  +P+A AY  R R    T+    F + R  FLAA  LG++ G+ NY Y+YG+S+LPVS
Sbjct  73    ITLLPIACAYMHRSRTADPTSGKKRFYMERPLFLAAIVLGIITGLDNYFYSYGLSRLPVS  132

Query  928   TSALIAASQLAFTAGGAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEY  749
             TS+LI ASQLAFTAG AFLLVKQ+FTA+S+NAV LLT GAGVLA+ S+ DRP  ES KEY
Sbjct  133   TSSLIIASQLAFTAGFAFLLVKQKFTAYSINAVFLLTIGAGVLALHSSSDRPENESNKEY  192

Query  748   VAAFLMTLASAALYGALLPCIELTYIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNK  569
             +  F+MTLA+AALYG +LP +ELTY K +Q ++Y LV+E Q+VM L AT FCTVGMLVN 
Sbjct  193   ILGFVMTLAAAALYGFVLPLVELTYKKAKQEISYALVMEIQLVMCLVATGFCTVGMLVNN  252

Query  568   DFQAISREARGFEIGEANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLT  389
             DF+ I +EAR FE+GE  YYVVV+ TA+I Q  F+GA G +   SS+LSG+++A  + +T
Sbjct  253   DFKVIGKEAREFELGETKYYVVVIFTAIINQCFFLGAIGVVFCASSMLSGVVIAVLLPVT  312

Query  388   EVFAVVFYGEKFGSEKGISLTLSLWGIVSYFYGEMKNGDNNKKEELQIQVTNMEPNETL  212
             E+ A+  + EKF +EKG+SL LSLWG VSYFYGE+K     KK + +I++ +  P  TL
Sbjct  313   EILAIFSFNEKFQAEKGVSLALSLWGFVSYFYGEIKQ-SKKKKPDPEIEMASSLPPNTL  370



>ref|XP_007018134.1| Purine permease 3 [Theobroma cacao]
 gb|EOY15359.1| Purine permease 3 [Theobroma cacao]
Length=356

 Score =   362 bits (929),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 200/357 (56%), Positives = 254/357 (71%), Gaps = 5/357 (1%)
 Frame = -1

Query  1276  MEVSEGKGNMR-RRLFLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPIN  1100
             MEV E + N   RR  L++N  ++ IG CGG L++RLYFI GG R+WFS+ L T GWPI 
Sbjct  1     MEVKEAEPNSSMRRALLVINCFVLAIGNCGGPLMMRLYFIHGGKRVWFSSWLETGGWPII  60

Query  1099  FIPLaaayytrrrhttttaasiftiTRNTFlaaaalgvllGIINYLYTYGVSKLPVSTSA  920
               P+A AY  RRR   T+    F +    F+A+A +G+L G  +YLY YGV++LPVSTS+
Sbjct  61    LFPIAWAYLHRRRTQPTSRNKFFFMKPPLFIASAVIGILTGFDDYLYAYGVARLPVSTSS  120

Query  919   LIAASQLAFTAGGAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAA  740
             LI A+QLAFTAG AFLLVKQ+FT++S+NAV LLT GAGVLA+ ++ DRP  ES KEYV  
Sbjct  121   LIIAAQLAFTAGFAFLLVKQKFTSYSINAVFLLTIGAGVLALNTSSDRPENESNKEYVMG  180

Query  739   FLMTLASAALYGALLPCIELTYIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQ  560
             FLMT+A+A LYG +LP +EL Y K +Q ++Y LV+E QMVM LFAT  CTVGMLVN DF+
Sbjct  181   FLMTIAAAVLYGFILPLVELMYKKAKQEISYALVMEIQMVMCLFATVLCTVGMLVNNDFK  240

Query  559   AISREARGFEIGEANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLTEVF  380
              ISREAR F +GE  YYVV + +A+IWQ  F+GA G I   SSL+SGI++A  + +TE+ 
Sbjct  241   VISREAREFGLGETKYYVVAISSAIIWQGFFLGAIGVIFCASSLVSGIMIAVLLPVTEIL  300

Query  379   AVVFYGEKFGSEKGISLTLSLWGIVSYFYGEMKNGDNNKKEELQIQVTNMEPNETLP  209
             AV+F  EKF +EKG++L LSLWG VSYFYGE+K     KK  L+   T M P  T P
Sbjct  301   AVIFLKEKFQAEKGVALALSLWGFVSYFYGEIKQ-TKKKKRALE---TEMPPVPTSP  353



>gb|KHG13700.1| Purine permease 3 -like protein [Gossypium arboreum]
 gb|KHG19122.1| Purine permease 3 -like protein [Gossypium arboreum]
Length=358

 Score =   362 bits (929),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 187/342 (55%), Positives = 250/342 (73%), Gaps = 3/342 (1%)
 Frame = -1

Query  1276  MEV---SEGKGNMRRRLFLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWP  1106
             MEV   SE      R+  L++N I++ IG C G L++RLYFI GG R+WFS+ L T GWP
Sbjct  1     MEVVKESEPNTTTMRKALLVINCIILSIGNCAGPLMMRLYFIHGGKRVWFSSWLETGGWP  60

Query  1105  INFIPLaaayytrrrhttttaasiftiTRNTFlaaaalgvllGIINYLYTYGVSKLPVST  926
             I   P+A  ++ R R   ++   +F +  + F+AAA +G+L G+ +YLY YGV++LPVST
Sbjct  61    IILFPIACVHFYRSRTQPSSENKLFFMKPHLFIAAAVIGILTGLDDYLYAYGVARLPVST  120

Query  925   SALIAASQLAFTAGGAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYV  746
             S+LI ASQLAFTAG AF+LVKQ+FT++S+NAV LLT G+GVLA+ ++ DRPA ES +EYV
Sbjct  121   SSLIIASQLAFTAGFAFVLVKQKFTSYSINAVFLLTIGSGVLAMHTSSDRPANESNREYV  180

Query  745   AAFLMTLASAALYGALLPCIELTYIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKD  566
               FLMT+ ++ALYG +LP +ELTY K +Q ++Y LV+E QMVM LFAT  CT+GMLVN D
Sbjct  181   LGFLMTVGASALYGFILPLVELTYKKAKQEISYALVMEIQMVMCLFATGVCTIGMLVNND  240

Query  565   FQAISREARGFEIGEANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLTE  386
             F+ I REAR +E+GE  YY+V + +A+IWQ  F+GA G I   SSLLSGII+A  + +TE
Sbjct  241   FKVIRREAREYELGETKYYIVAICSAMIWQCFFLGAIGVIFCASSLLSGIIIAVLLPVTE  300

Query  385   VFAVVFYGEKFGSEKGISLTLSLWGIVSYFYGEMKNGDNNKK  260
             + AV+FY E F +EKG++L LSLWG +SYFYGE+K    NK 
Sbjct  301   ILAVIFYNESFHAEKGVALALSLWGFLSYFYGEIKQSKENKP  342



>ref|XP_004152618.1| PREDICTED: purine permease 3-like [Cucumis sativus]
 ref|XP_004174047.1| PREDICTED: purine permease 3-like [Cucumis sativus]
 gb|KGN62722.1| hypothetical protein Csa_2G369730 [Cucumis sativus]
Length=363

 Score =   360 bits (924),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 180/340 (53%), Positives = 244/340 (72%), Gaps = 9/340 (3%)
 Frame = -1

Query  1243  RRLFLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIPLaaayytrr  1064
             +R  L+ N  ++ +G CGG L++RLYF+ GG R+W S+CL T GWPI FIPL  +Y  RR
Sbjct  14    KRTLLIFNCCLLAVGNCGGPLIMRLYFVHGGKRVWLSSCLETGGWPIIFIPLLISYIHRR  73

Query  1063  rhttttaasiftiTRNTFlaaaalgvllGI------INYLYTYGVSKLPVSTSALIAASQ  902
             R      +      +  F+          I       +YLY YGV++LPVSTSALI A Q
Sbjct  74    RLAALDPSGSPNSAQFIFMKPRLFLASAFIGILTGFDDYLYAYGVARLPVSTSALIIACQ  133

Query  901   LAFTAGGAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAFLMTLA  722
             LAFTAG AFLLVKQ+FT++S+NAVVLLT G  VLA+ ++GDRPAGES K+Y+A FLMT+A
Sbjct  134   LAFTAGFAFLLVKQKFTSYSINAVVLLTIGGAVLALHTSGDRPAGESNKDYIAGFLMTVA  193

Query  721   SAALYGALLPCIELTYIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQAISREA  542
             +A +YG +LP +ELTY K RQ +TYTLVLEFQ++MSLFAT  C +GML+N DFQ I REA
Sbjct  194   AAVVYGFVLPLVELTYKKARQQITYTLVLEFQLIMSLFATIVCAIGMLINNDFQVIPREA  253

Query  541   RGFEIGEANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLTEVFAVVFYG  362
               F +G+  YY+V+V++A++WQ  F+GA G I   SSL SGI++A  + +TE+ AV+ + 
Sbjct  254   EAFGLGKFRYYLVLVLSAILWQGFFLGAIGVIFSSSSLFSGIVIAVLLPVTEILAVIIFN  313

Query  361   EKFGSEKGISLTLSLWGIVSYFYGEMKNGDNNKKEELQIQ  242
             E+F +EKG+SL L+LWG +SYFYGE+K   +NK+++L++Q
Sbjct  314   ERFQAEKGVSLALNLWGFLSYFYGEIK---HNKRKKLELQ  350



>ref|XP_007223326.1| hypothetical protein PRUPE_ppa007339mg [Prunus persica]
 gb|EMJ24525.1| hypothetical protein PRUPE_ppa007339mg [Prunus persica]
Length=372

 Score =   360 bits (924),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 193/334 (58%), Positives = 250/334 (75%), Gaps = 3/334 (1%)
 Frame = -1

Query  1276  MEVS--EGKGNMRRRLFLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPI  1103
             ME S  E +    +R  L+L+ +++ IG CGG L++RLYFI GG R+W S+ L T GWPI
Sbjct  1     MEASHEEKRNASLKRALLILSCVLLSIGTCGGPLIMRLYFIHGGKRVWLSSWLETGGWPI  60

Query  1102  NFIPLaaayytrrrhttttaasiftiTRNTFlaaaalgvllGIINYLYTYGVSKLPVSTS  923
              FIP+A AYY RR     +    F      F+A+A +G++ G+ +YLY YGV++LPVSTS
Sbjct  61    IFIPIALAYYHRRTTEGPSTKLFFIKL-PLFIASAVIGLITGLDDYLYAYGVARLPVSTS  119

Query  922   ALIAASQLAFTAGGAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVA  743
             +LI A+QLAFTA  AFLLVKQ+FT++S NAVVLLT GA VL + +N DRP GES KEY+A
Sbjct  120   SLIIAAQLAFTALFAFLLVKQKFTSYSTNAVVLLTIGAAVLGLNTNADRPKGESDKEYIA  179

Query  742   AFLMTLASAALYGALLPCIELTYIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDF  563
              FLMT+A+AALYG +LP +ELTY K +Q++TY LVLE QMVM LFAT FCTVGML+N DF
Sbjct  180   GFLMTVAAAALYGFVLPLVELTYKKAKQTITYALVLEIQMVMCLFATIFCTVGMLINNDF  239

Query  562   QAISREARGFEIGEANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLTEV  383
             + I REAR F +G+  YYVV+V++A++WQ  F+GA G I   SSLLSGI++A  + +TE+
Sbjct  240   KVILREARNFGLGKGTYYVVLVLSAIVWQTFFLGAIGIIFCASSLLSGIVIAVLLPITEI  299

Query  382   FAVVFYGEKFGSEKGISLTLSLWGIVSYFYGEMK  281
              AV+FY EKF +EKG++L LSLWG VSYFYGE+K
Sbjct  300   LAVIFYHEKFQAEKGVALALSLWGFVSYFYGEIK  333



>ref|XP_002285719.1| PREDICTED: purine permease 1-like [Vitis vinifera]
Length=351

 Score =   359 bits (921),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 190/341 (56%), Positives = 247/341 (72%), Gaps = 2/341 (1%)
 Frame = -1

Query  1255  GNMRRRLFLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIPLaaay  1076
              NMR+ L L+LN +++ IG CGG L++RLYF+ GG R+WFS+ L T GWP+  +PL   Y
Sbjct  9     SNMRKAL-LVLNCVILSIGNCGGPLVMRLYFVLGGERIWFSSWLETVGWPLILVPLIITY  67

Query  1075  ytrrrhttttaasiftiTRNTFlaaaalgvllGIINYLYTYGVSKLPVSTSALIAASQLA  896
               RR    + A   F      F+A+A +GVL G  +YLY YGV+KLPVSTSALI ASQLA
Sbjct  68    MHRRTKQDSHAKLFFMK-PPLFVASAVIGVLTGFDDYLYAYGVAKLPVSTSALIVASQLA  126

Query  895   FTAGGAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAFLMTLASA  716
             FTA  AFLLVKQ+FT++SVNA+ LL+ GAGVLA+ ++ DRP  ES KEY   F+MTLA+A
Sbjct  127   FTAAFAFLLVKQKFTSYSVNAIFLLSIGAGVLALHTSSDRPTNESNKEYYLGFVMTLAAA  186

Query  715   ALYGALLPCIELTYIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQAISREARG  536
             ALYG +LP +ELTY K +Q++TY+LV+E QMVM  FAT FCTVGMLVN DFQAISREA+ 
Sbjct  187   ALYGFILPLVELTYKKTKQAITYSLVMEIQMVMCFFATVFCTVGMLVNNDFQAISREAKE  246

Query  535   FEIGEANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLTEVFAVVFYGEK  356
             +E+GEA YY+VVV   +IWQ  F+ + G I   SSL+ GI++   + +TE+ AV+F+ EK
Sbjct  247   YELGEAKYYLVVVWNGIIWQCFFLVSIGVIFSASSLVCGIVITVLLPVTEILAVIFFREK  306

Query  355   FGSEKGISLTLSLWGIVSYFYGEMKNGDNNKKEELQIQVTN  233
             F +EKG+SL LSLWG VSYFYGE+K+    K    + ++  
Sbjct  307   FQAEKGVSLALSLWGFVSYFYGEIKDSKKKKNPTSETELPQ  347



>ref|XP_002513994.1| purine transporter, putative [Ricinus communis]
 gb|EEF48577.1| purine transporter, putative [Ricinus communis]
Length=356

 Score =   358 bits (918),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 195/352 (55%), Positives = 248/352 (70%), Gaps = 12/352 (3%)
 Frame = -1

Query  1264  EGKGNMRRRLFLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIPLa  1085
             +   +  +R  L+LN I++ IG CGG L++RLYFI GG R+W S+ L T GWPI  IPL 
Sbjct  8     QANTSTTKRALLILNCILLSIGNCGGPLIMRLYFIHGGKRVWLSSWLETGGWPILLIPLF  67

Query  1084  aayytrrrhttttaasiftiTRNTFlaaaalgvllGIINYLYTYGVSKLPVSTSALIAAS  905
              +Y  RR     T           FLAA  +GVL G+ +YLY YGV++LPVSTS+LI A+
Sbjct  68    ISYLHRRSTNPPTKLFYMK--PRLFLAATFIGVLTGLDDYLYAYGVARLPVSTSSLIIAT  125

Query  904   QLAFTAGGAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAFLMTL  725
             QLAFTA  AFLLVKQ+FT+FS+NAVVLLT GAGVLA+ ++ DRP  ES K+Y   F+MTL
Sbjct  126   QLAFTAAFAFLLVKQKFTSFSINAVVLLTAGAGVLALHTSSDRPGHESTKQYALGFVMTL  185

Query  724   ASAALYGALLPCIELTYIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQAISRE  545
              +AALYG +LP +ELTY K +Q ++YTLV+E QMVM LFAT FCT+GMLVNKDF  I RE
Sbjct  186   VAAALYGFILPLVELTYKKSKQEISYTLVMEIQMVMCLFATIFCTIGMLVNKDFNVIPRE  245

Query  544   ARGFEIGEANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLTEVFAVVFY  365
             AR F +GE  YYV++V +A+IWQ  F+GA G I   SSLLSGI++A  + +TEV AV+FY
Sbjct  246   AREFGLGETKYYVILVWSAIIWQCFFLGAIGVIFCASSLLSGILIAVLLPVTEVLAVIFY  305

Query  364   GEKFGSEKGISLTLSLWGIVSYFYGEMKNGDNNKKEELQIQVTNMEPNETLP  209
              E F +EKG++L LSLWG VSYFYGE+K  ++ KK        N+ P   +P
Sbjct  306   QENFQAEKGVALALSLWGFVSYFYGEVK--ESKKK--------NLAPGSEMP  347



>ref|XP_008219368.1| PREDICTED: purine permease 3-like [Prunus mume]
Length=370

 Score =   357 bits (916),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 189/363 (52%), Positives = 256/363 (71%), Gaps = 6/363 (2%)
 Frame = -1

Query  1288  LKLKMEVSEGKGNMRRRLFLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGW  1109
             + ++    E +    +R  L+L+ +++ IG CGG L++RLYFI GG R+W S+ L T GW
Sbjct  1     MHMEANHEEKRNAALKRALLILSCVILSIGACGGPLIMRLYFIHGGKRVWLSSWLETGGW  60

Query  1108  PINFIPLaaayytrrrhttttaasiftiTRNTFlaaaalgvllGIINYLYTYGVSKLPVS  929
             PI FIP+A AYY RR     +    F      F+A+A +G+L G+ +YLY YGV++LPVS
Sbjct  61    PIIFIPIALAYYHRRTTEGPSTKLFFMKL-PLFIASAVIGLLTGLDDYLYAYGVARLPVS  119

Query  928   TSALIAASQLAFTAGGAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEY  749
             T+ALI A+ L FTA  AFLLVKQ+FT++S+N V LLT GA VL + ++ DRP GES K+Y
Sbjct  120   TAALITAAHLVFTALFAFLLVKQKFTSYSINGVFLLTIGAAVLGLNTSADRPKGESDKQY  179

Query  748   VAAFLMTLASAALYGALLPCIELTYIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNK  569
             +A F+MT +SAALYG +LP +ELTY K +Q++TY LVLE Q+VM LFAT FCTVGML+N 
Sbjct  180   IAGFMMTFSSAALYGFVLPLVELTYKKAKQTITYALVLEIQLVMCLFATIFCTVGMLINN  239

Query  568   DFQAISREARGFEIGEANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLT  389
             DF+ I REAR FE+GE+ YYVV+V +A++WQ  F+GA G I   SSLLSGI++A  + +T
Sbjct  240   DFKVIPREARNFELGESRYYVVLVFSAIVWQGFFLGAIGIIFCASSLLSGIVIAVLLPVT  299

Query  388   EVFAVVFYGEKFGSEKGISLTLSLWGIVSYFYGEMKNGDNNKKE-----ELQIQVTNMEP  224
             E+ AV+FY EKF +EKG++L LSLWG VSYFYGE K     + E     E ++++   + 
Sbjct  300   EILAVIFYHEKFQAEKGVALALSLWGFVSYFYGERKYSKQKESEMKNEKEKEVEIGKKDT  359

Query  223   NET  215
              ET
Sbjct  360   PET  362



>ref|XP_008444876.1| PREDICTED: purine permease 3-like [Cucumis melo]
Length=359

 Score =   356 bits (913),  Expect = 9e-116, Method: Compositional matrix adjust.
 Identities = 191/349 (55%), Positives = 248/349 (71%), Gaps = 5/349 (1%)
 Frame = -1

Query  1243  RRLFLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIPLaaayytrr  1064
             +++ L  N+I+M +G CGG L+LRLYFI GGNR+W S+ L + GWPI  IPLA +Y  RR
Sbjct  11    KKVLLAFNSILMSVGNCGGPLILRLYFIHGGNRVWLSSWLFSGGWPIILIPLAISYIHRR  70

Query  1063  rhttttaasiftiTRNTFla--aaalgvllGIINYLYTYGVSKLPVSTSALIAASQLAFT  890
             R  T  + +     R   L   +A +G L G+ NYL+ YG+++LPVSTS+LI ASQLAFT
Sbjct  71    RTATAGSKTKLIFMREPLLLFGSAVIGALTGLDNYLFAYGMARLPVSTSSLIIASQLAFT  130

Query  889   AGGAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAFLMTLASAAL  710
             AG A+LLVKQ+FT+++VN+VVLLT G  +LA+ S+GDRPAGES  EY+A FLMTL +A L
Sbjct  131   AGFAYLLVKQKFTSYTVNSVVLLTMGGAILALHSSGDRPAGESNGEYIAGFLMTLGAAVL  190

Query  709   YGALLPCIELTYIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQAISREARGFE  530
             YG +LP IEL Y K +QSLTYTL+LE Q+VM++  T  CT+GML+N DFQAI RE R F 
Sbjct  191   YGLILPLIELMYKKTKQSLTYTLILEIQLVMAISGTVLCTIGMLINNDFQAIPREGREFG  250

Query  529   IGEANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLTEVFAVVFYGEKFG  350
             +G   YYVV+V++ +IWQ  FIGA G I Y SSL SGI++A  +   E+ AV+F+ EKF 
Sbjct  251   LGNTKYYVVLVMSCVIWQCFFIGAVGVIFYSSSLFSGIVIALLLPAVEILAVIFFREKFQ  310

Query  349   SEKGISLTLSLWGIVSYFYGEMKNGDNNKKEELQ---IQVTNMEPNETL  212
             +EKG+SL L+LWG VSYFYGE K     K  ELQ   +  T   PN+ +
Sbjct  311   AEKGVSLALNLWGFVSYFYGEYKQTKKVKSIELQKAELGTTTPPPNQNV  359



>ref|XP_007227615.1| hypothetical protein PRUPE_ppa022492mg [Prunus persica]
 gb|EMJ28814.1| hypothetical protein PRUPE_ppa022492mg [Prunus persica]
Length=368

 Score =   356 bits (913),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 190/356 (53%), Positives = 252/356 (71%), Gaps = 6/356 (2%)
 Frame = -1

Query  1267  SEGKGNMRRRLFLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIPL  1088
              E +    +R  L+L+ + + IG CGG L++RLYFI GG R+W S+ L T GWPI FIP+
Sbjct  6     EEKRNAALKRALLILSCVFLSIGACGGPLIMRLYFIHGGKRVWLSSWLETGGWPIIFIPI  65

Query  1087  aaayytrrrhttttaasiftiTRNTFlaaaalgvllGIINYLYTYGVSKLPVSTSALIAA  908
             A AYY RR     +    F      F+A+A +G+L G+ +YLY YGV++LPVST+ALI A
Sbjct  66    ALAYYHRRTTEGPSTKLFFMKL-PLFIASAVIGLLTGLDDYLYAYGVARLPVSTAALITA  124

Query  907   SQLAFTAGGAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAFLMT  728
             + L FTA  AFLLVKQ+FT++S+N V LLT GA VL + ++ DRP GES K+Y+A F+MT
Sbjct  125   AHLVFTALFAFLLVKQKFTSYSINCVFLLTIGAAVLGLNTSADRPKGESDKQYIAGFMMT  184

Query  727   LASAALYGALLPCIELTYIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQAISR  548
             L+SAALYG +LP +ELTY K +Q++TY LVLE Q+VM LFAT FCTVGML+N DF+ I R
Sbjct  185   LSSAALYGFVLPLVELTYKKAKQTITYALVLEIQLVMCLFATIFCTVGMLINNDFKVIPR  244

Query  547   EARGFEIGEANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLTEVFAVVF  368
             EAR FE+GE  YYVV+V +A++WQ  F+GA G I   SSLLSGI++A  + +TE+ AV+F
Sbjct  245   EARNFELGERRYYVVLVFSAIVWQGFFLGAIGIIFCASSLLSGIVIAVLLPVTEILAVIF  304

Query  367   YGEKFGSEKGISLTLSLWGIVSYFYGEMKNGDNNKKE-----ELQIQVTNMEPNET  215
             Y EKF +EKG++L LSLWG VSYFYGE K     + E     E ++++   +  ET
Sbjct  305   YHEKFQAEKGVALALSLWGFVSYFYGERKYSKQKESEMKNEREKEVEIGKKDTPET  360



>ref|XP_006364706.1| PREDICTED: purine permease 3-like [Solanum tuberosum]
Length=362

 Score =   355 bits (911),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 182/350 (52%), Positives = 246/350 (70%), Gaps = 8/350 (2%)
 Frame = -1

Query  1267  SEGKGNMRRRLFLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIPL  1088
             ++   + R+   L++N I++ IG CGG L+ RLYF++GG R+W S+ L T GWPI  IPL
Sbjct  3     TQESSSRRKNFLLIINCIILAIGNCGGPLITRLYFLKGGERIWLSSWLETVGWPIVLIPL  62

Query  1087  aaayy--------trrrhttttaasiftiTRNTFlaaaalgvllGIINYLYTYGVSKLPV  932
             + +Y+                    +  +T   F+A+  +GVL G  NYLY YGV+KLPV
Sbjct  63    SFSYFNRRREFQGKMLSTIDNNNTKLILMTPRIFVASIGIGVLTGFDNYLYAYGVAKLPV  122

Query  931   STSALIAASQLAFTAGGAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKE  752
             STSAL+ ASQLAFTA  AFLLVKQ+FT++S+N++ LLTFGA VLA+ + GDRP GESKKE
Sbjct  123   STSALLIASQLAFTAAFAFLLVKQKFTSYSINSIFLLTFGAVVLALHAKGDRPNGESKKE  182

Query  751   YVAAFLMTLASAALYGALLPCIELTYIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVN  572
             YV  F+MTL +AALYG +LP  EL Y K +Q +TYTLV+E Q V  +F+T  CT+GM++N
Sbjct  183   YVLGFIMTLGAAALYGLILPLFELMYKKAKQGITYTLVMEIQAVSCIFSTVVCTIGMIIN  242

Query  571   KDFQAISREARGFEIGEANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISL  392
             KDFQA+SREA+ FE+GEA YY+V++ +A+IWQ  F+GA G I   SSL+SGI++   + +
Sbjct  243   KDFQAMSREAKSFELGEARYYIVIIWSAIIWQCFFLGAIGVIYSSSSLVSGILITVLLPI  302

Query  391   TEVFAVVFYGEKFGSEKGISLTLSLWGIVSYFYGEMKNGDNNKKEELQIQ  242
             TE+  VVFYGEKF  EKG+SL LS+WG +SY YG++K     K+ + Q Q
Sbjct  303   TEILGVVFYGEKFTPEKGVSLVLSIWGFISYLYGDIKASKKKKENQSQEQ  352



>ref|XP_004164781.1| PREDICTED: purine permease 3-like [Cucumis sativus]
Length=371

 Score =   355 bits (911),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 191/342 (56%), Positives = 244/342 (71%), Gaps = 2/342 (1%)
 Frame = -1

Query  1243  RRLFLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIPLaaayytrr  1064
             +R+ L  N+I+M IG CGG L+LRLYFI GGNR+W S+ L T GWPI  +PLA +Y  RR
Sbjct  24    QRVLLAFNSILMSIGNCGGPLILRLYFIHGGNRVWLSSWLFTGGWPIILLPLAISYIHRR  83

Query  1063  rhttttaasiftiTRNTFla--aaalgvllGIINYLYTYGVSKLPVSTSALIAASQLAFT  890
             R  T  + +     R   L   +A +GVL G+ NYL+ YG+++LPVSTS+LI ASQLAFT
Sbjct  84    RTATDGSKTKLIFMREPLLLLGSAVVGVLTGVDNYLFAYGMARLPVSTSSLIIASQLAFT  143

Query  889   AGGAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAFLMTLASAAL  710
             AG A+LLVKQ+FT+++VNAVVLLT G  +LA+ S+GDRP GE+  EY+A FLMTL +A L
Sbjct  144   AGFAYLLVKQKFTSYTVNAVVLLTMGGAILALHSSGDRPEGETNGEYIAGFLMTLGAAVL  203

Query  709   YGALLPCIELTYIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQAISREARGFE  530
             YG +LP IEL Y K +Q LTYTL+LE Q+VM++  T  CT+GML+N DFQAI+RE R F 
Sbjct  204   YGLILPLIELMYKKTKQRLTYTLILEIQLVMAISGTLVCTIGMLINNDFQAIAREGREFG  263

Query  529   IGEANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLTEVFAVVFYGEKFG  350
             +G   YYVV+V++ +IWQ  FIGA G I Y SSL SGI++A  +   E+ AVVF+ EKF 
Sbjct  264   LGSTKYYVVLVMSCIIWQCFFIGAVGVIFYSSSLFSGIVIALLLPAVEILAVVFFREKFQ  323

Query  349   SEKGISLTLSLWGIVSYFYGEMKNGDNNKKEELQIQVTNMEP  224
              EKG+SL L+LWG VSYFYGE K     K +ELQ    +  P
Sbjct  324   VEKGVSLALNLWGFVSYFYGEFKQTKKMKSKELQKAQASTTP  365



>ref|XP_004152619.1| PREDICTED: purine permease 3-like [Cucumis sativus]
 gb|KGN62723.1| hypothetical protein Csa_2G369740 [Cucumis sativus]
Length=371

 Score =   355 bits (911),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 191/342 (56%), Positives = 243/342 (71%), Gaps = 2/342 (1%)
 Frame = -1

Query  1243  RRLFLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIPLaaayytrr  1064
             +R+ L  N+I+M IG CGG L+LRLYFI GGNR+W S+ L T GWPI  +PLA +Y  RR
Sbjct  24    QRVLLAFNSILMSIGNCGGPLILRLYFIHGGNRVWLSSWLFTGGWPIILLPLAISYIHRR  83

Query  1063  rhttttaasiftiTRNTFla--aaalgvllGIINYLYTYGVSKLPVSTSALIAASQLAFT  890
             R  T    +     R   L   +A +GVL G+ NYL+ YG+++LPVSTS+LI ASQLAFT
Sbjct  84    RTATDGTKTKLIFMREPLLLLGSAVVGVLTGVDNYLFAYGMARLPVSTSSLIIASQLAFT  143

Query  889   AGGAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAFLMTLASAAL  710
             AG A+LLVKQ+FT+++VNAVVLLT G  +LA+ S+GDRP GE+  EY+A FLMTL +A L
Sbjct  144   AGFAYLLVKQKFTSYTVNAVVLLTMGGAILALHSSGDRPEGETNGEYIAGFLMTLGAAVL  203

Query  709   YGALLPCIELTYIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQAISREARGFE  530
             YG +LP IEL Y K +Q LTYTL+LE Q+VM++  T  CT+GML+N DFQAI+RE R F 
Sbjct  204   YGLILPLIELMYKKTKQRLTYTLILEIQLVMAISGTLVCTIGMLINNDFQAIAREGREFG  263

Query  529   IGEANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLTEVFAVVFYGEKFG  350
             +G   YYVV+V++ +IWQ  FIGA G I Y SSL SGI++A  +   E+ AVVF+ EKF 
Sbjct  264   LGSTKYYVVLVMSCIIWQCFFIGAVGVIFYSSSLFSGIVIALLLPAVEILAVVFFREKFQ  323

Query  349   SEKGISLTLSLWGIVSYFYGEMKNGDNNKKEELQIQVTNMEP  224
              EKG+SL L+LWG VSYFYGE K     K +ELQ    +  P
Sbjct  324   VEKGVSLALNLWGFVSYFYGEFKQTKKMKSKELQKAQASTTP  365



>ref|XP_009615076.1| PREDICTED: purine permease 3-like [Nicotiana tomentosiformis]
Length=353

 Score =   354 bits (908),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 191/346 (55%), Positives = 252/346 (73%), Gaps = 5/346 (1%)
 Frame = -1

Query  1243  RRLFLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIPLaaayytrr  1064
             R++ L++N I++ IG C G L++RLYF+ GGNR+WFS+ L T GWP+  IPLA AY+ RR
Sbjct  10    RKILLVINCILLAIGNCCGPLIMRLYFLHGGNRIWFSSWLQTVGWPLILIPLAIAYFQRR  69

Query  1063  rhttttaasiftiTRNTFlaaaalgvllGIINYLYTYGVSKLPVSTSALIAASQLAFTAG  884
              +       I       FLA++  G+L G+ NYLY YG SKLPVSTS LI A+QLAFTA 
Sbjct  70    ENNIKKLFLIT---PRIFLASSVFGILTGVDNYLYAYGNSKLPVSTSTLILATQLAFTAV  126

Query  883   GAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAFLMTLASAALYG  704
              AF LVKQ+FTA S+NA+VLLT GA VLA+ S  DRP GES KEY+  F++TL +AALYG
Sbjct  127   FAFFLVKQKFTAHSINAIVLLTVGAVVLALRSGSDRPKGESSKEYILGFVLTLLAAALYG  186

Query  703   ALLPCIELTYIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQAISREARGFEIG  524
              ++P +ELTYIK  Q++TY LVLE QMV+  FA+AF TVGM++N DF+AIS EAR F +G
Sbjct  187   FVMPMVELTYIKATQTITYALVLEVQMVICCFASAFATVGMIINNDFKAISSEARQFGLG  246

Query  523   EANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLTEVFAVVFYGEKFGSE  344
             E  YY V+V +A+IWQ  F+GA G I Y SSLLSG+I+A  + +TEV AV+ + EKF  E
Sbjct  247   EGKYYNVLVWSAIIWQFFFVGAIGVISYSSSLLSGVIIAVLLPVTEVLAVIIFHEKFQPE  306

Query  343   KGISLTLSLWGIVSYFYGEMKNGDNNKKEELQIQVTNMEPNETLPM  206
             KG++L LS+WG +SYFYGEMK     +K+ L++++TN + + T P+
Sbjct  307   KGVALFLSIWGFISYFYGEMKQ-HKKEKQTLKLEMTNTQ-SSTPPL  350



>emb|CDP01126.1| unnamed protein product [Coffea canephora]
Length=353

 Score =   353 bits (907),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 189/345 (55%), Positives = 254/345 (74%), Gaps = 3/345 (1%)
 Frame = -1

Query  1240  RLFLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIPLaaayytrrr  1061
             +  L++N +++ IG CGG +++RLYF++GG R+W S+ L T G+PI  IPL  +Y+ RR+
Sbjct  11    KALLVVNCLILAIGNCGGPIIMRLYFVKGGKRIWLSSWLQTVGFPIIAIPLLISYFHRRK  70

Query  1060  httttaasiftiTRNTFlaaaalgvllGIINYLYTYGVSKLPVSTSALIAASQLAFTAGG  881
                     +       F+AAAA+G++ GI +YLY YG+++LPVSTS++I ASQLAFTA  
Sbjct  71    TEGPNTKLVLMKY-PLFIAAAAVGLVTGIDDYLYAYGMARLPVSTSSIIIASQLAFTAVF  129

Query  880   AFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAFLMTLASAALYGA  701
             AFLLVKQ+FTA+SVNAVVLLT GAGVLA+ S+ DRP GES K YV  FLMT+A+A LYG 
Sbjct  130   AFLLVKQKFTAYSVNAVVLLTVGAGVLAMHSSSDRPKGESTKMYVLGFLMTVAAAVLYGF  189

Query  700   LLPCIELTYIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQAISREARGFEIGE  521
             +LP +EL Y+K +Q++TYTLVLE Q+VM LFAT FCTVGM+  KDFQA++REAR + +GE
Sbjct  190   ILPVVELMYLKAKQAITYTLVLEIQLVMCLFATVFCTVGMIAKKDFQAMAREARAYALGE  249

Query  520   ANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLTEVFAVVFYGEKFGSEK  341
             A YY+VV  +A+IWQ  F+G  G I   SSLLS I++A  + +TEV AV+ + EKF +EK
Sbjct  250   AEYYLVVTWSAVIWQFFFLGVIGVIFCASSLLSAIMIAVLLPVTEVIAVIVFQEKFQAEK  309

Query  340   GISLTLSLWGIVSYFYGEMKNGDNNKKEELQIQVTNMEPNETLPM  206
             G++L LSLWG VSYFYGE+KN     KEE++ Q  + +  E  P+
Sbjct  310   GVALFLSLWGFVSYFYGEIKN--KKSKEEIEGQKNDSQSTEMTPI  352



>ref|XP_004242795.1| PREDICTED: purine permease 3-like [Solanum lycopersicum]
Length=367

 Score =   354 bits (908),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 186/368 (51%), Positives = 254/368 (69%), Gaps = 18/368 (5%)
 Frame = -1

Query  1276  MEVSEGKGNMRRRLFLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINF  1097
             M + E     ++ L L +N I++ IG CGG L+ RLYF++GG R+W S+ L T GWPI  
Sbjct  1     MTIQENSSRTKKFL-LAINCILLAIGNCGGPLITRLYFLKGGERIWLSSWLETVGWPIVL  59

Query  1096  IPLaaayytrrrhttttaasiftiTRNT-------------FlaaaalgvllGIINYLYT  956
             IPL+ +Y+ RRR          +   +              F+A+  +G+L G  NYLY 
Sbjct  60    IPLSFSYFNRRREFRGKMILSTSTDNDNDNNAKFILMTPRIFVASIGIGILTGFDNYLYA  119

Query  955   YGVSKLPVSTSALIAASQLAFTAGGAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDR  776
             YGV+KLPVSTSAL+ ASQLAFTAG AFLLVKQ+FT++S+N++ LLT GA VLA+ +NGDR
Sbjct  120   YGVAKLPVSTSALLIASQLAFTAGFAFLLVKQKFTSYSINSIFLLTLGAVVLALHANGDR  179

Query  775   PAGESKKEYVAAFLMTLASAALYGALLPCIELTYIKGRQSLTYTLVLEFQMVMSLFATAF  596
             P GES+KEY+  F+MTL +AALYG +LP  EL Y K +Q +TYTLV+E Q V  +F+T  
Sbjct  180   PNGESRKEYILGFIMTLGAAALYGLILPLFELLYKKAKQGITYTLVMEIQAVYCIFSTVV  239

Query  595   CTVGMLVNKDFQAISREARGFEIGEANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGI  416
             CT+GM++NKDFQA+SREA+ FE+GEA YY+V++ +A++WQ  F+GA G I + SSL+SGI
Sbjct  240   CTIGMIINKDFQAMSREAKSFELGEARYYIVIIWSAILWQCFFLGAIGVIYFSSSLVSGI  299

Query  415   ILAATISLTEVFAVVFYGEKFGSEKGISLTLSLWGIVSYFYGEM----KNGDNNKKEELQ  248
             ++   + +TE+  VVFYGEKF  EKG+SL LS+WG +SY YG++    K  +N  KE+  
Sbjct  300   LITVLLPVTEILGVVFYGEKFTPEKGVSLVLSIWGFISYLYGDIKASKKKKENQSKEQEM  359

Query  247   IQVTNMEP  224
             I+  N  P
Sbjct  360   IEKINCTP  367



>ref|XP_004299691.1| PREDICTED: purine permease 3-like [Fragaria vesca subsp. vesca]
Length=373

 Score =   353 bits (907),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 194/348 (56%), Positives = 259/348 (74%), Gaps = 5/348 (1%)
 Frame = -1

Query  1282  LKMEVSEG---KGNMRRRLFLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAG  1112
             ++ME ++    K    +RL L+L+++++ IG CGG L++RLYFI GG R+W S+ L T G
Sbjct  1     MQMETTDNEQRKAAALKRLLLILSSVLLSIGTCGGPLIMRLYFIHGGKRVWLSSMLETGG  60

Query  1111  WPINFIPLaaayytrrrhttttaasiftiTRNT--FlaaaalgvllGIINYLYTYGVSKL  938
             WP+  +P+A AYY RR++   T             F+A+A +GVL G+ +YLY YGV++L
Sbjct  61    WPVILVPIAIAYYHRRKNQAPTDPPTKLFFMKLPLFVASAVIGVLTGLDDYLYAYGVARL  120

Query  937   PVSTSALIAASQLAFTAGGAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESK  758
             PVSTSALI A+QLAFTA  AF+LVKQ+FT++S+NAVVLLT GA VL + ++ DRP GES 
Sbjct  121   PVSTSALIIAAQLAFTALFAFILVKQKFTSYSINAVVLLTVGAAVLGLNTSSDRPKGESN  180

Query  757   KEYVAAFLMTLASAALYGALLPCIELTYIKGRQSLTYTLVLEFQMVMSLFATAFCTVGML  578
              +Y+  F+MT+A+AALYG +LP +EL Y K +Q++TY LVLE QMVMSLFAT FCTVGML
Sbjct  181   AQYMLGFVMTVAAAALYGFVLPLVELMYKKAKQNITYALVLEIQMVMSLFATIFCTVGML  240

Query  577   VNKDFQAISREARGFEIGEANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATI  398
             VN DF+ I REAR FE+GE  YYVV+VV+A++WQ  F+GA G I   SSLLSGI++A  +
Sbjct  241   VNNDFKVIPREARKFELGETTYYVVLVVSAIVWQTFFLGAIGLIFCASSLLSGIVIAVLL  300

Query  397   SLTEVFAVVFYGEKFGSEKGISLTLSLWGIVSYFYGEMKNGDNNKKEE  254
              +TE+FAV+FY EKF +EKG+SL LSLWG VSYFYGE+K+    K+ +
Sbjct  301   PVTEIFAVIFYHEKFQAEKGVSLALSLWGFVSYFYGEIKHNKQKKQAD  348



>ref|XP_004501676.1| PREDICTED: purine permease 1-like isoform X1 [Cicer arietinum]
 ref|XP_004501677.1| PREDICTED: purine permease 1-like isoform X2 [Cicer arietinum]
Length=367

 Score =   352 bits (903),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 190/364 (52%), Positives = 247/364 (68%), Gaps = 9/364 (2%)
 Frame = -1

Query  1273  EVSEGKGNMRRRLFLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFI  1094
              + E K    +R+ L++N  ++ +G  GG L++RLYFI GGNR+W S+ L TAG+P+  +
Sbjct  4     RIEEEKQRKMKRILLIINCFILALGNSGGPLIMRLYFIHGGNRVWLSSFLETAGFPLMLL  63

Query  1093  PLaaayytrrrhttttaasiftiTRNTFlaaaalgvllGII-------NYLYTYGVSKLP  935
             PL  +Y  RRR     AA+  +   N       L + +  I       +YLY YGV++LP
Sbjct  64    PLTVSYIKRRRLHRRNAATTESGKLNLISMKPPLFLAVAFIGIITGLDDYLYAYGVARLP  123

Query  934   VSTSALIAASQLAFTAGGAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKK  755
             VSTSALI ASQL FTA  AFLLVKQ+FTAFS+NAVVLLT GAGVLA+ ++GDRP GES K
Sbjct  124   VSTSALIIASQLGFTAVFAFLLVKQKFTAFSINAVVLLTIGAGVLAMHTSGDRPNGESTK  183

Query  754   EYVAAFLMTLASAALYGALLPCIELTYIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLV  575
             +YV  F+ T+A+AALYG +LP IEL Y K +Q LTY+LV+E Q VM +FAT FC VGM+V
Sbjct  184   QYVIGFITTVAAAALYGFVLPLIELVYKKTKQPLTYSLVMEIQFVMCMFATLFCAVGMIV  243

Query  574   NKDFQAISREARGFEIGEANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATIS  395
             N DF+ I REA+ F +GE  YY V+VV+A++WQ  F+GA G I   SSLLSGI++A  + 
Sbjct  244   NNDFKVIPREAKIFGLGEKTYYFVLVVSAIMWQAFFLGAVGVIFCASSLLSGILIAVLLP  303

Query  394   LTEVFAVVFYGEKFGSEKGISLTLSLWGIVSYFYGEMKNGDNNKKE--ELQIQVTNMEPN  221
             LTEV AV+FY E F +EK +SL LSLWG VSYFYGE K     KK+  +L+ Q+     +
Sbjct  304   LTEVLAVIFYKEHFQAEKAVSLILSLWGFVSYFYGEFKESKELKKKNPDLETQLAQTSVD  363

Query  220   ETLP  209
                P
Sbjct  364   VPAP  367



>ref|XP_004299692.1| PREDICTED: purine permease 3-like [Fragaria vesca subsp. vesca]
Length=373

 Score =   352 bits (902),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 192/348 (55%), Positives = 256/348 (74%), Gaps = 5/348 (1%)
 Frame = -1

Query  1282  LKMEVSEG---KGNMRRRLFLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAG  1112
             ++ME ++    K    +RL L+L+ +++ IG CGG L++RLYFI GG RLW S+ L T G
Sbjct  1     MQMETTDNEQLKAAALKRLLLILSCVLLSIGTCGGPLIMRLYFIHGGKRLWLSSMLETGG  60

Query  1111  WPINFIPLaaayytrrrhttttaasiftiTRNT--FlaaaalgvllGIINYLYTYGVSKL  938
             WP+  +P+A AYY RR++   T             F+A+A +GVL G+ +YLY YGV++L
Sbjct  61    WPVILVPIAIAYYHRRKNQAPTDPPTKLFFMKLPLFVASAVIGVLTGLDDYLYAYGVARL  120

Query  937   PVSTSALIAASQLAFTAGGAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESK  758
             P+ST +LI AS L FTA  AF+LVKQ+FT++S+NAVVLLT GA VL + ++ DRP GES 
Sbjct  121   PLSTLSLIIASHLVFTALFAFILVKQKFTSYSINAVVLLTVGAAVLGLNTSSDRPKGESN  180

Query  757   KEYVAAFLMTLASAALYGALLPCIELTYIKGRQSLTYTLVLEFQMVMSLFATAFCTVGML  578
              +Y+  F+MT+A+AALYG +LP +EL Y K +Q++TY LVLE QMVMSLFAT FCTVGML
Sbjct  181   AQYMLGFVMTVAAAALYGFVLPLVELMYKKAKQNITYALVLEIQMVMSLFATIFCTVGML  240

Query  577   VNKDFQAISREARGFEIGEANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATI  398
             VN DF+ I REAR FE+GE  YYVV+VV+A++WQ  F+GA G I   SSLLSGI++A  +
Sbjct  241   VNNDFKVIPREARKFELGETTYYVVLVVSAIVWQAFFLGAIGLIFCASSLLSGIVIAVLL  300

Query  397   SLTEVFAVVFYGEKFGSEKGISLTLSLWGIVSYFYGEMKNGDNNKKEE  254
              +TE+FAV+FY EKF +EKG+SL LSLWG VSYFYGEMK+   +K+ +
Sbjct  301   PVTEIFAVIFYHEKFQAEKGVSLALSLWGFVSYFYGEMKHNKQSKQAD  348



>ref|XP_010060063.1| PREDICTED: purine permease 3-like isoform X1 [Eucalyptus grandis]
 ref|XP_010060064.1| PREDICTED: purine permease 3-like isoform X2 [Eucalyptus grandis]
 ref|XP_010060065.1| PREDICTED: purine permease 3-like isoform X1 [Eucalyptus grandis]
 gb|KCW66595.1| hypothetical protein EUGRSUZ_F00389 [Eucalyptus grandis]
Length=360

 Score =   350 bits (897),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 195/334 (58%), Positives = 244/334 (73%), Gaps = 2/334 (1%)
 Frame = -1

Query  1273  EVSEG-KGNMRRRLFLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINF  1097
             E +E  +G   + + L +N  M+ +G CGG L++RLYF+ GG R+W S+ L T GWPI F
Sbjct  3     ETAEAPQGKTLKLVLLAINCAMLALGTCGGPLIMRLYFLHGGKRVWLSSWLETGGWPIIF  62

Query  1096  IPLaaayytrrrhttttaasiftiTRNTFlaaaalgvllGIINYLYTYGVSKLPVSTSAL  917
             IPLA AY+ RR     +A  I       F AAA +GVL G+ +YLY YGV++LPVSTSAL
Sbjct  63    IPLAVAYFRRRAAEGPSARLILMD-PFLFAAAAVIGVLTGLDDYLYAYGVARLPVSTSAL  121

Query  916   IAASQLAFTAGGAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAF  737
             + A+QLAFTAG AFLLV+Q FT++SVN+V LLT GAGVLA+ ++ DRPAGESK EY A F
Sbjct  122   LIATQLAFTAGFAFLLVRQLFTSYSVNSVFLLTMGAGVLAMHTSSDRPAGESKGEYYAGF  181

Query  736   LMTLASAALYGALLPCIELTYIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQA  557
              MTL +AALYG +LP +ELTY K +Q++TY+LVLEFQ+VM  FATAF TVGMLVNKDFQA
Sbjct  182   FMTLGAAALYGFVLPLVELTYKKAKQTVTYSLVLEFQLVMCFFATAFNTVGMLVNKDFQA  241

Query  556   ISREARGFEIGEANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLTEVFA  377
             I  EAR F +GE  YYVV+V + +IWQ  F+GA G I Y SSL SGI++A  + +TE+  
Sbjct  242   IPEEARNFTLGETRYYVVLVWSGIIWQFFFLGAIGVIHYASSLFSGIMIAVLLPITEILG  301

Query  376   VVFYGEKFGSEKGISLTLSLWGIVSYFYGEMKNG  275
             V+ + EKF  EK +SL LSLWG VSYFYGE K G
Sbjct  302   VICFHEKFQVEKAVSLVLSLWGFVSYFYGEFKRG  335



>ref|XP_010060067.1| PREDICTED: purine permease 1-like [Eucalyptus grandis]
Length=360

 Score =   349 bits (895),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 196/352 (56%), Positives = 250/352 (71%), Gaps = 4/352 (1%)
 Frame = -1

Query  1270  VSEGKGNMRRRLFLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIP  1091
             V++ +    +RLFL+LN IM+ +G CG  L++RLYF+RGG R+W  + L    WP+  +P
Sbjct  5     VADPRRKGLKRLFLVLNCIMLSVGTCGSPLIMRLYFVRGGARMWLVSWLEMGAWPMLLVP  64

Query  1090  LaaayytrrrhttttaasiftiTRNTFlaaaalgvllGIINYLYTYGVSKLPVSTSALIA  911
             L AAY  RR     TA  +    R  F AAA +GVLLG+ NY Y YGV +LPVSTSAL+ 
Sbjct  65    LGAAYSRRRSAEGPTARLVLMD-RFLFAAAAGIGVLLGLDNYFYAYGVGRLPVSTSALLI  123

Query  910   ASQLAFTAGGAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAFLM  731
             A+QLAFTAG AFLLV+QRFT+ S+N++ LLT GAGVL++ ++ DRPAGESK  Y   F M
Sbjct  124   ATQLAFTAGFAFLLVRQRFTSCSINSIFLLTIGAGVLSMHTSSDRPAGESKGAYFTGFFM  183

Query  730   TLASAALYGALLPCIELTYIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQAIS  551
             TL +AALYG +LP +EL Y K +Q++TY+LVLE Q+VM  FATAFCTV MLVNKDFQAI 
Sbjct  184   TLGAAALYGLVLPLVELMYKKAKQAVTYSLVLEIQLVMCFFATAFCTVAMLVNKDFQAIP  243

Query  550   REARGFEIGEANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLTEVFAVV  371
             REAR +E+GEA YYVV+V TA+I Q  F+GA G I Y SSL S +I+A  +  TE+ AV+
Sbjct  244   REARNYELGEARYYVVLVWTAIINQFFFLGAIGVIFYASSLFSAVIIATLLPFTEILAVI  303

Query  370   FYGEKFGSEKGISLTLSLWGIVSYFYGEMKNGDNNKKEELQIQVTNMEPNET  215
              + EKF +EKG++L LSLWG  SYFYGE K     KKE+     T ++P ET
Sbjct  304   CFQEKFQAEKGVALALSLWGFASYFYGEFKLA---KKEKEATAGTVIKPAET  352



>ref|XP_009765499.1| PREDICTED: purine permease 1-like [Nicotiana sylvestris]
Length=352

 Score =   348 bits (893),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 181/347 (52%), Positives = 248/347 (71%), Gaps = 1/347 (0%)
 Frame = -1

Query  1267  SEGKGNMRRRLFLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIPL  1088
               G     R++ LL+N +++ +G CGG L++RLY++ GG+R+WFS+ L TAGWP   IPL
Sbjct  3     HHGLNTTMRKILLLINCLVLAVGICGGPLMMRLYYVEGGSRVWFSSWLQTAGWPFTLIPL  62

Query  1087  aaayytrrrhttttaasiftiTRNTFlaaaalgvllGIINYLYTYGVSKLPVSTSALIAA  908
             A  Y+ RR+  +++A   F   R  F+A+  +G++ G+ ++LY++G SKLPVSTS+L+ A
Sbjct  63    AILYFYRRKTESSSAKLYFITPR-IFIASFIIGIVTGVDDFLYSWGGSKLPVSTSSLLLA  121

Query  907   SQLAFTAGGAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAFLMT  728
             +QLAFTA GAF +VK +FT +S+NAVVLLT GA +L V SNGDRP G + K Y+  F+MT
Sbjct  122   AQLAFTAIGAFFIVKLKFTPYSINAVVLLTVGAVLLGVRSNGDRPEGVTSKAYILGFMMT  181

Query  727   LASAALYGALLPCIELTYIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQAISR  548
             L +AALYG +LPCIEL Y+K +Q++T TLVLE QMVM   AT FCTVGM+ N DFQAISR
Sbjct  182   LLAAALYGVILPCIELIYLKAKQAITATLVLEIQMVMCFAATVFCTVGMIANNDFQAISR  241

Query  547   EARGFEIGEANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLTEVFAVVF  368
             EA+ F +GEA YY V++ T +IWQ  F+G  G I   SSL+SG+++A  + +TEV AVVF
Sbjct  242   EAKQFNLGEARYYTVIIWTTIIWQCFFVGVIGVIYCSSSLMSGVMIAVLLPVTEVLAVVF  301

Query  367   YGEKFGSEKGISLTLSLWGIVSYFYGEMKNGDNNKKEELQIQVTNME  227
             + E F  EKG++L LSLWG VSYFYGE +     K +  + ++T M 
Sbjct  302   FRENFSGEKGLALFLSLWGFVSYFYGEFRQTKKQKNKSPKTEMTMMH  348



>ref|XP_008444875.1| PREDICTED: purine permease 3-like [Cucumis melo]
Length=365

 Score =   348 bits (893),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 181/350 (52%), Positives = 242/350 (69%), Gaps = 12/350 (3%)
 Frame = -1

Query  1243  RRLFLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIPLaaayytrr  1064
             +R  L+ N  ++ +G CGG L++RLYF+ GGNR+W S+ L T GWPI FIPL  +Y  RR
Sbjct  16    KRTLLIFNCFLLAVGNCGGPLVMRLYFVHGGNRVWLSSFLETGGWPIIFIPLLISYIRRR  75

Query  1063  rhttttaasiftiTRNTFlaaaalgvllGI------INYLYTYGVSKLPVSTSALIAASQ  902
             R      +     ++  F+          I       +YLY YGV++LPVSTSALI A Q
Sbjct  76    RLAALDPSGSADSSQIIFMKPRLFLASAVIGILTGFDDYLYAYGVARLPVSTSALIIACQ  135

Query  901   LAFTAGGAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAFLMTLA  722
             LAFTAG AFLLVKQ+FT++S+NAVVLLT G  VLA+ ++GDRPAGES K+Y+A FLMT+A
Sbjct  136   LAFTAGFAFLLVKQKFTSYSINAVVLLTIGGAVLALHTSGDRPAGESNKDYIAGFLMTVA  195

Query  721   SAALYGALLPCIELTYIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQAISREA  542
             +A +YG +LP +ELTY K RQ +TYTLVLE+Q++MSLFAT  C +GML+N DFQ I REA
Sbjct  196   AAVVYGFILPLVELTYKKARQQITYTLVLEYQLIMSLFATIVCVIGMLINNDFQVIPREA  255

Query  541   RGFEIGEANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLTEVFAVVFYG  362
               F +G+  YY+V+V++A++WQ  F+GA G I   SSL SGI++A  + +TE+ AV+ + 
Sbjct  256   ETFGLGKFRYYLVLVLSAILWQGFFLGAIGVIFSSSSLFSGIVIAVLLPVTEILAVIIFN  315

Query  361   EKFGSEKGISLTLSLWGIVSYFYGEMKNGD------NNKKEELQIQVTNM  230
             EKF +EK +SL L+LWG VSYFYGE+KN           +E    Q+TN+
Sbjct  316   EKFQAEKAVSLALNLWGFVSYFYGEIKNNKKKKLELQRYEETASTQITNV  365



>ref|XP_008338896.1| PREDICTED: purine permease 3-like [Malus domestica]
Length=378

 Score =   348 bits (894),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 184/337 (55%), Positives = 249/337 (74%), Gaps = 1/337 (0%)
 Frame = -1

Query  1288  LKLKMEVSEGKGNMRRRLFLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGW  1109
             ++++ +  E +    + + L+++  ++ IG CGG L++RLYFI GG R+W S+ L T GW
Sbjct  1     MQMETDHVEKRNAAMKNVLLIISCALLSIGTCGGPLVMRLYFIHGGKRVWLSSWLETGGW  60

Query  1108  PINFIPLaaayytrrrhttttaasiftiTRNTFlaaaalgvllGIINYLYTYGVSKLPVS  929
             PI FIP+A AY  RR+    +    F      F A+A +GVL G+ +YLY YGV++LP+S
Sbjct  61    PIIFIPIAMAYCYRRKTEGPSTKLFFMKL-PLFTASAVIGVLTGLDDYLYAYGVARLPIS  119

Query  928   TSALIAASQLAFTAGGAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEY  749
             TSALI AS LAFTA  AF+LVKQ+FT+FS+NA+VLLT GA VL + ++ DRP GES KEY
Sbjct  120   TSALILASHLAFTALFAFILVKQKFTSFSINAIVLLTIGAVVLGLNTSSDRPEGESNKEY  179

Query  748   VAAFLMTLASAALYGALLPCIELTYIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNK  569
             +A F MT+A+AALYG +LP IELTY K +Q++TY LVLE Q+VM LFAT FCTVGML++ 
Sbjct  180   IAGFFMTVAAAALYGFVLPLIELTYKKAKQTITYALVLEVQLVMCLFATLFCTVGMLIDN  239

Query  568   DFQAISREARGFEIGEANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLT  389
             DF+ I +EAR F++GE  YYVV+V +A++WQ  F+GA G I   SSLLSGI++A+ I +T
Sbjct  240   DFKVIPKEARKFDLGETRYYVVLVFSAILWQGFFLGAIGIIFCASSLLSGIVIASLIPVT  299

Query  388   EVFAVVFYGEKFGSEKGISLTLSLWGIVSYFYGEMKN  278
             ++ AV+FY EKF +EKG+SL LSLWG + YFYGE K+
Sbjct  300   QILAVIFYHEKFQAEKGVSLALSLWGFIFYFYGERKH  336



>ref|XP_009373619.1| PREDICTED: purine permease 3-like [Pyrus x bretschneideri]
Length=380

 Score =   348 bits (893),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 181/334 (54%), Positives = 246/334 (74%), Gaps = 1/334 (0%)
 Frame = -1

Query  1288  LKLKMEVSEGKGNMRRRLFLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGW  1109
             ++++ +  E +    + + L+++  ++ +G CGG L++RLYFI GG R+W S+ L T GW
Sbjct  1     MQMETDHVEKRNAAMKNVLLIISCALLSVGTCGGPLVMRLYFIHGGKRVWLSSWLETGGW  60

Query  1108  PINFIPLaaayytrrrhttttaasiftiTRNTFlaaaalgvllGIINYLYTYGVSKLPVS  929
             PI FIP+A AY  RR+    +           F A+A +G+L G+ +YLY YGV++LP+S
Sbjct  61    PIIFIPIAMAYCYRRKTEGPSTKLFLMKL-PLFTASAVIGILTGLDDYLYAYGVARLPIS  119

Query  928   TSALIAASQLAFTAGGAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEY  749
             TSALI AS LAFTA  AF+LVKQ+FT FS+NA+VLLT GA VL + ++ DRP GES KEY
Sbjct  120   TSALILASHLAFTALFAFILVKQKFTLFSINAIVLLTIGAVVLGLNTSSDRPEGESNKEY  179

Query  748   VAAFLMTLASAALYGALLPCIELTYIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNK  569
             +A F MT+A+AALYG +LP IELTY K +Q++TY LVLE Q+VM LFAT FCTVGM+++ 
Sbjct  180   IAGFFMTVAAAALYGFVLPLIELTYKKAKQTITYALVLEVQLVMCLFATLFCTVGMIIDN  239

Query  568   DFQAISREARGFEIGEANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLT  389
             DF+ I REAR F++GE  YYVV+V +A++WQ  F+GA G I   SSLLSGI++A+ I +T
Sbjct  240   DFKVIPREARKFDLGETRYYVVLVFSAILWQGFFLGAIGIIFCASSLLSGIVIASLIPVT  299

Query  388   EVFAVVFYGEKFGSEKGISLTLSLWGIVSYFYGE  287
             ++ AV+FY EKF +EKG+SL LSLWG +SYFYGE
Sbjct  300   QILAVIFYHEKFQAEKGVSLALSLWGFISYFYGE  333



>ref|XP_009373503.1| PREDICTED: purine permease 3-like [Pyrus x bretschneideri]
Length=378

 Score =   347 bits (891),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 184/332 (55%), Positives = 243/332 (73%), Gaps = 1/332 (0%)
 Frame = -1

Query  1264  EGKGNMRRRLFLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIPLa  1085
             E +  + ++L L+++  ++ IG CGG L++RLYFI GG  +W S+ L T GWPI FIP+A
Sbjct  7     EKRNAVMKKLLLVISCTLLSIGTCGGPLVMRLYFIHGGKHIWLSSWLQTGGWPIIFIPIA  66

Query  1084  aayytrrrhttttaasiftiTRNTFlaaaalgvllGIINYLYTYGVSKLPVSTSALIAAS  905
               YY RR+    +    F      F+A+A +GVL G+ +YLY YGV++LPVSTSALI A 
Sbjct  67    IGYYHRRKTEGPSTKLFFMKL-PLFMASAVIGVLTGLDDYLYAYGVARLPVSTSALIIAG  125

Query  904   QLAFTAGGAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAFLMTL  725
             QLAFTA  AF+LVKQ+FT+FS+NAVVLLT G+ VL +  + DRP GES KEY+A F M +
Sbjct  126   QLAFTALFAFILVKQKFTSFSMNAVVLLTMGSAVLGLTISSDRPEGESNKEYIAGFFMMV  185

Query  724   ASAALYGALLPCIELTYIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQAISRE  545
             A+A+LYG +LP IELTY + +Q++TY LVLE Q VM LFAT FCTVGML+N DF+ I RE
Sbjct  186   AAASLYGFVLPLIELTYKRAKQTVTYALVLEIQSVMCLFATLFCTVGMLINNDFKVIPRE  245

Query  544   ARGFEIGEANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLTEVFAVVFY  365
             AR F++GE  YY+V+V++A +WQ  F+GA G I   SSLLSGI++A  + +TE+ AV+FY
Sbjct  246   ARKFDLGETRYYLVLVLSATVWQAFFLGAIGIIFCASSLLSGIVIAVLLPITEILAVIFY  305

Query  364   GEKFGSEKGISLTLSLWGIVSYFYGEMKNGDN  269
              EKF  EKG+SL LS+WG VSYFYGE+K+   
Sbjct  306   HEKFQPEKGVSLALSVWGFVSYFYGEIKHNKQ  337



>emb|CDP08377.1| unnamed protein product [Coffea canephora]
Length=356

 Score =   346 bits (888),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 186/346 (54%), Positives = 245/346 (71%), Gaps = 9/346 (3%)
 Frame = -1

Query  1243  RRLFLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIPLaaayytrr  1064
             R++ L+L+  M+ IG CGG +++RLYF++GG R+W S+ L T GWPI FIPL  +Y+ RR
Sbjct  10    RKILLVLSCFMLAIGNCGGPIIMRLYFVKGGKRIWLSSWLETGGWPITFIPLTISYFHRR  69

Query  1063  rhttttaasiftiTRNTFlaaaalgvllGIINYLYTYGVSKLPVSTSALIAASQLAFTAG  884
             +        I       F+A A +G+L G+ +YLY YG ++LPVST+ +I A+ L FTA 
Sbjct  70    KTEGPNTKLIQMKC-PVFIATAVIGLLTGLDDYLYAYGFARLPVSTATIIVATHLGFTAF  128

Query  883   GAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAFLMTLASAALYG  704
              AFLLVKQ+FTA+SVNA+VLL+ G+GVLA+ ++ DRP GES K YV  F+MTLA+AALYG
Sbjct  129   FAFLLVKQKFTAYSVNAIVLLSVGSGVLAMHTSSDRPKGESTKLYVLGFIMTLAAAALYG  188

Query  703   ALLPCIELTYIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQAISREARGFEIG  524
              +LP +EL YIK +Q++TYTL+LE  +VM  FAT FCTVGMLVN+DFQA+ REA+ +E+G
Sbjct  189   LVLPMVELMYIKAKQAITYTLLLEINLVMCFFATVFCTVGMLVNRDFQAMPREAKAYELG  248

Query  523   EANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLTEVFAVVFYGEKFGSE  344
             EA YYVVV   A+IWQ  F+G  G I   SSLLS II+A+ + +T   AVV + EKF  E
Sbjct  249   EAKYYVVVTWNAIIWQFFFLGVIGVIFCASSLLSAIIIASLLPVTGAIAVVAFDEKFPPE  308

Query  343   KGISLTLSLWGIVSYFYGEMKNGDNNKKEEL------QIQVTNMEP  224
             KG++L LSLWG VSYFYG +K+     KEE+      Q Q T M P
Sbjct  309   KGVALFLSLWGFVSYFYGAIKH--KRLKEEIEDHKINQSQATEMSP  352



>gb|KCW66598.1| hypothetical protein EUGRSUZ_F00392 [Eucalyptus grandis]
Length=480

 Score =   349 bits (896),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 196/352 (56%), Positives = 250/352 (71%), Gaps = 4/352 (1%)
 Frame = -1

Query  1270  VSEGKGNMRRRLFLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIP  1091
             V++ +    +RLFL+LN IM+ +G CG  L++RLYF+RGG R+W  + L    WP+  +P
Sbjct  125   VADPRRKGLKRLFLVLNCIMLSVGTCGSPLIMRLYFVRGGARMWLVSWLEMGAWPMLLVP  184

Query  1090  LaaayytrrrhttttaasiftiTRNTFlaaaalgvllGIINYLYTYGVSKLPVSTSALIA  911
             L AAY  RR     TA  +    R  F AAA +GVLLG+ NY Y YGV +LPVSTSAL+ 
Sbjct  185   LGAAYSRRRSAEGPTARLVLMD-RFLFAAAAGIGVLLGLDNYFYAYGVGRLPVSTSALLI  243

Query  910   ASQLAFTAGGAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAFLM  731
             A+QLAFTAG AFLLV+QRFT+ S+N++ LLT GAGVL++ ++ DRPAGESK  Y   F M
Sbjct  244   ATQLAFTAGFAFLLVRQRFTSCSINSIFLLTIGAGVLSMHTSSDRPAGESKGAYFTGFFM  303

Query  730   TLASAALYGALLPCIELTYIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQAIS  551
             TL +AALYG +LP +EL Y K +Q++TY+LVLE Q+VM  FATAFCTV MLVNKDFQAI 
Sbjct  304   TLGAAALYGLVLPLVELMYKKAKQAVTYSLVLEIQLVMCFFATAFCTVAMLVNKDFQAIP  363

Query  550   REARGFEIGEANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLTEVFAVV  371
             REAR +E+GEA YYVV+V TA+I Q  F+GA G I Y SSL S +I+A  +  TE+ AV+
Sbjct  364   REARNYELGEARYYVVLVWTAIINQFFFLGAIGVIFYASSLFSAVIIATLLPFTEILAVI  423

Query  370   FYGEKFGSEKGISLTLSLWGIVSYFYGEMKNGDNNKKEELQIQVTNMEPNET  215
              + EKF +EKG++L LSLWG  SYFYGE K     KKE+     T ++P ET
Sbjct  424   CFQEKFQAEKGVALALSLWGFASYFYGEFKLA---KKEKEATAGTVIKPAET  472



>emb|CDP19267.1| unnamed protein product [Coffea canephora]
Length=349

 Score =   345 bits (884),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 176/320 (55%), Positives = 243/320 (76%), Gaps = 1/320 (0%)
 Frame = -1

Query  1240  RLFLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIPLaaayytrrr  1061
             ++ L++N I++ IG CG  LL+RLYF++GG R+W  + + TA WPI FIPL  +Y+ R++
Sbjct  3     KILLVINCIILAIGNCGTPLLIRLYFVKGGQRIWLPSWIQTAAWPIIFIPLLISYFHRQK  62

Query  1060  httttaasiftiTR-NTFlaaaalgvllGIINYLYTYGVSKLPVSTSALIAASQLAFTAG  884
                    S   I +   F+A A +G+L G+ NYLY YG+++LPVST+A+I A+QL F A 
Sbjct  63    TDPRAEDSKLIIMKYPVFIATAVIGLLTGLDNYLYAYGIARLPVSTAAIIIAAQLVFVAF  122

Query  883   GAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAFLMTLASAALYG  704
              AFLLVKQ+FTA+SVNAV+LLT G+GVL + ++ DRP GES K YV  F+MTLA+AALYG
Sbjct  123   FAFLLVKQKFTAYSVNAVILLTVGSGVLGLHTSSDRPKGESNKLYVLGFIMTLAAAALYG  182

Query  703   ALLPCIELTYIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQAISREARGFEIG  524
              +LP +EL Y+K +Q +TY+LVLE Q++M  FAT FCTVGML+NKDFQAI+REAR +E+G
Sbjct  183   LILPMVELMYMKAKQVITYSLVLEIQLIMCFFATVFCTVGMLINKDFQAIAREARAYELG  242

Query  523   EANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLTEVFAVVFYGEKFGSE  344
             E  YYVV+V +A++ Q  F+GA G I   SSL+SGII+A ++ +TE+ AV+F+ EKF +E
Sbjct  243   EMKYYVVLVSSAIVSQCFFLGAIGVIFCASSLVSGIIIAVSLPVTELLAVIFFNEKFQAE  302

Query  343   KGISLTLSLWGIVSYFYGEM  284
             KG++L LSLWG +SYFYG++
Sbjct  303   KGVALFLSLWGFISYFYGDI  322



>ref|XP_009611006.1| PREDICTED: purine permease 1-like [Nicotiana tomentosiformis]
Length=352

 Score =   345 bits (884),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 185/351 (53%), Positives = 254/351 (72%), Gaps = 7/351 (2%)
 Frame = -1

Query  1264  EGKG---NMRRRLFLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFI  1094
             E KG   NMRR + L++N +++ +G CGG L++RLY++ GG+R+W S+ L TAGWP+  I
Sbjct  2     EDKGLSTNMRR-ILLVINCLILAVGICGGPLMMRLYYVEGGSRVWLSSWLQTAGWPLTLI  60

Query  1093  PLaaayytrrrhttttaasiftiTRNTFlaaaalgvllGIINYLYTYGVSKLPVSTSALI  914
             PLA  Y+ RR+   + A   F   R  F+A+  +GV+ G+ ++LY++G SKLPVSTS+L+
Sbjct  61    PLAILYFYRRKVEGSNAKFYFITPR-IFIASFVIGVVTGLDDFLYSWGGSKLPVSTSSLL  119

Query  913   AASQLAFTAGGAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAFL  734
              A+QLAFT+ GAF +VK +FT +S+NAV+LLT GA +L V SNGDRP G + K Y+  F+
Sbjct  120   LAAQLAFTSVGAFFIVKLKFTPYSINAVILLTVGAVLLGVRSNGDRPEGVTSKAYILGFM  179

Query  733   MTLASAALYGALLPCIELTYIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQAI  554
             MTL +AALYG +LPCIEL Y+K +Q +T TLVLE QMVM   ATAFCTVGM+ N DFQA+
Sbjct  180   MTLLAAALYGVILPCIELIYLKAKQVITATLVLEIQMVMCFAATAFCTVGMIANNDFQAM  239

Query  553   SREARGFEIGEANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLTEVFAV  374
             SREA+ F +GEA YY V+V T++IWQ  F+G  G I   SSL+SG+++A  + +TEV AV
Sbjct  240   SREAKQFNLGEARYYTVIVWTSIIWQCFFVGVIGVIYCSSSLMSGVMIAVLLPVTEVLAV  299

Query  373   VFYGEKFGSEKGISLTLSLWGIVSYFYGEMKN--GDNNKKEELQIQVTNME  227
             VF+ E F  EKG++L LSLWG VSYFYGE +      NK  +++++ T+ E
Sbjct  300   VFFRENFSGEKGLALFLSLWGFVSYFYGEFRQTKKQKNKSPQIEMKTTHTE  350



>ref|XP_009603730.1| PREDICTED: purine permease 3-like [Nicotiana tomentosiformis]
Length=352

 Score =   344 bits (882),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 191/349 (55%), Positives = 253/349 (72%), Gaps = 5/349 (1%)
 Frame = -1

Query  1264  EGKG---NMRRRLFLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFI  1094
             E KG   NMRR L LL+N +++ +G CGG L++RLY++ GG+R+W S+ L TAGWP+  I
Sbjct  2     EHKGLSTNMRRIL-LLINCLILAVGICGGPLMMRLYYVEGGSRVWLSSWLQTAGWPLTLI  60

Query  1093  PLaaayytrrrhttttaasiftiTRNTFlaaaalgvllGIINYLYTYGVSKLPVSTSALI  914
             PLA  Y+ RR+   + A   F   R  F+A+  +G++ G+ ++LY++G SKLPVSTS+L+
Sbjct  61    PLAILYFYRRKIEGSNAKFYFITPR-IFIASFIIGLVTGLDDFLYSWGGSKLPVSTSSLL  119

Query  913   AASQLAFTAGGAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAFL  734
              A+QLAFTA GAF +VK +FT +S+NAVVLLT GA +L V SNGDRP G + K Y+  F+
Sbjct  120   LAAQLAFTAVGAFFIVKLKFTPYSINAVVLLTVGAVLLGVRSNGDRPEGVTSKAYILGFM  179

Query  733   MTLASAALYGALLPCIELTYIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQAI  554
             MTL +AALYG +LPCIEL Y+K +Q++T TLVLE QMVM   ATAFCTVGM++N DFQAI
Sbjct  180   MTLLAAALYGVILPCIELIYLKAKQAITATLVLEIQMVMCFAATAFCTVGMIINNDFQAI  239

Query  553   SREARGFEIGEANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLTEVFAV  374
             SREA+ F +GEA YY VV+ TA+IWQ  F+G  G I   SSL+SG+++A  + +TEV AV
Sbjct  240   SREAKQFNLGEARYYTVVIWTAIIWQCFFVGVIGVIYCSSSLMSGVMIAVLLPVTEVLAV  299

Query  373   VFYGEKFGSEKGISLTLSLWGIVSYFYGEMKNGDNNKKEELQIQVTNME  227
             VFY E F  EKG++L LSLWG VSYFYGE +     K +  +I+ T M 
Sbjct  300   VFYRENFSGEKGLALFLSLWGFVSYFYGEFRQTKKQKNKSPEIETTTMH  348



>ref|XP_006366415.1| PREDICTED: purine permease 3-like [Solanum tuberosum]
Length=355

 Score =   343 bits (881),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 179/322 (56%), Positives = 241/322 (75%), Gaps = 2/322 (1%)
 Frame = -1

Query  1252  NMRRRLFLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIPLaaayy  1073
             NMRR L L++N +++ +G CGG L++RLYF+ GG RLWF++ L T GWP+  IPL   Y+
Sbjct  10    NMRRFL-LIINCLLLSVGVCGGPLMMRLYFVEGGLRLWFNSWLQTGGWPLTIIPLVILYF  68

Query  1072  trrrhttttaasiftiTRNTFlaaaalgvllGIINYLYTYGVSKLPVSTSALIAASQLAF  893
              RR+   +     +   R  F+A+  +GV  G+  YLY++G SKLPVSTS+L+ A+QLAF
Sbjct  69    YRRKTKGSDTKFYYITPR-IFIASFIIGVFTGVDAYLYSWGGSKLPVSTSSLLIAAQLAF  127

Query  892   TAGGAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAFLMTLASAA  713
             TA G++ + K +FT++S+NAVVLLT GA +L + SNGDRP G + KEYV  F+MTL +AA
Sbjct  128   TAIGSYFIAKIKFTSYSINAVVLLTLGAVLLGMRSNGDRPEGVTSKEYVIGFIMTLLAAA  187

Query  712   LYGALLPCIELTYIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQAISREARGF  533
             LYG +LPCIEL Y+K +Q++T TLVLE QMVM+  ATAFCT+GM+ NKDFQAISREA+ F
Sbjct  188   LYGLILPCIELIYLKAKQAITATLVLEIQMVMAFAATAFCTIGMIANKDFQAISREAKHF  247

Query  532   EIGEANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLTEVFAVVFYGEKF  353
              +GE  YY+VV+ +A+IWQ  F+GA G I   SSL+SG+++A  + +TEV  V+F+ EKF
Sbjct  248   NLGEGRYYIVVIWSAIIWQCFFVGAVGVIYLSSSLMSGVMIAVLLPITEVLGVIFFDEKF  307

Query  352   GSEKGISLTLSLWGIVSYFYGE  287
              +EKG+SL LSLWG VSYFYGE
Sbjct  308   SAEKGLSLFLSLWGFVSYFYGE  329



>ref|XP_004252714.1| PREDICTED: purine permease 3-like [Solanum lycopersicum]
Length=356

 Score =   343 bits (879),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 184/347 (53%), Positives = 252/347 (73%), Gaps = 6/347 (2%)
 Frame = -1

Query  1252  NMRRRLFLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIPLaaayy  1073
             NM+R L L++N +++ +G CGG L++RLYF+ GG R+WF++ L T GWP+  IPL   Y+
Sbjct  11    NMKRFL-LIINCLLLSVGVCGGPLMMRLYFVEGGLRIWFNSWLQTGGWPLTIIPLVILYF  69

Query  1072  trrrhttttaasiftiTRNTFlaaaalgvllGIINYLYTYGVSKLPVSTSALIAASQLAF  893
              RR+   +     +T  R  F+A+  +G+  G   YLY++G SKLPVSTS+L+ A+QLAF
Sbjct  70    YRRKIEGSDTKLYYTTPR-IFIASFVIGIFTGFDAYLYSWGGSKLPVSTSSLLIAAQLAF  128

Query  892   TAGGAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAFLMTLASAA  713
             TA GA+ +VK +FT++S+NAVVLLT GA +L + SNGDRP G + KEYV  F+MTL +AA
Sbjct  129   TAIGAYFIVKIKFTSYSINAVVLLTLGAVLLGIRSNGDRPEGVTSKEYVIGFIMTLLAAA  188

Query  712   LYGALLPCIELTYIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQAISREARGF  533
             LYG +LPCIEL Y+K +Q++T TLVLE QMVM   +TAFCT+GM+ NKDFQAISRE + F
Sbjct  189   LYGLILPCIELMYLKAKQAITATLVLEIQMVMCFASTAFCTIGMIANKDFQAISRETKKF  248

Query  532   EIGEANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLTEVFAVVFYGEKF  353
              +GEA YY+VV+ +A+IWQ  F+GA G I   SSL+SG+++A  + +TE+  V+F+ EKF
Sbjct  249   NLGEARYYIVVIWSAIIWQCFFVGAVGVIYLSSSLMSGVLIAVLLPITEILGVIFFDEKF  308

Query  352   GSEKGISLTLSLWGIVSYFYGEMKNGDNNKKEELQ----IQVTNMEP  224
              SEKG+SL LSLWG VSYFYGE K     +K+++Q       T +EP
Sbjct  309   SSEKGLSLFLSLWGFVSYFYGEFKQAKKVEKKKIQENEMTTTTQIEP  355



>gb|AES73111.2| purine permease-like protein [Medicago truncatula]
Length=371

 Score =   343 bits (880),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 185/359 (52%), Positives = 251/359 (70%), Gaps = 15/359 (4%)
 Frame = -1

Query  1279  KMEVSEGKGNMRRRLFLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPIN  1100
             + +V++ K N   +  L++N +++ +G  GG L++RLYFI GG R+W S CL TAG+P+ 
Sbjct  6     EQQVAKKKMN---KFLLIVNCLILALGNSGGPLIMRLYFIHGGQRVWLSACLETAGFPLM  62

Query  1099  FIPL-----------aaayytrrrhttttaasiftiTRNTFlaaaalgvllGIINYLYTY  953
              IPL                +      +   +I ++    F AAA +G+L G+ +YLY Y
Sbjct  63    LIPLTISYIQRFRHRHKPLPSNTISIASEKQNIISMKPPIFFAAAFVGILTGLDDYLYAY  122

Query  952   GVSKLPVSTSALIAASQLAFTAGGAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRP  773
             GV++LPVSTS+LI ASQL FTA  AFLLVKQ+FTAF+VNAV LLT GAGVLA+ ++ DRP
Sbjct  123   GVARLPVSTSSLIIASQLGFTAFFAFLLVKQKFTAFTVNAVFLLTVGAGVLAMHTSSDRP  182

Query  772   AGESKKEYVAAFLMTLASAALYGALLPCIELTYIKGRQSLTYTLVLEFQMVMSLFATAFC  593
             AG S K+Y   F  T+A++ALYG +LP +EL Y K +Q +TY+LV+EFQ VM +FAT FC
Sbjct  183   AGVSAKQYAIGFSTTVAASALYGFVLPAVELVYKKIKQPITYSLVMEFQFVMCMFATIFC  242

Query  592   TVGMLVNKDFQAISREARGFEIGEANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGII  413
             T+GM++N DF+ I REAR F +GE+ YYVV+V+ A++WQ  F+GA G +   SSLLSGI+
Sbjct  243   TIGMIINNDFKMIPREARNFGLGESIYYVVLVLNAIMWQAFFLGAIGVVFCASSLLSGIL  302

Query  412   LAATISLTEVFAVVFYGEKFGSEKGISLTLSLWGIVSYFYGEMKNGD-NNKKEELQIQV  239
             +A  + LTEV AVVFY EKF +EKG+SL LSLWG VSYFYGE+K+     KK  L+I++
Sbjct  303   IAVLLPLTEVLAVVFYKEKFQAEKGVSLVLSLWGFVSYFYGEIKHAKAEKKKRSLEIEM  361



>ref|XP_006433898.1| hypothetical protein CICLE_v10001546mg [Citrus clementina]
 gb|ESR47138.1| hypothetical protein CICLE_v10001546mg [Citrus clementina]
Length=371

 Score =   342 bits (878),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 191/343 (56%), Positives = 240/343 (70%), Gaps = 16/343 (5%)
 Frame = -1

Query  1201  GGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIPLaaayytrrrhttttaasiftiT  1022
             G C G L++RLYF+ GG R+WFS+ L  AG P+  IP+  +Y  RRR +TTT     T +
Sbjct  30    GNCAGPLIMRLYFLHGGKRIWFSSWLEAAGCPVILIPITVSYLQRRRSSTTTDHESSTSS  89

Query  1021  RNT--------------FlaaaalgvllGIINYLYTYGVSKLPVSTSALIAASQLAFTAG  884
             + +              F A+A +G+L G+ NYLY YGV++LPVSTS+LI ASQLAFTA 
Sbjct  90    QPSNNDNNKLILMRPPVFFASAIIGILTGLDNYLYAYGVARLPVSTSSLIIASQLAFTAA  149

Query  883   GAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAFLMTLASAALYG  704
              AFLLVKQ+ T++S+NAV LLT GA VL + +NGDRP  ES ++Y+  FLMT+ +A LYG
Sbjct  150   FAFLLVKQKLTSYSLNAVFLLTLGAVVLGLHTNGDRPHNESARQYLVGFLMTVGAAVLYG  209

Query  703   ALLPCIELTYIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQAISREARGFEIG  524
              +LP +ELTY + RQ +TY LVLE QMVM LFAT  CTVGM+VNKDFQAI +EAR + +G
Sbjct  210   FVLPLMELTYKRARQEITYALVLEIQMVMCLFATLVCTVGMVVNKDFQAIGKEARAYTLG  269

Query  523   EANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLTEVFAVVFYGEKFGSE  344
             E  YY VVV +ALIWQ  F+GA G I  GSSLLS II+A  + +TE+ AV+FY EKF +E
Sbjct  270   EGKYYAVVVASALIWQCFFLGAIGVIYCGSSLLSAIIIAVLLPVTEILAVIFYKEKFQAE  329

Query  343   KGISLTLSLWGIVSYFYGEMKNGDNNKKEELQIQVTNME-PNE  218
             KG+SL LSLWG  SYFYGE+KN    KK E Q+  T M  PN 
Sbjct  330   KGVSLALSLWGFASYFYGEIKNNKKMKKRE-QLPETEMPIPNP  371



>ref|XP_009605309.1| PREDICTED: purine permease 1-like [Nicotiana tomentosiformis]
Length=352

 Score =   342 bits (876),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 181/349 (52%), Positives = 244/349 (70%), Gaps = 3/349 (1%)
 Frame = -1

Query  1267  SEGKGNMRRRLFLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIPL  1088
              +G     RR+ LL+N +++ +G CGG L++RLY++ GG+R+W S+ L T GWP+  IPL
Sbjct  3     DKGLSTKMRRILLLVNCLILAVGVCGGPLMMRLYYVGGGSRVWLSSWLQTGGWPLTLIPL  62

Query  1087  aaayytrrrhttttaasiftiTRNTFlaaaalgvllGIINYLYTYGVSKLPVSTSALIAA  908
             A  Y+ RR+     A       +  F+ +  +GV  GI N+LY++G SKLPVSTS+L+ A
Sbjct  63    AILYFYRRKSEGANAKFCLITPQ-IFIVSFVIGVGTGIDNFLYSWGGSKLPVSTSSLLLA  121

Query  907   SQLAFTAGGAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAFLMT  728
             +QL FTA GAF +VK +FT +S+NAV+LLT GA +L + SNGD+P G + K YV  F+MT
Sbjct  122   AQLGFTAVGAFFIVKLKFTPYSINAVILLTVGAVLLGIRSNGDKPEGVTSKAYVLGFIMT  181

Query  727   LASAALYGALLPCIELTYIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQAISR  548
             L +AALYG +LP IEL Y+K +Q++T TLVLE Q+VM   ATAFCT+GM+ NKDFQAISR
Sbjct  182   LLAAALYGVILPSIELIYLKAKQAITVTLVLEIQIVMCFAATAFCTIGMVANKDFQAISR  241

Query  547   EARGFEIGEANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLTEVFAVVF  368
             EA  F + EA YY V+V TA+IWQ  F+GA G I   S+L+SG+I+A  + +TEV A+VF
Sbjct  242   EANQFNLEEARYYTVIVWTAIIWQCFFVGAVGVIYCSSALMSGVIIAVLLPVTEVLAIVF  301

Query  367   YGEKFGSEKGISLTLSLWGIVSYFYGEMKN--GDNNKKEELQIQVTNME  227
             + EKF  EKG+SL LSLWG VSYFYGE K      NK  + ++  T +E
Sbjct  302   FSEKFSGEKGVSLFLSLWGFVSYFYGEFKQMKKQKNKSSDTEMTTTQIE  350



>ref|XP_009763953.1| PREDICTED: purine permease 3-like [Nicotiana sylvestris]
 gb|ADP30799.1| nicotine uptake permease 2 [Nicotiana tabacum]
Length=352

 Score =   340 bits (873),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 184/349 (53%), Positives = 250/349 (72%), Gaps = 3/349 (1%)
 Frame = -1

Query  1267  SEGKGNMRRRLFLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIPL  1088
               G     RR+ LL++ +++ +G CGG L++RLY++ GG+R+W S+ L T GWP+ FIPL
Sbjct  3     HPGLSTTMRRILLLISCLILAVGICGGPLMMRLYYVEGGSRIWLSSWLQTGGWPLTFIPL  62

Query  1087  aaayytrrrhttttaasiftiTRNTFlaaaalgvllGIINYLYTYGVSKLPVSTSALIAA  908
             A  YY RR+   + A       R  F+AA  +G+  G+ ++LY++G SKLPVSTS+L+ A
Sbjct  63    AFLYYYRRKIEGSNAKFYLMTPR-IFIAAFVIGIATGLDDFLYSWGGSKLPVSTSSLLLA  121

Query  907   SQLAFTAGGAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAFLMT  728
             +QLAFTA GAF +VK + + FS+NAVVLLT GA +L + SNGDRP G + KEY+  F+MT
Sbjct  122   AQLAFTAVGAFFIVKLKLSPFSINAVVLLTVGAVLLGIRSNGDRPEGVTSKEYIIGFMMT  181

Query  727   LASAALYGALLPCIELTYIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQAISR  548
             L +AALYG +LPCIEL Y+K +Q++T TLVLE QM+MS  ATAFCTVGM+ NKDFQA+SR
Sbjct  182   LLAAALYGVILPCIELIYMKAKQAITATLVLEIQMIMSFAATAFCTVGMIANKDFQAMSR  241

Query  547   EARGFEIGEANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLTEVFAVVF  368
             EA+ F +GEA YY V+V TA IW+  F+G  G I   SSL+SG+++A  + +TEV AV+F
Sbjct  242   EAKQFNLGEARYYTVIVCTAAIWECFFVGIIGVIYCSSSLMSGVMIAVLLPVTEVLAVIF  301

Query  367   YGEKFGSEKGISLTLSLWGIVSYFYGEMKN--GDNNKKEELQIQVTNME  227
             + EKF  EKG++L LSLWG VSYFYGE +    + NK  E ++  T+ E
Sbjct  302   FKEKFSGEKGLALFLSLWGFVSYFYGEFRQTKKEKNKSPEAEMTTTHTE  350



>ref|XP_003602860.1| Purine permease [Medicago truncatula]
Length=440

 Score =   343 bits (881),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 189/359 (53%), Positives = 252/359 (70%), Gaps = 15/359 (4%)
 Frame = -1

Query  1279  KMEVSEGKGNMRRRLFLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPIN  1100
             + +V++ K N   +  L++N +++ +G  GG L++RLYFI GG R+W S CL TAG+P+ 
Sbjct  6     EQQVAKKKMN---KFLLIVNCLILALGNSGGPLIMRLYFIHGGQRVWLSACLETAGFPLM  62

Query  1099  FIPLaaayytrrrhttttaasiftiTRNT-----------FlaaaalgvllGIINYLYTY  953
              IPL  +Y  R RH      S      +            F AAA +G+L G+ +YLY Y
Sbjct  63    LIPLTISYIQRFRHRHKPLPSNTISIASEKQNIISMKPPIFFAAAFVGILTGLDDYLYAY  122

Query  952   GVSKLPVSTSALIAASQLAFTAGGAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRP  773
             GV++LPVSTS+LI ASQL FTA  AFLLVKQ+FTAF+VNAV LLT GAGVLA+ ++ DRP
Sbjct  123   GVARLPVSTSSLIIASQLGFTAFFAFLLVKQKFTAFTVNAVFLLTVGAGVLAMHTSSDRP  182

Query  772   AGESKKEYVAAFLMTLASAALYGALLPCIELTYIKGRQSLTYTLVLEFQMVMSLFATAFC  593
             AG S K+Y   F  T+A++ALYG +LP +EL Y K +Q +TY+LV+EFQ VM +FAT FC
Sbjct  183   AGVSAKQYAIGFSTTVAASALYGFVLPAVELVYKKIKQPITYSLVMEFQFVMCMFATIFC  242

Query  592   TVGMLVNKDFQAISREARGFEIGEANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGII  413
             T+GM++N DF+ I REAR F +GE+ YYVV+V+ A++WQ  F+GA G +   SSLLSGI+
Sbjct  243   TIGMIINNDFKMIPREARNFGLGESIYYVVLVLNAIMWQAFFLGAIGVVFCASSLLSGIL  302

Query  412   LAATISLTEVFAVVFYGEKFGSEKGISLTLSLWGIVSYFYGEMKNGD-NNKKEELQIQV  239
             +A  + LTEV AVVFY EKF +EKG+SL LSLWG VSYFYGE+K+     KK  L+I++
Sbjct  303   IAVLLPLTEVLAVVFYKEKFQAEKGVSLVLSLWGFVSYFYGEIKHAKAEKKKRSLEIEM  361



>ref|XP_010098679.1| Purine permease 3 [Morus notabilis]
 gb|EXB75582.1| Purine permease 3 [Morus notabilis]
Length=377

 Score =   341 bits (874),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 180/320 (56%), Positives = 234/320 (73%), Gaps = 4/320 (1%)
 Frame = -1

Query  1243  RRLFLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIPLaaayytrr  1064
             ++  L+LN I++ IG CGG L++RLYFI GG R+W S+CL T GWPI  +P   A ++  
Sbjct  28    QKALLVLNIIILGIGNCGGPLIMRLYFINGGKRVWLSSCLQTVGWPIILLP---AAFSFY  84

Query  1063  rhttttaasiftiTRNTFlaaaalgvllGIIN-YLYTYGVSKLPVSTSALIAASQLAFTA  887
             R      A+ F   +   + A A+  +L  +N Y YTYGV++LPVST+ALI ASQLAFTA
Sbjct  85    RRRRQNPAAKFFEIKPFLILAFAVVGILTGLNAYSYTYGVARLPVSTAALITASQLAFTA  144

Query  886   GGAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAFLMTLASAALY  707
               A+LLVKQ+FTA+S+NAV LLT G  VLA+ ++GDRP GES KEY+  FLM++ +A +Y
Sbjct  145   AFAYLLVKQKFTAYSLNAVALLTAGGAVLALHTSGDRPEGESSKEYLMGFLMSVGAALIY  204

Query  706   GALLPCIELTYIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQAISREARGFEI  527
             G +LP +EL Y K +Q LTY+LVLE QMVM  FATAFC VGM++NKDFQA+ REA+ FE+
Sbjct  205   GFILPLMELAYKKAKQELTYSLVLEVQMVMCFFATAFCIVGMIINKDFQAVPREAKKFEL  264

Query  526   GEANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLTEVFAVVFYGEKFGS  347
             GE  YYVV+V +A+IWQ  F+GA G +   SSLLSGI++A  + +TEVF V+FY E F +
Sbjct  265   GETKYYVVLVCSAIIWQGFFLGAVGVVYCASSLLSGIVIAVLLPVTEVFGVIFYKESFPA  324

Query  346   EKGISLTLSLWGIVSYFYGE  287
             EKG+SL LSLWG  SYFYGE
Sbjct  325   EKGLSLVLSLWGFASYFYGE  344



>ref|XP_009776518.1| PREDICTED: purine permease 1-like [Nicotiana sylvestris]
Length=352

 Score =   339 bits (870),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 184/346 (53%), Positives = 247/346 (71%), Gaps = 1/346 (0%)
 Frame = -1

Query  1267  SEGKGNMRRRLFLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIPL  1088
               G     RR+ LL+N +++ +G CGG L++RLY++ GG+R+WFS+ L TAGWP   IPL
Sbjct  3     HHGLSTTTRRILLLINCLILAVGICGGPLMMRLYYVEGGSRVWFSSWLQTAGWPFTLIPL  62

Query  1087  aaayytrrrhttttaasiftiTRNTFlaaaalgvllGIINYLYTYGVSKLPVSTSALIAA  908
             A  Y+ RR+   + A   F   R  F+A+  +GV+ G+ ++LY++G SKLPVSTS+L+ A
Sbjct  63    AILYFYRRKTEDSNAKLYFITPR-IFIASFVIGVVTGVDDFLYSWGGSKLPVSTSSLLLA  121

Query  907   SQLAFTAGGAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAFLMT  728
             +QLAFTA GAF +VK +FT +S+NAVVLLT GA +L V SNGDRP G + K Y+  F+MT
Sbjct  122   AQLAFTAIGAFFIVKLKFTPYSINAVVLLTVGAVLLGVRSNGDRPEGVTSKSYILGFMMT  181

Query  727   LASAALYGALLPCIELTYIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQAISR  548
             L +AALYG +LPCIEL Y+K +Q++T TLVLE QMVM   AT FCT+GM+ N DFQAISR
Sbjct  182   LLAAALYGVILPCIELIYLKAKQAITATLVLEIQMVMCFAATVFCTIGMIANNDFQAISR  241

Query  547   EARGFEIGEANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLTEVFAVVF  368
             EA+ F +GEA YY V+V T +IWQ  F+G  G I   SSL+SG+++A  + +TEV AVVF
Sbjct  242   EAKQFNLGEARYYTVIVWTTIIWQCFFVGVIGVIYCSSSLMSGVMIAVLLPVTEVLAVVF  301

Query  367   YGEKFGSEKGISLTLSLWGIVSYFYGEMKNGDNNKKEELQIQVTNM  230
             + E F  EKG++L LSLWG VSYFYGE +     K +  +I++T M
Sbjct  302   FRENFSGEKGLALFLSLWGFVSYFYGEFRQTKKQKNKSPKIEMTMM  347



>ref|XP_009795252.1| PREDICTED: purine permease 1-like [Nicotiana sylvestris]
Length=352

 Score =   338 bits (868),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 187/349 (54%), Positives = 248/349 (71%), Gaps = 3/349 (1%)
 Frame = -1

Query  1267  SEGKGNMRRRLFLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIPL  1088
              +G     RR+ LL+N +++ IG CGG L++RLY++ GG+R+WFS+ L TAGWP  FIPL
Sbjct  3     HQGLSTTMRRILLLINCLILAIGICGGPLMMRLYYVEGGSRVWFSSWLQTAGWPFTFIPL  62

Query  1087  aaayytrrrhttttaasiftiTRNTFlaaaalgvllGIINYLYTYGVSKLPVSTSALIAA  908
             A  Y+ RR+     A       R  F+A+  +G + G+ ++LY++G SKLPVSTS+L+ A
Sbjct  63    AILYFNRRKTEGINAKYYLITPR-IFIASFIIGFVTGLDDFLYSWGGSKLPVSTSSLLLA  121

Query  907   SQLAFTAGGAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAFLMT  728
             +QLAFTA GAF +VK +FT +S+NAVVLLT GA +L V SNGDRP G + K Y+  F+MT
Sbjct  122   AQLAFTAIGAFFIVKLKFTPYSINAVVLLTLGAVLLGVRSNGDRPEGVTSKAYIIGFMMT  181

Query  727   LASAALYGALLPCIELTYIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQAISR  548
             L +AALYG +LPCIEL Y+K +Q++T TLVLE QMVM   ATAFCTVGM+ N DFQAISR
Sbjct  182   LLAAALYGVILPCIELIYLKAKQAITATLVLEIQMVMCFAATAFCTVGMIANNDFQAISR  241

Query  547   EARGFEIGEANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLTEVFAVVF  368
             EA+ F +GEA YY VVV T +IWQ  F+G  G I   SSL+SG+++A  + +TEV AVVF
Sbjct  242   EAKQFNLGEARYYTVVVWTTIIWQCFFVGVIGVIYCSSSLMSGVMIAVLLPVTEVLAVVF  301

Query  367   YGEKFGSEKGISLTLSLWGIVSYFYGEMKNGD--NNKKEELQIQVTNME  227
             + E F  EKG++L LSLWG VSYFYGE +      NK  + ++  T++E
Sbjct  302   FRENFSGEKGLALFLSLWGFVSYFYGEFRQTKKLKNKSPKTEMATTHIE  350



>gb|EPS65699.1| hypothetical protein M569_09078, partial [Genlisea aurea]
Length=327

 Score =   336 bits (862),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 183/328 (56%), Positives = 237/328 (72%), Gaps = 4/328 (1%)
 Frame = -1

Query  1231  LLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIPLaaayytrrrhtt  1052
             L+LN +++ +GGC G +++RLYFI GG+ +WFS+   T GWP+ F+PL  +Y  R     
Sbjct  1     LVLNCLLLAVGGCAGPMVMRLYFIHGGSLVWFSSWQETGGWPVIFVPLVISYLRRLTAEA  60

Query  1051  ttaasiftiTRNTFlaaaalgvllGIINYLYTYGVSKLPVSTSALIAASQLAFTAGGAFL  872
               A  +  +    FLAAA +GVL G+ NY+Y +G+ KLPVSTS+L+ A+QLAFTA   FL
Sbjct  61    NAAPVLINL--RLFLAAAVIGVLTGVDNYIYAFGLEKLPVSTSSLVIATQLAFTALFGFL  118

Query  871   LVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAFLMTLASAALYGALLP  692
             +VK RFTA+S+NAVVLLT GA VLA+ ++GDRPAGES+  Y   F +TL +AALYG +LP
Sbjct  119   IVKLRFTAYSINAVVLLTVGAAVLAISASGDRPAGESRGAYWLGFFLTLGAAALYGFVLP  178

Query  691   CIELTYIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQAISREARGFEIGEANY  512
              +EL Y K    +TYTLV+E Q+VM  FATAFCTVGM  NK+FQ I RE R +++G A Y
Sbjct  179   LVELAYRKANLEMTYTLVMEVQLVMCFFATAFCTVGMFFNKEFQKIRREEREYKLGSATY  238

Query  511   YVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLTEVFAVVFYGEKFGSEKGIS  332
             YVVVV++ L WQ  F+GA G I Y SSL+SGII+A TI + E+  V+FYGEKFGS+KG+S
Sbjct  239   YVVVVLSCLAWQGFFLGAIGVIHYSSSLVSGIIIAITIPVNELLGVIFYGEKFGSQKGVS  298

Query  331   LTLSLWGIVSYFYGEMKNGD--NNKKEE  254
             L LSLWG +SYFYGE K+    NN  EE
Sbjct  299   LGLSLWGFLSYFYGEYKSRKKANNDGEE  326



>ref|XP_010064227.1| PREDICTED: purine permease 3-like [Eucalyptus grandis]
 gb|KCW66596.1| hypothetical protein EUGRSUZ_F00390 [Eucalyptus grandis]
Length=379

 Score =   338 bits (867),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 193/338 (57%), Positives = 242/338 (72%), Gaps = 7/338 (2%)
 Frame = -1

Query  1276  MEVSEGKGNMRRRLFLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINF  1097
             ME  +GK    + + L LN  M+ +  C G LL+RLYFI GG  +W S+ L T GWPI F
Sbjct  5     MEAPQGK--TLKLILLALNCAMLSLS-CAGPLLMRLYFIHGGASVWLSSWLETGGWPIIF  61

Query  1096  IPLaaayytrrrhttttaasiftiTRNTFlaaaalgvllGIINYLYTYGVSKLPVSTSAL  917
             IPLA AY+ RR     +A  +       F+AAA +GVL G+ +YLY+YGV++LPVSTSAL
Sbjct  62    IPLAVAYFRRRASEGPSARLVLMD-PFLFVAAAVIGVLTGLDDYLYSYGVARLPVSTSAL  120

Query  916   IAASQLAFTAGGAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAF  737
             + A+QLAFTAG AFLLV+Q FT++S+    LLT GAGVLA+ ++ DRPAGESK  Y A F
Sbjct  121   LIATQLAFTAGFAFLLVRQLFTSYSI---FLLTIGAGVLAMHTSSDRPAGESKGAYYAGF  177

Query  736   LMTLASAALYGALLPCIELTYIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQA  557
              MTL +AALYG +LP +ELTY K +Q++TY+LVLE Q+VM  FATAFCT+GMLVNKDFQA
Sbjct  178   FMTLGAAALYGLVLPLVELTYKKAKQAVTYSLVLEIQLVMCFFATAFCTIGMLVNKDFQA  237

Query  556   ISREARGFEIGEANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLTEVFA  377
             I REAR F +GEA YYVV+V  A++WQ  F+GA G I Y SSL SGI++A  I +TE+  
Sbjct  238   IPREARNFGLGEAQYYVVLVSNAIVWQFFFLGAIGVIFYASSLFSGIMIAILIPVTEILG  297

Query  376   VVFYGEKFGSEKGISLTLSLWGIVSYFYGEMKNGDNNK  263
             V+ + EKF +EKG+SL LSLWG  SYFYGE K     K
Sbjct  298   VICFHEKFQAEKGVSLALSLWGFASYFYGEFKRAKEEK  335



>gb|ADP30798.1| nicotine uptake permease 1 [Nicotiana tabacum]
Length=353

 Score =   337 bits (863),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 185/355 (52%), Positives = 250/355 (70%), Gaps = 2/355 (1%)
 Frame = -1

Query  1276  MEVSEGKGNMRRRLFLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINF  1097
             ME      NMRR L LL++ +++ +G CGG L++RLY++ GG+R+W S+ L T GWP+  
Sbjct  1     MEHPGLSTNMRRIL-LLISCLILAVGICGGPLMMRLYYVEGGSRIWLSSWLQTGGWPLTL  59

Query  1096  IPLaaayytrrrhttttaasiftiTRNTFlaaaalgvllGIINYLYTYGVSKLPVSTSAL  917
             IPLA  YY RR+   + A       R  F+A+  +GV  G+ ++LY++G SKLPVSTS+L
Sbjct  60    IPLAILYYYRRKTEGSNAKFYLMTPR-IFIASFVIGVATGLDDFLYSWGGSKLPVSTSSL  118

Query  916   IAASQLAFTAGGAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAF  737
             + A+QLAFTA GAF +VK + + FS+NAVVLLT GA +L + SNGDRP G + KEY+  F
Sbjct  119   LLAAQLAFTAVGAFFIVKLKLSPFSINAVVLLTVGAVLLGIRSNGDRPEGVTSKEYIIGF  178

Query  736   LMTLASAALYGALLPCIELTYIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQA  557
             +MTL +AALYG +LPCIEL Y+K +Q++T TLVLE QM+MS  ATAFCTVGM+ NKDFQA
Sbjct  179   MMTLLAAALYGVILPCIELIYMKAKQAITSTLVLEIQMIMSFAATAFCTVGMIANKDFQA  238

Query  556   ISREARGFEIGEANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLTEVFA  377
             +SREA+ F +GEA YY V+V TA IWQ  F+G  G I   SSL+SG+++A  + +TEV A
Sbjct  239   MSREAKQFNVGEARYYTVIVCTAAIWQCFFVGIIGVIYCSSSLMSGVMIAVLLPVTEVLA  298

Query  376   VVFYGEKFGSEKGISLTLSLWGIVSYFYGEMKNGDNNKKEELQIQVTNMEPNETL  212
             V+F+ E F  EKG++L LSLWG VSYFYGE +     K    + ++T     E++
Sbjct  299   VIFFKENFSGEKGLALFLSLWGFVSYFYGEFRQTKKQKNTSPEAEMTITTHTESV  353



>ref|XP_009621473.1| PREDICTED: purine permease 3-like [Nicotiana tomentosiformis]
Length=353

 Score =   336 bits (862),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 180/352 (51%), Positives = 247/352 (70%), Gaps = 1/352 (0%)
 Frame = -1

Query  1267  SEGKGNMRRRLFLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIPL  1088
              +G     RR+ LL+N +++ +G CGG L++RLY++ GG+R+W S+ L T GWP+  +PL
Sbjct  3     HQGLSAYMRRILLLINCLILAVGICGGPLMMRLYYVEGGSRIWLSSWLQTGGWPLTLVPL  62

Query  1087  aaayytrrrhttttaasiftiTRNTFlaaaalgvllGIINYLYTYGVSKLPVSTSALIAA  908
             A  Y  RR+     A   F   R  F+A+  +G+  G+ ++LY++G SKLPVSTS+L+ A
Sbjct  63    ALLYLYRRKIKGPDAKFYFITPR-IFIASFIIGIATGVDDFLYSWGGSKLPVSTSSLLLA  121

Query  907   SQLAFTAGGAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAFLMT  728
             +QLAFTA GAF +VK +FT +S NAVVLLT GA +L + +NGDRP G + K Y+  F+MT
Sbjct  122   AQLAFTAIGAFFIVKLKFTPYSTNAVVLLTVGAILLGIRANGDRPEGVTSKAYILGFIMT  181

Query  727   LASAALYGALLPCIELTYIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQAISR  548
             L +AALYG +LPCIEL Y+K +Q++T TLVLE QMVM   ATAFCTVGM+ NKDFQA+SR
Sbjct  182   LLAAALYGVILPCIELMYLKAKQAITATLVLEIQMVMCFAATAFCTVGMIANKDFQAMSR  241

Query  547   EARGFEIGEANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLTEVFAVVF  368
             EA+ F +GEA YY V+V TA+IWQ  F+G  G I   SSL+SG+++A  + +TEV AV+F
Sbjct  242   EAKQFNLGEARYYTVIVWTAIIWQCFFVGVIGVIYCSSSLMSGVMIAVLLPVTEVLAVIF  301

Query  367   YGEKFGSEKGISLTLSLWGIVSYFYGEMKNGDNNKKEELQIQVTNMEPNETL  212
             + EKF  EKG++L LSLWG VSYFYGE +     K +  Q ++      E++
Sbjct  302   FNEKFSGEKGLALFLSLWGFVSYFYGEFRQTKKQKNKSSQTEIMATTHTESV  353



>ref|XP_009588639.1| PREDICTED: purine permease 3-like [Nicotiana tomentosiformis]
Length=356

 Score =   336 bits (861),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 186/354 (53%), Positives = 243/354 (69%), Gaps = 18/354 (5%)
 Frame = -1

Query  1264  EGKGNMRRRLFLL-LNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIPL  1088
             E K N + + FLL +N I + IG CGG L+ RLYFI+GG R+W S+ L T+ WPI  IPL
Sbjct  2     EPKVNSKMKKFLLVMNCIFLAIGNCGGPLISRLYFIKGGKRIWLSSWLQTSAWPIILIPL  61

Query  1087  a--------------aayytrrrhttttaasiftiTRNTFlaaaalgvllGIINYLYTYG  950
             A                      +          +T   F+AA  +G+L GI NYL  YG
Sbjct  62    AISYFNRCKSQGKISTTVENNNNNDNNNNTKFILMTPRIFIAAVGMGILSGIDNYLSAYG  121

Query  949   VSKLPVSTSALIAASQLAFTAGGAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPA  770
             V+KLPVSTSAL+ ASQLAFTAG AFLLVKQ+F+A+S+N++ LLT GA VLA+ +  DRP 
Sbjct  122   VAKLPVSTSALLIASQLAFTAGFAFLLVKQKFSAYSINSIYLLTLGAVVLALHAKSDRPK  181

Query  769   GESKKEYVAAFLMTLASAALYGALLPCIELTYIKGRQSLTYTLVLEFQMVMSLFATAFCT  590
             GESKKEY+  F++TL +AALYG +LP  EL Y K +Q++TYTLVLE Q V   FAT  CT
Sbjct  182   GESKKEYILGFVLTLGAAALYGLILPLFELLYKKAKQTITYTLVLEIQAVYCFFATVVCT  241

Query  589   VGMLVNKDFQAISREARGFEIGEANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGIIL  410
             +GM++NKDFQA+SREA+ FE+GE  YY+V+V +A+IWQ  F+GA G +   SSL+S I++
Sbjct  242   IGMIINKDFQAMSREAKAFELGEGRYYIVIVWSAIIWQCFFLGAIGVVYSSSSLVSAILI  301

Query  409   AATISLTEVFAVVFYGEKFGSEKGISLTLSLWGIVSYFYGEMKNGDNNKKEELQ  248
                + +TEV AV+FYGEKF +EKG+SL LS+WG +SYFYG++K    +KK E Q
Sbjct  302   TVLLPVTEVLAVIFYGEKFTAEKGVSLALSMWGFISYFYGDIK---ASKKTENQ  352



>ref|XP_007042880.1| Purine permease 3 [Theobroma cacao]
 gb|EOX98711.1| Purine permease 3 [Theobroma cacao]
Length=419

 Score =   338 bits (867),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 184/376 (49%), Positives = 256/376 (68%), Gaps = 17/376 (5%)
 Frame = -1

Query  1333  SCYIYSRMVESLFYKL------KLKMEVSEGKGNMR----------RRLFLLLNAIMMCI  1202
             +CY   ++ +S F K+       LKM+       M           +R  L+LN  ++ +
Sbjct  41    TCYKRFKLSQSFFCKILWNINTSLKMDTRTSNDQMPYKEEKMSKGLKRSLLVLNCALLAL  100

Query  1201  GGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIPLaaayytrrrhttttaasiftiT  1022
             G  GG L++RLYF++GG  +W S+CL TAGWP   +PL  +Y  RRR         F   
Sbjct  101   GNVGGPLIMRLYFLKGGKGVWTSSCLETAGWPFMVMPLTFSYLYRRRKEGPATELFFIKP  160

Query  1021  RNTFlaaaalgvllGIINYLYTYGVSKLPVSTSALIAASQLAFTAGGAFLLVKQRFTAFS  842
                FL +A +G+L G+ ++LY YGV++LPVSTSALI ++QLAFTA  AFLLVKQ+FT+F+
Sbjct  161   -PLFLVSAVVGLLTGVDDFLYAYGVARLPVSTSALIISTQLAFTAAFAFLLVKQKFTSFT  219

Query  841   VNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAFLMTLASAALYGALLPCIELTYIKGR  662
             +N+V LLT GA VLA+ ++ DRPA ES ++Y   F MTLA++ LYG +LP IELTY K +
Sbjct  220   INSVFLLTVGAVVLALQTSSDRPANESNRQYYLGFFMTLAASMLYGFVLPAIELTYKKAK  279

Query  661   QSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQAISREARGFEIGEANYYVVVVVTALI  482
             Q++TY+LV+E QMVMS  AT FCT+GML +K+F+AI REA  FE+G++ YY+V++++A++
Sbjct  280   QTITYSLVMEMQMVMSFSATVFCTIGMLFHKEFEAIPREASKFELGQSTYYLVILLSAIL  339

Query  481   WQILFIGAAGSICYGSSLLSGIILAATISLTEVFAVVFYGEKFGSEKGISLTLSLWGIVS  302
             WQ  F+GA G I  GSSLLSGII+AA + +TE  AV+F+ EKF  EK IS+ LSLWG +S
Sbjct  340   WQFFFMGAVGVIFSGSSLLSGIIIAALLPVTESLAVLFFHEKFQVEKAISVVLSLWGSLS  399

Query  301   YFYGEMKNGDNNKKEE  254
             YFYGE++    N+  E
Sbjct  400   YFYGELQKNKKNQASE  415



>ref|XP_009598031.1| PREDICTED: purine permease 1-like [Nicotiana tomentosiformis]
Length=353

 Score =   335 bits (860),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 185/355 (52%), Positives = 250/355 (70%), Gaps = 2/355 (1%)
 Frame = -1

Query  1276  MEVSEGKGNMRRRLFLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINF  1097
             ME      NMRR L LL++ +++ +G CGG L++RLY++ GG+R+W S+ L T GWP+  
Sbjct  1     MEHPGLSTNMRRIL-LLISCLILAVGICGGPLMMRLYYVEGGSRIWLSSWLQTGGWPLTL  59

Query  1096  IPLaaayytrrrhttttaasiftiTRNTFlaaaalgvllGIINYLYTYGVSKLPVSTSAL  917
             IPLA  YY RR+   + A       R  F+A+  +GV  G+ ++LY++G SKLPVSTS+L
Sbjct  60    IPLAILYYYRRKTEGSNAKFYLMTPR-IFIASFIIGVATGLDDFLYSWGGSKLPVSTSSL  118

Query  916   IAASQLAFTAGGAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAF  737
             + A+QLAFTA GAF +VK + + FS+NAVVLLT GA +L + SNGDRP G + KEY+  F
Sbjct  119   LLAAQLAFTAVGAFFIVKLKLSPFSINAVVLLTVGAVLLGIRSNGDRPEGVTSKEYIIGF  178

Query  736   LMTLASAALYGALLPCIELTYIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQA  557
             +MTL +AALYG +LPCIEL Y+K +Q++T TLVLE QM+MS  ATAFCTVGM+ NKDFQA
Sbjct  179   MMTLLAAALYGVILPCIELIYMKAKQAITSTLVLEIQMIMSFAATAFCTVGMIANKDFQA  238

Query  556   ISREARGFEIGEANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLTEVFA  377
             +SREA+ F +GEA YY V+V TA IWQ  F+G  G I   SSL+SG+++A  + +TEV A
Sbjct  239   MSREAKQFNLGEARYYTVIVCTAAIWQCFFVGIIGVIYCSSSLMSGVMIAVLLPVTEVLA  298

Query  376   VVFYGEKFGSEKGISLTLSLWGIVSYFYGEMKNGDNNKKEELQIQVTNMEPNETL  212
             V+F+ E F  EKG++L LSLWG VSYFYGE +     K    + ++T     E++
Sbjct  299   VIFFKENFSGEKGLALFLSLWGFVSYFYGEFRQTKKQKNTSPEAEMTITTHTESV  353



>ref|XP_009769306.1| PREDICTED: purine permease 1-like [Nicotiana sylvestris]
Length=352

 Score =   335 bits (860),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 182/347 (52%), Positives = 246/347 (71%), Gaps = 1/347 (0%)
 Frame = -1

Query  1267  SEGKGNMRRRLFLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIPL  1088
               G     RR+ LL+N +++ +G CGG L++RLY++ GG+R+WFS+ L TAGWP   IPL
Sbjct  3     HHGLSTTMRRILLLINCLILAVGICGGPLMMRLYYVEGGSRVWFSSWLQTAGWPFTLIPL  62

Query  1087  aaayytrrrhttttaasiftiTRNTFlaaaalgvllGIINYLYTYGVSKLPVSTSALIAA  908
             A  Y+ RR+   + A   F   R  F+A+  +GV+ G+ ++LY++G SKLPVSTS+L+ A
Sbjct  63    AILYFYRRKTEGSNAKLYFITPR-IFIASFVIGVVTGVDDFLYSWGGSKLPVSTSSLLLA  121

Query  907   SQLAFTAGGAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAFLMT  728
             +QLAFTA GAF +VK +FT +S+NAVVLLT GA +L V SNGDRP G + K Y+  F+MT
Sbjct  122   AQLAFTAIGAFFIVKLKFTPYSINAVVLLTVGAVLLGVRSNGDRPEGVTSKAYILGFMMT  181

Query  727   LASAALYGALLPCIELTYIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQAISR  548
             L +AALYG +LPCIEL Y+K +Q++T TLVLE QMVM   AT FCT+GM+ N DFQAIS+
Sbjct  182   LLAAALYGVILPCIELIYLKAKQAITATLVLEIQMVMCFAATVFCTIGMIANNDFQAISK  241

Query  547   EARGFEIGEANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLTEVFAVVF  368
             EA+ F +GEA YY V+V T +IWQ  F+G  G I   SSL+SG+++A  + +TEV AVVF
Sbjct  242   EAKQFNLGEARYYTVIVWTTIIWQCFFVGVIGVIYCSSSLMSGVMIAVLLPVTEVLAVVF  301

Query  367   YGEKFGSEKGISLTLSLWGIVSYFYGEMKNGDNNKKEELQIQVTNME  227
             + E F  EKG++L LSLWG VSYFYGE +     K +  + ++T M 
Sbjct  302   FRENFSGEKGLALFLSLWGFVSYFYGEFRQTKKQKNKSPKTEMTMMH  348



>gb|AES73112.2| purine permease-like protein [Medicago truncatula]
Length=370

 Score =   336 bits (861),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 185/359 (52%), Positives = 250/359 (70%), Gaps = 15/359 (4%)
 Frame = -1

Query  1279  KMEVSEGKGNMRRRLFLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPIN  1100
             K +V+E K    +R  L++N +++ +G C   L++RLYFI GG R+W S  L TAG+P+ 
Sbjct  5     KKQVAEKK---MKRFLLVVNCLILSLGTCSAPLIMRLYFIHGGQRVWLSAFLQTAGFPLM  61

Query  1099  FIPLaaayytrrrhttttaasif-----------tiTRNTFlaaaalgvllGIINYLYTY  953
              IPLA +Y  R R                     ++    F AAA +G+L G+ +YL+ Y
Sbjct  62    LIPLAISYIKRHRLHHHPPPLTTISIAPEKLNIISMKPPIFFAAAFIGILTGLDDYLFAY  121

Query  952   GVSKLPVSTSALIAASQLAFTAGGAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRP  773
             GV++LPVSTSALI ASQL FTA  AFL+VK++FTAF+VNAVVLLT GAGVLA+ ++ DRP
Sbjct  122   GVARLPVSTSALIIASQLGFTAFFAFLIVKEKFTAFTVNAVVLLTVGAGVLAMHTSSDRP  181

Query  772   AGESKKEYVAAFLMTLASAALYGALLPCIELTYIKGRQSLTYTLVLEFQMVMSLFATAFC  593
             AG S K+Y  +F  T+A++ALYG +LP +EL Y K +Q +TY+ V+EFQ V  +FAT FC
Sbjct  182   AGVSAKQYWISFSTTVAASALYGFILPSVELVYKKIKQPVTYSFVMEFQFVTCMFATLFC  241

Query  592   TVGMLVNKDFQAISREARGFEIGEANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGII  413
              +GM+ N DF+ I +EAR F +GE+ YYVV+VV+A++WQ  F+GA G I   SSLLSGI+
Sbjct  242   AIGMIANNDFKVIPKEARNFGLGESTYYVVLVVSAIMWQAFFLGAIGVIFCASSLLSGIL  301

Query  412   LAATISLTEVFAVVFYGEKFGSEKGISLTLSLWGIVSYFYGEMKNGDNNKKE-ELQIQV  239
             +A  + LTEV AVVFY EKF +EKG+SL LSLWG VSYFYGE+K+    KK+  L+I++
Sbjct  302   IAVLLPLTEVLAVVFYKEKFQAEKGVSLVLSLWGFVSYFYGEIKHAKAEKKKCSLEIKM  360



>ref|XP_009783837.1| PREDICTED: purine permease 3-like [Nicotiana sylvestris]
Length=353

 Score =   334 bits (856),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 183/347 (53%), Positives = 244/347 (70%), Gaps = 3/347 (1%)
 Frame = -1

Query  1267  SEGKGNMRRRLFLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIPL  1088
              +G     RR+ LL+N +++ +G CGG L++RLY++ GG+R+W S+ L T GWP+  +PL
Sbjct  3     HQGLSTNMRRILLLINCLILAVGICGGPLMMRLYYVEGGSRIWLSSWLQTGGWPLTIVPL  62

Query  1087  aaayytrrrhttttaasiftiTRNTFlaaaalgvllGIINYLYTYGVSKLPVSTSALIAA  908
             A  Y  RR+     A   F   R  F+A+  +G+  G+ ++LY++G SKLPVSTS+L+ A
Sbjct  63    AILYLYRRKIEGPDAKFYFITPR-IFVASFIIGIATGVDDFLYSWGGSKLPVSTSSLLLA  121

Query  907   SQLAFTAGGAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAFLMT  728
             +QLAFTA GAF +VK + T +S NAVVLLT GA +L + +NGDRP G + K Y+  F+MT
Sbjct  122   AQLAFTAIGAFFIVKLKLTPYSTNAVVLLTVGAVLLGIRANGDRPEGVTSKAYILGFIMT  181

Query  727   LASAALYGALLPCIELTYIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQAISR  548
             L +AALYG +LPCIEL Y+K +QS+T TLVLE QMVM   ATAFCTVGM+ NKDFQA+SR
Sbjct  182   LLAAALYGIILPCIELMYLKAKQSITATLVLEIQMVMCFAATAFCTVGMIANKDFQAMSR  241

Query  547   EARGFEIGEANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLTEVFAVVF  368
             EA+ F +GEA YY V+V TA+IWQ  F+G  G I   SSL+SG+++A  + +TEV AVVF
Sbjct  242   EAKQFNLGEARYYTVIVWTAIIWQCFFVGVIGVIYCSSSLMSGVMIAVLLPVTEVLAVVF  301

Query  367   YGEKFGSEKGISLTLSLWGIVSYFYGEMKN--GDNNKKEELQIQVTN  233
             + EKF  EKG++L LSLWG VSYFYGE +      NK  E +I  T 
Sbjct  302   FNEKFSGEKGLALFLSLWGFVSYFYGEFRQTKKQKNKSSETEIMATT  348



>ref|XP_009762239.1| PREDICTED: purine permease 1-like [Nicotiana sylvestris]
Length=352

 Score =   333 bits (855),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 183/349 (52%), Positives = 248/349 (71%), Gaps = 3/349 (1%)
 Frame = -1

Query  1267  SEGKGNMRRRLFLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIPL  1088
              +G     RR+ LL+N +++ +G CGG L++RLY++ GG+R+WFS+ L T GWP+  IPL
Sbjct  3     DKGLSTKMRRILLLINCLILAVGVCGGPLMMRLYYVGGGSRVWFSSWLQTGGWPLTLIPL  62

Query  1087  aaayytrrrhttttaasiftiTRNTFlaaaalgvllGIINYLYTYGVSKLPVSTSALIAA  908
             A  Y+ RR+     A       +  F+A+  LGV  GI ++LY++G SKLPVSTS+L+ A
Sbjct  63    AILYFYRRKSKGADAKVCLITPQ-IFIASFVLGVGTGIDDFLYSWGGSKLPVSTSSLLLA  121

Query  907   SQLAFTAGGAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAFLMT  728
             +QL FTA GAF +VK +FT +S+NAV+LLT GA +L + SNGD+PAG + K YV  F+MT
Sbjct  122   AQLGFTAVGAFFIVKLKFTPYSINAVILLTVGAVLLGIRSNGDKPAGVTSKAYVLGFIMT  181

Query  727   LASAALYGALLPCIELTYIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQAISR  548
             L +AALYG +LP IEL Y+K +Q++T TLVLE QMVM   AT FCT+GM+ NKDFQAISR
Sbjct  182   LLAAALYGIILPSIELIYLKAKQAITVTLVLEIQMVMCFAATTFCTIGMVANKDFQAISR  241

Query  547   EARGFEIGEANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLTEVFAVVF  368
             EA  F +GEA YY V++ TA++WQ  F+GA G I   S+L+SG+I+A  + +TEV A+VF
Sbjct  242   EAIQFNLGEARYYTVIIWTAILWQCFFVGAVGVIYCSSALMSGVIIAVLLPVTEVLAIVF  301

Query  367   YGEKFGSEKGISLTLSLWGIVSYFYGEMK--NGDNNKKEELQIQVTNME  227
             + EKF  EKG+SL LSLWG VSYFYGE +      NK+ E ++  T +E
Sbjct  302   FSEKFSGEKGVSLFLSLWGFVSYFYGEFRLMKKQKNKRSETEMTPTEIE  350



>ref|XP_009766753.1| PREDICTED: purine permease 3-like [Nicotiana sylvestris]
Length=358

 Score =   333 bits (855),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 180/351 (51%), Positives = 242/351 (69%), Gaps = 8/351 (2%)
 Frame = -1

Query  1243  RRLFLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIPLaaayytrr  1064
             +++ L++N I++ +G CG  LL+RLYFI+GGNR+W ST L T  WPINFIPLA +Y+ RR
Sbjct  10    KKVLLVINCIILAVGTCGTPLLMRLYFIKGGNRIWLSTWLQTVAWPINFIPLAISYFYRR  69

Query  1063  rhttttaasiftiTR------NTFlaaaalgvllGIINYLYTYGVSKLPVSTSALIAASQ  902
             +       +     +        F+A   +GVL G  NY Y YG +KLPVSTS L+ A+Q
Sbjct  70    KININNDINNNNNMKVILMTPRIFVATIGIGVLQGFANYFYAYGTAKLPVSTSGLLFATQ  129

Query  901   LAFTAGGAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAFLMTLA  722
             LAFTAG AFL+VK +FT++SVNAV LLT GA +LA+ S GD+P GE KKEY+  F+MTLA
Sbjct  130   LAFTAGFAFLIVKLKFTSYSVNAVFLLTVGAVLLALHSGGDQPEGEPKKEYILGFIMTLA  189

Query  721   SAALYGALLPCIELTYIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQAISREA  542
             +AAL G + P +EL Y K  Q++TYTLVLEFQ V    AT   T+GM++NKDFQAIS EA
Sbjct  190   AAALSGLIFPLVELIYKKAHQAITYTLVLEFQTVYCFVATIVATIGMIINKDFQAISTEA  249

Query  541   RGFEIGEANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLTEVFAVVFYG  362
             + FE+GE  YY +++ +A+I Q  F+G  G I   SSL+SGI+++  + +TEV AV  YG
Sbjct  250   KAFELGEGRYYNLIIWSAIILQFYFLGTIGVIYSASSLVSGILISVLLPITEVLAVFIYG  309

Query  361   EKFGSEKGISLTLSLWGIVSYFYGEMKNGDNNKKEELQIQVTNMEPNETLP  209
             EKF +EKG+SL LSLWG +SYFYG++K  ++ KKEE   +   ++     P
Sbjct  310   EKFSAEKGVSLALSLWGFLSYFYGDIK--ESKKKEEQSPETEMIDSKACTP  358



>ref|XP_010538168.1| PREDICTED: purine permease 1-like [Tarenaya hassleriana]
Length=359

 Score =   332 bits (851),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 183/358 (51%), Positives = 249/358 (70%), Gaps = 13/358 (4%)
 Frame = -1

Query  1243  RRLFLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIPLaaayytrr  1064
              +  +++N I + IG CGG L++RLYF  GG R+W S+ L TAG+PI FIPL +++  R 
Sbjct  2     EKALVIINCIFLAIGNCGGPLMMRLYFNNGGKRVWLSSFLETAGFPIIFIPLFSSFLKRN  61

Query  1063  rhttttaasiftiTRNT-----------FlaaaalgvllGIINYLYTYGVSKLPVSTSAL  917
             R+ T+   +  + + +            F A+  +G++ G+ NYLY YG++ LPVSTS+L
Sbjct  62    RNRTSCIITSSSSSSDEKTRFFLMRPRLFAASGFIGIITGLDNYLYAYGLAFLPVSTSSL  121

Query  916   IAASQLAFTAGGAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAF  737
             I ASQLAFTA  AFLLVKQ+FT FSVNAVVLLT GAGVLA+ + GD+P+ ES+K+Y+  F
Sbjct  122   IIASQLAFTALFAFLLVKQKFTPFSVNAVVLLTVGAGVLALHTGGDKPSNESQKDYMLGF  181

Query  736   LMTLASAALYGALLPCIELTYIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQA  557
             ++T+A+A LY  +LP IELTY K RQ +++TLVLE QMVM LFA+ FC VGML++ DF+A
Sbjct  182   VLTVAAAVLYAFILPFIELTYKKARQEMSFTLVLEVQMVMCLFASVFCLVGMLISDDFKA  241

Query  556   ISREARGFEIGEANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLTEVFA  377
             I REAR F +GE  YYVV+  TA+IWQ  F+GA G I   SSL+SG++++  + LTEV A
Sbjct  242   IPREARSFGLGERVYYVVIAFTAIIWQGFFLGAIGVIFCASSLVSGVLISVLLPLTEVLA  301

Query  376   VVFYGEKFGSEKGISLTLSLWGIVSYFYGEMKNGDNNK--KEELQIQVTNMEPNETLP  209
             VV + E+F +EKG+SL LSLWG VSYFYGE K+   +K  + E + +     P    P
Sbjct  302   VVCFKERFQAEKGVSLVLSLWGFVSYFYGEAKHSKVHKDGQSEARTETETELPRLPCP  359



>ref|XP_006472532.1| PREDICTED: purine permease 1-like [Citrus sinensis]
 gb|KDO81081.1| hypothetical protein CISIN_1g017456mg [Citrus sinensis]
Length=371

 Score =   332 bits (851),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 192/343 (56%), Positives = 240/343 (70%), Gaps = 16/343 (5%)
 Frame = -1

Query  1201  GGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIPLaaayytrrrhttttaasiftiT  1022
             G C G L++RLYF+ GG R+WFS+ L TAG P+  IP+  +Y  RRR  TTT     T +
Sbjct  30    GNCAGPLIMRLYFLHGGKRIWFSSWLETAGCPVILIPITVSYLQRRRSGTTTDHESSTSS  89

Query  1021  RNT--------------FlaaaalgvllGIINYLYTYGVSKLPVSTSALIAASQLAFTAG  884
             + +              F A+A +G+L G+ NYLY YGV++LPVSTS+LI ASQLAFTA 
Sbjct  90    QPSNNDDNKLILMRPPVFFASAIIGILTGLDNYLYAYGVARLPVSTSSLIIASQLAFTAA  149

Query  883   GAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAFLMTLASAALYG  704
              AFLLVKQ+ T++S+NAV LLT GA VL + +NGDRP  ES ++Y+  FLMT+ +A LYG
Sbjct  150   FAFLLVKQKLTSYSLNAVFLLTLGAVVLGLHTNGDRPDNESARQYLVGFLMTIGAAVLYG  209

Query  703   ALLPCIELTYIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQAISREARGFEIG  524
              +LP +ELTY + RQ +TY LVLE QMVM LFAT  CTVGM+VNKDFQAI +EAR + +G
Sbjct  210   FVLPLMELTYKRARQEITYALVLEIQMVMCLFATLVCTVGMVVNKDFQAIGKEARAYTLG  269

Query  523   EANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLTEVFAVVFYGEKFGSE  344
             E  YY VVV +ALIWQ  F+GA G I  GSSLLS II+A  + +TE+ AV+FY EKF +E
Sbjct  270   EGKYYAVVVASALIWQCFFLGAIGVIYCGSSLLSAIIIAVLLPVTEILAVIFYKEKFQAE  329

Query  343   KGISLTLSLWGIVSYFYGEMKNGDNNKKEELQIQVTNME-PNE  218
             KG+SL LSLWG  SYFYGE+KN    KK E Q+  T M  PN 
Sbjct  330   KGVSLALSLWGFASYFYGEIKNKKKMKKRE-QLPETEMPIPNP  371



>ref|XP_009609429.1| PREDICTED: purine permease 3-like [Nicotiana tomentosiformis]
Length=359

 Score =   331 bits (849),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 181/350 (52%), Positives = 239/350 (68%), Gaps = 10/350 (3%)
 Frame = -1

Query  1243  RRLFLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIPLaaa-----  1079
             +++ L++N I++ +G CG  LLLRLYFI+GGNR+W ST L T  WPINFIPLA +     
Sbjct  10    KKVLLVINCIILAVGTCGTPLLLRLYFIKGGNRIWLSTWLQTVAWPINFIPLAISYFYRR  69

Query  1078  --yytrrrhttttaasiftiTRNTFlaaaalgvllGIINYLYTYGVSKLPVSTSALIAAS  905
                     +       +  +T   F A   +GVL G  NY Y+YG +K+PVSTS L+ A+
Sbjct  70    KININNDINNNNDNIKVILMTPRIFAATIGIGVLQGFANYFYSYGSAKVPVSTSGLLFAT  129

Query  904   QLAFTAGGAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAFLMTL  725
             QLAFTAG AFL+VK +FT++SVNAV LLT GA +LA+ S GD+P GE KKEY+  F+M L
Sbjct  130   QLAFTAGFAFLIVKLKFTSYSVNAVFLLTVGAVLLALHSGGDQPEGEPKKEYILGFIMIL  189

Query  724   ASAALYGALLPCIELTYIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQAISRE  545
             A+AAL G + P +EL Y K  Q++TYTLVLEFQ V    AT   T+GM++NKDFQAIS E
Sbjct  190   AAAALTGLIFPLVELIYKKAHQAITYTLVLEFQTVYCFVATIVATIGMIINKDFQAISTE  249

Query  544   ARGFEIGEANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLTEVFAVVFY  365
             A+ FE+GE  YY +++  A+I Q  F+G  G I   SSL+SGI+++  + +TEV AV FY
Sbjct  250   AKEFELGEGRYYNLIIWGAIILQFYFLGTIGVIYSASSLVSGILISVLLPITEVLAVFFY  309

Query  364   GEKFGSEKGISLTLSLWGIVSYFYGEMKNGDNNKKEELQIQVTNMEPNET  215
             GEKF +EKG+SL LSLWG +SYFYG+MK    +KK+E Q   T M  ++T
Sbjct  310   GEKFSAEKGVSLALSLWGFLSYFYGDMK---KSKKKENQSPETEMIDSKT  356



>ref|XP_006357923.1| PREDICTED: purine permease 3-like [Solanum tuberosum]
Length=341

 Score =   329 bits (844),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 179/342 (52%), Positives = 241/342 (70%), Gaps = 4/342 (1%)
 Frame = -1

Query  1243  RRLFLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIPLaaayytrr  1064
             +++ L++N I++ +G CGG L++RLYFI+GG R+W S+ L TA WPINFIPL  +Y+ RR
Sbjct  2     KKVLLVINCIILAVGTCGGPLVMRLYFIKGGKRIWLSSWLQTAAWPINFIPLVISYFYRR  61

Query  1063  rhttttaasiftiTRNTFlaaaalgvllGIINYLYTYGVSKLPVSTSALIAASQLAFTAG  884
             ++ +TT   + T     F+A   +G+L G  NY Y YG+ KLPVSTS L+ A+QLAFTA 
Sbjct  62    KNNSTTKLILMT--PRIFMATIGIGILQGFTNYFYAYGIGKLPVSTSGLLFATQLAFTAF  119

Query  883   GAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAFLMTLASAALYG  704
              AFL+VK +FT +SVN+V LLT GA VLA+ S GD+P GE +KEY+  F+MTLASAAL G
Sbjct  120   FAFLIVKLKFTPYSVNSVFLLTTGAVVLALRSGGDQPEGEPRKEYILGFVMTLASAALTG  179

Query  703   ALLPCIELTYIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQAISREARGFEIG  524
              + P +EL Y K +Q++TYT VLEFQ +    AT   T+GM++NKDFQAISREA+ FE+G
Sbjct  180   LIFPLVELIYKKTQQTITYTFVLEFQTLYCFVATVLATIGMIINKDFQAISREAKTFELG  239

Query  523   EANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLTEVFAVVFYGEKFGSE  344
             E  YY+V++ +A+I Q  F+G+ G I   SSL+ GI+L+  + LTEV AV  YGEKF +E
Sbjct  240   EDKYYIVIIWSAIILQFYFLGSIGVIYSASSLVCGILLSVLLPLTEVLAVFLYGEKFNAE  299

Query  343   KGISLTLSLWGIVSYFYGEMKNGDNNKKEEL--QIQVTNMEP  224
             KG+SL LSLWG  SYFYG+    +N+ +      I  TN  P
Sbjct  300   KGVSLALSLWGFASYFYGDYNKTENSNQSPAIEMIDKTNCTP  341



>ref|XP_008446590.1| PREDICTED: purine permease 3-like [Cucumis melo]
Length=366

 Score =   330 bits (846),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 176/365 (48%), Positives = 244/365 (67%), Gaps = 17/365 (5%)
 Frame = -1

Query  1276  MEVSEGKGNMRRRLFLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINF  1097
             M+  +      RR  L+ N  ++ +G CGG L++RLYF+ GGNR+W S+ L T G PI F
Sbjct  1     MDQQQQNTTAMRRPLLVFNCFLLAVGTCGGPLIMRLYFLHGGNRVWLSSFLQTGGCPIIF  60

Query  1096  IPLaaayytrrrhttttaasiftiTRNT----------FlaaaalgvllGIINYLYTYGV  947
             IPL  +Y  RRR      +   +   N+          FLA++ +G++ G +++LY YGV
Sbjct  61    IPLLISYIHRRRRPRAQYSLNPSEPTNSTEMIFMKPRLFLASSVIGIITGFVDFLYAYGV  120

Query  946   SKLPVSTSALIAASQLAFTAGGAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAG  767
             ++LPVSTSALI A QLAFTAG AF LVKQ+FT +S+NAVVL+T G  +LA+ ++GDR AG
Sbjct  121   AQLPVSTSALIRACQLAFTAGFAFWLVKQKFTPYSINAVVLVTAGGAILALHTSGDRRAG  180

Query  766   ESKKEYVAAFLMTLASAALYGALLPCIELTYIKGRQSLTYTLVLEFQMVMSLFATAFCTV  587
             E+ ++Y+A FL T+A+A +YG +LP +EL+Y + RQ +TYTLVLE Q  MSLFAT  CT+
Sbjct  181   EANRDYIAGFLTTVAAAVVYGFILPLVELSYKRARQQITYTLVLEVQFFMSLFATLVCTI  240

Query  586   GMLVNKDFQAISREARGFEIGEANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILA  407
              M++N DFQ I  EA  F +G+A YYV++V++A+IWQ  F+G  G I   SS  S I++A
Sbjct  241   AMVINNDFQVIPTEAEAFGLGKAKYYVILVLSAIIWQSFFLGVVGVIFCSSSFFSEIVIA  300

Query  406   ATISLTEVFAVVFYGEKFGSEKGISLTLSLWGIVSYFYGEMKNGDNNKKEELQ-------  248
               + +TE+ AV+ + EKF +EK ISL L+LWG VSYFYGE+K+     K ELQ       
Sbjct  301   VLLPVTEILAVIIFNEKFQAEKTISLILNLWGFVSYFYGEIKHNKKKMKLELQRRAETTT  360

Query  247   IQVTN  233
              Q+TN
Sbjct  361   TQITN  365



>ref|XP_010060066.1| PREDICTED: purine permease 1-like [Eucalyptus grandis]
Length=367

 Score =   330 bits (845),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 181/331 (55%), Positives = 238/331 (72%), Gaps = 1/331 (0%)
 Frame = -1

Query  1273  EVSEGKGNMRRRLFLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFI  1094
             E   G+   ++ L L LN  M+ +G CGG LL+RLY++ GG+ +W S+ L T GWP  F+
Sbjct  22    EAPRGESETQKPLLLALNCAMLSLGTCGGPLLMRLYYLYGGSGVWLSSWLETGGWPAIFL  81

Query  1093  PLaaayytrrrhttttaasiftiTRNTFlaaaalgvllGIINYLYTYGVSKLPVSTSALI  914
              LA AY  RR     +A  +       F A+A +GVL G+ +YLY YGV++LP STSAL+
Sbjct  82    ALAVAYLRRRSAEGPSARLVLMD-PFLFAASAVVGVLTGLDDYLYAYGVARLPASTSALL  140

Query  913   AASQLAFTAGGAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAFL  734
              A+QLAFTAG AFLLV+Q+FT++S+N+V LLT  AGVLA+ ++ DRPAGES +EY A F 
Sbjct  141   IATQLAFTAGFAFLLVRQQFTSYSINSVYLLTVAAGVLALNASSDRPAGESDQEYYAGFF  200

Query  733   MTLASAALYGALLPCIELTYIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQAI  554
             MTL +AALYG +LP +ELTY K +Q++TY+LVLE Q+VM  FATAFCTVGMLVNKDFQAI
Sbjct  201   MTLGAAALYGFVLPLVELTYKKAKQAVTYSLVLEIQLVMCFFATAFCTVGMLVNKDFQAI  260

Query  553   SREARGFEIGEANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLTEVFAV  374
               EA+ +E+GEA YYVV+V  A+ WQ  F+G  G I   SSL SGI++A  + +TE+ A+
Sbjct  261   PTEAKNYELGEALYYVVLVGNAIAWQFFFLGVIGVIFCASSLFSGIMIAVLLPVTEILAI  320

Query  373   VFYGEKFGSEKGISLTLSLWGIVSYFYGEMK  281
             + + E F + KG+SL LSLWG+ SYFYGE K
Sbjct  321   ICFRETFQAAKGVSLALSLWGLASYFYGEFK  351



>gb|EYU21538.1| hypothetical protein MIMGU_mgv1a020196mg [Erythranthe guttata]
Length=353

 Score =   328 bits (841),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 190/340 (56%), Positives = 252/340 (74%), Gaps = 3/340 (1%)
 Frame = -1

Query  1243  RRLFLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIPLaaayytrr  1064
             +  FL++N +++ +G CGG L++RLYFIRGG R+WFS+ L T GWPI  IPL AAY  RR
Sbjct  2     KTTFLIMNGVILAVGNCGGPLIMRLYFIRGGERIWFSSWLETGGWPIILIPLIAAYIRRR  61

Query  1063  rhtttta---asiftiTRNTFlaaaalgvllGIINYLYTYGVSKLPVSTSALIAASQLAF  893
             R TT  A   A +  +    F AA+ +G+L G+ +YLY  GV+KLP+ST+AL+AA+ L F
Sbjct  62    RSTTAAADGAAKLILMKPRLFSAASVIGILTGLDDYLYAKGVAKLPISTAALLAATHLVF  121

Query  892   TAGGAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAFLMTLASAA  713
             TA  AFLLVKQ+FTA+SVNAVVLLT G  VL + ++GDRP GES+KEYV  F+M L++AA
Sbjct  122   TAAFAFLLVKQKFTAYSVNAVVLLTVGTVVLGLHTSGDRPEGESEKEYVVGFIMALSAAA  181

Query  712   LYGALLPCIELTYIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQAISREARGF  533
             LYG +LP +EL Y K +Q+LTYTL++E Q+V+  FAT FCTVGML+N DFQAISREA+ +
Sbjct  182   LYGLILPVVELMYKKAKQALTYTLIMEIQLVICFFATLFCTVGMLINNDFQAISREAKEY  241

Query  532   EIGEANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLTEVFAVVFYGEKF  353
             E+GE  YY+VV+ +A+IWQ+ F+G  G I Y SSLLSGII+  TI +T++  V  Y EKF
Sbjct  242   ELGEMKYYLVVIWSAIIWQLFFLGVVGVIFYSSSLLSGIIITVTIPITQILGVFIYNEKF  301

Query  352   GSEKGISLTLSLWGIVSYFYGEMKNGDNNKKEELQIQVTN  233
              +EKGI+L LSLWG +SYF+GE+    N+ +   QI+ T 
Sbjct  302   QAEKGIALFLSLWGFISYFFGEITKNKNSNENNDQIRTTT  341



>ref|XP_002531513.1| purine transporter, putative [Ricinus communis]
 gb|EEF30867.1| purine transporter, putative [Ricinus communis]
Length=380

 Score =   329 bits (843),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 179/344 (52%), Positives = 239/344 (69%), Gaps = 2/344 (1%)
 Frame = -1

Query  1267  SEGKGNMRRRLFLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIPL  1088
              E   +   +  L++N  M+ IG CGG L+ RLYF++GG  +W S+ L TAGWP    PL
Sbjct  39    EEKMSSTLNKFLLIVNGTMLAIGNCGGPLIQRLYFLKGGKGVWISSFLQTAGWPFIIFPL  98

Query  1087  aaayytrrrhttttaasiftiTRNTFlaaaalgvllGIINYLYTYGVSKLPVSTSALIAA  908
               +Y  RR     +    +   R  F+A A +GVL G+ ++L  YGVS LPVSTSALI A
Sbjct  99    FVSYIHRRSKNAGSTKLYYITPR-LFIACAVIGVLTGLDDFLAAYGVSLLPVSTSALIIA  157

Query  907   SQLAFTAGGAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAFLMT  728
             +QL FTAG A++LVKQ+FT F+VNA+ LL+ GA VL + ++ DRP  E+  +Y++ F MT
Sbjct  158   TQLGFTAGFAYVLVKQKFTPFTVNAIFLLSIGAVVLVLHASSDRPPHETNGQYLSGFFMT  217

Query  727   LASAALYGALLPCIELTYIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQAISR  548
             L ++ALYG +LP IELTY K  Q++TYTLV+E Q+V+S FATAFCT GML++KDF AI R
Sbjct  218   LGASALYGFVLPLIELTYKKANQTITYTLVMEMQLVISFFATAFCTTGMLLHKDFAAIPR  277

Query  547   EARGFEIGEANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLTEVFAVVF  368
             EA  FE+G+A YYVV++V A+ WQ+ F+GA G +  GSSLLSGII+A  + +TE  AV F
Sbjct  278   EASEFELGKAKYYVVLMVNAIFWQLFFMGAVGVVFCGSSLLSGIIIATLLPVTETLAVFF  337

Query  367   YGEKFGSEKGISLTLSLWGIVSYFYGEMKNGDNNKKEELQIQVT  236
             Y EKF  EKGISL LSLWG + YFYGE++  +  KK+  ++ VT
Sbjct  338   YHEKFRVEKGISLVLSLWGFMFYFYGELQR-NKKKKQTSELAVT  380



>ref|XP_010266586.1| PREDICTED: purine permease 3-like [Nelumbo nucifera]
Length=373

 Score =   328 bits (842),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 176/329 (53%), Positives = 233/329 (71%), Gaps = 2/329 (1%)
 Frame = -1

Query  1201  GGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIPLaaayytrrrhttttaasiftiT  1022
             G  GG LL+RLYF RGGNR+W S+ L T GWPI   PL  +Y  RR       A +F + 
Sbjct  44    GESGGPLLMRLYFNRGGNRIWLSSWLETGGWPIFLFPLLFSYLHRRSKLGEQGARLFFMK  103

Query  1021  RNTFlaaaalgvllGIINYLYTYGVSKLPVSTSALIAASQLAFTAGGAFLLVKQRFTAFS  842
                F+A+A+LG+L G+++YLY YG+S+LPVST +LI +SQLAF A  +FLLV+QRFT FS
Sbjct  104   PRLFVASASLGLLTGLVDYLYAYGMSRLPVSTISLINSSQLAFNALFSFLLVRQRFTPFS  163

Query  841   VNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAFLMTLASAALYGALLPCIELTYIKGR  662
             +N+VVLLT GA VL + S+ DRP  E+K +Y   F +++ +A LYG LLP +E TY + +
Sbjct  164   INSVVLLTIGAIVLGLHSSSDRPKDEAKDQYYMGFFVSIGAAVLYGLLLPMVEFTYKRAK  223

Query  661   QSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQAISREARGFEIGEANYYVVVVVTALI  482
             Q++TY LV+E QMVMS+FATAFCTVGMLVNKDF+AI  EAR  E+G   YYVV+V +A+ 
Sbjct  224   QAITYPLVMEIQMVMSIFATAFCTVGMLVNKDFKAIGSEAREHELGVVKYYVVLVCSAIF  283

Query  481   WQILFIGAAGSICYGSSLLSGIILAATISLTEVFAVVFYGEKFGSEKGISLTLSLWGIVS  302
             WQ  ++GA G I Y SSL++GI  A  + + E+ AV+FY EKF  EKGISLTL+LWG  S
Sbjct  284   WQFFYLGAVGVIFYASSLVAGITSATLLPILEILAVIFYKEKFKGEKGISLTLALWGFTS  343

Query  301   YFYGEMKNGDNNKKEELQIQVTNMEPNET  215
             YFYGE+K   NN++++      +  PN +
Sbjct  344   YFYGELKG--NNQQDQKPESEPHQCPNSS  370



>ref|XP_003522775.1| PREDICTED: purine permease 1-like [Glycine max]
Length=357

 Score =   328 bits (840),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 183/337 (54%), Positives = 245/337 (73%), Gaps = 2/337 (1%)
 Frame = -1

Query  1267  SEGKGNMRRRLFLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIPL  1088
             +E K    +RL L+ N +++ IG  GG L++RLYF+ GG+R+W S+ L TAG+P+  +PL
Sbjct  6     NEDKDRTMKRLLLITNCLLLTIGTSGGPLVMRLYFLHGGHRVWLSSFLETAGFPLMLLPL  65

Query  1087  aaayytrrrhttttaasiftiTRNT--FlaaaalgvllGIINYLYTYGVSKLPVSTSALI  914
             A +Y+ RRR      +    I+       A+A +G+L G+ +YLY YGV++LPVSTSALI
Sbjct  66    AVSYFRRRRTAAAGTSKPKLISMKPPLLAASAFIGILTGLDDYLYAYGVARLPVSTSALI  125

Query  913   AASQLAFTAGGAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAFL  734
              A+QL FTA  AFLLV+Q+FTA+SVNAVVLLT GAGVLA+ ++GDRP GES KEYV  F+
Sbjct  126   IATQLGFTAFFAFLLVRQKFTAYSVNAVVLLTVGAGVLALHTSGDRPPGESVKEYVMGFV  185

Query  733   MTLASAALYGALLPCIELTYIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQAI  554
             MT+ +AALYG +LP +EL Y K +Q LTY+LV+E Q VM   AT FC +GM++N DF+ I
Sbjct  186   MTVIAAALYGFILPLVELVYKKIKQPLTYSLVMEIQFVMCFSATLFCLLGMIINNDFKVI  245

Query  553   SREARGFEIGEANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLTEVFAV  374
              REA+ FE GE +YY V+V +A++WQ  F+GA G I   SSL SGI++A  + +TEV AV
Sbjct  246   PREAKKFEHGEGSYYAVLVGSAILWQAFFLGAIGVIFCASSLFSGILIAVLLPVTEVLAV  305

Query  373   VFYGEKFGSEKGISLTLSLWGIVSYFYGEMKNGDNNK  263
             +FY EKF +EKG+SL LSLWG+VSYFYGE+K+    K
Sbjct  306   IFYKEKFQAEKGVSLLLSLWGMVSYFYGEIKHSKKMK  342



>gb|EPS67422.1| hypothetical protein M569_07351, partial [Genlisea aurea]
Length=319

 Score =   325 bits (834),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 178/321 (55%), Positives = 231/321 (72%), Gaps = 3/321 (1%)
 Frame = -1

Query  1243  RRLFLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIPLaaayytrr  1064
             R +FL++NA ++ +G C G L++RLYF RGGNR+WFS+ L +AG+PI  IPL  +Y   R
Sbjct  2     RMIFLIMNAALLTVGSCAGPLIMRLYFTRGGNRIWFSSWLESAGFPIILIPLIYSYCAGR  61

Query  1063  rhttttaasiftiTRNTFlaaaalgvllGIINYLYTYGVSKLPVSTSALIAASQLAFTAG  884
                 +   S+     +    AA +GVL G+ NYLY YGV+KLPVSTS+LI ASQL FTA 
Sbjct  62    GTHPSGIISMNPKLCSA---AAVVGVLAGLDNYLYAYGVAKLPVSTSSLIIASQLGFTAV  118

Query  883   GAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAFLMTLASAALYG  704
              A+L+VKQ+FTAFS+NAVVLLT  AG+LA+ SNGDRP GES  +Y   F++TLA+AALYG
Sbjct  119   FAYLIVKQKFTAFSINAVVLLTVAAGILALHSNGDRPKGESNGDYYTGFVLTLAAAALYG  178

Query  703   ALLPCIELTYIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQAISREARGFEIG  524
              +LP +EL Y K  Q L Y  VL+FQ V+  FAT  CT+GM V+ DF AI  EARGF++G
Sbjct  179   LMLPLVELAYAKTGQDLNYDAVLKFQFVLGFFATLACTIGMAVSGDFPAIPTEARGFQLG  238

Query  523   EANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLTEVFAVVFYGEKFGSE  344
             E  YY VVV +A+IWQ  F+G  G I Y S+LLSG++++  +  TE+ AV+F+ EKF +E
Sbjct  239   EGRYYAVVVSSAIIWQCFFLGNIGVIFYSSALLSGVLISVLLPPTEILAVLFFREKFQAE  298

Query  343   KGISLTLSLWGIVSYFYGEMK  281
             KG+SL LSL+G VSYFYGE K
Sbjct  299   KGVSLFLSLFGFVSYFYGEYK  319



>ref|XP_010322002.1| PREDICTED: LOW QUALITY PROTEIN: purine permease 3-like [Solanum 
lycopersicum]
Length=346

 Score =   327 bits (837),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 171/321 (53%), Positives = 234/321 (73%), Gaps = 0/321 (0%)
 Frame = -1

Query  1243  RRLFLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIPLaaayytrr  1064
             +++ L++N I++ +G CGG L++RLYFI+GG R+W S+ L TA WPINFIPL  +Y+ RR
Sbjct  2     KKVLLVINCIILAVGTCGGPLIMRLYFIKGGKRIWLSSWLQTAAWPINFIPLVISYFYRR  61

Query  1063  rhttttaasiftiTRNTFlaaaalgvllGIINYLYTYGVSKLPVSTSALIAASQLAFTAG  884
             ++    ++ +  +T   F+A   +G+L G  NY Y YGV+KLPVSTS L+ A+QLAFTA 
Sbjct  62    KNNNNNSSKLILMTPRVFMATIGIGILQGFTNYFYAYGVAKLPVSTSGLLFATQLAFTAF  121

Query  883   GAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAFLMTLASAALYG  704
              AFL+VK +FT +SVN+V LLT GA VLA+ S GD+P GE KK+YV  F MTLASAAL G
Sbjct  122   FAFLIVKLKFTPYSVNSVFLLTIGAVVLALRSGGDQPEGEXKKKYVLGFGMTLASAALTG  181

Query  703   ALLPCIELTYIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQAISREARGFEIG  524
              + P +EL Y K +Q++TYT VLEFQ +    AT   T+GM++N+DFQAISRE + FE+G
Sbjct  182   LIFPLVELIYKKAQQTITYTFVLEFQTLYCFVATVLATIGMIINEDFQAISREVKTFELG  241

Query  523   EANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLTEVFAVVFYGEKFGSE  344
             E  YY+V++ +A+I Q  F+G+ G I   SSL+SGI+++  + +TEV AV  YGEKF +E
Sbjct  242   EDKYYIVIIWSAIILQFYFLGSIGVIYSASSLVSGILISVLLPITEVLAVFLYGEKFNAE  301

Query  343   KGISLTLSLWGIVSYFYGEMK  281
             KG+SL LSLWG  SYFYG+ +
Sbjct  302   KGVSLALSLWGFASYFYGDYR  322



>ref|XP_009770717.1| PREDICTED: purine permease 1-like [Nicotiana sylvestris]
Length=350

 Score =   327 bits (837),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 178/345 (52%), Positives = 244/345 (71%), Gaps = 1/345 (0%)
 Frame = -1

Query  1267  SEGKGNMRRRLFLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIPL  1088
              +G     RR+ LL+N +++ +  CGG L++RLY++ GG+R+WFS+ L TAGWPI  IPL
Sbjct  3     HQGLSTTMRRILLLINCLILAVDICGGPLMMRLYYVEGGSRIWFSSWLQTAGWPITLIPL  62

Query  1087  aaayytrrrhttttaasiftiTRNTFlaaaalgvllGIINYLYTYGVSKLPVSTSALIAA  908
                Y+ R++   T A       R  F+A+  +GV+ G+ ++LY++G SKLPVSTS+L+ A
Sbjct  63    VILYFYRQKTEGTNAKYYLITPR-IFIASFIIGVVTGLDDFLYSWGGSKLPVSTSSLLLA  121

Query  907   SQLAFTAGGAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAFLMT  728
             +QLAFTA GAF +VK +FT +S+NAVVLLT GA +L V SNGDRP G + K Y+  F+MT
Sbjct  122   AQLAFTAIGAFFIVKLKFTPYSINAVVLLTLGAVLLGVRSNGDRPEGVTSKAYIIGFMMT  181

Query  727   LASAALYGALLPCIELTYIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQAISR  548
             L +AALYG +LPCIEL Y+K +Q++T TLVLE QMVM   ATAFCTVGM+VN +F+AISR
Sbjct  182   LLAAALYGVILPCIELIYLKAKQAITATLVLEIQMVMCFAATAFCTVGMIVNNNFKAISR  241

Query  547   EARGFEIGEANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLTEVFAVVF  368
             EA+ F +GEA YY V+V T ++W   F+G  G I   SSL+SG+++A  + +TEV AVVF
Sbjct  242   EAKQFNLGEARYYTVIVWTTIVWLCFFVGVIGVIYCSSSLMSGVMIAVLLPVTEVLAVVF  301

Query  367   YGEKFGSEKGISLTLSLWGIVSYFYGEMKNGDNNKKEELQIQVTN  233
             + E F  EKG++L L LWG VS FYGE +     K + L+ ++T 
Sbjct  302   FRENFLVEKGLALFLCLWGFVSCFYGEFRQTKKQKNKSLKSEMTT  346



>ref|XP_007018133.1| Purine permease 3, putative [Theobroma cacao]
 gb|EOY15358.1| Purine permease 3, putative [Theobroma cacao]
Length=410

 Score =   328 bits (842),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 175/319 (55%), Positives = 235/319 (74%), Gaps = 0/319 (0%)
 Frame = -1

Query  1243  RRLFLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIPLaaayytrr  1064
             R+  L++N I++ IG CGG LL+R YFI GG R WFS+ L+T GWPI   P+A AY  RR
Sbjct  2     RKALLVINGIVLAIGKCGGPLLMRAYFIHGGKRFWFSSWLTTGGWPIILFPIACAYMYRR  61

Query  1063  rhttttaasiftiTRNTFlaaaalgvllGIINYLYTYGVSKLPVSTSALIAASQLAFTAG  884
             R   T+   +F +    F+A+A +G+L G+ +YLY+YGV+ LPVST +++ ASQLAFTA 
Sbjct  62    RTEPTSKNKLFLMRPPLFVASAVIGILTGVDDYLYSYGVALLPVSTCSIVIASQLAFTAA  121

Query  883   GAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAFLMTLASAALYG  704
              AF+LVKQ+FT++SVNAV LLT GAGVLA+ ++ DRP  ES ++Y   F+MTLA+AALYG
Sbjct  122   FAFILVKQKFTSYSVNAVFLLTVGAGVLALRASSDRPDTESNRKYALGFIMTLAAAALYG  181

Query  703   ALLPCIELTYIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQAISREARGFEIG  524
              +LP +EL Y K +Q ++Y LV+E +MV  LFAT FCTVGMLVN DF+ I REAR F++G
Sbjct  182   FVLPLVELMYKKTKQEMSYALVMEIEMVNCLFATGFCTVGMLVNNDFKVIPREAREFDLG  241

Query  523   EANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLTEVFAVVFYGEKFGSE  344
             E  YYVV + +A++WQ  F+GA G I   SSL+SGII+A  + + E+ AV+FY E F +E
Sbjct  242   ETKYYVVAIWSAIMWQFFFLGATGVIFCASSLVSGIIIAVVLPVIEILAVIFYKENFQAE  301

Query  343   KGISLTLSLWGIVSYFYGE  287
             KG++L LS+WG +SYFYG 
Sbjct  302   KGVALALSVWGFISYFYGN  320


 Score = 67.0 bits (162),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 46/92 (50%), Positives = 60/92 (65%), Gaps = 0/92 (0%)
 Frame = -1

Query  1201  GGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIPLaaayytrrrhttttaasiftiT  1022
             G CGG  L+R YFI GG R WFS+ L+T GWPI   P+A AY  R R   T+   +F + 
Sbjct  319   GNCGGPFLMRAYFIHGGKRFWFSSWLTTGGWPIILFPIACAYMYRCRTEPTSKNKLFLMK  378

Query  1021  RNTFlaaaalgvllGIINYLYTYGVSKLPVST  926
                F+A+A +G+L G+ +YLY YGV+ LPVST
Sbjct  379   PPLFIASAVIGILTGVDDYLYAYGVALLPVST  410



>ref|XP_004490401.1| PREDICTED: purine permease 1-like [Cicer arietinum]
Length=361

 Score =   325 bits (833),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 174/345 (50%), Positives = 237/345 (69%), Gaps = 13/345 (4%)
 Frame = -1

Query  1258  KGNMRRRLFLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIPLaaa  1079
             + NM++ L L++N+I++ IG CGG L++RLYFI GG R W S+ L T+G+PI  +PL  +
Sbjct  15    RRNMKK-LLLVINSILLAIGTCGGPLVMRLYFIHGGKRAWLSSFLETSGFPIILLPLTIS  73

Query  1078  yytrrrhttttaasiftiTRNTFlaaaalgvllGII-------NYLYTYGVSKLPVSTSA  920
             +   R H     ++     RN       L +   II       +YLY  G+++LPVSTS+
Sbjct  74    HIHHRYHNRNCNSN-----RNFISMKPPLFLFSAIIGILTGLDDYLYACGIARLPVSTSS  128

Query  919   LIAASQLAFTAGGAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAA  740
             LI +S LAFTA  AF+LV+ +FTA+SVN +VLLT G+ VLAV SNG    GES+ EYV  
Sbjct  129   LIQSSHLAFTAVFAFILVRHKFTAYSVNCIVLLTLGSVVLAVRSNGGGGDGESRGEYVIG  188

Query  739   FLMTLASAALYGALLPCIELTYIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQ  560
             F+M L+SAALYG +LP +EL Y K +Q +TY+LV+E Q VM  FAT FC +GM+++KDF+
Sbjct  189   FVMILSSAALYGFVLPLMELVYKKTKQVVTYSLVMEIQFVMCFFATLFCILGMIIDKDFK  248

Query  559   AISREARGFEIGEANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLTEVF  380
              I REAR F +GE  YYVV+V +A++WQ  F+GA G I Y SSLLSGII+AA + +TE+ 
Sbjct  249   VIPREAREFNLGETKYYVVLVCSAIMWQFFFLGAIGVIFYASSLLSGIIIAAFLPVTEIM  308

Query  379   AVVFYGEKFGSEKGISLTLSLWGIVSYFYGEMKNGDNNKKEELQI  245
             AV+ Y E F +EKG++L LSLWG VSYFYGE+K     K +E ++
Sbjct  309   AVIVYKENFHAEKGVALVLSLWGFVSYFYGEIKEARKMKNKETEL  353



>ref|XP_010939717.1| PREDICTED: purine permease 3-like isoform X2 [Elaeis guineensis]
Length=362

 Score =   325 bits (833),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 177/337 (53%), Positives = 241/337 (72%), Gaps = 2/337 (1%)
 Frame = -1

Query  1267  SEGKGNMRRRLFLL-LNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIP  1091
             ++ + +   R FL+ LN  +M IG   G LLLRLYF++GG R W S+ L T GWP+ FIP
Sbjct  14    TKNQISKHLRWFLMALNFTIMVIGTAVGPLLLRLYFLKGGTRKWLSSWLQTGGWPLLFIP  73

Query  1090  LaaayytrrrhttttaasiftiTRNTFlaaaalgvllGIINYLYTYGVSKLPVSTSALIA  911
             LA +Y  R R        ++ +T   FLA   LG+L+G+ ++LY YG+S LPVSTS+++ 
Sbjct  74    LAISYAHRCRCGGGRPIKLYLMTPPLFLACTVLGLLVGLDDFLYAYGLSYLPVSTSSILI  133

Query  910   ASQLAFTAGGAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAFLM  731
             +SQL FTA  AF +VKQ+FT+FSVNAVVLL+ GA +L + ++GDRP GES  +Y   F M
Sbjct  134   SSQLGFTALFAFFMVKQKFTSFSVNAVVLLSIGAVILGLHASGDRPKGESNTQYYLGFFM  193

Query  730   TLASAALYGALLPCIELTYIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQAIS  551
             TLA+A LYG +LP +ELTY K +Q ++YTLV+E Q+ M  FAT FCTVGMLVN DF  I 
Sbjct  194   TLAAAVLYGFILPLVELTYAKAKQVVSYTLVIEMQLAMGFFATVFCTVGMLVNGDFHVIP  253

Query  550   REARGFEIGEANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLTEVFAVV  371
             REAR FE+GEA YYV++V +A++WQ +F+G  G+I YGS+LL+GII+A  + +++V AVV
Sbjct  254   REAREFELGEATYYVLLVWSAILWQFVFLGTVGAIFYGSALLAGIIMAVLVPVSQVLAVV  313

Query  370   FYGEKFGSEKGISLTLSLWGIVSYFYGE-MKNGDNNK  263
             F+ E F +EKG++L L+LWG  SYFYGE +K+   N 
Sbjct  314   FFHEPFSAEKGVALALALWGFASYFYGEFLKSKKKNP  350



>ref|XP_004237961.1| PREDICTED: purine permease 1-like [Solanum lycopersicum]
Length=374

 Score =   325 bits (832),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 178/345 (52%), Positives = 239/345 (69%), Gaps = 1/345 (0%)
 Frame = -1

Query  1309  VESLFYKLKLKMEVSEGKGNMRRRLFLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFST  1130
             +E   Y   +       K  M++ +FL+ N IM+ IG CGG L+ RLYFI GG R+W  +
Sbjct  1     MEISIYTFTINQNKQHQKSKMKKLIFLIFNIIMLSIGNCGGPLISRLYFIHGGQRIWIPS  60

Query  1129  CLSTAGWPINFIPLaaayytrrrhttttaasiftiTRNTFlaaaalgvllGIINYLYTYG  950
              L T G P+  IPLA AY+ RR+     A  +F   R  F+A+A +G+++G+  YL ++G
Sbjct  61    VLQTVGCPVILIPLAIAYFQRRKIQGPEAKIVFIT-RQEFIASAGVGIIVGLDGYLNSWG  119

Query  949   VSKLPVSTSALIAASQLAFTAGGAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPA  770
              +KLPVSTS LI A+QLAFTA  A L+VKQ+ TA+S N+VVLL  GA  LA+ +NGDRPA
Sbjct  120   PAKLPVSTSTLINATQLAFTALFAVLIVKQKLTAYSTNSVVLLIAGAATLALRANGDRPA  179

Query  769   GESKKEYVAAFLMTLASAALYGALLPCIELTYIKGRQSLTYTLVLEFQMVMSLFATAFCT  590
             GES K+Y+  F+MT   A LYG +LP IEL Y+K +Q++TY  VLE QMV+ + AT FCT
Sbjct  180   GESAKDYMLGFVMTFVGAVLYGLMLPLIELIYMKSKQAVTYITVLEIQMVLGISATVFCT  239

Query  589   VGMLVNKDFQAISREARGFEIGEANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGIIL  410
             +GM++NKDFQAI REA  + IGE+ YY+V+V+ A+IWQ   +G  G I Y SSLLSGII 
Sbjct  240   IGMIINKDFQAIPREASQYTIGESKYYMVLVLCAIIWQFALMGLVGVIFYSSSLLSGIIG  299

Query  409   AATISLTEVFAVVFYGEKFGSEKGISLTLSLWGIVSYFYGEMKNG  275
             A  + +TEV AV+ + EKF +EKG+++ L+LWG VSYFYGE + G
Sbjct  300   AFLLPVTEVLAVILFHEKFQAEKGVAIFLALWGFVSYFYGEYEQG  344



>ref|XP_007042882.1| Purine permease 3 isoform 2 [Theobroma cacao]
 gb|EOX98713.1| Purine permease 3 isoform 2 [Theobroma cacao]
Length=338

 Score =   323 bits (827),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 170/330 (52%), Positives = 238/330 (72%), Gaps = 1/330 (0%)
 Frame = -1

Query  1243  RRLFLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIPLaaayytrr  1064
             +R  L+LN  ++  G  GG L+++LYF++GG  +W S+CL TAGWP   +PL  +Y  RR
Sbjct  6     KRSLLVLNCALLAFGNVGGPLIMKLYFLKGGKGVWTSSCLETAGWPFMVMPLTFSYLYRR  65

Query  1063  rhttttaasiftiTRNTFlaaaalgvllGIINYLYTYGVSKLPVSTSALIAASQLAFTAG  884
             R         F      FLA+A +G+L G+ ++LY YGV++LPVST ALI ++QLAFT  
Sbjct  66    RKEGPGTELFFIK-PPLFLASAVIGLLTGVDDFLYAYGVARLPVSTLALIISTQLAFTVA  124

Query  883   GAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAFLMTLASAALYG  704
              AFLLVKQ+FT+F++N+V LL  GA VLA+ ++ D PA ES ++Y + F MTLA++ALYG
Sbjct  125   FAFLLVKQKFTSFTINSVFLLNIGAVVLALHTSSDHPANESNRQYCSGFFMTLAASALYG  184

Query  703   ALLPCIELTYIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQAISREARGFEIG  524
              +LP IELTY K +Q+++Y+LV+E QMVMS  AT FCT+GML +K+ +AI REA  FE+G
Sbjct  185   FVLPAIELTYKKAKQTISYSLVIEMQMVMSFSATVFCTIGMLFHKEVEAIPREASKFELG  244

Query  523   EANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLTEVFAVVFYGEKFGSE  344
             ++ YY+V++++A++WQ  F+GA G I  GSSLLSGII+AA + +TE  AV+F+ EKF  E
Sbjct  245   QSTYYLVILLSAILWQFFFMGAVGVIFSGSSLLSGIIIAALLPVTESLAVLFFHEKFQVE  304

Query  343   KGISLTLSLWGIVSYFYGEMKNGDNNKKEE  254
             K IS+ LSLWG +SYFYGE++    N+  E
Sbjct  305   KAISVVLSLWGSLSYFYGELQKNKKNQASE  334



>ref|XP_010266597.1| PREDICTED: purine permease 3-like [Nelumbo nucifera]
Length=369

 Score =   322 bits (826),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 171/325 (53%), Positives = 232/325 (71%), Gaps = 3/325 (1%)
 Frame = -1

Query  1201  GGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIPLaaayytrrrhtttt---aasif  1031
             G CGG LL+RLYF+ GG R+WFS+ L TAGWPI  +PL  +Y  RR         +  +F
Sbjct  42    GNCGGPLLIRLYFLHGGKRIWFSSWLETAGWPILLLPLLFSYSYRRSQDQGEERGSTRLF  101

Query  1030  tiTRNTFlaaaalgvllGIINYLYTYGVSKLPVSTSALIAASQLAFTAGGAFLLVKQRFT  851
              I    F A+A LG++ G+ +YLY YG+S+LPVSTSALIA++QL FTA  AF LV+Q FT
Sbjct  102   LIKPRLFAASAILGIITGLDDYLYAYGLSRLPVSTSALIASTQLIFTAIFAFFLVRQTFT  161

Query  850   AFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAFLMTLASAALYGALLPCIELTYI  671
             ++S+N++V+LT GA V+A+ +  DRP+ ES  +Y   F MT+ ++ALYG +LP +ELTY 
Sbjct  162   SYSINSIVMLTIGALVMALHTGSDRPSNESNTQYYTGFFMTIGASALYGLVLPLVELTYK  221

Query  670   KGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQAISREARGFEIGEANYYVVVVVT  491
             K  Q +TY+LV+E Q+V+S+FATAFC++GMLVN DF++I ++A  +EIGEA YY+V+V +
Sbjct  222   KSNQLITYSLVIEMQLVISIFATAFCSLGMLVNNDFKSIPKDASEYEIGEAKYYLVIVWS  281

Query  490   ALIWQILFIGAAGSICYGSSLLSGIILAATISLTEVFAVVFYGEKFGSEKGISLTLSLWG  311
             A++WQ+ F+G  G I  GSS+L GII+AA I +TE+ AV+F  EKF +EKGISL L LWG
Sbjct  282   AILWQLFFLGLVGVIFCGSSMLGGIIIAAVIPVTEILAVIFCREKFKAEKGISLALCLWG  341

Query  310   IVSYFYGEMKNGDNNKKEELQIQVT  236
               SYFYGE+K       E  Q   T
Sbjct  342   FTSYFYGEIKGPSKKNSETPQPDTT  366



>emb|CDP11456.1| unnamed protein product [Coffea canephora]
Length=345

 Score =   322 bits (824),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 169/334 (51%), Positives = 238/334 (71%), Gaps = 1/334 (0%)
 Frame = -1

Query  1252  NMRRRLFLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIPLaaayy  1073
             N  R+L L+L+ I++ +G CGG L++RLYF+ GG R+W +  L TA WP+  IPL A+Y 
Sbjct  8     NPTRKLLLMLSIILVTVGACGGPLIMRLYFLHGGKRIWLTGWLQTAAWPLILIPLVASYC  67

Query  1072  trrrhttttaasiftiTR-NTFlaaaalgvllGIINYLYTYGVSKLPVSTSALIAASQLA  896
              RR+     + +   +    T ++   +G L+G+ N+LY++GV  LPVST++LI A+QL 
Sbjct  68    NRRKKPEGGSPTKLVLIDLRTLISGVIIGCLVGLTNHLYSFGVGHLPVSTNSLILATQLV  127

Query  895   FTAGGAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAFLMTLASA  716
             FTA  AF+LV Q+F A++VNA+VLLT G+ VLA+ +  +RP GE  K YV  F++TLA+A
Sbjct  128   FTAFSAFILVGQKFNAYTVNAIVLLTLGSVVLAIHAGSERPKGEKNKMYVLGFILTLAAA  187

Query  715   ALYGALLPCIELTYIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQAISREARG  536
             AL G LLP IELTY+K +Q+++YTLV+EFQ V+ + AT F TVGMLVN DF+ IS+EAR 
Sbjct  188   ALSGCLLPLIELTYMKAKQAISYTLVMEFQSVVCISATVFSTVGMLVNNDFKEISQEARE  247

Query  535   FEIGEANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLTEVFAVVFYGEK  356
             +++GE  YY+V+V  A++WQ   +G  G I   SSL SGI+LAA + +TEV AV+FY EK
Sbjct  248   YQLGETKYYLVLVWCAIVWQCFTVGFTGIIFCASSLFSGIMLAALLPITEVLAVIFYHEK  307

Query  355   FGSEKGISLTLSLWGIVSYFYGEMKNGDNNKKEE  254
             F +EKGI+L LSLWG +S+FYG +K+G   +  E
Sbjct  308   FQAEKGIALALSLWGFISHFYGAIKHGKKQQIPE  341



>gb|KDP40942.1| hypothetical protein JCGZ_24941 [Jatropha curcas]
Length=355

 Score =   322 bits (824),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 173/329 (53%), Positives = 234/329 (71%), Gaps = 2/329 (1%)
 Frame = -1

Query  1228  LLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIPLaaayytrrrhttt  1049
             ++N  M+ IG CGG L+ RLYF+ GG  +W S+ L TAGWP+   PL  +Y  RR +  +
Sbjct  27    IVNGAMLAIGNCGGPLIQRLYFLEGGKAVWISSFLQTAGWPLVLFPLIVSYMYRRSNKGS  86

Query  1048  taasiftiTRNTFlaaaalgvllGIINYLYTYGVSKLPVSTSALIAASQLAFTAGGAFLL  869
                 I+   R  FLA A +G+L G+ ++L  YGVS LPVSTSALI A+QL FTAG A++L
Sbjct  87    RTKLIYISPR-LFLACAVIGLLTGLDDFLAAYGVSLLPVSTSALIIATQLGFTAGFAYIL  145

Query  868   VKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAFLMTLASAALYGALLPC  689
             VKQ+FT F++NA+ LL+ GA VL + ++ DRP  E+ ++Y+  F MTL ++ALYG +LP 
Sbjct  146   VKQKFTPFTINAIFLLSIGAVVLVIHASSDRPDHETTEKYLLGFFMTLGASALYGFVLPL  205

Query  688   IELTYIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQAISREARGFEIGEANYY  509
             IELTY K +Q++TYTLV+E Q+V+S FAT FC +GML++KDF+AI REA  FE+G   YY
Sbjct  206   IELTYKKAKQTITYTLVMEMQIVISFFATGFCAIGMLLHKDFEAIPREASEFELGRVKYY  265

Query  508   VVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLTEVFAVVFYGEKFGSEKGISL  329
             VV V TA+ WQ+ F+GA G +  GSSLLSGII+A  + +TE   V+FY EKF  EKGISL
Sbjct  266   VVNVFTAVFWQLFFMGAVGVVFCGSSLLSGIIIATLLPVTESLGVMFYHEKFHFEKGISL  325

Query  328   TLSLWGIVSYFYGEM-KNGDNNKKEELQI  245
              LSLWG +SYFYGE+ +N   ++  E ++
Sbjct  326   VLSLWGFISYFYGELQQNKKKSRTSEFEM  354



>ref|XP_009599635.1| PREDICTED: purine permease 1-like [Nicotiana tomentosiformis]
Length=352

 Score =   321 bits (822),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 183/347 (53%), Positives = 246/347 (71%), Gaps = 1/347 (0%)
 Frame = -1

Query  1267  SEGKGNMRRRLFLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIPL  1088
             ++G     RR+ LL+N +++ +G CGG L++RLY++ GG+R+WFS+ L TAGWP   IPL
Sbjct  3     NQGLSTTMRRILLLINCLILAVGICGGPLMMRLYYVEGGSRVWFSSWLQTAGWPFTLIPL  62

Query  1087  aaayytrrrhttttaasiftiTRNTFlaaaalgvllGIINYLYTYGVSKLPVSTSALIAA  908
             A  Y+ RR+     A       R  F+A+  +GV+ G+ ++LY++G SKLPVSTS+L+ A
Sbjct  63    AILYFYRRKTEGINAKYYLITPR-IFIASFIIGVVTGLDDFLYSWGGSKLPVSTSSLLLA  121

Query  907   SQLAFTAGGAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAFLMT  728
             +QLAFTA GAF +VK +FT +S+NAVVLLT G  +L V SNGDRP G + K Y+  F+MT
Sbjct  122   AQLAFTAVGAFFIVKLKFTPYSINAVVLLTVGVVLLGVRSNGDRPEGVTSKAYILGFMMT  181

Query  727   LASAALYGALLPCIELTYIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQAISR  548
             L +AALYG +LPCIEL Y+K +Q++T TLVLE QMVM   ATAFCTVGM+ N DFQAISR
Sbjct  182   LLAAALYGVILPCIELIYLKAKQAITATLVLEIQMVMCFAATAFCTVGMIANNDFQAISR  241

Query  547   EARGFEIGEANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLTEVFAVVF  368
             EA+ F +GEA YY V+V T +IWQ  F+G  G I   SSL+SG+++A  + +TEV AVVF
Sbjct  242   EAKQFNLGEARYYTVIVWTTIIWQCFFVGVIGVIYCSSSLMSGVMIAVLLPVTEVLAVVF  301

Query  367   YGEKFGSEKGISLTLSLWGIVSYFYGEMKNGDNNKKEELQIQVTNME  227
             + E F  EKG++L LSLWG VSYFYGE +     K +  + ++T M 
Sbjct  302   FRENFSGEKGLALFLSLWGFVSYFYGEFRQTKKEKNKSPKSEMTTMR  348



>ref|XP_006338103.1| PREDICTED: purine permease 1-like [Solanum tuberosum]
Length=354

 Score =   321 bits (822),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 177/325 (54%), Positives = 234/325 (72%), Gaps = 1/325 (0%)
 Frame = -1

Query  1249  MRRRLFLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIPLaaayyt  1070
             M++ +FL+ N IM+ IG CGG L+ RLYFI GG R+W  + L T G PI  IPLA AY+ 
Sbjct  1     MKKLIFLIFNIIMLSIGNCGGPLISRLYFIHGGQRIWIPSVLQTVGCPIILIPLAIAYFQ  60

Query  1069  rrrhttttaasiftiTRNTFlaaaalgvllGIINYLYTYGVSKLPVSTSALIAASQLAFT  890
             RR+     A  +F   R  F+A+A +G+++G+  YL ++G +KLPVSTS LI A+QLAFT
Sbjct  61    RRKIQGPEAKIVFIT-RQEFIASAGVGIIVGLDGYLNSWGPAKLPVSTSTLINATQLAFT  119

Query  889   AGGAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAFLMTLASAAL  710
             A  A L+VKQ+ TA+S N+VVLL  GA  LA+ +NGDRPAGES K+Y+  F+MT   A L
Sbjct  120   ALFAVLIVKQKLTAYSTNSVVLLIAGAATLALRANGDRPAGESAKDYMLGFVMTFIGAVL  179

Query  709   YGALLPCIELTYIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQAISREARGFE  530
             YG +LP IEL Y+K +Q++TYT VLE QMV+ + AT FCT+GM++NKDFQAI REA  + 
Sbjct  180   YGLMLPLIELIYMKAKQTVTYTTVLEIQMVLGISATVFCTIGMIINKDFQAIPREASQYA  239

Query  529   IGEANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLTEVFAVVFYGEKFG  350
             IGE+ YY+V+V  A+IWQ   +G  G I Y SSLLSGII A  + +TEV AV+ + EKF 
Sbjct  240   IGESKYYMVLVWCAIIWQFALLGLVGVIFYSSSLLSGIIGAFLLPVTEVLAVILFHEKFQ  299

Query  349   SEKGISLTLSLWGIVSYFYGEMKNG  275
             +EKG+++ L+LWG VSYFYGE + G
Sbjct  300   AEKGVAIFLALWGFVSYFYGEYEQG  324



>ref|XP_010675382.1| PREDICTED: purine permease 3-like [Beta vulgaris subsp. vulgaris]
Length=388

 Score =   322 bits (824),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 176/344 (51%), Positives = 236/344 (69%), Gaps = 4/344 (1%)
 Frame = -1

Query  1282  LKMEVSEGKGNMRRRLFLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPI  1103
             + ME  E    M++ L L+LN  M+ IG   G L++RLY+I GG  +W S+ L T GWP+
Sbjct  37    IAMEEPEMSTKMKK-LLLILNCFMLAIGISAGPLIMRLYYIHGGKSIWLSSWLETGGWPV  95

Query  1102  NFIPLaaayytrrrhttttaasiftiTRNTFlaaaalgvllGIINYLYTYGVSKLPVSTS  923
               +PL  AY+ RRR              NTF  AA +G++ G  +Y Y YGV  +PVSTS
Sbjct  96    MILPLLVAYFRRRRTDPEAKLFYIKA--NTFCYAAIVGLVAGSADYCYAYGVKHIPVSTS  153

Query  922   ALIAASQLAFTAGGAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVA  743
             +LI A+QLAFTA  AF+LV+Q+FTAFSVNAV LLTFGA VLA+ +  DRPAGESK +Y  
Sbjct  154   SLILATQLAFTAVFAFILVRQKFTAFSVNAVALLTFGAIVLALHAGNDRPAGESKAQYFV  213

Query  742   AFLMTLASAALYGALLPCIELTYIKGRQS-LTYTLVLEFQMVMSLFATAFCTVGMLVNKD  566
              F  TLAS+AL+  +LP IELTY + + + + Y+LV+E Q+V+S  ATA CTVGML + D
Sbjct  214   GFFFTLASSALFALMLPMIELTYRRVKHTAVNYSLVMEIQLVLSFSATALCTVGMLASGD  273

Query  565   FQAISREARGFEIGEANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLTE  386
             ++  +RE + +++G A Y+VV++++A++WQ  ++GAAG I YGSSLLSGII+A  + +TE
Sbjct  274   YKGYAREVQEYKLGNAMYFVVLIISAIVWQFFYLGAAGVIYYGSSLLSGIIIAVALPITE  333

Query  385   VFAVVFYGEKFGSEKGISLTLSLWGIVSYFYGEMKNGDNNKKEE  254
             + A+ FY EKF  EKG+SL LSLWG  SYFYGE K     KK E
Sbjct  334   IAAIFFYHEKFQVEKGVSLVLSLWGFFSYFYGEAKEMKKQKKRE  377



>ref|XP_004237962.1| PREDICTED: purine permease 3-like [Solanum lycopersicum]
Length=355

 Score =   319 bits (818),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 176/350 (50%), Positives = 242/350 (69%), Gaps = 1/350 (0%)
 Frame = -1

Query  1264  EGKGNMRRRLFLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIPLa  1085
             + + +  R+  L+LN I + IG CGG L+ RLYF+ GG R+W S+ L+  GWPI  I L 
Sbjct  2     DNQSSKWRKFILVLNCITLGIGYCGGPLISRLYFLHGGQRIWLSSWLACIGWPIVLIVLV  61

Query  1084  aayytrrrhttttaasiftiTRNTFlaaaalgvllGIINYLYTYGVSKLPVSTSALIAAS  905
              AY+ R +   +         R  F ++AALG+L+G+  YLY +G +KLPVSTS +I A+
Sbjct  62    IAYFYRLKTQGSDTNFFCIT-RQEFTSSAALGILVGLAGYLYAWGPAKLPVSTSTVIYAA  120

Query  904   QLAFTAGGAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAFLMTL  725
             QL FT   AFL+VKQ+ T++SVNAVVLL  GAG LA+ +  DRP GES K+YV  F+MTL
Sbjct  121   QLGFTVVFAFLIVKQKLTSYSVNAVVLLIVGAGTLALRAESDRPEGESTKQYVLGFVMTL  180

Query  724   ASAALYGALLPCIELTYIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQAISRE  545
              +AA  G  LP +EL YIK ++ +TY ++LE QM++++FA+AFCTVGM+VNKDFQ ISRE
Sbjct  181   LAAASTGLALPLLELIYIKAKKDVTYIMILEIQMILNIFASAFCTVGMIVNKDFQVISRE  240

Query  544   ARGFEIGEANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLTEVFAVVFY  365
             AR FE+G+A YY+V++ +A+IWQ+  +G  G + YGSSLL GI++A  + LTE+  VV Y
Sbjct  241   AREFELGKAKYYLVLIWSAIIWQLSTLGIVGVVQYGSSLLCGILIALLLPLTELLGVVLY  300

Query  364   GEKFGSEKGISLTLSLWGIVSYFYGEMKNGDNNKKEELQIQVTNMEPNET  215
              E F   KG+++ LSLWG VSYFYGEMK     K+EE +  +   E ++T
Sbjct  301   HETFEVTKGLAIFLSLWGFVSYFYGEMKQNHKKKREEEENPIPQTEMDQT  350



>ref|XP_010509839.1| PREDICTED: purine permease 2-like [Camelina sativa]
Length=351

 Score =   319 bits (817),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 171/328 (52%), Positives = 237/328 (72%), Gaps = 0/328 (0%)
 Frame = -1

Query  1231  LLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIPLaaayytrrrhtt  1052
             +++N I + IG CGG L++RLYF  GG R+WFS+ L T G P+   PL  ++  RRR   
Sbjct  10    VIINCIFLAIGNCGGPLMMRLYFHNGGARIWFSSFLQTVGCPLIIFPLLFSFLRRRRLEE  69

Query  1051  ttaasiftiTRNTFlaaaalgvllGIINYLYTYGVSKLPVSTSALIAASQLAFTAGGAFL  872
                 S+F +    F+A+  +G+L+G  NYLY+YG++ +PVST++LI ++QL FTA  AF 
Sbjct  70    QEKTSLFLMKPPLFIASVVVGLLMGFDNYLYSYGLAYIPVSTASLIISAQLGFTALFAFF  129

Query  871   LVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAFLMTLASAALYGALLP  692
             +VKQ+FT F++NA+VLLT GA VLA+ S+ D+ A ++ KEYV AFLMT+ +A LY  +LP
Sbjct  130   MVKQKFTPFTINAIVLLTVGAVVLAINSDSDKLANDTHKEYVVAFLMTVGAALLYAFILP  189

Query  691   CIELTYIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQAISREARGFEIGEANY  512
              +EL+Y K RQ +TYTLVLEFQMV+   AT FC VGMLV  DF+ I+REAR F++GE+ Y
Sbjct  190   LVELSYKKSRQRVTYTLVLEFQMVLCFVATCFCFVGMLVAGDFKVIAREARDFKLGESLY  249

Query  511   YVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLTEVFAVVFYGEKFGSEKGIS  332
             YVVVV TA+IWQ  F+GA G I   SSL+SGI+++A + +T V AV+ + EKF + KG++
Sbjct  250   YVVVVFTAVIWQAFFVGAIGLIFCASSLVSGIMVSALLPVTVVLAVICFQEKFQAGKGVA  309

Query  331   LTLSLWGIVSYFYGEMKNGDNNKKEELQ  248
             L LSLWG VSYFYG++K+ +  K +E Q
Sbjct  310   LALSLWGSVSYFYGQIKSEEKTKAQETQ  337



>ref|XP_011072345.1| PREDICTED: LOW QUALITY PROTEIN: purine permease 3-like [Sesamum 
indicum]
Length=341

 Score =   318 bits (816),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 180/331 (54%), Positives = 228/331 (69%), Gaps = 22/331 (7%)
 Frame = -1

Query  1276  MEVSEGKGNMRRRLFLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINF  1097
             MEV   K    +R+FL++N I++ IG CGG L++RLYFI GG R+WFS+ L T GWP+  
Sbjct  1     MEVE--KPTAEKRIFLIINCIILAIGNCGGPLIMRLYFIHGGKRIWFSSWLETGGWPVIL  58

Query  1096  IPLaaayytrrrhttttaasiftiTRNTFlaaaalgvllGIINYLYTYGVSKLPVSTSAL  917
             IPL  +Y  RRR        +       F+AAA +G+L G  +YLY YGV+KLPVSTS+L
Sbjct  59    IPLIVSYTRRRRPNPGAKLILMK--PRLFVAAAVIGILTGFDDYLYAYGVAKLPVSTSSL  116

Query  916   IAASQLAFTAGGAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAF  737
             I ASQLAFTA  A+ LVKQ+FTA+S+NAVVLLT GA V                     F
Sbjct  117   IIASQLAFTAVFAYFLVKQKFTAYSINAVVLLTVGAAV------------------XVGF  158

Query  736   LMTLASAALYGALLPCIELTYIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQA  557
               T A+AALYG +LP +E TY K +Q +TYTLV+E Q+VM  FAT  CTVGM++NKDFQA
Sbjct  159   FRTGAAAALYGLILPVVEYTYKKAKQPVTYTLVMEIQLVMCFFATVVCTVGMIINKDFQA  218

Query  556   ISREARGFEIGEANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLTEVFA  377
             I REA+GF +GEA YY+VV  +A+IWQ  F+GA G I Y SSLLSGI+++  +  TEV A
Sbjct  219   IGREAKGFGLGEARYYIVVGWSAIIWQCFFLGAIGVIFYASSLLSGILISVLLPATEVLA  278

Query  376   VVFYGEKFGSEKGISLTLSLWGIVSYFYGEM  284
             V+FY EKF +EKG+SL LSLWG +SYF+GE+
Sbjct  279   VIFYHEKFQAEKGVSLFLSLWGFISYFFGEI  309



>ref|XP_007141230.1| hypothetical protein PHAVU_008G178300g [Phaseolus vulgaris]
 gb|ESW13224.1| hypothetical protein PHAVU_008G178300g [Phaseolus vulgaris]
Length=344

 Score =   318 bits (816),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 174/330 (53%), Positives = 235/330 (71%), Gaps = 3/330 (1%)
 Frame = -1

Query  1204  IGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIPLaaayytrrrhttttaasifti  1025
             +G  GG L++RLYFI GGNR+W S+ L TA +P+  IPL  ++  R  H +     +   
Sbjct  15    MGTSGGPLVMRLYFIHGGNRIWLSSFLETAAFPLILIPLTISHLHRTSHHSPKPKLVSIK  74

Query  1024  TRNTFlaaaalgvllGIINYLYTYGVSKLPVSTSALIAASQLAFTAGGAFLLVKQRFTAF  845
                 FLA+A +G+L G+ +YLY  G+++LPVSTS+LI AS LAFTA  AFLLVK RFTA+
Sbjct  75    L-PLFLASAVIGILTGLDDYLYACGIARLPVSTSSLIQASHLAFTAVFAFLLVKHRFTAY  133

Query  844   SVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAFLMTLASAALYGALLPCIELTYIKG  665
             SVNA+VLLT  A VLA+ S GDRP+GES ++YV  F+M LA+AALYG +LP +EL Y + 
Sbjct  134   SVNAIVLLTVAAVVLALRSGGDRPSGESTRQYVIGFVMILAAAALYGFVLPLMELVYKRS  193

Query  664   RQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQAISREARGFEIGEANYYVVVVVTAL  485
             +Q +TY+LV+E Q VM  FAT FCT+GML+N DF+ I REA+ +++GE  YYVV+V +A+
Sbjct  194   KQRVTYSLVMEIQFVMCFFATLFCTIGMLINNDFKVIWREAKDYKLGETKYYVVLVGSAI  253

Query  484   IWQILFIGAAGSICYGSSLLSGIILAATISLTEVFAVVFYGEKFGSEKGISLTLSLWGIV  305
             +WQ  F+GA G I   SSL SGII+AA + +TEV  V+ Y E F +EKG++L LSLWG V
Sbjct  254   MWQFFFLGAIGVIFCSSSLFSGIIIAAFLPVTEVLGVIVYKENFEAEKGVALLLSLWGFV  313

Query  304   SYFYGEMKNG-DNNKKEELQIQVT-NMEPN  221
             SYFYGE+K   + NKK   + ++  ++ PN
Sbjct  314   SYFYGEIKQEREKNKKGCPETELPQSLPPN  343



>gb|KDP40961.1| hypothetical protein JCGZ_24960 [Jatropha curcas]
Length=472

 Score =   323 bits (827),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 174/329 (53%), Positives = 235/329 (71%), Gaps = 2/329 (1%)
 Frame = -1

Query  1228  LLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIPLaaayytrrrhttt  1049
             ++N  M+ IG CGG L+ RLYF++GG  +W S+ L TAGWP+   PL  +Y  RR +  +
Sbjct  144   IVNGAMLAIGNCGGPLIQRLYFLKGGKAVWISSFLQTAGWPLVLFPLIVSYMYRRSNKGS  203

Query  1048  taasiftiTRNTFlaaaalgvllGIINYLYTYGVSKLPVSTSALIAASQLAFTAGGAFLL  869
                 I+   R  FLA A +G+L G+ ++L  YGVS LPVSTSALI A+QL FTAG A++L
Sbjct  204   RTKLIYISPR-LFLACAVIGLLTGLDDFLTAYGVSLLPVSTSALIIATQLGFTAGFAYIL  262

Query  868   VKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAFLMTLASAALYGALLPC  689
             VKQ+FT F++NA+ LL+ GA VL + ++ DRP  E+ ++Y+  F MTL ++ALYG +LP 
Sbjct  263   VKQKFTPFTINAIFLLSIGAVVLVIHASSDRPDHETTEKYLLGFFMTLGASALYGFVLPL  322

Query  688   IELTYIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQAISREARGFEIGEANYY  509
             IELTY K +Q++TYTLV+E Q+V+S FATAFC +GML++KDF+AI REA  FE+G   YY
Sbjct  323   IELTYKKAKQTITYTLVMEMQVVISFFATAFCAIGMLLHKDFEAIPREASEFELGRLKYY  382

Query  508   VVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLTEVFAVVFYGEKFGSEKGISL  329
             VV V TA+ WQ+ F+GA G +   SSLLSGII+A  + +TE   V+FY EKF  EK ISL
Sbjct  383   VVNVFTAVFWQLFFMGAVGVVFCDSSLLSGIIIATLLPVTESLGVMFYHEKFHFEKAISL  442

Query  328   TLSLWGIVSYFYGEM-KNGDNNKKEELQI  245
              LSLWG VSYFYGE+ +N   ++  EL++
Sbjct  443   VLSLWGFVSYFYGELQQNKKKSRTSELEM  471



>ref|XP_008812221.1| PREDICTED: purine permease 3-like [Phoenix dactylifera]
Length=361

 Score =   318 bits (816),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 175/337 (52%), Positives = 234/337 (69%), Gaps = 1/337 (0%)
 Frame = -1

Query  1267  SEGKGNMRRRLFLL-LNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIP  1091
             ++ + +   R FL+ LN  +M IG     LLLRLYF++GG+R W S  L T GWP+ FIP
Sbjct  13    TKNQISKHLRWFLMALNFAIMVIGSTVSPLLLRLYFLKGGSRKWLSGWLQTGGWPLIFIP  72

Query  1090  LaaayytrrrhttttaasiftiTRNTFlaaaalgvllGIINYLYTYGVSKLPVSTSALIA  911
             LA +Y  RR         ++ +T   FLA   LG+L+G+ +YLY YG+S LPVSTS+++ 
Sbjct  73    LAISYAHRRGGGGGGGTKLYLMTPPLFLACTVLGLLIGLDDYLYAYGMSYLPVSTSSILI  132

Query  910   ASQLAFTAGGAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAFLM  731
             ++QL FTA  AF +VKQ+FT+FS NAVVLL+ GA +L + ++GDRP GES   Y   F M
Sbjct  133   STQLGFTALFAFFIVKQKFTSFSTNAVVLLSIGAVMLGLHASGDRPEGESNTLYYLGFAM  192

Query  730   TLASAALYGALLPCIELTYIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQAIS  551
             TLA+A LY  +LP +ELTY K +Q ++YTLV+E Q+VM  FAT FCTVGMLV+KDFQAIS
Sbjct  193   TLAAAVLYAFILPLVELTYAKAKQVVSYTLVMEMQLVMGFFATVFCTVGMLVSKDFQAIS  252

Query  550   REARGFEIGEANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLTEVFAVV  371
             REAR F +GE  YYV++V +A++WQ  F+G  G+I YGS+LL+GII+A  I + EV AV+
Sbjct  253   REARDFVLGEVRYYVLLVWSAILWQFFFLGTVGAIFYGSALLAGIIIAVLIPVAEVLAVI  312

Query  370   FYGEKFGSEKGISLTLSLWGIVSYFYGEMKNGDNNKK  260
             F+ E F   KG++L L+LWG+ SYFYGE       K 
Sbjct  313   FFHESFSGGKGVALVLALWGLASYFYGEFLESKKKKP  349



>ref|XP_003615204.1| Purine permease [Medicago truncatula]
 gb|AES98162.1| purine permease [Medicago truncatula]
Length=364

 Score =   318 bits (816),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 176/347 (51%), Positives = 243/347 (70%), Gaps = 6/347 (2%)
 Frame = -1

Query  1267  SEGKGNMRRRLFLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIPL  1088
              E K    ++L L+LN+I++ IG CGG L++RLYFI GG R+W S+ L T+ +PI  IPL
Sbjct  10    EESKKRSMKKLLLILNSILLAIGTCGGPLVMRLYFIHGGKRVWLSSFLETSAFPIILIPL  69

Query  1087  aaayyt-----rrrhttttaasiftiTRNTFlaaaalgvllGIINYLYTYGVSKLPVSTS  923
               ++       +  +      +  ++    F+A+A +GVL G+ +YLY  G+ +LPVSTS
Sbjct  70    TISHVHNRYRYQNPNGNNNNNNFVSMKPPLFIASAVIGVLTGLDDYLYACGIKRLPVSTS  129

Query  922   ALIAASQLAFTAGGAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNG-DRPAGESKKEYV  746
             +LI +S LAFTA  AF LVK +FTA+SVN++VLLT G+ VLA+ S+G DR  GES K+YV
Sbjct  130   SLIQSSHLAFTAVFAFFLVKHKFTAYSVNSIVLLTLGSVVLALNSDGGDRLVGESTKDYV  189

Query  745   AAFLMTLASAALYGALLPCIELTYIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKD  566
               F+M LASAALYG +LP +EL Y K +Q +TY+LV+E Q+VM  FAT FC VGM+++ D
Sbjct  190   IGFVMILASAALYGFVLPLLELVYKKSKQVITYSLVMEIQLVMCFFATLFCVVGMIIDND  249

Query  565   FQAISREARGFEIGEANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLTE  386
             F+ I REAR F++GE  YYVV+V +A++WQ  F+GA G I   SSLLSGII+AA + +TE
Sbjct  250   FKVIPREARDFKLGETKYYVVLVWSAIMWQFFFLGAIGVIFCASSLLSGIIIAAFLPITE  309

Query  385   VFAVVFYGEKFGSEKGISLTLSLWGIVSYFYGEMKNGDNNKKEELQI  245
             + AV+ Y EKF +EKG++L LSLWG VSYFY E+K     K  E+++
Sbjct  310   ILAVIVYKEKFQAEKGVALVLSLWGFVSYFYDEIKEAKKMKNREMEL  356



>ref|XP_009401279.1| PREDICTED: purine permease 1-like [Musa acuminata subsp. malaccensis]
Length=368

 Score =   318 bits (815),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 179/335 (53%), Positives = 234/335 (70%), Gaps = 7/335 (2%)
 Frame = -1

Query  1243  RRLFLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIPLaaa-----  1079
             RR  + +N ++M IG  GG LLLRLYF  GG R W S  L T GWPI F+PL  +     
Sbjct  24    RRALIAVNCVLMAIGNAGGPLLLRLYFHSGGKRQWLSGWLETGGWPIIFLPLLVSYLHRR  83

Query  1078  --yytrrrhttttaasiftiTRNTFlaaaalgvllGIINYLYTYGVSKLPVSTSALIAAS  905
                     H       +F ITR  FL  AALG+LLG+ ++LY YG+S LPVSTSAL+ ++
Sbjct  84    RRLLRGHGHRHQPPTKLFLITRPLFLYCAALGLLLGLDDFLYAYGLSFLPVSTSALLISA  143

Query  904   QLAFTAGGAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAFLMTL  725
             QL FTA  AF+LVKQ+FT +S+N+VVLLT GA +L +  + DRP   ++ EY   F++TL
Sbjct  144   QLVFTAFFAFVLVKQKFTPYSINSVVLLTVGAVMLGLHVSSDRPNNVTRGEYYMGFVLTL  203

Query  724   ASAALYGALLPCIELTYIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQAISRE  545
              +AA+YG  LP +ELTY K +Q++TYTLV+E QMVM  FATAFCTVGMLVNKDFQAI RE
Sbjct  204   GAAAVYGLFLPLVELTYTKAKQAITYTLVMEMQMVMGFFATAFCTVGMLVNKDFQAIPRE  263

Query  544   ARGFEIGEANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLTEVFAVVFY  365
             A+ +E GE  YYVV+V  A++WQ LF+G  G I   ++LL+G+++A  I +TEVFAV+F+
Sbjct  264   AKHYEQGEFRYYVVLVWCAILWQFLFLGTVGVIFCVNTLLAGVLIAVFIPVTEVFAVIFF  323

Query  364   GEKFGSEKGISLTLSLWGIVSYFYGEMKNGDNNKK  260
              EKFGSEKG++L LSLWG+ SY YGE + G  ++ 
Sbjct  324   KEKFGSEKGVALALSLWGLASYSYGEYREGKRSQN  358



>ref|XP_007042881.1| Purine permease 3 isoform 1 [Theobroma cacao]
 gb|EOX98712.1| Purine permease 3 isoform 1 [Theobroma cacao]
Length=338

 Score =   317 bits (812),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 168/330 (51%), Positives = 237/330 (72%), Gaps = 1/330 (0%)
 Frame = -1

Query  1243  RRLFLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIPLaaayytrr  1064
             +R  L+LN  ++  G  GG L+++LYF++GG  +W S+CL TAGWP   +PL  +Y  RR
Sbjct  6     KRSLLVLNCALLAFGNVGGPLIMKLYFLKGGKGVWTSSCLETAGWPFMVMPLTFSYLYRR  65

Query  1063  rhttttaasiftiTRNTFlaaaalgvllGIINYLYTYGVSKLPVSTSALIAASQLAFTAG  884
             R         F      FLA+A +G+L G+ ++LY YGV++LPVST ALI ++QLAFT  
Sbjct  66    RKEGPGTELFFIK-PPLFLASAVIGLLTGVDDFLYAYGVARLPVSTLALIISTQLAFTVA  124

Query  883   GAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAFLMTLASAALYG  704
              AFLLVKQ+FT+F++N+V LL  GA VLA+ ++ D PA ES ++Y + F MTLA++ALYG
Sbjct  125   FAFLLVKQKFTSFTINSVFLLNIGAVVLALHTSSDHPANESNRQYCSGFFMTLAASALYG  184

Query  703   ALLPCIELTYIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQAISREARGFEIG  524
              +LP IELTY K +Q+++Y+LV+E QMVMS  AT FCT+GML +K+ +AI REA  FE+G
Sbjct  185   FVLPAIELTYKKAKQTISYSLVIEMQMVMSFSATVFCTIGMLFHKEVEAIPREASKFELG  244

Query  523   EANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLTEVFAVVFYGEKFGSE  344
             ++ YY+V++++A++WQ  F+GA G I  GSSLLSGII+AA + +TE  AV+F+ EKF  E
Sbjct  245   QSTYYLVILLSAILWQFFFMGAVGVIFSGSSLLSGIIIAALLPVTESLAVLFFHEKFQVE  304

Query  343   KGISLTLSLWGIVSYFYGEMKNGDNNKKEE  254
             K IS+ LSL G +SYFYGE++    N+  +
Sbjct  305   KAISVVLSLLGSLSYFYGELQKNKKNQASD  334



>ref|XP_010413817.1| PREDICTED: purine permease 2-like [Camelina sativa]
Length=349

 Score =   317 bits (812),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 173/341 (51%), Positives = 241/341 (71%), Gaps = 1/341 (0%)
 Frame = -1

Query  1231  LLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIPLaaayytrrrhtt  1052
             +++N I + IG CGG L++RLYF  GG R+WFS+ L T G P+   PL  ++  RRR   
Sbjct  8     VIINCIFLAIGNCGGPLMMRLYFHNGGERIWFSSFLQTVGCPLILFPLLFSFLRRRRLVK  67

Query  1051  ttaasiftiTRNTFlaaaalgvllGIINYLYTYGVSKLPVSTSALIAASQLAFTAGGAFL  872
                 S+F +    F+A+   G+L+G  NYLY+YG++ +PVST++LI ++QL FTA  AF 
Sbjct  68    QEKTSLFLMKPPLFIASVVAGLLMGFDNYLYSYGLAYIPVSTASLIISAQLGFTALFAFC  127

Query  871   LVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAFLMTLASAALYGALLP  692
             +VKQ+FT F++NA+VLLT  A VLA+ S+  + A E+ KEYV  FLMT+ +A LY  +LP
Sbjct  128   MVKQKFTPFTINAIVLLTLSAVVLAINSDSYKLANETHKEYVVGFLMTVGAALLYAFILP  187

Query  691   CIELTYIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQAISREARGFEIGEANY  512
              +EL+Y K RQ +TYTLVLEFQMV+   AT FC VGMLV  DF+ I+REAR F++GE+ Y
Sbjct  188   LVELSYKKSRQGVTYTLVLEFQMVLCFVATCFCLVGMLVAGDFKVIAREARDFKLGESLY  247

Query  511   YVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLTEVFAVVFYGEKFGSEKGIS  332
             YVVVV TA+IWQ  F+GA G I   SSL+SGI+++A + +T V AV+ + EKF + KGI+
Sbjct  248   YVVVVFTAVIWQAFFVGAIGLIFCVSSLVSGIMVSALLPVTVVLAVICFQEKFQAGKGIA  307

Query  331   LTLSLWGIVSYFYGEMKNGDNNKKEELQ-IQVTNMEPNETL  212
             LTLSLWG VSYFYG+ K+G+  K +E Q  Q++ +   +++
Sbjct  308   LTLSLWGSVSYFYGQFKSGEKTKAQETQETQLSQLPVTDSV  348



>gb|AAF64547.1|AF078531_1 purine permease [Arabidopsis thaliana]
Length=356

 Score =   317 bits (813),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 174/333 (52%), Positives = 225/333 (68%), Gaps = 12/333 (4%)
 Frame = -1

Query  1201  GGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIPLaaayytrrrhttttaasiftiT  1022
             G CGG LL RLYF  GG R+WF + LSTAG+PI  IPL  ++ +RRR       +     
Sbjct  16    GTCGGPLLTRLYFTNGGKRIWFMSFLSTAGFPIILIPLLVSFLSRRRGNRNPNNAENKRK  75

Query  1021  RNTFlaaaalgvllGII-------NYLYTYGVSKLPVSTSALIAASQLAFTAGGAFLLVK  863
                FL    L +   +I       NYLY+YG++ LPVSTS+LI  +QLAF A  AFLLVK
Sbjct  76    TKLFLMETPLFIASIVIGLLTGLDNYLYSYGLAYLPVSTSSLIIGTQLAFNALFAFLLVK  135

Query  862   QRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAFLMTLASAALYGALLPCIE  683
             Q+FT FS+NAVVLLT G G+LA+ S+GD+PA ESKKEYV  FLMT+ +A LY  +LP +E
Sbjct  136   QKFTPFSINAVVLLTVGIGILALHSDGDKPAKESKKEYVVGFLMTVVAALLYAFILPLVE  195

Query  682   LTYIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQAISREARGFEI-GEANYYV  506
             LTY K RQ +T+ LVLE QMVM L AT FC +GM +  DF+ I+REAR F+I G   YY 
Sbjct  196   LTYKKARQEITFPLVLEIQMVMCLAATFFCVIGMFIVGDFKVIAREAREFKIGGSVFYYA  255

Query  505   VVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLTEVFAVVFYGEKFGSEKGISLT  326
             ++V+T +IWQ  F+GA G +   SSL SG++++  + +TEVFAVV + EKF +EKG+SL 
Sbjct  256   LIVITGIIWQGFFLGAIGIVFCASSLASGVLISVLLPVTEVFAVVCFREKFQAEKGVSLL  315

Query  325   LSLWGIVSYFYGEMKNG----DNNKKEELQIQV  239
             LSLWG VSYFYGE K+G    D  +  E ++ +
Sbjct  316   LSLWGFVSYFYGEFKSGKKVVDKPQPPETELPI  348



>ref|XP_006410518.1| hypothetical protein EUTSA_v10017788mg [Eutrema salsugineum]
 gb|ESQ51971.1| hypothetical protein EUTSA_v10017788mg [Eutrema salsugineum]
Length=372

 Score =   318 bits (814),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 185/373 (50%), Positives = 255/373 (68%), Gaps = 14/373 (4%)
 Frame = -1

Query  1282  LKMEVSEGKGN-MRRRL---FLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTA  1115
             ++ E  + + N M +++    +++N I++ IG CGG L+ RLY+  GG R+WFS+ L TA
Sbjct  5     IQEEPPKTQANVMSKKMKTALVIINCILLAIGNCGGPLITRLYYRNGGKRIWFSSFLQTA  64

Query  1114  GWPINFIPLaaayytrrrhttttaasift----iTRNTFlaaaalgvllGIINYLYTYGV  947
             G PI F+PL  ++  RRR          T    I    F A+  +G+L G  NYLY+YG+
Sbjct  65    GCPIIFLPLLFSFLRRRRRRKEEEEEAKTPFFLIKPPLFFASVVIGLLTGFDNYLYSYGL  124

Query  946   SKLPVSTSALIAASQLAFTAGGAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAG  767
             + LPVST++LI +SQLAFTA  AF +VKQ+FT F +NAVVLLT GAG+LA+ ++GD+ A 
Sbjct  125   AYLPVSTASLIISSQLAFTALFAFFMVKQKFTPFVINAVVLLTLGAGILALHTDGDKLAK  184

Query  766   ESKKEYVAAFLMTLASAALYGALLPCIELTYIKGRQSLTYTLVLEFQMVMSLFATAFCTV  587
             E+ KEYV  FLMT+A+A LY  +LP +ELTY K RQ ++YTLVLE QMV+   AT FC V
Sbjct  185   ETHKEYVVGFLMTVAAAILYAFILPLVELTYKKARQQISYTLVLEIQMVLCFVATCFCLV  244

Query  586   GMLVNKDFQAISREARGFEIGEANYYVVVVV-TALIWQILFIGAAGSICYGSSLLSGIIL  410
             GML + DF+ I++EAR F+ G ++YY VVVV TA+IWQ  F+G+ G I   SSL+SGI++
Sbjct  245   GMLADGDFKVIAKEARDFKHGGSSYYTVVVVFTAIIWQGFFLGSIGIIFCASSLVSGILI  304

Query  409   AATISLTEVFAVVFYGEKFGSEKGISLTLSLWGIVSYFYGEMKNGDNNKKEELQIQVTNM  230
             +A + LTEV AV+ + EKF +EKG+SL LSLWG +SYFYG++K+    KK   Q Q T +
Sbjct  305   SALLPLTEVLAVLCFREKFQAEKGLSLFLSLWGFLSYFYGQIKS--EKKKTPTQAQGTQL  362

Query  229   EPNETLPM*HSIA  191
                  LP+  S+A
Sbjct  363   ---PQLPITDSVA  372



>ref|NP_174144.1| purine permease 1 [Arabidopsis thaliana]
 sp|Q9FZ96.1|PUP1_ARATH RecName: Full=Purine permease 1; Short=AtPUP1 [Arabidopsis thaliana]
 gb|AAF98432.1|AC021044_11 purine permease [Arabidopsis thaliana]
 dbj|BAC42317.1| putative purine permease [Arabidopsis thaliana]
 gb|AAO63924.1| putative purine permease [Arabidopsis thaliana]
 gb|AEE30934.1| purine permease 1 [Arabidopsis thaliana]
Length=356

 Score =   317 bits (812),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 174/333 (52%), Positives = 225/333 (68%), Gaps = 12/333 (4%)
 Frame = -1

Query  1201  GGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIPLaaayytrrrhttttaasiftiT  1022
             G CGG LL RLYF  GG R+WF + LSTAG+PI  IPL  ++ +RRR       +     
Sbjct  16    GTCGGPLLTRLYFTNGGKRIWFMSFLSTAGFPIILIPLLVSFLSRRRSNRNPNNAENKRK  75

Query  1021  RNTFlaaaalgvllGII-------NYLYTYGVSKLPVSTSALIAASQLAFTAGGAFLLVK  863
                FL    L +   +I       NYLY+YG++ LPVSTS+LI  +QLAF A  AFLLVK
Sbjct  76    TKLFLMETPLFIASIVIGLLTGLDNYLYSYGLAYLPVSTSSLIIGTQLAFNALFAFLLVK  135

Query  862   QRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAFLMTLASAALYGALLPCIE  683
             Q+FT FS+NAVVLLT G G+LA+ S+GD+PA ESKKEYV  FLMT+ +A LY  +LP +E
Sbjct  136   QKFTPFSINAVVLLTVGIGILALHSDGDKPAKESKKEYVVGFLMTVVAALLYAFILPLVE  195

Query  682   LTYIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQAISREARGFEI-GEANYYV  506
             LTY K RQ +T+ LVLE QMVM L AT FC +GM +  DF+ I+REAR F+I G   YY 
Sbjct  196   LTYKKARQEITFPLVLEIQMVMCLAATFFCVIGMFIVGDFKVIAREAREFKIGGSVFYYA  255

Query  505   VVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLTEVFAVVFYGEKFGSEKGISLT  326
             ++V+T +IWQ  F+GA G +   SSL SG++++  + +TEVFAVV + EKF +EKG+SL 
Sbjct  256   LIVITGIIWQGFFLGAIGIVFCASSLASGVLISVLLPVTEVFAVVCFREKFQAEKGVSLL  315

Query  325   LSLWGIVSYFYGEMKNG----DNNKKEELQIQV  239
             LSLWG VSYFYGE K+G    D  +  E ++ +
Sbjct  316   LSLWGFVSYFYGEFKSGKKVVDKPQPPETELPI  348



>ref|XP_002893512.1| ATPUP3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69771.1| ATPUP3 [Arabidopsis lyrata subsp. lyrata]
Length=348

 Score =   317 bits (811),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 164/328 (50%), Positives = 230/328 (70%), Gaps = 1/328 (0%)
 Frame = -1

Query  1240  RLFLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIPLaaayytrrr  1061
             ++ +++N I++ IG CGG L++RLYF  GG R+WFST L TAG+P+ FIPL  +Y  RRR
Sbjct  3     KVLVIINCIILAIGNCGGPLIMRLYFNNGGKRIWFSTFLETAGFPVIFIPLLFSYIARRR  62

Query  1060  httttaasiftiTRNTFlaaaalgvllG-IINYLYTYGVSKLPVSTSALIAASQLAFTAG  884
                    + F + +   L  A    +L    NYLY YG++ LPVST+ALI ASQLAF A 
Sbjct  63    SNNVGDDTSFFLIKPRLLIVAVFIGILSGFDNYLYAYGIAYLPVSTAALIIASQLAFIAI  122

Query  883   GAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAFLMTLASAALYG  704
              +F +VK +FT F++NAVVLLT GA VL + +  D+P  E+ K+Y+  FLMT+A+A +Y 
Sbjct  123   FSFFMVKHKFTPFTINAVVLLTVGAAVLGMHTETDKPVHETHKQYIIGFLMTVAAAVMYA  182

Query  703   ALLPCIELTYIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQAISREARGFEIG  524
              +LP +EL Y K RQ ++YTLVLEFQ+++   A+    +GM +  DF+A+ +EAR F++G
Sbjct  183   FILPLVELAYQKARQPMSYTLVLEFQLILCFLASIVSVIGMFIAGDFKALPKEAREFKLG  242

Query  523   EANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLTEVFAVVFYGEKFGSE  344
             EA +YVV V +A+IWQ  F+GA G I   SSL+SGI+++  + +TEV AV+FY EKF +E
Sbjct  243   EALFYVVAVFSAIIWQGFFLGAIGLIFCTSSLVSGIMISVLLPITEVLAVIFYHEKFQAE  302

Query  343   KGISLTLSLWGIVSYFYGEMKNGDNNKK  260
             KG+SL LSLWG VSYFYGE+K+G + K+
Sbjct  303   KGLSLALSLWGFVSYFYGEIKSGKDKKR  330



>ref|XP_010460601.1| PREDICTED: purine permease 1 [Camelina sativa]
Length=354

 Score =   316 bits (810),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 183/355 (52%), Positives = 242/355 (68%), Gaps = 10/355 (3%)
 Frame = -1

Query  1231  LLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIPLaaayy---trrr  1061
             L++N I++ IG CGG LL RLY+  GG R+WF + LSTAG PI  IPL  ++     R +
Sbjct  6     LIINCIILTIGTCGGPLLTRLYYNNGGKRIWFMSFLSTAGCPIILIPLLVSFLNRRKRNK  65

Query  1060  httttaasiftiTRNTFlaaaalgvllGIINYLYTYGVSKLPVSTSALIAASQLAFTAGG  881
                     +F +    F+A+  +G+L+G+ NYLY YG++ LPVSTS+LI  +QLAF A  
Sbjct  66    AENVAKTELFLMETPLFVASIVIGLLIGLDNYLYAYGLAYLPVSTSSLIIGTQLAFNALF  125

Query  880   AFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAFLMTLASAALYGA  701
             AFLLVKQ+FT FSVNAVVLLT G G+LA+ S+GD+PA ES KEYV  FLMT+ +A LY  
Sbjct  126   AFLLVKQKFTPFSVNAVVLLTVGTGILALHSDGDKPANESHKEYVVGFLMTVIAAVLYAF  185

Query  700   LLPCIELTYIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQAISREARGFEI-G  524
             +LP +ELTY K RQ +T+ LVLE QMVM L AT FC VGM +  DF+ I++EAR F+I G
Sbjct  186   ILPLVELTYKKARQEITFPLVLEIQMVMCLSATCFCVVGMFIVGDFKVIAKEAREFKIGG  245

Query  523   EANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLTEVFAVVFYGEKFGSE  344
              A YY ++V+T +IWQ  F+GA G +   SSL SG++++  + +TEV AVV + EKF +E
Sbjct  246   SAFYYALIVITGIIWQGFFLGAIGIVFCASSLASGVLISVLLPVTEVLAVVCFREKFQAE  305

Query  343   KGISLTLSLWGIVSYFYGEMKNGDNNKKEELQIQVTNMEPNETLPM*HSIAPSTS  179
             K +SL LSLWG VSYFYGE K+G   KK   + Q T  E   TL   H+++ S +
Sbjct  306   KCVSLLLSLWGFVSYFYGEFKSG---KKVVDKPQQTETELPTTL---HAVSDSVA  354



>ref|XP_010509841.1| PREDICTED: purine permease 2-like [Camelina sativa]
Length=347

 Score =   316 bits (809),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 172/341 (50%), Positives = 240/341 (70%), Gaps = 1/341 (0%)
 Frame = -1

Query  1231  LLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIPLaaayytrrrhtt  1052
             +++N I + IG CGG L+LRLYF  GG R+WFS+ L T G P+   PL  ++  RR    
Sbjct  6     VIINFIFLAIGSCGGPLMLRLYFHNGGARIWFSSFLQTVGCPLILFPLLFSFLRRRCLEE  65

Query  1051  ttaasiftiTRNTFlaaaalgvllGIINYLYTYGVSKLPVSTSALIAASQLAFTAGGAFL  872
                 S+F +    F+A+  +G+L+G  NYLY+YG++ +PVST+ALI ++QL FTA  AF 
Sbjct  66    QETTSLFLMKPPLFIASVVVGLLMGFDNYLYSYGLAYIPVSTAALIISAQLGFTALFAFF  125

Query  871   LVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAFLMTLASAALYGALLP  692
             +VKQ+FT F++NA+VLLT GA VLA+ S+ D+ A E+ KEYV  FLMT  +A LY  +LP
Sbjct  126   MVKQKFTPFTINAIVLLTVGAVVLAINSDSDKLANETHKEYVVGFLMTAGAALLYAFILP  185

Query  691   CIELTYIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQAISREARGFEIGEANY  512
              +EL Y K RQ +TYTLVLEFQMV+   AT FC VGML + DF+ I+REAR F++GE+ Y
Sbjct  186   LVELAYKKSRQRVTYTLVLEFQMVLCFVATCFCLVGMLASGDFKVIAREARDFKLGESLY  245

Query  511   YVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLTEVFAVVFYGEKFGSEKGIS  332
             YVVVV TA+IWQ  F+GA G I   SSL+SGI+++A + +T V AV+ + EKF + KG++
Sbjct  246   YVVVVFTAVIWQAFFVGAIGLIFCVSSLVSGIMVSALLPVTVVLAVICFQEKFQAGKGVA  305

Query  331   LTLSLWGIVSYFYGEMKNGDNNKKEELQ-IQVTNMEPNETL  212
             L LSLWG VSYFYG++K+ +  K +E Q  Q++ +   +++
Sbjct  306   LALSLWGSVSYFYGQIKSEEKTKAQETQETQLSQLPVTDSV  346



>ref|XP_010244044.1| PREDICTED: purine permease 1-like [Nelumbo nucifera]
Length=357

 Score =   316 bits (809),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 173/345 (50%), Positives = 235/345 (68%), Gaps = 6/345 (2%)
 Frame = -1

Query  1243  RRLFLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIPLaaayytrr  1064
             ++  + LN  ++ +G CGG LLLR YF+ GG R+W S+ L T GWP+   PL   Y  RR
Sbjct  19    QKTLIFLNFTLLALGFCGGPLLLRQYFVXGGRRIWLSSWLETGGWPLFLFPLFVFYLQRR  78

Query  1063  rhttttaasiftiTRNTFlaaaalgvllGIINYLYTYGVSKLPVSTSALIAASQLAFTAG  884
             R      A + ++    F+A+A LG+L G+I+Y Y YG+S+LP ST+ALI ++QLAF A 
Sbjct  79    RRKGNQEARLLSMKPLLFVASAFLGILTGMIDYCYAYGMSRLPASTTALIGSTQLAFNAV  138

Query  883   GAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAFLMTLASAALYG  704
              +F++V+QRFT++S+NAVVLLT GA VL + ++ DRP  ES  +Y     MTL  AALYG
Sbjct  139   FSFIIVRQRFTSYSINAVVLLTIGAIVLGLHASKDRPEKESSHQYYVGLFMTLGEAALYG  198

Query  703   ALLPCIELTYIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQAISREARGFEIG  524
              LLP +ELTY K +Q++TY LV+E QMVMS+FAT FCTVGM+VNKDFQAISREAR +E+G
Sbjct  199   FLLPXVELTYKKAKQAITYPLVMEIQMVMSIFATLFCTVGMIVNKDFQAISREAREYELG  258

Query  523   EANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLTEVFAVVFYGEKFGSE  344
                YYVV+V  A+ WQ  ++GA G +   SSL+ GI  A  + + E+ AVV + EKF +E
Sbjct  259   AVKYYVVLVWCAIFWQFYYLGAIGVVFVASSLVGGITSAVLLPVLEILAVVLFREKFTAE  318

Query  343   KGISLTLSLWGIVSYFYGEMKNGDNNKKEELQIQVTNMEPNETLP  209
             KGI+L LSLWG  SYFYG+ K     +K+++  Q    + N  +P
Sbjct  319   KGIALVLSLWGFTSYFYGQYK-----RKKKMS-QTPQPDSNVQIP  357



>ref|XP_004146629.1| PREDICTED: purine permease 3-like [Cucumis sativus]
Length=355

 Score =   315 bits (808),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 180/354 (51%), Positives = 245/354 (69%), Gaps = 16/354 (5%)
 Frame = -1

Query  1243  RRLFLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIPLaaayytrr  1064
             RR  L+ N  ++ +G CGG LL+RLYF+ GGNR+W ST L T G PI FIPL  +Y  RR
Sbjct  2     RRTLLVFNCFLLAVGTCGGPLLMRLYFLHGGNRVWLSTFLETGGCPIIFIPLLISYIHRR  61

Query  1063  rhtttt--------aasiftiTRNTFlaaaalgvllGIINYLYTYGVSKLPVSTSALIAA  908
             R    +        +  +  +    FLA+  +G++ G +++LY YGV+++PVSTSALI A
Sbjct  62    RRRAHSLNPSESTNSTEMIFMKSRLFLASGVIGIITGFVDFLYAYGVARIPVSTSALIRA  121

Query  907   SQLAFTAGGAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAFLMT  728
              QLAFTAG AF LVKQ+FTA+S+N+VVL+T G  +LA+ ++GDR AGES +EY+  FL T
Sbjct  122   CQLAFTAGFAFWLVKQKFTAYSINSVVLVTAGGAILALHTSGDRRAGESNREYIEGFLTT  181

Query  727   LASAALYGALLPCIELTYIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQAISR  548
             +A++ +YG +LP +ELTY K RQ +TYTLVLE Q++MSLFAT  C++ ML+N DFQ I+ 
Sbjct  182   VAASVVYGFILPLVELTYKKARQQITYTLVLEVQLIMSLFATLVCSIAMLINNDFQMIAM  241

Query  547   EARGFEIGEANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLTEVFAVVF  368
             EA  F +G+A YYV++V++A+IWQ  F+G  G I   SS  SGII+A  + +TE+ AVV 
Sbjct  242   EAEAFGLGKAKYYVILVLSAIIWQGFFLGVIGVIFSSSSFFSGIIIAVLLPVTEILAVVT  301

Query  367   YGEKFGSEKGISLTLSLWGIVSYFYGEMKNGDNNKKE-ELQ-------IQVTNM  230
             + EKF +EK ISL L+LWG VSYFYGE+K+     K  ELQ        Q+TN+
Sbjct  302   FNEKFQAEKTISLILNLWGFVSYFYGEIKHNKKKMKNLELQRRAETTTTQITNI  355



>ref|XP_006295883.1| hypothetical protein CARUB_v10025013mg [Capsella rubella]
 gb|EOA28781.1| hypothetical protein CARUB_v10025013mg [Capsella rubella]
Length=349

 Score =   315 bits (808),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 168/342 (49%), Positives = 238/342 (70%), Gaps = 0/342 (0%)
 Frame = -1

Query  1243  RRLFLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIPLaaayytrr  1064
             + + +++N + + IG CGG L++RLYF  GG R+WFS+ L T G+P+   PL  ++  RR
Sbjct  5     KTVLVIVNCVFLAIGNCGGPLMIRLYFHNGGERIWFSSFLQTVGFPLILFPLLFSFLRRR  64

Query  1063  rhttttaasiftiTRNTFlaaaalgvllGIINYLYTYGVSKLPVSTSALIAASQLAFTAG  884
             R       S F +    F+A+  +G+L+G  NYLY+YG++ LPVST++LI ++QL FTA 
Sbjct  65    RLEEQEKTSFFLMKPRLFIASVVVGLLMGFDNYLYSYGLAYLPVSTASLIISAQLGFTAL  124

Query  883   GAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAFLMTLASAALYG  704
              AF +VKQ+FT F++NA+VLLT GA VLA+ S  D+ A E+ KEYV  FLM + +A LY 
Sbjct  125   FAFFMVKQKFTPFTINAIVLLTVGAVVLALNSESDKLANETHKEYVVGFLMVVGAALLYA  184

Query  703   ALLPCIELTYIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQAISREARGFEIG  524
              +LP +ELTY K RQ +TYTLVLEFQMV+   AT FC VGML   DF+ I+REARGF++G
Sbjct  185   FILPLVELTYKKSRQRITYTLVLEFQMVLCFVATCFCLVGMLAAGDFKVIAREARGFKLG  244

Query  523   EANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLTEVFAVVFYGEKFGSE  344
             E+ YYVV+V TA+IWQ  F+GA G I   SSL+SGI+++A + +T + AV+ + EKF + 
Sbjct  245   ESLYYVVIVFTAVIWQAFFVGAIGLIFCASSLVSGIMISALLPVTVILAVICFREKFQAG  304

Query  343   KGISLTLSLWGIVSYFYGEMKNGDNNKKEELQIQVTNMEPNE  218
             KG++L LSLWG VSYFYG++K+     +E    Q++ +   +
Sbjct  305   KGVALALSLWGSVSYFYGQIKSEKTKGQETQASQLSQLPVTD  346



>gb|KGN64615.1| hypothetical protein Csa_1G071290 [Cucumis sativus]
Length=366

 Score =   316 bits (809),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 177/354 (50%), Positives = 244/354 (69%), Gaps = 16/354 (5%)
 Frame = -1

Query  1243  RRLFLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIPLaaa-----  1079
             RR  L+ N  ++ +G CGG LL+RLYF+ GGNR+W ST L T G PI FIPL  +     
Sbjct  13    RRTLLVFNCFLLAVGTCGGPLLMRLYFLHGGNRVWLSTFLETGGCPIIFIPLLISYIHRR  72

Query  1078  ---yytrrrhttttaasiftiTRNTFlaaaalgvllGIINYLYTYGVSKLPVSTSALIAA  908
                 ++     +T +  +  +    FLA+  +G++ G +++LY YGV+++PVSTSALI A
Sbjct  73    RRRAHSLNPSESTNSTEMIFMKSRLFLASGVIGIITGFVDFLYAYGVARIPVSTSALIRA  132

Query  907   SQLAFTAGGAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAFLMT  728
              QLAFTAG AF LVKQ+FTA+S+N+VVL+T G  +LA+ ++GDR AGES +EY+  FL T
Sbjct  133   CQLAFTAGFAFWLVKQKFTAYSINSVVLVTAGGAILALHTSGDRRAGESNREYIEGFLTT  192

Query  727   LASAALYGALLPCIELTYIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQAISR  548
             +A++ +YG +LP +ELTY K RQ +TYTLVLE Q++MSLFAT  C++ ML+N DFQ I+ 
Sbjct  193   VAASVVYGFILPLVELTYKKARQQITYTLVLEVQLIMSLFATLVCSIAMLINNDFQMIAM  252

Query  547   EARGFEIGEANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLTEVFAVVF  368
             EA  F +G+A YYV++V++A+IWQ  F+G  G I   SS  SGII+A  + +TE+ AVV 
Sbjct  253   EAEAFGLGKAKYYVILVLSAIIWQGFFLGVIGVIFSSSSFFSGIIIAVLLPVTEILAVVT  312

Query  367   YGEKFGSEKGISLTLSLWGIVSYFYGEMKNGDNNKKE-ELQ-------IQVTNM  230
             + EKF +EK ISL L+LWG VSYFYGE+K+     K  ELQ        Q+TN+
Sbjct  313   FNEKFQAEKTISLILNLWGFVSYFYGEIKHNKKKMKNLELQRRAETTTTQITNI  366



>ref|NP_174143.1| purine permease 3 [Arabidopsis thaliana]
 sp|Q9FZ95.1|PUP3_ARATH RecName: Full=Purine permease 3; Short=AtPUP3 [Arabidopsis thaliana]
 gb|AAF98433.1|AC021044_12 Similar to purine permease [Arabidopsis thaliana]
 gb|AEE30933.1| purine permease 3 [Arabidopsis thaliana]
Length=351

 Score =   315 bits (807),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 164/328 (50%), Positives = 236/328 (72%), Gaps = 1/328 (0%)
 Frame = -1

Query  1240  RLFLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIPLaaayytrrr  1061
             +  +++N I++ IG CGG L++RLYF  GG R+WFST L TAG+P+ FIPL  +Y TRRR
Sbjct  3     KALVIINCIILAIGNCGGPLIMRLYFNNGGKRIWFSTFLETAGFPVIFIPLLFSYITRRR  62

Query  1060  httttaasiftiTRNTFlaaaalgvllG-IINYLYTYGVSKLPVSTSALIAASQLAFTAG  884
                   ++ F + +   L AA +  +L    NYLY YG++ LPVST+ALI ASQLAF A 
Sbjct  63    SNNVGDSTSFFLIKPRLLIAAVIVGILSGFDNYLYAYGIAYLPVSTAALIIASQLAFIAI  122

Query  883   GAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAFLMTLASAALYG  704
              +F +VK +FT F++NAVVLLT GA VL + +  D+P  E+ K+Y+  FL+T+A+A +Y 
Sbjct  123   FSFFMVKHKFTPFTINAVVLLTVGAAVLGMHTETDKPVHETHKQYITGFLITVAAAVMYA  182

Query  703   ALLPCIELTYIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQAISREARGFEIG  524
              +LP +EL Y K +Q+++YTLVLEFQ+++ L A+    +GM +  DF+A+ +EAR F++G
Sbjct  183   FILPLVELAYQKAKQTMSYTLVLEFQLILCLLASIVSVIGMFIAGDFKALPKEAREFKLG  242

Query  523   EANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLTEVFAVVFYGEKFGSE  344
             EA +YVV V +A+IWQ  F+GA G I   SSL+SGI+++  + +TEV AV+FY EKF +E
Sbjct  243   EALFYVVAVFSAIIWQGFFLGAIGLIFSTSSLVSGIMISVLLPITEVLAVIFYHEKFQAE  302

Query  343   KGISLTLSLWGIVSYFYGEMKNGDNNKK  260
             KG+SL LSLWG VSYFYGE+K+G++ ++
Sbjct  303   KGLSLALSLWGFVSYFYGEIKSGEDKRR  330



>gb|KFK44702.1| hypothetical protein AALP_AA1G292000 [Arabis alpina]
Length=354

 Score =   315 bits (806),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 180/350 (51%), Positives = 244/350 (70%), Gaps = 8/350 (2%)
 Frame = -1

Query  1231  LLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIPLaaayytrrrhtt  1052
             L++N I + IG CGG LL RLY+  GG R+WF + LSTAG+P+  IPL  ++  RR  T 
Sbjct  6     LIINCIFLVIGTCGGPLLTRLYYTNGGKRIWFMSFLSTAGFPVILIPLLFSFLHRRNRTE  65

Query  1051  ttaas----iftiTRNTFlaaaalgvllGIINYLYTYGVSKLPVSTSALIAASQLAFTAG  884
             TT  +    I  +    F+A+  +G+L G+ NYLY YG++ LPVSTS+LI  +QLAF A 
Sbjct  66    TTENAKKEGIILMETPLFIASIVIGLLTGLDNYLYAYGLAYLPVSTSSLIIGTQLAFNAL  125

Query  883   GAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAFLMTLASAALYG  704
              AFL+VKQ+FT FS+NAVVLLT G G+LA+ S+GD+PA ES+KEYV  FLMT+ +A LY 
Sbjct  126   FAFLMVKQKFTPFSINAVVLLTVGIGILALHSDGDKPAHESRKEYVIGFLMTVVAAVLYA  185

Query  703   ALLPCIELTYIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQAISREARGFEIG  524
              +LP +ELTY K RQ +T+TLVLE Q+VM +  + FC VGM+++ DF+ I+REAR F+IG
Sbjct  186   FILPLVELTYKKARQEITFTLVLEMQLVMCIAGSVFCLVGMIIDGDFKVIAREAREFKIG  245

Query  523   EAN-YYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLTEVFAVVFYGEKFGS  347
              +  YY ++V+T +IWQ  F+GA G +   SSL SG++++  + +TEV AVV + EKF +
Sbjct  246   GSMFYYSLIVITGIIWQGFFLGAIGIVFCASSLASGVLISVLLPVTEVLAVVCFREKFQA  305

Query  346   EKGISLTLSLWGIVSYFYGEMKNGDNNKKEELQIQVTNMEPNETLPM*HS  197
             EKG++L LSLWG VSYFYGE K+G   KK   + Q    E   TLP+  S
Sbjct  306   EKGVALLLSLWGFVSYFYGEFKSG---KKVLEKAQPPETELPLTLPVSDS  352



>ref|XP_008812219.1| PREDICTED: purine permease 3-like [Phoenix dactylifera]
 ref|XP_008812222.1| PREDICTED: purine permease 3-like [Phoenix dactylifera]
Length=357

 Score =   314 bits (804),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 176/328 (54%), Positives = 232/328 (71%), Gaps = 5/328 (2%)
 Frame = -1

Query  1240  RLFLL-LNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIPLaaayytrr  1064
             R FL+ LN  +M IG  GG LLLRLYF++GG+R W S+ L T GWP+ FIPLA +Y  RR
Sbjct  22    RWFLMALNFAIMVIGTTGGPLLLRLYFLKGGSRKWLSSWLETGGWPLLFIPLAISYAHRR  81

Query  1063  rhttttaasiftiTRNTFlaaaalgvllGIINYLYTYGVSKLPVSTSALIAASQLAFTAG  884
                  T   + T     FLA   LG+L+G+ ++LY YG+S LPVST++++ ++ L FTA 
Sbjct  82    GGGGPTKLYLMT--PPLFLACTVLGLLVGLDDFLYAYGMSCLPVSTASILVSTHLGFTAL  139

Query  883   GAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAFLMTLASAALYG  704
              AFL+VKQ+FT+FS NAVVLL+ GA +L + ++GDRP GES   Y   F MTLA+A LYG
Sbjct  140   FAFLIVKQKFTSFSTNAVVLLSIGAVILGLHASGDRPKGESNTLYYLGFAMTLAAAMLYG  199

Query  703   ALLPCIELTYIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQAISREARGFEIG  524
              +LP +ELTY K +Q ++YTLV+E Q+VM  FAT FCTVGMLVNKDFQAI +EAR F +G
Sbjct  200   VVLPLVELTYAKAKQVVSYTLVMEMQLVMGFFATVFCTVGMLVNKDFQAIPKEARDFGLG  259

Query  523   EANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLTEVFAVVFYGEKFGSE  344
             E  YYV++V +AL+WQ  ++G  G+I YGS+LL+GII+AA I +TEV AV+ + E F   
Sbjct  260   EVRYYVLLVWSALMWQFFYLGTVGAIFYGSALLAGIIIAAMIPVTEVLAVILFHEPFSGG  319

Query  343   KGISLTLSLWGIVSYFYGEMKNGDNNKK  260
             KG++  L+LWG  SYFYGE +     K 
Sbjct  320   KGVA--LALWGFASYFYGEFQESKKKKP  345



>ref|XP_010939715.1| PREDICTED: purine permease 3-like [Elaeis guineensis]
Length=362

 Score =   314 bits (804),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 176/340 (52%), Positives = 237/340 (70%), Gaps = 3/340 (1%)
 Frame = -1

Query  1267  SEGKGNMRRRLFLL-LNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIP  1091
             ++ + +   R FL+ LN  +M IG     LLLRLYF++GG R W S+ L T GWP+ FIP
Sbjct  14    TKNQISKHLRWFLMALNFTIMVIGTAVSPLLLRLYFLKGGTRKWLSSWLQTGGWPLLFIP  73

Query  1090  LaaayytrrrhttttaasiftiTRNTFlaaaalgvllGIINYLYTYGVSKLPVSTSALIA  911
             L  +Y  RRR        ++ IT   FL+   LG L+G+ ++LY YG+S LPVSTS+++ 
Sbjct  74    LVISYAHRRRCGGGRPTKLYLITPPLFLSCTVLGFLVGLDDFLYAYGMSYLPVSTSSILI  133

Query  910   ASQLAFTAGGAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAFLM  731
             ++QL FTA  AF +VKQ+FT+FSVNAVVLL+ GA +L + ++GDRP GES   Y   F M
Sbjct  134   STQLGFTALFAFFIVKQKFTSFSVNAVVLLSIGAVILGLHASGDRPKGESNTLYYWGFFM  193

Query  730   TLASAALYGALLPCIELTYIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQAIS  551
             TLA+A LYG +LP +ELTY K +Q ++YTLV+E Q+VM  FAT FCTVGMLVN DF AI 
Sbjct  194   TLAAAVLYGFILPLVELTYAKAKQVVSYTLVIEMQLVMGFFATVFCTVGMLVNNDFHAIP  253

Query  550   REARGFEIGEANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLTEVFAVV  371
             REA+  E+GE  YY +++ +A++WQ  F+G  G+I YGS+LL+GII+A  I +TEV AVV
Sbjct  254   REAQECELGELRYYELLIWSAILWQFFFLGTVGAIFYGSALLAGIIMAVLIPVTEVLAVV  313

Query  370   FYGEKFGSEKGISLTLSLWGIVSYFYGEMKNGDNNKKEEL  251
             F+ E F   KG++L L+LWG VSYFYGE    ++ KK+ L
Sbjct  314   FFHEPFSGGKGVALALALWGFVSYFYGEFL--ESKKKKPL  351



>ref|XP_006357924.1| PREDICTED: purine permease 3-like [Solanum tuberosum]
Length=355

 Score =   314 bits (804),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 177/352 (50%), Positives = 246/352 (70%), Gaps = 7/352 (2%)
 Frame = -1

Query  1264  EGKGNMR-RRLFLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIPL  1088
             E + N R +++ L++N+I + +G CG  L++RLYFI+GG R+W S  L T  WPIN IPL
Sbjct  6     EPQVNSRMKKILLIINSIFLAVGICGAPLIIRLYFIKGGKRIWLSCWLQTVAWPINLIPL  65

Query  1087  aaayytrrrhttttaasiftiTRNTFlaaaalgvllGIINYLYTYGVSKLPVSTSALIAA  908
             A +Y  RR +  ++   + T   + F+A   +G+L G  NY Y YGV++LPVSTS L+ +
Sbjct  66    AISYLYRRNNNNSSKLILMT--PHIFMATIGIGILQGFSNYSYAYGVAELPVSTSGLLCS  123

Query  907   SQLAFTAGGAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAFLMT  728
             +QLAFTA  AF++V+ +FT++SVN+V LLT GA +LA+ S GDRP GESKK Y+  F+MT
Sbjct  124   TQLAFTAFFAFIIVRLKFTSYSVNSVFLLTIGAVILALHSGGDRPEGESKKLYILGFIMT  183

Query  727   LASAALYGALLPCIELTYIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQAISR  548
             LA+AAL G + P +EL Y K +Q++TYT VLEFQ+V    AT F T+GM++N DFQAIS 
Sbjct  184   LAAAALAGLIFPLVELIYKKAQQAITYTFVLEFQIVYCFVATLFSTIGMIINNDFQAISG  243

Query  547   EARGFEIGEANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLTEVFAVVF  368
             EA+ FE+GE  YYVV++++A+IWQ   +G+ G I   SSL+ GI+++  + LTEV AV+ 
Sbjct  244   EAKTFELGEGRYYVVIILSAIIWQFYSLGSIGVIYSASSLVCGILISVLLPLTEVLAVIL  303

Query  367   YGEKFGSEKGISLTLSLWGIVSYFYGEMKNGD---NNKKEELQ-IQVTNMEP  224
             Y E F +EKGISL LSLWG VSYFYG+ K  +   NN+  E++ I   N  P
Sbjct  304   YRENFSAEKGISLALSLWGFVSYFYGDYKANNKRKNNQSPEIETIDKINRTP  355



>ref|XP_010478191.1| PREDICTED: purine permease 1-like [Camelina sativa]
Length=354

 Score =   313 bits (803),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 181/345 (52%), Positives = 236/345 (68%), Gaps = 7/345 (2%)
 Frame = -1

Query  1231  LLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIPLaaayytrr---r  1061
             L++N I++ IG CGG LL RLY+  GG R+WF + LSTAG PI  IPL  ++  RR   +
Sbjct  6     LIINCIILTIGTCGGPLLTRLYYNNGGKRIWFMSFLSTAGCPIILIPLLFSFLNRRNRNK  65

Query  1060  httttaasiftiTRNTFlaaaalgvllGIINYLYTYGVSKLPVSTSALIAASQLAFTAGG  881
                     +F +    F+A+  +G+L+G+ NYLY YG+  LPVSTS+LI  +QLAF A  
Sbjct  66    AENVAKTELFLMETPLFIASTVIGLLIGLDNYLYAYGLRYLPVSTSSLIIGTQLAFNALF  125

Query  880   AFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAFLMTLASAALYGA  701
             AFLLVKQ+FT FS+NAVVLLT G G+LA+ S+GD+PA ES +EYV  FLMT+ +A LY  
Sbjct  126   AFLLVKQKFTPFSINAVVLLTVGTGILALHSDGDKPANESHREYVVGFLMTVIAAVLYAF  185

Query  700   LLPCIELTYIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQAISREARGFEI-G  524
             +LP +ELTY K RQ +T+ LVLE QMVM L AT FC VGM +  DF+ I++EAR F+I G
Sbjct  186   ILPLVELTYKKARQEITFPLVLEIQMVMCLSATCFCVVGMFIVGDFKVIAKEAREFKIGG  245

Query  523   EANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLTEVFAVVFYGEKFGSE  344
              A YY ++V+T +IWQ  F+GA G +   SSL SG++++  + +TEV AVV + EKF +E
Sbjct  246   SAFYYALIVITGIIWQGFFLGAIGIVFCASSLASGVLISVLLPMTEVLAVVCFREKFQAE  305

Query  343   KGISLTLSLWGIVSYFYGEMKNGDNNKKEELQIQVTNMEPNETLP  209
             K  SL LSLWG VSYFYGE K+G   KK   + Q T  E   TLP
Sbjct  306   KCASLLLSLWGFVSYFYGEFKSG---KKVVDKPQQTETELPTTLP  347



>ref|XP_010469434.1| PREDICTED: purine permease 2-like [Camelina sativa]
Length=350

 Score =   313 bits (803),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 169/328 (52%), Positives = 233/328 (71%), Gaps = 0/328 (0%)
 Frame = -1

Query  1231  LLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIPLaaayytrrrhtt  1052
             +++N + + IG CGG L++RLYF  GG R+WFS+ L T G P+   PL  ++  RRR   
Sbjct  9     VIINCMFLAIGNCGGPLMMRLYFHNGGERIWFSSFLQTVGCPLILFPLLFSFLRRRRLVE  68

Query  1051  ttaasiftiTRNTFlaaaalgvllGIINYLYTYGVSKLPVSTSALIAASQLAFTAGGAFL  872
                 S+F +    F+A+   G+L+G  NYLY+YG++ +PVST++LI ++QL FTA  AF 
Sbjct  69    QEKTSLFLMKPPLFIASVVAGLLMGFDNYLYSYGLAYIPVSTASLIISAQLGFTALFAFF  128

Query  871   LVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAFLMTLASAALYGALLP  692
             +V+Q+FT F++NA+VLLT GA VLA+ S+ D+ A E+ KEYV  FLMT+ +A LY  +LP
Sbjct  129   MVRQKFTPFTINAIVLLTVGAVVLAINSDSDKLANETHKEYVVGFLMTVGAALLYAFILP  188

Query  691   CIELTYIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQAISREARGFEIGEANY  512
              +EL+Y K RQ +TYTLVLEFQMV+   AT FC VGMLV  DF+ I+REAR F++GE+ Y
Sbjct  189   LVELSYKKSRQGVTYTLVLEFQMVLCFAATCFCLVGMLVAGDFKVIAREARDFKLGESLY  248

Query  511   YVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLTEVFAVVFYGEKFGSEKGIS  332
             YVVVV TA+IWQ  F+GA G I   SSL+SGI+++A + +T V AV+ + EKF + KG++
Sbjct  249   YVVVVFTAVIWQAFFVGAIGLIFCVSSLVSGIMVSALLPVTVVLAVICFQEKFQAGKGVA  308

Query  331   LTLSLWGIVSYFYGEMKNGDNNKKEELQ  248
             L LSLWG VSYFYG+ K+ +  K  E Q
Sbjct  309   LALSLWGSVSYFYGQFKSDEKIKARETQ  336



>gb|EYU38177.1| hypothetical protein MIMGU_mgv1a023817mg [Erythranthe guttata]
Length=357

 Score =   313 bits (801),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 178/344 (52%), Positives = 237/344 (69%), Gaps = 7/344 (2%)
 Frame = -1

Query  1243  RRLFLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIPLaaayytrr  1064
             +  FL++N +++ +G  GG L++RLYFIRGG R+WFS+ L T GWPI  IPL AAY +RR
Sbjct  2     KTTFLIMNGVILAVGNSGGPLIMRLYFIRGGKRIWFSSWLETGGWPIILIPLLAAYISRR  61

Query  1063  rhttttaasiftiTRNTFlaaaalgvllGII-------NYLYTYGVSKLPVSTSALIAAS  905
             R    +  +        FL    L      I       +YLY  GV++LP+ST+AL+AA+
Sbjct  62    RRRRRSTTTAADGAAKLFLMKPRLFSAASAIGILTGLDDYLYAKGVAELPISTAALLAAT  121

Query  904   QLAFTAGGAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAFLMTL  725
              L FTA  AFLLVKQ+FTA+SVNAVVLLT G  VL + ++GDRP GES+KEYV  F M L
Sbjct  122   HLVFTAAFAFLLVKQKFTAYSVNAVVLLTVGTVVLGLHTSGDRPEGESEKEYVVGFFMAL  181

Query  724   ASAALYGALLPCIELTYIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQAISRE  545
             ++A LYG +LP +EL Y K +Q+LTYTL++E Q+V+  FAT FCTVGML+N DFQAISRE
Sbjct  182   SAAGLYGFILPVVELMYKKAKQALTYTLIMEIQLVICFFATLFCTVGMLINNDFQAISRE  241

Query  544   ARGFEIGEANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLTEVFAVVFY  365
             A+ +E+GE  YY+VV+ +A+IWQ+ F+G  G I Y SSLL  II+  TI +T++  V  Y
Sbjct  242   AKEYELGEMKYYLVVIWSAIIWQLFFLGVVGVIFYSSSLLCAIIITVTIPITQILGVFIY  301

Query  364   GEKFGSEKGISLTLSLWGIVSYFYGEMKNGDNNKKEELQIQVTN  233
              EKF +EKGI+L LSLWG +SYF+GE+    N+ +   Q + T 
Sbjct  302   NEKFQAEKGIALFLSLWGFISYFFGEITKTKNSNENNDQTRTTT  345



>ref|XP_006415682.1| hypothetical protein EUTSA_v10008037mg [Eutrema salsugineum]
 gb|ESQ34035.1| hypothetical protein EUTSA_v10008037mg [Eutrema salsugineum]
Length=356

 Score =   312 bits (800),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 176/348 (51%), Positives = 229/348 (66%), Gaps = 20/348 (6%)
 Frame = -1

Query  1201  GGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIPLaaayytrrrhttttaasiftiT  1022
             G CGG LL RLY+  GG R+WF + LSTAG PI  IPL  ++ +R R       S     
Sbjct  16    GTCGGPLLTRLYYNNGGKRIWFMSSLSTAGCPIILIPLFFSFLSRHRSNRNRNNSENAEK  75

Query  1021  RNTFlaaaalgvllGII-------NYLYTYGVSKLPVSTSALIAASQLAFTAGGAFLLVK  863
                FL    L +   +I       NYLY YG++ LPVSTS+LI  +QLAF A  AF +VK
Sbjct  76    TKIFLMETPLFIASIVIGLLTGLDNYLYAYGLAYLPVSTSSLIIGTQLAFNALFAFFMVK  135

Query  862   QRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAFLMTLASAALYGALLPCIE  683
             Q+FT FS+NAVVLLT G G+LA+ S+GD+PA ES KEYV  FLMT+ +A LY  +LP +E
Sbjct  136   QKFTPFSINAVVLLTVGTGILALHSDGDKPAKESHKEYVVGFLMTVIAAVLYAFILPLVE  195

Query  682   LTYIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQAISREARGFEI-GEANYYV  506
             LTY K RQ +T+TLVLE QMVM L AT FC VGML++ DF+ I+REAR F+I G A YY 
Sbjct  196   LTYKKARQEITFTLVLEIQMVMCLAATCFCLVGMLIDGDFKVIAREAREFKIGGSAFYYT  255

Query  505   VVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLTEVFAVVFYGEKFGSEKGISLT  326
             ++V+T +IWQ  F+GA G +   SSL SG++++  + +TEV AVV + EKF ++KG++L 
Sbjct  256   LIVMTGIIWQGFFLGAIGIVFCASSLASGVLISVLLPVTEVLAVVCFREKFQADKGVALL  315

Query  325   LSLWGIVSYFYGEMKNGDNNKKEELQIQVTNMEPNET----LPM*HSI  194
             LSLWG VSYFYGE K+G    ++E        +P ET    LP+  S+
Sbjct  316   LSLWGFVSYFYGEFKSGKKVLEKE--------QPPETELPSLPVTDSV  355



>ref|XP_010499327.1| PREDICTED: purine permease 1-like isoform X1 [Camelina sativa]
 ref|XP_010499328.1| PREDICTED: purine permease 1-like isoform X2 [Camelina sativa]
Length=354

 Score =   312 bits (800),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 178/340 (52%), Positives = 235/340 (69%), Gaps = 8/340 (2%)
 Frame = -1

Query  1231  LLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIPLaaayytrr---r  1061
             L++N I++ IG CGG LL RLY+  GG R+WF + LSTAG PI  IPL  ++  RR   +
Sbjct  6     LIINCIILTIGTCGGPLLTRLYYNNGGKRIWFMSFLSTAGCPIILIPLLFSFLNRRNRNK  65

Query  1060  httttaasiftiTRNTFlaaaalgvllGIINYLYTYGVSKLPVSTSALIAASQLAFTAGG  881
                     +F +    F+A+  +G+L+G+ NYLY YG++ L VSTS+LI  +QLAF A  
Sbjct  66    AENVAKTELFLMETPLFIASIVIGLLIGLDNYLYAYGLAYLQVSTSSLIIGTQLAFNALF  125

Query  880   AFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAFLMTLASAALYGA  701
             AFLLVKQ+FT FSVNAVVLLT G G+LA+ S+GD PA ES KEYV  FLMT+ +A LY  
Sbjct  126   AFLLVKQKFTPFSVNAVVLLTVGTGILALHSDGDLPANESHKEYVVGFLMTVIAAVLYAF  185

Query  700   LLPCIELTYIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQAISREARGFEI-G  524
             +LP +ELTY K RQ +T+ LVLE QMVM L AT FC VGM +  DF+ I++EAR F+I G
Sbjct  186   ILPLVELTYKKARQEITFPLVLEIQMVMCLSATCFCVVGMFIVGDFKVIAKEAREFKIRG  245

Query  523   EANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLTEVFAVVFYGEKFGSE  344
              A YY ++V+T +IWQ  F+GA G +   SSL SG++++  + +TEV AVV + EKF +E
Sbjct  246   SAFYYALIVITGIIWQGFFLGAIGIVFCASSLASGVLISVLLPVTEVLAVVCFREKFQAE  305

Query  343   KGISLTLSLWGIVSYFYGEMKNG----DNNKKEELQIQVT  236
             KG+SL LSLWG VSYFYGE K+G    D  ++ E ++  T
Sbjct  306   KGVSLLLSLWGFVSYFYGEFKSGKIVVDKPQQTETELPTT  345



>emb|CDY35722.1| BnaC03g58430D [Brassica napus]
Length=354

 Score =   312 bits (799),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 169/348 (49%), Positives = 242/348 (70%), Gaps = 8/348 (2%)
 Frame = -1

Query  1231  LLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIPLaaayytrrrh--  1058
             +++N +++ IG CGG LL RLY+  GG R+WF + LSTAG+P+  IPL  ++ +RR H  
Sbjct  6     IIINCVILTIGTCGGPLLTRLYYTNGGKRIWFMSFLSTAGFPVILIPLFFSFLSRRNHNR  65

Query  1057  ---ttttaasiftiTRNTFlaaaalgvllGIINYLYTYGVSKLPVSTSALIAASQLAFTA  887
                 T     +  +    F+A+  +G+L G+ NYLY YG++ LPVSTS+LI  +QLAF A
Sbjct  66    NNSETAEKTKLILMETPLFIASIVIGLLTGLDNYLYAYGLAYLPVSTSSLIIGTQLAFNA  125

Query  886   GGAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAFLMTLASAALY  707
               AF +VKQ+FT FS+NAVVLLT G  VLA+ SNGD+PA E+ KEYV  FLMT+ +A LY
Sbjct  126   LFAFFMVKQKFTPFSINAVVLLTVGIVVLALHSNGDKPANETHKEYVVGFLMTVIAAVLY  185

Query  706   GALLPCIELTYIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQAISREARGFEI  527
               +LP +E TY K RQ +T+ LVLE QMVM + AT FC VGM+++ DF+ ISREAR F+I
Sbjct  186   AFILPLVEFTYKKARQEITFPLVLEIQMVMCIAATCFCVVGMIIDGDFKVISREAREFKI  245

Query  526   -GEANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLTEVFAVVFYGEKFG  350
              G A YY ++V+T ++WQ  F+GA G +   SSL SG++++  + +TEV AV+ + EKF 
Sbjct  246   GGSAFYYTLIVITGIVWQGFFLGAIGVVFCASSLASGVLISVLLPVTEVLAVICFREKFQ  305

Query  349   SEKGISLTLSLWGIVSYFYGEMKNGDN--NKKEELQIQVTNMEPNETL  212
             +EKG+SL LS+WG VSYFYGE K+G     K +  + ++ +++ ++++
Sbjct  306   AEKGVSLFLSIWGFVSYFYGEYKSGKKVLEKHQPPETELPSLQVSDSV  353



>ref|XP_006338102.1| PREDICTED: purine permease 1-like [Solanum tuberosum]
Length=352

 Score =   312 bits (799),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 178/351 (51%), Positives = 243/351 (69%), Gaps = 3/351 (1%)
 Frame = -1

Query  1264  EGKGNMRRRLFLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIPLa  1085
             + + +  R+  L+LN I + IG CGG ++ RLYF+ GG R+W S+ L+  GWPI  I L 
Sbjct  2     DNQSSKWRKFILVLNCIALGIGYCGGPVISRLYFLHGGQRIWLSSWLACIGWPIILIVLI  61

Query  1084  aayytrrrhttttaasiftiTRNTFlaaaalgvllGIINYLYTYGVSKLPVSTSALIAAS  905
              AY+ R +   +    +    +  F ++AALG+L+G+  YLYT+G +KLPVSTS +I A+
Sbjct  62    IAYFYRLKTQGSDINFLCITLQE-FTSSAALGILVGLAGYLYTWGPAKLPVSTSTVIYAA  120

Query  904   QLAFTAGGAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAFLMTL  725
             QL FT   AFL+VKQ+ TA+SVNAVVLL  GAG LA+ +  DRP GES K+YV  F+MTL
Sbjct  121   QLGFTVIFAFLIVKQKLTAYSVNAVVLLIVGAGTLALRAESDRPEGESTKQYVLGFVMTL  180

Query  724   ASAALYGALLPCIELTYIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQAISRE  545
              +AA  G  LP +EL YI+ ++++TY ++LE QM++++FA+AFCTVGM+VNKDFQAISRE
Sbjct  181   LAAASTGLALPLLELIYIRAKKNVTYIMILEIQMILNIFASAFCTVGMIVNKDFQAISRE  240

Query  544   ARGFEIGEANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLTEVFAVVFY  365
             A  FE+G+A YY+V+V +A+IWQ   +G  G + YGSSLL GI++A  + LTE+  V+ Y
Sbjct  241   ASQFELGKAKYYLVLVWSAIIWQFSTLGIVGVVQYGSSLLCGILIALLLPLTELLGVILY  300

Query  364   GEKFGSEKGISLTLSLWGIVSYFYGEMKNGDNNKKEELQIQVTNMEPNETL  212
              E F   KG+++ LSLWG VSYFYGEMK   + KKEE  I  T M     L
Sbjct  301   HETFQVTKGLAIFLSLWGFVSYFYGEMKQ--SKKKEESPIPQTEMVQTSPL  349



>ref|XP_009148632.1| PREDICTED: purine permease 2-like [Brassica rapa]
Length=376

 Score =   313 bits (801),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 178/345 (52%), Positives = 247/345 (72%), Gaps = 6/345 (2%)
 Frame = -1

Query  1249  MRRRL---FLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIPLaaa  1079
             MR+++    +++N I++ IG CGG L+ RLYF  GG R+WFS+ L TAG PI   PL  +
Sbjct  28    MRKKMKTGLVIINCIILAIGNCGGPLITRLYFRNGGKRIWFSSFLQTAGCPIILFPLLFS  87

Query  1078  yytrrrhttttaasiftiTRNTFlaaaalgvllGIINYLYTYGVSKLPVSTSALIAASQL  899
             +  RR+  TTT   +       FLA+  +G+L G+ NYLY YG++ LPVSTS+L+ +SQL
Sbjct  88    FRLRRKEATTTPFFLIKP--PLFLASIVIGLLTGVDNYLYAYGLAYLPVSTSSLVISSQL  145

Query  898   AFTAGGAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAFLMTLAS  719
             AFTA  AF +VKQ+FT F +NAVVLLT GAG+LA+ ++GD+ A E+ KEY+  FLMTLA+
Sbjct  146   AFTAFFAFFMVKQKFTPFIINAVVLLTLGAGILALHTDGDKLAKETHKEYIVGFLMTLAA  205

Query  718   AALYGALLPCIELTYIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQAISREAR  539
             A LY  +LP +ELTY K R+ ++YTLVLE QMV+   AT FC VGML + DF+ ++REAR
Sbjct  206   AILYAFVLPLVELTYKKARKRISYTLVLEMQMVLCFVATCFCLVGMLADGDFKELAREAR  265

Query  538   GFEIGEAN-YYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLTEVFAVVFYG  362
              F++G +  YYVVVV TA+IWQ  F+G+ G I   SSL+SGI++ A + LTEV AV F+ 
Sbjct  266   DFKLGRSTYYYVVVVFTAIIWQGFFLGSIGMIFCASSLVSGILICALLPLTEVLAVFFFR  325

Query  361   EKFGSEKGISLTLSLWGIVSYFYGEMKNGDNNKKEELQIQVTNME  227
             EKF +EKG+SL LSLWG VSYFYG++K+ +  + ++ + Q++ + 
Sbjct  326   EKFQAEKGLSLFLSLWGFVSYFYGQIKSENKTETQDQEAQLSQLP  370



>ref|XP_009380886.1| PREDICTED: purine permease 3-like [Musa acuminata subsp. malaccensis]
Length=365

 Score =   312 bits (799),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 174/334 (52%), Positives = 230/334 (69%), Gaps = 5/334 (1%)
 Frame = -1

Query  1243  RRLFLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIPLaaayytrr  1064
             RR  ++LN ++M +G  G  LLLRLY+  GG R W S+ L TAGWP  F+PL   Y  RR
Sbjct  24    RRALIVLNCVLMALGNTGSPLLLRLYYRSGGKRQWLSSWLETAGWPFIFVPLLITYLHRR  83

Query  1063  rhttt-----taasiftiTRNTFlaaaalgvllGIINYLYTYGVSKLPVSTSALIAASQL  899
             R             +F IT   FLA A +G++ G  ++LY YG+S LPVSTS+L+ ++QL
Sbjct  84    RRCQLRPGNCHPTKLFFITPRLFLACAFIGLITGFDDFLYAYGLSFLPVSTSSLLISTQL  143

Query  898   AFTAGGAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAFLMTLAS  719
             AFTA  AFL+VKQ+FT +S+N+V LLT GA VL +  + DRP   ++ +Y   F++TL +
Sbjct  144   AFTAFFAFLIVKQKFTPYSINSVALLTVGAVVLGLHVSSDRPDNVTRGQYHLGFILTLGA  203

Query  718   AALYGALLPCIELTYIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQAISREAR  539
             AALYG +LP +EL Y K +Q++TYTLV+E Q+VM  FATAFCTVGMLVNKDFQAI REAR
Sbjct  204   AALYGLILPLVELMYSKSKQAITYTLVMEMQLVMGFFATAFCTVGMLVNKDFQAIPREAR  263

Query  538   GFEIGEANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLTEVFAVVFYGE  359
              FE+GE  YYVV+V +A+ WQ  F+G  G I   ++LL+GI++A  I +TEV  VVF+ E
Sbjct  264   HFELGEFRYYVVLVWSAVFWQFFFLGTVGIIFCVNTLLAGILIALFIPVTEVLGVVFFKE  323

Query  358   KFGSEKGISLTLSLWGIVSYFYGEMKNGDNNKKE  257
              F SEKGI+L LSLWG+ SY YGE +   + K +
Sbjct  324   NFSSEKGIALVLSLWGLASYSYGEYRQEKDKKDK  357



>emb|CDY27947.1| BnaCnng05320D [Brassica napus]
Length=349

 Score =   311 bits (797),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 171/343 (50%), Positives = 237/343 (69%), Gaps = 6/343 (2%)
 Frame = -1

Query  1243  RRLFLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIPLaaayytrr  1064
             + + +++N I++ IG CGG L+ RLYF  GG R+WFS+ L T+G PI  +PL  ++ TR 
Sbjct  4     KTVLVIINCIILAIGNCGGPLMTRLYFRNGGKRIWFSSFLQTSGCPIILLPLLISFLTRH  63

Query  1063  rhttttaasiftiTRNT--FlaaaalgvllGIINYLYTYGVSKLPVSTSALIAASQLAFT  890
             R                  FLA+   G+L+G  NYLY YG++ LPVSTS+LI +SQLAFT
Sbjct  64    RKQEQEDTKTTLFLIKPPLFLASVVFGLLIGFDNYLYAYGLAYLPVSTSSLIISSQLAFT  123

Query  889   AGGAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAFLMTLASAAL  710
             A  AF +VKQRFT F++NAVVLLT GAG LA+ ++GD+   E++KEY+  F MT+A+A L
Sbjct  124   ALFAFFMVKQRFTPFTINAVVLLTLGAGSLALHADGDKLPKETRKEYIVGFAMTVAAAVL  183

Query  709   YGALLPCIELTYIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQAISREARGFE  530
             Y  +LP +ELTY K  Q ++YTLVLE Q+V+ + AT FC VGML + DF+ + REAR F+
Sbjct  184   YAFVLPLVELTYKKASQRISYTLVLEMQLVLCVVATCFCLVGMLADGDFKELRREAREFK  243

Query  529   IGEANYYVVVVV-TALIWQILFIGAAGSICYGSSLLSGIILAATISLTEVFAVVFYGEKF  353
             +G + YY VVV  TA+IWQ  F+G+ G I   SSL+SG++++  + LTEV AV+F+ EKF
Sbjct  244   LGGSKYYCVVVAFTAVIWQGFFLGSIGMIFCASSLVSGVLISTLLPLTEVLAVLFFREKF  303

Query  352   GSEKGISLTLSLWGIVSYFYGEMKNGDNNKKEEL---QIQVTN  233
              +EKG+SL LSLWG VSYFYG++++    + +E    Q+QVT 
Sbjct  304   QAEKGVSLFLSLWGFVSYFYGKIQSEKEKRTQEAQLSQLQVTE  346



>ref|XP_007136297.1| hypothetical protein PHAVU_009G034400g [Phaseolus vulgaris]
 gb|ESW08291.1| hypothetical protein PHAVU_009G034400g [Phaseolus vulgaris]
Length=366

 Score =   311 bits (798),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 176/334 (53%), Positives = 235/334 (70%), Gaps = 4/334 (1%)
 Frame = -1

Query  1273  EVSEGKGN-MRRRLFLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINF  1097
             E SEG+ N   +RL L++N +++ +G  GG L++RLYF+RGGNR+W S  L TAG+P+  
Sbjct  3     EGSEGEKNRTMKRLLLIINCLLLAVGTTGGPLVMRLYFLRGGNRVWLSCFLETAGFPLMV  62

Query  1096  IPLaaayytrrrhttttaasiftiTRNTFlaaaalgvllGII---NYLYTYGVSKLPVST  926
              PL  +Y  RRR       +   +        AA   +  +    +YLY YGV++LPVST
Sbjct  63    PPLILSYLRRRRGAVAAGTAKPRLVSMNIPLLAASAFIGVLTGLDDYLYAYGVARLPVST  122

Query  925   SALIAASQLAFTAGGAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYV  746
             SALI A+QL FTA  AFLLV+Q+FT++SVNAVVLLT GA VLA+ ++GDRP GES K YV
Sbjct  123   SALIIATQLGFTAFFAFLLVRQKFTSYSVNAVVLLTIGAVVLALHASGDRPHGESVKAYV  182

Query  745   AAFLMTLASAALYGALLPCIELTYIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKD  566
               F+MT+ +AALYG +LP +EL Y K +Q +TY+LV+E Q V+   AT FC +GM+VN D
Sbjct  183   MGFVMTVIAAALYGFVLPLVELVYKKCKQPITYSLVMEIQFVLCFSATLFCGIGMIVNND  242

Query  565   FQAISREARGFEIGEANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLTE  386
             F+AI  EA+ F+ GE NYY V+V +A++WQ  F+GA G I   SSLLSGI++A  + +TE
Sbjct  243   FKAIPIEAKKFKHGEVNYYTVLVASAILWQAFFLGAIGVIFCASSLLSGILIAVLLPVTE  302

Query  385   VFAVVFYGEKFGSEKGISLTLSLWGIVSYFYGEM  284
             V AV+ Y EKF +EKG+SL LSLWG+VSYFYGE+
Sbjct  303   VLAVILYREKFKAEKGVSLLLSLWGMVSYFYGEI  336



>ref|XP_010509840.1| PREDICTED: purine permease 2-like [Camelina sativa]
Length=380

 Score =   312 bits (799),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 170/328 (52%), Positives = 234/328 (71%), Gaps = 0/328 (0%)
 Frame = -1

Query  1231  LLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIPLaaayytrrrhtt  1052
             L++N+I + IG CGG L++RLYF  GG R+WFS+ L T G P+   PL  ++  RRR   
Sbjct  39    LIVNSIFLAIGDCGGPLMMRLYFHNGGARIWFSSFLQTVGCPLILFPLLFSFLRRRRLEE  98

Query  1051  ttaasiftiTRNTFlaaaalgvllGIINYLYTYGVSKLPVSTSALIAASQLAFTAGGAFL  872
                 S+F +    F+A+  +G+L+G  NYLY+YG++ +PVST +LI ++QL FTA  AF 
Sbjct  99    QEKTSLFLMKPPLFIASVVVGLLVGFDNYLYSYGLAYIPVSTESLIISAQLGFTALFAFF  158

Query  871   LVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAFLMTLASAALYGALLP  692
             +VKQ+ T F++NA+VLLT GA VLA+ S+ D+ A E+ KEYV  FLMT+ +A LY  +LP
Sbjct  159   MVKQKITPFTINAIVLLTVGAVVLAINSDSDKLANETHKEYVVGFLMTVGAALLYAFILP  218

Query  691   CIELTYIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQAISREARGFEIGEANY  512
              +EL+Y K  Q +TYTLVLEFQMV+   AT FC VGMLV  DF+ I+REAR F++GE+ Y
Sbjct  219   LVELSYKKSCQRVTYTLVLEFQMVLCFVATCFCLVGMLVAGDFKVIAREARDFKLGESLY  278

Query  511   YVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLTEVFAVVFYGEKFGSEKGIS  332
             YVVVV TA+IWQ  F+GA G I   SSL+SGI+++A + +T V AV+ + EKF + KG++
Sbjct  279   YVVVVFTAVIWQAFFVGAIGLIFCVSSLVSGIMVSALLPVTVVLAVICFQEKFQAGKGVA  338

Query  331   LTLSLWGIVSYFYGEMKNGDNNKKEELQ  248
             L LSLWG VSYFYG+ K+ + NK ++ Q
Sbjct  339   LALSLWGSVSYFYGQFKSEEKNKAQKTQ  366



>ref|XP_010413821.1| PREDICTED: purine permease 2 [Camelina sativa]
Length=351

 Score =   310 bits (795),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 171/332 (52%), Positives = 235/332 (71%), Gaps = 3/332 (1%)
 Frame = -1

Query  1231  LLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIPLaaayytrrrhtt  1052
             +++N I + IG CGG L+LRLYF  GG R+WFS+ L T G P+   PL  ++ +RRR   
Sbjct  10    VIINCIFLAIGSCGGPLMLRLYFHNGGERIWFSSFLQTVGCPLILFPLLFSFLSRRRLEE  69

Query  1051  ttaasiftiTRNTFlaaaalgvllGIINYLYTYGVSKLPVSTSALIAASQLAFTAGGAFL  872
                 S+F +    F+A+  +G+L+G  NYLY+YG++ +PVST++LI ++QL FTA  AF 
Sbjct  70    QEKTSLFLMKPPLFIASVVVGLLMGFDNYLYSYGLAYIPVSTASLIISAQLGFTALFAFF  129

Query  871   LVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAFLMTLASAALYGALLP  692
             +VKQ+FT F++NA+VLLT GA VLA  S+ D+ A E+ KEYV  FLMT  +A LY  +LP
Sbjct  130   MVKQKFTPFTINAIVLLTVGAVVLAFNSDSDKLANETHKEYVVGFLMTAGAALLYAFILP  189

Query  691   CIELTYIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQAI---SREARGFEIGE  521
              +EL Y K RQ +TYTLVLEFQMV+   AT FC VGML + DF+ I   +REAR F++GE
Sbjct  190   LVELAYKKSRQRVTYTLVLEFQMVLCFVATCFCLVGMLASGDFKVIAREAREARDFKLGE  249

Query  520   ANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLTEVFAVVFYGEKFGSEK  341
             + YYVVVV TA+IWQ  F+GA G I   SSL+SGI+++A + +T V AV+ + EKF + K
Sbjct  250   SLYYVVVVFTAVIWQAFFVGAIGLIFCVSSLVSGIMVSALLPVTVVLAVICFQEKFQAGK  309

Query  340   GISLTLSLWGIVSYFYGEMKNGDNNKKEELQI  245
             G++L LSLWG VSYFYG++K+ +  K +E Q+
Sbjct  310   GVALALSLWGSVSYFYGQIKSEEKTKAQETQL  341



>emb|CDX94595.1| BnaC07g10630D [Brassica napus]
Length=349

 Score =   310 bits (793),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 171/352 (49%), Positives = 234/352 (66%), Gaps = 20/352 (6%)
 Frame = -1

Query  1240  RLFLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIPLaaayytrrr  1061
             R  +++N I++ IG CGG L++RLYF  GG+R+WFST L TAG+PI FIPL  +Y  RRR
Sbjct  3     RALVIINCIILAIGNCGGPLIMRLYFNNGGHRIWFSTFLETAGFPIIFIPLFFSYLNRRR  62

Query  1060  httttaasiftiTRNT--FlaaaalgvllGII-------NYLYTYGVSKLPVSTSALIAA  908
               +           NT  FL    L +   +I       NYLY YG++ LPVST+ALI A
Sbjct  63    SNSNEG-------ENTRFFLIKPRLLMAAILIGILSGFDNYLYAYGIAYLPVSTAALIIA  115

Query  907   SQLAFTAGGAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAFLMT  728
             SQLAF A  ++ +V  +FT F++NAVVLLT GA VL + +  D+P  E+ K+Y+  FL+T
Sbjct  116   SQLAFIAIFSYFMVSHKFTPFTINAVVLLTVGAAVLGMHTETDKPVHETHKQYMVGFLVT  175

Query  727   LASAALYGALLPCIELTYIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQAISR  548
             +A+A +Y  LLP +EL Y K +Q ++YTLVLE QM++   A+    +GML+  DF+A+  
Sbjct  176   VAAAVMYAFLLPLVELAYQKAKQPMSYTLVLEVQMILCFLASLVSLIGMLIAGDFKALPN  235

Query  547   EARGFEIGEANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLTEVFAVVF  368
             EAR F++GEA +YVV V++A+IWQ  F+GA G I   SSL+SGI+++  + +TEV AV+F
Sbjct  236   EAREFKLGEAMFYVVAVLSAIIWQGFFLGAIGLIFCASSLVSGIMISVLLPITEVLAVIF  295

Query  367   YGEKFGSEKGISLTLSLWGIVSYFYGEMK-NGDNNKKEELQIQVTNMEPNET  215
             Y EKF  EKG+SL LSLWG VSYFYGE+K + D   +EE Q+   N  P  T
Sbjct  296   YHEKFQKEKGLSLALSLWGFVSYFYGEIKADKDKRIQEEAQL---NSLPRRT  344



>ref|XP_009102926.1| PREDICTED: purine permease 3 [Brassica rapa]
 ref|XP_009102927.1| PREDICTED: purine permease 3 [Brassica rapa]
 emb|CDX94594.1| BnaC07g10640D [Brassica napus]
Length=349

 Score =   310 bits (793),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 172/352 (49%), Positives = 233/352 (66%), Gaps = 20/352 (6%)
 Frame = -1

Query  1240  RLFLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIPLaaayytrrr  1061
             R  +++N I++ IG CGG L++RLYF  GG+R+WFST L TAG+PI FIPL  +Y  RRR
Sbjct  3     RALVIINCIILAIGNCGGPLIMRLYFNNGGHRIWFSTFLETAGFPIIFIPLFFSYLNRRR  62

Query  1060  httttaasiftiTRNT--FlaaaalgvllGII-------NYLYTYGVSKLPVSTSALIAA  908
                           NT  FL    L +   +I       NYLY YG++ LPVST+ALI A
Sbjct  63    SNNNEG-------ENTRFFLIKPRLLMAAILIGILSGFDNYLYAYGIAYLPVSTAALIIA  115

Query  907   SQLAFTAGGAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAFLMT  728
             SQLAF A  ++ +V  +FT F++NAVVLLT GA VL + +  D+P  E+ K+Y+  FL+T
Sbjct  116   SQLAFIAIFSYFMVSHKFTPFTINAVVLLTVGAAVLGMHTETDKPVHETHKQYMVGFLVT  175

Query  727   LASAALYGALLPCIELTYIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQAISR  548
             +A+A +Y  LLP +EL Y K +Q ++YTLVLE QM++   A+    VGML+  DF+A+  
Sbjct  176   VAAAVMYAFLLPLVELAYQKAKQPMSYTLVLEVQMILCFLASLVSLVGMLIAGDFKALPN  235

Query  547   EARGFEIGEANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLTEVFAVVF  368
             EAR F++GEA +YVV V++A+IWQ  F+GA G I   SSL+SGI+++  + +TEV AV+F
Sbjct  236   EAREFKLGEAMFYVVAVLSAIIWQGFFLGAIGLIFCASSLVSGIMISVLLPITEVLAVIF  295

Query  367   YGEKFGSEKGISLTLSLWGIVSYFYGEMK-NGDNNKKEELQIQVTNMEPNET  215
             Y EKF  EKG+SL LSLWG VSYFYGE+K + D   +EE Q+   N  P  T
Sbjct  296   YHEKFQKEKGLSLALSLWGFVSYFYGEIKADKDKRIQEEAQL---NSLPRRT  344



>ref|XP_006305220.1| hypothetical protein CARUB_v10009586mg [Capsella rubella]
 gb|EOA38118.1| hypothetical protein CARUB_v10009586mg [Capsella rubella]
Length=351

 Score =   309 bits (791),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 167/341 (49%), Positives = 235/341 (69%), Gaps = 4/341 (1%)
 Frame = -1

Query  1240  RLFLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIPLaaayytrrr  1061
             +  +++  I++ IG CGG L++RLYF  GG R+WFST L TAG+P+ FIPL  +Y  RRR
Sbjct  3     KALVIITCIILAIGNCGGPLIMRLYFNNGGQRIWFSTFLETAGFPVIFIPLLFSYIHRRR  62

Query  1060  httttaasiftiTRNTFlaaaalgvllG-IINYLYTYGVSKLPVSTSALIAASQLAFTAG  884
             +   +  + F + +   L AA    +L    NYLY YG++ LPVST+ALI ASQLAF A 
Sbjct  63    NNNGSEPTSFFLIKPRLLGAAIFIGILSGFDNYLYAYGIAYLPVSTAALIIASQLAFIAI  122

Query  883   GAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAFLMTLASAALYG  704
              +F +VK +FT F++NAVVLLT GA VL + +  D+PA E++K+YV  FLMT+A+A +Y 
Sbjct  123   FSFFMVKHKFTPFTINAVVLLTVGAAVLGMHTETDKPAHETRKQYVTGFLMTVAAAVMYS  182

Query  703   ALLPCIELTYIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQAISREARGFEIG  524
              +LP +EL Y K +Q ++YTLVLE QMV+   A+    +GM +  DF+A+ +EA+ F++G
Sbjct  183   LILPLVELAYQKAKQPMSYTLVLEVQMVLCFLASIVSLIGMSIAGDFKALPKEAKEFKLG  242

Query  523   EANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLTEVFAVVFYGEKFGSE  344
             EA +YVV V +A+IWQ  F+GA G I   SSL+SGI+++  + +TEV AV+FY EKF +E
Sbjct  243   EAVFYVVAVFSAIIWQGFFLGAIGLIFCTSSLVSGIMISVLLPITEVLAVIFYHEKFQAE  302

Query  343   KGISLTLSLWGIVSYFYGEMKNGDNNKKEELQIQVTNMEPN  221
             KG+SL LSLWG VSYFYGE+K+    K+ +   Q  + EP 
Sbjct  303   KGLSLALSLWGFVSYFYGEIKSAKEKKRIQ---QEESQEPE  340



>emb|CDY29741.1| BnaA01g19250D [Brassica napus]
Length=377

 Score =   310 bits (793),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 179/345 (52%), Positives = 246/345 (71%), Gaps = 4/345 (1%)
 Frame = -1

Query  1258  KGNMRRRLFLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIPLaaa  1079
             K  M+  L +++N I++ IG CGG L+ RLYF  GG R+WFS+ L TAG PI   PL  +
Sbjct  30    KKKMKTGL-VMINCIILAIGNCGGPLITRLYFRNGGKRIWFSSFLQTAGCPIILFPLLFS  88

Query  1078  yytrrrhttttaasiftiTRNTFlaaaalgvllGIINYLYTYGVSKLPVSTSALIAASQL  899
             +  RR+  TTT   +       FLA+  +G+L G+ NYLY YG++ LPVSTS+L+ +SQL
Sbjct  89    FRLRRKEATTTPFFLIK--PPLFLASIVIGLLTGVDNYLYAYGLAYLPVSTSSLVISSQL  146

Query  898   AFTAGGAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAFLMTLAS  719
             AFTA  AF +VKQ+FT F +NAVVLLT GAG+LA+ ++GD+ A E+ KEY+  FLMTLA+
Sbjct  147   AFTAFFAFFMVKQKFTPFIINAVVLLTLGAGILALHTDGDKLAKETHKEYIVGFLMTLAA  206

Query  718   AALYGALLPCIELTYIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQAISREAR  539
             A LY  +LP +ELTY K R+ ++YTLVLE QMV+   AT FC VGML + DF+ ++REAR
Sbjct  207   AILYAFVLPLVELTYKKARKRISYTLVLEMQMVLCFGATCFCLVGMLADGDFKELAREAR  266

Query  538   GFEIGEAN-YYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLTEVFAVVFYG  362
              F++G +  YYVVVV TA+IWQ  F+G+ G I   SSL+SGI++ A + LTEV AV F+ 
Sbjct  267   DFKLGRSTYYYVVVVFTAIIWQGFFLGSIGMIFCASSLVSGILICALLPLTEVLAVFFFR  326

Query  361   EKFGSEKGISLTLSLWGIVSYFYGEMKNGDNNKKEELQIQVTNME  227
             EKF +EKG+SL LSLWG VSYFYG++K+ +  + ++ + Q++ + 
Sbjct  327   EKFQAEKGLSLFLSLWGFVSYFYGQIKSENKTETQDQEAQLSQLP  371



>ref|XP_010538169.1| PREDICTED: purine permease 3-like [Tarenaya hassleriana]
Length=346

 Score =   308 bits (790),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 169/335 (50%), Positives = 230/335 (69%), Gaps = 1/335 (0%)
 Frame = -1

Query  1228  LLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIPLaaayytrrrhttt  1049
             ++N I++ IG CGG L+ RLY+  GG R+W S+ L T G+PI  IPL      R+R    
Sbjct  7     IINCILLGIGNCGGPLMSRLYYNNGGQRIWLSSLLETGGFPIMSIPLFFCLLDRKRKRNR  66

Query  1048  taasiftiTR-NTFlaaaalgvllGIINYLYTYGVSKLPVSTSALIAASQLAFTAGGAFL  872
                +   + +   F AAA  G+L G+ +Y+Y YG+S LPVST++LI ASQLAFTA  AF 
Sbjct  67    DEKTRLILMKPRLFAAAAVAGLLTGVDDYIYAYGLSFLPVSTASLIIASQLAFTAFFAFF  126

Query  871   LVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAFLMTLASAALYGALLP  692
             LVKQ+FT FS+NA+VLLT GAGVLA+ + GD P  E+ K+Y+  FL+T+ +A LY  +LP
Sbjct  127   LVKQKFTPFSINAIVLLTLGAGVLALHTAGDVPPNETHKQYITGFLLTIGAAVLYAFVLP  186

Query  691   CIELTYIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQAISREARGFEIGEANY  512
              +EL+Y K  Q +TYTLVLEFQ VM  FAT FC  G+ ++ DF+ I  EA+ F++GE  Y
Sbjct  187   LVELSYKKANQPITYTLVLEFQFVMCFFATLFCATGLFISGDFKMIPAEAKTFKLGETLY  246

Query  511   YVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLTEVFAVVFYGEKFGSEKGIS  332
             YVV+V  +++WQ  F+GA G I   SSL+SGI++A  + LTE+ AVVF+GEKF +EKG+S
Sbjct  247   YVVIVFASMMWQCFFLGAIGVIFCASSLVSGILIAVLLPLTEILAVVFFGEKFQAEKGVS  306

Query  331   LTLSLWGIVSYFYGEMKNGDNNKKEELQIQVTNME  227
             L LSLWG  SYFYGE+K+    +  E   + T+M+
Sbjct  307   LVLSLWGFASYFYGEVKSDKERRDNERTREETDMD  341



>ref|XP_009109746.1| PREDICTED: purine permease 1-like [Brassica rapa]
Length=356

 Score =   308 bits (788),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 174/346 (50%), Positives = 235/346 (68%), Gaps = 10/346 (3%)
 Frame = -1

Query  1249  MRRRLFLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIPLaaayyt  1070
             M +   L++  I + IG CGG LL RLY+ +GG+R+WF + L+TAG PI  IPL  ++  
Sbjct  1     MMKNGLLIIVCIFLAIGTCGGPLLTRLYYTKGGSRIWFMSFLATAGCPIILIPLYVSFLR  60

Query  1069  -----rrrhttttaasiftiTRNTFlaaaalgvllGIINYLYTYGVSKLPVSTSALIAAS  905
                       T   A +F +    F+A+  +G+L+G+ NYLY YG++ LPVSTS+LI  +
Sbjct  61    RSNRNHNNSETAEKAKVFVMETPLFIASIVIGLLIGLDNYLYAYGLAYLPVSTSSLIVGT  120

Query  904   QLAFTAGGAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAFLMTL  725
             QLAF A  +FL+VKQ+FT FS+NAVVLLT G G+LA+ ++ DRPAG SKKEYV  FL+TL
Sbjct  121   QLAFNAIFSFLMVKQKFTPFSINAVVLLTVGTGILALHTDRDRPAGVSKKEYVVGFLLTL  180

Query  724   ASAALYGALLPCIELTYIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQAISRE  545
              +A LY  L+P +ELTY K RQ +T+TLVLE QMVM + +T FC VGM+V  DF AI RE
Sbjct  181   IAAVLYAFLMPLVELTYKKVRQEITFTLVLEMQMVMCVASTCFCLVGMVVKGDFVAIPRE  240

Query  544   ARGFEIGEA-NYYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLTEVFAVVF  368
             AR F IG +  YY ++VV  ++WQ  F+GA G +   SSL SG+ ++  + +TEV AVV 
Sbjct  241   AREFMIGSSLFYYTLIVVIGIVWQCFFLGALGVVYCASSLASGVFVSVLLPVTEVLAVVC  300

Query  367   YGEKFGSEKGISLTLSLWGIVSYFYGEMKNG----DNNKKEELQIQ  242
             + EKF +EKG++L LSLWG VSYFYGE K+G    D+ K  E ++ 
Sbjct  301   FREKFQAEKGVALLLSLWGFVSYFYGEFKSGKKIIDSPKSPETELP  346



>ref|XP_006357925.1| PREDICTED: purine permease 3-like [Solanum tuberosum]
Length=343

 Score =   306 bits (785),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 173/344 (50%), Positives = 232/344 (67%), Gaps = 6/344 (2%)
 Frame = -1

Query  1243  RRLFLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIPLaaayytrr  1064
              ++FL++N I++ IG CG  L++RLYFI+GG R+W S  L T  WPINFIPLA +Y  RR
Sbjct  2     NKVFLIINCIILTIGTCGAPLIMRLYFIKGGKRIWLSCWLQTVAWPINFIPLAISYLYRR  61

Query  1063  rhttttaasiftiTRNTFlaaaalgvllGIINYLYTYGVSKLPVSTSALIAASQLAFTAG  884
              +  ++   + T     F+A   +G+L G+ NY Y+YGV+KLPVST+ L+ ++QLAF A 
Sbjct  62    NNNNSSKLILMT--PRIFMATIGIGILQGLSNYFYSYGVAKLPVSTNGLLISTQLAFIAF  119

Query  883   GAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAFLMTLASAALYG  704
              AF++VK + T++S+N+V LLT GA VLA+ S GDRP GE+ KEY+  F+MTLASAAL G
Sbjct  120   FAFIIVKLKLTSYSINSVFLLTIGAVVLALHSGGDRPEGETNKEYILGFIMTLASAALTG  179

Query  703   ALLPCIELTYIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQAISREARGFEIG  524
              + P +EL Y K +Q++TYT VLEFQ V    AT F T+GM++N DFQAIS EA+ FE+G
Sbjct  180   LIFPLVELIYKKAQQAITYTFVLEFQTVYCFVATVFSTIGMVINNDFQAISGEAKAFELG  239

Query  523   EANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLTEVFAVVFYGEKFGSE  344
             E  YYVV++  A++ Q  F+G  G I   SSL+SGI+    + + EV AV  Y EKF +E
Sbjct  240   EGRYYVVIICIAIVLQFYFLGTIGVIYSASSLVSGILATFLLPVNEVLAVFLYSEKFSAE  299

Query  343   KGISLTLSLWGIVSYFYGEMKNGDNNKKEE----LQIQVTNMEP  224
             KGISL LSLWG  SYFYG+ K     K ++      I  TN  P
Sbjct  300   KGISLALSLWGFASYFYGDYKENKKRKNDQSPETKTIDKTNYTP  343



>ref|XP_009109745.1| PREDICTED: purine permease 1 [Brassica rapa]
 emb|CDX90136.1| BnaA08g18480D [Brassica napus]
Length=352

 Score =   306 bits (785),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 168/340 (49%), Positives = 235/340 (69%), Gaps = 5/340 (1%)
 Frame = -1

Query  1231  LLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIPLaaayytrrr---  1061
             ++++ +++ IG CGG LL RLY+  GG R+WF + LSTAG+P+  +PL  ++ +RR    
Sbjct  6     IIISCVILTIGTCGGPLLTRLYYTNGGKRIWFMSFLSTAGFPVILVPLFFSFLSRRNRNN  65

Query  1060  httttaasiftiTRNTFlaaaalgvllGIINYLYTYGVSKLPVSTSALIAASQLAFTAGG  881
               T     +  +    F+A+  +G+L G+ NYLY YG++ LPVSTS+LI  +QLAF A  
Sbjct  66    SETAEKPKLILMETPLFIASIVIGLLTGLDNYLYAYGLAYLPVSTSSLIIGTQLAFNALF  125

Query  880   AFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAFLMTLASAALYGA  701
             AF +VKQ+FT FS+NAVVLLT G  VLA+ S+GD+PA E+ KEYV  FLMT+ +A LY  
Sbjct  126   AFFMVKQKFTPFSINAVVLLTVGIVVLALHSSGDKPANETHKEYVVGFLMTVIAAVLYAF  185

Query  700   LLPCIELTYIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQAISREARGFEI-G  524
             +LP +ELTY K RQ +T+ LVLE QMVM L AT FC VGM+++ DF+ ISREAR F+I G
Sbjct  186   ILPLVELTYKKARQEITFPLVLEIQMVMCLAATCFCVVGMIIDGDFKVISREAREFKIGG  245

Query  523   EANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLTEVFAVVFYGEKFGSE  344
              A YY ++++T ++WQ  F+GA G +   SSL S ++++  + +TEV AV+ + EKF +E
Sbjct  246   SAFYYTLIMITGIVWQGFFLGAIGVVFCASSLASAVLISVLLPVTEVLAVICFREKFQAE  305

Query  343   KGISLTLSLWGIVSYFYGEMKNGDNNKKEELQIQVTNMEP  224
             KG+SL LS+WG VSYFYGE K+G     E+ Q   T + P
Sbjct  306   KGVSLFLSIWGFVSYFYGEYKSG-KKVLEKHQPPETELPP  344



>ref|XP_006305203.1| hypothetical protein CARUB_v10009570mg [Capsella rubella]
 gb|EOA38101.1| hypothetical protein CARUB_v10009570mg [Capsella rubella]
Length=355

 Score =   307 bits (786),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 173/347 (50%), Positives = 234/347 (67%), Gaps = 12/347 (3%)
 Frame = -1

Query  1231  LLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIPLaaayytr-----  1067
             L++N I++ IG CGG LL RLY+  GG R+WF + LSTAG+PI  IPL  ++  R     
Sbjct  6     LIINCIILAIGTCGGPLLTRLYYNNGGKRIWFMSFLSTAGFPIILIPLFVSFLNRRRCNR  65

Query  1066  rrhttttaasiftiTRNTFlaaaalgvllGIINYLYTYGVSKLPVSTSALIAASQLAFTA  887
             +         +F +    F+A+  +G+L G+ NYLY+YG++ LPVSTS+LI  +QLAF A
Sbjct  66    KNVANAAKTELFLMETPLFVASIVIGLLSGLDNYLYSYGLAYLPVSTSSLIVGTQLAFNA  125

Query  886   GGAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAFLMTLASAALY  707
               +FLLVKQ+FT FS+NAVVLLT G G+LA+ S+GD+PA ES +EYV  FLMTL +A LY
Sbjct  126   LFSFLLVKQKFTPFSINAVVLLTVGTGILALHSDGDKPANESHREYVIGFLMTLIAAVLY  185

Query  706   GALLPCIELTYIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQAISREARGFEI  527
               +LP +ELTY K RQ +T+ LVLE QMVM L AT FC VGM +  DF+ I++EAR F+I
Sbjct  186   AFILPLVELTYKKARQEITFQLVLEIQMVMCLAATGFCVVGMFIVGDFKVIAKEAREFKI  245

Query  526   -GEANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLTEVFAVVFYGEKFG  350
              G   YY ++V+T +I Q   +GA G +   SSL SG++++  + +TEV AVV + EKF 
Sbjct  246   GGPVFYYALIVITGIIMQGFSLGAIGVVFCASSLASGVLISVLLPVTEVLAVVCFREKFQ  305

Query  349   SEKGISLTLSLWGIVSYFYGEMKNGDNNKKEELQIQVTNMEPNETLP  209
             +EKG+SL LS+WG VSYFYGE K+G     ++ Q      +P   LP
Sbjct  306   AEKGVSLFLSMWGFVSYFYGEFKSGKKVVVDKPQ------QPETELP  346



>ref|XP_002893513.1| hypothetical protein ARALYDRAFT_890360 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69772.1| hypothetical protein ARALYDRAFT_890360 [Arabidopsis lyrata subsp. 
lyrata]
Length=356

 Score =   306 bits (785),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 173/349 (50%), Positives = 229/349 (66%), Gaps = 20/349 (6%)
 Frame = -1

Query  1201  GGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIPLaaayytrrrhttttaasiftiT  1022
             G CGG LL RLYF  GG R+WF + L TAG PI  +PL A++  RRR    +  +  T  
Sbjct  16    GTCGGPLLTRLYFTNGGKRIWFMSFLQTAGCPIILLPLVASFLRRRRSNRNSNNAENTPK  75

Query  1021  RNTFlaaaalgvllGII-------NYLYTYGVSKLPVSTSALIAASQLAFTAGGAFLLVK  863
                FL    L +   +I       NYLY+YG++ LPVSTS+LI  +QLAF A  AFLLVK
Sbjct  76    TKIFLMETPLFIASIVIGLLTGLDNYLYSYGLAYLPVSTSSLIIGTQLAFNALFAFLLVK  135

Query  862   QRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAFLMTLASAALYGALLPCIE  683
             Q+FT FS+NAVVLLT G G+LA+ S+GD+PA ES K+YV  FLMT+ +A LY  +LP +E
Sbjct  136   QKFTPFSINAVVLLTVGTGILALHSDGDKPANESHKQYVIGFLMTVVAAVLYAFILPLVE  195

Query  682   LTYIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQAISREARGFEI-GEANYYV  506
             LTY K RQ +T+ LV E QMVM + AT FC VGM +  DF+ I+REAR F+I G   YY 
Sbjct  196   LTYKKARQEITFPLVFEIQMVMCVAATLFCLVGMFIVGDFKVIAREAREFKIGGSVFYYA  255

Query  505   VVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLTEVFAVVFYGEKFGSEKGISLT  326
             ++V+T ++WQ  F+GA G +   SSL SG++++  + +TEV AVV + EKF +EKG+SL 
Sbjct  256   LIVITGIVWQGFFLGAIGIVFCASSLASGVLISVLLPVTEVLAVVCFREKFQAEKGVSLL  315

Query  325   LSLWGIVSYFYGEMKNG----DNNKKEELQIQVTNMEPNETLPM*HSIA  191
             LSLWG VSYFYGE+K+G    D  +  E ++ +        LP+  S+A
Sbjct  316   LSLWGFVSYFYGEIKSGKKVLDKPQPPETELPI--------LPVSDSVA  356



>emb|CDY12422.1| BnaC08g09110D [Brassica napus]
Length=376

 Score =   307 bits (786),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 179/346 (52%), Positives = 243/346 (70%), Gaps = 5/346 (1%)
 Frame = -1

Query  1258  KGNMRRRLFLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIPLaaa  1079
             K  M+  L +++N I++ IG CGG L+ RLYF  GG R+WFS+ L TAG PI   PL  +
Sbjct  30    KKKMKTGL-VMINCIILAIGNCGGPLITRLYFRNGGKRIWFSSFLQTAGCPIILFPLLFS  88

Query  1078  yytrrrhttttaasiftiTRNTFlaaaalgvllGIINYLYTYGVSKLPVSTSALIAASQL  899
             +  RR+  TTT   +       FLA+  +G+L G+ NYLY YG++ LPVSTS+L+ +SQL
Sbjct  89    FRLRRKEATTTPFFLIK--PPLFLASIVIGLLTGVDNYLYAYGLAYLPVSTSSLVISSQL  146

Query  898   AFTAGGAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAFLMTLAS  719
             AFTA  AF +VKQ+FT F +NAVVLLT GAG+LA+ ++GD+ A E+ KEY+  FLMTLA+
Sbjct  147   AFTAFFAFFMVKQKFTPFIINAVVLLTLGAGILALHTDGDKLAKETHKEYIVGFLMTLAA  206

Query  718   AALYGALLPCIELTYIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQAISREAR  539
             A LY  +LP +ELTY K RQ ++YTLVLE Q+V+   AT FC VGML + DF+ ++REAR
Sbjct  207   AILYAFVLPLVELTYKKARQRISYTLVLEMQLVLCFVATCFCLVGMLADGDFKELAREAR  266

Query  538   GFEIGEAN--YYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLTEVFAVVFY  365
              F++G +   YYVVVV TA+IWQ  F+G+ G I   SSL+SGI++ A + LTEV AV F+
Sbjct  267   DFKLGGSTTYYYVVVVFTAIIWQGFFLGSIGMIFCASSLVSGILICALLPLTEVLAVFFF  326

Query  364   GEKFGSEKGISLTLSLWGIVSYFYGEMKNGDNNKKEELQIQVTNME  227
              EKF +EK ISL LSLWG VSYFYG++K  +  +  + + Q++ + 
Sbjct  327   REKFQAEKSISLFLSLWGFVSYFYGQIKAENKTETPDQEAQLSQLP  372



>ref|XP_002881298.1| ATPUP2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH57557.1| ATPUP2 [Arabidopsis lyrata subsp. lyrata]
Length=358

 Score =   306 bits (784),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 171/355 (48%), Positives = 239/355 (67%), Gaps = 12/355 (3%)
 Frame = -1

Query  1243  RRLFLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIPLaaayytrr  1064
             + + +++N I + IG CGG L++RLYF  GG R+WFS+ L T G P+   PL  ++  R 
Sbjct  4     KTVLVIINCIFLAIGNCGGPLMMRLYFSNGGQRIWFSSFLQTVGCPLIIFPLLFSFIRRL  63

Query  1063  rhttttaasiftiTRNT-FlaaaalgvllGIINYLYTYGVSKLPVSTSALIAASQLAFTA  887
             R       + F + +   F+AA  +G+L+G  NYLY+YG++ +PVST++LI ++QL FTA
Sbjct  64    RCLDEQEKTPFFLMKPPLFIAAILVGLLMGFDNYLYSYGLAYIPVSTASLIISAQLGFTA  123

Query  886   GGAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAFLMTLASAALY  707
               AF +VKQ+FT F++NAVVLLT GA VLA+ S+ D+ A E+ KEYV  FLMT+ +A LY
Sbjct  124   LFAFFMVKQKFTPFTINAVVLLTVGAVVLALNSDSDKLANETHKEYVVGFLMTIGAALLY  183

Query  706   GALLPCIELTYIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQ-----------  560
               +LP +ELTY K  Q +TYTL LEFQMV+  FAT FC VGML   DF+           
Sbjct  184   AFILPLVELTYKKSCQRITYTLALEFQMVLCFFATCFCLVGMLAAGDFKVKHALFIFKNR  243

Query  559   AISREARGFEIGEANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLTEVF  380
              I+ EAR F++GE+ YYVVVV TA+IWQ  F+GA G I   SSL+SGI+++A + +T + 
Sbjct  244   VIAGEARDFKLGESLYYVVVVFTAVIWQAFFVGAIGLIFCASSLVSGIMISALLPVTVIL  303

Query  379   AVVFYGEKFGSEKGISLTLSLWGIVSYFYGEMKNGDNNKKEELQIQVTNMEPNET  215
             AV+ + EKF + KG++L LSLWG VSYFYG+MK+ +  K +E Q+    +  +ET
Sbjct  304   AVICFQEKFQAGKGVALALSLWGSVSYFYGQMKSEEKTKAQETQLSQLPVTDSET  358



>gb|KFK44691.1| hypothetical protein AALP_AA1G290900 [Arabis alpina]
Length=351

 Score =   305 bits (781),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 167/345 (48%), Positives = 236/345 (68%), Gaps = 4/345 (1%)
 Frame = -1

Query  1249  MRRRLFLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIPLaaayyt  1070
             M  +  +++N I++ IG CGG L++RLYF  GG R+WFS+ L TAG+P+  IPL  +Y  
Sbjct  1     MATKALVIINCIILAIGNCGGPLIMRLYFNNGGKRIWFSSFLETAGFPVILIPLFFSYLN  60

Query  1069  rrrht----tttaasiftiTRNTFlaaaalgvllGIINYLYTYGVSKLPVSTSALIAASQ  902
             R R      T+   S F I      AA  +GVL G  NYLY YG++ LPVST+ALI ASQ
Sbjct  61    RLRRNNNNGTSENISFFLIKPRLLFAAVLVGVLSGFDNYLYAYGIAYLPVSTAALIIASQ  120

Query  901   LAFTAGGAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAFLMTLA  722
             LAF A  ++ +V  +FT +++NAVVLLT GA VL + +  D+P  E+ K+YV  FLMT+A
Sbjct  121   LAFIAIFSYFMVNHKFTPYTINAVVLLTVGAAVLGMHTETDKPVHETHKQYVIGFLMTVA  180

Query  721   SAALYGALLPCIELTYIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQAISREA  542
             +A +Y  +LP +EL Y K +Q ++YTLVLE Q+V+ LFA+    +GM +  DF+A+  EA
Sbjct  181   AAVMYAFILPLVELAYQKAKQPMSYTLVLEVQLVLCLFASLVSLIGMFIAGDFKALPIEA  240

Query  541   RGFEIGEANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLTEVFAVVFYG  362
             R F++GEA +YVVVV +A+IWQ  F+GA G I   SSL+SGI+++  + +TEV AV+FY 
Sbjct  241   REFKLGEALFYVVVVFSAIIWQGFFLGAIGLIFCASSLVSGIMISVLLPITEVLAVIFYH  300

Query  361   EKFGSEKGISLTLSLWGIVSYFYGEMKNGDNNKKEELQIQVTNME  227
             EKF +EKG+SL LSLWG VSYFYGE+K+    K+ + + ++ ++ 
Sbjct  301   EKFQAEKGLSLALSLWGFVSYFYGEIKSDKEKKRIQQETELASLP  345



>ref|XP_009143832.1| PREDICTED: purine permease 2 isoform X1 [Brassica rapa]
Length=351

 Score =   303 bits (776),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 164/347 (47%), Positives = 243/347 (70%), Gaps = 5/347 (1%)
 Frame = -1

Query  1243  RRLFLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIPLa---aayy  1073
             + + +++N I++ IG CGG L+ RLYF  GG R+WFS+ L T+G PI  +PL       +
Sbjct  4     KTVLVIINCIILAIGNCGGPLMTRLYFRNGGKRIWFSSFLQTSGCPIILLPLLFSFLTRH  63

Query  1072  trrrhttttaasiftiTRNTFlaaaalgvllGIINYLYTYGVSKLPVSTSALIAASQLAF  893
              +++       ++F I    FLA+  +G+L+G  NYLY YG++ LPVSTS+LI +SQLAF
Sbjct  64    RQQQEQEEPKTTLFLIKPPLFLASVVVGLLIGFDNYLYAYGLAYLPVSTSSLIISSQLAF  123

Query  892   TAGGAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAFLMTLASAA  713
             TA  AF +VKQRFT F++NAVVLLT GAG LA+ ++GD+   E++KEY+  F+MT+A+A 
Sbjct  124   TALFAFFMVKQRFTPFTINAVVLLTLGAGSLALHADGDKLPKETRKEYIVGFVMTVAAAV  183

Query  712   LYGALLPCIELTYIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQAISREARGF  533
             LY  +LP +EL Y K  Q ++YTLVLE Q+V+ + AT  C VGML + DF+ + REAR F
Sbjct  184   LYAFVLPLVELAYKKASQRISYTLVLEMQLVLCVVATCLCLVGMLADGDFKELGREAREF  243

Query  532   EIGEANYYVVVVV-TALIWQILFIGAAGSICYGSSLLSGIILAATISLTEVFAVVFYGEK  356
             ++G + +Y +VV  TA+IWQ  F+G+ G I   SSL+SG++++A + LTEV AV+F+ EK
Sbjct  244   KLGGSKHYCLVVAFTAVIWQGFFLGSIGMIFCASSLVSGVLISALLPLTEVLAVLFFKEK  303

Query  355   FGSEKGISLTLSLWGIVSYFYGEMKNGDNNKKEELQIQVTNMEPNET  215
             F + KG+SL LSLWG VSYFYG++++ +  KK+  + +++ +   E+
Sbjct  304   FQAAKGVSLFLSLWGFVSYFYGKIQS-EKEKKKTQEAELSQLPATES  349



>ref|XP_004957086.1| PREDICTED: purine permease 3-like [Setaria italica]
Length=356

 Score =   301 bits (772),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 172/341 (50%), Positives = 232/341 (68%), Gaps = 5/341 (1%)
 Frame = -1

Query  1291  KLKLKMEVSEGKGNMRRRLFLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAG  1112
              ++ + + +  +G   RRL + LN  M+ +G  GG LL RLYF +GG+R W S  L TAG
Sbjct  2     DVEARKDAAPARGKAMRRLLVALNCGMLALGAIGGPLLSRLYFSKGGHRQWLSAWLETAG  61

Query  1111  WPINFIPLaaayytrrrhttttaasiftiTRNTFlaaaalgvllGIINYLYTYGVSKLPV  932
             WP+  +P+ AAY  RR       A +        LAA  LGV  G+ +++Y YG+S LPV
Sbjct  62    WPLLLVPVVAAYVARRARDRAAPALLTPP--RILLAAVGLGVATGVDDFIYAYGLSYLPV  119

Query  931   STSALIAASQLAFTAGGAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKE  752
             STSA++ ++QLAFT   AFL+V+QR TA SVNAV LLT GA VL +  + DRP G ++ +
Sbjct  120   STSAILISTQLAFTVLFAFLIVRQRLTAASVNAVALLTVGAVVLGLHVSSDRPPGVTRGQ  179

Query  751   YVAAFLMTLASAALYGALLPCIELTYIK---GRQSLTYTLVLEFQMVMSLFATAFCTVGM  581
             Y   F++TL +AALYG +LP +EL Y +   G +++TY LV+E Q+VM  FATAFCTVGM
Sbjct  180   YWLGFILTLGAAALYGLVLPLVELAYRRAAGGGRAVTYALVIEMQLVMGFFATAFCTVGM  239

Query  580   LVNKDFQAISREARGFEIGEANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAAT  401
             +VNKDFQAI REA+ FE+GEA YY V+V +A++WQ  F+GA G I    +LL+GI++A  
Sbjct  240   IVNKDFQAIPREAKHFELGEARYYTVLVWSAVLWQCFFLGAVGVIFCVHTLLAGILIAVF  299

Query  400   ISLTEVFAVVFYGEKFGSEKGISLTLSLWGIVSYFYGEMKN  278
             I +TEV AV+F  EKF SEKG++L LSLWG+ SY YGE  +
Sbjct  300   IPVTEVAAVIFLHEKFSSEKGVALVLSLWGLASYSYGEWSD  340



>ref|NP_973592.1| purine permease 2 [Arabidopsis thaliana]
 gb|AEC08879.1| purine permease 2 [Arabidopsis thaliana]
Length=347

 Score =   300 bits (769),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 164/334 (49%), Positives = 235/334 (70%), Gaps = 1/334 (0%)
 Frame = -1

Query  1243  RRLFLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIPLaaayytrr  1064
             + + +++N I + IG CGG L++RLYF  GG R+WF + L T G P+ F PL  ++  RR
Sbjct  4     KTVLVIINCIFLAIGNCGGPLMMRLYFQNGGERIWFPSFLQTVGCPLIFFPLLLSFLRRR  63

Query  1063  rhttttaasiftiTRNT-FlaaaalgvllGIINYLYTYGVSKLPVSTSALIAASQLAFTA  887
             R       + F + +   F+AA  +G+L+G  NYLY+YG++ +PVST++LI ++QL FTA
Sbjct  64    RCLEEQETTPFFLMKPPLFIAAIVVGLLVGFDNYLYSYGLAYIPVSTASLIISAQLGFTA  123

Query  886   GGAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAFLMTLASAALY  707
               AF +VKQ+FT F++NA+VLLT GA VLA+ S+ D+ A E+ KEYV  F+MTL +A LY
Sbjct  124   LFAFFMVKQKFTPFTINAIVLLTGGAVVLALNSDSDKLANETHKEYVVGFIMTLGAALLY  183

Query  706   GALLPCIELTYIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQAISREARGFEI  527
             G +LP +EL+Y K  Q +TYTL LEFQMV+   AT  C VGML   DF+ I+ EAR F++
Sbjct  184   GFILPLVELSYKKSGQRITYTLALEFQMVLCFAATCVCLVGMLAAGDFKVIAGEARDFKL  243

Query  526   GEANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLTEVFAVVFYGEKFGS  347
             GE+ YYVV+V TA+IWQ  F+GA G I   SSL+SGI+++A + +T + AV+ + EKF +
Sbjct  244   GESLYYVVIVFTAIIWQAFFVGAIGLIFCASSLVSGIMVSALLPVTVILAVICFQEKFQA  303

Query  346   EKGISLTLSLWGIVSYFYGEMKNGDNNKKEELQI  245
              KG++L LSLWG VSYFYG++K+ +  K ++ Q+
Sbjct  304   GKGVALALSLWGSVSYFYGQVKSEEKTKAQDTQL  337



>emb|CDY16284.1| BnaC01g23190D [Brassica napus]
Length=377

 Score =   301 bits (770),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 176/346 (51%), Positives = 239/346 (69%), Gaps = 6/346 (2%)
 Frame = -1

Query  1258  KGNMRRRLFLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIPLaaa  1079
             K  M+  L +++N I++ IG CGG L+ RLYF  GG R+WFS+ L TAG P    PL  +
Sbjct  32    KKKMKTGL-VIINCIILAIGNCGGPLITRLYFRNGGKRIWFSSFLQTAGCPSILFPLLFS  90

Query  1078  yytrrrhttttaasiftiTRNTFlaaaalgvllGIINYLYTYGVSKLPVSTSALIAASQL  899
             +  R+  TTT    I       FLA+  +G+L G+ NYLY YG++ LPVSTS+L+ +S L
Sbjct  91    FLRRKEATTTPFFLIK---PPLFLASIVIGLLTGVDNYLYAYGLAYLPVSTSSLVISSHL  147

Query  898   AFTAGGAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAFLMTLAS  719
             AFTA  AF +VKQ+FT F +NAVVLLT GAG+LA+ ++GD+ A E+ KEY+  F MTLA+
Sbjct  148   AFTAFFAFFMVKQKFTPFIINAVVLLTLGAGILALHTDGDKLAKETHKEYIVGFFMTLAA  207

Query  718   AALYGALLPCIELTYIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQAISREAR  539
             A LY  +LP +ELTY K RQ ++YTLVLE Q+V+   AT FC VGML + DF+ ++REAR
Sbjct  208   AILYAFVLPLVELTYKKARQRISYTLVLEMQLVLCFVATCFCLVGMLADGDFKELAREAR  267

Query  538   GFEIGEAN--YYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLTEVFAVVFY  365
              F++G +   YYVVVV TA+IWQ  F+G+ G I   SSL+SGI++ A + LTEV AV F+
Sbjct  268   DFKLGGSTTYYYVVVVFTAIIWQGFFLGSIGMIFCASSLVSGILICALLPLTEVLAVFFF  327

Query  364   GEKFGSEKGISLTLSLWGIVSYFYGEMKNGDNNKKEELQIQVTNME  227
              EKF +EK ISL LSLWG VSYFYG++K  +  +  + + Q++ + 
Sbjct  328   REKFQAEKSISLFLSLWGFVSYFYGQIKAENKTETPDQEAQLSQLP  373



>dbj|BAJ86755.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=360

 Score =   300 bits (767),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 171/337 (51%), Positives = 228/337 (68%), Gaps = 5/337 (1%)
 Frame = -1

Query  1279  KMEVSEGKGNMRRRLFLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPIN  1100
             +      +G   +RL + LN  M+ +G  GG LL RLYF +GG+R W S  L T GWP+ 
Sbjct  11    QRPAPPARGKAMQRLLVALNCGMLTLGTTGGPLLSRLYFSKGGHRKWLSAWLETGGWPLL  70

Query  1099  FIPLaaayytrrrhttttaasiftiTRNTFlaaaalgvllGIINYLYTYGVSKLPVSTSA  920
              +P+AA+Y  RR    +    +        +AAA LG+  G  ++LY YG+S +PVSTSA
Sbjct  71    LLPVAASYLRRRAQDPSAPVVLAPP--RILVAAAGLGLATGADDFLYAYGLSFVPVSTSA  128

Query  919   LIAASQLAFTAGGAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAA  740
             ++ ++QLAFT   AFL+V+QR TA SVNAV LLT GA VL +  + DRPAG ++ +Y   
Sbjct  129   ILISTQLAFTVLFAFLIVRQRLTALSVNAVALLTVGAVVLGLHVSSDRPAGVTRGQYWLG  188

Query  739   FLMTLASAALYGALLPCIELTYIK---GRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNK  569
             FL+TL SAALYG +LP IELTY +   G + +TY LV+E Q+VM  FATAFCTVGM+VN 
Sbjct  189   FLLTLGSAALYGLVLPLIELTYKRAAGGGRVVTYALVMEMQLVMGFFATAFCTVGMIVNN  248

Query  568   DFQAISREARGFEIGEANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLT  389
             DFQA++REAR FE+GEA YY V+V +A++WQ  F+GA G I    +L +GI++A  I +T
Sbjct  249   DFQAMAREARAFELGEARYYTVLVWSAILWQFFFLGAVGVIFCVHTLFAGILIAVFIPVT  308

Query  388   EVFAVVFYGEKFGSEKGISLTLSLWGIVSYFYGEMKN  278
             EV AV+F  EKF SEKG++L LSLWG+ SY YGE  +
Sbjct  309   EVLAVIFLHEKFSSEKGVALVLSLWGLASYSYGEYSD  345



>ref|XP_003519187.1| PREDICTED: purine permease 1-like [Glycine max]
Length=344

 Score =   299 bits (766),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 184/355 (52%), Positives = 244/355 (69%), Gaps = 12/355 (3%)
 Frame = -1

Query  1249  MRRRLFLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIPLaaayyt  1070
             M +R+ LL+N I++  G  GGAL++RLYFI GG R+W S+ L TA +PI    L      
Sbjct  1     MMKRILLLINTILLATGTSGGALVMRLYFIHGGKRIWLSSFLETAAFPIII--LPIIISY  58

Query  1069  rrrhttttaasiftiTRNTFlaaaalgvllGIINYLYTYGVSKLPVSTSALIAASQLAFT  890
               +     ++++ +I    FLA+A +G+L G+ +YLY  GV++LPVST +LI AS LAFT
Sbjct  59    IHKRRRHRSSALISIKPPLFLASALIGLLTGLDDYLYACGVARLPVSTFSLIQASHLAFT  118

Query  889   AGGAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAFLMTLASAAL  710
             A  AFLLV+ RFT +SVN+VVLLT  A VLA+ S+GDRPAGES ++YV  F+M LA+AAL
Sbjct  119   AVFAFLLVRHRFTPYSVNSVVLLTVAAVVLALRSSGDRPAGESSRQYVIGFVMILAAAAL  178

Query  709   YGALLPCIELTYIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQAISREARGFE  530
             YG +LP +EL Y K RQ +TY+LV+E Q+V+  FAT FCTVGM++N DF+ I REAR F+
Sbjct  179   YGFVLPLMELVYKKSRQRITYSLVMEIQLVLCFFATLFCTVGMIINNDFKVIPREARDFK  238

Query  529   IGEANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLTEVFAVVFYGEKFG  350
             +GE  YYVV+V +A++WQ  F+GA G I   SSLLSGII+AA + +TEV AV+ Y E F 
Sbjct  239   LGETKYYVVLVWSAIMWQFFFLGAIGVIFCASSLLSGIIIAAFLPVTEVLAVIVYKESFH  298

Query  349   SEKGISLTLSLWGIVSYFYGEMKNGDNNKKEELQIQVTNMEPNETLPM*HSIAPS  185
             +EKG++L LSLWG VSYFYGE+K      K        N  P   LP   S+ P+
Sbjct  299   AEKGVALVLSLWGFVSYFYGEIKQDREKNK--------NRCPETDLP--QSLPPN  343



>ref|XP_008806390.1| PREDICTED: purine permease 3-like [Phoenix dactylifera]
Length=367

 Score =   300 bits (767),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 164/327 (50%), Positives = 226/327 (69%), Gaps = 5/327 (2%)
 Frame = -1

Query  1243  RRLFLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIPLaaayytrr  1064
             +R  ++LN +++ +G  GG LL R+YF  GG+R W S+ L T GWP+  +PL+ +Y  RR
Sbjct  22    KRALVVLNCLLLSVGNTGGPLLSRVYFRHGGHRQWLSSWLETGGWPLILLPLSISYLYRR  81

Query  1063  rhttttaasifti-----TRNTFlaaaalgvllGIINYLYTYGVSKLPVSTSALIAASQL  899
             R                 T   FLA A LG+L+G+ ++LY YG+S LPVSTSAL+ +SQL
Sbjct  82    RRRLAPDNHHHPTKLFFLTPRLFLACAVLGLLIGVDDFLYAYGLSFLPVSTSALLISSQL  141

Query  898   AFTAGGAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAFLMTLAS  719
             AFTA  AFL+VKQ+FT +S+N+V LLT GA +L + ++ DRP   S+ +Y+  F +TL +
Sbjct  142   AFTASFAFLIVKQKFTPYSINSVALLTVGAVMLGLHTSSDRPDNVSEGQYLTGFFLTLGT  201

Query  718   AALYGALLPCIELTYIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQAISREAR  539
             AALYG +LP +ELTY K RQ +TYTLV+E Q+VM  FATA CT+GMLVNKDF+ I REAR
Sbjct  202   AALYGLILPLVELTYRKARQVITYTLVMEMQLVMGFFATALCTIGMLVNKDFEVIPREAR  261

Query  538   GFEIGEANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLTEVFAVVFYGE  359
              + +GE  YY+V+V +A++WQ  F+G  G I   ++LL+GII+A  I + E+FA +   E
Sbjct  262   QYGLGEVKYYMVLVWSAILWQCFFLGTVGVIFCVNTLLAGIIIAVFIPVIELFAAILLHE  321

Query  358   KFGSEKGISLTLSLWGIVSYFYGEMKN  278
             KF SEKG+SL L LWG+ SY YGE ++
Sbjct  322   KFTSEKGVSLALCLWGLASYSYGEYRD  348



>ref|XP_010549316.1| PREDICTED: purine permease 3 [Tarenaya hassleriana]
Length=340

 Score =   298 bits (762),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 161/345 (47%), Positives = 223/345 (65%), Gaps = 19/345 (6%)
 Frame = -1

Query  1231  LLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIPLaaayytrrrhtt  1052
             +++N I++ IG CGG L++RLYF  GGNR+WFS+ L TAG+P+  +PL   Y  RRR  T
Sbjct  6     VIINCIILAIGNCGGPLIMRLYFNNGGNRIWFSSFLETAGFPVILLPLLFFYLQRRRTDT  65

Query  1051  ttaasiftiTRNTFlaaaalgvllGII--------NYLYTYGVSKLPVSTSALIAASQLA  896
                       + +F       ++  II        NYLY YG++ LPVST+ALI ASQLA
Sbjct  66    ----------KTSFFLMKPRLLMASIIVGVLSGFDNYLYAYGLAFLPVSTAALIIASQLA  115

Query  895   FTAGGAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAFLMTLASA  716
             F A  +F +VK +FT F++NAVVLLT GA VL + +  D+P  ES K+YV  F+M   +A
Sbjct  116   FIAVFSFFMVKHKFTHFTINAVVLLTIGAAVLGMHTEADKPVEESHKQYVMGFIMAAGAA  175

Query  715   ALYGALLPCIELTYIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQAISREARG  536
              +Y  +LP +EL+Y K RQ +TYTLVLE QMV+  FA+  C  GM    DF+A+  EA  
Sbjct  176   IMYAFILPLVELSYRKARQPITYTLVLEVQMVLCFFASCVCIGGMYFAGDFKALPVEADN  235

Query  535   FEIGEANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLTEVFAVVFYGEK  356
             F++G + +Y+VV+ +A+IWQ  F+GA G I   SSL+SGI+++  + +TEV AV+ + EK
Sbjct  236   FKLGTSMFYLVVIFSAIIWQGFFLGAIGLIFSASSLVSGIMISVLLPITEVLAVIIFHEK  295

Query  355   FGSEKGISLTLSLWGIVSYFYGEMKNGDNNKK-EELQIQVTNMEP  224
             F  EK +SL LSLWG VSYFYGE+K+    K+ EE++      EP
Sbjct  296   FPPEKAVSLVLSLWGFVSYFYGEVKSEKAAKQSEEIEAPPRLPEP  340



>ref|XP_009143833.1| PREDICTED: purine permease 2 isoform X2 [Brassica rapa]
Length=362

 Score =   296 bits (759),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 168/358 (47%), Positives = 244/358 (68%), Gaps = 16/358 (4%)
 Frame = -1

Query  1243  RRLFLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIPLaaayytrr  1064
             + + +++N I++ IG CGG L+ RLYF  GG R+WFS+ L T+G PI  +PL  ++ TR 
Sbjct  4     KTVLVIINCIILAIGNCGGPLMTRLYFRNGGKRIWFSSFLQTSGCPIILLPLLFSFLTRH  63

Query  1063  rhtttt---aasiftiTRNTFlaaaalgvllGIINYLYTYGVSKLPVSTSALIAASQLAF  893
             R          ++F I    FLA+  +G+L+G  NYLY YG++ LPVSTS+LI +SQLAF
Sbjct  64    RQQQEQEEPKTTLFLIKPPLFLASVVVGLLIGFDNYLYAYGLAYLPVSTSSLIISSQLAF  123

Query  892   TAGGAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAFLMTLASAA  713
             TA  AF +VKQRFT F++NAVVLLT GAG LA+ ++GD+   E++KEY+  F+MT+A+A 
Sbjct  124   TALFAFFMVKQRFTPFTINAVVLLTLGAGSLALHADGDKLPKETRKEYIVGFVMTVAAAV  183

Query  712   LYGALLPCIELTYIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDF----------  563
             LY  +LP +EL Y K  Q ++YTLVLE Q+V+ + AT  C VGML + DF          
Sbjct  184   LYAFVLPLVELAYKKASQRISYTLVLEMQLVLCVVATCLCLVGMLADGDFKNQEFDFLFT  243

Query  562   -QAISREARGFEIGEANYYVVVVV-TALIWQILFIGAAGSICYGSSLLSGIILAATISLT  389
              Q + REAR F++G + +Y +VV  TA+IWQ  F+G+ G I   SSL+SG++++A + LT
Sbjct  244   VQELGREAREFKLGGSKHYCLVVAFTAVIWQGFFLGSIGMIFCASSLVSGVLISALLPLT  303

Query  388   EVFAVVFYGEKFGSEKGISLTLSLWGIVSYFYGEMKNGDNNKKEELQIQVTNMEPNET  215
             EV AV+F+ EKF + KG+SL LSLWG VSYFYG++++ +  KK+  + +++ +   E+
Sbjct  304   EVLAVLFFKEKFQAAKGVSLFLSLWGFVSYFYGKIQS-EKEKKKTQEAELSQLPATES  360



>ref|XP_010460596.1| PREDICTED: purine permease 3 [Camelina sativa]
Length=353

 Score =   296 bits (757),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 166/346 (48%), Positives = 231/346 (67%), Gaps = 15/346 (4%)
 Frame = -1

Query  1240  RLFLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIPLaaayytrrr  1061
             +  +++N I++ IG CGG L++RLYF  GG R+WFST L TAG+P+ FIPL  +Y  RRR
Sbjct  3     KALVIINCIILAIGNCGGPLIMRLYFNNGGKRIWFSTFLETAGFPVIFIPLLFSYIHRRR  62

Query  1060  httttaasiftiTRNTFlaaaalgvllGII--------NYLYTYGVSKLPVSTSALIAAS  905
             +      +       +F       +   I+        NYLY YG++ LPVST+ALI AS
Sbjct  63    NNNGGENA------TSFFLIKPRLLGAAIVIGILSGFDNYLYAYGIAYLPVSTAALIIAS  116

Query  904   QLAFTAGGAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAFLMTL  725
             QLAF A  +F +VK +FT F++NAVVLLT GA VL + +  DRP  E+ K+YV  FL+T+
Sbjct  117   QLAFIAIFSFFMVKHKFTPFTINAVVLLTVGAAVLGMHTETDRPVHETHKQYVIGFLVTV  176

Query  724   ASAALYGALLPCIELTYIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQAISRE  545
             A+A +Y  +LP +EL Y K +Q L+YTLVLE QM++   A+    +GM +  DF+A+ +E
Sbjct  177   AAAVVYAFILPLVELAYQKAKQPLSYTLVLEVQMILCFLASIVSLIGMSIAGDFKALPKE  236

Query  544   ARGFEIGEANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLTEVFAVVFY  365
             A+ F++GEA +YVV V +A+IWQ  F+GA G I   SSL+SGI+++  + +TEV AV+FY
Sbjct  237   AKEFKLGEALFYVVAVFSAIIWQGFFLGAIGLIFCTSSLVSGIMISVLLPITEVLAVIFY  296

Query  364   GEKFGSEKGISLTLSLWGIVSYFYGEMKNGDNNKKEELQIQVTNME  227
              EKF +EKG+SL LSLWG VSYFYGE+K+ DN+KK   Q +    E
Sbjct  297   HEKFQAEKGLSLALSLWGFVSYFYGEIKS-DNDKKRIQQEESQETE  341



>ref|XP_002462515.1| hypothetical protein SORBIDRAFT_02g027100 [Sorghum bicolor]
 gb|EER99036.1| hypothetical protein SORBIDRAFT_02g027100 [Sorghum bicolor]
Length=365

 Score =   296 bits (758),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 173/358 (48%), Positives = 231/358 (65%), Gaps = 8/358 (2%)
 Frame = -1

Query  1279  KMEVSEGKGNMRRRLFLL-LNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPI  1103
             K      +GN     FL+ LN  M+ +G  GG LL RLYF +GG+R W S  L T GWP+
Sbjct  7     KDAPPPARGNKAMHRFLVALNCGMLALGAIGGPLLSRLYFSKGGHRQWLSAWLETGGWPL  66

Query  1102  NFIPLaaayytrrrhttttaasiftiTRNTFlaaaalgvllGIINYLYTYGVSKLPVSTS  923
               +P+A ++  RR         +        LAA ALGV  G+ +++Y YG++ LPVSTS
Sbjct  67    LLVPVALSFVARRARDRAAPVLLTPP--RILLAAVALGVATGVDDFIYAYGLAYLPVSTS  124

Query  922   ALIAASQLAFTAGGAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVA  743
             A++ ++QLAFT   AFL+V+QR TA SVNAV LLT GA VL +  + DRP G ++ +Y  
Sbjct  125   AILISTQLAFTVFFAFLVVRQRLTAASVNAVALLTVGAVVLGLHVSSDRPPGVTRGQYWL  184

Query  742   AFLMTLASAALYGALLPCIELTYIK----GRQSLTYTLVLEFQMVMSLFATAFCTVGMLV  575
              F +TL +AALYG +LP +EL Y +    G ++++Y LV+E Q+VM  FATAFCTVGM+V
Sbjct  185   GFTLTLGAAALYGLVLPLVELAYKRAAAGGGRAVSYALVVEMQLVMGFFATAFCTVGMIV  244

Query  574   NKDFQAISREARGFEIGEANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATIS  395
             NKDFQAI REAR +E+GEA YY V+V +A++WQ  F+GA G I    +LL+GI++A  I 
Sbjct  245   NKDFQAIPREARQYELGEARYYTVLVWSAVLWQCFFLGAVGVIFCVHTLLAGILIAVFIP  304

Query  394   LTEVFAVVFYGEKFGSEKGISLTLSLWGIVSYFYGEMKNGDN-NKKEELQIQVTNMEP  224
             +TEV AV+F  EKF SEKG++L LSLWG+ SY YGE        KK E    V   +P
Sbjct  305   VTEVAAVIFLHEKFSSEKGVALVLSLWGLASYSYGEWSQARKAKKKREHAAAVEAQQP  362



>emb|CDY17197.1| BnaA05g09910D [Brassica napus]
Length=351

 Score =   295 bits (756),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 166/347 (48%), Positives = 244/347 (70%), Gaps = 5/347 (1%)
 Frame = -1

Query  1243  RRLFLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIPLa---aayy  1073
             + + +++N I++ IG CGG L+ RLYF  GG R+WFS+ L T+G PI  +PL       +
Sbjct  4     KTVLVIINCIILAIGNCGGPLMTRLYFRNGGKRIWFSSFLQTSGCPIILLPLLFSFLTRH  63

Query  1072  trrrhttttaasiftiTRNTFlaaaalgvllGIINYLYTYGVSKLPVSTSALIAASQLAF  893
              +++       ++F I    FLA+  +G+L+G  NYLY YG++ LPVSTS+LI +SQLAF
Sbjct  64    RQQQEQEEPKTTLFLIKPPLFLASVVVGLLIGFDNYLYAYGLAYLPVSTSSLIISSQLAF  123

Query  892   TAGGAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAFLMTLASAA  713
             TA  AF +VKQRFT F++NAVVLLT GAG LA+ ++GD+   E++KEY+  F+MT+A+A 
Sbjct  124   TAFFAFFMVKQRFTPFTINAVVLLTLGAGSLALHADGDKLPKETRKEYIVGFVMTVAAAV  183

Query  712   LYGALLPCIELTYIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQAISREARGF  533
             LY  +LP +EL Y K  Q ++YTLVLE Q+V+   AT FC VGML + DF+ + REAR F
Sbjct  184   LYAFVLPLVELAYKKASQRISYTLVLEMQLVLCFVATCFCLVGMLADGDFKELGREAREF  243

Query  532   EIGEANYYVVVVV-TALIWQILFIGAAGSICYGSSLLSGIILAATISLTEVFAVVFYGEK  356
             ++G + +Y +VV  TA+IWQ  F+G+ G I   SSL+SG++++A + LTEV AV+F+ EK
Sbjct  244   KLGGSKHYCLVVAFTAVIWQGFFLGSIGMIFCASSLVSGVLISALLPLTEVLAVLFFKEK  303

Query  355   FGSEKGISLTLSLWGIVSYFYGEMKNGDNNKKEELQIQVTNMEPNET  215
             F +EKG+SL LSLWG VSYFYG++++ +  KK+  + +++ +   E+
Sbjct  304   FQAEKGVSLFLSLWGFVSYFYGKIQS-EKEKKKTQEAELSQLPATES  349



>ref|XP_010942638.1| PREDICTED: purine permease 3-like isoform X2 [Elaeis guineensis]
 ref|XP_010942639.1| PREDICTED: purine permease 3-like isoform X2 [Elaeis guineensis]
Length=365

 Score =   296 bits (757),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 166/340 (49%), Positives = 231/340 (68%), Gaps = 2/340 (1%)
 Frame = -1

Query  1243  RRLFLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIPLaaayytrr  1064
             +R  ++LN +++ +G  GG LL RLYF  GG+R W ++ L T GWP+  +PL  +Y  RR
Sbjct  22    KRALVVLNCLLLFVGDTGGPLLSRLYFRHGGHRQWLASWLETGGWPLILLPLFISYLYRR  81

Query  1063  rhttttaasift--iTRNTFlaaaalgvllGIINYLYTYGVSKLPVSTSALIAASQLAFT  890
             R  +          +T   FLA A LG+L G  ++LY YG+S LPVSTSA++ ++QLAFT
Sbjct  82    RLASDHHHPTKLFFLTPRLFLACAVLGLLTGTDDFLYAYGLSFLPVSTSAILISTQLAFT  141

Query  889   AGGAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAFLMTLASAAL  710
             A  AFL+VKQ+FT +S+N++ LL+ GA +L + ++ DRP   S+ +Y+  F +TL +AAL
Sbjct  142   AFFAFLIVKQKFTPYSINSIALLSVGAVILGLHTSSDRPDNVSQGQYLMGFFLTLGTAAL  201

Query  709   YGALLPCIELTYIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQAISREARGFE  530
             YG +LP +ELTY K  Q +TYTLV+E Q+VM  FATAFCT+GMLVNKDF+AI REAR + 
Sbjct  202   YGLVLPLVELTYRKASQVITYTLVMEMQLVMGFFATAFCTIGMLVNKDFEAIQREARQYG  261

Query  529   IGEANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLTEVFAVVFYGEKFG  350
             +GE  YYVV+V  A++WQ  F+G  G I   ++LL+GII+A  I + E+F  +F  EKF 
Sbjct  262   LGEVKYYVVLVWCAILWQCFFLGTVGVIFCVNTLLAGIIIAVLIPVIELFGAIFLHEKFT  321

Query  349   SEKGISLTLSLWGIVSYFYGEMKNGDNNKKEELQIQVTNM  230
             SEKG+SL L LWG+ SY YGE +     K+  L+ Q T +
Sbjct  322   SEKGVSLALCLWGLASYSYGEYRENKKKKEAALKAQTTGL  361



>emb|CDP16579.1| unnamed protein product [Coffea canephora]
Length=271

 Score =   292 bits (748),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 147/251 (59%), Positives = 189/251 (75%), Gaps = 4/251 (2%)
 Frame = -1

Query  970  NYLYTYGVSKLPVSTSALIAASQLAFTAGGAFLLVKQRFTAFSVNAVVLLTFGAGVLAVG  791
            +Y Y YG ++LPVSTSA+I A+QLAFTA  AFLLVKQ+FTA+SVNA+VLLT G+ VL + 
Sbjct  20   DYFYGYGAARLPVSTSAIIIATQLAFTALFAFLLVKQKFTAYSVNAIVLLTVGSAVLGLH  79

Query  790  SNGDRPAGESKKEYVAAFLMTLASAALYGALLPCIELTYIKGRQSLTYTLVLEFQMVMSL  611
            ++ DRP GES K YV  FLM LA+AALYG +LP + L Y+K +Q +TYTLVLE Q+VM  
Sbjct  80   ASSDRPKGESNKMYVLGFLMMLAAAALYGLILPMVGLMYMKAKQPITYTLVLEIQLVMCF  139

Query  610  FATAFCTVGMLVNKDFQAISREARGFEIGEANYYVVVVVTALIWQILFIGAAGSICYGSS  431
            FATAFCTVGML+N DFQAISREAR +E+GE  YY+V+V  A++ Q  F+GA G I   SS
Sbjct  140  FATAFCTVGMLINNDFQAISREAREYELGETKYYIVLVSCAIVSQCFFMGAIGVIFCASS  199

Query  430  LLSGIILAATISLTEVFAVVFYGEKFGSEKGISLTLSLWGIVSYFYGEMKNG--DNNKKE  257
            LLSGI++A  + +TE+ AV+F+ EKF +EK ++L LSLWG VSYFYG++     +  +K+
Sbjct  200  LLSGIMIAVLLPVTEILAVIFFNEKFQAEKAVALVLSLWGFVSYFYGDISKTKLEEERKD  259

Query  256  ELQI--QVTNM  230
            E  I  Q T M
Sbjct  260  ERIIPSQATGM  270



>ref|XP_006841259.1| hypothetical protein AMTR_s00135p00097090 [Amborella trichopoda]
 gb|ERN02934.1| hypothetical protein AMTR_s00135p00097090 [Amborella trichopoda]
Length=362

 Score =   294 bits (752),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 163/332 (49%), Positives = 219/332 (66%), Gaps = 6/332 (2%)
 Frame = -1

Query  1267  SEGKGNMRRRLFLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIPL  1088
              + K    +RL LL+NA+ + +G  GG L+ RLYF+ GG++LW S  L T GWPI   PL
Sbjct  7     PDPKKKKHQRLLLLINALCLTLGATGGPLISRLYFLHGGHKLWLSAFLETGGWPILLFPL  66

Query  1087  aaayytrrrhttttaasiftiTRNT------FlaaaalgvllGIINYLYTYGVSKLPVST  926
             A + +  + +     +        T      FL  + +G+L G+ +Y+Y +G+S LPVST
Sbjct  67    AFSKFFNKTNKKNPQSQQQEGEERTHITLPLFLQCSFIGLLTGVDDYMYAFGLSYLPVST  126

Query  925   SALIAASQLAFTAGGAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYV  746
             SAL+ ASQLAFTA  A ++V+ +FTAF  N+VVLLT G+  L +G+NGDRP G S   Y 
Sbjct  127   SALLIASQLAFTALFALIVVRHKFTAFLTNSVVLLTLGSAFLGLGANGDRPKGLSNGRYF  186

Query  745   AAFLMTLASAALYGALLPCIELTYIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKD  566
               F MTL +AALYG +LP IEL Y + RQ +TY LVLE Q+VMS+FATAFC VGML+NKD
Sbjct  187   LGFFMTLGAAALYGLVLPLIELMYARSRQKITYMLVLEMQLVMSVFATAFCAVGMLINKD  246

Query  565   FQAISREARGFEIGEANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLTE  386
             FQ I +EAR F++G   YY  +V + + WQ+ FIG  G I   SS++SGI++A  I +TE
Sbjct  247   FQHIPKEARAFDLGAVGYYATLVGSGVAWQLFFIGTVGLIFCASSVVSGIMIAFLIPITE  306

Query  385   VFAVVFYGEKFGSEKGISLTLSLWGIVSYFYG  290
             + AV+FY EKF  EK ++L +SLWG  SY YG
Sbjct  307   ILAVIFYHEKFTGEKAMALIMSLWGFASYIYG  338



>ref|XP_010549318.1| PREDICTED: purine permease 3-like [Tarenaya hassleriana]
Length=347

 Score =   293 bits (749),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 169/330 (51%), Positives = 228/330 (69%), Gaps = 3/330 (1%)
 Frame = -1

Query  1240  RLFLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIPLaaayytrrr  1061
             +  ++LN +++ IG CGG L+ RLY+  GG  +W S+ L T G+P+  IPL   +  RRR
Sbjct  3     KALVILNCVLLGIGNCGGPLMSRLYYNNGGKSVWLSSFLETGGFPLMLIPLLFCFLNRRR  62

Query  1060  ht---tttaasiftiTRNTFlaaaalgvllGIINYLYTYGVSKLPVSTSALIAASQLAFT  890
             +    +   A +  +    F+ AA  G+L G+ +Y+Y YG+S LPVST++LI ASQLAFT
Sbjct  63    NHGRNSDGNAGVILMKPRLFMGAAVSGLLTGVDDYIYAYGLSFLPVSTASLIIASQLAFT  122

Query  889   AGGAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAFLMTLASAAL  710
             A  AF LVKQ+FT FS+NA+VLLT GAGVLA+ +  D PA E+KK+YV  F++T+ +A L
Sbjct  123   AFFAFFLVKQKFTPFSINAIVLLTLGAGVLALHTASDIPANETKKQYVTGFVLTVGAAVL  182

Query  709   YGALLPCIELTYIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQAISREARGFE  530
             Y  +LP IEL+Y K RQ+++Y +VLEFQ VM  FAT FC  GML++ DF+ I +EA  F+
Sbjct  183   YAFVLPLIELSYKKARQTISYDVVLEFQFVMCFFATLFCFAGMLISGDFKMIPKEAETFQ  242

Query  529   IGEANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLTEVFAVVFYGEKFG  350
             +G + YYVV+V  +L+WQ  F+GA G I   SSL+SGI++A  + +TEV AVVFY E F 
Sbjct  243   LGPSLYYVVLVGASLMWQCFFLGAIGVIFCASSLVSGILIAVLLPVTEVLAVVFYHETFS  302

Query  349   SEKGISLTLSLWGIVSYFYGEMKNGDNNKK  260
             SEKG+SL LSLWG  SYFYGE K G   K 
Sbjct  303   SEKGVSLVLSLWGFASYFYGEAKAGKAEKD  332



>ref|XP_010499329.1| PREDICTED: purine permease 3-like [Camelina sativa]
 ref|XP_010499330.1| PREDICTED: purine permease 3-like [Camelina sativa]
Length=355

 Score =   293 bits (750),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 175/347 (50%), Positives = 239/347 (69%), Gaps = 7/347 (2%)
 Frame = -1

Query  1240  RLFLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIPLaaayytrrr  1061
             +  +++N I++ IG CGG L++RLYF  GG R+WFST L TAG+P+ FIPL  +Y  RR+
Sbjct  3     KALVIINCIILAIGNCGGPLIMRLYFNNGGKRIWFSTFLETAGFPVIFIPLLFSYIHRRK  62

Query  1060  htt--ttaasiftiTRNTFlaaaalgvllGIINYLYTYGVSKLPVSTSALIAASQLAFTA  887
             +      A S F I      AA  +G+L G  NYLY YG++ LPVST+ALI ASQLA  A
Sbjct  63    NNNGGENATSFFLIKPRLLGAAIFIGILSGFDNYLYAYGIAYLPVSTAALIIASQLACIA  122

Query  886   GGAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAFLMTLASAALY  707
               +F +VK +FT F++NAVVLLT GA VL + +  DRP  E+ K+YV  FL+T+A+A +Y
Sbjct  123   IFSFFMVKHKFTPFTINAVVLLTVGAAVLGMHTETDRPVHETHKQYVLGFLVTVAAAVVY  182

Query  706   GALLPCIELTYIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQAISREARGFEI  527
               +LP +EL Y K +Q L+YTLVLE QM++   A+    +GM +  DF+A+ +EA+ F++
Sbjct  183   AFILPLVELAYQKAKQPLSYTLVLEVQMILCFLASIVSLIGMSIAGDFKALPKEAKEFKL  242

Query  526   GEANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLTEVFAVVFYGEKFGS  347
             GE  YYVV V +A+IWQ  F+GA G I   SSL+SGI+++  + +TEV AV+FY EKF +
Sbjct  243   GEVLYYVVAVFSAIIWQGFFLGAIGLIFCTSSLVSGIMISVLLPITEVLAVIFYHEKFQA  302

Query  346   EKGISLTLSLWGIVSYFYGEMKNGDNNKKEELQIQVTNMEPNET-LP  209
             EKG+SL LSLWG VSYFYGE+K+ DN+K+   +IQ    E  ET LP
Sbjct  303   EKGLSLALSLWGFVSYFYGEIKS-DNDKR---RIQQEEKESQETELP  345



>ref|XP_010942637.1| PREDICTED: purine permease 3-like isoform X1 [Elaeis guineensis]
Length=448

 Score =   296 bits (758),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 166/340 (49%), Positives = 231/340 (68%), Gaps = 2/340 (1%)
 Frame = -1

Query  1243  RRLFLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIPLaaayytrr  1064
             +R  ++LN +++ +G  GG LL RLYF  GG+R W ++ L T GWP+  +PL  +Y  RR
Sbjct  105   KRALVVLNCLLLFVGDTGGPLLSRLYFRHGGHRQWLASWLETGGWPLILLPLFISYLYRR  164

Query  1063  rhttttaasift--iTRNTFlaaaalgvllGIINYLYTYGVSKLPVSTSALIAASQLAFT  890
             R  +          +T   FLA A LG+L G  ++LY YG+S LPVSTSA++ ++QLAFT
Sbjct  165   RLASDHHHPTKLFFLTPRLFLACAVLGLLTGTDDFLYAYGLSFLPVSTSAILISTQLAFT  224

Query  889   AGGAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAFLMTLASAAL  710
             A  AFL+VKQ+FT +S+N++ LL+ GA +L + ++ DRP   S+ +Y+  F +TL +AAL
Sbjct  225   AFFAFLIVKQKFTPYSINSIALLSVGAVILGLHTSSDRPDNVSQGQYLMGFFLTLGTAAL  284

Query  709   YGALLPCIELTYIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQAISREARGFE  530
             YG +LP +ELTY K  Q +TYTLV+E Q+VM  FATAFCT+GMLVNKDF+AI REAR + 
Sbjct  285   YGLVLPLVELTYRKASQVITYTLVMEMQLVMGFFATAFCTIGMLVNKDFEAIQREARQYG  344

Query  529   IGEANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLTEVFAVVFYGEKFG  350
             +GE  YYVV+V  A++WQ  F+G  G I   ++LL+GII+A  I + E+F  +F  EKF 
Sbjct  345   LGEVKYYVVLVWCAILWQCFFLGTVGVIFCVNTLLAGIIIAVLIPVIELFGAIFLHEKFT  404

Query  349   SEKGISLTLSLWGIVSYFYGEMKNGDNNKKEELQIQVTNM  230
             SEKG+SL L LWG+ SY YGE +     K+  L+ Q T +
Sbjct  405   SEKGVSLALCLWGLASYSYGEYRENKKKKEAALKAQTTGL  444



>gb|AAC69140.1| hypothetical protein [Arabidopsis thaliana]
Length=356

 Score =   292 bits (747),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 164/345 (48%), Positives = 235/345 (68%), Gaps = 12/345 (3%)
 Frame = -1

Query  1243  RRLFLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIPLaaayytrr  1064
             + + +++N I + IG CGG L++RLYF  GG R+WF + L T G P+ F PL  ++  RR
Sbjct  2     KTVLVIINCIFLAIGNCGGPLMMRLYFQNGGERIWFPSFLQTVGCPLIFFPLLLSFLRRR  61

Query  1063  rhttttaasiftiTRNT-FlaaaalgvllGIINYLYTYGVSKLPVSTSALIAASQLAFTA  887
             R       + F + +   F+AA  +G+L+G  NYLY+YG++ +PVST++LI ++QL FTA
Sbjct  62    RCLEEQETTPFFLMKPPLFIAAIVVGLLVGFDNYLYSYGLAYIPVSTASLIISAQLGFTA  121

Query  886   GGAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAFLMTLASAALY  707
               AF +VKQ+FT F++NA+VLLT GA VLA+ S+ D+ A E+ KEYV  F+MTL +A LY
Sbjct  122   LFAFFMVKQKFTPFTINAIVLLTGGAVVLALNSDSDKLANETHKEYVVGFIMTLGAALLY  181

Query  706   GALLPCIELTYIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQ-----------  560
             G +LP +EL+Y K  Q +TYTL LEFQMV+   AT  C VGML   DF+           
Sbjct  182   GFILPLVELSYKKSGQRITYTLALEFQMVLCFAATCVCLVGMLAAGDFKVKHALFIFKNR  241

Query  559   AISREARGFEIGEANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLTEVF  380
              I+ EAR F++GE+ YYVV+V TA+IWQ  F+GA G I   SSL+SGI+++A + +T + 
Sbjct  242   VIAGEARDFKLGESLYYVVIVFTAIIWQAFFVGAIGLIFCASSLVSGIMVSALLPVTVIL  301

Query  379   AVVFYGEKFGSEKGISLTLSLWGIVSYFYGEMKNGDNNKKEELQI  245
             AV+ + EKF + KG++L LSLWG VSYFYG++K+ +  K ++ Q+
Sbjct  302   AVICFQEKFQAGKGVALALSLWGSVSYFYGQVKSEEKTKAQDTQL  346



>ref|NP_180931.2| purine permease 2 [Arabidopsis thaliana]
 sp|Q94GB1.1|PUP2_ARATH RecName: Full=Purine permease 2; Short=AtPUP2 [Arabidopsis thaliana]
 gb|AAK61813.1|AF078532_1 putative purine permease [Arabidopsis thaliana]
 gb|AEC08880.1| purine permease 2 [Arabidopsis thaliana]
Length=358

 Score =   291 bits (746),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 164/345 (48%), Positives = 235/345 (68%), Gaps = 12/345 (3%)
 Frame = -1

Query  1243  RRLFLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIPLaaayytrr  1064
             + + +++N I + IG CGG L++RLYF  GG R+WF + L T G P+ F PL  ++  RR
Sbjct  4     KTVLVIINCIFLAIGNCGGPLMMRLYFQNGGERIWFPSFLQTVGCPLIFFPLLLSFLRRR  63

Query  1063  rhttttaasiftiTRNT-FlaaaalgvllGIINYLYTYGVSKLPVSTSALIAASQLAFTA  887
             R       + F + +   F+AA  +G+L+G  NYLY+YG++ +PVST++LI ++QL FTA
Sbjct  64    RCLEEQETTPFFLMKPPLFIAAIVVGLLVGFDNYLYSYGLAYIPVSTASLIISAQLGFTA  123

Query  886   GGAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAFLMTLASAALY  707
               AF +VKQ+FT F++NA+VLLT GA VLA+ S+ D+ A E+ KEYV  F+MTL +A LY
Sbjct  124   LFAFFMVKQKFTPFTINAIVLLTGGAVVLALNSDSDKLANETHKEYVVGFIMTLGAALLY  183

Query  706   GALLPCIELTYIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQ-----------  560
             G +LP +EL+Y K  Q +TYTL LEFQMV+   AT  C VGML   DF+           
Sbjct  184   GFILPLVELSYKKSGQRITYTLALEFQMVLCFAATCVCLVGMLAAGDFKVKHALFIFKNR  243

Query  559   AISREARGFEIGEANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLTEVF  380
              I+ EAR F++GE+ YYVV+V TA+IWQ  F+GA G I   SSL+SGI+++A + +T + 
Sbjct  244   VIAGEARDFKLGESLYYVVIVFTAIIWQAFFVGAIGLIFCASSLVSGIMVSALLPVTVIL  303

Query  379   AVVFYGEKFGSEKGISLTLSLWGIVSYFYGEMKNGDNNKKEELQI  245
             AV+ + EKF + KG++L LSLWG VSYFYG++K+ +  K ++ Q+
Sbjct  304   AVICFQEKFQAGKGVALALSLWGSVSYFYGQVKSEEKTKAQDTQL  348



>gb|EPS72255.1| hypothetical protein M569_02503, partial [Genlisea aurea]
Length=232

 Score =   287 bits (734),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 144/230 (63%), Positives = 175/230 (76%), Gaps = 0/230 (0%)
 Frame = -1

Query  976  IINYLYTYGVSKLPVSTSALIAASQLAFTAGGAFLLVKQRFTAFSVNAVVLLTFGAGVLA  797
            ++NY YTYGVSK+PVSTS+LI ASQLAFTA   F LVKQ+FT +S+NAVVLLT GA VLA
Sbjct  3    LVNYFYTYGVSKIPVSTSSLIIASQLAFTAVFCFFLVKQKFTPYSINAVVLLTCGAAVLA  62

Query  796  VGSNGDRPAGESKKEYVAAFLMTLASAALYGALLPCIELTYIKGRQSLTYTLVLEFQMVM  617
            + ++ DRP GES K+Y   F+MT A + LYG +LP +EL+Y++  Q L+Y+L+LEFQMVM
Sbjct  63   MHASSDRPNGESNKDYWMGFIMTAAVSVLYGLILPLMELSYMRAGQVLSYSLILEFQMVM  122

Query  616  SLFATAFCTVGMLVNKDFQAISREARGFEIGEANYYVVVVVTALIWQILFIGAAGSICYG  437
              FATAFCTVGM+VNKDFQAI  EA GFE+G A YYVVV     I Q  F+G  G I Y 
Sbjct  123  CFFATAFCTVGMIVNKDFQAIGEEAEGFELGVAKYYVVVFFNVTINQCFFVGVVGVIFYS  182

Query  436  SSLLSGIILAATISLTEVFAVVFYGEKFGSEKGISLTLSLWGIVSYFYGE  287
            SSL SG++LA  +  TE+ AVVF+ EKF  EKG+SL L+LWG VSYFYGE
Sbjct  183  SSLFSGVLLALLLPPTEILAVVFFHEKFQVEKGVSLFLALWGFVSYFYGE  232



>ref|NP_001131978.1| uncharacterized protein LOC100193377 [Zea mays]
 gb|ACF80629.1| unknown [Zea mays]
 gb|ACG41442.1| ATPUP3 [Zea mays]
 tpg|DAA40288.1| TPA: ATPUP3 [Zea mays]
Length=361

 Score =   291 bits (746),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 167/341 (49%), Positives = 227/341 (67%), Gaps = 5/341 (1%)
 Frame = -1

Query  1291  KLKLKMEVSEGKGNMRRRLFLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAG  1112
              ++ + + +  +G   RR  + LN  M+ +G  GG LL RLYF +GG+R W S  L T G
Sbjct  2     DVEARKDAAPARGKAVRRFLVALNCGMLALGAIGGPLLSRLYFSKGGHRQWLSAWLETGG  61

Query  1111  WPINFIPLaaayytrrrhttttaasiftiTRNTFlaaaalgvllGIINYLYTYGVSKLPV  932
             WP+  +P+AA++  RR         +        LAAA LGV  G+ +++Y YG++ LPV
Sbjct  62    WPLLLVPVAASFGARRARDRGAPVLLTPP--RILLAAAGLGVATGVDDFVYAYGLAYLPV  119

Query  931   STSALIAASQLAFTAGGAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKE  752
             STSA++ ++QLAFT   AFL+V+QR TA SVNAV LLT GA VL +  + DRP G ++  
Sbjct  120   STSAILISTQLAFTVFFAFLVVRQRLTAASVNAVALLTVGAVVLGLHVSSDRPPGVTRGR  179

Query  751   YVAAFLMTLASAALYGALLPCIELTYIK---GRQSLTYTLVLEFQMVMSLFATAFCTVGM  581
             Y   F +TL +AALYG +LP +EL Y +   G +++TY LV+E Q+VM  FATAFCTVGM
Sbjct  180   YWLGFSLTLCAAALYGLVLPLVELAYRRAAGGGRAVTYALVVEMQLVMGFFATAFCTVGM  239

Query  580   LVNKDFQAISREARGFEIGEANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAAT  401
             +VNKDFQAI REAR +E+GEA YY+V+   A++WQ  F+GA G I    +LL+GI++A  
Sbjct  240   VVNKDFQAIPREARQYELGEARYYMVLAWAAVLWQCFFLGAVGVIFCVHTLLAGILIAVF  299

Query  400   ISLTEVFAVVFYGEKFGSEKGISLTLSLWGIVSYFYGEMKN  278
             I +TEV AV+F  EKF SEKG++L LSLWG+ SY YGE   
Sbjct  300   IPVTEVAAVIFLHEKFSSEKGVALALSLWGLASYSYGEWSQ  340



>ref|XP_006358992.1| PREDICTED: purine permease 1-like [Solanum tuberosum]
Length=358

 Score =   290 bits (742),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 161/334 (48%), Positives = 227/334 (68%), Gaps = 0/334 (0%)
 Frame = -1

Query  1255  GNMRRRLFLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIPLaaay  1076
               M++   L+LN IM  IG CGG L+ RLYFI GG R+W S+ L T   P+  IPL+ +Y
Sbjct  10    AKMKKFTLLILNIIMFSIGNCGGPLISRLYFIHGGQRIWLSSWLQTIACPLILIPLSISY  69

Query  1075  ytrrrhttttaasiftiTRNTFlaaaalgvllGIINYLYTYGVSKLPVSTSALIAASQLA  896
             + RR+  +   A IF++TR   + +  +G++ G+  Y  ++G +KLPVSTS+LI A+QLA
Sbjct  70    FHRRKIESPATARIFSLTRREIIGSTGVGIIAGLDGYFISWGPAKLPVSTSSLINATQLA  129

Query  895   FTAGGAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAFLMTLASA  716
             FTA  A LLVKQ+ T +S  +V LL  GA  LA+   GDRPAG S KEYV  F+MT+  A
Sbjct  130   FTALFAVLLVKQKLTVYSKLSVFLLIAGAATLALRGKGDRPAGVSVKEYVIGFVMTVMGA  189

Query  715   ALYGALLPCIELTYIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQAISREARG  536
               +G ++  IEL YIK + +++YT+VLE Q+++ + AT FCT+GM++N DFQAI +EA  
Sbjct  190   VCFGLMVSLIELIYIKAKNAISYTMVLEIQLIIGVSATVFCTIGMIINNDFQAIPKEASE  249

Query  535   FEIGEANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLTEVFAVVFYGEK  356
             +EIGEA YY+V+V  A+IWQ+  +G  G I Y SSLLSGII A  + +TE+ A+V + EK
Sbjct  250   YEIGEAKYYLVLVWCAIIWQLALMGLVGVIFYSSSLLSGIIGAFLLPVTEILAIVLFHEK  309

Query  355   FGSEKGISLTLSLWGIVSYFYGEMKNGDNNKKEE  254
             F  EKG+++ L+L G VSYFYGE++     K++ 
Sbjct  310   FQVEKGVAIFLALCGFVSYFYGEIEQSKKEKQDN  343



>gb|EAZ09425.1| hypothetical protein OsI_31698 [Oryza sativa Indica Group]
Length=388

 Score =   290 bits (743),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 164/336 (49%), Positives = 222/336 (66%), Gaps = 12/336 (4%)
 Frame = -1

Query  1255  GNMRRRLFLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIPLaaay  1076
             G + R   L++N ++M +G   G LLLR YF+RGGNR W S+ L TAGWP+   PL  +Y
Sbjct  30    GRLFRSPLLVVNFVLMVVGSACGPLLLRAYFLRGGNRKWLSSLLQTAGWPLLLAPLCFSY  89

Query  1075  ytrrrhttttaasiftiTRNT--FlaaaalgvllGII-------NYLYTYGVSKLPVSTS  923
              +RRR               T  FL    L V   ++       + LY YG++ LPVSTS
Sbjct  90    SSRRRRREVEDDGAGAGAAATPLFLMTPRLLVASAVVGLMTGVDDLLYAYGLAYLPVSTS  149

Query  922   ALIAASQLAFTAGGAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVA  743
             +++ ++QLAFTA  A LLV+QRFTAFSVNAVVLL+ GA +L + + GDRPAG S+ +Y A
Sbjct  150   SILISTQLAFTAAFALLLVRQRFTAFSVNAVVLLSVGAAMLGMNAGGDRPAGVSRAQYCA  209

Query  742   AFLMTLASAALYGALLPCIELT---YIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVN  572
              F MTLA+AALYG +LP +EL+   +   R ++TYTLV+E Q+V+   ATAF  VGMLVN
Sbjct  210   GFAMTLAAAALYGLVLPVMELSQAHHAAARGAVTYTLVMEMQLVIGFVATAFSAVGMLVN  269

Query  571   KDFQAISREARGFEIGEANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISL  392
              DF AI  EA  F +G+A YY+++  +A ++Q  F+G  G+I YGS+LL+G+I+   I +
Sbjct  270   NDFHAIPGEAHEFGLGQAGYYLLLAGSAAMYQCFFLGTIGAIFYGSALLAGVIMTVLIPV  329

Query  391   TEVFAVVFYGEKFGSEKGISLTLSLWGIVSYFYGEM  284
             TEV AV+F+ E F   KG++L LSLWG VSYFYGE+
Sbjct  330   TEVLAVMFFHEPFNGTKGVALALSLWGFVSYFYGEV  365



>ref|NP_001063424.1| Os09g0467300 [Oryza sativa Japonica Group]
 dbj|BAD17524.1| putative purine permease [Oryza sativa Japonica Group]
 dbj|BAD19735.1| putative purine permease [Oryza sativa Japonica Group]
 dbj|BAF25338.1| Os09g0467300 [Oryza sativa Japonica Group]
Length=390

 Score =   290 bits (743),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 164/336 (49%), Positives = 222/336 (66%), Gaps = 12/336 (4%)
 Frame = -1

Query  1255  GNMRRRLFLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIPLaaay  1076
             G + R   L++N ++M +G   G LLLR YF+RGGNR W S+ L TAGWP+   PL  +Y
Sbjct  32    GRLFRSPLLVVNFVLMVVGSACGPLLLRAYFLRGGNRKWLSSLLQTAGWPLLLAPLCFSY  91

Query  1075  ytrrrhttttaasiftiTRNT--FlaaaalgvllGII-------NYLYTYGVSKLPVSTS  923
              +RRR               T  FL    L V   ++       + LY YG++ LPVSTS
Sbjct  92    SSRRRRREVEDDGAGAGAAATPLFLMTPRLLVASAVVGLMTGVDDLLYAYGLAYLPVSTS  151

Query  922   ALIAASQLAFTAGGAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVA  743
             +++ ++QLAFTA  A LLV+QRFTAFSVNAVVLL+ GA +L + + GDRPAG S+ +Y A
Sbjct  152   SILISTQLAFTAAFALLLVRQRFTAFSVNAVVLLSVGAAMLGMNAGGDRPAGVSRAQYCA  211

Query  742   AFLMTLASAALYGALLPCIELT---YIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVN  572
              F MTLA+AALYG +LP +EL+   +   R ++TYTLV+E Q+V+   ATAF  VGMLVN
Sbjct  212   GFAMTLAAAALYGLVLPVMELSQAHHAAARGAVTYTLVMEMQLVIGFVATAFSAVGMLVN  271

Query  571   KDFQAISREARGFEIGEANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISL  392
              DF AI  EA  F +G+A YY+++  +A ++Q  F+G  G+I YGS+LL+G+I+   I +
Sbjct  272   NDFHAIPGEAHEFGLGQAGYYLLLAGSAAMYQCFFLGTIGAIFYGSALLAGVIMTVLIPV  331

Query  391   TEVFAVVFYGEKFGSEKGISLTLSLWGIVSYFYGEM  284
             TEV AV+F+ E F   KG++L LSLWG VSYFYGE+
Sbjct  332   TEVLAVMFFHEPFNGTKGVALALSLWGFVSYFYGEV  367



>dbj|BAJ94351.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=395

 Score =   290 bits (743),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 164/351 (47%), Positives = 231/351 (66%), Gaps = 11/351 (3%)
 Frame = -1

Query  1249  MRRRLFLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIPL-----a  1085
             + R   +++N ++M +G   G LLLR Y++ GG   W ++ L TAGWP+   PL     +
Sbjct  47    LYRNPVVVVNFLLMALGTVSGPLLLRAYYLHGGTSKWLTSLLQTAGWPLLLPPLCVSFIS  106

Query  1084  aayytrrrhttttaasiftiTRNTFlaaaalgvllGIINYLYTYGVSKLPVSTSALIAAS  905
                  +   + T AAS+  ++     A  A+G+++G+INYLY YG++ LPVSTS+++ ++
Sbjct  107   RRRRRQSEESATEAASLSLMSAGLLAATIAIGLVIGLINYLYAYGLANLPVSTSSILIST  166

Query  904   QLAFTAGGAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAFLMTL  725
             QLAFTA  A L+V+ RFTAFSVNAVVLL  GA +L +   GDRPAG S+ +Y A F MTL
Sbjct  167   QLAFTAVFALLVVRHRFTAFSVNAVVLLVVGAAMLGLNGGGDRPAGVSRAQYYAGFAMTL  226

Query  724   ASAALYGALLPCIELT----YIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQA  557
              SAALYG +LP +EL+      +   ++TYTLVLE QMV+ + ATAF  VGMLVNKDF  
Sbjct  227   GSAALYGLVLPLMELSQARHAARAGAAVTYTLVLEIQMVIGITATAFSVVGMLVNKDFHE  286

Query  556   ISREARGFEIGEANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLTEVFA  377
             I  EAR F++GEA YY ++V +A  +Q  FIG  G+I YGS+LL+G+I+   IS+TEVFA
Sbjct  287   IPDEARRFDLGEAGYYFILVSSATAFQCFFIGMIGAIFYGSALLAGVIMTLLISVTEVFA  346

Query  376   VVFYGEKFGSEKGISLTLSLWGIVSYFYGEMKNGDNNKKEELQIQVTNMEP  224
             V+ + E F   KG++L +S+WG +SYFYGE++   N K+         +EP
Sbjct  347   VLLFHEPFNGTKGVALAISIWGFISYFYGEIRT--NKKQSNTSTDKEQLEP  395



>ref|XP_003579811.2| PREDICTED: purine permease 3-like [Brachypodium distachyon]
Length=365

 Score =   289 bits (740),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 169/323 (52%), Positives = 220/323 (68%), Gaps = 4/323 (1%)
 Frame = -1

Query  1237  LFLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIPLaaayytrrrh  1058
             L + LN  M+ +G  GG LL RLY+ +GG R W S  L T GWP+   P++ +Y  RR  
Sbjct  29    LMVALNCGMLTLGTTGGPLLSRLYYSKGGQRQWLSAWLETGGWPLLLFPVSFSYLARRAR  88

Query  1057  ttttaasiftiTRNTFlaaaalgvllGIINYLYTYGVSKLPVSTSALIAASQLAFTAGGA  878
                 A  + T  R   +AAAALG+  G  +++Y YG+S LPVSTSA++ ++QLAFT   A
Sbjct  89    DGPGAPLVLTRPRTL-MAAAALGLATGADDFIYAYGLSYLPVSTSAILISTQLAFTVFFA  147

Query  877   FLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAFLMTLASAALYGAL  698
             FL+V+QR TAFSVNAV LLT GA VL + ++ DRPAG ++ +Y   F ++L +AALYG +
Sbjct  148   FLVVRQRLTAFSVNAVALLTVGAVVLGLHASSDRPAGVTRGQYWLGFFLSLGAAALYGLV  207

Query  697   LPCIELTYIK---GRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQAISREARGFEI  527
             LP IEL Y     G + +TY LVLE Q+VM  FATAFCTVGM+VN DFQAISREAR FE+
Sbjct  208   LPLIELAYKHAAGGGREVTYALVLEMQLVMGFFATAFCTVGMVVNNDFQAISREARAFEL  267

Query  526   GEANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLTEVFAVVFYGEKFGS  347
             GE  YYVV+V  A++WQ  F+GA G I    +L +GI++A  I +TEV  V+F  EKF S
Sbjct  268   GETRYYVVLVSCAVLWQFFFLGAVGVIFCVHTLFAGILIAVFIPVTEVLGVIFLHEKFSS  327

Query  346   EKGISLTLSLWGIVSYFYGEMKN  278
             EKG++L LSLWG+ SY YGE  +
Sbjct  328   EKGVALVLSLWGLASYSYGEYSD  350



>ref|NP_001063425.1| Os09g0467400 [Oryza sativa Japonica Group]
 dbj|BAD19736.1| putative purine permease [Oryza sativa Japonica Group]
 dbj|BAF25339.1| Os09g0467400 [Oryza sativa Japonica Group]
 dbj|BAG90051.1| unnamed protein product [Oryza sativa Japonica Group]
Length=361

 Score =   288 bits (736),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 165/328 (50%), Positives = 222/328 (68%), Gaps = 5/328 (2%)
 Frame = -1

Query  1264  EGKGNMRRRLFLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIPLa  1085
              G+G   R L + LN  M+ +G  GG L+ RLYF +GG+R W S  L TAGWP+  +P+A
Sbjct  17    PGRGRAARWLLVALNCGMLVVGTTGGPLISRLYFSKGGHRQWLSAWLQTAGWPLLLVPVA  76

Query  1084  aayytrrrhttttaasiftiTRNTFlaaaalgvllGIINYLYTYGVSKLPVSTSALIAAS  905
             A+Y +RR         +        LA   LG L G  +++Y YG++ LPVSTSA++ ++
Sbjct  77    ASYLSRRARDRRAPLFLTPT--RVLLAGVGLGFLNGADDFIYAYGLAYLPVSTSAILIST  134

Query  904   QLAFTAGGAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAFLMTL  725
             QLAFT   A L+V+QRFTA ++NAV LLT GA VL + ++ DRPAG +  +Y   F +TL
Sbjct  135   QLAFTVFFACLIVRQRFTAATLNAVALLTIGAVVLGLHASKDRPAGVTSGKYWMGFFLTL  194

Query  724   ASAALYGALLPCIELTYIK---GRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQAI  554
              +AALYG +LP +EL Y     G +++TY LV+E Q+VM  FATAFCTVGM+VNKDFQAI
Sbjct  195   GAAALYGLILPLVELAYKHAAGGGRAVTYALVMEMQLVMGFFATAFCTVGMVVNKDFQAI  254

Query  553   SREARGFEIGEANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLTEVFAV  374
              REA+ +E+GEA YYVV+V  A++W+  F+GA G I    +LL+GII+A  I +TEV  V
Sbjct  255   PREAKQYELGEARYYVVLVFNAVLWEFFFVGAVGVIFCVHTLLAGIIIAVFIPITEVLGV  314

Query  373   VFYGEKFGSEKGISLTLSLWGIVSYFYG  290
             +F  EKF SEKG++L LSLWG+ SY YG
Sbjct  315   IFLHEKFSSEKGVALVLSLWGLASYSYG  342



>ref|XP_008667169.1| PREDICTED: uncharacterized protein LOC100193377 isoform X1 [Zea 
mays]
 gb|ACR36679.1| unknown [Zea mays]
 tpg|DAA40290.1| TPA: hypothetical protein ZEAMMB73_258363 [Zea mays]
Length=363

 Score =   287 bits (735),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 169/342 (49%), Positives = 225/342 (66%), Gaps = 7/342 (2%)
 Frame = -1

Query  1282  LKMEVSEGKGNMR----RRLFLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTA  1115
             + +E S     +R    RRL +  N +M+ +G  GG LL RLYF +GG+R W S  L T 
Sbjct  1     MDVEASHESPPLRSKTMRRLLVATNCVMLALGVTGGQLLSRLYFSKGGHRQWLSGWLQTG  60

Query  1114  GWPINFIPLaaayytrrrhttttaasiftiTRNTFlaaaalgvllGIINYLYTYGVSKLP  935
             GWP+   P+AA+Y  RR    +  A +        LAAA LG++ G+ N LY +G+  LP
Sbjct  61    GWPLLLPPVAASYVRRRARYRSAPALLTQTQPRILLAAAGLGLIAGVDNLLYAWGLEFLP  120

Query  934   VSTSALIAASQLAFTAGGAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKK  755
             VSTSA++ ++QLAFT   AFL+V+QR T  +VNAV LLT GA VL +  + DRPAG ++ 
Sbjct  121   VSTSAILISTQLAFTVLFAFLIVRQRLTMATVNAVALLTVGAVVLGLHVSSDRPAGVTRS  180

Query  754   EYVAAFLMTLASAALYGALLPCIELTY---IKGRQSLTYTLVLEFQMVMSLFATAFCTVG  584
             +Y   F +TL +A LYG  LP +ELTY     G +++TY LV+E Q+VM   ATAFCTVG
Sbjct  181   QYWLGFTLTLGAAVLYGLFLPLVELTYKCAAGGGRAVTYALVVELQLVMGFVATAFCTVG  240

Query  583   MLVNKDFQAISREARGFEIGEANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAA  404
             M+VNKDFQAI REAR +E+GEA YY+V+   A++WQ  F+GA G I    +LL+GI++A 
Sbjct  241   MIVNKDFQAIPREARQYELGEARYYMVLAWAAVLWQCFFLGAVGVIFCVHTLLAGILIAV  300

Query  403   TISLTEVFAVVFYGEKFGSEKGISLTLSLWGIVSYFYGEMKN  278
              I +TEV AV+F  EKF SEKG++L LSLWG+ SY YGE   
Sbjct  301   FIPVTEVAAVIFLHEKFSSEKGVALALSLWGLASYSYGEWSQ  342



>ref|XP_006661330.1| PREDICTED: purine permease 3-like [Oryza brachyantha]
Length=377

 Score =   287 bits (734),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 166/346 (48%), Positives = 232/346 (67%), Gaps = 14/346 (4%)
 Frame = -1

Query  1243  RRLFLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIPLaaayytrr  1064
             R   L++N I+M +G   G LLLR YF+RGG R   ST L  AGWP+  +PL  +Y +RR
Sbjct  31    RNPLLVVNFILMVVGSACGPLLLRAYFLRGGRRKGLSTLLPPAGWPLLLVPLCFSYCSRR  90

Query  1063  rhtt----ttaasiftiTRNTFlaaaalgvllGIINYLYTYGVSKLPVSTSALIAASQLA  896
             R            +F +T     A+A +G++ G+ + LY YG++ LPVSTS+++ ++QLA
Sbjct  91    RREEEDGGAATTPLFLMTPRLLAASATVGLMTGLDDLLYAYGLAYLPVSTSSILISTQLA  150

Query  895   FTAGGAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAFLMTLASA  716
             FTA  A LLV+QRFTAFSVNAVVLL+ GA +L + + GDRPAG S+ +Y A F MTL +A
Sbjct  151   FTAAFALLLVRQRFTAFSVNAVVLLSVGAAMLGMNTGGDRPAGVSRAQYYAGFAMTLGAA  210

Query  715   ALYGALLPCIELT---YIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQAISRE  545
             ALYG +LP +EL+   +   R ++TYTLV+E Q+V+   ATAF  VGMLVN DF AI  E
Sbjct  211   ALYGLVLPVMELSQARHAAARGAVTYTLVMEMQLVIGFVATAFSAVGMLVNNDFHAIPGE  270

Query  544   ARGFEIGEANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLTEVFAVVFY  365
             A+GF +G+A YY+++  +A ++Q  F+G  G+I YGS+LL+G+I+   I +TEV AV+F+
Sbjct  271   AQGFGLGQAGYYLLLAGSAAMYQCFFLGTIGAIFYGSALLAGVIMTVLIPVTEVLAVMFF  330

Query  364   GEKFGSEKGISLTLSLWGIVSYFYGEMK-------NGDNNKKEELQ  248
              E F   KG++L LSLWG VSYFYGE++       +G+  K + L 
Sbjct  331   HEPFNGTKGVALALSLWGFVSYFYGEVRAKAARPHSGEAPKPDHLD  376



>ref|XP_008652812.1| PREDICTED: purine permease 3-like [Zea mays]
 tpg|DAA61853.1| TPA: hypothetical protein ZEAMMB73_233624 [Zea mays]
Length=367

 Score =   286 bits (733),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 165/345 (48%), Positives = 225/345 (65%), Gaps = 6/345 (2%)
 Frame = -1

Query  1279  KMEVSEGKGNMRRRLFLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPIN  1100
             K +    +G    R  + LN  M+ +G  GG LL RLYF +GG+R W S  L T GWP+ 
Sbjct  7     KSDAPPARGKAMHRFLVALNCGMLAVGAIGGPLLSRLYFSKGGHRQWLSAWLETGGWPLL  66

Query  1099  FIPLaaayytrrrhttttaasiftiTRNTFlaaaalgvllGIINYLYTYGVSKLPVSTSA  920
              IP+AA++  RR         +        LAAA LGV  G  +++Y +G++ LPVSTSA
Sbjct  67    VIPVAASFVARRARDRGAPVLLAPP--RILLAAAGLGVATGADDFIYAFGLAYLPVSTSA  124

Query  919   LIAASQLAFTAGGAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAA  740
             ++ ++QLAFT   AFL+V+QR TA SVNAV LLT GA VL +  + DRP G ++ +Y   
Sbjct  125   ILISTQLAFTVFFAFLVVRQRLTAASVNAVALLTVGAVVLGLHVSSDRPPGVTRGQYWLG  184

Query  739   FLMTLASAALYGALLPCIELTYIKGRQS----LTYTLVLEFQMVMSLFATAFCTVGMLVN  572
             F++TL +AALYG +LP +EL Y +   +    +TY LV+E Q+VM  FATAFCTVGM+VN
Sbjct  185   FVLTLGAAALYGLVLPLVELAYRRAAGAGGRAVTYALVVEMQLVMGFFATAFCTVGMVVN  244

Query  571   KDFQAISREARGFEIGEANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISL  392
             KDFQAI REAR +++GEA YY V+  +A++WQ  F+GA G I    +LL+GI++A  I +
Sbjct  245   KDFQAIPREARRYKLGEARYYAVLAWSAVLWQCFFLGAVGVIFCVHTLLAGILIAVFIPV  304

Query  391   TEVFAVVFYGEKFGSEKGISLTLSLWGIVSYFYGEMKNGDNNKKE  257
             TEV AV+F  E+F SEKG++L LSLWG+ SY YGE       K++
Sbjct  305   TEVAAVIFLRERFSSEKGVALVLSLWGLASYSYGEWSEARAKKRK  349



>ref|XP_010478189.1| PREDICTED: purine permease 3-like [Camelina sativa]
Length=345

 Score =   285 bits (729),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 169/333 (51%), Positives = 232/333 (70%), Gaps = 5/333 (2%)
 Frame = -1

Query  1240  RLFLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIPLaaayytrrr  1061
             +  +++N I++ IG CGG L++RLYF  GG R+WFST L TAG+P+ FIPL  +Y  RRR
Sbjct  3     KALVIINCIILAIGNCGGPLIMRLYFNNGGKRIWFSTFLETAGFPVIFIPLLFSYIHRRR  62

Query  1060  htt--ttaasiftiTRNTFlaaaalgvllGIINYLYTYGVSKLPVSTSALIAASQLAFTA  887
             +      A S F I      AA  +G+L G  NYLY YG++ LPVST+ALI ASQLAF A
Sbjct  63    NNNGGENATSFFLIKPRLLGAAIFIGILSGFDNYLYAYGIAYLPVSTAALIIASQLAFIA  122

Query  886   GGAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAFLMTLASAALY  707
               +F +VK +FT F++NAVVLLT GA VL + +  D+P  E+ K+YV  FL+T+A+A +Y
Sbjct  123   IFSFFMVKHKFTPFTINAVVLLTVGAAVLGMHTETDKPVHETHKQYVTGFLVTVAAAVVY  182

Query  706   GALLPCIELTYIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQAISREARGFEI  527
               +LP +EL Y K +Q L+YTLVL  QM++   A+    +GM +  DF+A+ +EA+ F++
Sbjct  183   AFILPLVELAYQKAKQPLSYTLVL--QMILCFLASIVSLIGMSIAGDFKALPKEAKEFKL  240

Query  526   GEANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLTEVFAVVFYGEKFGS  347
             GE  +YVV V +A+IWQ  F+GA G I   SSL+SGI+++  + +TEV AV+FY EKF +
Sbjct  241   GEVLFYVVAVFSAIIWQGFFLGAIGLIFCTSSLVSGIMISVLLPITEVLAVIFYHEKFQA  300

Query  346   EKGISLTLSLWGIVSYFYGEMKNGDNNKKEELQ  248
             EKG+SL LSLWG VSYFYGE+K+ DN+KK   Q
Sbjct  301   EKGLSLALSLWGFVSYFYGEIKS-DNDKKRIQQ  332



>ref|XP_009113691.1| PREDICTED: purine permease 1-like [Brassica rapa]
Length=355

 Score =   284 bits (727),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 169/350 (48%), Positives = 236/350 (67%), Gaps = 12/350 (3%)
 Frame = -1

Query  1249  MRRRLFLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIPLaaayyt  1070
             M+  L L+L  +++ IG CGG LL RLY+  GG R+WF + +STAG P+ FIPL  ++  
Sbjct  1     MKNSL-LVLICMILAIGTCGGPLLTRLYYNNGGERIWFMSFISTAGCPVIFIPLVLSFLR  59

Query  1069  rrrhtttt---aasiftiTRNTFlaaaalgvllGIINYLYTYGVSKLPVSTSALIAASQL  899
             RR    +       I  +    F+A+  +G+L+G+ NY + YG++ LPVST++LI  +QL
Sbjct  60    RRNRNNSENIEKTEIVLMETPMFMASIVIGLLIGLDNYCFAYGLAYLPVSTTSLIVGTQL  119

Query  898   AFTAGGAFLLVKQRFTAFSVNAVVLLTFGAGVLAV-GSNGDRPAGESKKEYVAAFLMTLA  722
              F A  +F +VKQ FT FS+NAVVLLT G G+LA+ G +G+R A  S KEYV  FL+TL 
Sbjct  120   GFNAIFSFFMVKQTFTPFSINAVVLLTAGTGILALRGGDGERSADVSHKEYVVGFLVTLT  179

Query  721   SAALYGALLPCIELTYIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQAISREA  542
             +A LY  +LP +ELTY K RQ +T+TLVLE Q+VM + A+ FC VGMLV  DF+ I  EA
Sbjct  180   AAVLYAFILPFVELTYKKVRQQITFTLVLEMQLVMCIAASCFCIVGMLVEGDFKVIPIEA  239

Query  541   RGFEI--GEANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLTEVFAVVF  368
             R F++  G A YY+++++T +++Q LF+GA G +   SSL SG++++A + +TEV AVV 
Sbjct  240   REFKVGGGSAFYYMLILMTGIVYQGLFLGAIGVVFCASSLASGVLISALLPVTEVLAVVC  299

Query  367   YGEKFGSEKGISLTLSLWGIVSYFYGEMKNGDN--NKKEELQIQVTNMEP  224
             + EKF  EKG++L LSLWG VSYFYGE K+G    NK    Q+Q T + P
Sbjct  300   FREKFQVEKGVALLLSLWGFVSYFYGEFKSGKRIINKT---QLQETELPP  346



>dbj|BAJ88843.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=417

 Score =   285 bits (730),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 157/343 (46%), Positives = 220/343 (64%), Gaps = 13/343 (4%)
 Frame = -1

Query  1243  RRLFLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIPLaaayytrr  1064
             R   L +N +++ +G   G LLLRLYF+RGG R W S+ L TAGWP+  +PL  ++ +RR
Sbjct  64    RDPLLAVNFLLLAVGASCGPLLLRLYFLRGGARKWLSSLLQTAGWPLLLVPLCFSFSSRR  123

Query  1063  rhttttaasiftiTRNTFlaaaalgvllGII--------NYLYTYGVSKLPVSTSALIAA  908
             R              +         +   ++        N+LY YG + LPVSTS+++ +
Sbjct  124   RRRRHRQGGGDDPISSAVFLMTPRLLAATVVVGIMTGADNFLYAYGTAYLPVSTSSILIS  183

Query  907   SQLAFTAGGAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAFLMT  728
             +QLAFTA  A L+V+QRFTA +VNA+VLL+ GA +L +GS GDRPAG +  +Y A F   
Sbjct  184   TQLAFTAAFALLVVRQRFTASTVNAIVLLSVGAAMLGMGSGGDRPAGVTGAQYAAGFGTA  243

Query  727   LASAALYGALLPCIELTYIKGRQS-----LTYTLVLEFQMVMSLFATAFCTVGMLVNKDF  563
             L +AALYG +LP +EL+            LTYTLV+E Q+V+ L ATAFC VGMLVNKDF
Sbjct  244   LGAAALYGLVLPVMELSQAWHAARAGAAALTYTLVVEIQVVIGLTATAFCAVGMLVNKDF  303

Query  562   QAISREARGFEIGEANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLTEV  383
             QAI REAR  E+G+A YY+++V TA ++Q   +G  G+I YGS+L +GII+   + +TEV
Sbjct  304   QAIPREARQSELGKAGYYLLLVGTAAVYQCFCLGIIGAIYYGSALFAGIIITVFLPVTEV  363

Query  382   FAVVFYGEKFGSEKGISLTLSLWGIVSYFYGEMKNGDNNKKEE  254
              AVVF+ E F   KG++L LSLWG+ SYFYGE+++   + + +
Sbjct  364   LAVVFFHEPFSGTKGVALGLSLWGLASYFYGEVRHMAPDAEHQ  406



>dbj|BAJ87663.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=388

 Score =   284 bits (726),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 157/343 (46%), Positives = 219/343 (64%), Gaps = 13/343 (4%)
 Frame = -1

Query  1243  RRLFLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIPLaaayytrr  1064
             R   L +N +++ +G   G LLLRLYF+RGG R W S+ L TAGWP+  +PL  ++ +RR
Sbjct  35    RDPLLAVNFLLLAVGASCGPLLLRLYFLRGGARKWLSSLLQTAGWPLLLVPLCFSFSSRR  94

Query  1063  rhttttaasiftiTRNTFlaaaalgvllGII--------NYLYTYGVSKLPVSTSALIAA  908
             R                        +   ++        N+LY YG + LPVSTS+++ +
Sbjct  95    RRRRHRQGGGDDPISGAVFLMTPRLLAATVVVGIMTGADNFLYAYGTAYLPVSTSSILIS  154

Query  907   SQLAFTAGGAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAFLMT  728
             +QLAFTA  A L+V+QRFTA +VNA+VLL+ GA +L +GS GDRPAG +  +Y A F   
Sbjct  155   TQLAFTAAFALLVVRQRFTASTVNAIVLLSVGAAMLGMGSGGDRPAGVTGAQYAAGFGTA  214

Query  727   LASAALYGALLPCIELTYIKGRQS-----LTYTLVLEFQMVMSLFATAFCTVGMLVNKDF  563
             L +AALYG +LP +EL+            LTYTLV+E Q+V+ L ATAFC VGMLVNKDF
Sbjct  215   LGAAALYGLVLPVMELSQAWHAARAGAAALTYTLVVEIQVVIGLTATAFCAVGMLVNKDF  274

Query  562   QAISREARGFEIGEANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLTEV  383
             QAI REAR  E+G+A YY+++V TA ++Q   +G  G+I YGS+L +GII+   + +TEV
Sbjct  275   QAIPREARQSELGKAGYYLLLVGTAAVYQCFCLGIIGAIYYGSALFAGIIITVFLPVTEV  334

Query  382   FAVVFYGEKFGSEKGISLTLSLWGIVSYFYGEMKNGDNNKKEE  254
              AVVF+ E F   KG++L LSLWG+ SYFYGE+++   + + +
Sbjct  335   LAVVFFHEPFSGTKGVALGLSLWGLASYFYGEVRHMAPDAEHQ  377



>gb|EPS58788.1| hypothetical protein M569_16026, partial [Genlisea aurea]
Length=330

 Score =   281 bits (720),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 170/329 (52%), Positives = 213/329 (65%), Gaps = 2/329 (1%)
 Frame = -1

Query  1243  RRLFLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIPLaaayytrr  1064
             +RLFLL+NA+++ +G CG  L LRLYF RGG  +WF+  L + GWP+  +PLA  Y  RR
Sbjct  2     KRLFLLVNAVILAVGYCGLPLTLRLYFGRGGEMVWFAGWLQSGGWPVILLPLAVNYLARR  61

Query  1063  rhttttaasiftiTR-NTFlaaaalgvllGIINYLYTYGVSKLPVSTSALIAASQLAFTA  887
             R  T + +      R   F AA A+G++ G  N++Y YG+SKLPVST ALI A+QLAFT 
Sbjct  62    RERTPSGSVKVIRLRPKLFAAAMAIGMITGADNFMYAYGISKLPVSTVALIDATQLAFTV  121

Query  886   GGAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAFLMTLASAALY  707
               +F +VKQ+ TAFSVNAVVLLT GA V AV S GDRPAGES  EY   F M   SAA +
Sbjct  122   VFSFFIVKQKLTAFSVNAVVLLTVGAVVFAVHSTGDRPAGESHSEYWKGFAMMAGSAATF  181

Query  706   GALLPCIELTYIK-GRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQAISREARGFE  530
             G  L  +E +Y K G  S+ Y  VLEF +V ++ AT F TVGM    +FQAI  EA G+ 
Sbjct  182   GLCLSLVEFSYAKTGGPSMDYAAVLEFDLVTNISATLFSTVGMAAEHNFQAIRGEATGYR  241

Query  529   IGEANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLTEVFAVVFYGEKFG  350
              G   YY  V   AL+ Q L +G AG I Y SSL SGI+L+  + L EV AVVF+ +++ 
Sbjct  242   SGRIKYYAAVFSVALVCQCLRLGIAGVIHYSSSLYSGILLSVLLPLVEVLAVVFFKDEYP  301

Query  349   SEKGISLTLSLWGIVSYFYGEMKNGDNNK  263
              EKGI+L LSLWG VSYFYGE K  +N  
Sbjct  302   PEKGIALFLSLWGFVSYFYGEYKVANNRN  330



>emb|CDX90135.1| BnaA08g18490D [Brassica napus]
Length=323

 Score =   281 bits (718),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 160/335 (48%), Positives = 211/335 (63%), Gaps = 32/335 (10%)
 Frame = -1

Query  1231  LLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIPLaaayytrrrhtt  1052
             L++  I + IG CGG LL RLY+ +GG+R+WF + L+TAG PI  IPL  ++  R     
Sbjct  6     LIIVCIFLAIGTCGGPLLTRLYYTKGGSRIWFMSFLATAGCPIILIPLYVSFLRRSN---  62

Query  1051  ttaasiftiTRNTFlaaaalgvllGIINYLYTYGVSKLPVSTSALIAASQLAFTAGGAFL  872
                       RN               N   T   +K+ V  + L  AS LAF A  +FL
Sbjct  63    ----------RNH--------------NNSETAEKAKVFVMETPLFIASILAFNAIFSFL  98

Query  871   LVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAFLMTLASAALYGALLP  692
             +VKQ+FT FS+NAVVLLT G G+LA+ ++ DRPAG SKKEYV  FL+TL +A LY  L+P
Sbjct  99    MVKQKFTPFSINAVVLLTVGTGILALHTDRDRPAGVSKKEYVVGFLLTLIAAVLYAFLMP  158

Query  691   CIELTYIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQAISREARGFEIGEA-N  515
              +ELTY K RQ +T+TLVLE QMVM + +T FC VGM+V  DF AI REAR F IG +  
Sbjct  159   LVELTYKKVRQEITFTLVLEMQMVMCVASTCFCLVGMVVKGDFVAIPREAREFMIGSSLF  218

Query  514   YYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLTEVFAVVFYGEKFGSEKGI  335
             YY ++VV  ++WQ  F+GA G +   SSL SG+ ++  + +TEV AVV + EKF +EKG+
Sbjct  219   YYTLIVVIGIVWQCFFLGALGVVYCASSLASGVFVSVLLPVTEVLAVVCFREKFQAEKGV  278

Query  334   SLTLSLWGIVSYFYGEMKNG----DNNKKEELQIQ  242
             +L LSLWG VSYFYGE K+G    D+ K  E ++ 
Sbjct  279   ALLLSLWGFVSYFYGEFKSGKKIIDSPKSPETELP  313



>ref|XP_003578263.2| PREDICTED: purine permease 3-like [Brachypodium distachyon]
Length=397

 Score =   283 bits (723),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 165/356 (46%), Positives = 232/356 (65%), Gaps = 16/356 (4%)
 Frame = -1

Query  1252  NMRRRLFLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIP-----L  1088
             +M   LF++ N ++M +G   G LLLR YF+ GGNR W S+ L TAGWP+  +P      
Sbjct  45    HMYSPLFVV-NFLLMVVGSACGPLLLRAYFLHGGNRKWLSSLLQTAGWPL-LLPALGFSF  102

Query  1087  aaayytrrrhttttaasiftiTRNTFlaaaalgvllGIINYLYTYGVSKLPVSTSALIAA  908
              +    R+     TAA +F ++     A  A+G + G+ + LY YG++ LPVSTS+++ +
Sbjct  103   VSRRRRRKATKGATAAPLFLMSPRLLAATVAVGFMTGLDDLLYAYGLAYLPVSTSSILIS  162

Query  907   SQLAFTAGGAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAFLMT  728
             +QL FTA  A LLV+QRFTAFSVNAVVLL+ GA +L + + GDRPAG +K +YVA F MT
Sbjct  163   TQLVFTAAFALLLVRQRFTAFSVNAVVLLSVGAAMLGMNAGGDRPAGVTKGQYVAGFAMT  222

Query  727   LASAALYGALLPCIELTYIK-----GRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDF  563
             L +AALYG +LP +EL+  +     GR  +TY LV+E Q V+ L ATAF  VGMLVN DF
Sbjct  223   LGAAALYGLVLPVMELSQARHAARYGR-PVTYALVMEMQAVIGLTATAFSAVGMLVNNDF  281

Query  562   QAISREARGFEIGEANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLTEV  383
             QAI  EAR F +G+  YY+++  +A ++Q  F+G  G+I YGS+LL+G+I+   I +TEV
Sbjct  282   QAIPGEAREFGLGQVGYYLLLAGSATVYQFFFLGTIGAIFYGSALLAGVIMTVLIPVTEV  341

Query  382   FAVVFYGEKFGSEKGISLTLSLWGIVSYFYGEMK---NGDNNKKEELQIQVTNMEP  224
              AV+F+ E F   KGI+L LSLWG VSY YGE++   +   + K    +   +++P
Sbjct  342   LAVMFFHEPFNGTKGIALALSLWGFVSYLYGEVRAKAHKSESDKPPNTVHTEHLDP  397



>dbj|BAK04933.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=377

 Score =   281 bits (720),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 159/352 (45%), Positives = 234/352 (66%), Gaps = 8/352 (2%)
 Frame = -1

Query  1261  GKGNMRRRLFLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIPLaa  1082
             G   +R    L++N ++M +G   G LLLR YF+ GG R W S+ L TAGWP+   PL A
Sbjct  28    GAKPLRHNPLLVINFLLMVVGSAFGPLLLRAYFLHGGTRKWLSSLLQTAGWPLLLAPLGA  87

Query  1081  ayytrrrhttt--taasiftiTRNTFlaaaalgvllGIINYLYTYGVSKLPVSTSALIAA  908
             ++ +RRR      +A  +F ++     A  A+G++ G+ + LY YG++ LPVSTS+++ +
Sbjct  88    SFLSRRRSNKDGGSATPLFLMSPRLLAATVAVGLMTGLDDLLYAYGLAYLPVSTSSILIS  147

Query  907   SQLAFTAGGAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAFLMT  728
             +QLAFTA  A LLV+QRFTAFSVNAVVLL+ GA +L + + GDRPAG ++ +Y A F MT
Sbjct  148   TQLAFTAAFALLLVRQRFTAFSVNAVVLLSVGAAMLGMNAGGDRPAGVTRPQYYAGFGMT  207

Query  727   LASAALYGALLPCIELTYIKGRQ----SLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQ  560
             L +A +YG +LP +EL+  +       ++TYTLV+E Q+V+   ATAF  VGMLVN DF 
Sbjct  208   LGAALIYGIVLPVMELSQARHAARTGAAVTYTLVMEMQIVIGFTATAFSAVGMLVNNDFH  267

Query  559   AISREARGFEIGEANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLTEVF  380
             AI  EAR F +G++ YY+++  +A ++Q  F+G  G+I YGS+LL+G+I+   I +TEV 
Sbjct  268   AIRGEAREFGLGQSGYYLLLAGSATVYQFFFLGTIGAIFYGSALLAGVIMTVLIPVTEVL  327

Query  379   AVVFYGEKFGSEKGISLTLSLWGIVSYFYGEMKNGDNNKKEELQIQVTNMEP  224
             AV+F+ E F   KG++L LSLWG VSY YGE++     K+ +  +   +++P
Sbjct  328   AVMFFHEPFNGTKGVALALSLWGFVSYLYGEVR--AKAKQSDKPLNAEHLDP  377



>dbj|BAD19737.1| putative purine permease [Oryza sativa Japonica Group]
Length=361

 Score =   281 bits (718),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 162/319 (51%), Positives = 221/319 (69%), Gaps = 5/319 (2%)
 Frame = -1

Query  1237  LFLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIPLaaayytrrrh  1058
             L + LN  M+ +G  GG +L RLYF +GG+R W S  L TAGWP+  +P++A+Y++RR  
Sbjct  26    LLVALNCGMLVVGTTGGPILSRLYFSKGGHRKWLSAWLETAGWPLLLVPVSASYHSRRAR  85

Query  1057  ttttaasiftiTRNTFlaaaalgvllGIINYLYTYGVSKLPVSTSALIAASQLAFTAGGA  878
                    +    R   LA A LGVL G  +++Y YG++ LPVSTSA++ ++QLAFT   A
Sbjct  86    DRGAPLFLTP--RRVLLAGAVLGVLTGADDFVYAYGLAYLPVSTSAILISTQLAFTVFFA  143

Query  877   FLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAFLMTLASAALYGAL  698
              L+V+QR TA ++NAV LLT GA VL + ++ DRPAG +  +Y   F +TL +AALYG +
Sbjct  144   CLIVRQRLTAATLNAVALLTIGAVVLGLHASKDRPAGVTTGKYWMGFFLTLGAAALYGLI  203

Query  697   LPCIELTYIK---GRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQAISREARGFEI  527
             LP +EL Y     G +++TY LV+E Q+VM  FATAFCTVG++VNKDFQAI REA+ +E+
Sbjct  204   LPLVELAYKHAAGGGRAVTYALVMEMQLVMGFFATAFCTVGVIVNKDFQAIPREAKQYEL  263

Query  526   GEANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLTEVFAVVFYGEKFGS  347
             GEA YYVV+V  A++W+  F+GA G I    +LL+GII+A  I +TEV  V+F  EKF S
Sbjct  264   GEARYYVVLVFNAVLWEFFFVGAVGVIFCVHTLLAGIIIAVFIPITEVLGVIFLHEKFSS  323

Query  346   EKGISLTLSLWGIVSYFYG  290
             EKG++L LSLWG+ SY YG
Sbjct  324   EKGVALVLSLWGLASYSYG  342



>ref|XP_006841261.1| hypothetical protein AMTR_s00135p00099660 [Amborella trichopoda]
 gb|ERN02936.1| hypothetical protein AMTR_s00135p00099660 [Amborella trichopoda]
Length=366

 Score =   281 bits (718),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 153/364 (42%), Positives = 228/364 (63%), Gaps = 12/364 (3%)
 Frame = -1

Query  1300  LFYKLKLKME----VSEGKGNMRRRLFLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFS  1133
             L + L L M+    +S+ K  ++  + L +N + + +GG    L+ R+YF+ GG R WF+
Sbjct  8     LHHVLNLAMDTSTTISDNKSPVKGYILLAVNGLFLTLGGGCAPLVSRIYFLHGGQRKWFT  67

Query  1132  TCLSTAGWPINFIPLaaayytrrrhttttaasiftiTRNTFlaaaalgvllGII---NYL  962
               + TA WP+          +  +  +    S    +  TF  A     +  +I   +Y+
Sbjct  68    AWIQTAAWPLL-----LIPLSLPKFFSKKLQSQQEKSHLTFPLALQSAGIGLLIGLDDYM  122

Query  961   YTYGVSKLPVSTSALIAASQLAFTAGGAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNG  782
             Y +G+S LPVSTS+L+  +QLAFTA  AF+LV+ RFTA+S+NAVVLLT G  +L +G+ G
Sbjct  123   YAFGLSYLPVSTSSLLLCTQLAFTALFAFVLVRYRFTAYSINAVVLLTLGPVLLGLGARG  182

Query  781   DRPAGESKKEYVAAFLMTLASAALYGALLPCIELTYIKGRQSLTYTLVLEFQMVMSLFAT  602
             DRP G S  +Y   ++MT+ +AA++G ++P +EL Y K +  +TYTLVLE Q++M + AT
Sbjct  183   DRPEGVSGAKYALGYVMTVGTAAVFGLVVPLLELVYGKAKVVVTYTLVLEMQVIMYVVAT  242

Query  601   AFCTVGMLVNKDFQAISREARGFEIGEANYYVVVVVTALIWQILFIGAAGSICYGSSLLS  422
             AFCTVGM+ NKDFQAI  EAR F +GE  YY+ VV + ++WQ+ FIG+AG I   SS+ +
Sbjct  243   AFCTVGMIANKDFQAIPIEAREFGLGEFKYYLTVVASGVMWQLFFIGSAGFIFCTSSMFT  302

Query  421   GIILAATISLTEVFAVVFYGEKFGSEKGISLTLSLWGIVSYFYGEMKNGDNNKKEELQIQ  242
             G+ +A  I L+E+  V+F+ EKF  EKG++L LS+WG VSYFYGE  N    K  ++   
Sbjct  303   GVFVALQIPLSELLVVIFFHEKFTGEKGMALVLSMWGFVSYFYGEHLNARKKKGPDMDTA  362

Query  241   VTNM  230
             +  +
Sbjct  363   INQL  366



>gb|EEC84724.1| hypothetical protein OsI_31699 [Oryza sativa Indica Group]
Length=361

 Score =   280 bits (717),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 162/319 (51%), Positives = 220/319 (69%), Gaps = 5/319 (2%)
 Frame = -1

Query  1237  LFLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIPLaaayytrrrh  1058
             L + LN  M+ +G  GG +L RLYF +GG+R W S  L TAGWP+  +P++A+Y +RR  
Sbjct  26    LLVALNCGMLVVGTTGGPILSRLYFSKGGHRKWLSAWLETAGWPLLLVPVSASYLSRRAR  85

Query  1057  ttttaasiftiTRNTFlaaaalgvllGIINYLYTYGVSKLPVSTSALIAASQLAFTAGGA  878
                    +    R   LA A LGVL G  +++Y YG++ LPVSTSA++ ++QLAFT   A
Sbjct  86    DRGAPLFLTP--RRVLLAGAVLGVLTGADDFVYAYGLAYLPVSTSAILISTQLAFTVFFA  143

Query  877   FLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAFLMTLASAALYGAL  698
              L+V+QR TA ++NAV LLT GA VL + ++ DRPAG +  +Y   F +TL +AALYG +
Sbjct  144   CLIVRQRLTAATLNAVALLTIGAVVLGLHASKDRPAGVTTGKYWMGFFLTLGAAALYGLI  203

Query  697   LPCIELTYIK---GRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQAISREARGFEI  527
             LP +EL Y     G +++TY LV+E Q+VM  FATAFCTVG++VNKDFQAI REA+ +E+
Sbjct  204   LPLVELAYKHAAGGGRAVTYALVMEMQLVMGFFATAFCTVGVIVNKDFQAIPREAKQYEL  263

Query  526   GEANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLTEVFAVVFYGEKFGS  347
             GEA YYVV+V  A++W+  F+GA G I    +LL+GII+A  I +TEV  V+F  EKF S
Sbjct  264   GEARYYVVLVFNAVLWEFFFVGAVGVIFCVHTLLAGIIIAVFIPITEVLGVIFLHEKFSS  323

Query  346   EKGISLTLSLWGIVSYFYG  290
             EKG++L LSLWG+ SY YG
Sbjct  324   EKGVALVLSLWGLASYSYG  342



>ref|XP_010926344.1| PREDICTED: purine permease 3-like isoform X1 [Elaeis guineensis]
Length=367

 Score =   280 bits (715),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 156/343 (45%), Positives = 217/343 (63%), Gaps = 20/343 (6%)
 Frame = -1

Query  1252  NMRRRLFLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPIN---------  1100
             +++    +  NA++M +G  GG+LLLRLYF+RGG+R+W ST L  A WPI          
Sbjct  26    HLKPSPLVAFNAVLMLVGSGGGSLLLRLYFVRGGHRMWLSTFLQVAAWPILLLPLYLSRL  85

Query  1099  FIPLaaayytrrrhttttaasiftiTRNTFlaaaalgvllGIINYLYTYGVSKLPVSTSA  920
             F+P           TTT       +      A+A LG+L+ +  YLY YG S LP+STS+
Sbjct  86    FLP----------TTTTPRRHHLLLPLPLAAASAFLGLLIALDCYLYAYGSSCLPLSTSS  135

Query  919   LIAASQLAFTAGGAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAA  740
             L+ ASQLAFTA  +FL+V+QRFTAFS+NAVVLLT G  VL++G+ GDRP GE+  +Y   
Sbjct  136   LLIASQLAFTAVFSFLIVRQRFTAFSLNAVVLLTLGPVVLSLGAAGDRPEGEAMSKYYVG  195

Query  739   FLMTLASAALYGALLPCIELTYIK-GRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDF  563
             F M++A+AAL G +LP +EL Y +   + +TY  V+  Q+VM    + FC +GML+NKDF
Sbjct  196   FFMSIAAAALIGLVLPLVELAYRRMSTEEMTYATVIVTQIVMGASGSVFCLLGMLINKDF  255

Query  562   QAISREARGFEIGEANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLTEV  383
             QAI +EA+ FE+GE  YY+V++  A+ WQI+ +G  G I   SSL  G+++A  + + E+
Sbjct  256   QAIPKEAKDFELGELKYYMVLIWNAICWQIINVGMVGVIFTASSLFCGVMIAILVPVGEI  315

Query  382   FAVVFYGEKFGSEKGISLTLSLWGIVSYFYGEMKNGDNNKKEE  254
              AV+F  EKF   KG++L L LWG  SY YGEMK     K+  
Sbjct  316   LAVIFLNEKFNGSKGVALALCLWGFASYMYGEMKQSKKQKQPS  358



>ref|XP_010263028.1| PREDICTED: purine permease 1-like [Nelumbo nucifera]
Length=365

 Score =   277 bits (709),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 156/346 (45%), Positives = 221/346 (64%), Gaps = 7/346 (2%)
 Frame = -1

Query  1285  KLKMEVSEGKGNMRRRLFLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWP  1106
             K+    S  K NM +   L +N +   +G   G LLLRLYF+ GGNR W  + L TAG P
Sbjct  22    KMPEGDSSTKSNMAKWWLLGINCVCTVLGTIAGPLLLRLYFLHGGNRKWIPSWLETAGVP  81

Query  1105  INFIPLaaayytrrrhttttaasiftiTRNTFlaaaalgvllGIINYLYTYGVSKLPVST  926
                 PL   Y   R       A          L +A +G+L G+ N++Y+ G+S LPVST
Sbjct  82    ALLGPLTVLYLRERASGVRFLAPT-----KLLLLSAGIGLLAGLNNFMYSLGLSFLPVST  136

Query  925   SALIAASQLAFTAGGAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYV  746
             S+L+ ++QLAFTA  AFL+ KQ+FT +S NAVVL+T GA +L +  +GDRP G S K+Y+
Sbjct  137   SSLLLSTQLAFTAFFAFLIAKQKFTPYSTNAVVLMTLGAVLLGLTKSGDRPPGVSNKDYL  196

Query  745   AAFLMTLASAALYGALLPCIELTYIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKD  566
               F++TL +A L G +LPC E++Y   R+++TY++VL+FQ  ++ FAT FCT+GML+NKD
Sbjct  197   LGFILTLGAAGLLGFILPCCEVSYATARKTITYSVVLQFQFGVNFFATVFCTIGMLINKD  256

Query  565   FQAISREARGFEIGEANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLTE  386
             FQAI REA  FE+G   YY+V+V  A++WQ+  +G  G +   +SL +G++ A  + LTE
Sbjct  257   FQAIPREANAFELGAVKYYMVLVSIAIVWQMAVVGLLGVVFCTTSLFAGVLNATLLPLTE  316

Query  385   VFAVVFYGEKFGSEKGISLTLSLWGIVSYFYGEMKNGDNNKKEELQ  248
             + AV+ Y EKF  EKG++L L  WG +SYFYG  K  +N K++ L 
Sbjct  317   IAAVIVYHEKFTGEKGMALALCSWGFISYFYGSYK--ENKKQKALS  360



>ref|XP_010234593.1| PREDICTED: purine permease 3-like isoform X1 [Brachypodium distachyon]
Length=375

 Score =   278 bits (710),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 160/334 (48%), Positives = 227/334 (68%), Gaps = 10/334 (3%)
 Frame = -1

Query  1234  FLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIPLaaayytrrrht  1055
              L++N +++  G   G LLLR YF+ GG R W S+ L TAGWP+  +PL A++++RRR  
Sbjct  35    LLVVNFVLLAAGTACGPLLLRAYFVHGGTRKWLSSLLQTAGWPLLLVPLCASFFSRRRRH  94

Query  1054  tttaasift---iTRNTFlaaaalgvllGIINYLYTYGVSKLPVSTSALIAASQLAFTAG  884
                  S      +T     A+ A+GV+ G+ N+ Y YG + LPVSTS+++ ++QL FTA 
Sbjct  95    LQDHGSSCELFFMTPRLLAASTAIGVMTGVDNFFYAYGQAYLPVSTSSILLSTQLVFTAA  154

Query  883   GAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAFLMTLASAALYG  704
              A LLV+QRF A +VNAVVLLT GA +L + + GDRPAG S  +Y A F M L +AALYG
Sbjct  155   FALLLVRQRFAAATVNAVVLLTVGAAMLGMNAGGDRPAGVSAPQYRAGFGMVLGAAALYG  214

Query  703   ALLPCIELTYIK--GRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQAISREARGFE  530
              LLP +EL+  +   R ++TYTLV+E Q+V+ L A+AFC +GM++NKDFQ IS EAR  E
Sbjct  215   LLLPAMELSQARHAARGAVTYTLVVEIQLVIGLSASAFCAIGMIINKDFQGISGEARESE  274

Query  529   IGEANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLTEVFAVVFYGEKFG  350
             +GEA YY+++  TA ++Q   +G  G+I YGS+LL+G+I+   I ++EV AV+F+ E F 
Sbjct  275   LGEAGYYLLLAGTAAVYQCFCLGTIGAIFYGSALLAGVIITVFIPVSEVLAVIFFHEPFS  334

Query  349   SEKGISLTLSLWGIVSYFYGEMKNGDNNKKEELQ  248
               KGI+L LSLWG++SYFYG+++      K+ LQ
Sbjct  335   PTKGIALGLSLWGLISYFYGDVRT-----KQALQ  363



>ref|XP_004959530.1| PREDICTED: purine permease 1-like [Setaria italica]
Length=378

 Score =   278 bits (710),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 155/335 (46%), Positives = 222/335 (66%), Gaps = 7/335 (2%)
 Frame = -1

Query  1243  RRLFLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIPLaaayytrr  1064
             R   L++N ++M +G  GG L LR YF+ GG R W S  L TAG+P+  +PL  ++  R+
Sbjct  34    RNPLLVVNFVLMVVGTAGGPLFLRAYFLHGGARKWLSAFLQTAGFPLLLVPLCVSFSRRK  93

Query  1063  rhttttaasiftiTRNTFlaaaalgvllGIINYLYTYGVSKLPVSTSALIAASQLAFTAG  884
             +    T   + T      +A+A +G++ G+ + LYTYG++ LPVSTS+++ ++QLAFTA 
Sbjct  94    KAAGGTPFFLMTP--RLLVASAGIGLMTGLDDLLYTYGLAYLPVSTSSILISTQLAFTAA  151

Query  883   GAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAFLMTLASAALYG  704
              A LLV+QRFTA SVNAVVLL+ GA +L + + GDRPAG S+ +Y A F MTL +AAL+G
Sbjct  152   FALLLVRQRFTASSVNAVVLLSVGAAMLGMNAGGDRPAGVSRAQYSAGFAMTLGAAALFG  211

Query  703   ALLPCIELTYIK-----GRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQAISREAR  539
              +LP +EL+  +     G   +TYTLV+E Q+V+ L AT F  VGMLVN DF AI  EAR
Sbjct  212   LVLPVMELSQARHAARPGAAPVTYTLVIEMQLVIGLTATIFTAVGMLVNNDFHAIPEEAR  271

Query  538   GFEIGEANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLTEVFAVVFYGE  359
              F  G + YY+++  +A  +Q  F+G  G+I +GS+LL+G+I+   I +TEV AV+ + E
Sbjct  272   QFGFGRSGYYLLLAGSAATYQCFFLGTIGAIFFGSALLAGVIMTVLIPVTEVLAVMLFSE  331

Query  358   KFGSEKGISLTLSLWGIVSYFYGEMKNGDNNKKEE  254
              F   KG++L LSLWG VSYFYGE++    N + +
Sbjct  332   PFNGTKGVALALSLWGFVSYFYGEVQTSKANHQSD  366



>gb|EMT19524.1| Purine permease 3 [Aegilops tauschii]
Length=333

 Score =   275 bits (704),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 152/335 (45%), Positives = 222/335 (66%), Gaps = 8/335 (2%)
 Frame = -1

Query  1210  MCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIPLaaayytrrrhttttaasif  1031
             M +G   G LLLR  F+ GG R W S+ L  AGWP+   PL+A++ +RRR     +++  
Sbjct  1     MVVGSAFGPLLLRASFLHGGPRKWLSSLLQPAGWPLLLAPLSASFLSRRRSNKDGSSATP  60

Query  1030  tiTRNT--FlaaaalgvllGIINYLYTYGVSKLPVSTSALIAASQLAFTAGGAFLLVKQR  857
                 +     A  A+G+  G+ + LY YG++ LPVSTS+++ ++QLAFTA  A LLV+QR
Sbjct  61    LFLMSPRLLAATVAVGLRTGLDDLLYAYGLAYLPVSTSSILISTQLAFTAAFALLLVRQR  120

Query  856   FTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAFLMTLASAALYGALLPCIELT  677
             FTAFSVNAVVLL+ GA +L + + GDRPAG ++ +Y A F MTL +AALYG +LP +EL+
Sbjct  121   FTAFSVNAVVLLSVGAAMLGMNAGGDRPAGVTRAQYYAGFGMTLGAAALYGLMLPVMELS  180

Query  676   YIKGRQ----SLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQAISREARGFEIGEANYY  509
               +       ++TY LV+E Q+V+   ATAF  +GMLVN DF AI REAR F +G+  YY
Sbjct  181   QARHAARTGAAVTYILVMEMQIVIGFTATAFSAIGMLVNNDFHAIPREAREFGLGQIGYY  240

Query  508   VVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLTEVFAVVFYGEKFGSEKGISL  329
             +++  +A+++Q  F+G  G+I YGS+LL+G+I+   I +TEV AV+F+ E F   KG++L
Sbjct  241   LLLAASAIVYQFFFLGTIGAIFYGSALLAGVIMTVLIPVTEVLAVLFFHEPFNGTKGVAL  300

Query  328   TLSLWGIVSYFYGEMKNGDNNKKEELQIQVTNMEP  224
              LSLWG VSY YGE++    +  + L  +  +++P
Sbjct  301   ALSLWGFVSYLYGEIRAKAQDSDKPLNTE--HLDP  333



>gb|KFK31021.1| hypothetical protein AALP_AA6G057800 [Arabis alpina]
Length=317

 Score =   275 bits (702),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 155/334 (46%), Positives = 213/334 (64%), Gaps = 33/334 (10%)
 Frame = -1

Query  1243  RRLFLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIPLaaayytrr  1064
             + + +++N I++ IG CGG L+ RLY+  GG R+WFS+ L TAG PI    L    ++  
Sbjct  6     KTVLVIINCIILAIGNCGGPLMTRLYYNNGGKRIWFSSFLQTAGCPI---ILLPLLFSFF  62

Query  1063  rhttttaasiftiTRNTFlaaaalgvllGIINYLYTYGVSKLPVSTSALIAASQLAFTAG  884
                         I R  FLA+  +G+L G  NYLY YG++ LPVSTS+LI +SQLAFTA 
Sbjct  63    LRRKEEKTPYLLIKRPLFLASIVIGLLTGFDNYLYAYGLAYLPVSTSSLILSSQLAFTAL  122

Query  883   GAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAFLMTLASAALYG  704
              AF LVK +FT F++NA+VL+T G+G+LA+ ++GD+ A E+ KEYV  FLMTLA++ LY 
Sbjct  123   FAFFLVKHKFTPFTINAIVLITIGSGILALHTDGDKLAEETHKEYVIGFLMTLAASVLYA  182

Query  703   ALLPCIELTYIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQAISREARGFEIG  524
              +LP +ELTY K RQ ++YTLVLE Q+V+   AT FC VGML + DF+ I+ EAR F++G
Sbjct  183   FVLPLVELTYKKARQEISYTLVLEMQIVLCSVATCFCLVGMLADGDFKVIANEAREFKLG  242

Query  523   EAN-YYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLTEVFAVVFYGEKFGS  347
                 YYVVVV TA+IWQ                             E+ A++F+ EKF +
Sbjct  243   GTRYYYVVVVFTAIIWQ-----------------------------ELLAILFFREKFQA  273

Query  346   EKGISLTLSLWGIVSYFYGEMKNGDNNKKEELQI  245
             EKG+SL LSLWG VSYFYG++K+ +  +  E Q+
Sbjct  274   EKGVSLGLSLWGFVSYFYGQIKSENKTQDHETQL  307



>ref|XP_008667894.1| PREDICTED: PUP1 isoform X1 [Zea mays]
 tpg|DAA40285.1| TPA: PUP1 [Zea mays]
Length=387

 Score =   276 bits (707),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 159/346 (46%), Positives = 224/346 (65%), Gaps = 9/346 (3%)
 Frame = -1

Query  1243  RRLFLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIPLaaayytrr  1064
             R   L++N ++M +G  GG L LR YF+ GG R W S  L TAG+P+  +PL  ++  RR
Sbjct  40    RNPLLVVNFVLMVVGSAGGPLFLRAYFLHGGARKWLSALLQTAGFPLLLVPLCVSFSRRR  99

Query  1063  rhttttaasiftiTRNT---FlaaaalgvllGIINYLYTYGVSKLPVSTSALIAASQLAF  893
             R     A +       T     A+AA+G++ G+ + LY YG++ LPVSTS+++ ++QLAF
Sbjct  100   RRRDDGAPAKAPFFLMTPRLLAASAAIGLMTGLDDLLYAYGLAYLPVSTSSILISTQLAF  159

Query  892   TAGGAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAFLMTLASAA  713
             TA  A LLV+QRFTAFSVNAV LL+ GA +L + + GDRPAG S  +Y A F MTL +AA
Sbjct  160   TAAFALLLVRQRFTAFSVNAVALLSAGAAMLGMNAGGDRPAGVSPAQYGAGFAMTLGAAA  219

Query  712   LYGALLPCIELT----YIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQAISRE  545
             LYG LLP +EL+          ++TYTLV+E Q+V+ L AT F  VGML N D  AI  E
Sbjct  220   LYGLLLPAMELSQAQARAGTAAAVTYTLVIEMQLVIGLTATVFSAVGMLANHDLHAIPGE  279

Query  544   ARGFEIGEANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLTEVFAVVFY  365
             AR F++G + YY+++  +A  +Q  F+G  G++ +GS+LL+G+++   I +TEV AVVF+
Sbjct  280   AREFDLGRSGYYLLLAGSAATYQCFFLGTIGAVFFGSALLAGVVMTVLIPVTEVLAVVFF  339

Query  364   GEKFGSEKGISLTLSLWGIVSYFYGEMKNGDNNKKEELQIQVTNME  227
              E F   KG++L LSLWG VSYFYGE++   +     L  + TN+E
Sbjct  340   HEPFNGTKGVALALSLWGFVSYFYGEVQT--SKAHHHLPDKPTNVE  383



>ref|NP_001147096.1| PUP1 [Zea mays]
 gb|ACG25423.1| PUP1 [Zea mays]
Length=373

 Score =   276 bits (706),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 157/356 (44%), Positives = 216/356 (61%), Gaps = 14/356 (4%)
 Frame = -1

Query  1261  GKGNMRRRLFLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIPLaa  1082
             G     R   L++N ++M +G  GG L LR YF+ GG R W S  L TAG+P+  +PL  
Sbjct  17    GTTRTLRNPLLVVNFVLMVVGSAGGPLFLRAYFLHGGARKWLSALLQTAGFPLLLVPLCV  76

Query  1081  ayytrrrhttttaasiftiTRNTFlaaaalgvllGII-------NYLYTYGVSKLPVSTS  923
             ++  RRR                FL    L      I       + LY YG++ LPVSTS
Sbjct  77    SFSRRRRRRPRRPDDGAPAMAPFFLMTPRLLAASAAIGLMTGLDDLLYAYGLAYLPVSTS  136

Query  922   ALIAASQLAFTAGGAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVA  743
             +++ ++QLAFTA  A LLV+QRFTAFSVNAV LL+ GA +L + + GDRPAG S  +Y A
Sbjct  137   SILISTQLAFTAAFALLLVRQRFTAFSVNAVALLSAGAAMLGMNAGGDRPAGVSPAQYGA  196

Query  742   AFLMTLASAALYGALLPCIELT----YIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLV  575
              F MTL +AALYG LL  +EL+          ++TYTLV+E Q+V+ L AT F  VGML 
Sbjct  197   GFAMTLGAAALYGLLLHAMELSQAQARAGTAAAVTYTLVIEMQLVIGLTATVFSAVGMLA  256

Query  574   NKDFQAISREARGFEIGEANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATIS  395
             N D  AI  EAR F++G + YY+++  +A  +Q  F+G  G++ +GS+LL+G+++   I 
Sbjct  257   NHDLHAIPGEAREFDLGRSGYYLLLAGSAATYQCFFLGTIGAVFFGSALLAGVVMTVLIP  316

Query  394   LTEVFAVVFYGEKFGSEKGISLTLSLWGIVSYFYGEMKNGDNNKKEELQIQVTNME  227
             +TEV AVVF+ E F   KG++L LSLWG VSYFYGE++    +K   L  + TN+E
Sbjct  317   VTEVLAVVFFHEPFNGTKGVALALSLWGFVSYFYGEVQ---TSKAHHLPDKPTNVE  369



>gb|KCW51603.1| hypothetical protein EUGRSUZ_J01095 [Eucalyptus grandis]
Length=302

 Score =   273 bits (699),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 168/321 (52%), Positives = 214/321 (67%), Gaps = 27/321 (8%)
 Frame = -1

Query  1177  LRLYFIRGGNRLWFSTCLSTAGWPINFIPLaaayytrrrhttttaasiftiTRNTFlaaa  998
             +RLYF+RG  R+W  + L    WP+  +PLAAAY  RR      A  I    R  F AAA
Sbjct  1     MRLYFVRGKARMWLVSWLEMGAWPMLLLPLAAAYSRRRSAMGPAARLILMD-RFLFAAAA  59

Query  997   algvllGIINYLYTYGVSKLPVSTSALIAASQLAFTAGGAFLLVKQRFTAFSVNAVVLLT  818
              +GVL+G+ NY Y YG+ +LPVSTSAL+ A+QLAFTAG AFLLV+Q FT+ S+N+     
Sbjct  60    GIGVLMGLDNYFYVYGLGRLPVSTSALLIATQLAFTAGFAFLLVRQVFTSCSINS-----  114

Query  817   FGAGVLAVGSNGDRPAGESKKEYVAAFLMTLASAALYGALLPCIELTYIKGRQSLTYTLV  638
                      SNG   AG         F M+L +AALYG +LP +ELTY K +Q++TY+LV
Sbjct  115   ---------SNGANYAG---------FFMSLGAAALYGFVLPLVELTYKKAKQAVTYSLV  156

Query  637   LEFQMVMSLFATAFCTVGMLVNKDFQAISREARGFEIGEANYYVVVVVTALIWQILFIGA  458
             LE Q+VM  FATAFCT+GMLVNKDFQAI REAR +E+GEA YYV++V TA+I Q  F+GA
Sbjct  157   LEIQLVMCFFATAFCTIGMLVNKDFQAIPREARSYELGEARYYVLLVWTAIINQFFFLGA  216

Query  457   AGSICYGSSLLSGIILAATISLTEVFAVVFYGEKFGSEKGISLTLSLWGIVSYFYGEMKN  278
              G I Y SSL S +I+AA + +TE+ AV+ + EKF +EKG++L LSLWG  SYFYGE K 
Sbjct  217   IGVIFYASSLFSAVIIAALLPVTEILAVICFQEKFQAEKGVALALSLWGFASYFYGEFK-  275

Query  277   GDNNKKEELQIQVTNMEPNET  215
                 KKE+     T ++P ET
Sbjct  276   --LVKKEKEATAGTVIKPAET  294



>tpg|DAA61854.1| TPA: hypothetical protein ZEAMMB73_233624 [Zea mays]
Length=394

 Score =   272 bits (695),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 166/372 (45%), Positives = 226/372 (61%), Gaps = 33/372 (9%)
 Frame = -1

Query  1279  KMEVSEGKGNMRRRLFLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPIN  1100
             K +    +G    R  + LN  M+ +G  GG LL RLYF +GG+R W S  L T GWP+ 
Sbjct  7     KSDAPPARGKAMHRFLVALNCGMLAVGAIGGPLLSRLYFSKGGHRQWLSAWLETGGWPLL  66

Query  1099  FIPLaaayytrrrhttttaasiftiTRNTFlaaaalgvllGIINYLYTYGVSKLPVSTSA  920
              IP+AA++  RR         +        LAAA LGV  G  +++Y +G++ LPVSTSA
Sbjct  67    VIPVAASFVARRARDRGAPVLLAPP--RILLAAAGLGVATGADDFIYAFGLAYLPVSTSA  124

Query  919   LIAASQLAFTAGGAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAA  740
             ++ ++QLAFT   AFL+V+QR TA SVNAV LLT GA VL +  + DRP G ++ +Y   
Sbjct  125   ILISTQLAFTVFFAFLVVRQRLTAASVNAVALLTVGAVVLGLHVSSDRPPGVTRGQYWLG  184

Query  739   FLMTLASAALYGALLPCIELTY----IKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVN  572
             F++TL +AALYG +LP +EL Y      G +++TY LV+E Q+VM  FATAFCTVGM+VN
Sbjct  185   FVLTLGAAALYGLVLPLVELAYRRAAGAGGRAVTYALVVEMQLVMGFFATAFCTVGMVVN  244

Query  571   KDFQ---------------------------AISREARGFEIGEANYYVVVVVTALIWQI  473
             KDFQ                           AI REAR +++GEA YY V+  +A++WQ 
Sbjct  245   KDFQGAHRLANWQQQCPRAEMPPDDGIIIGAAIPREARRYKLGEARYYAVLAWSAVLWQC  304

Query  472   LFIGAAGSICYGSSLLSGIILAATISLTEVFAVVFYGEKFGSEKGISLTLSLWGIVSYFY  293
              F+GA G I    +LL+GI++A  I +TEV AV+F  E+F SEKG++L LSLWG+ SY Y
Sbjct  305   FFLGAVGVIFCVHTLLAGILIAVFIPVTEVAAVIFLRERFSSEKGVALVLSLWGLASYSY  364

Query  292   GEMKNGDNNKKE  257
             GE       K++
Sbjct  365   GEWSEARAKKRK  376



>emb|CDY35721.1| BnaC03g58420D [Brassica napus]
Length=319

 Score =   267 bits (682),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 151/330 (46%), Positives = 202/330 (61%), Gaps = 32/330 (10%)
 Frame = -1

Query  1213  MMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIPLaaayytrrrhttttaasi  1034
             ++ I  CGG LL RLY+ +GG+R+WF + L+TAG PI  IPL  ++      +       
Sbjct  6     LLIIVTCGGPLLTRLYYTKGGSRIWFMSFLATAGCPIILIPLYVSFLRLSNRSHN-----  60

Query  1033  ftiTRNTFlaaaalgvllGIINYLYTYGVSKLPVSTSALIAASQL-AFTAGGAFLLVKQR  857
                                  N   T       + T   IA   L AF A  +FL+VKQ+
Sbjct  61    ---------------------NSETTEKAKVFVMETPLFIAYPSLSAFNAIFSFLMVKQK  99

Query  856   FTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAFLMTLASAALYGALLPCIELT  677
             FT FS+NAVVLLT G G+LA+ +NGDRPAG SKKEYV  F++TL +A LY  L+P +ELT
Sbjct  100   FTPFSINAVVLLTVGTGILALHTNGDRPAGVSKKEYVVGFMLTLIAAVLYAFLMPLVELT  159

Query  676   YIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQAISREARGFEIGEA-NYYVVV  500
             Y K RQ +T+TLVLE QMVM + +T FC VGM+V  DF+AI REAR F IG +  YY ++
Sbjct  160   YKKVRQEITFTLVLEMQMVMCVASTCFCLVGMVVKGDFKAIPREAREFMIGSSLFYYTLI  219

Query  499   VVTALIWQILFIGAAGSICYGSSLLSGIILAATISLTEVFAVVFYGEKFGSEKGISLTLS  320
             VV  ++WQ  F+GA G +   SSL SG+ ++  + +TEV AVV + EKF ++KG++L LS
Sbjct  220   VVIGIVWQCFFLGAFGVVYCASSLTSGVFVSVLLPVTEVLAVVCFREKFQAKKGVALLLS  279

Query  319   LWGIVSYFYGEMKNG----DNNKKEELQIQ  242
             LWG VSYF GE K+G    D+ K  E ++ 
Sbjct  280   LWGFVSYFSGEFKSGKKIIDSPKSPETELP  309



>ref|XP_004158055.1| PREDICTED: LOW QUALITY PROTEIN: purine permease 3-like [Cucumis 
sativus]
Length=304

 Score =   266 bits (680),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 149/297 (50%), Positives = 209/297 (70%), Gaps = 8/297 (3%)
 Frame = -1

Query  1243  RRLFLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIPLaaa-----  1079
             RR  L+ N  ++ +G CGG LL+RLYF+ GGNR+W ST L TAG PI FIPL  +     
Sbjct  2     RRTLLVFNCFLLAVGTCGGPLLMRLYFLHGGNRVWLSTFLETAGCPIIFIPLLISYIHRR  61

Query  1078  ---yytrrrhttttaasiftiTRNTFlaaaalgvllGIINYLYTYGVSKLPVSTSALIAA  908
                 ++     +T +  +  +    FLA+  +G++ G +++LY YGV+++PVSTSALI A
Sbjct  62    RRRAHSLNPSESTNSTEMIFMKSRLFLASGVIGIITGFVDFLYAYGVARIPVSTSALIRA  121

Query  907   SQLAFTAGGAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAFLMT  728
              QLAFTAG AF LVKQ+FTA+S+N+VVL+T G  +LA+ ++GDR AGES +EY+  FL T
Sbjct  122   CQLAFTAGFAFWLVKQKFTAYSINSVVLVTAGGAILALHTSGDRRAGESNREYIEGFLTT  181

Query  727   LASAALYGALLPCIELTYIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQAISR  548
             +A++ +YG +LP +ELTY K RQ +TYTLVLE Q++MSLFAT  C++ ML+N DFQ I+ 
Sbjct  182   VAASVVYGFILPLVELTYKKARQQITYTLVLEVQLIMSLFATLVCSIAMLINNDFQMIAM  241

Query  547   EARGFEIGEANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLTEVFA  377
             EA  F +G+A YYV++V++A+IWQ  F+G  G I   SS  SGII+A  + +TE+ A
Sbjct  242   EAEAFGLGKAKYYVILVLSAIIWQGFFLGVIGVIFSSSSFXSGIIIAVLLPVTEILA  298



>ref|XP_004959525.1| PREDICTED: purine permease 3-like [Setaria italica]
Length=409

 Score =   269 bits (687),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 160/332 (48%), Positives = 215/332 (65%), Gaps = 5/332 (2%)
 Frame = -1

Query  1240  RLFLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIPLaaayytrrr  1061
             RL + LN  ++ +GG GG LL RLY+I GG R W S  L T GWP+  IPLA +Y +RR 
Sbjct  72    RLLVALNCTLLALGGTGGQLLSRLYYINGGQRQWLSAGLQTGGWPLLLIPLAGSYASRRA  131

Query  1060  httttaasiftiTRNTFlaaaalgvllGIINYLYTYGVSKLPVSTSALIAASQLAFTAGG  881
                     +        LAAA LGV+ G+ ++LY +G+  LPVSTSA++ ++QL FT   
Sbjct  132   RDRGAPVLLSPP--RFLLAAAGLGVITGVDDFLYAWGLEFLPVSTSAILISTQLVFTVLF  189

Query  880   AFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAFLMTLASAALYGA  701
             +FL+V+ R TA +VNAV LLT G  VL +  + DRP G ++ +Y   F++TL +AAL G 
Sbjct  190   SFLIVRHRLTAATVNAVALLTVGGVVLGLHVSSDRPEGVTRGQYWLGFVLTLGAAALGGV  249

Query  700   LLPCIELTY---IKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQAISREARGFE  530
             L+P +EL Y     G + LTY++ +E Q+V+ L ATAF T GM+VNKDFQAI  EA+ FE
Sbjct  250   LMPLVELAYKCAAGGGRVLTYSVAMELQLVIGLVATAFFTAGMIVNKDFQAIPSEAKRFE  309

Query  529   IGEANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLTEVFAVVFYGEKFG  350
             +GEA YY V+V  A++WQ  F+GA G I    +LL+GI++A  I +TEV AV+F  EKF 
Sbjct  310   LGEARYYTVLVWAAVLWQFFFLGAVGVIFCVHTLLAGILIAVFIPVTEVAAVIFLHEKFS  369

Query  349   SEKGISLTLSLWGIVSYFYGEMKNGDNNKKEE  254
             SEKG++L LSLWG+ SY YGE       K  E
Sbjct  370   SEKGVALVLSLWGLASYSYGEWNEARAKKNTE  401



>emb|CDY15687.1| BnaA07g08580D [Brassica napus]
Length=303

 Score =   265 bits (678),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 132/253 (52%), Positives = 180/253 (71%), Gaps = 4/253 (2%)
 Frame = -1

Query  970  NYLYTYGVSKLPVSTSALIAASQLAFTAGGAFLLVKQRFTAFSVNAVVLLTFGAGVLAVG  791
            NYLY YG++ LPVST+ALI ASQLAF A  ++ +V  +FT F++NAVVLLT GA VL + 
Sbjct  49   NYLYAYGIAYLPVSTAALIIASQLAFIAIFSYFMVSHKFTPFTINAVVLLTVGAAVLGMH  108

Query  790  SNGDRPAGESKKEYVAAFLMTLASAALYGALLPCIELTYIKGRQSLTYTLVLEFQMVMSL  611
            +  D+P  E+ K+Y+  FL+T+A+A +Y  LLP +EL Y K +Q ++YTLVLE QM++  
Sbjct  109  TETDKPVHETHKQYMVGFLVTVAAAVMYAFLLPLVELAYQKAKQPMSYTLVLEVQMILCF  168

Query  610  FATAFCTVGMLVNKDFQAISREARGFEIGEANYYVVVVVTALIWQILFIGAAGSICYGSS  431
             A+    VGML+  DF+A+  EAR F++GEA +YVV V++A+IWQ  F+GA G I   SS
Sbjct  169  LASLVSLVGMLIAGDFKALPNEAREFKLGEAMFYVVAVLSAIIWQGFFLGAIGLIFCASS  228

Query  430  LLSGIILAATISLTEVFAVVFYGEKFGSEKGISLTLSLWGIVSYFYGEMK-NGDNNKKEE  254
            L+SGI+++  + +TEV AV+FY EKF  EKG+SL LSLWG VSYFYGE+K + D   +EE
Sbjct  229  LVSGIMISVLLPITEVLAVIFYHEKFQKEKGLSLALSLWGFVSYFYGEIKADKDKRIQEE  288

Query  253  LQIQVTNMEPNET  215
             Q+   N  P  T
Sbjct  289  AQL---NSLPRRT  298



>ref|XP_010263027.1| PREDICTED: purine permease 3-like [Nelumbo nucifera]
Length=365

 Score =   266 bits (679),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 152/352 (43%), Positives = 219/352 (62%), Gaps = 7/352 (2%)
 Frame = -1

Query  1306  ESLFYKLKLKMEVSEGKGNMRRRLFLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTC  1127
             E   Y  K+    S  K NM +   L +N +   +G   G L LRLYF+ GGNR W  + 
Sbjct  15    EKTCYYTKIPDGDSSIKSNMAKWWLLGINCVCTVLGTIAGPLFLRLYFLHGGNRKWIPSW  74

Query  1126  LSTAGWPINFIPLaaayytrrrhttttaasiftiTRNTFlaaaalgvllGIINYLYTYGV  947
             L TAG P+   PL   Y   R       A          L +A +G+L+G+ +++Y++G+
Sbjct  75    LQTAGVPVLLGPLTVLYLRERASGVRFLAPT-----KLLLLSAGIGILVGLNDFMYSHGL  129

Query  946   SKLPVSTSALIAASQLAFTAGGAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAG  767
             S LPVSTSAL+ ++QL FTA  A L+ KQ+FT +S+NAVVL+T GA +L +  +GDR  G
Sbjct  130   SFLPVSTSALLLSTQLGFTALFALLIAKQKFTPYSINAVVLMTLGAALLGLSKSGDRLLG  189

Query  766   ESKKEYVAAFLMTLASAALYGALLPCIELTYIKGRQSLTYTLVLEFQMVMSLFATAFCTV  587
              S ++Y   F++TL +A L G +LPC E+ Y   R+++TY++VL+FQ  ++ FAT FCT+
Sbjct  190   VSNRDYWLGFVLTLGAAGLLGFILPCCEVAYATARKTITYSVVLQFQFGVNFFATVFCTI  249

Query  586   GMLVNKDFQAISREARGFEIGEANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILA  407
             GML+NKDFQAI REA  FE+G   YY+V+V  A++WQ+  +G  G +   +SL +G++ A
Sbjct  250   GMLINKDFQAIPREANAFELGAVKYYLVLVSIAIVWQMAGVGTLGVVFSTTSLFAGVLNA  309

Query  406   ATISLTEVFAVVFYGEKFGSEKGISLTLSLWGIVSYFYGEMKNGDNNKKEEL  251
               + LTE  AV+ Y EKF  EKG++L L  WG +SYFYG  K  +  K++ L
Sbjct  310   TLLPLTETAAVIVYHEKFTGEKGMALALCSWGFISYFYGSYK--EKKKQDAL  359



>gb|EPS74474.1| hypothetical protein M569_00285, partial [Genlisea aurea]
Length=311

 Score =   264 bits (675),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 155/315 (49%), Positives = 212/315 (67%), Gaps = 6/315 (2%)
 Frame = -1

Query  1231  LLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIPLaaayytrrrhtt  1052
             L++N +++ +G  G  L++RLYFI GG  LWF++ L T+ +P+  IPL   +  R   T 
Sbjct  2     LIINGLLLAVGSSGIPLIMRLYFIHGGKMLWFASWLQTSAFPLILIPLLFNHLRRTTTTA  61

Query  1051  ttaasiftiTRNTFlaaaalgvllGIINYLYTYGVSKLPVSTSALIAASQLAFTAGGAFL  872
                 SI    R    AAAA+G+ +G  NYLY YG SKLPVSTS+LI ++QL FTA  +FL
Sbjct  62    ARFFSIN---RKLSAAAAAIGIAIGFNNYLYAYGSSKLPVSTSSLIFSTQLIFTALFSFL  118

Query  871   LVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAFLMTLASAALYGALLP  692
             LVK +FTA+S+NA+VLLT GA +L+  S+      ES ++Y   F +T+ + AL G + P
Sbjct  119   LVKHKFTAYSINAIVLLTVGAVILSFHSSAK---DESDRDYEFGFAVTVTAVALSGLIQP  175

Query  691   CIELTYIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQAISREARGFEIGEANY  512
              +EL Y+K  Q++   + LEFQ V+S FAT FCTVGML+ KDF+ IS EA+GFEIG  NY
Sbjct  176   LMELCYLKSDQAVDGVVALEFQFVLSSFATGFCTVGMLMGKDFEGISGEAKGFEIGAVNY  235

Query  511   YVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLTEVFAVVFYGEKFGSEKGIS  332
              + V  TA++ Q  F+G+ G I   S+LL+G+I+ A++ L E+ AVV + EKF  EKG+S
Sbjct  236   ILTVFFTAVVSQCFFLGSVGVIHLSSALLAGVIICASLPLCEILAVVLFREKFRPEKGVS  295

Query  331   LTLSLWGIVSYFYGE  287
             L LSLWG VSYFYGE
Sbjct  296   LLLSLWGSVSYFYGE  310



>ref|XP_010234594.1| PREDICTED: purine permease 3-like isoform X2 [Brachypodium distachyon]
Length=375

 Score =   261 bits (666),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 158/334 (47%), Positives = 229/334 (69%), Gaps = 5/334 (1%)
 Frame = -1

Query  1234  FLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIPLaaayytrrrht  1055
              L++N +++  G   G LLLR YF+ GG R W S+ L TAGWP+  +PL A++++RRR  
Sbjct  35    LLVVNFVLLAAGTACGPLLLRAYFVHGGTRKWLSSLLQTAGWPLLLVPLCASFFSRRRRH  94

Query  1054  tttaasift---iTRNTFlaaaalgvllGIINYLYTYGVSKLPVSTSALIAASQLAFTAG  884
                  S      +T     A+ A+GV+ G+ N+ Y YG + LPVSTS+++ ++QL FTA 
Sbjct  95    LQDHGSSCELFFMTPRLLAASTAIGVMTGVDNFFYAYGQAYLPVSTSSILLSTQLVFTAA  154

Query  883   GAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAFLMTLASAALYG  704
              A LLV+QRF A +VNAVVLLT GA +L + + GDRPAG S  +Y A F M L +AALYG
Sbjct  155   FALLLVRQRFAAATVNAVVLLTVGAAMLGMNAGGDRPAGVSAPQYRAGFGMVLGAAALYG  214

Query  703   ALLPCIELTYIK--GRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQAISREARGFE  530
              LLP +EL+  +   R ++TYTLV+E Q+V+ L A+AFC +GM++NKDFQ I  EAR FE
Sbjct  215   LLLPAMELSQARHAARGAVTYTLVVEIQLVIGLSASAFCAIGMIINKDFQEIPAEAREFE  274

Query  529   IGEANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLTEVFAVVFYGEKFG  350
             +GEA YY+++V TA ++Q + +G  G+I YGS+LL+G++LA  I +  + AV+F+ E F 
Sbjct  275   LGEAGYYLLLVGTASVFQCICLGTIGAIFYGSALLAGVVLAMFIPVNGMLAVLFFHEPFS  334

Query  349   SEKGISLTLSLWGIVSYFYGEMKNGDNNKKEELQ  248
             + KGI+L LSLWG++SYFYG+++     + ++ Q
Sbjct  335   ATKGIALGLSLWGLLSYFYGDVRTKQALQSDKHQ  368



>ref|XP_006841262.1| hypothetical protein AMTR_s00135p00100890 [Amborella trichopoda]
 gb|ERN02937.1| hypothetical protein AMTR_s00135p00100890 [Amborella trichopoda]
Length=357

 Score =   259 bits (662),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 144/331 (44%), Positives = 214/331 (65%), Gaps = 12/331 (4%)
 Frame = -1

Query  1201  GGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIPLaaayytrrrhttttaasiftiT  1022
             G  G  L+ RLYFI GG R W +  + TA +PI  IPL  +  +  + + +         
Sbjct  35    GASGAPLVSRLYFIHGGQRKWLTAWIQTAAFPILLIPLFLSKISSTKTSQSQRRQSHL--  92

Query  1021  RNTFlaaaalgvllGII---NYLYTYGVSKLPVSTSALIAASQLAFTAGGAFLLVKQRFT  851
               TF  A     +  +I   +Y+Y +G+S LP+STS L+ ++QL FTA  AFL+V QRFT
Sbjct  93    --TFPLALQSASIGLLIGIDDYMYAFGLSYLPISTSTLLVSTQLGFTAFFAFLIVGQRFT  150

Query  850   AFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAFLMTLASAALYGALLPCIELTYI  671
             A ++NAVVLL+ G+ +L + ++ DRP G +  +Y   F++TL +AAL G + P IEL Y+
Sbjct  151   AHTINAVVLLSLGSVLLGIRASSDRPEGVTGAQYGLGFVLTLGAAALIGLVFPLIELVYV  210

Query  670   KGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQAISREARGFEIGEANYYVVVVVT  491
             K +Q +T+ LV+E  +VMS+ AT FCT+GM++NKDFQ ISRE++ F +GE  Y++ VV +
Sbjct  211   KSKQIVTFGLVMEMLLVMSVVATGFCTIGMVINKDFQVISRESKEFGLGEFKYHLTVVAS  270

Query  490   ALIWQILFIGAAGSICYGSSLLSGIILAATISLTEVFAVVFYGEKFGSEKGISLTLSLWG  311
              ++WQ+  IG+   I Y SSLL+GI+LA  + LT + AV+F+ EKF +EKG++L L LWG
Sbjct  271   GILWQVFLIGSFSFILYTSSLLNGILLAVQLPLTSILAVIFFHEKFSAEKGMALVLCLWG  330

Query  310   IVSYFYGEMKNGDNNKKEELQIQVTNMEPNE  218
               SY+YGE  +  + K+EE+   V ++E N 
Sbjct  331   FASYYYGE--HIQSKKREEV---VRDIEINH  356



>gb|ABR16841.1| unknown [Picea sitchensis]
Length=368

 Score =   259 bits (661),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 149/325 (46%), Positives = 206/325 (63%), Gaps = 7/325 (2%)
 Frame = -1

Query  1201  GGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIPLaaayytrrrhttttaasiftiT  1022
             G   G LL R YF+ GG++ W S+ L TAGW                           IT
Sbjct  39    GSTAGPLLTRFYFLHGGSKRWLSSWLETAGW-------PLLLLPLYLSYRKQPNRENHIT  91

Query  1021  RNTFlaaaalgvllGIINYLYTYGVSKLPVSTSALIAASQLAFTAGGAFLLVKQRFTAFS  842
                FLA   +G+L G  +YLY YG+S LP+ST++++ AS L FTAG A LLV+Q+F+ FS
Sbjct  92    PKLFLACCGIGILTGADDYLYAYGLSFLPLSTASVLIASHLGFTAGFALLLVRQKFSPFS  151

Query  841   VNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAFLMTLASAALYGALLPCIELTYIKGR  662
             VN+VVLL+  + +LA  ++GDRP G + ++YV  F++TL +AALYG ++P IELTY + +
Sbjct  152   VNSVVLLSASSVLLAFHTSGDRPEGVTSRQYVVGFVLTLGAAALYGFVIPLIELTYKRAK  211

Query  661   QSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQAISREARGFEIGEANYYVVVVVTALI  482
             + +TYTLV+E Q VMS+ AT FCTVGML+N DFQA+ REA GF +G+ +Y + +V  A+ 
Sbjct  212   RPITYTLVMEMQFVMSVTATVFCTVGMLINGDFQALHREAEGFRLGKIDYSMALVWAAVA  271

Query  481   WQILFIGAAGSICYGSSLLSGIILAATISLTEVFAVVFYGEKFGSEKGISLTLSLWGIVS  302
             WQ+ FIG  G     SSLLSG+I+A  I  TEV AV+ + EKF +EKG++L L+LWG  S
Sbjct  272   WQLFFIGVFGVTSMASSLLSGVIIALMIPGTEVLAVILFHEKFSAEKGMALVLALWGFAS  331

Query  301   YFYGEMKNGDNNKKEELQIQVTNME  227
             Y YGE       +  ++  Q +  E
Sbjct  332   YLYGEYYYYLKLRPPDVPKQQSKPE  356



>ref|XP_006661332.1| PREDICTED: purine permease 3-like, partial [Oryza brachyantha]
Length=265

 Score =   255 bits (651),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 128/248 (52%), Positives = 176/248 (71%), Gaps = 3/248 (1%)
 Frame = -1

Query  970  NYLYTYGVSKLPVSTSALIAASQLAFTAGGAFLLVKQRFTAFSVNAVVLLTFGAGVLAVG  791
            +++Y  G++ LPVSTSA++ ++ LAFT   A L+V+QR TA ++NAV LLT GA VL + 
Sbjct  14   DFIYASGLAYLPVSTSAILTSTHLAFTVFFACLIVRQRLTAATLNAVALLTIGAVVLGLH  73

Query  790  SNGDRPAGESKKEYVAAFLMTLASAALYGALLPCIELTYIK---GRQSLTYTLVLEFQMV  620
            ++ DRPAG +  +Y   F +TL +AALYG +LP +EL Y     G +++TY LV+E Q+V
Sbjct  74   TSNDRPAGVTNGKYWMGFFLTLGAAALYGLILPLVELAYKHAAGGGRAVTYALVVEMQLV  133

Query  619  MSLFATAFCTVGMLVNKDFQAISREARGFEIGEANYYVVVVVTALIWQILFIGAAGSICY  440
            M  FATAFCTVGM+V+KDFQAI REA+ +E+GE  YY V+V  A++WQ  F+GA G I Y
Sbjct  134  MGFFATAFCTVGMIVDKDFQAIPREAKQYELGETRYYTVLVFNAILWQFFFVGAIGVIFY  193

Query  439  GSSLLSGIILAATISLTEVFAVVFYGEKFGSEKGISLTLSLWGIVSYFYGEMKNGDNNKK  260
              +LL+GII+A  I +TEV +VVF  EKF SEKG++L LSLWG+ SY YGE  +   NK+
Sbjct  194  VHTLLAGIIIAVFIPITEVLSVVFLHEKFSSEKGVALVLSLWGLASYSYGEYTDAKANKR  253

Query  259  EELQIQVT  236
               Q + +
Sbjct  254  AASQAEAS  261



>ref|XP_009631999.1| PREDICTED: purine permease 1-like [Nicotiana tomentosiformis]
Length=358

 Score =   258 bits (658),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 149/359 (42%), Positives = 228/359 (64%), Gaps = 18/359 (5%)
 Frame = -1

Query  1267  SEGKGNMRRRL---------FLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTA  1115
              EGK    R+L          +++N I + +G   G +L+R+YF+ GG R W      TA
Sbjct  8     QEGKNCKPRKLKNFMSIKTLLIVINCIFLAVGQIAGVMLVRIYFLHGGKRKWLQAFWLTA  67

Query  1114  GWPINFIPLaaayytrrrhttttaasiftiTRNTFlaaaalgvllGIINYLYTYGVSKLP  935
             G+PI  +P+A ++  RR+   T    +    +   LA+A LG+LLG+ +YLYT+G+S LP
Sbjct  68    GFPILLLPIAISFAKRRKANKTETNRVLLTPK-LILASAILGLLLGVCSYLYTFGMSYLP  126

Query  934   VSTSALIAASQLAFTAGGAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKK  755
             VS S+L+A++ LAFTA  A+ +VK +FT +SVNAVVL+TFG+ +L +  NGDRP GES +
Sbjct  127   VSISSLLASTSLAFTAIFAYFIVKHKFTHYSVNAVVLMTFGSIILGLHMNGDRPKGESNR  186

Query  754   EYVAAFLMTLASAALYGALLPCIELTYIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLV  575
             +YV  F+MT+  AAL+G L   +E ++IK   ++T+ LV++ Q ++S+F+T FC V M++
Sbjct  187   QYVLGFVMTIVGAALHGFLNAGVEYSHIKAGVAVTFDLVMQMQFLISMFSTLFCVVAMII  246

Query  574   NKDFQAISREARGFEIGEANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATIS  395
             NKDFQ I REA  F +G+  YY+++ ++A+  QI+ IG  G I   S+LLSGI  +  + 
Sbjct  247   NKDFQTIHREAEAFGLGQNKYYMILALSAIALQIMIIGNLGLIFSSSALLSGIFNSLLVP  306

Query  394   LTEVFAVVFYGEKFGSEKGISLTLSLWGIVSYFYGEMKNGDNNKKEELQIQVTNMEPNE  218
             + ++FAV+F  E F +EK ++L + LWG  SYFYGE K            +VT  +P++
Sbjct  307   VQQIFAVMFLPESFNAEKWMALAMCLWGFASYFYGEYKASLK--------KVTKTKPDQ  357



>ref|XP_010247465.1| PREDICTED: purine permease 3-like [Nelumbo nucifera]
Length=364

 Score =   258 bits (658),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 158/338 (47%), Positives = 218/338 (64%), Gaps = 5/338 (1%)
 Frame = -1

Query  1231  LLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIPLaaayytrrrhtt  1052
             L+LN  +M IG  GG LL+RLY++ GGNR W S+ L +AG+PI  IPL+  Y   RRH  
Sbjct  32    LILNCTIMAIGTIGGPLLMRLYYLHGGNRRWLSSLLQSAGFPILLIPLSLLYLRHRRHRG  91

Query  1051  ttaasiftiTRNTFlaaaalgvllGIINYLYTYGVSKLPVSTSALIAASQLAFTAGGAFL  872
              + +  F   +   +++A LG+LLG+ N++Y  G+S +PVSTSA++ ASQLAF AG A L
Sbjct  92    VSPSEFFIEPK-LLVSSAVLGLLLGLDNFMYALGLSYIPVSTSAILFASQLAFIAGFARL  150

Query  871   LVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAFLMTLASAALYGALLP  692
             +VKQRFT +S+N+VVL+T G+  L + S+GDRPAG S  EY++ FL+TL SA L G +LP
Sbjct  151   IVKQRFTPYSINSVVLMTIGSITLGIHSDGDRPAGVSDGEYLSGFLLTLGSALLIGFILP  210

Query  691   CIELTYIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQAISREARGFEIGEANY  512
              IE  Y K  +++  T V++FQ  + LF++     GML+NKDFQ I REAR +E+G   Y
Sbjct  211   SIEFAYSKASRAVDLTAVMQFQFNVGLFSSILSATGMLINKDFQEIPREAREYELGHGMY  270

Query  511   YVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLTEVFAVVFYGEKFGSEKGIS  332
             Y V+  +A+ WQ+ F+G  G I   +SL +GI  A  +   EV AV+ Y EKF  EKGI+
Sbjct  271   YFVLSASAIAWQLSFVGLLGLIFCTTSLFTGIYSAVLLPFAEVGAVIAYHEKFTGEKGIA  330

Query  331   LTLSLWGIVSYFYGEMKNGDNNKKEELQIQVTNMEPNE  218
             L L LWG  SYFYGE +      K E  + + +  P  
Sbjct  331   LALCLWGFTSYFYGEYR----KSKVETSMTIDDQSPQP  364



>ref|XP_002301070.2| hypothetical protein POPTR_0002s09980g [Populus trichocarpa]
 gb|EEE80343.2| hypothetical protein POPTR_0002s09980g [Populus trichocarpa]
Length=349

 Score =   256 bits (655),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 144/340 (42%), Positives = 225/340 (66%), Gaps = 4/340 (1%)
 Frame = -1

Query  1273  EVSEGKGNMRRRLFLL-LNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINF  1097
             E  + +     + FL+ LN ++M +G   G LL+R+Y++ GG   W    L TAG+PI  
Sbjct  10    EPDQHQNKKHMKAFLVFLNCMLMAVGQVAGPLLVRIYYLHGGKSNWLGAWLLTAGFPILI  69

Query  1096  IPLaaayytrrrhttttaasiftiTRNTFlaaaalgvllGIINYLYTYGVSKLPVSTSAL  917
             IP+A +Y   R         +       F A+  LG+LLG+ +YLY++G+S LPVS S++
Sbjct  70    IPIAISYIRARARAQAGRLLVTPWL---FSASVILGLLLGLDSYLYSFGMSYLPVSVSSI  126

Query  916   IAASQLAFTAGGAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAF  737
             + +SQLAFTA  A+++VK +FT +S+NAV L+TFG+ +L    NGDRP+GESK +Y+  F
Sbjct  127   LGSSQLAFTAIFAYIIVKHKFTHYSINAVALMTFGSVILGFHMNGDRPSGESKGKYILGF  186

Query  736   LMTLASAALYGALLPCIELTYIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQA  557
              MT+  AAL+G L+P +E TY+K  +++T+ LVL+ Q ++S+FAT FC++ M++NKDF+A
Sbjct  187   FMTIGGAALHGFLMPALEFTYLKAGKAITFDLVLQVQFLISMFATLFCSIPMIINKDFKA  246

Query  556   ISREARGFEIGEANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLTEVFA  377
             IS+EA  F +G+  YY ++++ A++ Q+L IG+ G I   SSLL G++ +  + + + FA
Sbjct  247   ISKEAAEFGLGKTKYYTILLIAAIVLQLLVIGSLGVIFNSSSLLGGLVSSLLVPVQQAFA  306

Query  376   VVFYGEKFGSEKGISLTLSLWGIVSYFYGEMKNGDNNKKE  257
             V+   E F +EKG++L + LWG  SY YGE +  + NK+E
Sbjct  307   VMILKEVFNAEKGMALAMCLWGFASYLYGEYQKPEANKEE  346



>emb|CDP01096.1| unnamed protein product [Coffea canephora]
Length=359

 Score =   255 bits (651),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 150/363 (41%), Positives = 226/363 (62%), Gaps = 14/363 (4%)
 Frame = -1

Query  1288  LKLKMEVSEGKGNM---------RRRLFLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWF  1136
             + ++  +  GK NM          + L +L N I++ IG  GG LL+R+YF+ GG R W 
Sbjct  1     MDMEAAIQGGKHNMLNKFKICISMKTLMVLFNCILLAIGQVGGPLLVRIYFLHGGKRKWL  60

Query  1135  STCLSTAGWPINFIPLaaayytrrrhttttaasiftiTRNTFlaaaalgvllGIINYLYT  956
             +  L TAG+P+  +P++ +Y+  R   ++    +         A+A LG LLGI +YLYT
Sbjct  61    TAWLLTAGFPLLILPISISYFKNRSKASSPKFLVP---PRLVAASAFLGFLLGIDSYLYT  117

Query  955   YGVSKLPVSTSALIAASQLAFTAGGAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDR  776
             +G+S LPVS S+L+ +SQLAFTA  A+ +VK +FT +S+NAVVL+TFG+ +L +  NGDR
Sbjct  118   FGMSYLPVSVSSLLGSSQLAFTAIFAYFVVKHKFTHYSINAVVLMTFGSAILGLHMNGDR  177

Query  775   PAGESKKEYVAAFLMTLASAALYGALLPCIELTYIKGRQSLTYTLVLEFQMVMSLFATAF  596
             P+GES   Y   F MTL +AAL+G ++P  E    K   ++T+ L L+ Q ++S+FAT F
Sbjct  178   PSGESNANYTLGFFMTLGAAALHGFIMPAFEYAQKKAEVTVTFDLFLQVQFLVSMFATLF  237

Query  595   CTVGMLVNKDFQAISREARGFEIGEANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGI  416
             CT+ M++NKDFQAI +EA  FE+G   YY ++V+  +  Q + IG+ G I   SSL  GI
Sbjct  238   CTIPMIINKDFQAIPQEAAEFELGPMKYYTILVMAGIALQCMMIGSTGVIFSSSSLFGGI  297

Query  415   ILAATISLTEVFAVVFYGEKFGSEKGISLTLSLWGIVSYFYGEMKNGDNNKKEELQIQVT  236
             + +  + + ++FAV    E F  EKG++L + LWG  SYFYGE K   N K+ +++ +  
Sbjct  298   VTSLLVPVQQIFAVFCLAESFSGEKGMALAMCLWGFASYFYGEYK--VNQKQPDVKHEPE  355

Query  235   NME  227
             + E
Sbjct  356   HEE  358



>ref|XP_002513954.1| purine transporter, putative [Ricinus communis]
 gb|EEF48537.1| purine transporter, putative [Ricinus communis]
Length=358

 Score =   255 bits (651),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 151/358 (42%), Positives = 233/358 (65%), Gaps = 13/358 (4%)
 Frame = -1

Query  1276  MEVSEGKGNMRRR---------LFLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCL  1124
             ME  +G  +  ++         L ++LN ++M IG  GG LL+RLY++ GG R W ++ L
Sbjct  1     MEAEQGSNSRPKQQENSKHIKILLVVLNCLLMSIGQVGGPLLIRLYYLHGGKRKWLTSWL  60

Query  1123  STAGWPINFIPLaaayytrrrhttttaasiftiTRNTFlaaaalgvllGIINYLYTYGVS  944
              TAG+PI  +P++++Y   R  +    + +    R  F A+A +G+LLG+  YLY++G+S
Sbjct  61    LTAGFPILILPISSSYMIARARSRAPTSRLLLT-RWLFAASAFIGLLLGLDGYLYSFGLS  119

Query  943   KLPVSTSALIAASQLAFTAGGAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGE  764
              LPVS S+L+ ++QLAFTA  A+++VK RFT +S+NAVVL+TFG+ +L    NGD P GE
Sbjct  120   YLPVSVSSLLGSTQLAFTAIFAYIVVKHRFTHYSINAVVLMTFGSIILGFHMNGDVPNGE  179

Query  763   SKKEYVAAFLMTLASAALYGALLPCIELTYIKGRQSLTYTLVLEFQMVMSLFATAFCTVG  584
             S  +YV  F M + +AAL+G ++P +E T++     +T+ LV++ Q ++S+FAT FCT+ 
Sbjct  180   SNGKYVLGFFMAVGAAALHGFIMPAVEYTHMNAGMPITFDLVMQVQFLISMFATLFCTIP  239

Query  583   MLVNKDFQAISREARGFEIGEANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAA  404
             M++NKDFQAI +EA  F +G+A YY ++VV A+I Q+L IG+ G I   +SLL G++ + 
Sbjct  240   MIINKDFQAIPKEAEKFGLGQAKYYTILVVAAVIMQLLIIGSLGVIFASTSLLGGLVSSL  299

Query  403   TISLTEVFAVVFYGEKFGSEKGISLTLSLWGIVSYFYG---EMKNGDNNKKEELQIQV  239
              + + +VFAV+F  E F +EKG++L + LWG  S+ YG   E       KKEE   +V
Sbjct  300   LVPVQQVFAVIFLHEVFNAEKGMALAMCLWGFASHLYGAYVESSKKQAKKKEESNCEV  357



>ref|XP_009762898.1| PREDICTED: purine permease 3-like [Nicotiana sylvestris]
Length=359

 Score =   253 bits (647),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 143/321 (45%), Positives = 215/321 (67%), Gaps = 2/321 (1%)
 Frame = -1

Query  1243  RRLFLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIPLaaayytrr  1064
             + L + +N I M +G   G +L+R+YF+ GG R W    L TAG+PI  +P+A +Y  RR
Sbjct  24    KTLLVFINCIFMAVGQIAGVMLVRIYFLHGGKRKWLQAFLLTAGFPILVLPIAISYAKRR  83

Query  1063  rhttttaasiftiTRNTFlaaaalgvllGIINYLYTYGVSKLPVSTSALIAASQLAFTAG  884
             +  T T   I T      LA+A LG+L  + +YLYT+G+S LPVS S+L+A++ LAFTA 
Sbjct  84    KAKTETNRVILT--PKLILASAILGLLFCVCSYLYTFGMSYLPVSISSLLASTSLAFTAI  141

Query  883   GAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAFLMTLASAALYG  704
              A+  VK +FT +S+NAVVL+TFG+ +L +  NGDRP GES ++YV  F+MT+  AAL+G
Sbjct  142   FAYFFVKHKFTHYSINAVVLMTFGSIILGLHMNGDRPKGESNRQYVLGFVMTIVGAALHG  201

Query  703   ALLPCIELTYIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQAISREARGFEIG  524
              +   +E ++IK    +T+ LV++ Q ++ +F+T FC V M++N+DFQAI REA  F +G
Sbjct  202   FVNAGVEYSHIKAGVVVTFDLVMQMQFLICIFSTLFCVVAMIINEDFQAIHREAGEFRLG  261

Query  523   EANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLTEVFAVVFYGEKFGSE  344
             +  YY+++ ++A+  QI+ IG  G I   S+LLSGI+ +  + + ++FAV+F  E F +E
Sbjct  262   QNKYYMILALSAIALQIMIIGNLGLIFSSSALLSGIVNSLLVPVQQIFAVMFLPESFNAE  321

Query  343   KGISLTLSLWGIVSYFYGEMK  281
             K ++L + LWG  SYFYGE K
Sbjct  322   KWMALAMCLWGFASYFYGEYK  342



>ref|XP_002462514.1| hypothetical protein SORBIDRAFT_02g027090 [Sorghum bicolor]
 gb|EER99035.1| hypothetical protein SORBIDRAFT_02g027090 [Sorghum bicolor]
Length=378

 Score =   250 bits (639),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 151/375 (40%), Positives = 208/375 (55%), Gaps = 38/375 (10%)
 Frame = -1

Query  1273  EVSEGKGNMR---RRLFLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPI  1103
              V++  G  R   R   L++N  +M +G  GG L LR YF+ GG R W S  L TAG+P+
Sbjct  12    NVAQSAGTTRTLIRNPLLVVNFALMVVGSAGGPLFLRAYFLHGGARKWLSAFLQTAGFPL  71

Query  1102  NFIPL-------aaayytrrrhttttaasiftiTRNTFlaaaalgvllG--------IIN  968
               +PL                     A +    TR  F       +           + +
Sbjct  72    LLVPLCVSFFSRRRQRDRDDADADADAPANKAATRTPFFLMTPRLLAASAAIGLMTGVDD  131

Query  967   YLYTYGVSKLPVSTSALIAASQLAFTAGGAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGS  788
              LY YG++ LP           LAFTA  A LLV+QRFTAFSVNAV LLT GA +L + +
Sbjct  132   LLYAYGLAYLP-----------LAFTAAFALLLVRQRFTAFSVNAVALLTVGAAMLGMNA  180

Query  787   NGDRPAGESKKEYVAAFLMTLASAALYGALLPCIELT-----YIKGRQSLTYTLVLEFQM  623
              GDRPAG S+ +Y A F MTL +AALYG +LP +EL+        G  ++TYTLV+E Q+
Sbjct  181   GGDRPAGVSRAQYGAGFAMTLGAAALYGLVLPVVELSQARHAARAGAGAVTYTLVIEMQL  240

Query  622   VMSLFATAFCTVGMLVNKDFQAISREARGFEI-GEANYYVVVVVTALIWQILFIGAAGSI  446
             V+ L AT F  VGML N D  AI  EAR F++ G A YY+++  +A  +Q  F+G  G++
Sbjct  241   VIGLTATVFSAVGMLANNDLHAIPGEAREFDLGGSAGYYLLLAGSAATYQCFFLGTIGAV  300

Query  445   CYGSSLLSGIILAATISLTEVFAVVFYGEKFGSEKGISLTLSLWGIVSYFYGEMKNGDNN  266
              +GS+LL+G+++   I +TEV AV+F+ E F   KG++L LSLWG VSYFYGE++    +
Sbjct  301   FFGSALLAGVVMTVLIPVTEVLAVMFFHEPFNGTKGVALALSLWGFVSYFYGEVQTSKAH  360

Query  265   KKEELQIQVTNMEPN  221
             +      Q  +  PN
Sbjct  361   RHHH---QSADKTPN  372



>ref|XP_006360267.1| PREDICTED: purine permease 1-like [Solanum tuberosum]
Length=361

 Score =   248 bits (633),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 147/349 (42%), Positives = 225/349 (64%), Gaps = 12/349 (3%)
 Frame = -1

Query  1276  MEVSEGKGNMRRR-----------LFLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFST  1130
             ME+ E +GN  +R           L +L+N I + +G   G LL+R+Y++ GG R W   
Sbjct  1     MEI-EQEGNYDKRKKIKNFMSIKTLLILINCIFISVGQISGVLLVRIYYLHGGKRKWLQA  59

Query  1129  CLSTAGWPINFIPLaaayytrrrhttttaasiftiTRNTFlaaaalgvllGIINYLYTYG  950
              L TAG+PI  +P++ +Y  +R+  T        +T    + +A LG+LLGI +YLYT+G
Sbjct  60    FLLTAGFPILILPISISYVKKRKKITNNNNIRLFVTPKLAIFSAILGILLGICSYLYTFG  119

Query  949   VSKLPVSTSALIAASQLAFTAGGAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPA  770
             +S LPVS S+L++++ LAFTA  A+ +VK +FT +SVNAVVL+  G+ +L +  NGDRP 
Sbjct  120   MSYLPVSISSLLSSTSLAFTAIFAYFMVKHKFTDYSVNAVVLMMLGSIILGLHMNGDRPI  179

Query  769   GESKKEYVAAFLMTLASAALYGALLPCIELTYIKGRQSLTYTLVLEFQMVMSLFATAFCT  590
             GES + Y   F+MTL  AAL+G +   +E +++K    +T+ LV++ Q ++S+F+  FC 
Sbjct  180   GESNRRYTLGFVMTLVGAALHGFVNAGVEYSHVKAGVVVTFDLVMQMQFLISMFSALFCI  239

Query  589   VGMLVNKDFQAISREARGFEIGEANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGIIL  410
             V M++NKDFQAI+REA  F +G+  YY+++ +TA+  Q + IG  G I   S+LLSGI+ 
Sbjct  240   VAMIINKDFQAITREAEEFGLGQRKYYMILALTAISLQTMIIGNLGMIFCSSALLSGIVN  299

Query  409   AATISLTEVFAVVFYGEKFGSEKGISLTLSLWGIVSYFYGEMKNGDNNK  263
             A  + + ++FAV+F  E+F S+K ++L + LWG  SYFYGE K+   NK
Sbjct  300   ALLVPIQQIFAVMFLPERFNSDKWMALAMCLWGFASYFYGEYKDSMTNK  348



>gb|EEE69873.1| hypothetical protein OsJ_29687 [Oryza sativa Japonica Group]
Length=341

 Score =   246 bits (627),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 125/230 (54%), Positives = 170/230 (74%), Gaps = 3/230 (1%)
 Frame = -1

Query  970  NYLYTYGVSKLPVSTSALIAASQLAFTAGGAFLLVKQRFTAFSVNAVVLLTFGAGVLAVG  791
            +++Y YG++ LPVSTSA++ ++QLAFT   A L+V+QR TA ++NAV LLT GA VL + 
Sbjct  93   DFVYAYGLAYLPVSTSAILISTQLAFTVFFACLIVRQRLTAATLNAVALLTIGAVVLGLH  152

Query  790  SNGDRPAGESKKEYVAAFLMTLASAALYGALLPCIELTYIK---GRQSLTYTLVLEFQMV  620
            ++ DRPAG +  +Y   F +TL +AALYG +LP +EL Y     G +++TY LV+E Q+V
Sbjct  153  ASKDRPAGVTTGKYWMGFFLTLGAAALYGLILPLVELAYKHAAGGGRAVTYALVMEMQLV  212

Query  619  MSLFATAFCTVGMLVNKDFQAISREARGFEIGEANYYVVVVVTALIWQILFIGAAGSICY  440
            M  FATAFCTVG++VNKDFQAI REA+ +E+GEA YYVV+V  A++W+  F+GA G I  
Sbjct  213  MGFFATAFCTVGVIVNKDFQAIPREAKQYELGEARYYVVLVFNAVLWEFFFVGAVGVIFC  272

Query  439  GSSLLSGIILAATISLTEVFAVVFYGEKFGSEKGISLTLSLWGIVSYFYG  290
              +LL+GII+A  I +TEV  V+F  EKF SEKG++L LSLWG+ SY YG
Sbjct  273  VHTLLAGIIIAVFIPITEVLGVIFLHEKFSSEKGVALVLSLWGLASYSYG  322



>ref|XP_010248452.1| PREDICTED: purine permease 3-like [Nelumbo nucifera]
Length=326

 Score =   243 bits (620),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 154/330 (47%), Positives = 210/330 (64%), Gaps = 5/330 (2%)
 Frame = -1

Query  1210  MCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIPLaaayytrrrhttttaasif  1031
             M IG  GG LL+RLY++ GGNR W S  L +AG+PI  IPL+  Y   RR    + +  F
Sbjct  1     MAIGNIGGPLLMRLYYLHGGNRRWLSCSLQSAGFPILLIPLSLLYLHHRRRRGVSPSEFF  60

Query  1030  tiTRNTFlaaaalgvllGIINYLYTYGVSKLPVSTSALIAASQLAFTAGGAFLLVKQRFT  851
                +   +++A LG+LLG+ N++Y  G+S +PVSTSAL+ A+QLAFTAG A L+VKQRFT
Sbjct  61    IEPK-LLVSSAVLGLLLGLDNFMYALGLSYIPVSTSALLFATQLAFTAGFARLIVKQRFT  119

Query  850   AFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAFLMTLASAALYGALLPCIELTYI  671
              +S+N+VVL+  G+  L + S GD PAG S  EY++ F +TL SA L G +LPCIE  Y 
Sbjct  120   PYSINSVVLMILGSITLGIHSGGDWPAGVSDGEYLSGFFLTLGSALLVGFILPCIEFAYS  179

Query  670   KGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQAISREARGFEIGEANYYVVVVVT  491
             K  +++ +  V++FQ  M LFAT F  + ML+NKDFQ I REAR +E+G   YY V+  +
Sbjct  180   KASRAVDFAAVMQFQFNMGLFATIFAAMEMLINKDFQEIPREAREYELGHGMYYFVLSAS  239

Query  490   ALIWQILFIGAAGSICYGSSLLSGIILAATISLTEVFAVVFYGEKFGSEKGISLTLSLWG  311
             A++WQ+  IG  G I   +SL +GI  A  +   E+ AV+ Y EKF  EKGI+L L LWG
Sbjct  240   AIVWQLSLIGLLGLIFCTTSLFTGIYGAVLLPFAEIGAVIAYHEKFTGEKGIALALCLWG  299

Query  310   IVSYFYGEMKNGDNNKKEELQIQVTNMEPN  221
               SYFYGE +      K E  + + +  P 
Sbjct  300   FTSYFYGEYR----KSKVERSMTIDDQSPQ  325



>ref|XP_008795222.1| PREDICTED: purine permease 3-like [Phoenix dactylifera]
Length=351

 Score =   243 bits (619),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 119/239 (50%), Positives = 164/239 (69%), Gaps = 0/239 (0%)
 Frame = -1

Query  976  IINYLYTYGVSKLPVSTSALIAASQLAFTAGGAFLLVKQRFTAFSVNAVVLLTFGAGVLA  797
            + +Y+Y+Y  S LP+STS+L+ ASQLAFTA  A L+V+QRFT FS+NAVVLLT G  VL 
Sbjct  102  VDSYMYSYASSFLPLSTSSLLMASQLAFTAVFALLIVRQRFTPFSLNAVVLLTLGPVVLG  161

Query  796  VGSNGDRPAGESKKEYVAAFLMTLASAALYGALLPCIELTYIKGRQSLTYTLVLEFQMVM  617
            +G   DRP GE + +Y   F M +A+AAL G +LP +EL Y +  + +TY +V+E QMVM
Sbjct  162  LGGASDRPEGEPQSKYYLGFCMMVAAAALIGLVLPLVELAYRRTTEEMTYAMVIETQMVM  221

Query  616  SLFATAFCTVGMLVNKDFQAISREARGFEIGEANYYVVVVVTALIWQILFIGAAGSICYG  437
                + FC +GML++KDFQAI +EAR FE+GE  YY+V++  A+ WQIL +G  G I   
Sbjct  222  GASGSLFCLLGMLLSKDFQAIPKEAREFELGELRYYMVLIWDAICWQILNVGLVGVIFSA  281

Query  436  SSLLSGIILAATISLTEVFAVVFYGEKFGSEKGISLTLSLWGIVSYFYGEMKNGDNNKK  260
            SSL  G+++A  + + E+  V+F  EKF   K ++L LSLWG  SY YGE+K G  +K+
Sbjct  282  SSLFGGMMIAILVPIGEILPVIFLNEKFNGSKAVALALSLWGFASYLYGELKQGKKSKQ  340



>ref|XP_011016754.1| PREDICTED: purine permease 1-like [Populus euphratica]
Length=349

 Score =   242 bits (618),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 141/342 (41%), Positives = 222/342 (65%), Gaps = 4/342 (1%)
 Frame = -1

Query  1279  KMEVSEGKGNMRRRLFLL-LNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPI  1103
             K E  + +     + FL+ LN ++M +G   G LL+R+Y++ GG   W    L TAG+PI
Sbjct  8     KNEPDQHQNKKHMKAFLVFLNCMLMAVGQVAGPLLVRMYYLHGGKSNWLGAWLLTAGFPI  67

Query  1102  NFIPLaaayytrrrhttttaasiftiTRNTFlaaaalgvllGIINYLYTYGVSKLPVSTS  923
                 +     +  R      A    +T   F A+  LG++LG+ +YLY++G+S LPVS S
Sbjct  68    L---IIPISISYIRARARAQAGRLLVTPWLFSASVILGLVLGLDSYLYSFGMSYLPVSVS  124

Query  922   ALIAASQLAFTAGGAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVA  743
             +++ +SQL FTA  A+++VK +FT +S+NAV L+TFG+ +L    NGDRP+GESK +Y+ 
Sbjct  125   SILGSSQLTFTAFFAYIIVKHKFTHYSINAVALMTFGSLILGFHMNGDRPSGESKGKYIL  184

Query  742   AFLMTLASAALYGALLPCIELTYIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDF  563
              F MT+  AAL+G L+P +E TY+K  +++T+ LVL+ Q ++S+FAT FC++ M++NKDF
Sbjct  185   GFFMTIGGAALHGFLMPALEFTYLKAGKAITFDLVLQVQFLISMFATLFCSIPMIINKDF  244

Query  562   QAISREARGFEIGEANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLTEV  383
             +AIS+EA  F +GE  YY ++++ A++ Q+L IG+ G I   SSLL G++ +  + + + 
Sbjct  245   KAISKEAAEFGLGETKYYTILLIAAIVLQLLVIGSLGVIFNSSSLLGGLVSSLLVPVQQA  304

Query  382   FAVVFYGEKFGSEKGISLTLSLWGIVSYFYGEMKNGDNNKKE  257
             FAV+   E F + KG++L + LWG  SY YGE +  + NK+E
Sbjct  305   FAVIILKEVFNAVKGMALAMCLWGFASYLYGEYQKPEANKEE  346



>ref|XP_010098677.1| Purine permease 3 [Morus notabilis]
 gb|EXB75580.1| Purine permease 3 [Morus notabilis]
Length=273

 Score =   239 bits (610),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 134/238 (56%), Positives = 172/238 (72%), Gaps = 2/238 (1%)
 Frame = -1

Query  1273  EVSEGKGNMRRRLFLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFI  1094
             E     GN + +  L+LN I++ IG CGG L++RLYF+ GG R+W S+ L T GW I  +
Sbjct  3     EQQSSGGNRQNKALLILNCILLSIGNCGGPLIMRLYFLNGGKRVWLSSWLETGGWAIILL  62

Query  1093  PLaaayytrrrhttttaasiftiTRNTFlaaaalgvllGIINYLYTYGVSKLPVSTSALI  914
             PLA ++Y RRR  +             FLA+A +G+L G+ +Y+Y YGV++LPVSTSALI
Sbjct  63    PLAFSFYRRRRQNSAAKFFEIKPF--LFLASAGVGLLTGLDDYIYAYGVARLPVSTSALI  120

Query  913   AASQLAFTAGGAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAFL  734
              ASQLAFTA  A+LLVKQ+FT++SVNAVVLLT    VLA+ ++GDRP GES KEY+  FL
Sbjct  121   IASQLAFTAAFAYLLVKQKFTSYSVNAVVLLTIAGAVLALHTSGDRPKGESNKEYLMGFL  180

Query  733   MTLASAALYGALLPCIELTYIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQ  560
             MT+ +A LYG +LP +EL Y K +Q +TY+LVLE QMVM  FATAFCTVGM+VNKDFQ
Sbjct  181   MTVGAAVLYGFILPLMELVYKKAKQEITYSLVLEIQMVMCFFATAFCTVGMIVNKDFQ  238



>gb|KHN08969.1| Purine permease 1, partial [Glycine soja]
Length=206

 Score =   236 bits (603),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 118/207 (57%), Positives = 151/207 (73%), Gaps = 3/207 (1%)
 Frame = -1

Query  838  NAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAFLMTLASAALYGALLPCIELTYIKGRQ  659
            NAVVLLT GAGVLA+ ++GDRP GES KEYV  F+MT+ +AALYG +LP IEL Y K +Q
Sbjct  1    NAVVLLTVGAGVLALHTSGDRPPGESVKEYVMGFVMTVIAAALYGFVLPLIELVYQKIKQ  60

Query  658  SLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQAISREARGFEIGEANYYVVVVVTALIW  479
             LTY+LV+E Q VM   AT FC +GM++N DF+ I REA+ FE GE +YY V+V +A+IW
Sbjct  61   PLTYSLVMEIQFVMCFSATLFCLLGMIINNDFKVIPREAKQFEHGEGSYYAVLVGSAIIW  120

Query  478  QILFIGAAGSICYGSSLLSGIILAATISLTEVFAVVFYGEKFGSEKGISLTLSLWGIVSY  299
            Q  F+GA G I   SSL SGI++A  + +TEV AV+FY EKF +EKG+SL LSLWG+VSY
Sbjct  121  QAFFLGAIGVIFCASSLFSGILIAVLLPVTEVLAVIFYKEKFQAEKGVSLLLSLWGMVSY  180

Query  298  FYGEMKNGDNNKKEELQIQVTNMEPNE  218
            FYGE+K+    KK+         EP++
Sbjct  181  FYGEIKHSRKRKKKNSD---PEAEPSQ  204



>ref|XP_009801738.1| PREDICTED: purine permease 1-like isoform X1 [Nicotiana sylvestris]
Length=310

 Score =   240 bits (612),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 145/338 (43%), Positives = 203/338 (60%), Gaps = 32/338 (9%)
 Frame = -1

Query  1243  RRLFLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIPLaaayytrr  1064
             + + L+LN I + +G CGG L++RLYFI+GG R+W ST L T  WPINF+PL  +Y+   
Sbjct  2     KIVLLVLNCIFLAVGTCGGPLVMRLYFIKGGKRIWLSTWLQTVAWPINFLPLGISYFYSL  61

Query  1063  rhttttaasiftiTRNT---FlaaaalgvllGIINYLYTYGVSKLPVSTSALIAASQLAF  893
             ++      +   +   T   F+A   +GVL G  NY Y+YG +KLPVSTS L+ A+QLAF
Sbjct  62    KNINDNNNNNTKVILMTPRIFVATIGIGVLQGFGNYFYSYGTAKLPVSTSGLLFATQLAF  121

Query  892   TAGGAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAFLMTLASAA  713
             T G AFL+ K +FT++ VNAV+LLT G  +LA+ S GD+P GE+KKEY+  F+MTLA+AA
Sbjct  122   TTGFAFLIAKLKFTSYLVNAVILLTIGVVLLALHSGGDQPEGETKKEYILGFIMTLAAAA  181

Query  712   LYGALLPCIELTYIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQAISREARGF  533
             L G + P +EL Y K  Q++TYTLVLEFQ V    AT   T+GM++NKDF          
Sbjct  182   LSGLIFPLVELIYKKAHQAITYTLVLEFQTVYCFVATIVATIGMIINKDFL---------  232

Query  532   EIGEANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLTEVFAVVFYGEKF  353
                   +Y             F+G  G I   SSL+SGI+++  + +TE+ AV  YGEK 
Sbjct  233   ------FY-------------FLGTIGVIYSASSLVSGILISVLLPVTEILAVFIYGEKL  273

Query  352   GSEKGISLTLSLWGIVSYFYGEMKNGDNNKKEELQIQV  239
               +K   L  SL+G + + +  +      KK  L+ Q+
Sbjct  274   VQKKEFLLP-SLYGDLFHIFMVILKKARRKKNNLRKQI  310



>gb|KCW66597.1| hypothetical protein EUGRSUZ_F00391 [Eucalyptus grandis]
Length=261

 Score =   236 bits (601),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 133/239 (56%), Positives = 174/239 (73%), Gaps = 1/239 (0%)
 Frame = -1

Query  1273  EVSEGKGNMRRRLFLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFI  1094
             E   G+   ++ L L LN  M+ +G CGG LL+RLY++ GG+ +W S+ L T GWP  F+
Sbjct  22    EAPRGESETQKPLLLALNCAMLSLGTCGGPLLMRLYYLYGGSGVWLSSWLETGGWPAIFL  81

Query  1093  PLaaayytrrrhttttaasiftiTRNTFlaaaalgvllGIINYLYTYGVSKLPVSTSALI  914
              LA AY  RR     +A  +       F A+A +GVL G+ +YLY YGV++LP STSAL+
Sbjct  82    ALAVAYLRRRSAEGPSARLVLMD-PFLFAASAVVGVLTGLDDYLYAYGVARLPASTSALL  140

Query  913   AASQLAFTAGGAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAFL  734
              A+QLAFTAG AFLLV+Q+FT++S+N+V LLT  AGVLA+ ++ DRPAGES +EY A F 
Sbjct  141   IATQLAFTAGFAFLLVRQQFTSYSINSVYLLTVAAGVLALNASSDRPAGESDQEYYAGFF  200

Query  733   MTLASAALYGALLPCIELTYIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQA  557
             MTL +AALYG +LP +ELTY K +Q++TY+LVLE Q+VM  FATAFCTVGMLVNKDFQ+
Sbjct  201   MTLGAAALYGFVLPLVELTYKKAKQAVTYSLVLEIQLVMCFFATAFCTVGMLVNKDFQS  259



>ref|XP_006360266.1| PREDICTED: purine permease 1-like [Solanum tuberosum]
Length=364

 Score =   238 bits (608),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 138/351 (39%), Positives = 220/351 (63%), Gaps = 11/351 (3%)
 Frame = -1

Query  1282  LKMEV-SEGKGNMRRRL---------FLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFS  1133
             + ME+  EG  N  ++L          +L+  I + +G   G LL+R+Y++ GG R W  
Sbjct  1     MDMEIEQEGNYNKPKKLKNFMSIKTLLILIYCIFLLVGQISGVLLVRIYYLHGGKRKWLQ  60

Query  1132  TCLSTAGWPINFIPLaaayytrrrhttttaasiftiTRNTFlaaaalgvllG-IINYLYT  956
             + L TAG+PI  +P++ +Y  + +  T    +I           +A+  +L  I +YLYT
Sbjct  61    SLLLTAGFPILILPISISYMKKMKKITINNNNIRLFVTPKLAIFSAILGILFGICSYLYT  120

Query  955   YGVSKLPVSTSALIAASQLAFTAGGAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDR  776
              G+S LPVS S+L++++ LAFTA  A+ +VK +FT +SVNAVVL+  G+ +L +  NGDR
Sbjct  121   IGMSYLPVSISSLLSSTSLAFTAIFAYFMVKHKFTHYSVNAVVLMMLGSIILGLHMNGDR  180

Query  775   PAGESKKEYVAAFLMTLASAALYGALLPCIELTYIKGRQSLTYTLVLEFQMVMSLFATAF  596
             P GES ++Y   F+MT+  AAL+G L   +E +++K    +T+ LV++ Q ++S+F++ F
Sbjct  181   PIGESNRQYTLGFVMTIIGAALHGFLNAGVEYSHVKAGVVVTFDLVMQIQFLISMFSSLF  240

Query  595   CTVGMLVNKDFQAISREARGFEIGEANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGI  416
             C V +++N+DFQAI+REA  F +G+  YY+++ +TA+  Q + IG+ G I   S+LL GI
Sbjct  241   CIVAIIINRDFQAITREAEEFGLGQKKYYMILALTAISLQTMMIGSLGMIFCSSALLFGI  300

Query  415   ILAATISLTEVFAVVFYGEKFGSEKGISLTLSLWGIVSYFYGEMKNGDNNK  263
             + A  I + ++FAV+F  E F S+K ++L + LWG  SYFYGE K+   NK
Sbjct  301   VNALLIPIQQIFAVIFLPESFNSDKWMALAMCLWGFASYFYGEYKDSMTNK  351



>ref|XP_004252530.1| PREDICTED: purine permease 1-like [Solanum lycopersicum]
Length=364

 Score =   237 bits (604),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 140/346 (40%), Positives = 216/346 (62%), Gaps = 9/346 (3%)
 Frame = -1

Query  1243  RRLFLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIPLaaayytrr  1064
             + L + +N I + +G   G LL+R+Y++ GG R W    L TAG+PI  +P++ +Y  +R
Sbjct  24    KTLLIFINFIFISVGQISGVLLVRIYYLHGGKRKWLQAFLLTAGFPILILPISISYLKKR  83

Query  1063  rhttttaasiftiTRNTFlaaaalgvllG-IINYLYTYGVSKLPVSTSALIAASQLAFTA  887
             +  T    +I           +A+  LL  I +YLYT+G+S LPVS S+L++++ LAFTA
Sbjct  84    KKITNINNNIRFFVTPKLAMFSAILGLLLGICSYLYTFGMSYLPVSISSLLSSTSLAFTA  143

Query  886   GGAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAFLMTLASAALY  707
               A+ +VK +FT +SVNAVVL+  G+ +L +  NGDRP GES + Y   F+MTL  AAL+
Sbjct  144   IFAYFMVKHKFTDYSVNAVVLMMLGSIILGLHMNGDRPIGESNRSYALGFVMTLVGAALH  203

Query  706   GALLPCIELTYIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQAISREARGFEI  527
             G +   +E +++K    +T+ LV++ Q ++S+F+  FC V M++NKDFQAI+REA  F +
Sbjct  204   GFVNAGVEYSHVKAGVVVTFDLVMQMQFLISMFSALFCIVAMIINKDFQAITREAEEFGL  263

Query  526   GEANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLTEVFAVVFYGEKFGS  347
             G+  YY+++ +TA+  QI+ IG  G I   S+LL GI+ A  + + ++FAV+F  E F S
Sbjct  264   GQRKYYMILGLTAISLQIMIIGNLGMIFCSSALLLGIVNALLVPIQQIFAVMFLPESFNS  323

Query  346   EKGISLTLSLWGIVSYFYGEMKNGDNNKKEELQIQVTNMEPNETLP  209
             +K ++L + LWG  SYFYGE K    NK  +        + + TLP
Sbjct  324   DKWMALAMCLWGFASYFYGEYKESITNKVTK--------DKHATLP  361



>ref|XP_009789614.1| PREDICTED: purine permease 1-like [Nicotiana sylvestris]
Length=271

 Score =   222 bits (566),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 125/238 (53%), Positives = 174/238 (73%), Gaps = 1/238 (0%)
 Frame = -1

Query  1267  SEGKGNMRRRLFLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIPL  1088
              +G     RR+ LL+N +++ +G CGG L++RLY++ GG+R+WFS+ L TAGWP+  IPL
Sbjct  3     HKGLSTNLRRILLLINCLILAVGICGGPLMMRLYYVEGGSRVWFSSWLQTAGWPLTLIPL  62

Query  1087  aaayytrrrhttttaasiftiTRNTFlaaaalgvllGIINYLYTYGVSKLPVSTSALIAA  908
             A  Y+ RR+   +     F   R  F+A+  +GV+ G+ ++LY++G SKLPVSTS+L+ A
Sbjct  63    AILYFYRRKTQGSNTKLYFITPR-IFIASFIIGVVTGLDDFLYSWGGSKLPVSTSSLLLA  121

Query  907   SQLAFTAGGAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAFLMT  728
             +QLAFTA GAF +VK +FT +S+NAV+LLT GA +L + SNGDRP G + K Y+  F+MT
Sbjct  122   AQLAFTAVGAFFIVKLKFTPYSINAVILLTVGAVLLGIRSNGDRPEGVTSKAYILGFMMT  181

Query  727   LASAALYGALLPCIELTYIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQAI  554
             L +AALYG +LPCIEL Y+K +Q +T TLVLE QM+M L AT FCT+GM+VN DFQ +
Sbjct  182   LLAAALYGVILPCIELIYLKAKQVITATLVLEIQMIMCLAATTFCTMGMIVNNDFQVL  239



>ref|XP_006661331.1| PREDICTED: purine permease 3-like [Oryza brachyantha]
Length=269

 Score =   220 bits (560),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 109/207 (53%), Positives = 147/207 (71%), Gaps = 3/207 (1%)
 Frame = -1

Query  871  LVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAFLMTLASAALYGALLP  692
            +V+QR TA ++NAV LLT GA VL + ++ DRPAG +  +Y   F +TL +AALYG +LP
Sbjct  55   VVRQRLTAATLNAVALLTIGAVVLGLHTSNDRPAGVTNGKYWMGFFLTLGAAALYGLILP  114

Query  691  CIELTYIK---GRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQAISREARGFEIGE  521
             +EL Y     G +++TY LV+E Q+VM  FATAFCTVGM+VNKDFQAI REA+ +E+GE
Sbjct  115  LVELAYKHAAGGGRAVTYALVMEMQLVMGFFATAFCTVGMIVNKDFQAIPREAKQYELGE  174

Query  520  ANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLTEVFAVVFYGEKFGSEK  341
              YY V+V +A++W+  F+GA G I    +LL+GII+A  I +TEV  V+F  EKF SEK
Sbjct  175  TRYYTVLVFSAILWEFFFVGAVGVIFCVHTLLAGIIIAVFIPITEVLGVIFLHEKFSSEK  234

Query  340  GISLTLSLWGIVSYFYGEMKNGDNNKK  260
            G++L LSLWG+ SY YGE  +    K+
Sbjct  235  GVALVLSLWGLASYSYGEYTDAKAKKR  261



>gb|EMS63809.1| Purine permease 3 [Triticum urartu]
Length=284

 Score =   219 bits (558),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 112/214 (52%), Positives = 155/214 (72%), Gaps = 4/214 (2%)
 Frame = -1

Query  970  NYLYTYGVSKLPVSTSALIAASQLAFTAGGAFLLVKQRFTAFSVNAVVLLTFGAGVLAVG  791
            + LY YG++ LPVSTS+++ ++QLAFTA  A LLV+QRFTAFSVNAVVLL+ GA +L + 
Sbjct  6    DLLYAYGLAYLPVSTSSILISTQLAFTAAFALLLVRQRFTAFSVNAVVLLSVGAAMLGMN  65

Query  790  SNGDRPAGESKKEYVAAFLMTLASAALYGALLPCIELTYIKGR----QSLTYTLVLEFQM  623
            + GDRPAG ++ +Y A F MTL +AALYG +LP +EL+  K       ++TYTLV+E Q+
Sbjct  66   AGGDRPAGVTRAQYSAGFGMTLGAAALYGLMLPVMELSQAKHAARTGAAVTYTLVMEMQI  125

Query  622  VMSLFATAFCTVGMLVNKDFQAISREARGFEIGEANYYVVVVVTALIWQILFIGAAGSIC  443
            V+   ATAF  VGMLVN DF AI REAR F +G+  YY+++  +A+++Q  F+G  G+I 
Sbjct  126  VIGFTATAFSAVGMLVNNDFHAIPREAREFGLGQIGYYLLLAASAIVYQFFFLGTIGAIF  185

Query  442  YGSSLLSGIILAATISLTEVFAVVFYGEKFGSEK  341
            YGS+LL+G+I+   I +TEV AV+F+ E F   K
Sbjct  186  YGSALLAGVIMTVLIPVTEVLAVLFFHEPFNGTK  219



>emb|CDY46618.1| BnaA09g27450D [Brassica napus]
Length=227

 Score =   217 bits (552),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 117/221 (53%), Positives = 157/221 (71%), Gaps = 8/221 (4%)
 Frame = -1

Query  871  LVKQRFTAFSVNAVVLLTFGAGVLAV-GSNGDRPAGESKKEYVAAFLMTLASAALYGALL  695
            +VKQ FT FS+NAVVLLT G G+LA+ G +G+R A  S KEYV  FL+TL +A LY  +L
Sbjct  1    MVKQTFTPFSINAVVLLTAGTGILALRGGDGERSADVSHKEYVVGFLVTLTAAVLYAFIL  60

Query  694  PCIELTYIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQAISREARGFEI--GE  521
            P +ELTY K RQ +T+TLVLE Q+VM + A+ FC VGMLV  DF+ I  EAR F++  G 
Sbjct  61   PFVELTYKKVRQQITFTLVLEMQLVMCIAASCFCIVGMLVEGDFKVIPIEAREFKVGGGS  120

Query  520  ANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLTEVFAVVFYGEKFGSEK  341
            A YY+++++T +++Q LF+GA G +   SSL SG++++A + +TEV AVV + EKF  EK
Sbjct  121  AFYYMLILMTGIVYQGLFLGAIGVVFCASSLASGVLISALLPVTEVLAVVCFREKFQVEK  180

Query  340  GISLTLSLWGIVSYFYGEMKNGDN--NKKEELQIQVTNMEP  224
            G++L LSLWG VSYFYGE K+G    NK    Q+Q T + P
Sbjct  181  GVALLLSLWGFVSYFYGEFKSGKRIINKT---QLQETELPP  218



>ref|XP_009801739.1| PREDICTED: purine permease 1-like isoform X2 [Nicotiana sylvestris]
Length=264

 Score =   216 bits (550),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 121/242 (50%), Positives = 163/242 (67%), Gaps = 4/242 (2%)
 Frame = -1

Query  1243  RRLFLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIPLaaayytrr  1064
             + + L+LN I + +G CGG L++RLYFI+GG R+W ST L T  WPINF+PL  +Y+   
Sbjct  2     KIVLLVLNCIFLAVGTCGGPLVMRLYFIKGGKRIWLSTWLQTVAWPINFLPLGISYFYSL  61

Query  1063  rhttttaasiftiTRNT---FlaaaalgvllGIINYLYTYGVSKLPVSTSALIAASQLAF  893
             ++      +   +   T   F+A   +GVL G  NY Y+YG +KLPVSTS L+ A+QLAF
Sbjct  62    KNINDNNNNNTKVILMTPRIFVATIGIGVLQGFGNYFYSYGTAKLPVSTSGLLFATQLAF  121

Query  892   TAGGAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAFLMTLASAA  713
             T G AFL+ K +FT++ VNAV+LLT G  +LA+ S GD+P GE+KKEY+  F+MTLA+AA
Sbjct  122   TTGFAFLIAKLKFTSYLVNAVILLTIGVVLLALHSGGDQPEGETKKEYILGFIMTLAAAA  181

Query  712   LYGALLPCIELTYIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQAI-SREARG  536
             L G + P +EL Y K  Q++TYTLVLEFQ V    AT   T+GM++NKDF  I + E   
Sbjct  182   LSGLIFPLVELIYKKAHQAITYTLVLEFQTVYCFVATIVATIGMIINKDFLEIRATEDPE  241

Query  535   FE  530
             FE
Sbjct  242   FE  243



>ref|XP_009801740.1| PREDICTED: purine permease 1-like isoform X3 [Nicotiana sylvestris]
Length=237

 Score =   214 bits (545),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 117/230 (51%), Positives = 158/230 (69%), Gaps = 3/230 (1%)
 Frame = -1

Query  1243  RRLFLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIPLaaayytrr  1064
             + + L+LN I + +G CGG L++RLYFI+GG R+W ST L T  WPINF+PL  +Y+   
Sbjct  2     KIVLLVLNCIFLAVGTCGGPLVMRLYFIKGGKRIWLSTWLQTVAWPINFLPLGISYFYSL  61

Query  1063  rhttttaasiftiTRNT---FlaaaalgvllGIINYLYTYGVSKLPVSTSALIAASQLAF  893
             ++      +   +   T   F+A   +GVL G  NY Y+YG +KLPVSTS L+ A+QLAF
Sbjct  62    KNINDNNNNNTKVILMTPRIFVATIGIGVLQGFGNYFYSYGTAKLPVSTSGLLFATQLAF  121

Query  892   TAGGAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAFLMTLASAA  713
             T G AFL+ K +FT++ VNAV+LLT G  +LA+ S GD+P GE+KKEY+  F+MTLA+AA
Sbjct  122   TTGFAFLIAKLKFTSYLVNAVILLTIGVVLLALHSGGDQPEGETKKEYILGFIMTLAAAA  181

Query  712   LYGALLPCIELTYIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDF  563
             L G + P +EL Y K  Q++TYTLVLEFQ V    AT   T+GM++NKDF
Sbjct  182   LSGLIFPLVELIYKKAHQAITYTLVLEFQTVYCFVATIVATIGMIINKDF  231



>ref|XP_010418647.1| PREDICTED: purine permease 2-like [Camelina sativa]
Length=248

 Score =   213 bits (541),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 119/234 (51%), Positives = 161/234 (69%), Gaps = 0/234 (0%)
 Frame = -1

Query  1231  LLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIPLaaayytrrrhtt  1052
             +++N I + IG CGG L+LRLYF  GG R+WFS+ L T G P+   PL  ++ +RRR   
Sbjct  10    VIINCIFLAIGSCGGPLMLRLYFHNGGERIWFSSFLQTVGCPLILFPLLFSFLSRRRLEE  69

Query  1051  ttaasiftiTRNTFlaaaalgvllGIINYLYTYGVSKLPVSTSALIAASQLAFTAGGAFL  872
                 S+F +    F+A+  +G+L+G  NYLY+YG++ +PVST++LI ++QL FTA  AF 
Sbjct  70    QEKTSLFLMKPPLFIASVVVGLLMGFDNYLYSYGLAYIPVSTASLIISAQLGFTALFAFF  129

Query  871   LVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAFLMTLASAALYGALLP  692
             +VKQ+FT F++NA+VLLT GA VLA  S+ D+ A E+ KEYV  FLMT  +A LY  +LP
Sbjct  130   MVKQKFTPFTINAIVLLTVGAVVLAFNSDSDKLANETHKEYVVGFLMTAGAALLYAFILP  189

Query  691   CIELTYIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQAISREARGFE  530
              +EL Y K RQ +TYTLVLEFQMV+   AT FC VGML + DF+ I+RE    E
Sbjct  190   LVELAYKKSRQRVTYTLVLEFQMVLCFVATCFCLVGMLASGDFKVIAREXSTLE  243



>ref|XP_003602861.1| Purine permease [Medicago truncatula]
Length=274

 Score =   212 bits (540),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 122/253 (48%), Positives = 169/253 (67%), Gaps = 14/253 (6%)
 Frame = -1

Query  1279  KMEVSEGKGNMRRRLFLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPIN  1100
             K +V+E K    +R  L++N +++ +G C   L++RLYFI GG R+W S  L TAG+P+ 
Sbjct  5     KKQVAEKK---MKRFLLVVNCLILSLGTCSAPLIMRLYFIHGGQRVWLSAFLQTAGFPLM  61

Query  1099  FIPLaaayytrrrhttttaasif-----------tiTRNTFlaaaalgvllGIINYLYTY  953
              IPLA +Y  R R                     ++    F AAA +G+L G+ +YL+ Y
Sbjct  62    LIPLAISYIKRHRLHHHPPPLTTISIAPEKLNIISMKPPIFFAAAFIGILTGLDDYLFAY  121

Query  952   GVSKLPVSTSALIAASQLAFTAGGAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRP  773
             GV++LPVSTSALI ASQL FTA  AFL+VK++FTAF+VNAVVLLT GAGVLA+ ++ DRP
Sbjct  122   GVARLPVSTSALIIASQLGFTAFFAFLIVKEKFTAFTVNAVVLLTVGAGVLAMHTSSDRP  181

Query  772   AGESKKEYVAAFLMTLASAALYGALLPCIELTYIKGRQSLTYTLVLEFQMVMSLFATAFC  593
             AG S K+Y  +F  T+A++ALYG +LP +EL Y K +Q +TY+ V+EFQ V  +FAT FC
Sbjct  182   AGVSAKQYWISFSTTVAASALYGFILPSVELVYKKIKQPVTYSFVMEFQFVTCMFATLFC  241

Query  592   TVGMLVNKDFQAI  554
              +GM+ N DF+ +
Sbjct  242   AIGMIANNDFKRV  254



>ref|XP_006415683.1| hypothetical protein EUTSA_v10009673mg [Eutrema salsugineum]
 gb|ESQ34036.1| hypothetical protein EUTSA_v10009673mg [Eutrema salsugineum]
Length=338

 Score =   211 bits (537),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 131/347 (38%), Positives = 198/347 (57%), Gaps = 26/347 (7%)
 Frame = -1

Query  1240  RLFLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIPLaaayytrrr  1061
             R  +++N I++ IG CGG L++RLYF  GG  +WFST L TAG+PI FIPL  +Y  RRR
Sbjct  3     RAIVIINCIVLAIGNCGGPLIMRLYFNNGGKSIWFSTFLETAGFPIIFIPLLFSYLKRRR  62

Query  1060  httttaasiftiTRNTFlaaaalgvllG-IINYLYTYGVSKLPVSTSALIAASQLAFTAG  884
                    +   + +   L AA L  +L    NYLY YG++ LPVST+ALI ASQLAF A 
Sbjct  63    SNNGNENTSLFLIKPRLLIAAVLIGILSGFDNYLYAYGIAYLPVSTAALIIASQLAFIAI  122

Query  883   GAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAFLMTLASAALYG  704
              ++ +V  +FT F++NAVVLLT GA VL + +  D+P  E+ K+Y+  FL+T+A+A +Y 
Sbjct  123   FSYFMVNHKFTPFTINAVVLLTVGAAVLGMHTETDKPVHETHKQYIIGFLVTVAAAVMYA  182

Query  703   ALLPCIELTYIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQAISREARGFEIG  524
              +LP +EL Y K +Q ++Y+LVLE Q+++   A+    +G+         +  ++  +  
Sbjct  183   FVLPLVELAYQKAKQPMSYSLVLEVQLILCFLASLVSLIGL---------TNRSKRIQAW  233

Query  523   EANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLTEV--------FAVVF  368
               N         L     F      I  GS  +  + + + +   ++         +  F
Sbjct  234   RGN--------VLCGGCGFSHNLARILLGSHWIDLLRIISRLGYYDISPFAHHRGLSCYF  285

Query  367   YGEKFGSEKGISLTLSLWGIVSYFYGEMKNGDNNKKEELQIQVTNME  227
             Y EKF +EKG+SL LSLWG VSYFYGE+K    NK+ + + ++ ++ 
Sbjct  286   YHEKFQAEKGLSLALSLWGFVSYFYGEIKANKENKRIQQETELISLP  332



>emb|CBI19192.3| unnamed protein product [Vitis vinifera]
Length=316

 Score =   210 bits (534),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 122/270 (45%), Positives = 183/270 (68%), Gaps = 13/270 (5%)
 Frame = -1

Query  1276  MEVSEGKGN-----MRRR----LFLLL-NAIMMCIGGCGGALLLRLYFIRGGNRLWFSTC  1127
             ME S+G  N      RR+    +FL+L N ++M IG  GG LLLR+Y++ GG R W +  
Sbjct  1     MESSQGSQNEATQRQRRKSLKAMFLVLVNCVLMTIGQVGGPLLLRIYYLHGGKRKWLNAW  60

Query  1126  LSTAGWPINFIPLaaayytrrrhttttaasiftiTRNTFlaaaalgvllGIINYLYTYGV  947
             L T+G+PI  +P+A +Y   +     T   +         A+A LG+LLG+  YLY++G+
Sbjct  61    LLTSGFPILILPMAFSYLRAQAKGQATVLLVT---PRLVAASAFLGILLGLDGYLYSFGL  117

Query  946   SKLPVSTSALIAASQLAFTAGGAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAG  767
             S LP+S S+L+ ++QLAFTA  AF++VK +FT +SVNAVVL+TFG+ VL +  NGDRP+G
Sbjct  118   SYLPISVSSLLGSTQLAFTAIFAFIVVKHKFTHYSVNAVVLMTFGSIVLGLHMNGDRPSG  177

Query  766   ESKKEYVAAFLMTLASAALYGALLPCIELTYIKGRQSLTYTLVLEFQMVMSLFATAFCTV  587
              S  +Y+  FLMTL +AAL+G ++P +E T++K    +T+ LV++ Q ++S+FAT FCT+
Sbjct  178   VSDGKYLLGFLMTLGAAALHGFIMPALEYTHLKAGMPITFDLVMQIQFLISMFATLFCTI  237

Query  586   GMLVNKDFQAISREARGFEIGEANYYVVVV  497
              M++NKDFQA+S+EA  + +GE  YY+V +
Sbjct  238   PMVINKDFQAVSKEAAEYGLGETKYYMVSI  267



>ref|XP_010939716.1| PREDICTED: purine permease 1-like isoform X1 [Elaeis guineensis]
Length=408

 Score =   212 bits (539),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 126/235 (54%), Positives = 163/235 (69%), Gaps = 1/235 (0%)
 Frame = -1

Query  1240  RLFLL-LNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIPLaaayytrr  1064
             R FL+ LN  +M IG   G LLLRLYF++GG R W S+ L T GWP+ FIPLA +Y  R 
Sbjct  23    RWFLMALNFTIMVIGTAVGPLLLRLYFLKGGTRKWLSSWLQTGGWPLLFIPLAISYAHRC  82

Query  1063  rhttttaasiftiTRNTFlaaaalgvllGIINYLYTYGVSKLPVSTSALIAASQLAFTAG  884
             R        ++ +T   FLA   LG+L+G+ ++LY YG+S LPVSTS+++ +SQL FTA 
Sbjct  83    RCGGGRPIKLYLMTPPLFLACTVLGLLVGLDDFLYAYGLSYLPVSTSSILISSQLGFTAL  142

Query  883   GAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAFLMTLASAALYG  704
              AF +VKQ+FT+FSVNAVVLL+ GA +L + ++GDRP GES  +Y   F MTLA+A LYG
Sbjct  143   FAFFMVKQKFTSFSVNAVVLLSIGAVILGLHASGDRPKGESNTQYYLGFFMTLAAAVLYG  202

Query  703   ALLPCIELTYIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQAISREAR  539
              +LP +ELTY K +Q ++YTLV+E Q+ M  FAT FCTVGMLVN DF  I    R
Sbjct  203   FILPLVELTYAKAKQVVSYTLVIEMQLAMGFFATVFCTVGMLVNGDFHNILVHCR  257



>ref|XP_004985414.1| PREDICTED: purine permease 3-like [Setaria italica]
Length=376

 Score =   210 bits (535),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 134/318 (42%), Positives = 179/318 (56%), Gaps = 14/318 (4%)
 Frame = -1

Query  1198  GCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIPLaaayytrrrhtttta--asifti  1025
             G GG+LL+R YF+ GG RLW ST +  +GWP+   P+ A+   R R         +    
Sbjct  29    GAGGSLLIRAYFVHGGRRLWLSTMIQLSGWPLLLPPICASLLLRSRSRDGAGGGVADHLP  88

Query  1024  TRNTFlaaaalgvllGIINYLYTYGVSKLPVSTSALIAASQLAFTAGGAFLLVKQRFTAF  845
                   A A LG +  +  + Y+ G   LP+STS+L+ A+QL F A  AFL    RFT F
Sbjct  89    PPRLVRAVAVLGAVFAVACFAYSLGSQALPLSTSSLLQATQLTFNAVSAFLFAGLRFTPF  148

Query  844   SVNAVVLLTFGAGVLAVGSNGDRPA-GESKKEYVAAFLMTLASAALYGALLPCIELTYIK  668
             SVNAVVLLT G  VL    + +  A  E    Y   FL  ++SAAL G +LP +E+   +
Sbjct  149   SVNAVVLLTIGPAVLGFAPSSETEAQAEGSTAYWTGFLECMSSAALIGLVLPLVEVAMSR  208

Query  667   -GRQS----------LTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQAISREARGFEIGE  521
              GR+            +Y  V++ Q VM    TA C VGM + KDFQAI  EA  F +GE
Sbjct  209   YGRRDGGPAAARAPPPSYATVMQIQAVMGAAGTAVCLVGMAIAKDFQAIPTEAAAFGLGE  268

Query  520   ANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLTEVFAVVFYGEKFGSEK  341
              NYY++++  A+ WQ+  +G  G I   SSLL+GI++A  + L+EV AV+F  EKF   K
Sbjct  269   TNYYLLLIFGAVSWQLSNLGIMGLIVCSSSLLAGIMIALVLPLSEVLAVIFLHEKFDGVK  328

Query  340   GISLTLSLWGIVSYFYGE  287
             GI+L L LWG VSY YGE
Sbjct  329   GIALVLCLWGFVSYLYGE  346



>ref|XP_002977419.1| hypothetical protein SELMODRAFT_417455 [Selaginella moellendorffii]
 gb|EFJ21423.1| hypothetical protein SELMODRAFT_417455 [Selaginella moellendorffii]
Length=380

 Score =   207 bits (526),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 128/316 (41%), Positives = 183/316 (58%), Gaps = 15/316 (5%)
 Frame = -1

Query  1201  GGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIPLaaayytrrrhttttaasiftiT  1022
             G   G LL R YF  GG+R W ST L T+GWP+    LA A  +           +    
Sbjct  68    GTVVGQLLTRFYFAAGGSRKWLSTWLQTSGWPL----LAVATGSIYWKRGIKLTPLTPAL  123

Query  1021  RNTFlaaaalgvllGIINYLYTYGVSKLPVSTSALIAASQLAFTAGGAFLLVKQRFTAFS  842
               T+ A   L     + +++Y YG+S LP STS L+++SQLAF A  A ++ +Q+   F 
Sbjct  124   AATYTALGFLVA---LYSFMYAYGLSYLPASTSGLLSSSQLAFNAIFALIITRQKINPFG  180

Query  841   VNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAFLMTLASAALYGALLPCIELTYIK--  668
              NA+VL+T  A +LA+ S+ ++  G ++KE V  ++MT+ +AAL G   P  EL   K  
Sbjct  181   WNAIVLVTSAAVILALHSDDEKLPGVTRKEVVLGYVMTIVAAALSGFFFPITELVIRKFL  240

Query  667   ---GRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQAISREARGFEIGEANYYVVVV  497
                 R     T++LE Q ++SL +TA  +V M +N DF AI  E+R F+ G A YY+ +V
Sbjct  241   TGSSRSGDAATVLLEMQTLLSLISTAVSSVAMAINHDFLAIPGESRRFKAGAARYYITLV  300

Query  496   VTALIWQILFIGAAGSICYGSSLLSGIILAATISLTEVFAVVFYGEKFGSEKGISLTLSL  317
              TA+ WQ  F+G  G I   SSLL+G+I+A  I +  +FAV+F+G+ FG  K +S+ LSL
Sbjct  301   STAVSWQFAFLGTLGMIFLSSSLLAGVIMALEIPIGSIFAVIFFGDSFGGLKIMSMLLSL  360

Query  316   WGIVSYFYG---EMKN  278
             WG VSY YG   +MKN
Sbjct  361   WGFVSYTYGGYMDMKN  376



>ref|XP_002977418.1| hypothetical protein SELMODRAFT_417454 [Selaginella moellendorffii]
 gb|EFJ21422.1| hypothetical protein SELMODRAFT_417454 [Selaginella moellendorffii]
Length=388

 Score =   206 bits (523),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 130/321 (40%), Positives = 190/321 (59%), Gaps = 20/321 (6%)
 Frame = -1

Query  1201  GGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIPLaaayytrrrhttttaasiftiT  1022
             G   G LL R YF  GG+R W ST L T+GWP+    LA A  +           +    
Sbjct  75    GMIAGQLLTRFYFAAGGSRKWLSTWLQTSGWPL----LAVATGSIYWKRGIKLTPLTPAL  130

Query  1021  RNTFlaaaalgvllGIINYLYTYGVSKLPVSTSALIAASQLAFTAGGAFLLVKQRFTAFS  842
               T++A   LG    + N++Y YG++ LP ST+ L+++SQLAF A  A ++ +QR   F 
Sbjct  131   AATYIALGFLGA---LDNFMYAYGLAYLPASTNGLLSSSQLAFNAIFALIITRQRINPFG  187

Query  841   VNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAFLMTLASAALYGALLPCIELTYIKGR  662
              NA+VL++  A +LA+ S+ ++  G ++KE V  ++MT+ +AAL+G L P IEL     R
Sbjct  188   WNAIVLVSSAAMILALHSDDEKLPGVTRKEVVLGYVMTIGAAALFGLLYPLIELAI---R  244

Query  661   QSLTYT-------LVLEFQMVMSLFATAFCTVGMLVNKDFQAISREARGFEIGEANYYVV  503
             + LT +       +VLE Q ++SL +TA  +V M +N DF AI  E+R F+ G A+YY+ 
Sbjct  245   KFLTRSSDGGAAAVVLEMQTLLSLISTAVASVAMAINHDFLAIPGESRRFKAGAASYYLT  304

Query  502   VVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLTEVFAVVFYGEKFGSEKGISLTL  323
             +V TA+ WQ  F+G  G I   SSLL+G+ILA  I +  +FAV+F+G+ FG  K +S+ L
Sbjct  305   LVSTAVSWQFAFLGTLGIIFLSSSLLAGVILALAIPIGSIFAVIFFGDSFGGVKIMSMLL  364

Query  322   SLWGIVSYFYG---EMKNGDN  269
             SLWG VSY +G   +MK    
Sbjct  365   SLWGFVSYTFGGYVDMKKASK  385



>ref|XP_002465736.1| hypothetical protein SORBIDRAFT_01g044690 [Sorghum bicolor]
 gb|EER92734.1| hypothetical protein SORBIDRAFT_01g044690 [Sorghum bicolor]
Length=370

 Score =   204 bits (518),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 134/354 (38%), Positives = 196/354 (55%), Gaps = 21/354 (6%)
 Frame = -1

Query  1246  RRRLFLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIPLaaayytr  1067
             R    ++++A ++ +G  GG+LL+R+YF++GG  LW ST +  +GWP+   P+  +   R
Sbjct  6     RLSPLVIISAFLVLLGA-GGSLLIRVYFVQGGQSLWLSTMIQVSGWPLLLPPICISLLLR  64

Query  1066  rrhttttaasiftiTRNTFlaaaalgvll-----GIINYLYTYGVSKLPVSTSALIAASQ  902
              R         ++I  +         V +      +  Y Y+ G   LP++TS+L+ A+Q
Sbjct  65    SRRRDRDRDGGYSIADDLLQPRLVGAVAVLGVLFALACYAYSLGSQALPLTTSSLLQATQ  124

Query  901   LAFTAGGAFLLVKQRFTAFSVNAVVLLTFGAGVLAVG--SNGDRPAGE-SKKEYVAAFLM  731
             LAF A  AF+    RFT FSVNAVVLLT G  VL VG  S+ +  +GE S+  Y A F  
Sbjct  125   LAFNALCAFVFAGIRFTPFSVNAVVLLTVGPAVLGVGPSSSDETVSGEGSRTAYWAGFTE  184

Query  730   TLASAALYGALLPCIELTYIK-GRQSL-----------TYTLVLEFQMVMSLFATAFCTV  587
              +ASAAL G ++P  E+   + GR++            +Y  V++ Q VM    T  C V
Sbjct  185   CMASAALMGLVVPLFEVAMSRYGRRTAPAGGAFTGAPPSYVTVMQVQAVMGAAGTVLCLV  244

Query  586   GMLVNKDFQAISREARGFEIGEANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILA  407
             GM V ++FQA+ REA  F +GE +Y +V++   + WQ+  +G  G +   SSLL+GI+LA
Sbjct  245   GMAVMEEFQAVPREAATFGLGETSYCLVLIFGTVSWQLCNLGIMGLVACSSSLLAGIMLA  304

Query  406   ATISLTEVFAVVFYGEKFGSEKGISLTLSLWGIVSYFYGEMKNGDNNKKEELQI  245
               + L+EV AVVF  EKF   KG++L L LWG VSY YGE        K+   I
Sbjct  305   LLLPLSEVLAVVFLHEKFDGVKGVALVLCLWGFVSYLYGESAQNKKLTKDPESI  358



>gb|EPS58881.1| hypothetical protein M569_15932 [Genlisea aurea]
Length=320

 Score =   201 bits (512),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 139/319 (44%), Positives = 189/319 (59%), Gaps = 11/319 (3%)
 Frame = -1

Query  1177  LRLYFIRGGNRLWFSTCLSTAGWPINFIPLaaayytrrrhtttt--aasiftiTRNTFla  1004
             +RLYF  GG  +WF T LS+AG PI  +PLA  Y  RR  +         F +     + 
Sbjct  1     MRLYFAEGGGLVWFLTWLSSAGCPIILLPLAVNYVRRRSKSAADGIMPPFFIVKPKLLVC  60

Query  1003  aaalgvllGIINYLYTYGVSKLPVSTSALIAASQLAFTAGGAFLLVKQRFTAFSVNAVVL  824
              AA+G++    NY Y YG+SKLPVST A+I A+QLAFTAG AFL+VKQ+FT +S+NAVVL
Sbjct  61    GAAIGIIAAADNYFYVYGMSKLPVSTFAIIGATQLAFTAGFAFLIVKQKFTPYSINAVVL  120

Query  823   LTFGAGVLAVGSNGDRPAGESKKEYVAAFLMTLASAALYGALLPCIELTYIKGRQSLTYT  644
             LT  A VL++ +   R +GE   +Y   F  T   A L+G ++  +EL+Y K +Q +TY 
Sbjct  121   LTAAAAVLSLDAKNVRLSGEPSVDYWTGFCFTAGEAVLFGLIMSLVELSYSKSQQPMTYG  180

Query  643   LVLEFQMVMSLFATAFCTVGMLVNKDFQAISREARGFEIGEANYYVVVVVTALIWQILFI  464
             LVLEFQ+ M   A     +GM     F  I  +A GFE G A Y  V + TA   Q  F+
Sbjct  181   LVLEFQLAMCSSACVCSAIGMAATGGFAKIRTDAAGFESGRAKYCAVALFTAAACQCFFL  240

Query  463   GAAGSICYGSSLLSGIILAATISLTEVFAVVFYGEKFGSEKGISLTLSLWGIVSYFYGEM  284
             GA G +C+ SSL SG++L + + L E+ AVVF+ ++FG+ K ++L LSLWG  SY YGE 
Sbjct  241   GAIGVVCFSSSLFSGVVLNSLLVLVEICAVVFFHDEFGAGKAVALFLSLWGFASYSYGEY  300

Query  283   K---------NGDNNKKEE  254
             +         N D+N   +
Sbjct  301   RIRVRVPIPGNDDDNVPSQ  319



>ref|XP_008651823.1| PREDICTED: purine permease 3 [Zea mays]
 tpg|DAA43786.1| TPA: hypothetical protein ZEAMMB73_889347 [Zea mays]
Length=391

 Score =   202 bits (514),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 145/350 (41%), Positives = 200/350 (57%), Gaps = 10/350 (3%)
 Frame = -1

Query  1267  SEGKGNMRRRLFLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIPL  1088
             S      R  L ++L+A ++ +G  GG LLLR+YF+ GG RL+ S  L  +GWP+   P+
Sbjct  31    SPAPVRYRPSLLVILSACLVLMGA-GGPLLLRVYFVHGGERLFLSAMLQISGWPLLLPPI  89

Query  1087  aaayytrrrhttttaasiftiTRNTFlaaaalgvllGIINYLYTYGVSKLPVSTSALIAA  908
               + Y  R  + +   +   +      AAA LG    I  +LY  G   LP+STS+L+ A
Sbjct  90    CVSLYRSRSRSRSHGVASLLLPPRLAGAAAVLGAFYAISCFLYALGSQALPLSTSSLLLA  149

Query  907   SQLAFTAGGAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAFLMT  728
             +QLAFTA  AFL V  RFT FS NAVVLLT G  VL VG    +PAGE+ + Y   F   
Sbjct  150   TQLAFTAVFAFLFVGLRFTPFSANAVVLLTIGPAVLGVGPGSGKPAGEASRTYWIGFCEA  209

Query  727   LASAALYGALLPCIELTYIK--------GRQSLTYTLVLEFQMVMSLFATAFCTVGMLVN  572
             +A+AAL G +LP +E+   +         R    Y  V++ Q VM    T  C +GM + 
Sbjct  210   IAAAALAGLVLPLVEIATARYGRRTGPAARVPPPYATVMQMQAVMGAAGTLVCLLGMAIK  269

Query  571   KDFQAISREARGFEIGEANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISL  392
              DFQA+  EA  F +G+ NYY+V++  A+ WQ+L +G  G I   SSLL+GI++A  + L
Sbjct  270   SDFQAVPSEAATFGLGKTNYYLVLIWDAISWQLLNLGIVGLITCASSLLAGIMIAVLLPL  329

Query  391   TEVFAVVFYGEKFGSEKGISLTLSLWGIVSYFYGE-MKNGDNNKKEELQI  245
             +E+ AV+F  EKF   KGI+L LSLWG  SY YGE  +     +K ELQ+
Sbjct  330   SEILAVIFLHEKFDGPKGIALVLSLWGFASYLYGEKAQKKTETQKNELQM  379



>gb|ABR16480.1| unknown [Picea sitchensis]
Length=367

 Score =   201 bits (511),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 124/341 (36%), Positives = 190/341 (56%), Gaps = 16/341 (5%)
 Frame = -1

Query  1285  KLKMEVSEGKGNMRRRL---------FLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFS  1133
              L  +  +G G+ RR L          ++ + + + +G     LL R YF  GG+  W S
Sbjct  16    DLITDAEQGGGSNRRILAGKRTTHWVLVIFSILALLVGQAAATLLSRYYFAYGGDSRWIS  75

Query  1132  TCLSTAGWPINFIPLaaayytrrrhttttaasiftiTRNTFlaaaalgvllGIINYLYTY  953
             T L T GWPI  IPL           T              L   ALG+LL   N LY++
Sbjct  76    TLLQTVGWPILLIPLVLYQGKEASKLTPLT-------PKLVLIYVALGLLLAGDNLLYSW  128

Query  952   GVSKLPVSTSALIAASQLAFTAGGAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRP  773
             GVS +P ST +L+ +SQLAF A  AF+L++Q+ T + VN++VLLT  A +L V S+ DRP
Sbjct  129   GVSFMPASTYSLLCSSQLAFNAVFAFMLIRQKITPYIVNSLVLLTLSAILLGVHSDSDRP  188

Query  772   AGESKKEYVAAFLMTLASAALYGALLPCIELTYIKGRQSLTYTLVLEFQMVMSLFATAFC  593
              G +  +++  F+ T+A++A+YG LLP ++L + +  +  T+ +VLE Q+  SL AT  C
Sbjct  189   EGVNTAKHIVGFICTIAASAIYGLLLPLMQLVFDRVIKKETFAVVLEMQIYTSLVATVVC  248

Query  592   TVGMLVNKDFQAISREARGFEIGEANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGII  413
              VG+ V+ +F+ I  EA  F  G+  YY+ ++ +A+ WQ+  +G  G I   SSL S +I
Sbjct  249   IVGLFVSGEFRDIKEEAHSFTRGKVAYYMTLIWSAIGWQVCSVGVVGLIFLVSSLFSNVI  308

Query  412   LAATISLTEVFAVVFYGEKFGSEKGISLTLSLWGIVSYFYG  290
                 + +  + +V F+ +K  + K IS+ LS+WG VSY +G
Sbjct  309   STLALPVVPILSVGFFHDKMDALKIISMLLSIWGFVSYIFG  349



>ref|NP_001136854.1| hypothetical protein [Zea mays]
 gb|ACF82767.1| unknown [Zea mays]
 gb|AFW89428.1| hypothetical protein ZEAMMB73_630266 [Zea mays]
Length=394

 Score =   201 bits (510),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 148/351 (42%), Positives = 204/351 (58%), Gaps = 15/351 (4%)
 Frame = -1

Query  1246  RRRLFLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIPLaaayytr  1067
             R  L ++L+A ++ +G  GG LLLR+YF+ GG RL+ S  L  +GWP+   P+  + Y  
Sbjct  44    RPSLLVILSACLVLMGA-GGPLLLRVYFVHGGKRLFLSAMLQISGWPLLLPPICVSLYRS  102

Query  1066  rrhttttaasiftiTRNTFlaaaalgvllGIINYLYTYGVSKLPVSTSALIAASQLAFTA  887
             RRH       +         AAA LG L  +  ++Y  G   LP+STS+L+ A+QLAFTA
Sbjct  103   RRHGVAKKLLLPP---RLAGAAAVLGALYAVSCFVYALGSQALPLSTSSLLLATQLAFTA  159

Query  886   GGAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAFLMTLASAALY  707
               AFL V  RFT FS NAVVLLT G  VL VG    +PAGE+ + Y   F   +A+AAL 
Sbjct  160   VFAFLFVGLRFTPFSANAVVLLTIGPAVLGVGPGSGKPAGEASRTYWTGFCEAIAAAALA  219

Query  706   GALLPCIELTYIK--------GRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQAIS  551
             G +LP +E+   +         R    Y  V++ Q VM    T  C +GM V  DFQA++
Sbjct  220   GLVLPLVEVATARYGRRTGPAARVPPPYATVMQMQAVMGAAGTVVCLLGMAVKSDFQAVA  279

Query  550   REARGFEIGEANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLTEVFAVV  371
              EA  F +GE NYY+V+V  A+ WQ+L +G  G I   SSLL+GI++A  + L+EV AV+
Sbjct  280   SEAATFGLGETNYYLVLVWDAVSWQLLNLGIVGLITCASSLLAGIMIAVLLPLSEVLAVI  339

Query  370   FYGEKFGSEKGISLTLSLWGIVSYFYGEMKNGDNNKKEELQIQV---TNME  227
             F  EKF   KGI+L LSLWG  SY YGE       + ++++ Q+   T++E
Sbjct  340   FLHEKFDGPKGIALVLSLWGFASYLYGEKAQSKMQQTQKMEQQLAIKTDLE  390



>dbj|BAG88745.1| unnamed protein product [Oryza sativa Japonica Group]
Length=289

 Score =   197 bits (502),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 118/244 (48%), Positives = 156/244 (64%), Gaps = 12/244 (5%)
 Frame = -1

Query  1255  GNMRRRLFLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIPLaaay  1076
             G + R   L++N ++M +G   G LLLR YF+RGGNR W S+ L TAGWP+   PL  +Y
Sbjct  32    GRLFRSPLLVVNFVLMVVGSACGPLLLRAYFLRGGNRKWLSSLLQTAGWPLLLAPLCFSY  91

Query  1075  ytrrrhttttaasiftiTRNT--FlaaaalgvllGII-------NYLYTYGVSKLPVSTS  923
              +RRR               T  FL    L V   ++       + LY YG++ LPVSTS
Sbjct  92    SSRRRRREVEDDGAGAGAAATPLFLMTPRLLVASAVVGLMTGVDDLLYAYGLAYLPVSTS  151

Query  922   ALIAASQLAFTAGGAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVA  743
             +++ ++QLAFTA  A LLV+QRFTAFSVNAVVLL+ GA +L + + GDRPAG S+ +Y A
Sbjct  152   SILISTQLAFTAAFALLLVRQRFTAFSVNAVVLLSVGAAMLGMNAGGDRPAGVSRAQYCA  211

Query  742   AFLMTLASAALYGALLPCIELT---YIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVN  572
              F MTLA+AALYG +LP +EL+   +   R ++TYTLV+E Q+V+   ATAF  VGMLVN
Sbjct  212   GFAMTLAAAALYGLVLPVMELSQAHHAAARGAVTYTLVMEMQLVIGFVATAFSAVGMLVN  271

Query  571   KDFQ  560
              DF 
Sbjct  272   NDFH  275



>gb|EYU34538.1| hypothetical protein MIMGU_mgv1a019697mg, partial [Erythranthe 
guttata]
Length=161

 Score =   192 bits (487),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 92/161 (57%), Positives = 118/161 (73%), Gaps = 3/161 (2%)
 Frame = -1

Query  682  LTYIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQAISREARGFEIGEANYYVV  503
            LTY K +Q+++YTLVLE Q+VM +FAT+FCTVGMLVN DFQAI+REAR +E+GE  YY+V
Sbjct  1    LTYKKAKQAVSYTLVLEMQLVMCVFATSFCTVGMLVNNDFQAIAREARTYELGETKYYIV  60

Query  502  VVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLTEVFAVVFYGEKFGSEKGISLTL  323
            VV +A++WQ  F+GA G I Y SSLLSGI++   +  TE+ A++FY EKF +EKG+SL L
Sbjct  61   VVWSAIVWQCFFLGAIGVIFYSSSLLSGIVITVLLPATEILAIIFYHEKFQAEKGLSLFL  120

Query  322  SLWGIVSYFYGEMKNG---DNNKKEELQIQVTNMEPNETLP  209
            SLWG +SYFYGEMK     +N  +   Q Q T  E N   P
Sbjct  121  SLWGFISYFYGEMKKNKSKNNIDQSNDQTQATETEANYANP  161



>dbj|BAJ96346.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=391

 Score =   197 bits (501),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 145/349 (42%), Positives = 199/349 (57%), Gaps = 16/349 (5%)
 Frame = -1

Query  1246  RRRLFLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIPLaaayytr  1067
             R  L ++ +A ++ IG  GG LLLR+YF+ GG RLW S  L  +GWP+   P+  + +  
Sbjct  38    RPSLLVIFSACLVLIG-AGGPLLLRVYFVHGGQRLWLSALLQISGWPLLLPPMCVSLFRG  96

Query  1066  rrhttttaasiftiTRNTFlaaaalgvllGIINYLYTYGVSKLPVSTSALIAASQLAFTA  887
             RRH                +AAA LG    +  Y+Y  G   LP+STS+L+ A+QLAFTA
Sbjct  97    RRHGIANLLLP----PRLVVAAAVLGGFYAVSCYVYAMGSQALPLSTSSLLLATQLAFTA  152

Query  886   GGAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAFLMTLASAALY  707
               AFL V  RFT FS NAV+LL  G  VL VG    +PAG + K Y   F   +A+AAL 
Sbjct  153   VFAFLFVGLRFTPFSANAVLLLIIGPAVLGVGPGAGKPAGVTSKAYWTGFCEGIAAAALA  212

Query  706   GALLPCIELTYIK--------GRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQAIS  551
             G +LP +E++  +         R    Y+ V++ Q VM    T  C +GM +  DF A+ 
Sbjct  213   GLVLPLVEVSMERYGRRTGPAARAPPPYSTVMQMQAVMGAAGTLVCLLGMAIKSDFGALR  272

Query  550   REARGFEIGEANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLTEVFAVV  371
              EA  F +GE  YY+V+V  A+ WQ+L +G  G I + SSLL+GI++A  + L+++ AV+
Sbjct  273   SEAAAFGLGETKYYLVLVWDAVSWQLLNLGIMGLITFASSLLAGIMIAVLLPLSQILAVL  332

Query  370   FYGEKFGSEKGISLTLSLWGIVSYFYGE---MKNGDNNKKEELQIQVTN  233
             F  EKF   KGI+L LSLWG  SY YGE    K  + +K E LQ QV +
Sbjct  333   FLHEKFDGPKGIALVLSLWGFASYMYGEKVQQKKAEAHKSELLQQQVAS  381



>ref|XP_002975003.1| hypothetical protein SELMODRAFT_232471 [Selaginella moellendorffii]
 gb|EFJ23788.1| hypothetical protein SELMODRAFT_232471 [Selaginella moellendorffii]
Length=292

 Score =   194 bits (492),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 124/314 (39%), Positives = 180/314 (57%), Gaps = 26/314 (8%)
 Frame = -1

Query  1210  MCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIPLaaayytrrrhttttaasif  1031
             M  G   G LL R YF  GG+R W ST L T+GWP+    LA A  +           + 
Sbjct  1     MLTGMIAGQLLTRFYFAAGGSRKWLSTWLQTSGWPL----LAVATGSIYWKRGIKLTPLT  56

Query  1030  tiTRNTFlaaaalgvllGIINYLYTYGVSKLPVSTSALIAASQLAFTAGGAFLLVKQRFT  851
                  T++A   LG    + N++Y YG++ LP ST+ L+++SQLAF A  A ++ +QR  
Sbjct  57    PALAATYIALGFLGA---LDNFMYAYGLAYLPASTNGLLSSSQLAFNAIFALIITRQRIN  113

Query  850   AFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAFLMTLASAALYGALLPCIELTYI  671
              F  NA+VL++  A +LA+ S+ ++  G ++KE V  ++MT  +AAL             
Sbjct  114   PFGWNAIVLVSSAAVILALHSDDEKLPGVTRKEVVLGYVMTTGAAAL-------------  160

Query  670   KGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQAISREARGFEIGEANYYVVVVVT  491
                 S   T++LE Q ++SL +TA  +V M +N DF AI  E+R F+ G A YY+ +V T
Sbjct  161   ---SSDAATVLLEMQTLLSLISTAVSSVAMAINHDFLAIPGESRRFKAGAARYYITLVST  217

Query  490   ALIWQILFIGAAGSICYGSSLLSGIILAATISLTEVFAVVFYGEKFGSEKGISLTLSLWG  311
             A+ WQ  F+G  G I   SSLL+G+I+A  I +  +FAV+F+G+ FG  K +S+ LSLWG
Sbjct  218   AVSWQFAFLGTLGMIFLSSSLLAGVIMALEIPIGSIFAVIFFGDSFGGLKIMSMFLSLWG  277

Query  310   IVSYFYG---EMKN  278
              VSY YG   +MKN
Sbjct  278   FVSYTYGGYMDMKN  291



>ref|XP_008779125.1| PREDICTED: purine permease 1-like [Phoenix dactylifera]
Length=261

 Score =   192 bits (489),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 120/222 (54%), Positives = 152/222 (68%), Gaps = 2/222 (1%)
 Frame = -1

Query  1225  LNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIPLaaayytrrrhtttt  1046
             LN  +M IG     LLLRLYF++GG+R W S  L T GWP+  IPLA +Y  RRR    T
Sbjct  28    LNFAIMVIGTTASPLLLRLYFLKGGSRKWLSGWLETVGWPLLLIPLAISYAHRRRGGGPT  87

Query  1045  aasiftiTRNTFlaaaalgvllGIINYLYTYGVSKLPVSTSALIAASQLAFTAGGAFLLV  866
                + T     FLA   LG+LLG+  +L  YG+S LPVSTS+++ ++QL FTA  AF +V
Sbjct  88    KLYLMT--PPLFLACTVLGLLLGLDCFLNAYGLSYLPVSTSSILISTQLGFTALFAFFIV  145

Query  865   KQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAFLMTLASAALYGALLPCI  686
             KQ+FT+FS NAVVLL+ GA +L + ++GDRP GES   Y   F MTLA+A LY  +LP +
Sbjct  146   KQKFTSFSTNAVVLLSIGAVMLGLHASGDRPEGESNTLYYLGFAMTLAAAVLYAFILPLV  205

Query  685   ELTYIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQ  560
             ELTY K +Q ++YTLV+E Q+VM  FA  FCTVGMLVNKDFQ
Sbjct  206   ELTYAKAKQVVSYTLVMEMQLVMGFFAAVFCTVGMLVNKDFQ  247



>emb|CDY72169.1| BnaCnng76300D, partial [Brassica napus]
Length=253

 Score =   192 bits (488),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 115/239 (48%), Positives = 160/239 (67%), Gaps = 5/239 (2%)
 Frame = -1

Query  1231  LLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIPLaaayytrrrhtt  1052
             L+L  +++ IG CGG LL RLY+  GG R+WF + +STAG P+ FIPL  ++  RR    
Sbjct  6     LVLICMILAIGTCGGPLLTRLYYNNGGERIWFMSFISTAGCPVTFIPLVLSFLRRRNRNN  65

Query  1051  t---taasiftiTRNTFlaaaalgvllGIINYLYTYGVSKLPVSTSALIAASQLAFTAGG  881
             +       I  +    F+A+  +G+L+G+ NY + YG++ LPVST++LI  +QL F A  
Sbjct  66    SENIDKTEIVLMETPMFMASIVIGLLIGLDNYCFAYGLAYLPVSTTSLIVGTQLGFNAIF  125

Query  880   AFLLVKQRFTAFSVNAVVLLTFGAGVLAV-GSNGDRPAGESKKEYVAAFLMTLASAALYG  704
             +F +VKQ FT FS+NAVVLLT G G+LA+ G +GDRPA  S KEYV  FL+TL +A LY 
Sbjct  126   SFFMVKQTFTPFSINAVVLLTAGTGILALRGGDGDRPADVSHKEYVVGFLVTLTAAVLYA  185

Query  703   ALLPCIELTYIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQAISREARGFEI  527
              +LP +ELT  K RQ +T+TLVLE Q+VM L A+ FC  GMLV  DF+ +++E+  + I
Sbjct  186   FILPFVELTCKKVRQEITFTLVLEMQLVMCLAASCFCIFGMLVEGDFK-VNKESDLYSI  243



>dbj|BAJ95836.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ95854.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ97308.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=390

 Score =   192 bits (489),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 144/349 (41%), Positives = 193/349 (55%), Gaps = 16/349 (5%)
 Frame = -1

Query  1246  RRRLFLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIPLaaayytr  1067
             R    ++ +A ++ IG   G LLLR+YF+ GG RLW S  +  +GWP+   PL  + +  
Sbjct  37    RPSPLVVFSACLVLIGS-SGPLLLRVYFVHGGQRLWLSALVQISGWPLLLPPLCVSLFRG  95

Query  1066  rrhttttaasiftiTRNTFlaaaalgvllGIINYLYTYGVSKLPVSTSALIAASQLAFTA  887
             RRH                  A  LG L  +  Y+Y  G   LP+STS+L+ A+QLAFTA
Sbjct  96    RRHGIANLLLPA----RLVGTAVVLGSLYAVSCYVYAMGSQALPLSTSSLLLATQLAFTA  151

Query  886   GGAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAFLMTLASAALY  707
               AFL V  RFT FS NAV+LLT G  VL VG    +PAGE  K Y   F   +A+AAL 
Sbjct  152   VFAFLFVGLRFTPFSANAVMLLTIGPAVLGVGPGSGKPAGEPSKTYWTGFCEAIAAAALA  211

Query  706   GALLPCIEL--------TYIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQAIS  551
             G +LP +E+        T    R    Y+ V++ Q +M    T  C +GM +  DF+A+ 
Sbjct  212   GLVLPLVEVAMERFGRRTGPAARAPPPYSTVMQMQAMMGAAGTMVCLLGMAIKTDFKAMP  271

Query  550   REARGFEIGEANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLTEVFAVV  371
              EA  + +GE  YY+V+V  A+ WQ+L +G  G I   SSLL+GI++A  + L+EV AV+
Sbjct  272   SEAAAYGLGETKYYLVLVWGAVSWQMLNLGVVGLITCASSLLAGIMVAVLLPLSEVLAVI  331

Query  370   FYGEKFGSEKGISLTLSLWGIVSYFYGE---MKNGDNNKKEELQIQVTN  233
             F  EKF   KGI+L LSLWG  SY YGE    K  +  K + LQ QV  
Sbjct  332   FLHEKFDGPKGIALVLSLWGFASYMYGEKVQQKKLEAQKSQLLQQQVAK  380



>ref|NP_001049213.1| Os03g0187800 [Oryza sativa Japonica Group]
 gb|AAN64138.1| Hypothetical protein [Oryza sativa Japonica Group]
 gb|ABF94375.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAF11127.1| Os03g0187800 [Oryza sativa Japonica Group]
Length=399

 Score =   192 bits (489),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 135/303 (45%), Positives = 177/303 (58%), Gaps = 12/303 (4%)
 Frame = -1

Query  1174  RLYFIRGGNRLWFSTCLSTAGWPINFIPLaaayytrrrhttttaasiftiTRNTFlaaaa  995
             R+YF+ GG RLW S  L  +GWP+   PL  + Y  RRH            R    AAA 
Sbjct  68    RVYFVHGGTRLWLSATLQISGWPLLLPPLCVSLYRGRRHGIGNLLLP----RRLVGAAAV  123

Query  994   lgvllGIINYLYTYGVSKLPVSTSALIAASQLAFTAGGAFLLVKQRFTAFSVNAVVLLTF  815
             LG L  +  ++Y  G   LP+STS+L+ A+QLAFTA  AFL V  RFT FS NAVVLLT 
Sbjct  124   LGGLYAVSCFVYALGSQALPLSTSSLLLATQLAFTAVFAFLFVGLRFTPFSANAVVLLTI  183

Query  814   GAGVLAVGSNGDRPAGESKKEYVAAFLMTLASAALYGALLPCIELTYIK--------GRQ  659
             G  VL VG +  +PAGES + Y   F   + +AAL G ++P +E+   +         R 
Sbjct  184   GPAVLGVGPSSGKPAGESSRAYWTGFCEAIGAAALAGLVIPLVEVATARYGRRTGPAARV  243

Query  658   SLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQAISREARGFEIGEANYYVVVVVTALIW  479
                Y  V++ Q VM    TA C +GM +  DFQA++REA  F +G ANYY+V+   A+ W
Sbjct  244   PPPYATVMQMQAVMGAAGTAVCVLGMAIKGDFQAVAREAAAFGLGAANYYLVLAWDAVSW  303

Query  478   QILFIGAAGSICYGSSLLSGIILAATISLTEVFAVVFYGEKFGSEKGISLTLSLWGIVSY  299
             Q+L +G  G I   SSLL+GI++A  + L++V AV+F  EKF   KGI+L LSLWG  SY
Sbjct  304   QLLNLGIMGLITCASSLLAGIMIAVLLPLSQVLAVIFLHEKFDGTKGIALVLSLWGFASY  363

Query  298   FYG  290
              YG
Sbjct  364   LYG  366



>gb|EAY88839.1| hypothetical protein OsI_10311 [Oryza sativa Indica Group]
Length=398

 Score =   192 bits (489),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 135/303 (45%), Positives = 177/303 (58%), Gaps = 12/303 (4%)
 Frame = -1

Query  1174  RLYFIRGGNRLWFSTCLSTAGWPINFIPLaaayytrrrhttttaasiftiTRNTFlaaaa  995
             R+YF+ GG RLW S  L  +GWP+   PL  + Y  RRH            R    AAA 
Sbjct  67    RVYFVHGGTRLWLSATLQISGWPLLLPPLCVSLYRGRRHGIGNLLLP----RRLVGAAAV  122

Query  994   lgvllGIINYLYTYGVSKLPVSTSALIAASQLAFTAGGAFLLVKQRFTAFSVNAVVLLTF  815
             LG L  +  ++Y  G   LP+STS+L+ A+QLAFTA  AFL V  RFT FS NAVVLLT 
Sbjct  123   LGGLYAVSCFVYALGSQALPLSTSSLLLATQLAFTAVFAFLFVGLRFTPFSANAVVLLTI  182

Query  814   GAGVLAVGSNGDRPAGESKKEYVAAFLMTLASAALYGALLPCIELTYIK--------GRQ  659
             G  VL VG +  +PAGES + Y   F   + +AAL G ++P +E+   +         R 
Sbjct  183   GPAVLGVGPSSGKPAGESSRAYWTGFCEAIGAAALAGLVIPLVEVATARYGRRTGPAARV  242

Query  658   SLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQAISREARGFEIGEANYYVVVVVTALIW  479
                Y  V++ Q VM    TA C +GM +  DFQA++REA  F +G ANYY+V+   A+ W
Sbjct  243   PPPYATVMQMQAVMGAAGTAVCVLGMAIKGDFQAVAREAAAFGLGAANYYLVLAWDAVSW  302

Query  478   QILFIGAAGSICYGSSLLSGIILAATISLTEVFAVVFYGEKFGSEKGISLTLSLWGIVSY  299
             Q+L +G  G I   SSLL+GI++A  + L++V AV+F  EKF   KGI+L LSLWG  SY
Sbjct  303   QLLNLGIMGLITCASSLLAGIMIAVLLPLSQVLAVIFLHEKFDGTKGIALVLSLWGFASY  362

Query  298   FYG  290
              YG
Sbjct  363   LYG  365



>ref|XP_006373040.1| hypothetical protein POPTR_0017s07610g, partial [Populus trichocarpa]
 gb|ERP50837.1| hypothetical protein POPTR_0017s07610g, partial [Populus trichocarpa]
Length=251

 Score =   188 bits (477),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 95/195 (49%), Positives = 127/195 (65%), Gaps = 20/195 (10%)
 Frame = -1

Query  862  QRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAFLMTLASAALYGALLPCIE  683
            Q+F +F++NA+ LLT GA +L + ++ DRPA E+ K+Y     MTL +AALYG +LP +E
Sbjct  52   QKFPSFTINAIFLLTIGAVILVLHTSSDRPAHETNKQYFLGVFMTLGTAALYGFVLPVVE  111

Query  682  LTYIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQAISREARGFEIGEANYYVV  503
            LTY K +Q++TYTLV+E QMV S FATAFC  GM        I +EA   E+G+  Y+V 
Sbjct  112  LTYKKAKQTITYTLVVEIQMVKSFFATAFCAAGMF------EIPKEASACELGQEKYHVA  165

Query  502  VVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLTEVFAVVFYGEKFGSEKGISLTL  323
            ++ +A++WQ  F+GA G    GSSLLS              AV+FY EKF +EK ISL L
Sbjct  166  IIFSAILWQCFFMGAIGVTFCGSSLLS--------------AVLFYHEKFHAEKAISLVL  211

Query  322  SLWGIVSYFYGEMKN  278
            SLWG  SYFYGE++ 
Sbjct  212  SLWGFFSYFYGELQQ  226



>gb|EEE69876.1| hypothetical protein OsJ_29691 [Oryza sativa Japonica Group]
Length=265

 Score =   188 bits (478),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 120/254 (47%), Positives = 161/254 (63%), Gaps = 12/254 (5%)
 Frame = -1

Query  1264  EGKGNMRRRLFLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIPLa  1085
              G+G   R L + LN  M+ +G  GG L+ RLYF +GG+R W S  L TAGWP+  +P+A
Sbjct  17    PGRGRAARWLLVALNCGMLVVGTTGGPLISRLYFSKGGHRQWLSAWLQTAGWPLLLVPVA  76

Query  1084  aayytrrrhttttaasiftiTRNTFlaaaalgvllGIINYLYTYGVSKLPVSTSALIAAS  905
             A+Y +RR         +        LA   LG L G  +++Y YG++ LPVSTSA++ ++
Sbjct  77    ASYLSRRARDRRAPLFLTPT--RVLLAGVGLGFLNGADDFIYAYGLAYLPVSTSAILIST  134

Query  904   QLAFTAGGAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKKEYVAAFLMTL  725
             QLAFT   A L+V+QRFTA ++NAV LLT GA VL + ++ DRPAG +  +Y   F +TL
Sbjct  135   QLAFTVFFACLIVRQRFTAATLNAVALLTIGAVVLGLHASKDRPAGVTSGKYWMGFFLTL  194

Query  724   ASAALYGALLPCIELTYIK---GRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQAI  554
              +AALYG +LP +EL Y     G +++TY LV+E Q+VM  FATAFCTVGM+VNKDFQ  
Sbjct  195   GAAALYGLILPLVELAYKHAAGGGRAVTYALVMEMQLVMGFFATAFCTVGMVVNKDFQ--  252

Query  553   SREARGFEIGEANY  512
                  G   G ANY
Sbjct  253   -----GLFFGLANY  261



>gb|KHN08292.1| Purine permease 1 [Glycine soja]
Length=176

 Score =   185 bits (470),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 89/159 (56%), Positives = 118/159 (74%), Gaps = 0/159 (0%)
 Frame = -1

Query  739  FLMTLASAALYGALLPCIELTYIKGRQSLTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQ  560
            F+MT+ +AALYG +LP +EL Y K +Q LTY+LV+E Q VM   AT FC +GM++N DF+
Sbjct  3    FVMTVIAAALYGFILPLVELVYKKIKQPLTYSLVMEIQFVMCFSATLFCLLGMIINNDFK  62

Query  559  AISREARGFEIGEANYYVVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLTEVF  380
             I REA+ FE GE +YY V+V +A++WQ  F+GA G I   SSL SGI++A  + +TEV 
Sbjct  63   VIPREAKKFEHGEGSYYAVLVGSAILWQAFFLGAIGVIFCASSLFSGILIAVLLPVTEVL  122

Query  379  AVVFYGEKFGSEKGISLTLSLWGIVSYFYGEMKNGDNNK  263
            AV+FY EKF +EKG+SL LSLWG+VSYFYGE+K+    K
Sbjct  123  AVIFYKEKFQAEKGVSLLLSLWGMVSYFYGEIKHSKKMK  161



>ref|XP_004979831.1| PREDICTED: purine permease 3-like [Setaria italica]
Length=358

 Score =   189 bits (481),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 131/339 (39%), Positives = 186/339 (55%), Gaps = 28/339 (8%)
 Frame = -1

Query  1192  GGALLLRLYFIRGGNRLWFSTCLSTAGWPINFIPLaaayytrrrhttttaasiftiTRNT  1013
             GG+L++R+YF+ GG  LW ST +   GWP+     A+    R       +  + +  R  
Sbjct  33    GGSLVIRVYFVHGGPHLWVSTMMQVGGWPLLLPIWASLLLLRDGGGAGISVHLRSPHRAG  92

Query  1012  FlaaaalgvllGIINYLYTYGVSKLPVSTSALIAASQLAFTAGGAFLLVKQRFTAFSVNA  833
             FLA         I  + Y+ G   LP+STSA++ A+QLAF A  AFL    RFT FSVNA
Sbjct  93    FLAVFGACFA--IACFAYSLGSQSLPLSTSAVLQATQLAFNAIFAFLFAGLRFTPFSVNA  150

Query  832   VVLLTFGAGVLAVGSNGDRPAGESKKEYVAAFLMTLASAALYGALLPCIELTYIKG--RQ  659
             VVLL+ G  VL     G RP         A F+  L SAA+ G +LP +++T  +G  R+
Sbjct  151   VVLLSMGPAVL-----GARP-------NWAGFVECLTSAAVLGLVLPLVQVTMSRGHGRR  198

Query  658   S----------LTYTLVLEFQMVMSLFATAFCTVGMLVNKDFQAISREARGFEIGEANYY  509
             S           ++ +V++ Q++M   ATA C VGM V+K FQA+  EA  F +GE  YY
Sbjct  199   SGAAETAPPPPPSFAMVVQMQVLMGAAATAVCLVGMAVSKTFQAVPEEAGEFGLGETGYY  258

Query  508   VVVVVTALIWQILFIGAAGSICYGSSLLSGIILAATISLTEVFAVVFYGEKFGSEKGISL  329
             +++VV A+ WQ+  +G    I   SSLL+GI++A  + L++V AV+F  EK    K I+L
Sbjct  259   LLLVVGAISWQLSNLGVMALIVCSSSLLAGIMIALFLPLSDVLAVIFLHEKMDGLKAIAL  318

Query  328   TLSLWGIVSYFYGEM--KNGDNNKKEELQIQVTNMEPNE  218
              +SLWG VSY YGE   K  +  +KE   I    + P +
Sbjct  319   VVSLWGFVSYLYGESLEKKMEAGEKEAESICSPLIVPCD  357



>tpg|DAA40289.1| TPA: hypothetical protein ZEAMMB73_258363 [Zea mays]
Length=281

 Score =   186 bits (473),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 120/260 (46%), Positives = 162/260 (62%), Gaps = 9/260 (3%)
 Frame = -1

Query  1282  LKMEVSEGKGNMR----RRLFLLLNAIMMCIGGCGGALLLRLYFIRGGNRLWFSTCLSTA  1115
             + +E S     +R    RRL +  N +M+ +G  GG LL RLYF +GG+R W S  L T 
Sbjct  1     MDVEASHESPPLRSKTMRRLLVATNCVMLALGVTGGQLLSRLYFSKGGHRQWLSGWLQTG  60

Query  1114  GWPINFIPLaaayytrrrhttttaasiftiTRNTFlaaaalgvllGIINYLYTYGVSKLP  935
             GWP+   P+AA+Y  RR    +  A +        LAAA LG++ G+ N LY +G+  LP
Sbjct  61    GWPLLLPPVAASYVRRRARYRSAPALLTQTQPRILLAAAGLGLIAGVDNLLYAWGLEFLP  120

Query  934   VSTSALIAASQLAFTAGGAFLLVKQRFTAFSVNAVVLLTFGAGVLAVGSNGDRPAGESKK  755
             VSTSA++ ++QLAFT   AFL+V+QR T  +VNAV LLT GA VL +  + DRPAG ++ 
Sbjct  121   VSTSAILISTQLAFTVLFAFLIVRQRLTMATVNAVALLTVGAVVLGLHVSSDRPAGVTRS  180

Query  754   EYVAAFLMTLASAALYGALLPCIELTY---IKGRQSLTYTLVLEFQMVMSLFATAFCTVG  584
             +Y   F +TL +A LYG  LP +ELTY     G +++TY LV+E Q+VM   ATAFCTVG
Sbjct  181   QYWLGFTLTLGAAVLYGLFLPLVELTYKCAAGGGRAVTYALVVELQLVMGFVATAFCTVG  240

Query  583   MLVNKDFQAISREARGFEIG  524
             M+VNKDFQ   R+A    + 
Sbjct  241   MIVNKDFQV--RDAPHIRVA  258



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3583994365200