BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c24280_g1_i6 len=749 path=[5303:0-88 5392:89-120 2887:121-121
2888:122-123 858:124-147 9102:148-170 5470:171-421 1436:422-445
9270:446-446 9271:447-461 8527:462-555 5853:556-584 1310:585-585
2237:586-609 9355:610-621 8046:622-630 5938:631-748]

Length=749
                                                                      Score     E

ref|XP_006350130.1|  PREDICTED: putative F-box protein At1g47790-...    106   2e-23   
ref|XP_010314076.1|  PREDICTED: putative F-box protein At1g32420        100   2e-21   
ref|XP_010326852.1|  PREDICTED: putative F-box protein At1g32420      95.1    2e-19   
ref|XP_009797070.1|  PREDICTED: putative F-box protein At4g21240      94.4    2e-19   
ref|XP_009617122.1|  PREDICTED: F-box protein At1g30790-like          95.1    2e-19   
ref|XP_009596418.1|  PREDICTED: putative F-box protein At1g32420      92.4    1e-18   
ref|XP_009779041.1|  PREDICTED: putative F-box protein At1g32420      92.0    2e-18   
ref|XP_006348768.1|  PREDICTED: F-box protein At5g65850-like          90.5    8e-18   
ref|XP_009597735.1|  PREDICTED: putative F-box protein At1g32420      89.4    2e-17   
ref|XP_004228837.2|  PREDICTED: putative F-box protein At3g10240      87.0    8e-17   
ref|XP_009609776.1|  PREDICTED: F-box protein At1g47340-like          85.9    3e-16   
gb|KDP32917.1|  hypothetical protein JCGZ_13698                       85.9    4e-16   
ref|XP_006366903.1|  PREDICTED: F-box protein At1g30790-like          86.3    7e-16   
ref|XP_009779040.1|  PREDICTED: putative F-box protein At1g47790      85.1    9e-16   
ref|XP_006367491.1|  PREDICTED: putative F-box protein At3g10240-...  83.6    2e-15   
ref|XP_009602535.1|  PREDICTED: putative F-box protein At1g47790      82.4    7e-15   
ref|XP_006338789.1|  PREDICTED: F-box protein At1g30790-like          81.3    8e-15   
ref|XP_010101604.1|  F-box/kelch-repeat protein                       82.4    8e-15   
ref|XP_006366851.1|  PREDICTED: putative F-box protein At1g47790-...  80.9    2e-14   
ref|XP_006367351.1|  PREDICTED: F-box protein At2g40925-like          81.3    2e-14   
ref|XP_009619255.1|  PREDICTED: putative F-box protein At1g47730      79.0    4e-14   
ref|XP_010650314.1|  PREDICTED: putative F-box protein At5g52610      80.5    6e-14   
ref|XP_010052511.1|  PREDICTED: putative F-box protein At3g16210 ...  79.3    7e-14   
ref|XP_010052510.1|  PREDICTED: putative F-box protein At3g16210 ...  79.3    9e-14   
emb|CDY37714.1|  BnaA04g19540D                                        78.2    1e-13   
ref|XP_010317786.1|  PREDICTED: putative F-box protein At1g47730      79.0    1e-13   
ref|XP_006279529.1|  hypothetical protein CARUB_v10028190mg           79.0    1e-13   
ref|XP_009141321.1|  PREDICTED: F-box protein At1g30790-like          78.2    1e-13   
ref|XP_006354726.1|  PREDICTED: F-box protein At5g65850-like          77.8    2e-13   
ref|XP_006343419.1|  PREDICTED: putative F-box protein At3g10240-...  77.8    3e-13   
ref|NP_193856.1|  putative F-box protein                              78.2    3e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009609121.1|  PREDICTED: putative F-box protein At1g52480      75.9    5e-13   
gb|KCW86405.1|  hypothetical protein EUGRSUZ_B03075                   77.4    5e-13   
ref|XP_009131893.1|  PREDICTED: F-box protein At1g30790-like          77.0    6e-13   
ref|XP_006393361.1|  hypothetical protein EUTSA_v10011962mg           76.6    8e-13   
ref|XP_010650194.1|  PREDICTED: F-box protein DOR-like                76.3    1e-12   
ref|XP_011012768.1|  PREDICTED: F-box/kelch-repeat protein At3g06...  75.9    1e-12   
ref|XP_002299005.1|  F-box family protein                             76.3    1e-12   Populus trichocarpa [western balsam poplar]
ref|XP_010650199.1|  PREDICTED: F-box protein At5g65850               75.9    1e-12   
ref|XP_011012382.1|  PREDICTED: putative F-box protein At1g32420      76.3    1e-12   
ref|XP_011038127.1|  PREDICTED: putative F-box protein At1g32420      75.9    2e-12   
ref|XP_008804788.1|  PREDICTED: F-box/kelch-repeat protein At3g06...  74.7    2e-12   
ref|XP_010046603.1|  PREDICTED: uncharacterized protein LOC104435576  77.0    2e-12   
ref|XP_010496909.1|  PREDICTED: putative F-box protein At4g21240      75.1    2e-12   
gb|KDP25256.1|  hypothetical protein JCGZ_20412                       75.1    3e-12   
ref|XP_009772624.1|  PREDICTED: putative F-box protein At1g32420      74.7    3e-12   
ref|XP_002876140.1|  hypothetical protein ARALYDRAFT_906605           74.3    6e-12   
ref|XP_007217609.1|  hypothetical protein PRUPE_ppa017043mg           73.9    6e-12   
ref|XP_002532719.1|  ubiquitin-protein ligase, putative               73.9    6e-12   Ricinus communis
ref|NP_190800.1|  putative F-box protein                              73.9    7e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010484937.1|  PREDICTED: F-box protein At1g31080-like          73.9    9e-12   
gb|KFK43310.1|  hypothetical protein AALP_AA1G107800                  73.6    1e-11   
ref|XP_002876155.1|  hypothetical protein ARALYDRAFT_906627           73.6    1e-11   
ref|XP_009119783.1|  PREDICTED: putative F-box protein At4g21240      73.6    1e-11   
ref|XP_006403294.1|  hypothetical protein EUTSA_v10003391mg           73.2    1e-11   
ref|XP_010520304.1|  PREDICTED: F-box protein At1g30790-like isof...  73.2    1e-11   
ref|XP_008391463.1|  PREDICTED: F-box protein CPR30-like              72.8    1e-11   
emb|CDX92334.1|  BnaA10g13730D                                        72.8    2e-11   
ref|XP_002312504.2|  hypothetical protein POPTR_0008s14300g           73.2    2e-11   Populus trichocarpa [western balsam poplar]
ref|XP_010520305.1|  PREDICTED: putative F-box protein At1g53550 ...  73.2    2e-11   
ref|XP_009626748.1|  PREDICTED: putative F-box protein At1g32420      72.4    2e-11   
ref|XP_010520306.1|  PREDICTED: putative F-box protein At1g32660 ...  72.8    2e-11   
ref|XP_011045615.1|  PREDICTED: F-box/kelch-repeat protein At3g06...  72.4    2e-11   
emb|CDY15236.1|  BnaC05g01150D                                        72.4    2e-11   
gb|KCW86406.1|  hypothetical protein EUGRSUZ_B03076                   72.4    2e-11   
ref|XP_008341088.1|  PREDICTED: F-box protein CPR30-like              70.5    3e-11   
ref|XP_010048538.1|  PREDICTED: F-box/kelch-repeat protein At3g06...  72.0    3e-11   
emb|CDX89978.1|  BnaA10g01040D                                        72.4    3e-11   
ref|XP_009120634.1|  PREDICTED: F-box protein At1g30790-like          72.0    3e-11   
gb|KDO49218.1|  hypothetical protein CISIN_1g037535mg                 70.1    3e-11   
ref|XP_009609989.1|  PREDICTED: putative F-box protein At1g50870      71.6    3e-11   
ref|XP_006391500.1|  hypothetical protein EUTSA_v10019615mg           72.0    3e-11   
gb|KFK30034.1|  hypothetical protein AALP_AA7G209000                  71.6    5e-11   
ref|XP_006373076.1|  hypothetical protein POPTR_0017s08480g           71.2    5e-11   
ref|XP_008228271.1|  PREDICTED: F-box protein CPR30-like              71.2    6e-11   
ref|XP_007021323.1|  F-box and associated interaction domains-con...  71.2    6e-11   
gb|EMT01351.1|  hypothetical protein F775_15769                       70.9    7e-11   
ref|XP_007036154.1|  F-box and associated interaction domains-con...  70.9    7e-11   
ref|XP_010519757.1|  PREDICTED: F-box protein DOR-like                71.2    7e-11   
ref|XP_010431562.1|  PREDICTED: F-box protein At2g21930-like          70.9    8e-11   
emb|CDY09166.1|  BnaA02g05920D                                        70.9    8e-11   
ref|XP_006447718.1|  hypothetical protein CICLE_v10015458mg           70.9    9e-11   
ref|XP_006663850.1|  PREDICTED: putative F-box protein At3g52320-...  70.9    9e-11   
ref|XP_009119666.1|  PREDICTED: putative F-box protein At4g21240      70.9    9e-11   
ref|XP_009141209.1|  PREDICTED: F-box protein DOR-like                70.5    1e-10   
ref|XP_010417686.1|  PREDICTED: F-box/kelch-repeat protein At3g04...  70.5    1e-10   
ref|XP_006437454.1|  hypothetical protein CICLE_v10033971mg           70.5    1e-10   
gb|KEH28993.1|  F-box protein interaction domain protein              70.5    1e-10   
ref|XP_006297749.1|  hypothetical protein CARUB_v10013784mg           70.5    1e-10   
ref|XP_009126873.1|  PREDICTED: F-box protein At1g30790-like          70.1    1e-10   
ref|XP_010686915.1|  PREDICTED: F-box protein CPR30-like              70.1    2e-10   
gb|EEE69821.1|  hypothetical protein OsJ_29568                        68.9    2e-10   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003605372.1|  F-box protein                                    69.7    2e-10   
ref|XP_009609120.1|  PREDICTED: putative F-box protein At1g32420      67.8    2e-10   
ref|XP_009372410.1|  PREDICTED: F-box protein CPR30-like              69.3    3e-10   
ref|XP_006393240.1|  hypothetical protein EUTSA_v10012205mg           69.3    3e-10   
ref|NP_193726.1|  F-box/kelch-repeat protein                          69.3    3e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011002219.1|  PREDICTED: F-box protein CPR30-like              68.9    3e-10   
dbj|BAD37944.1|  hypothetical protein                                 68.9    4e-10   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001066235.1|  Os12g0164300                                     68.9    4e-10   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004243873.1|  PREDICTED: F-box/kelch-repeat protein At3g23...  68.9    4e-10   
gb|EAY82372.1|  hypothetical protein OsI_37584                        68.9    4e-10   Oryza sativa Indica Group [Indian rice]
gb|EAZ19750.1|  hypothetical protein OsJ_35328                        68.9    4e-10   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002874089.1|  hypothetical protein ARALYDRAFT_910273           68.9    4e-10   
ref|XP_011043919.1|  PREDICTED: F-box protein CPR30-like              68.9    4e-10   
ref|XP_004292837.1|  PREDICTED: F-box protein At3g07870-like          68.9    4e-10   
gb|ABA95877.2|  F-box protein interaction domain containing prote...  68.9    4e-10   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006366850.1|  PREDICTED: putative F-box protein At1g20657-...  68.6    4e-10   
gb|EEC84670.1|  hypothetical protein OsI_31579                        67.8    5e-10   Oryza sativa Indica Group [Indian rice]
ref|XP_010277878.1|  PREDICTED: F-box protein CPR30-like              68.6    5e-10   
ref|XP_009588485.1|  PREDICTED: F-box protein CPR30-like              68.6    5e-10   
gb|KDO58461.1|  hypothetical protein CISIN_1g047073mg                 68.2    5e-10   
ref|XP_010479100.1|  PREDICTED: F-box protein At1g53790-like isof...  68.6    5e-10   
ref|XP_002308787.1|  hypothetical protein POPTR_0006s01360g           68.6    5e-10   Populus trichocarpa [western balsam poplar]
ref|XP_006413922.1|  hypothetical protein EUTSA_v10025237mg           68.6    5e-10   
ref|XP_010686233.1|  PREDICTED: F-box protein CPR30-like              68.6    5e-10   
ref|XP_010479099.1|  PREDICTED: F-box protein At1g53790-like isof...  68.6    6e-10   
ref|XP_006301974.1|  hypothetical protein CARUB_v10022454mg           68.2    6e-10   
ref|XP_009364321.1|  PREDICTED: F-box/kelch-repeat protein At3g06...  68.2    6e-10   
ref|XP_011028178.1|  PREDICTED: LOW QUALITY PROTEIN: F-box only p...  68.2    7e-10   
ref|XP_003605393.1|  F-box/kelch-repeat protein                       68.2    7e-10   
ref|XP_006393242.1|  hypothetical protein EUTSA_v10012379mg           68.2    7e-10   
ref|XP_006292949.1|  hypothetical protein CARUB_v10019224mg           67.8    8e-10   
ref|XP_006361686.1|  PREDICTED: F-box protein CPR30-like              68.2    8e-10   
ref|XP_006428799.1|  hypothetical protein CICLE_v10011877mg           67.8    8e-10   
ref|XP_006484611.1|  PREDICTED: F-box protein CPR30-like isoform X1   67.8    9e-10   
emb|CDP17261.1|  unnamed protein product                              67.8    9e-10   
ref|XP_007147813.1|  hypothetical protein PHAVU_006G157000g           67.8    9e-10   
gb|KDO44224.1|  hypothetical protein CISIN_1g046902mg                 67.8    9e-10   
ref|XP_010546896.1|  PREDICTED: F-box/kelch-repeat protein At3g06...  67.8    1e-09   
ref|XP_003623090.1|  F-box protein                                    67.4    1e-09   
ref|XP_010264513.1|  PREDICTED: F-box/kelch-repeat protein At3g23...  67.4    1e-09   
emb|CDY15327.1|  BnaC04g42960D                                        67.4    1e-09   
ref|XP_006344513.1|  PREDICTED: F-box protein At1g53790-like          67.0    1e-09   
gb|KDO36510.1|  hypothetical protein CISIN_1g016891mg                 67.0    1e-09   
ref|XP_010044316.1|  PREDICTED: putative F-box protein At1g50870      67.0    1e-09   
ref|XP_006285969.1|  hypothetical protein CARUB_v10007490mg           67.0    2e-09   
ref|XP_003546182.1|  PREDICTED: F-box protein CPR30-like isoform X1   67.0    2e-09   
ref|XP_004486105.1|  PREDICTED: F-box/kelch-repeat protein At3g23...  67.0    2e-09   
ref|XP_006405041.1|  hypothetical protein EUTSA_v10000468mg           67.0    2e-09   
ref|XP_010248476.1|  PREDICTED: F-box protein At3g07870-like          67.0    2e-09   
ref|XP_009339954.1|  PREDICTED: F-box protein At3g07870-like          67.0    2e-09   
ref|XP_006415158.1|  hypothetical protein EUTSA_v10009644mg           66.6    2e-09   
ref|XP_010431565.1|  PREDICTED: F-box protein At2g21930-like          66.6    2e-09   
ref|XP_010501044.1|  PREDICTED: putative F-box protein At1g53370      66.6    2e-09   
ref|XP_010683823.1|  PREDICTED: F-box protein CPR30-like              66.6    2e-09   
ref|XP_004159645.1|  PREDICTED: F-box protein CPR30-like              66.6    2e-09   
ref|XP_002300155.2|  hypothetical protein POPTR_0001s32570g           66.2    3e-09   Populus trichocarpa [western balsam poplar]
ref|XP_010326062.1|  PREDICTED: putative F-box protein At1g50870 ...  66.6    3e-09   
ref|XP_004147498.1|  PREDICTED: F-box protein CPR30-like              66.2    3e-09   
ref|XP_006349972.1|  PREDICTED: F-box/kelch-repeat protein At3g06...  66.2    3e-09   
ref|XP_007023958.1|  F-box family protein                             66.2    3e-09   
gb|KCW54173.1|  hypothetical protein EUGRSUZ_I00151                   66.2    3e-09   
ref|XP_010326068.1|  PREDICTED: putative F-box protein At1g50870 ...  66.2    3e-09   
ref|XP_010030321.1|  PREDICTED: F-box/kelch-repeat protein At3g23...  66.2    3e-09   
emb|CDX88816.1|  BnaA03g08330D                                        66.2    3e-09   
ref|XP_010474403.1|  PREDICTED: F-box protein At2g21930-like          65.5    3e-09   
ref|XP_009791674.1|  PREDICTED: putative F-box protein At1g32420      65.9    3e-09   
ref|XP_009131849.1|  PREDICTED: F-box protein At1g30790-like          66.2    3e-09   
emb|CDP12767.1|  unnamed protein product                              66.2    3e-09   
ref|XP_010686238.1|  PREDICTED: F-box protein CPR30-like              65.9    3e-09   
gb|KHN33084.1|  F-box/kelch-repeat protein                            65.9    3e-09   
ref|XP_007035349.1|  F-box family protein, putative                   66.2    4e-09   
ref|XP_008443403.1|  PREDICTED: F-box protein CPR30-like              65.9    4e-09   
gb|KHN15107.1|  F-box/kelch-repeat protein                            65.9    4e-09   
ref|XP_004252679.2|  PREDICTED: F-box protein At5g65850-like          65.5    4e-09   
ref|XP_006601442.1|  PREDICTED: F-box/kelch-repeat protein At3g23...  65.9    4e-09   
ref|XP_006294273.1|  hypothetical protein CARUB_v10023270mg           65.9    4e-09   
ref|XP_009760177.1|  PREDICTED: F-box/kelch-repeat protein At3g23...  65.9    4e-09   
ref|XP_006294272.1|  hypothetical protein CARUB_v10023270mg           65.9    5e-09   
ref|XP_006597565.1|  PREDICTED: F-box/kelch-repeat protein At3g23...  65.5    5e-09   
ref|XP_003546119.1|  PREDICTED: F-box/kelch-repeat protein At3g23...  65.5    5e-09   
ref|XP_008370996.1|  PREDICTED: F-box protein CPR30-like              65.5    5e-09   
ref|XP_010523116.1|  PREDICTED: putative F-box protein At1g20657      65.5    5e-09   
ref|XP_009596513.1|  PREDICTED: F-box/kelch-repeat protein At3g23...  65.5    5e-09   
ref|XP_010274506.1|  PREDICTED: F-box protein CPR30-like              65.5    6e-09   
ref|XP_010255762.1|  PREDICTED: F-box protein At3g07870-like          65.5    6e-09   
ref|XP_010920812.1|  PREDICTED: F-box/kelch-repeat protein At3g06...  65.5    6e-09   
ref|XP_009358253.1|  PREDICTED: F-box protein At1g30790-like          65.1    6e-09   
ref|XP_006437777.1|  hypothetical protein CICLE_v10033302mg           65.1    6e-09   
ref|XP_010319105.1|  PREDICTED: putative F-box protein At1g47790      63.2    7e-09   
ref|XP_010548778.1|  PREDICTED: F-box/kelch-repeat protein At3g06...  65.1    7e-09   
ref|XP_010546890.1|  PREDICTED: F-box/kelch-repeat protein At3g06...  65.1    7e-09   
ref|XP_010023845.1|  PREDICTED: F-box/kelch-repeat protein At3g06...  65.1    7e-09   
gb|KDO70159.1|  hypothetical protein CISIN_1g017140mg                 65.1    7e-09   
ref|XP_010688549.1|  PREDICTED: F-box protein CPR30-like              63.5    7e-09   
ref|XP_002874091.1|  predicted protein                                64.3    7e-09   
ref|XP_006484376.1|  PREDICTED: F-box protein At1g30790-like          65.1    7e-09   
ref|XP_004486101.1|  PREDICTED: F-box/kelch-repeat protein At3g23...  65.1    7e-09   
ref|XP_008793681.1|  PREDICTED: F-box/kelch-repeat protein At3g06...  65.1    8e-09   
ref|XP_004977725.1|  PREDICTED: uncharacterized protein LOC101783053  65.5    8e-09   
ref|XP_004304889.1|  PREDICTED: F-box/kelch-repeat protein At3g06...  65.1    8e-09   
ref|XP_006421004.1|  hypothetical protein CICLE_v10006809mg           64.7    8e-09   
ref|XP_007047848.1|  F-box family protein, putative                   64.7    8e-09   
ref|XP_010546881.1|  PREDICTED: F-box/kelch-repeat protein At3g06...  65.1    8e-09   
ref|XP_010669281.1|  PREDICTED: F-box/kelch-repeat protein At3g06...  64.7    9e-09   
ref|XP_010324105.1|  PREDICTED: F-box protein CPR30-like              64.7    9e-09   
ref|XP_010431577.1|  PREDICTED: putative F-box protein At1g32420      64.7    9e-09   
ref|XP_009127532.1|  PREDICTED: F-box protein DOR-like                64.7    9e-09   
ref|XP_006599477.1|  PREDICTED: F-box/kelch-repeat protein At3g06...  64.3    9e-09   
ref|XP_007143916.1|  hypothetical protein PHAVU_007G113100g           64.7    9e-09   
ref|XP_002300154.1|  hypothetical protein POPTR_0001s32580g           64.7    1e-08   Populus trichocarpa [western balsam poplar]
ref|XP_002894025.1|  hypothetical protein ARALYDRAFT_336831           64.7    1e-08   
ref|XP_009762226.1|  PREDICTED: F-box/kelch-repeat protein At3g23...  64.7    1e-08   
ref|XP_006280484.1|  hypothetical protein CARUB_v10026421mg           64.7    1e-08   
ref|XP_007211962.1|  hypothetical protein PRUPE_ppa006542mg           64.7    1e-08   
ref|XP_002312730.1|  F-box family protein                             64.7    1e-08   Populus trichocarpa [western balsam poplar]
ref|XP_008227473.1|  PREDICTED: F-box protein CPR30-like              64.3    1e-08   
ref|XP_004305866.1|  PREDICTED: F-box/kelch-repeat protein At3g23...  64.3    1e-08   
ref|NP_001241466.1|  uncharacterized protein LOC100815072             64.3    1e-08   
ref|NP_174520.1|  putative F-box protein                              63.9    1e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007216437.1|  hypothetical protein PRUPE_ppa021853mg           63.9    1e-08   
ref|XP_007032644.1|  S locus F-box protein with the low allelic s...  63.9    2e-08   
ref|XP_010091000.1|  F-box protein                                    63.9    2e-08   
ref|XP_007049216.1|  F-box and associated interaction domains-con...  63.9    2e-08   
ref|XP_010679277.1|  PREDICTED: F-box protein CPR30-like              62.4    2e-08   
ref|XP_006355905.1|  PREDICTED: F-box protein At5g65850-like          63.5    2e-08   
ref|XP_008443401.1|  PREDICTED: F-box protein CPR30-like              63.9    2e-08   
ref|XP_003534732.1|  PREDICTED: F-box protein CPR30-like isoform X1   63.9    2e-08   
ref|XP_010916704.1|  PREDICTED: F-box protein At3g07870-like          63.5    2e-08   
ref|XP_010326072.1|  PREDICTED: putative F-box protein At3g16210 ...  63.2    2e-08   
gb|KDP39340.1|  hypothetical protein JCGZ_01097                       63.5    2e-08   
ref|XP_002880405.1|  hypothetical protein ARALYDRAFT_900620           63.5    2e-08   
ref|XP_007049215.1|  F-box and associated interaction domains-con...  63.5    2e-08   
gb|KHN41302.1|  F-box/kelch-repeat protein                            62.0    3e-08   
ref|XP_006295463.1|  hypothetical protein CARUB_v10024565mg           63.5    3e-08   
emb|CAN70931.1|  hypothetical protein VITISV_034638                   62.8    3e-08   Vitis vinifera
ref|XP_002531022.1|  Transitional endoplasmic reticulum ATPase, p...  63.9    3e-08   Ricinus communis
gb|KDO71683.1|  hypothetical protein CISIN_1g046204mg                 63.5    3e-08   
gb|KDP21618.1|  hypothetical protein JCGZ_03289                       63.2    3e-08   
gb|AIG62970.1|  S-locus F-box protein type-2                          63.5    3e-08   
ref|XP_006281449.1|  hypothetical protein CARUB_v10027527mg           63.5    3e-08   
ref|XP_006404833.1|  hypothetical protein EUTSA_v10000190mg           63.2    3e-08   
sp|Q9SSQ2.1|FB55_ARATH  RecName: Full=F-box protein At1g52490         63.2    3e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006404713.1|  hypothetical protein EUTSA_v10000505mg           63.2    3e-08   
ref|XP_010326063.1|  PREDICTED: putative F-box protein At3g16210 ...  63.2    3e-08   
ref|XP_010326064.1|  PREDICTED: putative F-box protein At3g16210 ...  63.2    3e-08   
ref|XP_002453434.1|  hypothetical protein SORBIDRAFT_04g005990        63.2    3e-08   Sorghum bicolor [broomcorn]
ref|XP_011045685.1|  PREDICTED: F-box/kelch-repeat protein At3g06...  62.8    4e-08   
ref|XP_002869958.1|  hypothetical protein ARALYDRAFT_914664           63.2    4e-08   
ref|XP_010546887.1|  PREDICTED: F-box/kelch-repeat protein At3g06...  63.2    4e-08   
ref|XP_004246756.1|  PREDICTED: putative F-box protein At3g16210 ...  62.8    4e-08   
ref|XP_010665455.1|  PREDICTED: F-box/kelch-repeat protein At3g23...  62.8    4e-08   
ref|XP_002440131.1|  hypothetical protein SORBIDRAFT_09g026600        62.8    4e-08   Sorghum bicolor [broomcorn]
ref|XP_004304895.1|  PREDICTED: F-box/kelch-repeat protein At3g17...  62.8    4e-08   
gb|KDP32919.1|  hypothetical protein JCGZ_13700                       62.8    4e-08   
ref|XP_008384140.1|  PREDICTED: F-box protein CPR30                   62.8    4e-08   
ref|XP_010456489.1|  PREDICTED: F-box/kelch-repeat protein At3g04...  62.8    4e-08   
gb|EAZ44931.1|  hypothetical protein OsJ_29572                        62.8    4e-08   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009352591.1|  PREDICTED: F-box protein CPR30                   62.8    4e-08   
ref|XP_010495266.1|  PREDICTED: putative F-box protein At1g50870      62.8    4e-08   
ref|XP_006300070.1|  hypothetical protein CARUB_v10016298mg           62.8    5e-08   
ref|XP_010468006.1|  PREDICTED: F-box/kelch-repeat protein At3g04...  62.8    5e-08   
ref|XP_010100313.1|  F-box protein                                    62.8    5e-08   
gb|KFK31211.1|  hypothetical protein AALP_AA6G082400                  62.8    5e-08   
gb|AIG62971.1|  S-locus F-box protein type-2                          62.4    5e-08   
ref|XP_006419563.1|  hypothetical protein CICLE_v10006995mg           62.4    5e-08   
ref|XP_006406621.1|  hypothetical protein EUTSA_v10022123mg           62.4    5e-08   
ref|XP_010067995.1|  PREDICTED: uncharacterized protein LOC104454805  62.8    5e-08   
ref|XP_010467413.1|  PREDICTED: F-box only protein 8-like             62.4    5e-08   
ref|XP_004252041.2|  PREDICTED: F-box protein At3g07870-like          62.4    6e-08   
ref|XP_010451172.1|  PREDICTED: putative F-box protein At4g21240      62.4    6e-08   
ref|XP_007039036.1|  F-box family protein, putative                   62.4    6e-08   
ref|XP_006489261.1|  PREDICTED: F-box/kelch-repeat protein At3g06...  62.4    6e-08   
ref|XP_009611723.1|  PREDICTED: F-box protein CPR30-like              60.8    6e-08   
ref|XP_010480341.1|  PREDICTED: F-box protein DOR-like                60.8    6e-08   
ref|NP_001063316.2|  Os09g0448100                                     62.4    7e-08   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009137026.1|  PREDICTED: F-box/kelch-repeat protein At4g19...  62.4    7e-08   
emb|CDY34481.1|  BnaC04g13180D                                        62.0    7e-08   
ref|XP_006358426.1|  PREDICTED: F-box/kelch-repeat protein At3g23...  62.0    7e-08   
ref|XP_009113693.1|  PREDICTED: putative F-box protein At1g50870 ...  60.8    7e-08   
ref|XP_010312919.1|  PREDICTED: F-box/kelch-repeat protein At3g06...  61.2    7e-08   
ref|XP_009796154.1|  PREDICTED: F-box/kelch-repeat protein At3g06...  62.0    7e-08   
ref|XP_007049214.1|  F-box and associated interaction domains-con...  62.0    7e-08   
ref|XP_006430979.1|  hypothetical protein CICLE_v10012020mg           62.0    7e-08   
ref|XP_009123657.1|  PREDICTED: F-box protein At1g53790 isoform X2    62.0    7e-08   
ref|NP_175904.1|  putative F-box protein                              62.0    7e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011009039.1|  PREDICTED: F-box/kelch-repeat protein At3g23...  62.0    8e-08   
ref|XP_009137020.1|  PREDICTED: F-box protein At4g19940-like          62.0    8e-08   
ref|XP_010418673.1|  PREDICTED: putative F-box protein At3g23960      62.0    8e-08   
ref|XP_010023677.1|  PREDICTED: F-box/kelch-repeat protein At3g06...  62.0    8e-08   
gb|KDO38301.1|  hypothetical protein CISIN_1g017748mg                 62.0    8e-08   
ref|XP_006366636.1|  PREDICTED: F-box protein CPR30-like              62.0    8e-08   
ref|XP_009592062.1|  PREDICTED: putative F-box protein At1g32420      61.2    8e-08   
ref|XP_006489260.1|  PREDICTED: F-box/kelch-repeat protein At3g23...  62.0    8e-08   
ref|XP_010424060.1|  PREDICTED: F-box/kelch-repeat protein At3g04...  61.2    9e-08   
ref|XP_010419260.1|  PREDICTED: F-box protein At2g21930-like          60.8    9e-08   
ref|XP_006447715.1|  hypothetical protein CICLE_v10015426mg           62.0    9e-08   
ref|XP_008360760.1|  PREDICTED: F-box/kelch-repeat protein At3g06...  61.6    9e-08   
ref|XP_009144184.1|  PREDICTED: F-box protein At5g65850-like          61.6    1e-07   
gb|KDO71685.1|  hypothetical protein CISIN_1g037927mg                 61.6    1e-07   
ref|XP_006409386.1|  hypothetical protein EUTSA_v10023110mg           61.2    1e-07   
ref|NP_001065424.1|  Os10g0566300                                     61.6    1e-07   
emb|CDP21478.1|  unnamed protein product                              60.1    1e-07   
ref|XP_010686908.1|  PREDICTED: F-box protein CPR30-like              61.6    1e-07   
emb|CAN60955.1|  hypothetical protein VITISV_008877                   61.2    1e-07   
gb|KDO58464.1|  hypothetical protein CISIN_1g015251mg                 61.6    1e-07   
ref|XP_009113692.1|  PREDICTED: putative F-box protein At1g50870 ...  60.8    1e-07   
ref|XP_006415391.1|  hypothetical protein EUTSA_v10009932mg           61.6    1e-07   
gb|AES79309.2|  F-box protein interaction domain protein              61.6    1e-07   
ref|XP_003623091.1|  F-box/kelch-repeat protein                       61.6    1e-07   
ref|XP_002886496.1|  hypothetical protein ARALYDRAFT_893290           61.6    1e-07   
gb|EEC84673.1|  hypothetical protein OsI_31582                        61.6    1e-07   
ref|XP_006304938.1|  hypothetical protein CARUB_v10012023mg           61.6    1e-07   
ref|XP_009605142.1|  PREDICTED: F-box/kelch-repeat protein At3g23...  61.6    1e-07   
ref|XP_011006067.1|  PREDICTED: F-box/kelch-repeat protein At3g23...  61.6    1e-07   
ref|XP_009123656.1|  PREDICTED: F-box protein At1g53790 isoform X1    61.6    1e-07   
ref|XP_009124318.1|  PREDICTED: putative F-box protein At1g47790      61.2    1e-07   
ref|XP_009597313.1|  PREDICTED: F-box only protein 8-like             61.6    1e-07   
ref|XP_006585849.1|  PREDICTED: F-box/kelch-repeat protein At3g23...  61.2    1e-07   
gb|AIG62944.1|  S-locus F-box protein type-2                          61.2    1e-07   
dbj|BAJ52237.1|  hypothetical protein                                 61.2    1e-07   
ref|XP_006492797.1|  PREDICTED: F-box protein CPR30-like              61.2    1e-07   
ref|XP_009392077.1|  PREDICTED: F-box/kelch-repeat protein At3g06...  61.2    1e-07   
gb|KDO53808.1|  hypothetical protein CISIN_1g043816mg                 61.2    1e-07   
emb|CDY08063.1|  BnaC03g34600D                                        61.2    1e-07   
emb|CDY30661.1|  BnaC06g10250D                                        60.1    1e-07   
ref|XP_006575809.1|  PREDICTED: F-box/kelch-repeat protein At3g23...  59.7    1e-07   
ref|XP_010464190.1|  PREDICTED: F-box/kelch-repeat protein At3g06...  61.2    1e-07   
dbj|BAJ11967.1|  MdFBX19                                              61.2    2e-07   
ref|XP_006487903.1|  PREDICTED: F-box protein CPR30-like              61.2    2e-07   
ref|XP_006352014.1|  PREDICTED: F-box protein At3g07870-like          61.2    2e-07   
ref|XP_004293251.1|  PREDICTED: F-box/kelch-repeat protein At3g06...  60.8    2e-07   
gb|KEH33428.1|  F-box protein interaction domain protein              61.2    2e-07   
ref|XP_010546886.1|  PREDICTED: F-box/kelch-repeat protein At3g06...  60.8    2e-07   
ref|XP_002877869.1|  hypothetical protein ARALYDRAFT_906625           60.5    2e-07   
ref|XP_002873533.1|  hypothetical protein ARALYDRAFT_909156           60.8    2e-07   
ref|XP_006413659.1|  hypothetical protein EUTSA_v10026850mg           60.8    2e-07   
ref|XP_006297737.1|  hypothetical protein CARUB_v10013770mg           60.8    2e-07   
ref|XP_006415204.1|  hypothetical protein EUTSA_v10007859mg           60.8    2e-07   
ref|XP_006415425.1|  hypothetical protein EUTSA_v10009419mg           60.8    2e-07   
ref|XP_010648950.1|  PREDICTED: LOW QUALITY PROTEIN: F-box protei...  60.8    2e-07   
ref|XP_009335885.1|  PREDICTED: F-box/kelch-repeat protein At3g23...  60.8    2e-07   
emb|CDY58343.1|  BnaA03g57440D                                        60.8    2e-07   
ref|XP_010056473.1|  PREDICTED: F-box/kelch-repeat protein At3g06...  60.8    2e-07   
ref|XP_009117144.1|  PREDICTED: putative F-box protein At3g52320      60.8    2e-07   
ref|XP_002888154.1|  hypothetical protein ARALYDRAFT_893536           60.8    2e-07   
emb|CDY72619.1|  BnaAnng41690D                                        60.8    2e-07   
ref|XP_009134878.1|  PREDICTED: F-box/kelch-repeat protein At3g06...  60.8    2e-07   
ref|XP_007049219.1|  F-box and associated interaction domains-con...  60.8    2e-07   
ref|XP_006358449.1|  PREDICTED: F-box/kelch-repeat protein At3g23...  60.5    2e-07   
gb|KCW62667.1|  hypothetical protein EUGRSUZ_G00214                   60.5    2e-07   
gb|EMT31257.1|  hypothetical protein F775_21728                       60.5    2e-07   
ref|XP_010108722.1|  F-box/kelch-repeat protein                       60.5    2e-07   
ref|XP_006374099.1|  hypothetical protein POPTR_0015s01340g           59.7    2e-07   
ref|XP_006305072.1|  hypothetical protein CARUB_v10009440mg           60.5    3e-07   
ref|XP_009150782.1|  PREDICTED: F-box/kelch-repeat protein At4g19...  60.5    3e-07   
ref|XP_009613911.1|  PREDICTED: F-box protein At3g07870-like          60.5    3e-07   
gb|AFJ21663.1|  F-box protein                                         60.5    3e-07   
ref|XP_010431563.1|  PREDICTED: F-box protein At2g21930-like          60.5    3e-07   
emb|CDY09167.1|  BnaA02g05930D                                        60.5    3e-07   
ref|XP_010672220.1|  PREDICTED: F-box protein CPR30-like              60.5    3e-07   
ref|XP_006413270.1|  hypothetical protein EUTSA_v10026790mg           60.5    3e-07   
ref|XP_011097347.1|  PREDICTED: F-box protein At3g07870-like          60.1    3e-07   
ref|XP_002890990.1|  F-box family protein                             60.1    3e-07   
gb|KFK31162.1|  hypothetical protein AALP_AA6G076700                  60.1    3e-07   
gb|KCW80811.1|  hypothetical protein EUGRSUZ_C02180                   59.7    3e-07   
gb|KDP40079.1|  hypothetical protein JCGZ_02077                       60.1    3e-07   
ref|XP_003599499.1|  F-box protein                                    60.5    3e-07   
gb|KFK44888.1|  hypothetical protein AALP_AA1G315900                  60.1    3e-07   
emb|CDX88781.1|  BnaA03g08680D                                        60.1    3e-07   
ref|XP_006358425.1|  PREDICTED: F-box/kelch-repeat protein At3g23...  60.1    3e-07   
ref|XP_002870349.1|  hypothetical protein ARALYDRAFT_915515           60.1    4e-07   
gb|KDP40213.1|  hypothetical protein JCGZ_02211                       60.1    4e-07   
ref|XP_006424213.1|  hypothetical protein CICLE_v10028697mg           60.1    4e-07   
ref|XP_009149664.1|  PREDICTED: putative F-box protein At1g50870      59.7    4e-07   
ref|XP_010101627.1|  Putative F-box protein                           60.1    4e-07   
ref|XP_009132266.1|  PREDICTED: F-box protein At1g30790-like          59.3    4e-07   
ref|XP_010270137.1|  PREDICTED: F-box/kelch-repeat protein At3g06...  60.1    4e-07   
ref|XP_007206268.1|  hypothetical protein PRUPE_ppa016207mg           59.7    4e-07   
ref|XP_009102165.1|  PREDICTED: F-box protein At1g30790-like          59.7    4e-07   
ref|XP_010067990.1|  PREDICTED: F-box protein DOR-like                60.1    4e-07   
ref|XP_002882368.1|  hypothetical protein ARALYDRAFT_896506           59.7    4e-07   
emb|CDY47732.1|  BnaA02g16630D                                        59.7    4e-07   
ref|XP_006415372.1|  hypothetical protein EUTSA_v10009588mg           59.7    4e-07   
emb|CDY42382.1|  BnaA08g00320D                                        59.7    4e-07   
ref|XP_006419562.1|  hypothetical protein CICLE_v10006734mg           59.7    4e-07   
ref|XP_010048539.1|  PREDICTED: F-box/kelch-repeat protein At3g06...  59.7    4e-07   
ref|XP_006416297.1|  hypothetical protein EUTSA_v10009934mg           59.7    4e-07   
ref|XP_010650357.1|  PREDICTED: F-box protein At5g65850-like          59.7    4e-07   
ref|XP_006373085.1|  hypothetical protein POPTR_0017s08560g           59.7    4e-07   
ref|XP_010466551.1|  PREDICTED: F-box protein At1g47810-like          59.7    5e-07   
gb|KEH31907.1|  F-box protein interaction domain protein              59.7    5e-07   
gb|AES91195.2|  F-box protein interaction domain protein              59.7    5e-07   
ref|XP_003637494.1|  F-box protein                                    59.7    5e-07   
ref|XP_003594230.1|  F-box protein                                    59.7    5e-07   
ref|XP_009148178.1|  PREDICTED: F-box protein DOR-like                59.7    5e-07   
ref|XP_006301539.1|  hypothetical protein CARUB_v10021972mg           59.7    5e-07   
gb|KEH31908.1|  F-box protein interaction domain protein              59.7    5e-07   
ref|XP_008223140.1|  PREDICTED: F-box/kelch-repeat protein At3g23...  59.7    5e-07   
ref|XP_003615598.1|  F-box/kelch-repeat protein                       59.7    5e-07   
ref|XP_006437451.1|  hypothetical protein CICLE_v10033888mg           59.7    5e-07   
ref|XP_006484612.1|  PREDICTED: F-box protein CPR30-like              59.3    6e-07   
ref|XP_009589614.1|  PREDICTED: putative F-box protein At1g47790 ...  58.5    6e-07   
ref|XP_008443617.1|  PREDICTED: F-box protein CPR30-like              59.3    6e-07   
ref|XP_010431681.1|  PREDICTED: putative F-box protein At2g19630      59.3    6e-07   
ref|XP_009630555.1|  PREDICTED: F-box/kelch-repeat protein At3g06...  59.3    6e-07   
ref|XP_009785094.1|  PREDICTED: F-box/kelch-repeat protein At3g23...  58.9    6e-07   
gb|AIG62908.1|  S-locus F-box protein type-1                          59.3    6e-07   
dbj|BAJ11961.1|  MdFBX13                                              59.3    7e-07   
ref|XP_009376440.1|  PREDICTED: F-box protein At3g07870-like          59.3    7e-07   
gb|AIG62920.1|  S-locus F-box protein type-1                          59.3    7e-07   
emb|CDP01467.1|  unnamed protein product                              58.5    7e-07   
ref|XP_008449401.1|  PREDICTED: F-box protein CPR30-like              59.3    7e-07   
ref|XP_008449399.1|  PREDICTED: F-box protein CPR30-like              59.3    7e-07   
ref|XP_011095318.1|  PREDICTED: F-box protein At1g30790-like          59.3    7e-07   
ref|XP_007207569.1|  hypothetical protein PRUPE_ppa018669mg           59.3    7e-07   
gb|KEH22768.1|  F-box protein interaction domain protein              59.3    7e-07   
ref|XP_010446451.1|  PREDICTED: putative F-box protein At4g38870      59.3    8e-07   
ref|XP_009785095.1|  PREDICTED: F-box/kelch-repeat protein At3g23...  58.5    8e-07   
ref|XP_010462512.1|  PREDICTED: putative F-box protein At4g21240      58.9    8e-07   
ref|XP_004231348.2|  PREDICTED: F-box/kelch-repeat protein At3g06...  58.9    8e-07   
ref|XP_004253287.1|  PREDICTED: F-box/kelch-repeat protein At3g23...  59.3    8e-07   
ref|XP_003609004.1|  F-box/kelch-repeat protein                       59.3    8e-07   
ref|XP_009122876.1|  PREDICTED: putative F-box protein At1g47790      58.9    8e-07   
ref|NP_201072.1|  putative F-box protein                              58.9    8e-07   
ref|XP_002320506.1|  F-box family protein                             58.9    9e-07   
ref|XP_010312813.1|  PREDICTED: F-box protein At3g07870-like          58.9    9e-07   
emb|CDY15352.1|  BnaC04g42710D                                        58.9    9e-07   
ref|XP_002882369.1|  hypothetical protein ARALYDRAFT_896507           58.9    9e-07   
gb|KEH34030.1|  F-box protein interaction domain protein              58.9    9e-07   
gb|AIG62943.1|  S-locus F-box protein type-1                          58.9    9e-07   
ref|XP_006341885.1|  PREDICTED: F-box protein CPR30-like              58.9    9e-07   
gb|AES64644.2|  F-box protein interaction domain protein              58.9    9e-07   
ref|XP_006301435.1|  hypothetical protein CARUB_v10021853mg           58.9    9e-07   
gb|ABE27177.1|  F-box 2                                               58.9    1e-06   
ref|XP_006586599.1|  PREDICTED: F-box/kelch-repeat protein At3g23...  58.9    1e-06   
ref|XP_009144183.1|  PREDICTED: putative F-box protein At2g19630      58.5    1e-06   
ref|XP_010678724.1|  PREDICTED: putative F-box protein At5g50220      58.5    1e-06   
ref|XP_010059025.1|  PREDICTED: F-box/kelch-repeat protein At3g23...  58.5    1e-06   
emb|CDY46913.1|  BnaA09g12810D                                        58.5    1e-06   
ref|XP_007026273.1|  F-box and associated interaction domains-con...  58.5    1e-06   
gb|AES98540.2|  F-box protein interaction domain protein              58.5    1e-06   
ref|XP_006341328.1|  PREDICTED: F-box/kelch-repeat protein At3g23...  58.5    1e-06   
ref|XP_010456851.1|  PREDICTED: F-box protein At1g30790-like          58.2    1e-06   
ref|XP_010425323.1|  PREDICTED: F-box protein At1g30790-like          58.5    1e-06   
ref|XP_010059744.1|  PREDICTED: F-box protein CPR30-like              58.5    1e-06   
ref|XP_010495152.1|  PREDICTED: F-box/kelch-repeat protein At3g04...  58.5    1e-06   
emb|CDX85577.1|  BnaA02g02360D                                        58.5    1e-06   
ref|XP_003608998.1|  F-box protein                                    58.9    1e-06   
ref|XP_011077554.1|  PREDICTED: F-box/kelch-repeat protein At3g23...  58.5    1e-06   
gb|ABE27176.1|  F-box 1                                               57.0    1e-06   
ref|XP_003599498.1|  F-box/kelch-repeat protein                       58.5    1e-06   
ref|XP_009613187.1|  PREDICTED: F-box protein At3g07870-like isof...  58.5    1e-06   
ref|XP_003615582.1|  F-box/kelch-repeat protein                       58.5    1e-06   
gb|KEH23076.1|  F-box protein interaction domain protein              58.5    1e-06   
gb|KEH34308.1|  F-box protein interaction domain protein              58.5    1e-06   
ref|XP_008364742.1|  PREDICTED: F-box/kelch-repeat protein At3g06...  58.5    1e-06   
ref|XP_004491295.1|  PREDICTED: F-box protein CPR30-like              58.5    1e-06   
ref|XP_009380221.1|  PREDICTED: F-box only protein 8-like isoform X4  58.5    1e-06   
ref|XP_009588872.1|  PREDICTED: F-box protein At3g07870-like          58.5    1e-06   
ref|XP_009589613.1|  PREDICTED: F-box/kelch-repeat protein At3g06...  58.2    1e-06   
ref|XP_009630551.1|  PREDICTED: F-box/kelch-repeat protein At3g06...  58.5    1e-06   
ref|XP_009113058.1|  PREDICTED: putative F-box protein At1g47790      58.5    1e-06   
ref|XP_006404139.1|  hypothetical protein EUTSA_v10011009mg           58.5    1e-06   
ref|XP_009613702.1|  PREDICTED: F-box protein At3g07870-like isof...  58.5    1e-06   
ref|XP_010460917.1|  PREDICTED: F-box only protein 12-like isofor...  58.5    1e-06   
ref|XP_010438750.1|  PREDICTED: putative F-box protein At4g21240      58.5    1e-06   
emb|CAN60954.1|  hypothetical protein VITISV_008876                   58.9    1e-06   
gb|EMT05155.1|  hypothetical protein F775_03153                       58.5    1e-06   
ref|XP_007214785.1|  hypothetical protein PRUPE_ppa022751mg           58.5    1e-06   
emb|CDY47318.1|  BnaAnng08920D                                        58.2    1e-06   
emb|CDY72470.1|  BnaCnng77820D                                        58.2    1e-06   
ref|XP_010546895.1|  PREDICTED: F-box/kelch-repeat protein At3g06...  58.2    1e-06   
ref|XP_008368690.1|  PREDICTED: LOW QUALITY PROTEIN: putative F-b...  58.2    1e-06   
ref|XP_008390785.1|  PREDICTED: F-box protein At3g07870-like          58.2    1e-06   
ref|XP_006285026.1|  hypothetical protein CARUB_v10006333mg           58.2    1e-06   
gb|AIG62921.1|  S-locus F-box protein type-2                          58.2    1e-06   
ref|XP_010472191.1|  PREDICTED: F-box protein At2g21930-like          58.2    1e-06   
ref|XP_002525780.1|  ubiquitin-protein ligase, putative               58.2    1e-06   
gb|EYU43573.1|  hypothetical protein MIMGU_mgv1a023819mg              58.2    1e-06   
ref|XP_004303328.1|  PREDICTED: F-box protein At3g07870-like          58.2    1e-06   
ref|XP_008227015.1|  PREDICTED: F-box/kelch-repeat protein At3g06...  58.2    1e-06   
gb|AIG62909.1|  S-locus F-box protein type-2                          58.2    2e-06   
ref|XP_009107031.1|  PREDICTED: F-box/LRR-repeat protein At2g4092...  58.2    2e-06   
ref|XP_010321175.1|  PREDICTED: putative F-box protein At1g32420      58.2    2e-06   
ref|XP_009761524.1|  PREDICTED: putative F-box protein At1g30920      57.4    2e-06   
gb|KDP42173.1|  hypothetical protein JCGZ_02903                       58.2    2e-06   
ref|XP_006289740.1|  hypothetical protein CARUB_v10003308mg           58.2    2e-06   
ref|XP_010665779.1|  PREDICTED: F-box protein CPR30-like isoform X2   58.2    2e-06   
ref|XP_010026698.1|  PREDICTED: F-box/kelch-repeat protein At3g06...  58.2    2e-06   
ref|XP_010480782.1|  PREDICTED: F-box protein At3g57590-like          58.2    2e-06   
dbj|BAJ52234.1|  hypothetical protein                                 58.2    2e-06   
gb|ABD85473.1|  S2-locus F-box                                        58.2    2e-06   
ref|XP_006424224.1|  hypothetical protein CICLE_v10030112mg           58.2    2e-06   
ref|XP_002864982.1|  F-box family protein                             58.2    2e-06   
ref|XP_010669497.1|  PREDICTED: F-box/kelch-repeat protein At3g23...  58.2    2e-06   
ref|XP_010665777.1|  PREDICTED: F-box protein CPR30-like isoform X1   58.2    2e-06   
ref|XP_006366472.1|  PREDICTED: putative F-box protein At3g10240-...  57.8    2e-06   
emb|CDX78592.1|  BnaA03g05040D                                        58.2    2e-06   
gb|ADD09580.1|  galactose oxidase                                     57.8    2e-06   
ref|XP_006305945.1|  hypothetical protein CARUB_v10011186mg           58.2    2e-06   
ref|XP_003601558.1|  F-box protein                                    58.2    2e-06   
ref|XP_009380217.1|  PREDICTED: F-box protein At3g07870-like isof...  58.2    2e-06   
ref|XP_009380218.1|  PREDICTED: F-box protein At3g07870-like isof...  57.8    2e-06   
ref|XP_009380215.1|  PREDICTED: F-box protein At3g07870-like isof...  57.8    2e-06   
emb|CDX69639.1|  BnaA10g19880D                                        57.8    2e-06   
ref|XP_009782366.1|  PREDICTED: F-box protein At5g62510-like          57.8    2e-06   
emb|CDY71509.1|  BnaUnng04390D                                        57.8    2e-06   
ref|XP_009126330.1|  PREDICTED: F-box protein At4g11590-like          57.8    2e-06   



>ref|XP_006350130.1| PREDICTED: putative F-box protein At1g47790-like [Solanum tuberosum]
Length=360

 Score =   106 bits (265),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 72/208 (35%), Positives = 111/208 (53%), Gaps = 32/208 (15%)
 Frame = +2

Query  95   LPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTH--PSRMRILILY  268
            +P E+++EI+ KLP KSL++FKCVSK FYSL+ D  F + H+   +T    +R R+    
Sbjct  11   IPGELVIEILKKLPVKSLMKFKCVSKSFYSLISDPFFIESHQKSYMTQFFVNRPRMT---  67

Query  269  PVLWRDRNFTNFNWYYTINYSEENQGNLQANRLQYFDHNPNLFRKVYLSSSLNGLICFCR  448
                          YY ++ +EE   +L    L+Y D   + F+ +    S NGL+C   
Sbjct  68   --------------YYRLSKNEERDEDLATCPLEYLDQ--SCFQNLRYMQSTNGLVCL--  109

Query  449  FSDRSDEIAIHNLSTRQHIPLPSNCHYDGSCKMNAFGLLGFDSGSRRYKVLKSVEFTTGD  628
            ++D  D IAI N   +QH+ LP   H     K + F  +GFD+ ++R+KV  +  F  G 
Sbjct  110  WNDLGD-IAICNPFIKQHVFLPCQQH-----KGSTFYAIGFDTTTKRHKVFNAEIFRGGK  163

Query  629  SVSVKHWVFTVGVDKSWRKIHSSPYYHP  712
             +     +FT+G+DKSWR+I S   + P
Sbjct  164  LICS---IFTIGIDKSWREICSCINFRP  188



>ref|XP_010314076.1| PREDICTED: putative F-box protein At1g32420 [Solanum lycopersicum]
Length=356

 Score =   100 bits (250),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 72/208 (35%), Positives = 111/208 (53%), Gaps = 32/208 (15%)
 Frame = +2

Query  95   LPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTH--PSRMRILILY  268
            +P E++VEI+ KLPAKSL++FKCVSK F SL+ D SF + H+   +T    +R+R+    
Sbjct  11   IPDELIVEILRKLPAKSLMKFKCVSKSFNSLMSDPSFIESHQKSYMTEFFINRLRME---  67

Query  269  PVLWRDRNFTNFNWYYTINYSEENQGNLQANRLQYFDHNPNLFRKVYLSSSLNGLICFCR  448
                          YY ++ ++E+   L    L+Y D   + FR +    S NGL+C   
Sbjct  68   --------------YYRLSKTDEDL--LSTCPLEYLDQ--SCFRNLKCMQSTNGLVCLW-  108

Query  449  FSDRSDEIAIHNLSTRQHIPLPSNCHYDGSCKMNAFGLLGFDSGSRRYKVLKSVEFTTGD  628
              +   +IAI N   +QHI LP   HY  +     +  +GFD  ++ +KV K  E    +
Sbjct  109  --NNHGDIAICNPFIKQHIFLPRQQHYSRT----IYAGIGFDPTTKTHKVFK--EEIIFE  160

Query  629  SVSVKHWVFTVGVDKSWRKIHSSPYYHP  712
            S  V + +FT+G+DKSWR+I+    + P
Sbjct  161  SGKVMYSIFTIGIDKSWREINGWINFRP  188



>ref|XP_010326852.1| PREDICTED: putative F-box protein At1g32420 [Solanum lycopersicum]
Length=360

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 75/206 (36%), Positives = 103/206 (50%), Gaps = 27/206 (13%)
 Frame = +2

Query  98   PQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYPVL  277
            P+EI+ EI S LP KSLV+F+CVSK  YSL+++  F D H   S+T     + L+     
Sbjct  11   PEEIIFEIFSWLPVKSLVQFRCVSKKIYSLILEPDFVDTHHRRSMTRDGGTKFLL-----  65

Query  278  WRDRNFTNFNWYYTINYSEENQGNLQANRLQYFDHNPNLFRKVYLSSSLNGLICFCRFSD  457
               R    F   YTI  +E+ +          +  NPN  R  Y+  + NGL  FC + D
Sbjct  66   ---RKIEGF---YTIKRNEDEKT---------YKWNPN-NRYDYVMYA-NGL--FCMWKD  106

Query  458  RSDEIAIHNLSTRQHIPLPSNCHYDGSCKMNAFGL-LGFDSGSRRYKVLKSVEFTTGDSV  634
              +   I N STR+ I LP N     S     +   LG++   +RYKVL + EF  G S 
Sbjct  107  NVETPRIWNPSTREVILLP-NLRCGSSIHPLTYNYSLGYEPEEKRYKVLMTQEFKRG-SR  164

Query  635  SVKHWVFTVGVDKSWRKIHSSPYYHP  712
              K WV T+ +DK WR+I S   + P
Sbjct  165  PTKSWVLTLSIDKEWREIESMIDFVP  190



>ref|XP_009797070.1| PREDICTED: putative F-box protein At4g21240 [Nicotiana sylvestris]
Length=246

 Score = 94.4 bits (233),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 73/212 (34%), Positives = 113/212 (53%), Gaps = 25/212 (12%)
 Frame = +2

Query  95   LPQEILVEIVSKL-PAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYP  271
            +P EI+ +I+ ++ P KSL+RF+CVSK F SL+    F + H+           +++ +P
Sbjct  16   IPLEIIFDILIRVVPVKSLLRFRCVSKSFCSLISQPLFIETHQKTCFA----AELIVSFP  71

Query  272  VLWRDRNFTNFNWYYTINYSEENQGNLQANRLQYFDHNPNLFRKVYLSSSLNGLICFCRF  451
             L    +FT     Y +    E+ G  QA   QY   N   F K+    S+NGL+C   +
Sbjct  72   SL----SFTRKVIIYKLVQKLED-GKFQAFPFQYL--NAPCFCKLDSLESINGLVCL--W  122

Query  452  SDRSDEIAIHNLSTRQHIPLPSNC---HYDGSCKMNAFGLLGFDSGSRRYKVLKS--VEF  616
            +D  D +AI N  T+ H+ LP +    HY    +      LG+D  +++YKVLK   VE 
Sbjct  123  NDNED-VAIINPFTKYHVFLPKSTERFHYSTFTRC----FLGYDPSTKKYKVLKVDLVED  177

Query  617  TTGDSVSVKHWVFTVGVDKSWRKIHSSPYYHP  712
              G    VKHW+F++G+D+SWR+IH   ++ P
Sbjct  178  EKG-HYKVKHWIFSLGIDESWREIHGWDHFFP  208



>ref|XP_009617122.1| PREDICTED: F-box protein At1g30790-like, partial [Nicotiana tomentosiformis]
Length=377

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 67/209 (32%), Positives = 109/209 (52%), Gaps = 18/209 (9%)
 Frame = +2

Query  92   FLPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYP  271
            ++P EI+ EI+ ++PAKSL+RF+C+SK+F SL+ + SF + H      H + +   ++  
Sbjct  24   YIPNEIVFEIMKRVPAKSLMRFRCISKYFCSLISEPSFIEAH------HKTFVSQFLVSH  77

Query  272  VLWRDRNFTNFNWYYTINYSEENQGNLQANRLQYFDHNPNLFRKVYLSSSLNGLICFCRF  451
            V     N T     Y ++  EE Q    A  ++Y D     FR +    S+NGLIC   +
Sbjct  78   V-----NSTEKEVIYKLSEREEYQD--LACPIEYLDE--PCFRILPYMQSINGLICLWNW  128

Query  452  SDRSDEIAIHNLSTRQHIPLPSNCHYDGSCKMNAFGLLGFDSGSRRYKVLKSVEFTTGDS  631
                 ++AI N  T++HI LP     +      +    GFD  ++++K+L S   +  + 
Sbjct  129  ---EGDVAICNPFTKEHIFLPRIYLREKVLSSISTYSFGFDPTTKKHKILMSDITSIEEK  185

Query  632  VSVKHWVFTVGVDKSWRKIHSSPYYHPYN  718
            +  K+W+FT+ VDK WRKI +     P N
Sbjct  186  LVAKYWIFTIVVDKWWRKISNWAEIIPMN  214



>ref|XP_009596418.1| PREDICTED: putative F-box protein At1g32420, partial [Nicotiana 
tomentosiformis]
Length=274

 Score = 92.4 bits (228),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 68/213 (32%), Positives = 107/213 (50%), Gaps = 43/213 (20%)
 Frame = +2

Query  95   LPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYPV  274
            +P EI+ EI+ ++PAKSL+RF+CVSK F SL+ +  F + H+ +S               
Sbjct  14   IPYEIIFEILKEVPAKSLMRFRCVSKSFCSLISEPLFIEAHQKFSTAQ------------  61

Query  275  LWRDRNFTNFNWYYTINYSEENQGNLQANRLQYFDHNPNLFRKVYLSSSLNGLICFCRFS  454
                     F+   T   + EN        +QYF  N + F K++  +S NGL+C   F 
Sbjct  62   ---------FHVSCTSLTTRENV-------IQYF--NQSRFSKLHSLASTNGLVCLWNFY  103

Query  455  DRSDEIAIHNLSTRQHIPLPSNCHYDGSCKMNAFGLLGFDSGSRRYKVLKSVEFTTGD--  628
                ++A+ N  T++HI LP+       C       LGFD  +++YKV+K+ ++   D  
Sbjct  104  G---DVAVCNPFTQEHIFLPNQQPSITCCS------LGFDPTTKKYKVIKA-QYMLEDRD  153

Query  629  -SVSVKHWVFTVGVDKSWRKIHSSPYYHPYNGF  724
             S  V++W++T+GVDK WR+I       P   F
Sbjct  154  YSCKVRYWIYTIGVDKLWREIPDCANIFPIYNF  186



>ref|XP_009779041.1| PREDICTED: putative F-box protein At1g32420 [Nicotiana sylvestris]
Length=352

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 66/213 (31%), Positives = 103/213 (48%), Gaps = 42/213 (20%)
 Frame = +2

Query  95   LPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYPV  274
            +P EI+ EI+ K+P KSL+RF+CVSK F SL+ +  F + H+  S               
Sbjct  14   IPHEIIFEILKKIPVKSLMRFRCVSKSFCSLISEPLFIEAHQKLSTAQ------------  61

Query  275  LWRDRNFTNFNWYYTINYSEENQGNLQANRLQYFDHNPNLFRKVYLSSSLNGLICFCRFS  454
                         + ++ S       + N +QYF  N + F K++  +S NGL+C   F 
Sbjct  62   -------------FHVSCSSLAT---RENVIQYF--NQSRFSKLHSLASTNGLVCLWNFY  103

Query  455  DRSDEIAIHNLSTRQHIPLPSNCHYDGSCKMNAFGLLGFDSGSRRYKVLKSVEFTTGD--  628
                E+A+ N  T++HI LP+       C       LGFD  +++YKV+K+  +   D  
Sbjct  104  G---EVAVCNPFTQEHIFLPNQRPSITCCS------LGFDPTTKKYKVIKAQYYILDDRD  154

Query  629  -SVSVKHWVFTVGVDKSWRKIHSSPYYHPYNGF  724
             S  V++W++T+GVD  WR+I       P   F
Sbjct  155  YSCKVRYWIYTIGVDNLWREIPDCANIFPIYNF  187



>ref|XP_006348768.1| PREDICTED: F-box protein At5g65850-like [Solanum tuberosum]
Length=366

 Score = 90.5 bits (223),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 71/208 (34%), Positives = 113/208 (54%), Gaps = 35/208 (17%)
 Frame = +2

Query  95   LPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYPV  274
            + +EI+ +I S+LP  SL+RFKC+SKF+ SLV D SF D+H + S+  P +++IL     
Sbjct  15   ISEEIMCDIFSRLPVDSLMRFKCLSKFYNSLVSDPSFIDIHESHSIFRPHKIKIL----A  70

Query  275  LWRDRNFTNFNWYYTINYSEENQGNLQANRLQYFD----HNPNLFRKVYLSSSLNGLICF  442
              +D N      +YTI+   E++  +    ++ FD    HN   F  V      NGL  F
Sbjct  71   RSKDENI-----FYTIDQQAEHKKPIV---IKEFDGTICHN---FHYV------NGL--F  111

Query  443  CRFSDRSDEIAIHNLST--RQHIPLPSNCHYDGSCKMNAFGLLGFDSGSRRYKVLKSVEF  616
            C +S +    AI+N  T   +++P PS  + D +    +F   GF+   +++K+L + + 
Sbjct  112  CLWSTKELPPAIYNPITGLAKYLPSPSFINDDFTHNYYSF---GFEPNEKKFKILMTSDP  168

Query  617  TTGDSVSVKHWVFTVGVDKSWRKIHSSP  700
              G S    HWV T+G  +SWR+I S+P
Sbjct  169  QIGGS---GHWVLTLGSSESWREIESAP  193



>ref|XP_009597735.1| PREDICTED: putative F-box protein At1g32420 [Nicotiana tomentosiformis]
Length=346

 Score = 89.4 bits (220),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 63/211 (30%), Positives = 102/211 (48%), Gaps = 40/211 (19%)
 Frame = +2

Query  95   LPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYPV  274
            +P E++ EI+ ++PAKSL+RF+CVSK F SL+ +  F + H+  S               
Sbjct  14   IPHEMIFEILKQVPAKSLMRFRCVSKSFCSLISEPLFIEAHQKLSTAQ------------  61

Query  275  LWRDRNFTNFNWYYTINYSEENQGNLQANRLQYFDHNPNLFRKVYLSSSLNGLICFCRFS  454
                         + ++ S         + +QY   N + F K++  +S NG++C   F 
Sbjct  62   -------------FHVSCSSLTTSK---DVIQYL--NQSRFSKLHSLASTNGVVCLWNFD  103

Query  455  DRSDEIAIHNLSTRQHIPLPSNCHYDGSCKMNAFGLLGFDSGSRRYKVLKSVEFTTG-DS  631
                ++A+ N  T++HI LP        C       LGFDS +++YKV+K+       DS
Sbjct  104  G---DVAVSNPFTQEHIFLPYQQSSITCCS------LGFDSTTKKYKVIKAQYLLDDRDS  154

Query  632  VSVKHWVFTVGVDKSWRKIHSSPYYHPYNGF  724
              V++W++T+GVDK WR+I       P   F
Sbjct  155  GKVRYWIYTIGVDKLWREIPDCANIFPAYSF  185



>ref|XP_004228837.2| PREDICTED: putative F-box protein At3g10240 [Solanum lycopersicum]
Length=290

 Score = 87.0 bits (214),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 67/203 (33%), Positives = 100/203 (49%), Gaps = 28/203 (14%)
 Frame = +2

Query  95   LPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYPV  274
            +P+EI+++I + LP KSL+RFKCV+KFF SLV +  F ++H + S+ H    +       
Sbjct  5    IPEEIVIQIFTWLPVKSLMRFKCVAKFFNSLVSESYFTEIHTSHSMIHQGGTKY------  58

Query  275  LWRDRNFTNFNWYYTINYSEENQGNLQANRLQYFDHNPNLFRKVYLSSSL---NGLICFC  445
                  F N   +Y I   ++  G   A+RL     +      + + S++   NGL C  
Sbjct  59   ------FLNGTEFYCIADQQKEYGKSSASRLVQIRSSVEFPFYIPVGSNISCVNGLFCI-  111

Query  446  RFSDRSDEIAIHNLSTRQHIPLPSNCHYDGSCKMNAFGLLGFDSGSRRYKVLKSVEFTTG  625
                     AI N ST +   LP     D  C +  +  LGF+    +YKVL + +   G
Sbjct  112  -----QKPPAILNPSTGEVRYLPK--LNDDRCLL--YYWLGFEPEENKYKVLLTRD---G  159

Query  626  DSVSVKHWVFTVGVDKSWRKIHS  694
              + +K  VFT+GVDKSWRK  S
Sbjct  160  SGLYIKQCVFTLGVDKSWRKTQS  182



>ref|XP_009609776.1| PREDICTED: F-box protein At1g47340-like [Nicotiana tomentosiformis]
Length=355

 Score = 85.9 bits (211),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 66/203 (33%), Positives = 102/203 (50%), Gaps = 28/203 (14%)
 Frame = +2

Query  92   FLPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYP  271
            FLP+EI+  I S LP +SL+RF+CV KF  SLV D SF D+H+  S++ P + + L    
Sbjct  4    FLPEEIIYHIFSWLPVESLMRFRCVFKFCNSLVFDPSFVDIHQRHSISRPHKTKFLTSSG  63

Query  272  VLWRDRNFTNFNWYYTINYSEENQGNLQANRLQYFDHNPNLFRKVYLSSSLNGLICFCRF  451
                 +N       YTI+         QA+ L+  + N   + +      + GL  FC +
Sbjct  64   Y---GKNL------YTID---------QASFLRIAEINETRYPRF---GYVKGL--FCLW  100

Query  452  SDRSDEIAIHNLSTRQHIPLPSNCHYDGSCKMNAFGLLGFDSGSRRYKVLKSVEFTTGDS  631
                    I+N  TR+ I LPS    +   +   +  LGF+   ++YK+L      +  S
Sbjct  101  GSWVQPPVIYNPITRKVISLPSQNFLEK--RTVHYCSLGFEPEKKKYKILMITHVRSAPS  158

Query  632  VSVKHWVFTVGVDKSWRKIHSSP  700
               ++WVFT+G  +SWR+I S+P
Sbjct  159  ---RYWVFTLGSAESWREIKSAP  178



>gb|KDP32917.1| hypothetical protein JCGZ_13698 [Jatropha curcas]
Length=387

 Score = 85.9 bits (211),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 67/225 (30%), Positives = 112/225 (50%), Gaps = 29/225 (13%)
 Frame = +2

Query  95   LPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYPV  274
            LP ++L EI+ +LPAK L+ F+CVSK + +L+   +F +LH   SL   S + I++    
Sbjct  4    LPWDMLAEILCRLPAKKLLCFRCVSKLWRALIDGPNFINLHLKHSLATSSNLHIIV----  59

Query  275  LWRDRNFTNFNWYYTINYSEENQGNLQANRLQYFDHNPNLFRKVYLSSSLNGLICFCRFS  454
              ++    + ++    N  +        + L  ++H+      + +  S NGL+C C   
Sbjct  60   --KNSELCSVDFDLLDNLKQ------LEHPLMCYNHS------IKILGSCNGLLCICNV-  104

Query  455  DRSDEIAIHNLSTRQHIPLP----SNCHYDG--SCKMNAFGLLGFDSGSRRYKVLKSVEF  616
               D+IA+ N S R++  LP        Y G  SC++  FG LG+D     +KV++  +F
Sbjct  105  --VDDIALWNPSIRKYHVLPYLSIELNRYFGTCSCRVCVFG-LGYDQNKDDFKVVRIAQF  161

Query  617  TTGDSVSVKHWVFTVGVDK-SWRKIHSSPYYHPYNGFNTHFYSTS  748
            T  D  S++  V    + + SWR+I   PY+  Y G N  F S +
Sbjct  162  TGVDKKSIESEVKVYSLRRNSWRRIGDMPYFVLYPGANGMFVSGA  206



>ref|XP_006366903.1| PREDICTED: F-box protein At1g30790-like [Solanum tuberosum]
Length=464

 Score = 86.3 bits (212),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 69/210 (33%), Positives = 110/210 (52%), Gaps = 33/210 (16%)
 Frame = +2

Query  95   LPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYPV  274
            +PQ+I++EI+S LPAKSL+RFKCV+KFF SLV + +F D+HR  SLT P   ++      
Sbjct  5    IPQDIVIEILSWLPAKSLMRFKCVTKFFNSLVFNSNFMDIHRCRSLTRPGGKKL------  58

Query  275  LWRDRNFTNFNWYYTINYSEENQGNLQANRLQYFDHNPNLFRKVYLSSSLNGL-ICFCRF  451
                  F + + +Y  +  ++  G   A+ LQ  +    L   +++   LN +   F  +
Sbjct  59   ------FLHGSKFYCTSDQQKEDGINSASILQ-IESFGELSFHIHVDPRLNCVNNLFLLW  111

Query  452  SDRSDEIA-IHNLSTRQHIPLPSN------CHYDGSCKMNAFGLLGFDSGSRRYKVLKSV  610
               S + A I N ST +   LPS       CHY           LGF+   ++YKVL + 
Sbjct  112  QPLSVQPATILNPSTTEVKLLPSLIEGFSWCHYS----------LGFEPEEKKYKVLSTA  161

Query  611  EFTTGDSVSVKHWVFTVGVDKSWRKIHSSP  700
            ++       +K+ VFT+G+D++WR+   +P
Sbjct  162  KY--DQEGYIKNRVFTLGIDETWRETKHNP  189



>ref|XP_009779040.1| PREDICTED: putative F-box protein At1g47790 [Nicotiana sylvestris]
Length=381

 Score = 85.1 bits (209),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 63/209 (30%), Positives = 101/209 (48%), Gaps = 22/209 (11%)
 Frame = +2

Query  95   LPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYPV  274
            +P E++VEI+ K+ AKSL+RF+CVSK F S + D  F + H+   +         ++  +
Sbjct  7    IPHELIVEILKKVRAKSLLRFRCVSKSFCSRISDPLFIEAHQKSCVAQ------FLVGCL  60

Query  275  LWRDRNFTNFNWYYTINYSEENQGNLQANRLQYFDHNPNLFRKVYLSSSLNGLICFCRFS  454
             W  ++       Y +   EE+Q    A  +QY D     FR+     S+ GL+C     
Sbjct  61   AWTPKDVI-----YNLGQREEHQD--LAYPIQYLDQ--PCFREFNYMQSIGGLVC---LW  108

Query  455  DRSDEIAIHNLSTRQHIPLPSNCHYDGSCKMNAFGLLGFDSGSRRYKVLKSVEFTTGDSV  634
            +   E+AI N   +QH+ LP          +     L  D  ++++KV K+      +  
Sbjct  109  NNVGEVAICNPFIKQHVFLPYQQPTGELYGIMTCCSLCVDPTTKKHKVFKA-HLRNNER-  166

Query  635  SVKHWVFTVGVDKSWRKIHSSPYYHPYNG  721
              ++WVFT+GVDK WR+I     + P NG
Sbjct  167  --RYWVFTIGVDKLWREISGCSNFLPSNG  193



>ref|XP_006367491.1| PREDICTED: putative F-box protein At3g10240-like [Solanum tuberosum]
Length=314

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 68/204 (33%), Positives = 100/204 (49%), Gaps = 26/204 (13%)
 Frame = +2

Query  95   LPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYPV  274
            +P+EI+++I + LP KSL+RFKCV+KFF SLV +  F D H + S+      +  +    
Sbjct  5    IPEEIVIQIFTWLPVKSLMRFKCVTKFFNSLVSESYFTDTHTSHSMIRQGGTKYFL----  60

Query  275  LWRDRNFTNFNWYYTINYSEENQGNLQANRLQY--FDHNPNLFRKVYLSSSLNGLICFCR  448
                R F     Y T +  +E+     +N +Q   FD  P         S +NGL C  +
Sbjct  61   --GGRGF-----YCTADQQKEDGKTSASNLVQIRSFDEFPFYIPVGSDVSCVNGLFCIQK  113

Query  449  FSDRSDEIAIHNLSTRQHIPLPSNCHYDGSCKMNAFGLLGFDSGSRRYKVLKSVEFTTGD  628
             +      AI N ST +   LP   + D S     +  LGF+    +YK+L + +   G 
Sbjct  114  PA------AILNPSTGEVRYLP-KLNDDRSL---LYYWLGFEPEENKYKILLTQD---GS  160

Query  629  SVSVKHWVFTVGVDKSWRKIHSSP  700
             + +K  VFT+GVDKSWRK    P
Sbjct  161  GLYIKQCVFTLGVDKSWRKTQRIP  184



>ref|XP_009602535.1| PREDICTED: putative F-box protein At1g47790 [Nicotiana tomentosiformis]
Length=366

 Score = 82.4 bits (202),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 73/225 (32%), Positives = 105/225 (47%), Gaps = 46/225 (20%)
 Frame = +2

Query  95   LPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYPV  274
            +P EI+ EI S LP K L+RFKCVSKF  SL+ +  F ++H++              + V
Sbjct  11   IPDEIIFEIFSWLPVKFLMRFKCVSKFCNSLISNPYFREIHQS--------------HSV  56

Query  275  LWRDRNFTNFNWYYTINYSEENQGNLQANRLQYFDHNPNLFRKVYLSSS-------LNGL  433
              R    T F     + +SE +Q NL    L       + FR   L S+         GL
Sbjct  57   YRRHDKITKF-----LVFSEGDQENLYTKELGQ-TTKASRFRVEKLDSASSTKSTYAKGL  110

Query  434  ICFCRFSDRSDEIAIHNLSTRQHIPLP-----------SNCHYDGSCKMNAFGLLGFDSG  580
            +C     +   +  I N STR+   LP            N  Y   C       LGFDS 
Sbjct  111  LCLWDPENLIQQAIILNPSTRETRFLPYLSSVVDQENFVNRDYRCYCS------LGFDSY  164

Query  581  SRRYKVLKSVEFTTGDSVSVKHWVFTVGVDKSWRKIHSS-PYYHP  712
             RR+K+L ++ +  G + S ++W+FT+G D+SWR+I S+ PY  P
Sbjct  165  KRRHKILMTLVYDDGQNKSTRNWIFTLG-DESWREIKSNIPYIMP  208



>ref|XP_006338789.1| PREDICTED: F-box protein At1g30790-like [Solanum tuberosum]
Length=290

 Score = 81.3 bits (199),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 62/205 (30%), Positives = 106/205 (52%), Gaps = 26/205 (13%)
 Frame = +2

Query  92   FLPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYP  271
             +P EI+ EI+ ++ AKSL+RF CVSK+F S + + SF + HR+ +          +L+ 
Sbjct  13   IIPNEIVFEILKRICAKSLMRFICVSKYFCSFISESSFIEAHRSLAAQ-------FLLHR  65

Query  272  VLWRDRNFTNFNWYYTINYSEENQGNLQANRLQYFDHNPNLFRKVY--LSSSLNGLICFC  445
            + +  +        Y ++  +E+  N     ++Y D     FR ++   SSS+NG+ C  
Sbjct  66   ITYTPKIII-----YNLSLEDEDLANCL---VRYLDE--TCFRTLHNMQSSSINGIFCLW  115

Query  446  RFSDRSDEIAIHNLSTRQHIPLPS--NCHYDGSCKMNAFGLLGFDSGSRRYKVLKS--VE  613
             +   + ++AI N   ++H+ LP   +       K+ +  L GFD  + ++KVL    V 
Sbjct  116  NY---NGDVAICNPFIKEHVFLPKVPDIEKVSQSKIISSYLFGFDPTANKHKVLMGYMVF  172

Query  614  FTTGDSVSVKHWVFTVGVDKSWRKI  688
            F       +K+ +FT+GVDKSWR I
Sbjct  173  FENRLVHGIKYLIFTIGVDKSWRDI  197



>ref|XP_010101604.1| F-box/kelch-repeat protein [Morus notabilis]
 gb|EXB88907.1| F-box/kelch-repeat protein [Morus notabilis]
Length=386

 Score = 82.4 bits (202),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 62/200 (31%), Positives = 105/200 (53%), Gaps = 10/200 (5%)
 Frame = +2

Query  95   LPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLH-RNWSLTHPSRMRILILYP  271
            LP E++VEI+S LPA+SLVRFKCV K +YS++ D  F   H RN +    ++      Y 
Sbjct  7    LPMELVVEIMSFLPAESLVRFKCVCKLWYSIINDRGFVAKHLRNATKISSTKSLCFTGYG  66

Query  272  VLWRDRNFTNFNWYYTINYSEENQGNLQANRLQYFDHNPNLFRKVYLSSSLNGLICFCRF  451
              + +   +    Y      E     ++ +   +F  + + +    +SS  NG+  FC +
Sbjct  67   KEFEEPVSSFLTIYDDDKNGEHVYSVVEDSLSPFFQRHRDEY---VVSSQCNGI--FCLY  121

Query  452  SDR-SDEIAIHNLSTRQHIPLPSNCHYDGSCKMNAFGLLGFDSGSRRYKVLKSVEFTTGD  628
             ++ ++ + + N +TR+   LP +C    +C +  FG  G+D     YKV+++V    GD
Sbjct  122  GEQITNNVILCNPATREFKLLPDSCFCVKTCGI-MFG-FGYDPRVDSYKVVRAVLLDCGD  179

Query  629  SVSVKHWVFTVGVDKSWRKI  688
            ++S++  V TVG   SWR+I
Sbjct  180  NLSLRAEVCTVG-SSSWREI  198



>ref|XP_006366851.1| PREDICTED: putative F-box protein At1g47790-like [Solanum tuberosum]
Length=319

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 66/212 (31%), Positives = 101/212 (48%), Gaps = 37/212 (17%)
 Frame = +2

Query  95   LPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILI----  262
            LPQE++++I   LP  SL+RF+CVSKFF +LV+D  F  +H   S+T     + L+    
Sbjct  10   LPQELIIDIFLWLPVMSLMRFRCVSKFFDALVLDSDFTHVHYLRSMTRDGGTKFLMGKTE  69

Query  263  -LYPV-LWRDRNFTNFNWYYTINYSEENQGNLQANRLQYFDHNPNLFRKVYLSSSLNGLI  436
             LY V L  D N + +N                      FD +   F    +S S     
Sbjct  70   DLYAVDLNEDGNISRWN----------------------FDCHDQYFNGPCVSGS-----  102

Query  437  CFCRFSDRSDEIAIHNLSTRQHIPLPSNCHYDGSCKMNAFGLLGFDSGSRRYKVLKSVEF  616
             +C +    + + I N STR+ I LP       S K   +  LG++   ++YKVL  V  
Sbjct  103  -YCIWKHDKEPVRIFNPSTRKMIVLPYQRKKFHSVKSLYYYSLGYEPLEKKYKVLMQVHN  161

Query  617  TTGDSVSVKHWVFTVGVDKSWRKIHSSPYYHP  712
            + G +   ++++FT+ +DKSWRKI     + P
Sbjct  162  SRGHA---RNFIFTLSIDKSWRKIKDIINFFP  190



>ref|XP_006367351.1| PREDICTED: F-box protein At2g40925-like [Solanum tuberosum]
Length=353

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 65/212 (31%), Positives = 109/212 (51%), Gaps = 29/212 (14%)
 Frame = +2

Query  92   FLPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYP  271
            ++P+EI+ EI S LP KSL+RFKC +KF  SL+++  F ++H   S++   R + ++   
Sbjct  8    WIPEEIMFEIFSWLPVKSLLRFKCNTKFCTSLILESDFVNIHTCRSMSRSGRTKFIL---  64

Query  272  VLWRDRNFTNFNWYYTINYSEENQGN---LQANRLQY-FDHNPNLFRKVYLSSSLNGLIC  439
               R++  + F   +T    E+ + +   LQ  R  Y + H    + ++   + +NGL C
Sbjct  65   ---REKWESIF---FTAEQREDEKDSTPFLQIPRYNYLYLHGLAYYSRL---NCVNGLCC  115

Query  440  FCRFSDRSDEIAIHNLSTRQHIPLPSNCHYDGSCKMNAFGLLGFDSGSRRYKVLKSVEFT  619
                S  +   AI N STR+   LP   + DG      +  LGF+   +++KV    +  
Sbjct  116  MWD-SLSTRHAAIFNPSTREVRFLP---NIDGELSPCNYS-LGFEPEEKKFKVFSRYK--  168

Query  620  TGDSVSVKHWVFTVGVDKSWRKIHSSPYYHPY  715
                   +HWVFT+G+DKSWR+  +  +  PY
Sbjct  169  ------ERHWVFTLGIDKSWRENKNISFAIPY  194



>ref|XP_009619255.1| PREDICTED: putative F-box protein At1g47730 [Nicotiana tomentosiformis]
Length=291

 Score = 79.0 bits (193),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 62/207 (30%), Positives = 95/207 (46%), Gaps = 38/207 (18%)
 Frame = +2

Query  95   LPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYPV  274
            +P EI+ +I S LP KSL+RFKCVSKF+ SLV D  F D+H+  S+ HP + R       
Sbjct  10   IPDEIIYDIFSWLPIKSLMRFKCVSKFYSSLVSDSCFVDIHQYNSIHHPDKHR-------  62

Query  275  LWRDRNFTNFNWYYTINYSEENQGNLQANRLQYFD-HNPNLFRKVYLSSSLNGLICFCRF  451
                                   G  +A+ ++        ++ K   +  L GL C    
Sbjct  63   --------------------RGGGTSKASVIRVGKLRGLIIYPKFGYAKGLFGLWC----  98

Query  452  SDRSDEIAIHNLSTRQHIPLPSNCHYDGSCKMNAFGLLGFDSGSRRYKVLKSVEFTTGDS  631
            S       I+N  TR+  PLP    +D     + +  LGF+    +YK+L          
Sbjct  99   STSRLPPVIYNPITRKVRPLPRLNFFDEI--TDCYYSLGFEPDKSKYKIL----LVRHSC  152

Query  632  VSVKHWVFTVGVDKSWRKIHSSPYYHP  712
            + +++WV+T+G  KSWR+I S+  + P
Sbjct  153  LPLRYWVYTLGTSKSWREIKSTVDFFP  179



>ref|XP_010650314.1| PREDICTED: putative F-box protein At5g52610 [Vitis vinifera]
Length=434

 Score = 80.5 bits (197),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 59/202 (29%), Positives = 109/202 (54%), Gaps = 25/202 (12%)
 Frame = +2

Query  95   LPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYPV  274
            +P +++VEI+++LP KSL+RF+CV K + S++ D SF +LHR  S+T      +L+ +P 
Sbjct  67   IPDDVVVEILARLPVKSLLRFRCVCKLWRSIISDSSFIELHRTLSVTRAGGNLLLLCFP-  125

Query  275  LWRDRNFTNFNW--YYTINYSEENQGNLQANRLQYFDHNPNLFRKVYLSSSLNGLICFCR  448
                 +  ++ W   + I++SEE +G+  A R        N F     S  +NGLIC   
Sbjct  126  -----SVAHWPWRLLFYIDHSEE-EGHCNAFR--------NDFSLSGFSECINGLIC---  168

Query  449  FSDRSDEIAIHNLSTRQHIPLPSNC-HYDGSCKMNAFGLLGFDSGSRRYKVLKSVE-FTT  622
                  +  + NLST++ + LP+   ++    + ++   LGF+  +  YK+L++ + + +
Sbjct  169  --QDDPQPQVCNLSTKERVILPTTAINFPKWIQTSSHCSLGFEPRNNTYKILRTWKVYWS  226

Query  623  GDSVSVKHWVFTVGVDKSWRKI  688
                S +  +FT+G   +WR +
Sbjct  227  SLDWSSRFEIFTLG-SNTWRSL  247



>ref|XP_010052511.1| PREDICTED: putative F-box protein At3g16210 isoform X2 [Eucalyptus 
grandis]
 gb|KCW76575.1| hypothetical protein EUGRSUZ_D00965 [Eucalyptus grandis]
Length=348

 Score = 79.3 bits (194),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 67/231 (29%), Positives = 100/231 (43%), Gaps = 55/231 (24%)
 Frame = +2

Query  95   LPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYPV  274
            LPQ++ VEI+ +LP KSL+RF+CVS+ + S + D +F  LH   S  + S          
Sbjct  17   LPQDVAVEILKRLPVKSLLRFRCVSRSWRSAIDDPAFVALHARHSALYAS----------  66

Query  275  LWRDRNFTNFNWYYT-INYSEENQGNLQANRLQYFDHN----PNLF-----------RKV  406
                      NWY   ++Y    +G+LQ +R     H+    P+L            R  
Sbjct  67   ----------NWYLVCLDY----RGDLQ-DRCSLVPHDSLTLPSLLRVETPFVTPPPRGF  111

Query  407  YLSSSLNGLICFCRFSDRSDEIAIHNLSTRQH-----IPLPSNCHYDGSCKMNAFGLLGF  571
            Y   S NGLIC    +     + + NL TR+H      P P    +      + F   GF
Sbjct  112  YFVGSCNGLICLADRNGEGPYMYLWNLFTRKHKVIQVFPCPEEPQFRCKPADSGFLGFGF  171

Query  572  DSGSRRYKVLKSVEFTTGDSVSVKHWVFTVGV----DKSWRKIHSS-PYYH  709
            D+GS  YK+++ + F   D    + W   VG+      SWR +    P +H
Sbjct  172  DAGSNDYKIVRILPFQGDD----RRWFGRVGIYSLRTDSWRSLRCQVPAFH  218



>ref|XP_010052510.1| PREDICTED: putative F-box protein At3g16210 isoform X1 [Eucalyptus 
grandis]
 gb|KCW76576.1| hypothetical protein EUGRSUZ_D00965 [Eucalyptus grandis]
Length=385

 Score = 79.3 bits (194),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 67/231 (29%), Positives = 100/231 (43%), Gaps = 55/231 (24%)
 Frame = +2

Query  95   LPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYPV  274
            LPQ++ VEI+ +LP KSL+RF+CVS+ + S + D +F  LH   S  + S          
Sbjct  17   LPQDVAVEILKRLPVKSLLRFRCVSRSWRSAIDDPAFVALHARHSALYAS----------  66

Query  275  LWRDRNFTNFNWYYT-INYSEENQGNLQANRLQYFDHN----PNLF-----------RKV  406
                      NWY   ++Y    +G+LQ +R     H+    P+L            R  
Sbjct  67   ----------NWYLVCLDY----RGDLQ-DRCSLVPHDSLTLPSLLRVETPFVTPPPRGF  111

Query  407  YLSSSLNGLICFCRFSDRSDEIAIHNLSTRQH-----IPLPSNCHYDGSCKMNAFGLLGF  571
            Y   S NGLIC    +     + + NL TR+H      P P    +      + F   GF
Sbjct  112  YFVGSCNGLICLADRNGEGPYMYLWNLFTRKHKVIQVFPCPEEPQFRCKPADSGFLGFGF  171

Query  572  DSGSRRYKVLKSVEFTTGDSVSVKHWVFTVGV----DKSWRKIHSS-PYYH  709
            D+GS  YK+++ + F   D    + W   VG+      SWR +    P +H
Sbjct  172  DAGSNDYKIVRILPFQGDD----RRWFGRVGIYSLRTDSWRSLRCQVPAFH  218



>emb|CDY37714.1| BnaA04g19540D [Brassica napus]
Length=307

 Score = 78.2 bits (191),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 62/213 (29%), Positives = 100/213 (47%), Gaps = 28/213 (13%)
 Frame = +2

Query  95   LPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYPV  274
            +P +++++I S LPAKSL+RF  VSK ++S +   +F D+    S+T P   R+L  +  
Sbjct  24   IPFDLIIDIFSLLPAKSLIRFLSVSKLWFSTIRSKTFVDMFLTRSMTRP---RLLFTFYH  80

Query  275  LWRDRNFTNFNWYYTINYSEENQGNLQANRLQYFDHNPNLFRKVYLSSSLNGLIC-----  439
            +   RNF     +    Y   + G   ++ +  +D   +         S+NG IC     
Sbjct  81   IESRRNFI----FSAPEYEYSDDGKYFSSAMARYDMTISDLDHYRFCGSVNGFICFISGV  136

Query  440  ---FCRFSDRSDEIAIHNLSTRQHIPLP---SNCHYDGSCKMNAFGLLGFDSGSRRYKVL  601
               FC +      I ++N +TRQ + LP   SN  Y  +C       LG+D    +YKVL
Sbjct  137  SGPFCNWIPPFSSITVYNPTTRQLVKLPDFTSNGRYVYAC-------LGYDPVEDQYKVL  189

Query  602  KSVEFTTG-DSVSVKHWVFTVGV--DKSWRKIH  691
              + F  G   +  +H+V T+     + WRKI 
Sbjct  190  CVMMFGPGSQDIQQEHFVCTLSSFQQQEWRKIE  222



>ref|XP_010317786.1| PREDICTED: putative F-box protein At1g47730 [Solanum lycopersicum]
Length=369

 Score = 79.0 bits (193),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 70/200 (35%), Positives = 99/200 (50%), Gaps = 38/200 (19%)
 Frame = +2

Query  107  ILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYPVLWRD  286
            +L+ +++KLP KSL+R KCVS F  S+V    F D+HR  S      ++           
Sbjct  3    LLLAVITKLPVKSLMRLKCVSTFCKSIVSKSDFLDIHRCRSTGTKFLLK-----------  51

Query  287  RNFTNFNWYYTINYSEENQGNLQANRLQYFDHNP---NLFRKVYLSSSLNGLICFCRFSD  457
                    YYT    E+  G   A+ LQ    N     + R  +LSS +NGL C C    
Sbjct  52   ----GEEVYYTAE--EKKDGKESASLLQVDKFNKIYSCIPRNSHLSSCVNGLFC-CW---  101

Query  458  RSDEIAIHNLSTRQHIPLP-SNCH---YDGSCKMNAFGLLGFDSGSRRYKVLKSVEFTTG  625
            RS  I I N ST++   LP SN H   Y+ S        LGF+    +YKV+ S E+   
Sbjct  102  RSSSILIFNPSTKEIRYLPHSNKHIAWYNYS--------LGFEPKENKYKVV-SAEYHAQ  152

Query  626  DSVSVKHWVFTVGVDKSWRK  685
            +   +K+W+FT+G+DKSWR+
Sbjct  153  EGY-IKYWIFTLGIDKSWRE  171



>ref|XP_006279529.1| hypothetical protein CARUB_v10028190mg [Capsella rubella]
 gb|EOA12427.1| hypothetical protein CARUB_v10028190mg [Capsella rubella]
Length=396

 Score = 79.0 bits (193),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 70/222 (32%), Positives = 105/222 (47%), Gaps = 24/222 (11%)
 Frame = +2

Query  92   FLPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYP  271
            ++P ++  EI S+LP+KS+ R +CVSK + S++   SF +L    S T P R+   I   
Sbjct  9    YIPTDLYFEIFSRLPSKSIARSRCVSKLWESMLSSPSFTELFLTRSSTRP-RLLFAIKRS  67

Query  272  VLWRDRNFTNFNWYYTINYSEENQGNLQANRLQYFDHNPNLFRKVYLSSSLNGLICFCR-  448
              W  R F++  + Y    +E++   + A          +L++   + S  +GL+CF   
Sbjct  68   REW--RFFSSPQYPYD---NEKSSLQVAATDYNVKLSGRSLYKSTCMCSFTSGLLCFPNV  122

Query  449  --FSDRSDEIAIHNLSTRQHIPLPSNCHYDGSCKMNAFGLLGFDSGSRRYKVLKSVEF--  616
                 R  E  I N +TRQH+ LP          M +   LGFD   +RYKVL  VE   
Sbjct  123  PILGGRYTECVICNPTTRQHVILPIL-----KTGMKSKLFLGFDPIGKRYKVLLLVEDWG  177

Query  617  -----TTGDSVSVKHWVFTVGVDK-SWRKI--HSSPYYHPYN  718
                 +  D     H++ T+G  K SWRKI  HS    +P N
Sbjct  178  SHSTNSYSDYSETVHYIMTLGTRKMSWRKIPYHSEVVLYPLN  219



>ref|XP_009141321.1| PREDICTED: F-box protein At1g30790-like [Brassica rapa]
Length=324

 Score = 78.2 bits (191),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 62/213 (29%), Positives = 100/213 (47%), Gaps = 28/213 (13%)
 Frame = +2

Query  95   LPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYPV  274
            +P +++++I S LPAKSL+RF  VSK ++S +   +F D+    S+T P   R+L  +  
Sbjct  41   IPFDLIIDIFSLLPAKSLIRFLSVSKLWFSTIRSKTFVDMFLTRSMTRP---RLLFTFYH  97

Query  275  LWRDRNFTNFNWYYTINYSEENQGNLQANRLQYFDHNPNLFRKVYLSSSLNGLIC-----  439
            +   RNF     +    Y   + G   ++ +  +D   +         S+NG IC     
Sbjct  98   IESRRNFI----FSAPEYEYSDDGKYFSSAMARYDMTISDLDHYRFCGSVNGFICFISGV  153

Query  440  ---FCRFSDRSDEIAIHNLSTRQHIPLP---SNCHYDGSCKMNAFGLLGFDSGSRRYKVL  601
               FC +      I ++N +TRQ + LP   SN  Y  +C       LG+D    +YKVL
Sbjct  154  SGPFCNWIPPFSSITVYNPTTRQLVKLPDFTSNGRYVYAC-------LGYDPVEDQYKVL  206

Query  602  KSVEFTTG-DSVSVKHWVFTVGV--DKSWRKIH  691
              + F  G   +  +H+V T+     + WRKI 
Sbjct  207  CVMMFGPGSQDIQQEHFVCTLSSFQQQEWRKIE  239



>ref|XP_006354726.1| PREDICTED: F-box protein At5g65850-like [Solanum tuberosum]
Length=360

 Score = 77.8 bits (190),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 68/203 (33%), Positives = 97/203 (48%), Gaps = 30/203 (15%)
 Frame = +2

Query  95   LPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYPV  274
            +P++I+ +I S LP KSL+RFK VSKF+ SLV +  F D+H+        R R  I Y V
Sbjct  10   IPRDIIFDIFSTLPVKSLMRFKSVSKFYNSLVCESVFVDIHQ-------CRSRSRIKYIV  62

Query  275  LWRDRNFTNFNWYYTINYSEENQGNLQANRLQYFDHNPNLFRKVYLS--SSLNGLICFCR  448
              R +        YTI   EE + +          H  N   K++ +    +NGL  FC 
Sbjct  63   RQRAK-------LYTIEAMEEGKVSPL--------HIDNFCEKLFYNYIMCVNGL--FCC  105

Query  449  FSDRSDEIAIHNLSTRQHIPLPSNCHYDGSCKMNAFGLLGFDSGSRRYKVLKSVEFTTGD  628
                 D +AI N ST+    LP             F  +GFD   + YKVL ++    G 
Sbjct  106  SMRNVDGVAICNPSTKVVRSLPRLKECPKIDYAEYFCSMGFDPEEKTYKVLMTI---NGF  162

Query  629  SVSVKHWVFTVGVD-KSWRKIHS  694
            +   ++WVFT+G D +SWR+I  
Sbjct  163  TKPTRNWVFTLGRDEESWREIKG  185



>ref|XP_006343419.1| PREDICTED: putative F-box protein At3g10240-like [Solanum tuberosum]
Length=371

 Score = 77.8 bits (190),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 69/217 (32%), Positives = 108/217 (50%), Gaps = 36/217 (17%)
 Frame = +2

Query  95   LPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYPV  274
            +PQ+I ++I S LPAKSL+RFKCVSKF+ ++V++  F D+                    
Sbjct  3    IPQDITIQIFSCLPAKSLMRFKCVSKFYNTIVLEPYFGDI--------------------  42

Query  275  LWRDRNFTNFNWYYTI----NYSEENQGNL-QANRLQYFDHNPNLFRKVYLSSSL-NGLI  436
              R  N++  N          YS E  GN  ++ +L  FD   + F +V       NGL 
Sbjct  43   --RSSNYSKINRVIGCLGDGIYSIEEDGNATKSYQLDNFDKLCHHFDRVSNCFGYDNGL-  99

Query  437  CFCRFSDRSDEIAIHNLSTRQHIPLPSNCHYDGSCKMNAFGLLGFDSGSRRYKVLKSVEF  616
             FC + ++   I+I N +T +   LP    YDGS  + +   +GF+     YKVL ++  
Sbjct  100  -FCTWDEKY--ISIFNPATGEVRYLPYLKCYDGSYGICS---IGFEPEENEYKVLLTIYK  153

Query  617  TTGDSVSVKHWVFTVGVDKSWRKIHSSPYYHPYNGFN  727
                 +S + WVFT+G+D SWR+I +   ++ Y G+ 
Sbjct  154  LNHLELS-RAWVFTLGIDNSWREIITYDEHNYYIGYG  189



>ref|NP_193856.1| putative F-box protein [Arabidopsis thaliana]
 sp|O49565.1|FB239_ARATH RecName: Full=Putative F-box protein At4g21240 [Arabidopsis thaliana]
 emb|CAA17543.1| putative protein [Arabidopsis thaliana]
 emb|CAB79124.1| putative protein [Arabidopsis thaliana]
 gb|AEE84431.1| putative F-box protein [Arabidopsis thaliana]
Length=417

 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 63/208 (30%), Positives = 105/208 (50%), Gaps = 23/208 (11%)
 Frame = +2

Query  92   FLPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYP  271
             +P +++ +I+ +LPAKS VRF+ VSK + S+     F       S   PS  R+ ++  
Sbjct  35   LIPLDMIPDILLRLPAKSAVRFRIVSKLWLSITTRPYFIR-----SFAFPSSTRLCLMAC  89

Query  272  VLWRD-RNFTNFNWYYTINYSEENQGNLQANRLQYFDHNPNLFRKVYLSSSLNGLICFCR  448
            V  RD R F + + +   +Y+  ++  +++ +  Y+  NP+       S S+NGL+CF  
Sbjct  90   VKARDMRLFISLHQHDDGSYAHVDRCEIKSPKHDYY--NPS-------SESVNGLVCFGD  140

Query  449  FSDRSDEIAIHNLSTRQHIPLPSNCHYDGSCKMNAFGLLGFDSGSRRYKVLKSVEFTTGD  628
            F +    I + N S RQH+ LP    +  + +      LG+D    +YKVL    +  G+
Sbjct  141  FYN----IVVWNPSMRQHVTLPEPKPH-STVRYFIRSCLGYDPVEDKYKVLSISGYHNGN  195

Query  629  SVSVKHWVFTVGVDKSWRKIHSSPYYHP  712
               +   VFT+G  +SWR I +SP   P
Sbjct  196  HDPL---VFTLGPQESWRVIQNSPLDIP  220



>ref|XP_009609121.1| PREDICTED: putative F-box protein At1g52480 [Nicotiana tomentosiformis]
Length=288

 Score = 75.9 bits (185),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 63/210 (30%), Positives = 97/210 (46%), Gaps = 42/210 (20%)
 Frame = +2

Query  104  EILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHS-FADLHRNWSLT--HPSRMRILILYPV  274
            +I+ EI+  LP KSL+RFKCVSK F SL+ +   F + H+N SL   H S   ++I    
Sbjct  17   DIVFEILKSLPIKSLIRFKCVSKSFCSLISEPLLFIEAHQNGSLAQFHASCSSLMI----  72

Query  275  LWRDRNFTNFNWYYTINYSEENQGNLQANRLQYFDHNPNLFRKVYLSSSLNGLICFCRFS  454
                                      + + +QY   N + F K++  +S NGL+C  +F 
Sbjct  73   --------------------------RKDVIQYL--NLSCFGKLHSLASTNGLVCLWKFD  104

Query  455  DRSDEIAIHNLSTRQHIPLPSNCHYDGSCKMNAFGLLGFDSGSRRYKVLKSVEFTTGDSV  634
                 +AI N   ++HI LP     +          +GFD  +++ KV K+         
Sbjct  105  GV---VAICNPFIKEHIFLPCQQPKEKPYGSMICCSIGFDPITKKPKVFKA----HVRDY  157

Query  635  SVKHWVFTVGVDKSWRKIHSSPYYHPYNGF  724
              ++W+FT+GVDKSWR+I       P + F
Sbjct  158  EARYWIFTIGVDKSWREIFDCAKSFPGSNF  187



>gb|KCW86405.1| hypothetical protein EUGRSUZ_B03075 [Eucalyptus grandis]
Length=400

 Score = 77.4 bits (189),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 63/221 (29%), Positives = 96/221 (43%), Gaps = 19/221 (9%)
 Frame = +2

Query  95   LPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYPV  274
            +P ++L+EI+ +LP KSL RF+CVS  + SL+ D  F   H   S T P   R+L+  PV
Sbjct  11   IPDDLLIEILRRLPVKSLCRFRCVSTLWRSLISDPRFLAAHLAHSATRP---RLLVTLPV  67

Query  275  LWRDRNFTNFNWYYTINYSEENQGNLQANRLQYFDHNPNLFRKVYLSSSLNGLICFCRFS  454
              +        W ++ ++ E  +   Q        H        Y+S SLNGLIC     
Sbjct  68   --QQVPCPQGRWLFSADHPESGRDRPQIAEPHLLVHGSP---GRYVSQSLNGLICL----  118

Query  455  DRSDEIAIHNLSTRQHIPLPSNCHYDGSCKMNAFGLLGFDSGSRRYKVLKSVEFTTGD--  628
            +    I + N STR+ + L  +    G          GFD   + +KV ++    +G   
Sbjct  119  EVGGLIIVCNPSTRKLVTLGQSKARSGRGCSYCRHSFGFDPVGKEHKVFETWVSDSGKPD  178

Query  629  -SVSVKHWVFTVGVDKSWRKIHSSP---YYHPYNGFNTHFY  739
              + +  +V T+G    WR I   P    + P   FN   Y
Sbjct  179  RGLIMNQFVLTLG-SSGWRGIEGGPPHLKHDPEFCFNGVIY  218



>ref|XP_009131893.1| PREDICTED: F-box protein At1g30790-like [Brassica rapa]
Length=397

 Score = 77.0 bits (188),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 60/208 (29%), Positives = 102/208 (49%), Gaps = 27/208 (13%)
 Frame = +2

Query  95   LPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYPV  274
            +P +++++I+S+LPAK L+RF+ VSK ++S++    F       S T P   R+L+    
Sbjct  23   IPLDLVLDILSRLPAKPLIRFQAVSKLWFSIIRSKDFVGTFLTRSKTRP---RLLL----  75

Query  275  LWRDRNFTNFNWYYTINYSEENQGNLQANRLQYFDHNPNLFRKVYL--SSSLNGLICFCR  448
                  F +F+      +S     + + +      H+  +   VY   S  +NGL+C   
Sbjct  76   -----TFKHFDSRKRFIFSAPEHEDDKTSSTVMARHDMTISDLVYYIESPPVNGLVCCTH  130

Query  449  FSDRSDEIAIHNLSTRQHIPLPSNCHYDGSCKMNAFGLLGFDSGSRRYKVLKSVEFT---  619
             S     IA+ N +TRQ + LP     +G    + +  LG+D    +YKVL  + F    
Sbjct  131  GS----SIAVCNPTTRQIVTLPDVITPNGR---DVYARLGYDPVGDQYKVLCVMMFDGFD  183

Query  620  --TGDSVSVKHWVFTVGV-DKSWRKIHS  694
              T D++  +H+VFT+G   K W+KI +
Sbjct  184  SGTSDNIQQEHFVFTLGTPQKKWKKIET  211



>ref|XP_006393361.1| hypothetical protein EUTSA_v10011962mg [Eutrema salsugineum]
 gb|ESQ30647.1| hypothetical protein EUTSA_v10011962mg [Eutrema salsugineum]
Length=370

 Score = 76.6 bits (187),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 71/223 (32%), Positives = 105/223 (47%), Gaps = 30/223 (13%)
 Frame = +2

Query  95   LPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYPV  274
            +P +++ EI+S+LPAKS+ RF CVSK + S+++   F DL    S + P R+    L+ V
Sbjct  10   IPIDLVNEILSRLPAKSIARFHCVSKLWSSMLLRPYFTDLFLTRSSSRPPRL----LFAV  65

Query  275  LWRDRNFTNFNWYYTINYSEENQGNL--QANR-LQYFDHNPNLFRKVYLSSSLNGLICFC  445
                  +  F      N  EE   +L   A+R +++   N  L    Y S    G ICFC
Sbjct  66   QLDGEEWCFFTSSQPQNPYEEESSSLVVTADRHMKFLGDNLCLESCGYAS----GWICFC  121

Query  446  R---FSDRSDEIAIHNLSTRQHI--PLPSNCHYDGSCKMNAFGLLGFDSGSRRYKVLK-S  607
            R    S+      I N ST Q++  P+P  C    +C  +    LGFD   +++KVL   
Sbjct  122  RRTMISEDDKRTVICNPSTGQYVSLPIPKTC----ACWRS---FLGFDPIGKQFKVLSIR  174

Query  608  VEFTTGDSVSVKHWVFTVGV-DKSWRKIHSSPYYHPYNGFNTH  733
                + D    +  + T+G  + SWRKIH      P N F  H
Sbjct  175  CRNHSYDEKGFQCQILTLGTGNDSWRKIHC-----PLNHFPQH  212



>ref|XP_010650194.1| PREDICTED: F-box protein DOR-like [Vitis vinifera]
Length=378

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 63/204 (31%), Positives = 104/204 (51%), Gaps = 29/204 (14%)
 Frame = +2

Query  95   LPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYPV  274
            +P +++  I++ LP KSL+RF+CV K + S++ D  F + H++ S +      +LI +P 
Sbjct  6    VPNDLVFGILTHLPVKSLLRFRCVCKSWRSMISDPLFVEAHQSRSASA-----LLISFPD  60

Query  275  LWRDRNFTNFNWYYTINYSEENQGNLQANRLQYFDHNPNLFRKVYLSSSLNGLIC-FCRF  451
            +   R+       + IN  E       A+R+  F H         +S S+NGLIC + ++
Sbjct  61   M---RDPDRKRTLFCINEGE-------AHRIPGFSH-------WNISQSVNGLICIYGQY  103

Query  452  SDR-SDEIAIHNLSTRQHIPLPSNCHYDGSCKMNAFGLLGFDSGSRRYKVLKSVEFTTGD  628
            S + S  + + N STR+H+ LP     D          LGFD  ++ YK+L+       D
Sbjct  104  SPKQSHRVRVCNPSTREHVTLPPPFFSDPDLFFQC-NSLGFDPSTKTYKILRG---WMAD  159

Query  629  SVSVKHWVFTVGVDKSWRKIHSSP  700
            S   K+ +FT+G D +WR I  +P
Sbjct  160  SWGPKYEIFTLGSD-AWRIIKDAP  182



>ref|XP_011012768.1| PREDICTED: F-box/kelch-repeat protein At3g06240-like [Populus 
euphratica]
Length=361

 Score = 75.9 bits (185),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 68/215 (32%), Positives = 108/215 (50%), Gaps = 40/215 (19%)
 Frame = +2

Query  95   LPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLH--RNWSLTHPSRMRILILY  268
            LPQEI+V+I+  LPAKSL+RFKCV + + SL+ D  FA LH  R +   + +R R+L+  
Sbjct  4    LPQEIIVDILIYLPAKSLIRFKCVCRSWRSLISDPQFAKLHLKRAYEDENINRQRLLVAA  63

Query  269  PVLWRDRNFTNFNWYYTINYSEENQGNLQANRLQYF------DHNPNLFRKVYLSSSLNG  430
              L            Y++++   + G+   N L          HN +    ++L S  +G
Sbjct  64   DPL------------YSVDFEAASDGD-NGNTLVKLPYPNAESHNDSFAVGLFLGSC-DG  109

Query  431  LICFCRFSDRSDEIAIHNLSTRQHIPLP---SNCHYDGSCKMNAFGLLGFDSGSRRYKVL  601
            ++C     +  D + + N STR+   LP   S+ H D S        LG+DS +  YK++
Sbjct  110  IVCIL---NEVDNVVLWNPSTRESKKLPGPSSSLHKDFSTG------LGYDSSTDDYKMV  160

Query  602  --KSVEFTTG-DSVSVKHWVFTVGVDKSWRKIHSS  697
               S   +TG D + V+  VFT+  + +WR +  S
Sbjct  161  IASSATASTGSDQIMVE--VFTLKTN-TWRTVQGS  192



>ref|XP_002299005.1| F-box family protein [Populus trichocarpa]
 gb|EEE83810.1| F-box family protein [Populus trichocarpa]
Length=412

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 62/209 (30%), Positives = 103/209 (49%), Gaps = 28/209 (13%)
 Frame = +2

Query  95   LPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYPV  274
            +PQ+I+ EI++KLPAKSL+RF+CV K + SL+ D  F  LH+N SL  P +  +L+    
Sbjct  33   IPQDIVAEILAKLPAKSLMRFRCVCKTWSSLIRDPFFVKLHQNQSLNKPCKTGLLM----  88

Query  275  LWRDRNFTNFNWYYTINYSEENQGNLQANRLQYFDHNPNLFRKVYLSSSLNGLICFCRFS  454
                     FN ++     E  Q  L+ + +       ++ +   +    NGL C     
Sbjct  89   ---STKHQLFNSHFVFADHEGKQA-LEEDTI-------SIPKSSNVLGIANGLACIVNDK  137

Query  455  DRSDEIAIHNLSTRQHIPLPSNCHYDGSCKMNAFGLLGFDSGSRRYKVLKSVEFTTGDSV  634
             R   I+++NLSTR+   +P         ++      GFD  +  YK++K   F   D  
Sbjct  138  HR---ISVYNLSTRESTTIPPPPQ---EIRIQDRLSFGFDPLANEYKIVK---FCAHDKE  188

Query  635  SVKHWVFTVGVDKSWRKIHSSPYYHPYNG  721
              +  +FT+G ++ WR+I+   +Y+ Y G
Sbjct  189  QFE--IFTLGTER-WRRINRK-HYNFYGG  213



>ref|XP_010650199.1| PREDICTED: F-box protein At5g65850 [Vitis vinifera]
Length=376

 Score = 75.9 bits (185),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 59/201 (29%), Positives = 100/201 (50%), Gaps = 24/201 (12%)
 Frame = +2

Query  95   LPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYPV  274
            LP +I++EI+S+LP K ++R +CV K + S ++  SF  LH   SLT P    +L+    
Sbjct  10   LPLDIIIEILSRLPVKFILRSRCVCKLWRSTILSPSFIQLHHTRSLTRPDGNGLLL----  65

Query  275  LWRDRNFTNFNWYYTINYSEENQGNLQANRLQYFDHNPNLFRKVYLSSSLNGLICFCRFS  454
                R  ++ + +     S +N         Q +D  P  F     S S+NGLIC     
Sbjct  66   --GSRVESDGSLHLCFVGSAQNVN-------QLYDSTPRPFFSA--SESINGLIC---LG  111

Query  455  DRSDEIAIHNLSTRQHIPLPSNCHYDGSCK--MNAFGLLGFDSGSRRYKVLKSVEFTTGD  628
               D++ + N ST++ + LP       S     +++  LGFD  +  YK+L++       
Sbjct  112  LPDDDVCVCNPSTKECVALPRTLMRQLSPLHWYHSYAFLGFDPPTNTYKILRT---WWTR  168

Query  629  SVSVKHWVFTVGVDKSWRKIH  691
            +VS+ H +FT+G  ++WR ++
Sbjct  169  AVSLAHEIFTLG-SQTWRVLN  188



>ref|XP_011012382.1| PREDICTED: putative F-box protein At1g32420 [Populus euphratica]
Length=413

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 61/209 (29%), Positives = 102/209 (49%), Gaps = 28/209 (13%)
 Frame = +2

Query  95   LPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYPV  274
            +PQ+I+ E+++KLPAKSL+RF+CV K + SL+ D  F  LH+N SL  P +  +L+    
Sbjct  33   IPQDIVAEVLAKLPAKSLMRFRCVCKTWSSLIRDPFFVKLHQNQSLNKPCKTGLLM----  88

Query  275  LWRDRNFTNFNWYYTINYSEENQGNLQANRLQYFDHNPNLFRKVYLSSSLNGLICFCRFS  454
                     FN ++     E  Q  L+ + +       ++ +   +    NGL C     
Sbjct  89   ---STKHQLFNSHFVFADHEGKQA-LEEDTI-------SIPKSANVLGIANGLACIVNDK  137

Query  455  DRSDEIAIHNLSTRQHIPLPSNCHYDGSCKMNAFGLLGFDSGSRRYKVLKSVEFTTGDSV  634
             R   I+++NLSTR+   +P         +       GFD  +  YK++K   F   +  
Sbjct  138  HR---ISVYNLSTRESTTIPPPPQ---EIRFQDRLSFGFDPLANEYKIVK---FCAHEKE  188

Query  635  SVKHWVFTVGVDKSWRKIHSSPYYHPYNG  721
              +  +FT+G D+ WR+I+   +Y+ Y G
Sbjct  189  QFE--IFTLGTDR-WRRINRK-HYNFYGG  213



>ref|XP_011038127.1| PREDICTED: putative F-box protein At1g32420 [Populus euphratica]
Length=430

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 61/209 (29%), Positives = 102/209 (49%), Gaps = 28/209 (13%)
 Frame = +2

Query  95   LPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYPV  274
            +PQ+I+ E+++KLPAKSL+RF+CV K + SL+ D  F  LH+N SL  P +  +L+    
Sbjct  50   IPQDIVAEVLAKLPAKSLMRFRCVCKTWSSLIRDPFFVKLHQNQSLNKPCKTGLLM----  105

Query  275  LWRDRNFTNFNWYYTINYSEENQGNLQANRLQYFDHNPNLFRKVYLSSSLNGLICFCRFS  454
                     FN ++     E  Q  L+ + +       ++ +   +    NGL C     
Sbjct  106  ---STKHQLFNSHFVFADHEGKQA-LEEDTI-------SIPKSANVLGIANGLACIVNDK  154

Query  455  DRSDEIAIHNLSTRQHIPLPSNCHYDGSCKMNAFGLLGFDSGSRRYKVLKSVEFTTGDSV  634
             R   I+++NLSTR+   +P         +       GFD  +  YK++K   F   +  
Sbjct  155  HR---ISVYNLSTRESTTIPPPPQ---EIRFQDRLSFGFDPLANEYKIVK---FCAHEKE  205

Query  635  SVKHWVFTVGVDKSWRKIHSSPYYHPYNG  721
              +  +FT+G D+ WR+I+   +Y+ Y G
Sbjct  206  QFE--IFTLGTDR-WRRINRK-HYNFYGG  230



>ref|XP_008804788.1| PREDICTED: F-box/kelch-repeat protein At3g06240-like [Phoenix 
dactylifera]
Length=305

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 61/220 (28%), Positives = 104/220 (47%), Gaps = 28/220 (13%)
 Frame = +2

Query  95   LPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYPV  274
            LP +IL  I+ +LP KS++RF CVSK+++++++D  F +LH   S T P+   +LIL   
Sbjct  12   LPPDILFSILRRLPLKSVLRFCCVSKYWFNVIMDPDFRNLHFFQSPTEPT---VLILSQR  68

Query  275  LWRDRNFTNFNWYYTINYSEENQGNLQANRLQYFDHNPNLFRKVYLSSSLNGLICFCRFS  454
                 N  + N     ++      N  ++ +     N        L  + NGL+CF  F 
Sbjct  69   KLLRENVISMNLLNLKDHKVHVSDNAISHMVGSHSFN--------LVGTCNGLLCFTSF-  119

Query  455  DRSDEIAIHNLSTRQHI--PLPSNCHYDGSCKMNAFGLLGFDSGSRRYKVLK--------  604
            D+ + I + N  TR+ +  P PS       C +  +G  GFD  +++YKV++        
Sbjct  120  DQGESICVGNPITRELVTLPKPSRTASPEPCTL-VYG-FGFDCLTKKYKVVRIFHPTLSI  177

Query  605  SVEFTTGD-SVSVKHWVFTVGVDKSWRKIHS---SPYYHP  712
               F  G+    +   V+T+G + SW+ +      P+  P
Sbjct  178  PESFRFGNLETRMTAEVYTLGANGSWKAVQGFNRPPFGQP  217



>ref|XP_010046603.1| PREDICTED: uncharacterized protein LOC104435576 [Eucalyptus grandis]
Length=973

 Score = 77.0 bits (188),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 63/221 (29%), Positives = 96/221 (43%), Gaps = 19/221 (9%)
 Frame = +2

Query  95   LPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYPV  274
            +P ++L+EI+ +LP KSL RF+CVS  + SL+ D  F   H   S T P   R+L+  PV
Sbjct  11   IPDDLLIEILRRLPVKSLCRFRCVSTLWRSLISDPRFLAAHLAHSATRP---RLLVTLPV  67

Query  275  LWRDRNFTNFNWYYTINYSEENQGNLQANRLQYFDHNPNLFRKVYLSSSLNGLICFCRFS  454
              +        W ++ ++ E  +   Q        H        Y+S SLNGLIC     
Sbjct  68   --QQVPCPQGRWLFSADHPESGRDRPQIAEPHLLVHGSP---GRYVSQSLNGLICL----  118

Query  455  DRSDEIAIHNLSTRQHIPLPSNCHYDGSCKMNAFGLLGFDSGSRRYKVLKSVEFTTGD--  628
            +    I + N STR+ + L  +    G          GFD   + +KV ++    +G   
Sbjct  119  EVGGLIIVCNPSTRKLVTLGQSKARSGRGCSYCRHSFGFDPVGKEHKVFETWVSDSGKPD  178

Query  629  -SVSVKHWVFTVGVDKSWRKIHSSP---YYHPYNGFNTHFY  739
              + +  +V T+G    WR I   P    + P   FN   Y
Sbjct  179  RGLIMNQFVLTLG-SSGWRGIEGGPPHLKHDPEFCFNGVIY  218


 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 62/219 (28%), Positives = 100/219 (46%), Gaps = 16/219 (7%)
 Frame = +2

Query  101  QEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYPVLW  280
            ++ L+EI  +LP KSL RFKCVS+ + SL+   SF D H   S T P   ++++ +P   
Sbjct  589  EDALIEIQKRLPVKSLCRFKCVSRGWRSLISSRSFIDSHFAHSETRP---KLIVSFPA--  643

Query  281  RDRNFTNFNWYYTINYSEENQGNLQANRLQYFDHNPNLFRKVYLSSSLNGLICFCRFSDR  460
            R+ +  +F     ++ S    G  Q  R      +   +   Y S S+ GL+C     + 
Sbjct  644  RNPDGRSFLRLCLVDQSHPRNGRPQLVRRGLLVPD---WSGYYCSPSVEGLVCL----EV  696

Query  461  SDEIAIHNLSTRQHIPLPSNCHYDGSCKMNAFGLLGFDSGSRRYKVLKSVEFTTGDSVSV  640
            +  + I N ST + +          S    A    GFD   R +KVL +V         +
Sbjct  697  ASGVNICNPSTGKQVTFELPHAAASSAHSQATHSFGFDPVKREHKVLSTVLRPESGHPIM  756

Query  641  KHWVFTVGVDKSWRKIHSSPYYHPYNG---FNTHFYSTS  748
            + WV T+G ++ WR +   P +H  +G   F+   Y T+
Sbjct  757  ESWVLTLGTNE-WRPVEHCPPHHKKDGEFCFDGVLYYTA  794



>ref|XP_010496909.1| PREDICTED: putative F-box protein At4g21240 [Camelina sativa]
Length=375

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 60/215 (28%), Positives = 100/215 (47%), Gaps = 26/215 (12%)
 Frame = +2

Query  92   FLPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYP  271
            ++P ++++EI+S+LPAKS+VRF+CVSK + ++     F       S   PS + ++    
Sbjct  8    WIPLDVMIEILSRLPAKSVVRFRCVSKLWSAVTTTPDFIKSFHTHSSARPSLLLVM----  63

Query  272  VLWRDRNFTNFNWYYTINYSEENQGNLQANRLQYF--DHNPNLFRKVYLSSSLNGLICFC  445
                 +      ++   ++ +  +   + ++ Q       P L     + SS+ GLICF 
Sbjct  64   -----KEEDKRVFFSLPHHQDPARRYTRVDKYQMMLPTKGPKLVGTGKVFSSIRGLICF-  117

Query  446  RFSDRSDEIAIHNLSTRQHIPLPSNCHYDGSCKMNAFGLLGFDSGSRRYKVLKSVEFTTG  625
               D + ++ I N + RQH+ LP     D         LLG+D    +YKVL      +G
Sbjct  118  --EDVNLQVVIWNPTLRQHVVLP-----DPKLSRPLISLLGYDPIDDKYKVL----CMSG  166

Query  626  DSVSVKHWVFTVGVDKSWRKIHS-SPYYHPYNGFN  727
               + +  V T+G  +SWR     SP  H Y G N
Sbjct  167  RRENPR--VLTLGTQESWRMTEPFSPGLHWYGGKN  199



>gb|KDP25256.1| hypothetical protein JCGZ_20412 [Jatropha curcas]
Length=389

 Score = 75.1 bits (183),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 61/208 (29%), Positives = 93/208 (45%), Gaps = 27/208 (13%)
 Frame = +2

Query  95   LPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYPV  274
            +P E +  I ++LP KSLVRF+CV K   S++ + SF   H  +   HP +  ++I    
Sbjct  29   IPPEAIFGIFTRLPVKSLVRFRCVDKLCSSIITNPSFVIAHEPYP--HPKQGLLIICT--  84

Query  275  LWRDRNFTNFNWYYTINYSEENQGNLQANRLQYFDHNPNLFRKVYLSSSLNGLICFCRFS  454
                   T      T   +++N G             P L R  Y + S NG++C     
Sbjct  85   -------TKLQLAQTFFIADQNGGTATCC----LTVPPRLSR--YTTQSTNGIVCM----  127

Query  455  DRSDEIAIHNLSTRQHIPLPSNCHYDGSCKMNAF---GLLGFDSGSRRYKVLKSVEFTTG  625
            D      + N STRQ I LP  C        + +     +GFD  +++YKVL S  +   
Sbjct  128  DFGICATVCNPSTRQAITLPYICSKSSLSASSTYFCVNFMGFDPSNKQYKVLNS--WRHY  185

Query  626  DSVSVKHWVFTVGVDKSWRKIHSSPYYH  709
               S ++ VFT+G  K WR + S P ++
Sbjct  186  RKPSTEYRVFTLGT-KEWRPLQSGPPFY  212



>ref|XP_009772624.1| PREDICTED: putative F-box protein At1g32420 [Nicotiana sylvestris]
Length=360

 Score = 74.7 bits (182),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 66/211 (31%), Positives = 106/211 (50%), Gaps = 19/211 (9%)
 Frame = +2

Query  104  EILVEIVSKLPAKSLVRFKCVSKFFYSLVI-DHSFADLHRNWSLTHPSRMRILILYPVLW  280
            +++ EI++ LPAKSL+RF+CVSK + SL+  +  F  LH   S T P   R+L      +
Sbjct  10   DMIFEILTWLPAKSLMRFRCVSKAWNSLIRHEPDFVKLHNARSQTRPLASRLLFEIGTRY  69

Query  281  RDRNFTNFNWYYTINYSEENQG-NLQANRLQ-YFDHNPNLFRKVYL-SSSLNGLICFCRF  451
             +   +      T N   + +G +LQ  R + YFD     F +V + S+  NGL+CF  +
Sbjct  70   HEVVESR-----TSNLPTQVEGFSLQLARPRHYFD-----FDEVTICSNPCNGLVCF--Y  117

Query  452  SDRSDEIAIHNLSTRQHIPLPSNCHYDGSCKMNAFGLLGFDSGSRRYKVLKSVEFTTGDS  631
            + +     ++N++T +   LPS+       +      LGFD  + RYK+L  V +     
Sbjct  118  NHKDTLSYLYNVTTGEIKALPSSLTRLPKGRRGPTLFLGFDPATERYKLLHFVFYENEKK  177

Query  632  VSVKHWVFTVGVDKSWRKIHSSPYYHPYNGF  724
              +K  + T+G   SWR+I    Y  P+N F
Sbjct  178  PMIK--ILTLGT-TSWRRIQQDEYPLPFNSF  205



>ref|XP_002876140.1| hypothetical protein ARALYDRAFT_906605 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52399.1| hypothetical protein ARALYDRAFT_906605 [Arabidopsis lyrata subsp. 
lyrata]
Length=420

 Score = 74.3 bits (181),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 64/217 (29%), Positives = 105/217 (48%), Gaps = 26/217 (12%)
 Frame = +2

Query  95   LPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYPV  274
            +P+++L+EI+++LPA S+ RFKCVSK + SL+    F +L   + ++ P R       P 
Sbjct  41   IPEDVLMEILARLPANSVTRFKCVSKHWSSLISSRYFTNLF--FEVSSPKREP----RPF  94

Query  275  LWRDRNFTNFNWYYTINYSEENQGNLQANRLQYFDHNPNL-FRKVYLSSSLNGLICFCRF  451
            ++       +    T N       + + + + Y + +  L     Y  +SL GL+CF   
Sbjct  95   MFLSDKGHQYALLSTNN-------SFEVDSVPYLNQDLTLPGMGGYFVNSLRGLMCF---  144

Query  452  SDRSDEIAIHNLSTRQHIPLP---SNCHYDGSCKMNAFGLLGFDSGSRRYKVLKSVEFTT  622
                 E+ I NL+T+Q + LP   SN   +     + +   G DS +  YKVL  V   +
Sbjct  145  -RVGREVRICNLTTKQLVNLPKVKSNLLDEVEGDFHMWNYFGHDSVNDEYKVLSIVWEVS  203

Query  623  GDS--VSVKHWVFTVGVDKSWRKIHSS---PYYHPYN  718
             +   V  +H VF +G   SWR  HS+   P + PY+
Sbjct  204  KEERVVRSEHQVFVLGSGASWRGTHSTIHPPPHRPYS  240



>ref|XP_007217609.1| hypothetical protein PRUPE_ppa017043mg [Prunus persica]
 gb|EMJ18808.1| hypothetical protein PRUPE_ppa017043mg [Prunus persica]
Length=379

 Score = 73.9 bits (180),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 58/206 (28%), Positives = 106/206 (51%), Gaps = 14/206 (7%)
 Frame = +2

Query  92   FLPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYP  271
            ++P+EIL+ I+S+LP KSL+RF CV K + SL+    F  +H N ++T+ +   I+ L+ 
Sbjct  11   YIPEEILINILSRLPVKSLIRFICVCKLWSSLIRSSRFIGMHLNRNVTNHAHAFIIALHE  70

Query  272  VLWRDRNFTNFNWYYTINYSEENQGNLQANRLQYFDHNPNLFR-KVYLSSSLNGLICFC-  445
               + R        YT+  +E  +  L   +L++    P +   K+ +  S NGL+C   
Sbjct  71   SRRKPR------ICYTLFSNETFEPCL---KLKHPSTWPKIIGPKIDIHGSSNGLVCLSY  121

Query  446  RFSDRSDEIAIHNLSTRQHIPLPSNCHYDGSC-KMNAFGLLGFDSGSRRYKVLKSVEFTT  622
               +    I + NLS ++H+ LP        C +   +   GF  G   YKV++ + F+ 
Sbjct  122  ELGNLDTAIYLCNLSIQKHVVLPPTSILCLPCPEYVTYFAFGFHPGLNDYKVVRLLSFSE  181

Query  623  GDSVSVKHWVFTVGVDKSWRKIHSSP  700
            G+   ++  V+++  + SW++I + P
Sbjct  182  GNHC-IEVEVYSLSTN-SWKRIDAIP  205



>ref|XP_002532719.1| ubiquitin-protein ligase, putative [Ricinus communis]
 gb|EEF29668.1| ubiquitin-protein ligase, putative [Ricinus communis]
Length=389

 Score = 73.9 bits (180),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 66/218 (30%), Positives = 105/218 (48%), Gaps = 29/218 (13%)
 Frame = +2

Query  95   LPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYPV  274
            LP E++ EI+ +L AK L+  +CVSK + +L+   +F  LH N S+  P  + I++    
Sbjct  4    LPLEMIAEILCRLTAKKLLCCRCVSKRWRTLIDSPTFIYLHLNHSIESPCNLSIILKSSE  63

Query  275  LWRDRNFTNFNWYYTINYSEENQGNLQANRLQYFDHNPNLFRKVYLSSSLNGLICFCRFS  454
            L            Y++++   +      + L  ++H       V +  S NGL+C C   
Sbjct  64   L------------YSLSFDLLDNIQPLDHPLMCYNHG------VKILGSCNGLLCICNI-  104

Query  455  DRSDEIAIHNLSTRQH--IP-LPSNC-HYDG--SCKMNAFGLLGFDSGSRRYKVLKSVEF  616
               D+IA+ N S R H  +P LP     Y G  SC+++ FG  G+D  +  YK+++  +F
Sbjct  105  --VDDIALWNPSIRAHRVVPYLPVELKRYFGMCSCRVSVFG-FGYDLSNDDYKLVRIAQF  161

Query  617  TTGDSVSVKHWVFTVGVDK-SWRKIHSSPYYHPYNGFN  727
               D  S +  V    + K SWR+I   PY   Y G N
Sbjct  162  GGVDRKSFESEVKVFSLRKNSWRRIADMPYCVLYPGEN  199



>ref|NP_190800.1| putative F-box protein [Arabidopsis thaliana]
 sp|Q9FT50.1|FB202_ARATH RecName: Full=Putative F-box protein At3g52320 [Arabidopsis thaliana]
 emb|CAC07923.1| putative protein [Arabidopsis thaliana]
 gb|AEE78932.1| putative F-box protein [Arabidopsis thaliana]
Length=390

 Score = 73.9 bits (180),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 68/215 (32%), Positives = 102/215 (47%), Gaps = 26/215 (12%)
 Frame = +2

Query  95   LPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYPV  274
            +P+E+L++I+ +LPAKSL+RFKCVSK + SL+    F +         PS    L  Y V
Sbjct  27   IPEEMLIDILIRLPAKSLMRFKCVSKLWLSLITSRYFTN-----RFFKPSSPSCLFAYLV  81

Query  275  LWRDRNFTNFNWYYTINYSEENQGNLQANRLQYFDHNPNL-FRKVYLSSSLNGLICFCRF  451
               DR   N + Y  +  S  ++ +     +   D +  +     YL ++  GL+C+ R 
Sbjct  82   ---DRE--NQSKYLLLQSSSSSRHDHSDTSVSVIDQHSTIPIMGGYLVNAARGLLCY-RT  135

Query  452  SDRSDEIAIHNLSTRQHIPLPSNCHYDGSCKMNAFGLLGFDSGSRRYKVLKSVEFTTGDS  631
              R   + + N STRQ + LP         K N +   G D     YKVL      T + 
Sbjct  136  GRR---VKVCNPSTRQIVELPIM-----RSKTNVWNWFGHDPFHDEYKVLSLFWEVTKEQ  187

Query  632  VSVK--HWVFTVGVDKSWR--KIHSSPY--YHPYN  718
              V+  H V  +GV  SWR  K H +P+  +HPY+
Sbjct  188  TVVRSEHQVLVLGVGASWRNTKSHHTPHRPFHPYS  222



>ref|XP_010484937.1| PREDICTED: F-box protein At1g31080-like [Camelina sativa]
Length=450

 Score = 73.9 bits (180),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 68/227 (30%), Positives = 104/227 (46%), Gaps = 32/227 (14%)
 Frame = +2

Query  95   LPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYPV  274
            +P ++  EI S+LPAKS+ RF+CVSK + S++   SF +L    S   P R+   I  P 
Sbjct  10   IPTDLFNEIFSRLPAKSISRFRCVSKLWDSMLSSPSFTELFLTRSWARP-RLLFAIKQPS  68

Query  275  LWRDRNFTNFNWYYTINYSEENQGNLQANRLQYFDHNP--NLFRKVYLSSSLNGLICFCR  448
             WR        +    N  ++++ +L+          P  ++FR     S  +GL+CF  
Sbjct  69   EWR-------FFSSPQNPDDDDKSSLEVAATDCHVDFPGKSMFRDDCTCSYTSGLLCFPN  121

Query  449  F------SDRSDEIAIHNLSTRQHIPLPSNCHYDGSCKMNAFGLLGFDSGSRRYKVLKSV  610
                       D+  I N +T Q + LP       S +      LGFD+  +R+KVL  V
Sbjct  122  VPILENKGGDVDQCVICNPATGQRVFLPKQKTTGVSSRF----FLGFDTIDKRFKVLHLV  177

Query  611  EFTTGDSV-------SVKHWVFTVGVDK-SWRKIHSSPY---YHPYN  718
            EF+   S           H++ T+G  K SWR+I S P     +P+N
Sbjct  178  EFSRPHSTIPHRFCFETVHYILTLGTGKMSWREI-SCPLELELYPFN  223



>gb|KFK43310.1| hypothetical protein AALP_AA1G107800 [Arabis alpina]
Length=405

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 64/218 (29%), Positives = 103/218 (47%), Gaps = 39/218 (18%)
 Frame = +2

Query  92   FLPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYP  271
            F+P +++ +I+ +LPAKS VRF+CVSK + S+     F    R++S+   SR R+++   
Sbjct  16   FIPLDLIPDILLRLPAKSAVRFRCVSKLWLSITTRPEFI---RSFSIQ--SRRRLMVCTK  70

Query  272  VLWRDRNFTNFNWYYTINYSEENQ------GNLQANRLQYFDHNPNLFRKVYLSSSLNGL  433
                 R+F +      +N  E +        +  ++   Y +H P        S S+ GL
Sbjct  71   TADDKRSFISLP--PNLNTPESHVIDCYMINSPSSDCDGYHNHTP-------FSESVQGL  121

Query  434  ICFCRFSDRSDEIAIHNLSTRQHIPLPS---NCHYDGSCKMNAFGLLGFDSGSRRYKVLK  604
            +C+      S +I + N S RQH+ LP      H+  SC       LG+D    +YKVL 
Sbjct  122  VCY----GDSYKIVVWNPSMRQHVTLPQPEPRAHWVRSC-------LGYDPVEGKYKVL-  169

Query  605  SVEFTTGDSVSVKHWVFTVGVDKSWRKIHSSPYYHPYN  718
               + +G        VFT+G  ++WR  H  P + P N
Sbjct  170  ---YISGKRAK-DPLVFTLGPQETWRLTHDCPVHVPKN  203



>ref|XP_002876155.1| hypothetical protein ARALYDRAFT_906627 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52414.1| hypothetical protein ARALYDRAFT_906627 [Arabidopsis lyrata subsp. 
lyrata]
Length=413

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 67/219 (31%), Positives = 114/219 (52%), Gaps = 23/219 (11%)
 Frame = +2

Query  95   LPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADL-HRNWSLTHPSRMRILILYP  271
            +P+ +L+EI+ +LPAKSL+RFKCVSK +YSL+      ++ H++ S T   R+ + ++  
Sbjct  29   IPENVLMEILPRLPAKSLMRFKCVSKLWYSLISSRYLTNIFHKSSSSTQGRRLFMSLV--  86

Query  272  VLWRDRNFTNFNWYYTINYSEENQGNLQA-NRLQYFDHNPNL-FRKVY--LSSSLNGLIC  439
                D+   N+N Y  ++ S ++   +   + +  FD +  L  R +     ++L GL+C
Sbjct  87   ----DKEM-NYN-YALVSSSRDSVPVISPYDSVPVFDLDQYLDMRGIEGCFVNALRGLVC  140

Query  440  FCRFSDRSDEIAIHNLSTRQHIPLPSNCHYDGSCKM-NAFGLLGFDSGSRRYKVLKSV-E  613
            F R   R   + I NL+TRQH+ LP       +  + N +   G D     YKV  +V E
Sbjct  141  F-RIGTR---VRICNLTTRQHVTLPILRPITVAKPIDNVWNYFGHDPVHDEYKVFSTVWE  196

Query  614  FTTGDS-VSVKHWVFTVGVDKSWRKIHSS---PYYHPYN  718
             +  +  V  +H V  +G + SWR   ++   P + PY+
Sbjct  197  MSEEERVVRSEHHVLVLGPEASWRNTQNTITPPPHRPYS  235



>ref|XP_009119783.1| PREDICTED: putative F-box protein At4g21240 [Brassica rapa]
Length=419

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 60/210 (29%), Positives = 101/210 (48%), Gaps = 26/210 (12%)
 Frame = +2

Query  92   FLPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYP  271
             +P +++ +IV +LPAKS VRF+CVSK + S++    F     +++    SR+R+L+   
Sbjct  29   LIPLDLIHDIVLRLPAKSAVRFRCVSKLWASIITRPYFIT---SFAFMTSSRLRLLVCIK  85

Query  272  VLWRDRNFTNFNWYY--TINYSEENQGNLQANRLQYFDHNPNLFRKVYLSSSLNGLICFC  445
               + R F +   +     +YS+  +  +        ++ P        S S++GLIC  
Sbjct  86   TSDKRRLFVSLPQHEHPHTSYSDVERYQMDPPEFDTGNYEP-------YSESVHGLICCG  138

Query  446  RFSDRSDEIAIHNLSTRQHIPLPSNCHYDGSCKMNAFGLLGFDSGSRRYKVLKSVEFTTG  625
             F     E  + N S RQH+ LP    +    +  ++  LG+D    +YKV      +  
Sbjct  139  NF---MGETVVWNPSMRQHVTLPEPAEF----RFKSY-FLGYDPVEDKYKVFCIASSSNN  190

Query  626  DSVSVKHWVFTVGVDKSWRKIHSSP-YYHP  712
            D +     VFT+G  +SWR I +SP +Y P
Sbjct  191  DPI-----VFTLGPQESWRVIKNSPKHYTP  215



>ref|XP_006403294.1| hypothetical protein EUTSA_v10003391mg [Eutrema salsugineum]
 gb|ESQ44747.1| hypothetical protein EUTSA_v10003391mg [Eutrema salsugineum]
Length=380

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 59/205 (29%), Positives = 95/205 (46%), Gaps = 36/205 (18%)
 Frame = +2

Query  95   LPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYPV  274
            LP +++++I++KLP +S+ +  C+SKF+ S++    FA L+   S T P     L+L+  
Sbjct  29   LPVDLIIQILTKLPPRSVSKLICLSKFWSSIIQGKHFAHLYITRSSTRP-----LLLFQF  83

Query  275  LWRDRNFTNFNWYYTINYSEENQGNLQANRLQYFDHNPNLFRKVYLSSSLNGLICFCRFS  454
              R   F          Y   +Q N  ++ +     NP       +S+   GLIC     
Sbjct  84   FCRATQF----------YRCSSQENPSSDHI----INPKNIPGHIISTPFRGLIC---VR  126

Query  455  DRSDEIAIHNLSTRQHIPLPSNCHYDGSCKMNAFGLLGFDSGSRRYKVLKSVEFTTGDSV  634
            D  +++ + N ST Q + LP               L G+D  +  YKVL     +T    
Sbjct  127  DYDNKLLVGNPSTGQFLALPGG--------QTGSILFGYDPVTDLYKVL-----STSTRK  173

Query  635  SVKHWVFTVGVDKSWRKIHSS-PYY  706
             V+H VFT+G  ++WR IH   P+Y
Sbjct  174  DVQHRVFTLGAQQAWRSIHCKYPHY  198



>ref|XP_010520304.1| PREDICTED: F-box protein At1g30790-like isoform X1 [Tarenaya 
hassleriana]
Length=471

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 63/213 (30%), Positives = 100/213 (47%), Gaps = 26/213 (12%)
 Frame = +2

Query  104  EILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYPVLWR  283
            ++  EI+S+LPAK+LVR +CVSK + S++    FA+     S T P   R+L+ +P   R
Sbjct  100  DLTFEILSRLPAKTLVRSQCVSKDWSSIIHSPHFANSFLARSSTRP---RLLVAFPDTKR  156

Query  284  DRNFTNFNWYYTINYSEENQGNLQANRLQYFDHNPNLFRKVYLSSSLNGLICFCRFSDRS  463
                      +++ YS  +  N   + +    H   +   +  + S++GL C    S  +
Sbjct  157  ---------RHSVLYSSPHPENHGHDSILVASHEMTIPLCLRFTQSIHGLFC----SQNA  203

Query  464  DEIAIHNLSTRQHIPLPSNCHYDGSCKMNAFGLLGFDSGSRRYKVLKSVEFTTGDSV---  634
             E++I N +T++ + LP      GS K   +   G+D  S +YKVL        D V   
Sbjct  204  HELSICNPATKKFVTLPE----IGSKKTLMYSFFGYDHVSHQYKVLSITHNPNYDQVVRE  259

Query  635  --SVKHWVFTV-GVDKSWRKIHSSPYYHPYNGF  724
                +HWVFT+    K WRKI      +P  G 
Sbjct  260  ESDTEHWVFTLSSSQKEWRKIKGIRSEYPSCGL  292



>ref|XP_008391463.1| PREDICTED: F-box protein CPR30-like [Malus domestica]
Length=371

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 61/203 (30%), Positives = 99/203 (49%), Gaps = 22/203 (11%)
 Frame = +2

Query  92   FLPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYP  271
            +LP+EILV I+ +LP KSLVRF CV KF+  L+    F   H + ++T+ +   ++ LY 
Sbjct  11   YLPEEILVNILVRLPVKSLVRFTCVCKFWSDLIQSSRFIGKHLHRNVTNHAHSFVIALY-  69

Query  272  VLWRDRNFTNFNWYYTINYSEENQGNLQANRLQYFDHNPNLFRKVYLSSSLNGLICFC-R  448
                  + +     YT+  +E  +  L+         +P    K+ +  S++GL+C    
Sbjct  70   -----ESTSKPKISYTLLSNETMEPCLKIK-------HPLSGYKIDVHGSVDGLVCLSYE  117

Query  449  FSDRSDEIAIHNLSTRQHIPLPSN---CHYDGSCKMNAFGLLGFDSGSRRYKVLKSVEFT  619
              D    I + NLS R+H+ LP       +   C   +F   GF  G   YKV++ V F 
Sbjct  118  LGDLDTSIYLCNLSIRKHVVLPPTSTLSRHSDVCFTVSF---GFHPGLNDYKVVRMVSFN  174

Query  620  TGDSVSVKHWVFTVGVDKSWRKI  688
             G   S +  V+++   KSW++I
Sbjct  175  GGKLCS-ELEVYSLST-KSWKRI  195



>emb|CDX92334.1| BnaA10g13730D [Brassica napus]
Length=366

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 63/215 (29%), Positives = 101/215 (47%), Gaps = 27/215 (13%)
 Frame = +2

Query  95   LPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYPV  274
            +P +++ EI+S+LPAKS++RF+ VSK + S++     AD     S T P   R+L     
Sbjct  22   IPFDLIFEILSRLPAKSIIRFQSVSKLWSSIIRSKDLADSFLIHSKTRP---RLLF----  74

Query  275  LWRDRNFTNFNWYYTINYSEENQGNLQANRLQYFDHNPNLFRKVYLSS-SLNGLICFCRF  451
                  F +F+      +S       Q +     D   +     Y+ S  +NGLIC  R 
Sbjct  75   -----TFKHFDSRQRFIFSAPEHDTEQNSSTARHDMTISDLVSYYIKSRPVNGLICCTRG  129

Query  452  SDRSDEIAIHNLSTRQHIPLPSNCHYDGSCKMNAFGLLGFDSGSRRYKVL-----KSVEF  616
            S     +A+ N +TR+ + LP +   +G    + +  LG+D    +YKVL        + 
Sbjct  130  S----SVAVCNPTTRKILKLP-DVTLNGR---DMYARLGYDPVQDQYKVLCVMMHDGFDS  181

Query  617  TTGDSVSVKHWVFTVGVDK-SWRKIHSSPYYHPYN  718
             T D++  +H+VFT+G  +  WRKI       PY 
Sbjct  182  RTKDNIEQEHFVFTLGCQRQEWRKIEFIDVGDPYT  216



>ref|XP_002312504.2| hypothetical protein POPTR_0008s14300g [Populus trichocarpa]
 gb|EEE89871.2| hypothetical protein POPTR_0008s14300g [Populus trichocarpa]
Length=433

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 71/243 (29%), Positives = 112/243 (46%), Gaps = 49/243 (20%)
 Frame = +2

Query  95   LPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYPV  274
            +P +++++I+++LPAKS+VRF+CVS+ + S   D  FA LH   SLT  +   +L+ YP 
Sbjct  26   IPDDVILDILTRLPAKSVVRFRCVSRTWCSFTHDPFFASLHHARSLTRDNGSALLLSYP-  84

Query  275  LWRDRNFTNFNWYYTINYSEENQG--NLQANRL-QYFDHNPNLFRKVYLSSSLNGLICFC  445
                      +   + ++ E  QG  NLQ + + Q + H         LS  + G++C  
Sbjct  85   -------DPSSSSTSFSFFERKQGFRNLQISHVDQQYTH---------LSEIIRGILCI-  127

Query  446  RFSDRSDEIAIHNLSTRQHIPLP--------SNCHYDGSCKMNAFGLLGFDSGSRRYKVL  601
                RS  + I N++T++ I LP        S    D           GF+S +R YKVL
Sbjct  128  -NYRRSHRVDICNITTQETITLPRSTNIPIRSGAGVDFDIVYEPRYSFGFNSSTRDYKVL  186

Query  602  KSVEFT---------TGDSV------SVKHWVFTVGVDK---SWRKIHSS-PYYHPYNGF  724
                 T          G S       +V+  +FT+G D+   SWRKI    PY    +G 
Sbjct  187  NICSITRYKLQVNPNNGLSTREVSQRTVEFEIFTIGCDRGAGSWRKIDPGYPYDQELHGL  246

Query  725  NTH  733
            ++ 
Sbjct  247  SSE  249



>ref|XP_010520305.1| PREDICTED: putative F-box protein At1g53550 isoform X2 [Tarenaya 
hassleriana]
Length=450

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 63/213 (30%), Positives = 100/213 (47%), Gaps = 26/213 (12%)
 Frame = +2

Query  104  EILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYPVLWR  283
            ++  EI+S+LPAK+LVR +CVSK + S++    FA+     S T P   R+L+ +P   R
Sbjct  100  DLTFEILSRLPAKTLVRSQCVSKDWSSIIHSPHFANSFLARSSTRP---RLLVAFPDTKR  156

Query  284  DRNFTNFNWYYTINYSEENQGNLQANRLQYFDHNPNLFRKVYLSSSLNGLICFCRFSDRS  463
                      +++ YS  +  N   + +    H   +   +  + S++GL C    S  +
Sbjct  157  R---------HSVLYSSPHPENHGHDSILVASHEMTIPLCLRFTQSIHGLFC----SQNA  203

Query  464  DEIAIHNLSTRQHIPLPSNCHYDGSCKMNAFGLLGFDSGSRRYKVLKSVEFTTGDSV---  634
             E++I N +T++ + LP      GS K   +   G+D  S +YKVL        D V   
Sbjct  204  HELSICNPATKKFVTLPE----IGSKKTLMYSFFGYDHVSHQYKVLSITHNPNYDQVVRE  259

Query  635  --SVKHWVFTV-GVDKSWRKIHSSPYYHPYNGF  724
                +HWVFT+    K WRKI      +P  G 
Sbjct  260  ESDTEHWVFTLSSSQKEWRKIKGIRSEYPSCGL  292



>ref|XP_009626748.1| PREDICTED: putative F-box protein At1g32420 [Nicotiana tomentosiformis]
Length=346

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 59/200 (30%), Positives = 98/200 (49%), Gaps = 15/200 (8%)
 Frame = +2

Query  104  EILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYPVLWR  283
            +I+ +I++ LPAKSL+RFKCVSK  +++  D  F  LH   SL  PS  R+L     L+ 
Sbjct  8    DIVFQILTWLPAKSLMRFKCVSKT-WNIQHDPDFVKLHNARSLARPSTTRVL-----LFE  61

Query  284  DRNFTNFNWYYTINYSEENQGNLQANRLQYFD--HNPNLFRKVYLSSSLNGLICFCRFSD  457
                     Y +I   ++ +  L+   L+     H  N ++    S+  +GL+C   F D
Sbjct  62   VEVCPGGEDYLSI---KKRRPELEGFSLKLLAPRHYFNYYQMSVCSNYCHGLVCLYSFKD  118

Query  458  RSDEIAIHNLSTRQ--HIPLPSNCHYDGSCKMNAFGLLGFDSGSRRYKVLKSVEFTTGDS  631
               +  ++N++T +   +P   N        ++    LGFDS + +YK++         +
Sbjct  119  --TQTYLYNVTTGEIKALPFSMNQEIHAQYPLDPQLFLGFDSITGKYKLVHIFVGKNNGN  176

Query  632  VSVKHWVFTVGVDKSWRKIH  691
              +K  + T+G D SWRKIH
Sbjct  177  RVIKTRILTLGTDSSWRKIH  196



>ref|XP_010520306.1| PREDICTED: putative F-box protein At1g32660 isoform X3 [Tarenaya 
hassleriana]
Length=411

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 61/201 (30%), Positives = 97/201 (48%), Gaps = 26/201 (13%)
 Frame = +2

Query  104  EILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYPVLWR  283
            ++  EI+S+LPAK+LVR +CVSK + S++    FA+     S T P   R+L+ +P   R
Sbjct  100  DLTFEILSRLPAKTLVRSQCVSKDWSSIIHSPHFANSFLARSSTRP---RLLVAFPDTKR  156

Query  284  DRNFTNFNWYYTINYSEENQGNLQANRLQYFDHNPNLFRKVYLSSSLNGLICFCRFSDRS  463
                      +++ YS  +  N   + +    H   +   +  + S++GL C    S  +
Sbjct  157  ---------RHSVLYSSPHPENHGHDSILVASHEMTIPLCLRFTQSIHGLFC----SQNA  203

Query  464  DEIAIHNLSTRQHIPLPSNCHYDGSCKMNAFGLLGFDSGSRRYKVLKSVEFTTGDSV---  634
             E++I N +T++ + LP      GS K   +   G+D  S +YKVL        D V   
Sbjct  204  HELSICNPATKKFVTLPE----IGSKKTLMYSFFGYDHVSHQYKVLSITHNPNYDQVVRE  259

Query  635  --SVKHWVFTV-GVDKSWRKI  688
                +HWVFT+    K WRKI
Sbjct  260  ESDTEHWVFTLSSSQKEWRKI  280



>ref|XP_011045615.1| PREDICTED: F-box/kelch-repeat protein At3g06240-like [Populus 
euphratica]
Length=364

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 66/203 (33%), Positives = 94/203 (46%), Gaps = 14/203 (7%)
 Frame = +2

Query  95   LPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLH--RNWSLTHPSRMRILILY  268
            LPQ+I+V+I+S LP KSLVRFKCV K + SL+ D  F  LH  R     + +R R+L+  
Sbjct  4    LPQDIIVDILSYLPVKSLVRFKCVCKPWQSLISDPRFVKLHLKRAIEGNNINRQRLLVAA  63

Query  269  PVLWRDRNFTNFNWYYTINYSEENQGNLQANRLQYFDHNPNLFRKVYLSSSLNGLICFCR  448
              L+   +F   +    IN   E      A+R + F           +  S +GL+C   
Sbjct  64   EPLYSSVDFEAASDGDDINAVMELPYPSAASRTESFAF-------ASIRGSCDGLVCIRN  116

Query  449  FSDRSDEIAIHNLSTRQHIPLPSNCHYDGSCKMNAFGLLGFDSGSRRYK-VLKSVEFTTG  625
              D  D + + N STR+   LP    Y    K      LG+DS    YK V+  +    G
Sbjct  117  GGDVHD-MFLWNPSTRESKKLPKPSSY--VQKDGFLTGLGYDSTIDDYKLVIACLTTANG  173

Query  626  DSVSVKHWVFTVGVDKSWRKIHS  694
                +   VFT+  + SWR+I  
Sbjct  174  SHKIMAPEVFTLKTN-SWRRIQG  195



>emb|CDY15236.1| BnaC05g01150D [Brassica napus]
Length=421

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 59/210 (28%), Positives = 101/210 (48%), Gaps = 26/210 (12%)
 Frame = +2

Query  92   FLPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYP  271
             +P +++ +IV +LPAKS VRF+CVSK +  ++   +  D   +++    SR+R+L+   
Sbjct  31   LIPLDLIHDIVLRLPAKSAVRFRCVSKLWAFII---TRPDFITSFAFMSSSRLRLLVCIK  87

Query  272  VLWRDRNFTNFNWYY--TINYSEENQGNLQANRLQYFDHNPNLFRKVYLSSSLNGLICFC  445
               + R F +   +     +YS+  +  +        ++ P        S S++GLIC  
Sbjct  88   TSDKRRLFVSLPQHEHPHTSYSDVERYQMDPPEFDTGNYEP-------YSESVHGLICCG  140

Query  446  RFSDRSDEIAIHNLSTRQHIPLPSNCHYDGSCKMNAFGLLGFDSGSRRYKVLKSVEFTTG  625
             F     E  + N S RQH+ LP    +    +  ++  LG+D    +YKV      +  
Sbjct  141  NF---MGETVVWNPSMRQHVTLPEPAEF----RFKSY-FLGYDPVEDKYKVFCITSSSNN  192

Query  626  DSVSVKHWVFTVGVDKSWRKIHSSP-YYHP  712
            D +     VFT+G  +SWR I +SP +Y P
Sbjct  193  DPI-----VFTLGPQESWRVIKNSPKHYTP  217



>gb|KCW86406.1| hypothetical protein EUGRSUZ_B03076, partial [Eucalyptus grandis]
Length=383

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 62/216 (29%), Positives = 98/216 (45%), Gaps = 16/216 (7%)
 Frame = +2

Query  110  LVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYPVLWRDR  289
            L+EI  +LP KSL RFKCVS+ + SL+   SF D H   S T P   ++++ +P   R+ 
Sbjct  2    LIEIQKRLPVKSLCRFKCVSRGWRSLISSRSFIDSHFAHSETRP---KLIVSFPA--RNP  56

Query  290  NFTNFNWYYTINYSEENQGNLQANRLQYFDHNPNLFRKVYLSSSLNGLICFCRFSDRSDE  469
            +  +F     ++ S    G  Q  R      +   +   Y S S+ GL+C     + +  
Sbjct  57   DGRSFLRLCLVDQSHPRNGRPQLVRRGLLVPD---WSGYYCSPSVEGLVCL----EVASG  109

Query  470  IAIHNLSTRQHIPLPSNCHYDGSCKMNAFGLLGFDSGSRRYKVLKSVEFTTGDSVSVKHW  649
            + I N ST + +          S    A    GFD   R +KVL +V         ++ W
Sbjct  110  VNICNPSTGKQVTFELPHAAASSAHSQATHSFGFDPVKREHKVLSTVLRPESGHPIMESW  169

Query  650  VFTVGVDKSWRKIHSSPYYHPYNG---FNTHFYSTS  748
            V T+G ++ WR +   P +H  +G   F+   Y T+
Sbjct  170  VLTLGTNE-WRPVEHCPPHHKKDGEFCFDGVLYYTA  204



>ref|XP_008341088.1| PREDICTED: F-box protein CPR30-like [Malus domestica]
Length=251

 Score = 70.5 bits (171),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 68/221 (31%), Positives = 107/221 (48%), Gaps = 29/221 (13%)
 Frame = +2

Query  98   PQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSL-THPSRMRILILYPV  274
            P EIL +I+S+LP K L+   CVSK +Y+++ DH F   H   S+ T+ +R  +L     
Sbjct  7    PPEILFDILSRLPPKDLIXILCVSKSWYAIIHDHHFIKAHLQRSIQTNSARTLLLRSNSA  66

Query  275  LWRDRNFTNFNWYYTINY-SEENQGNLQANRLQYFDHNPNLFRKVYLSSSLNGLICF--C  445
            LW D        +Y++++  +E  G L    ++     P  + +  L  S+NG++C   C
Sbjct  67   LWSD--------FYSLSFNGDEAFGTLVP--IERPLKXPGDYLE-XLGCSVNGVVCIHDC  115

Query  446  RFSDRSDEIAIHNLSTR--QHIPLPSNCHYDGSCKMNAFGLLGF--DSGSRRYKVLKSVE  613
              +D    + + N S +  + IPLP+  H   S   N + L GF  DS +  +KVL+  +
Sbjct  116  ECTD----VCLWNTSIQKLKKIPLPTLEHQPPS-YSNRYTLFGFGYDSANDDFKVLRITQ  170

Query  614  FTTGDSVSVKHWVFTVGVDK-SWRKIHSSPYYHPYNGFNTH  733
            F      SV   V    +   SW+KI S     P  GF+ H
Sbjct  171  FENRKRESVDSQVGVYSLKSNSWKKIQS----LPCRGFSVH  207



>ref|XP_010048538.1| PREDICTED: F-box/kelch-repeat protein At3g06240-like isoform 
X1 [Eucalyptus grandis]
Length=376

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 64/215 (30%), Positives = 101/215 (47%), Gaps = 26/215 (12%)
 Frame = +2

Query  95   LPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYPV  274
            LP+EIL++I+ KLP KSLVRF+CVSK + SL+   SF  LH   ++    R  IL+    
Sbjct  7    LPEEILIQILLKLPVKSLVRFRCVSKSWDSLITHPSFVSLHLRHAMAGHDRSVILL----  62

Query  275  LWRDRNFTNFNWYYTINYSEENQGNLQANRLQYFDHNPNLFRKVYLSSSLNGLICFCRFS  454
              R  + T      T+    E+   L+   L++     + +   YL+ S NGL+CF  + 
Sbjct  63   --RHYSLTQRKERNTLYLDGES--FLEHQELEFPLKTHDTY---YLAGSCNGLLCFSDYI  115

Query  455  DRSDEIAIHNLSTRQHIPLPSNCHYDGSCKMNAFGLLGFDSGSRRYKVLKSVEFTTGDSV  634
              + ++ + N S R+ + LP     D           GFD+    YKV++ + +  G   
Sbjct  116  INNLQVILWNPSLRKCVQLPIPRFIDTDLTHTYVLGFGFDTRRVDYKVVRLI-YILG---  171

Query  635  SVKHWVFTVGVD--------KSWRKIHSS-PYYHP  712
              K+W   V  +         +WR I ++ PY  P
Sbjct  172  --KNWSVIVPPEVEIYELKTNAWRGIQTAVPYVIP  204



>emb|CDX89978.1| BnaA10g01040D [Brassica napus]
Length=419

 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 59/210 (28%), Positives = 101/210 (48%), Gaps = 26/210 (12%)
 Frame = +2

Query  92   FLPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYP  271
             +P +++ +IV +LPAKS VRF+CVSK +  ++   +  D   +++    SR+R+L+   
Sbjct  29   LIPLDLIHDIVLRLPAKSAVRFRCVSKLWAFII---TRPDFITSFAFMSSSRLRLLVCIK  85

Query  272  VLWRDRNFTNFNWYY--TINYSEENQGNLQANRLQYFDHNPNLFRKVYLSSSLNGLICFC  445
               + R F +   +     +YS+  +  +        ++ P        S S++GLIC  
Sbjct  86   TSDKRRLFVSLPQHEHPHTSYSDVERYQMDPPEFDTGNYEP-------YSESVHGLICCG  138

Query  446  RFSDRSDEIAIHNLSTRQHIPLPSNCHYDGSCKMNAFGLLGFDSGSRRYKVLKSVEFTTG  625
             F     E  + N S RQH+ LP    +    +  ++  LG+D    +YKV      +  
Sbjct  139  NF---MGETVVWNPSMRQHVTLPEPAEF----RFKSY-FLGYDPVEDKYKVFCITSSSNN  190

Query  626  DSVSVKHWVFTVGVDKSWRKIHSSP-YYHP  712
            D +     VFT+G  +SWR I +SP +Y P
Sbjct  191  DPI-----VFTLGPQESWRVIKNSPKHYTP  215



>ref|XP_009120634.1| PREDICTED: F-box protein At1g30790-like [Brassica rapa]
Length=411

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 64/215 (30%), Positives = 100/215 (47%), Gaps = 27/215 (13%)
 Frame = +2

Query  95   LPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYPV  274
            +P ++  EI+S+LPAKS++RF+ VSK + S++     AD     S T P   R+L     
Sbjct  22   IPFDLTFEILSRLPAKSIIRFQSVSKLWSSIIRSKDLADSFLIHSKTRP---RLLF----  74

Query  275  LWRDRNFTNFNWYYTINYSEENQGNLQANRLQYFDHNPNLFRKVYLSS-SLNGLICFCRF  451
                  F +F+      +S       + +     D   +     Y+ S  +NGLIC  R 
Sbjct  75   -----TFKHFDSRQRFIFSAPEHDTEENSSTARHDMTISDLVSYYIKSRPVNGLICCTRG  129

Query  452  SDRSDEIAIHNLSTRQHIPLPSNCHYDGSCKMNAFGLLGFDSGSRRYKVL-----KSVEF  616
            S     IA+ N +TRQ + LP +   +G    + +  LG+D    +YKVL        + 
Sbjct  130  S----SIAVCNPTTRQILKLP-DVTLNGR---DMYARLGYDPVQDQYKVLCVMMHDGFDS  181

Query  617  TTGDSVSVKHWVFTVGV-DKSWRKIHSSPYYHPYN  718
             T D++  +H+VFT+G   + WRKI       PY 
Sbjct  182  RTKDNIEQEHFVFTLGCQQQEWRKIEFIDVGDPYT  216



>gb|KDO49218.1| hypothetical protein CISIN_1g037535mg, partial [Citrus sinensis]
Length=216

 Score = 70.1 bits (170),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 68/221 (31%), Positives = 109/221 (49%), Gaps = 30/221 (14%)
 Frame = +2

Query  95   LPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILI---L  265
            LP +I ++I+S+LP KSL+RFKC+SK F SL+    F  +H   S+   S + +++    
Sbjct  4    LPTDIKIDILSRLPVKSLLRFKCMSKSFCSLIASQEFIKIHLKRSIETNSNLSLILSGTP  63

Query  266  YPVLWRDRNFTNFNWYYTINYSEENQGNLQANRLQYFDHN-PNLFRKVYLSSSLNGLICF  442
             P+L   R      W   I  +  +  NL        DH   N   +  +  S NGLI  
Sbjct  64   APILDSSR-----YWNGKIFSASLDSLNLGVE----LDHPFKNCKGRTPIIDSCNGLIAL  114

Query  443  CRFSDRSDE--IAIHNLSTRQHIPLPSNCHYDGSCKMNAFGLL---GFDSGSRRYKVLKS  607
                 ++DE  IA  N ST++H+ LP    Y G  K   + ++   G+D+ +  YKV++ 
Sbjct  115  -----KNDENGIAFWNPSTKEHLILPK---YWGDLKDKVYMVVDGFGYDAVNDDYKVVRL  166

Query  608  VEFTTGDSVSVKHWVFTVGVDKSWRKIHSS-PYY--HPYNG  721
            V F   +    +  V+++  + SWR+I    PYY  H ++G
Sbjct  167  VHFVRENVEYTEVSVYSLRTN-SWRRIRVDFPYYILHGWDG  206



>ref|XP_009609989.1| PREDICTED: putative F-box protein At1g50870 [Nicotiana tomentosiformis]
Length=364

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 63/204 (31%), Positives = 101/204 (50%), Gaps = 22/204 (11%)
 Frame = +2

Query  101  QEILVEIVSKLPAKSLVRFKCVSKFFYSLVI-DHSFADLHRNWSLTHPSRMRILILYPVL  277
            ++++ E+++ LPAKSL+RF+CVSK + S +  D  F  LH   S T P   R  +L+ + 
Sbjct  26   RDMIFEVLTWLPAKSLMRFRCVSKAWNSFIRHDPHFVKLHNARSQTRPLASR--LLFEIG  83

Query  278  WRDRNFTNFNWYYTINYSEENQG-NLQANRLQ-YFDHNPNLFRKVYLSSSLNGLICFCRF  451
             R R         T N+  + +G +LQ  R + YFD N         S+  NGL+CF  +
Sbjct  84   TRHREVVE----STSNFPTQLEGFSLQLARPRHYFDFN----EITICSNHCNGLVCF--Y  133

Query  452  SDRSDEIAIHNLSTRQHIPLPSNCHYDGSCKMNAFGLLGFDSGSRRYKVLKSVEFTTGDS  631
            + +  +  ++N++T +   LPS+           F  LGFD  + RYK+L  + +T    
Sbjct  134  NRKDTQSYLYNVTTGEIKALPSSLRLPKGSGPTLF--LGFDQATERYKLLHVIFYTKKPR  191

Query  632  VSVKHWVFTVGVDKSWRKIHSSPY  703
            +     + T+G   SWR I    Y
Sbjct  192  IK----ILTLGTT-SWRIIRGDQY  210



>ref|XP_006391500.1| hypothetical protein EUTSA_v10019615mg [Eutrema salsugineum]
 gb|ESQ28786.1| hypothetical protein EUTSA_v10019615mg [Eutrema salsugineum]
Length=400

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 63/212 (30%), Positives = 98/212 (46%), Gaps = 19/212 (9%)
 Frame = +2

Query  95   LPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYPV  274
            + +E+L+EI+++LP KSL+ FKCVSK + SL+    F DL     L   SR R    Y V
Sbjct  29   ISEELLIEILTRLPVKSLMTFKCVSKLWLSLIASRYFTDLF----LKSSSRRRRFFAYLV  84

Query  275  LWRDRNFTNFNWYYTINYSEENQGNLQANRLQYFDHNPNLFR-KVYLSSSLNGLICFCRF  451
               DR  T   +    + ++ +  +     +   D +  + + +    S+ +GL CF   
Sbjct  85   ---DRE-TRIKYALLASSTDLDHSD---TTVSVIDQDLAMSKTEGCFVSAAHGLACF---  134

Query  452  SDRSDEIAIHNLSTRQHIPLPSNCHYDGSCKMNAFGLLGFDSGSRRYKVLKSVEFTTGDS  631
                + + I NL TRQ + LP    ++     N +   G D  +  YKVL  V   T + 
Sbjct  135  -RIGESVRICNLHTRQVLELPVML-FETKVNYNMWNYFGHDPVNDEYKVLSVVWDLTKEK  192

Query  632  --VSVKHWVFTVGVDKSWRKIHSSPYYHPYNG  721
              V  +H V  +G   SWRKI     + P +G
Sbjct  193  RVVRSEHQVLVLGAGASWRKIQCHIPHCPGSG  224



>gb|KFK30034.1| hypothetical protein AALP_AA7G209000 [Arabis alpina]
Length=403

 Score = 71.6 bits (174),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 63/217 (29%), Positives = 111/217 (51%), Gaps = 26/217 (12%)
 Frame = +2

Query  92   FLPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYP  271
             LP ++++EI+S+LPAKS+ R +CVSK + S++    F +L     LT  +  +  +L+ 
Sbjct  27   LLPIDLIIEILSRLPAKSIARCRCVSKLWGSIIRSQVFTEL----VLTRSATTQPHLLFA  82

Query  272  VLWRDRNFTNFNWYYTINYSEENQGNLQAN-RLQY-FDHNPNLFRKVYLSSSLNGLICFC  445
                ++N   F +Y +     E    + AN  +++ FD +  + R V+      GLIC  
Sbjct  83   C---EKNGEVF-FYSSPQNPYEKSSPITANYHMKFPFDDDDFVLRPVH------GLICLK  132

Query  446  R---FSDR-SDEIAIHNLSTRQHIPLPSNCHYDGSCKMNAFGLLGFDSGSRRYKVLKSVE  613
            +   F  R +  + I N ST Q + LP       + +++    LG+D   +++K+L    
Sbjct  133  QIRIFKGRNTTALMICNPSTGQSLTLPRV----KTRRVDVMSFLGYDPVGKQFKLLSMTS  188

Query  614  FTTG-DSVSVKHWVFTVGVDK-SWRKIHSSPYYHPYN  718
              +G + VS +H + T+G  K SWRKI  S  ++P +
Sbjct  189  SISGSNRVSAEHQILTLGNGKLSWRKIECSTPHYPLS  225



>ref|XP_006373076.1| hypothetical protein POPTR_0017s08480g [Populus trichocarpa]
 gb|ERP50873.1| hypothetical protein POPTR_0017s08480g [Populus trichocarpa]
Length=360

 Score = 71.2 bits (173),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 65/215 (30%), Positives = 105/215 (49%), Gaps = 40/215 (19%)
 Frame = +2

Query  95   LPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLH--RNWSLTHPSRMRILILY  268
            LPQEI+V+I++ LPAKSL++FKCV + + SL+ D  FA LH  R     + +R R+LI  
Sbjct  4    LPQEIIVDILTYLPAKSLIKFKCVCRSWRSLISDPQFAKLHLKRAHEDENINRQRLLIAA  63

Query  269  PVLWRDRNFTNFNWYYTINYSEENQGNLQANRLQYF------DHNPNLFRKVYLSSSLNG  430
              L            Y++++   + G+   N L          HN +    ++L S  +G
Sbjct  64   DPL------------YSVDFEAASDGD-NGNTLVKLSYPNAESHNDSFAVGLFLGSC-DG  109

Query  431  LICFCRFSDRSDEIAIHNLSTRQHIPL---PSNCHYDGSCKMNAFGLLGFDSGSRRYKVL  601
            ++C     +  D + + N STR+   L    S+ H D S        LG+DS +  YK++
Sbjct  110  IVCIL---NEVDSVVLWNPSTRESKKLSGPTSSLHKDFSTG------LGYDSSTDDYKMV  160

Query  602  ---KSVEFTTGDSVSVKHWVFTVGVDKSWRKIHSS  697
                +   T  D + V+  VFT+  + +WR +  S
Sbjct  161  IASSATASTRSDQIMVE--VFTLKTN-TWRTVQGS  192



>ref|XP_008228271.1| PREDICTED: F-box protein CPR30-like [Prunus mume]
Length=379

 Score = 71.2 bits (173),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 55/206 (27%), Positives = 106/206 (51%), Gaps = 14/206 (7%)
 Frame = +2

Query  92   FLPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYP  271
            ++P EIL+ I+S+LP KSL+RF CV K + SL+    F  +H N ++T+ +   I+ L+ 
Sbjct  11   YIPDEILINILSRLPVKSLIRFICVCKLWSSLIRSSRFIGMHLNRNVTNHAHAFIIALHE  70

Query  272  VLWRDRNFTNFNWYYTINYSEENQGNLQANRLQYFDHNPNLFR-KVYLSSSLNGLICFC-  445
               + +      + YT+  +E  +  L   ++++    P +   K+ +  S NGL+C   
Sbjct  71   SRRKPK------FCYTLFSNETFEPCL---KIKHPSTWPKIIGPKIDIHGSSNGLVCLSY  121

Query  446  RFSDRSDEIAIHNLSTRQHIPLPSNCHYDGSC-KMNAFGLLGFDSGSRRYKVLKSVEFTT  622
               +    I + NLS ++H+ LP        C +   +   GF  G   Y+V++ + F+ 
Sbjct  122  ELGNLDTAIYLCNLSIQKHVVLPPTSILCLPCPEYVTYVAFGFHPGLNDYRVVRLLSFSE  181

Query  623  GDSVSVKHWVFTVGVDKSWRKIHSSP  700
            G+   ++  V+++  + SW++I + P
Sbjct  182  GNH-CIEVEVYSLSTN-SWKRIDAIP  205



>ref|XP_007021323.1| F-box and associated interaction domains-containing protein, 
putative isoform 1 [Theobroma cacao]
 ref|XP_007021324.1| F-box and associated interaction domains-containing protein, 
putative isoform 1 [Theobroma cacao]
 ref|XP_007021325.1| F-box and associated interaction domains-containing protein, 
putative isoform 1 [Theobroma cacao]
 gb|EOY12848.1| F-box and associated interaction domains-containing protein, 
putative isoform 1 [Theobroma cacao]
 gb|EOY12849.1| F-box and associated interaction domains-containing protein, 
putative isoform 1 [Theobroma cacao]
 gb|EOY12850.1| F-box and associated interaction domains-containing protein, 
putative isoform 1 [Theobroma cacao]
Length=398

 Score = 71.2 bits (173),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 67/225 (30%), Positives = 107/225 (48%), Gaps = 25/225 (11%)
 Frame = +2

Query  92   FLPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYP  271
            +LPQE+++EI+ +LP KSLV+ + V K + SL+   SF   H   +L+ P+   +L+   
Sbjct  4    YLPQEVILEILRRLPVKSLVKCRSVCKAWNSLIKSPSFISSHLQTALSKPNDHLLLL---  60

Query  272  VLWRDRNFTNFNWYYTINYSEENQGNLQANRLQY-FDHNPNLFRKVYLSSSLNGLICFCR  448
                 R F N    Y +++  +N    +  +L + F  N   FR   L  S NGL+C   
Sbjct  61   -----RLFENDKESYFLHF--DNDDFDEYKQLHFPFKSNSPWFR---LVGSCNGLVCLQD  110

Query  449  --FSDRSDEIAIHNLSTRQHI--PLPSNCHYDGSCKMNAFGLLGFDSGSRRYKVLKSVEF  616
              F   S E+ + N S +++I  P P      G    +  G  GFDS +  YK+L  V  
Sbjct  111  GFFPLDSVELILWNPSIQKYITLPKPGVTCLSGRAYNSTLG-FGFDSRTNDYKLLNVVSM  169

Query  617  TTGDSVSVKHWVFTVGVD-KSWRKIHS-SPYYHPYNGFNTHFYST  745
            + G+       V+   +D  SW+++ + SP Y    G   H +S 
Sbjct  170  SVGEEAETLTEVYLFSLDGNSWKRVTAISPKY----GIEGHEFSA  210



>gb|EMT01351.1| hypothetical protein F775_15769 [Aegilops tauschii]
Length=371

 Score = 70.9 bits (172),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 62/212 (29%), Positives = 90/212 (42%), Gaps = 25/212 (12%)
 Frame = +2

Query  92   FLPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYP  271
            +LP  ++  I+S LP+KS +R K V K ++++V D  F   H   S   P+    ++L P
Sbjct  39   YLPDAVISNILSWLPSKSAIRCKAVCKAWHAMVSDRHFVSDHLERSKERPA----VLLLP  94

Query  272  VLW--RDRNFTNFNW---YYTINYSEENQGNLQANRLQYFDHNPNLFRKVYLSSSLNGLI  436
              +  R+ N     W   YY       N G      L Y +H P    +  L    +GLI
Sbjct  95   CAYSRREHNVLMSLWIDFYY-------NSGGGDMTELMYREHIPKSIGQCTLPLHCDGLI  147

Query  437  CFCRFSDRSDEIAIHNLSTRQHIPLPSNCHYDGSCKMNAFGLLGFDSGSRRYKVLK---S  607
                 S    E+ + N +TR+ +  P   H     K    G LGFD  S +YKV +    
Sbjct  148  ---LTSTLDQEVMVCNPATREFVTSPKGSHNLN--KRPRVG-LGFDPSSSKYKVARFFYQ  201

Query  608  VEFTTGDSVSVKHWVFTVGVDKSWRKIHSSPY  703
            VE         +  V T+G D  WR+    PY
Sbjct  202  VEDGKTSQPICRFEVLTLGTDNEWRRTVDPPY  233



>ref|XP_007036154.1| F-box and associated interaction domains-containing-like protein 
[Theobroma cacao]
 gb|EOY20655.1| F-box and associated interaction domains-containing-like protein 
[Theobroma cacao]
Length=370

 Score = 70.9 bits (172),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 56/209 (27%), Positives = 98/209 (47%), Gaps = 16/209 (8%)
 Frame = +2

Query  95   LPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYPV  274
            +P +++ +I + LP KSLVRF+CVS+   S++    FA +H +      SR  +L    +
Sbjct  7    IPFDVIFDIFTDLPVKSLVRFRCVSRICSSIITCQDFAKMHSSPYSRIKSR-SLLTPTII  65

Query  275  LWRDRNFTNFNWYYTINYSEENQGNLQANRLQYFDHNPNLFRKVYLSSSLNGLICFCRFS  454
            +       +   +++   +E ++G++  + +      P   R  Y + S+NG+IC     
Sbjct  66   ISCSTELQSAQMFFS---AELHEGSVSVSAVHLRTIPPRFSR--YTTPSVNGIICM----  116

Query  455  DRSDEIAIHNLSTRQHIPLPSNCHYDGSCKMN---AFGLLGFDSGSRRYKVLKSVEFTTG  625
            D      I N STRQ I LP  C  +     +        GFD  +  YKVL +   +  
Sbjct  117  DFGLCATIFNPSTRQAITLPFVCPPNSPAAASTSFCVNSFGFDPITECYKVLNTWAVSGK  176

Query  626  DSVSVKHWVFTVGVDKSWRKIHSSPYYHP  712
               + ++ V+T+G + SWR +   P + P
Sbjct  177  ---ATEYRVYTLGTNNSWRLLGGGPSHSP  202



>ref|XP_010519757.1| PREDICTED: F-box protein DOR-like [Tarenaya hassleriana]
Length=452

 Score = 71.2 bits (173),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 60/211 (28%), Positives = 100/211 (47%), Gaps = 24/211 (11%)
 Frame = +2

Query  95   LPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYPV  274
            +P ++ V+I+++LP KSLVRF CVSK + S +    FA+     SLT P   R+L+    
Sbjct  95   IPLDLTVDILTRLPVKSLVRFLCVSKGWSSTISGRDFANSFMTRSLTRP---RLLL----  147

Query  275  LWRDRNFTNFNWYYTINYSEENQGNLQANRLQYFDHNPNLFRKVYLSSSLNGLICFCRFS  454
                  F   N Y   + +     +++++ +  + ++ N    V  +  + GL+C     
Sbjct  148  -----TFIANNKYVFFSLTHPQNSDMESSSVATYVYDMNW--SVDWAHPVRGLVCV----  196

Query  455  DRSDEIAIHNLSTRQHIPLPSNCHYDGSCKMNAFGLLGFDSGSRRYKVLKSVEFTTGDSV  634
                 +AI N ST Q I LP       + + +     G+D    +YKVL S+       V
Sbjct  197  GSPPNLAICNPSTNQFITLPKV----KTRRKDIHSFFGYDPIDDQYKVL-SMTVAKRREV  251

Query  635  SVKHWVFTVGVDKSWRKIHSS-PYYHPYNGF  724
            + +H V T+G  K+WR I S+ P++    G 
Sbjct  252  AEEHQVLTLGTRKTWRMIESTFPHWPRIEGL  282



>ref|XP_010431562.1| PREDICTED: F-box protein At2g21930-like [Camelina sativa]
Length=402

 Score = 70.9 bits (172),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 56/210 (27%), Positives = 97/210 (46%), Gaps = 25/210 (12%)
 Frame = +2

Query  95   LPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYPV  274
            +P +++ EI   LP KSL RF CVSK + S + +  F   +   S   P  +        
Sbjct  27   IPADVIQEIFKGLPVKSLARFVCVSKEYASFIRNRDFVKTYLMKSSDSPQSL--------  78

Query  275  LWRDRNFTNFNWYYTINYSEENQGNLQANRLQYFDHNPNLFRKVYLSSSLNGLICFCRFS  454
            ++     ++   ++  +   +++G L ++ L  +    +       + S+NGLIC+    
Sbjct  79   IFTFEGKSSGKHFFFSSLQPQDRGELVSSALAVYHMKCHFHPYKTFAPSVNGLICY----  134

Query  455  DRSDEIAIHNLSTRQHIPLPSNCHYDGSCKMNAFGLLGFDSGSRRYKVLKSVEFTTGDSV  634
              S ++ ++N STR+ I LP       S +++ +  LG+D     YKVL     T GD V
Sbjct  135  GPSCKLMVYNPSTRRSITLPKI----ESMRIDIYHFLGYDPIDGDYKVLC---MTKGDPV  187

Query  635  SVKHW------VFTVGVDKSWRKIHSSPYY  706
              ++       + T+G DKSWR I   P +
Sbjct  188  GKRYGLAQELRLLTLGKDKSWRMIEDFPLH  217



>emb|CDY09166.1| BnaA02g05920D [Brassica napus]
Length=396

 Score = 70.9 bits (172),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 63/211 (30%), Positives = 101/211 (48%), Gaps = 28/211 (13%)
 Frame = +2

Query  95   LPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYPV  274
            +P +I++EI+S LPAKSL+R +  SK ++S +   +F DL    S T P   R+L+ Y  
Sbjct  26   IPFDIIIEILSFLPAKSLIRLQSGSKLWFSTIRTKNFIDLFLARSKTRP---RLLLPYMH  82

Query  275  LWRDRNFTNFNWYYTINYSEENQGNLQANRLQYFDHNPNLFRKVY--LSSSLNGLICFCR  448
            +   + F        ++  E N+   ++       H+  +   +Y  +S  +NGLIC  R
Sbjct  83   VESKKRF-------ILSAPEHNKEEDKSASTVTLRHDMTILDPLYYVISRPVNGLICCVR  135

Query  449  FSDRSDEIAIHNLSTRQHIPLPSNCHYDGSCKMNAFGLLGFDSGSRRYKVL--KSVEFTT  622
             S     I++ N +TRQ + LP      G    + +  LG+D    +YKVL     +F +
Sbjct  136  DSS----ISVCNPATRQIVKLPDVTLNGG----DMYARLGYDPVEDQYKVLCVMIAKFNS  187

Query  623  ----GDSVSVKHWVFTV--GVDKSWRKIHSS  697
                G     +H V TV     + WRKI +S
Sbjct  188  FGPYGQDTRQEHLVCTVTSSEKQEWRKIENS  218



>ref|XP_006447718.1| hypothetical protein CICLE_v10015458mg [Citrus clementina]
 ref|XP_006469543.1| PREDICTED: F-box protein At3g07870-like [Citrus sinensis]
 gb|ESR60958.1| hypothetical protein CICLE_v10015458mg [Citrus clementina]
Length=405

 Score = 70.9 bits (172),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 60/214 (28%), Positives = 99/214 (46%), Gaps = 35/214 (16%)
 Frame = +2

Query  95   LPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYPV  274
            LP  ILV+I S+LP K++++ KCV K ++SL  D  FA +H        +R    I+   
Sbjct  42   LPLPILVDIFSRLPIKTILQIKCVCKSWHSLCSDPYFAKIHL-------ARAPFSIMILE  94

Query  275  LWRDRNFTNFNWYYTINYSEENQGNLQANRLQYFDHNPNLFRKVYLSSSLNGLICFCRFS  454
             +  R +TN                   + +  F  N     ++ L SS NGLIC   FS
Sbjct  95   KFCKRIYTN-------------------SLVPLFTLNQGDKERLSLLSSCNGLICLHEFS  135

Query  455  DRSDEIAIHNLSTRQHIPLPSNCHYDGSCKMNAFGLLGFDSGSRRYKVLKSVEFTTGDSV  634
             + D I++ N     H+ LP       + ++  F   G++  + +YKV++ + +    ++
Sbjct  136  YKQDVISVWNPILGDHLVLPQPKRKSVATRIRGF---GYNQSTNQYKVIQILSYKDQAAI  192

Query  635  S---VKHWVFTVGVDKSWRKIHSSPYY--HPYNG  721
            S   ++  V T+G + +WR I   PY    PY G
Sbjct  193  SSSKLQVEVHTIGTN-TWRNIGDLPYVLNQPYYG  225



>ref|XP_006663850.1| PREDICTED: putative F-box protein At3g52320-like [Oryza brachyantha]
Length=407

 Score = 70.9 bits (172),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 59/209 (28%), Positives = 103/209 (49%), Gaps = 19/209 (9%)
 Frame = +2

Query  92   FLPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYP  271
            ++P  ++  I+ +LP++SL+RFKCV K +Y+++    F   H   S   PS    +++ P
Sbjct  33   YIPDNVMFNIMLRLPSRSLIRFKCVCKAWYAMISSQFFVHAHLEQSKLKPSS---VLMAP  89

Query  272  VLW-RDRNFTNFNWYYTINYSEENQGNLQANRLQYFDHN-PNLFRKVYLSSSLNGLICFC  445
              + + RN   F +  ++    + QGN     L  F ++ P +          NGL+   
Sbjct  90   GFYKKQRNGQKFAFLMSL---YKYQGNNIMQHLHDFPYDFPQILDTWSRPVHCNGLL---  143

Query  446  RFSDRSDEIAIHNLSTRQHIPLPSNCHYDGSCKMNAFGLLGFDSGSRRYKVLK---SVEF  616
              SD  D++ I+N ST + + LP         + + F   GFD+ S++YKV K     ++
Sbjct  144  FVSDMKDKMLIYNPSTTEVVSLPKGSPNLYKSRGHGF---GFDNHSKKYKVTKVYYQRDY  200

Query  617  TTGDSVSVKHWVFTVGVDKSWRKIHSSPY  703
             T   V+ K  V T+G ++ WR++   PY
Sbjct  201  ETS-LVTCKCEVLTLGTNE-WRQMEDPPY  227



>ref|XP_009119666.1| PREDICTED: putative F-box protein At4g21240 [Brassica rapa]
Length=414

 Score = 70.9 bits (172),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 65/212 (31%), Positives = 102/212 (48%), Gaps = 28/212 (13%)
 Frame = +2

Query  95   LPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYPV  274
            L  ++ +EI+ +LPAKS VRF+CVSK + S+     F    R++++    +  +L     
Sbjct  26   LTLDLTLEILLRLPAKSAVRFRCVSKLWSSITTRPEFI---RSFAIQSSKQPCLLACVDA  82

Query  275  -LWRDRNFTNFNWYYTINYSEENQGNLQANRLQYFDHNPNLFRKVYLSSSLNGLICFCRF  451
             L   R F +   +   + S+ +      +RL++ + N  L     +S S++GL+CF  F
Sbjct  83   SLSGKRLFISLPQHVHPDESDYS----YVDRLEHCEVN-ALVDDEPMSESVHGLVCFGNF  137

Query  452  SDRSDEIAIHNLSTRQHIPLPS---NCHYDGSCKMNAFGLLGFDSGSRRYKVLKSVEFTT  622
                + I + N S RQH+ LP       Y  SC       LG+D  S +YKVL       
Sbjct  138  ----NRIVVWNPSMRQHVTLPELEPRVRYIRSC-------LGYDPVSDKYKVLCISGKRC  186

Query  623  GDSVSVKHWVFTVGVDKSWRKIHSSPYYHPYN  718
             D +     VFT+G  +SWR   +SP + P N
Sbjct  187  QDPL-----VFTLGPQESWRVTQNSPRHFPTN  213



>ref|XP_009141209.1| PREDICTED: F-box protein DOR-like [Brassica rapa]
Length=390

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 59/210 (28%), Positives = 95/210 (45%), Gaps = 26/210 (12%)
 Frame = +2

Query  95   LPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYPV  274
            +P +++ EI S+LP+K++ R +CVSK   S++  H F +L    S   P  +        
Sbjct  19   IPDDLVFEIFSRLPSKAIARCRCVSKLLASMLRSHYFTELFLTKSCARPQLL-------F  71

Query  275  LWRDRNFTNFNWYYTINYSEENQGNLQANRLQYFDHNPNLFRKVYLSSSLNGLICFCRFS  454
             + D +   F         EEN   L AN+L     +        LS+  +G  C+ +  
Sbjct  72   AFEDDSEVVFFSSPQPENPEENSYVLAANQLARIPSSYG------LSAPTSGFFCY-KVE  124

Query  455  DRSDEI-------AIHNLSTRQHIPLPSNCHYDGSCKMNAFGLLGFDSGSRRYKVLK-SV  610
               + +        I N ST Q + LP       + +  A   LG+D  S+ +KVL    
Sbjct  125  QTFEGMKVPEFVPVICNPSTGQSLTLP---RLKPTMRQGAHSHLGYDPVSKEFKVLSMET  181

Query  611  EFTTGDSVSVKHWVFTVGVDK-SWRKIHSS  697
             F +G+ +S+KH V T+G +K SWR +  S
Sbjct  182  SFVSGEWISLKHQVLTLGTEKLSWRLVECS  211



>ref|XP_010417686.1| PREDICTED: F-box/kelch-repeat protein At3g04660-like [Camelina 
sativa]
Length=355

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 55/206 (27%), Positives = 99/206 (48%), Gaps = 20/206 (10%)
 Frame = +2

Query  92   FLPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYP  271
            F+P+E++VEI+ ++PA+S+ RF CVSK + S+V    F + ++          R  +L+ 
Sbjct  29   FIPRELIVEILVRVPARSIARFICVSKLWSSIVRSQDFTNSYQLLMTRRSDPTRPRLLFS  88

Query  272  VLWRDRNFTNFNWYYTINYSEENQGNLQANRLQYFDHNPNLFRKVYLSSSLNGLICFCRF  451
            +  +  N         ++  + +  + +   +      P  +     S+ + GLIC C++
Sbjct  89   LFCQSMNMQQL----FLSQQDPSSDHHKVKNISMRHPTPLSYE---FSTPVRGLIC-CQY  140

Query  452  SDRSDEIAIHNLSTRQHIPLPSNCHYDGSCKMNAFGLLGFDSGSRRYKVL-KSVEFTTGD  628
                +++ I N ST Q +PLP       + + + F   G+D  +  YKVL  +V    G 
Sbjct  141  D--GNKVMIGNPSTGQFLPLPR--IKSRTRRRDIFSFFGYDPVNDVYKVLCMTVVLGLGG  196

Query  629  S-------VSVKHWVFTVGVDKSWRK  685
                    VS +H VFT+G ++ WRK
Sbjct  197  PLRRWSGYVSQEHQVFTLGANQEWRK  222



>ref|XP_006437454.1| hypothetical protein CICLE_v10033971mg [Citrus clementina]
 gb|ESR50694.1| hypothetical protein CICLE_v10033971mg [Citrus clementina]
Length=386

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 67/223 (30%), Positives = 109/223 (49%), Gaps = 27/223 (12%)
 Frame = +2

Query  95   LPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILIL---  265
            LP +I ++I+S+LP KSL+RFKCVSK F SL+    F  +H   S+   S + +++    
Sbjct  4    LPTDINIDILSRLPVKSLLRFKCVSKSFCSLIDSQEFIKIHLKRSIETNSNLSLILSGTP  63

Query  266  YPVLWRDRNFTNFNWYYTINYSEENQGNLQANRLQYFDHN-PNLFRKVYLSSSLNGLICF  442
             P+L   R      W   I  +  +  NL        DH   N   +  +  S NGLI  
Sbjct  64   APILDSSR-----YWNGKIFSASLDSLNLGVE----LDHPFKNCKGRTPIIDSCNGLIAL  114

Query  443  CRFSDRSDE--IAIHNLSTRQHIPLPSNCHYDGSCKMNAFGLL---GFDSGSRRYKVLKS  607
                 ++DE  IA  NLST++H+ LP    + G  K   + ++   G+D+ +  YKV++ 
Sbjct  115  -----KNDENGIAFWNLSTKEHLILPK---FWGDLKDKVYMVVDGFGYDAVNDDYKVVRL  166

Query  608  VEFTTGDSVSVKHWVFTVGVDKSWRKIHSSPYYHPYNGFNTHF  736
            V F   +    +  V+++  + SWR+I     Y   +G++  F
Sbjct  167  VHFVRENVEYTEVSVYSLRTN-SWRRIRVDFPYSILHGWDGKF  208



>gb|KEH28993.1| F-box protein interaction domain protein [Medicago truncatula]
Length=390

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 66/225 (29%), Positives = 111/225 (49%), Gaps = 27/225 (12%)
 Frame = +2

Query  92   FLPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYP  271
            FLP E+++EI+S LP K L++F+CV+KFF +++ D  F ++H N S+ +P    IL  Y 
Sbjct  5    FLPDELIMEILSCLPVKPLMKFRCVNKFFNTVISDPQFVEVHLNKSVRNPHLTSILEQYN  64

Query  272  VLWRDRNFTNFNWY-YTINYSEENQGNLQANRLQYFD---HNPNLFRKVYLSSSLNGLIC  439
                D+   ++N   + I+   EN     +  + Y+D      N + + ++    NGL+C
Sbjct  65   ---EDKQVIDWNLVTFPISRLLEN----HSTSVLYYDPYYRLTNDYCRWWVVGWCNGLLC  117

Query  440  FC---RFSDRSDEIAIHNLSTRQHIP--LPSNCHYDGSCKMNAFGLLGFDSGSRRYKVLK  604
                 +   +   I   N +TR      LPS+     +C   AF   G+D+ ++ YKV+ 
Sbjct  118  LIDMRKSRSQDSRICFWNPATRTKSEYLLPSS----NNCIWFAF---GYDTLAKTYKVVS  170

Query  605  SVEFTTGDSVSVKHWV--FTVGVDKSWRKIHSSPYYHPYNGFNTH  733
              +    +  + + WV  F++G + SWR I   P   P   FN H
Sbjct  171  FCKELDVEHGNPRIWVKIFSMG-NNSWRNIQCFPML-PLCRFNNH  213



>ref|XP_006297749.1| hypothetical protein CARUB_v10013784mg [Capsella rubella]
 gb|EOA30647.1| hypothetical protein CARUB_v10013784mg [Capsella rubella]
Length=423

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 69/221 (31%), Positives = 103/221 (47%), Gaps = 35/221 (16%)
 Frame = +2

Query  98   PQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYPVL  277
            P+E+ +EI+++LP  SL+RFKCVSK + SL+    F +     S     R R+ +    L
Sbjct  46   PEEVWMEILARLPVNSLLRFKCVSKLWSSLISSRYFTNFFFKLSSQTLER-RVFMSVVDL  104

Query  278  WRDRNFTNF------NWYYTINYSEENQG-NLQANRLQYFDHNPNLFRKVYLSSSLNGLI  436
                ++  F      NW  ++++ + N+   L A R  +   NP           L GL+
Sbjct  105  QSYSDYMLFSASSPRNWDASVSFLQLNEDLTLPAMRGHFV--NP-----------LRGLM  151

Query  437  CFCRFSDRSDEIAIHNLSTRQHIPLP---SNCHYDGSCKMNAFGLLGFDSGSRRYKVLKS  607
            CF        E+ I+NL+TRQ + LP   SN     S   N F   G D  S  YKVL +
Sbjct  152  CF----RLGREVRIYNLTTRQLLRLPIVESNMWEGDSLMWNYF---GHDPVSDEYKVLSN  204

Query  608  VEFTTGD--SVSVKHWVFTVGVDKSWR--KIHSSPYYHPYN  718
            V   +     VS +  V  +G   SWR  + H+ P + PY+
Sbjct  205  VSSVSKGLRRVSSETQVLVLGAGASWRNTRSHTHPPHRPYS  245



>ref|XP_009126873.1| PREDICTED: F-box protein At1g30790-like [Brassica rapa]
Length=396

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 64/212 (30%), Positives = 103/212 (49%), Gaps = 30/212 (14%)
 Frame = +2

Query  95   LPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYPV  274
            +P ++++EI+S LPAKSL+R +  SK ++S +   +F DL    S T P   R+L+ Y  
Sbjct  26   IPFDLIIEILSFLPAKSLIRLQSGSKLWFSTIRTKNFIDLFLARSKTRP---RLLLPYMH  82

Query  275  LWRDRNFTNFNWYYTINYSEENQGNLQANRLQYFDHNPNLFRKVY--LSSSLNGLICFCR  448
            +   + F        ++  E N+   ++       H+  +   +Y  +S  +NGLIC  R
Sbjct  83   VESKKRF-------ILSAPEHNKEEDKSASTVTLRHDMTILDPLYYVISRPVNGLICCVR  135

Query  449  FSDRSDEIAIHNLSTRQHIPLPSNCHYDGSCK-MNAFGLLGFDSGSRRYKVL-----KSV  610
             S     I++ N +TRQ + LP     D +C   + +  LG+D    +YKVL     K  
Sbjct  136  DSS----ISVCNPATRQIVKLP-----DVTCNGGDMYARLGYDPVEDQYKVLCVMIAKLN  186

Query  611  EFTT-GDSVSVKHWVFTV--GVDKSWRKIHSS  697
             F   G  +  +H V TV     + WRKI +S
Sbjct  187  SFGPYGQDIRQEHLVCTVTSSEKQEWRKIENS  218



>ref|XP_010686915.1| PREDICTED: F-box protein CPR30-like [Beta vulgaris subsp. vulgaris]
Length=397

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 66/210 (31%), Positives = 99/210 (47%), Gaps = 23/210 (11%)
 Frame = +2

Query  95   LPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYPV  274
            LP EI+  I+SKLP K+L+ FKCV K + SL+   +F  LH N +L   +   +L+ YP 
Sbjct  4    LPTEIISIILSKLPVKTLLHFKCVCKSWNSLIKTPNFIKLHLNQTLISDTNRHLLLYYPF  63

Query  275  LWRDRNFTNFNWYYTINYSEENQGNLQANRLQYFD-HNPNLFRKVYLSSSLNGLICFCRF  451
            L                YS E   +   NR+     H+P    +V+L  S NG++C    
Sbjct  64   L----------------YSAELDIHHNHNRITLSKLHHPLSPLQVHLFGSCNGVVCIADP  107

Query  452  SDRSDEIAIHNLSTRQHIPLP-SNCHYDGSCKMNAFGLLGFDSGSRRYKVLKSVE-FTTG  625
            S    +I   N  T+ H  LP  N +   +     FG  G+DS +  YKVL+  + FT  
Sbjct  108  SKT--DIFFFNPLTKSHYKLPVKNVNPSFNIGYELFG-FGYDSKNDDYKVLRLAQGFTIN  164

Query  626  DSVSVKHWVFTVGVDKSWRKIHSSPYYHPY  715
                 +  V+++  + SW+ I S  +Y  Y
Sbjct  165  KVFCSEASVYSLNRN-SWKSIESMSWYLIY  193



>gb|EEE69821.1| hypothetical protein OsJ_29568 [Oryza sativa Japonica Group]
Length=293

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 60/208 (29%), Positives = 98/208 (47%), Gaps = 23/208 (11%)
 Frame = +2

Query  92   FLPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYP  271
            ++P+++L +I+S LP+KSL+RF+ V K +++ +    F + H   S   PS   +L++  
Sbjct  35   YIPEDVLFKILSWLPSKSLIRFRSVCKAWHATISSSRFVNAHLECSKQRPS---LLVIPG  91

Query  272  VLWRDRNFTNFNWYYTI-NYSEENQGNLQANRLQYFDHNPNLFRKVYLSSSLNGLICFCR  448
                 +N  N  +  ++  Y + N  +LQ          P   RK       +GL+    
Sbjct  92   SFEMKKNGENIAFLMSLYKYQDPNIMHLQ--------DFPRGIRKWIRPVHCDGLLL---  140

Query  449  FSDRSDEIAIHNLSTRQHIPLPSNCHYDGSCKMNAFGLLGFDSGSRRYKVLKSV---EFT  619
             S R  ++ I N STR+ + LP   H    C     G  GFD  S +YKV ++    ++ 
Sbjct  141  ISTRKHKMMICNPSTREIVSLPEGSH--SLCGGMGLG-FGFDPHSNKYKVARAFYQRDYP  197

Query  620  TGDSVSVKHWVFTVGVDKSWRKIHSSPY  703
            T   V  K  V T+G D +WR+    PY
Sbjct  198  TTRQV-CKFEVLTLGTD-AWRQTEDPPY  223



>ref|XP_003605372.1| F-box protein [Medicago truncatula]
 ref|XP_003605384.1| F-box protein [Medicago truncatula]
 gb|AES87569.1| F-box protein interaction domain protein [Medicago truncatula]
Length=385

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 59/198 (30%), Positives = 96/198 (48%), Gaps = 22/198 (11%)
 Frame = +2

Query  92   FLPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYP  271
             LP E+++E++S LP K L++F+CV+KFF +L+ D  F  +H   S  +P  + ++  + 
Sbjct  29   MLPNELILEVISWLPVKHLMQFRCVNKFFNTLLSDPYFVQMHLKKSSRNP-HLALMWQHN  87

Query  272  VLWRDRNFTNFNWYYTINYSEENQGNLQANRLQYFDHNPNLFRKVYLSSSLNGLICFCRF  451
               RD  F  F     I  S+ N   L  N    FD N   +++ ++  S NGL+C    
Sbjct  88   PSCRDCRFITFPISSLIQ-SDPNHTTLHDNPYHRFDEN---YQRWWVVGSCNGLLCLIDI  143

Query  452  --SDRSDEIAIHNLSTRQH-----IPLPSNCHYDGSCKMNAFGLLGFDSGSRRYKVLKSV  610
              S   D +   N +TR +     I LPSN  +       AF   G+D+ +  YKV+   
Sbjct  144  HCSGSYDSLIFWNPATRTYSRRISISLPSNFKF-------AF---GYDNSTETYKVVAFR  193

Query  611  EFTTGDSVSVKHWVFTVG  664
             +  G+ V     +F++G
Sbjct  194  GYIEGNIVRSVVNIFSLG  211



>ref|XP_009609120.1| PREDICTED: putative F-box protein At1g32420 [Nicotiana tomentosiformis]
Length=212

 Score = 67.8 bits (164),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 46/133 (35%), Positives = 69/133 (52%), Gaps = 15/133 (11%)
 Frame = +2

Query  335  ENQGNLQANRLQYFDHNPNLFRKVYLSSSLNGLICFCRFSDRSDEIAIHNLSTRQHIPLP  514
            E +  +    +QY   N + F K++   S NGL+C   F     ++A+ N  TR+HI LP
Sbjct  2    EKKKIVAIGVIQYL--NQSCFSKLHSLVSTNGLVCLWNFYG---DVAVLNPFTREHIFLP  56

Query  515  SNCHYD--GSCKMNAFGLLGFDSGSRRYKVLKSVEFTTG-DSVSVKHWVFTVGVDKSWRK  685
             NC     G C       LGFD  +++YKV+K+     G +S  V++W++T+GVDK WR+
Sbjct  57   -NCQQPLIGCCS------LGFDPTTKKYKVIKAHWILGGRNSCEVRYWIYTIGVDKIWRE  109

Query  686  IHSSPYYHPYNGF  724
            I       P   F
Sbjct  110  IPDCANIFPIYNF  122



>ref|XP_009372410.1| PREDICTED: F-box protein CPR30-like [Pyrus x bretschneideri]
Length=371

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 56/200 (28%), Positives = 94/200 (47%), Gaps = 16/200 (8%)
 Frame = +2

Query  92   FLPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYP  271
            +LP+EILV I+ +LP KSLVRF CV K +  L+    F   H + ++T+ +   ++ LY 
Sbjct  11   YLPEEILVNILVRLPVKSLVRFTCVCKLWSDLIQSSRFIGKHLHRNVTNHAHSFVIALY-  69

Query  272  VLWRDRNFTNFNWYYTINYSEENQGNLQANRLQYFDHNPNLFRKVYLSSSLNGLICFC-R  448
                  + +     YT+  +E  +  L+         +P    K+ +  S++GL+C    
Sbjct  70   -----ESTSKPKISYTLLSNETMEPCLKIK-------HPLYGYKIDVHGSVDGLVCLSYE  117

Query  449  FSDRSDEIAIHNLSTRQHIPLPSNCHYDGSCKMNAFGLLGFDSGSRRYKVLKSVEFTTGD  628
              D    I + NLS R+H+ LP          +      GF  G   YKV++ V F  G 
Sbjct  118  LGDLDTSIYLCNLSIRKHVVLPPTSTLSRHSDVRVTVSFGFHPGLNDYKVVRMVSF-NGW  176

Query  629  SVSVKHWVFTVGVDKSWRKI  688
                +  V+++   KSW+++
Sbjct  177  KFCSELEVYSLST-KSWKRV  195



>ref|XP_006393240.1| hypothetical protein EUTSA_v10012205mg [Eutrema salsugineum]
 gb|ESQ30526.1| hypothetical protein EUTSA_v10012205mg [Eutrema salsugineum]
Length=417

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 65/206 (32%), Positives = 96/206 (47%), Gaps = 20/206 (10%)
 Frame = +2

Query  95   LPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYPV  274
            +P +++ EI+S+LPAKS+ RF CVSK + S+++   F DL    S   P  +   +   V
Sbjct  10   IPIDLVNEILSRLPAKSIARFHCVSKLWSSMILRPYFTDLFLTRSSARPPCLLFAVQLDV  69

Query  275  LWRDRNFTNFNWYYTINYSEENQGNL--QANR-LQYFDHNPNLFRKVYLSSSLNGLICFC  445
               +  F  F      N  +E   +L   A+R +Q+   N  L    Y S    GLICFC
Sbjct  70   DGDEWCF--FTSSQPQNPYDEESSSLVVTADRHMQFLGDNTWLETCGYAS----GLICFC  123

Query  446  RFSDRSDEIAIHNLSTRQH--IPLPSNCHYDGSCKMNAFGLLGFDSGSRRYKVLKSVEFT  619
            R         I N ST Q+  +P+P    Y  S        LGFD   +++KVL   +  
Sbjct  124  RHRPDDKRTLIFNPSTGQYTSLPIPKKWIYLRS-------YLGFDPIEKQFKVLSIRDPN  176

Query  620  TG-DSVSVKHWVFTVGV-DKSWRKIH  691
               D    ++ + T+G  +  WRKIH
Sbjct  177  PNYDEKGFQYEILTLGTRNVLWRKIH  202



>ref|NP_193726.1| F-box/kelch-repeat protein [Arabidopsis thaliana]
 sp|O49420.1|FBK86_ARATH RecName: Full=F-box/kelch-repeat protein At4g19930 [Arabidopsis 
thaliana]
 emb|CAA16601.1| putative protein [Arabidopsis thaliana]
 emb|CAB78993.1| putative protein [Arabidopsis thaliana]
 gb|AEE84248.1| F-box/kelch-repeat protein [Arabidopsis thaliana]
Length=431

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 63/210 (30%), Positives = 103/210 (49%), Gaps = 20/210 (10%)
 Frame = +2

Query  92   FLPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYP  271
            ++P ++++EI+++LPAKSL+RFK VSK + SL+   +F     N  L  PS ++ L +  
Sbjct  42   YIPFDLVIEILTRLPAKSLMRFKSVSKLWSSLICSRTFT----NRLLRVPSFIQRLYVT-  96

Query  272  VLWRDRNFTNFNWYYTINYSEENQGNLQANRLQYFDHNPNLFRKVYLSSSLNGLICFCRF  451
            + + D +    +   + + S  +  +  ++ +   D      +  YLS  L GL+CF   
Sbjct  97   LTFLDNSLQRKSKLLSSSSSPGSDISTMSSFVVDRDLTTPSMKGYYLSHVLRGLMCFV--  154

Query  452  SDRSDEIAIHNLSTRQHIPLP----SNCHYDGSCKMNAFGLLGFDSGSRRYKVLKSV---  610
              +   + I+N +TRQ + LP    SN   +          +G D    +YKV+  V   
Sbjct  155  --KEPSVKIYNTTTRQLVVLPDIEESNIIAEDHKNKKIMYRIGHDPVGDQYKVVCIVARP  212

Query  611  --EFTTGDSVSVKHWVFTVGVDKS--WRKI  688
              EF        +HWVF +G DKS  WRKI
Sbjct  213  NDEFGELRRYLSEHWVFILGGDKSSGWRKI  242



>ref|XP_011002219.1| PREDICTED: F-box protein CPR30-like [Populus euphratica]
Length=396

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 66/222 (30%), Positives = 104/222 (47%), Gaps = 24/222 (11%)
 Frame = +2

Query  95   LPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYPV  274
            LP E++ EI+ +LPAK L+  + VSK + +L+   +F  LH   S+   S + I++    
Sbjct  4    LPLEMIAEILCRLPAKELLCCRSVSKPWCALIDGPNFVKLHLKHSMDTSSNLYIILRTTS  63

Query  275  LWRDRNFT-NFNWYYTINYSEENQGNLQANRLQYFDHNPNLFRKVYLSSSLNGLICFCRF  451
                 +F  N      +   E N        L  ++H       + +  S+NGL+C    
Sbjct  64   HVHYMDFEQNLVLNDCVTLKELNH------PLMCYNHG------IKVLGSVNGLLC---I  108

Query  452  SDRSDEIAIHNLSTRQH-----IPLPSNCHYD-GSCKMNAFGLLGFDSGSRRYKVLKSVE  613
            S+  D+IA+ N STR+H     +PL    ++   SC +  FG  G+DS    YK+++  +
Sbjct  109  SNVVDDIAVWNPSTRKHRVVPFLPLELKRYFGTKSCSVYVFG-FGYDSVRDDYKLVRIAQ  167

Query  614  FTTGDSVSVKHWVFTVGVDK-SWRKIHSSPYYHPYNGFNTHF  736
            F  G   S +  V    + K SWR+I   PY   Y G N  F
Sbjct  168  FGGGGKRSFESEVKVYSLRKQSWRRIGDMPYCVHYPGANGVF  209



>dbj|BAD37944.1| hypothetical protein [Oryza sativa Japonica Group]
 dbj|BAD38236.1| hypothetical protein [Oryza sativa Japonica Group]
Length=371

 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 60/208 (29%), Positives = 98/208 (47%), Gaps = 23/208 (11%)
 Frame = +2

Query  92   FLPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYP  271
            ++P+++L +I+S LP+KSL+RF+ V K +++ +    F + H   S   PS   +L++  
Sbjct  35   YIPEDVLFKILSWLPSKSLIRFRSVCKAWHATISSSRFVNAHLECSKQRPS---LLVIPG  91

Query  272  VLWRDRNFTNFNWYYTI-NYSEENQGNLQANRLQYFDHNPNLFRKVYLSSSLNGLICFCR  448
                 +N  N  +  ++  Y + N  +LQ          P   RK       +GL+    
Sbjct  92   SFEMKKNGENIAFLMSLYKYQDPNIMHLQ--------DFPRGIRKWIRPVHCDGLL---L  140

Query  449  FSDRSDEIAIHNLSTRQHIPLPSNCHYDGSCKMNAFGLLGFDSGSRRYKVLKSV---EFT  619
             S R  ++ I N STR+ + LP   H    C     G  GFD  S +YKV ++    ++ 
Sbjct  141  ISTRKHKMMICNPSTREIVSLPEGSH--SLCGGMGLG-FGFDPHSNKYKVARAFYQRDYP  197

Query  620  TGDSVSVKHWVFTVGVDKSWRKIHSSPY  703
            T   V  K  V T+G D +WR+    PY
Sbjct  198  TTRQV-CKFEVLTLGTD-AWRQTEDPPY  223



>ref|NP_001066235.1| Os12g0164300 [Oryza sativa Japonica Group]
 gb|ABA95876.2| F-box protein interaction domain containing protein, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF29254.1| Os12g0164300 [Oryza sativa Japonica Group]
Length=414

 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 59/211 (28%), Positives = 99/211 (47%), Gaps = 21/211 (10%)
 Frame = +2

Query  92   FLPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYP  271
            ++P E++ +++ +LP+KSL+RFK V K +++++    F + H  WS   PS    L++ P
Sbjct  34   YIPDEVMFDVLLRLPSKSLMRFKSVCKAWHAMISSPIFINAHLEWSKLKPSS---LLMAP  90

Query  272  VLWRDRNFTNFNWYYTINYSEENQGNLQANRLQYFDHN-PNLFRKVYLSSSLNGLICFCR  448
              ++ +     N  + +   +   GN     L  F  + P +          +GL+    
Sbjct  91   GFYQKQK-NGQNIAFLMGLYKYQGGNNNVVHLHDFPRDFPQVLDTWTRPVHCDGLLL---  146

Query  449  FSDRSDEIAIHNLSTRQHIPLPS---NCHYDGSCKMNAFGLLGFDSGSRRYKVLKSVEFT  619
             S+ S ++ I+N STR+ + LP    N H     K    G  GFD  S +YKV + V + 
Sbjct  147  VSNMSKKMIIYNPSTREIVSLPKGSRNLH-----KGTGIG-FGFDPRSSKYKVAR-VFYQ  199

Query  620  TGDSVSV---KHWVFTVGVDKSWRKIHSSPY  703
              D  S+   K  V T+G    WR+    PY
Sbjct  200  RDDKTSMLVCKFEVLTLGTINVWRQTEDPPY  230



>ref|XP_004243873.1| PREDICTED: F-box/kelch-repeat protein At3g23880-like [Solanum 
lycopersicum]
Length=485

 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 57/184 (31%), Positives = 95/184 (52%), Gaps = 22/184 (12%)
 Frame = +2

Query  92   FLPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYP  271
            +LP+++LVEI+SKLP K+LV+   V K +YS++I+ +F  LH N  ++   R  +L +  
Sbjct  4    YLPKDVLVEILSKLPLKTLVQCTTVCKSWYSIIINPNFISLHHNTHISTAGRRPLLFV--  61

Query  272  VLWRDRNFTNFNWYYTINYSEENQGNLQANRLQYFDH-----NPNLFRKVYLS--SSLNG  430
               R  N  +    Y +++ +E  G  +++    F+       P   R  Y+      NG
Sbjct  62   ---RHYNMFDRVERYALHFDDEELG--ESSDADSFEEYLELKCPERSRSEYMRIVGCCNG  116

Query  431  LICFCRFSDR-SDEIAIHNLSTRQHIPLPS-NCHYD--GSCKMNAFGLLGFDSGSRRYKV  598
            LIC     D+ +D + + N   R+H+ LP+ +  Y+  GSC    +G  GFD     YKV
Sbjct  117  LICLSDDYDKFTDTVVLWNPIIRKHVGLPNPSLGYNGRGSC---IYG-FGFDGVKHDYKV  172

Query  599  LKSV  610
            ++ V
Sbjct  173  VRVV  176



>gb|EAY82372.1| hypothetical protein OsI_37584 [Oryza sativa Indica Group]
Length=412

 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 59/211 (28%), Positives = 99/211 (47%), Gaps = 21/211 (10%)
 Frame = +2

Query  92   FLPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYP  271
            ++P E++ +++ +LP+KSL+RFK V K +++++    F + H  WS   PS    L++ P
Sbjct  49   YIPDEVMFDVLLRLPSKSLMRFKSVCKAWHAMISSPIFINAHLEWSKLKPSS---LLMAP  105

Query  272  VLWRDRNFTNFNWYYTINYSEENQGNLQANRLQYFDHN-PNLFRKVYLSSSLNGLICFCR  448
              ++ +     N  + +   +   GN     L  F  + P +          +GL+    
Sbjct  106  GFYQKQK-NGQNIAFLMGLYKYQGGNNNVVHLHDFPRDFPQVLDTWTRPVHCDGLLL---  161

Query  449  FSDRSDEIAIHNLSTRQHIPLPS---NCHYDGSCKMNAFGLLGFDSGSRRYKVLKSVEFT  619
             S+ S ++ I+N STR+ + LP    N H     K    G  GFD  S +YKV + V + 
Sbjct  162  VSNMSKKMIIYNPSTREIVSLPKGSRNLH-----KGTGIG-FGFDPRSSKYKVAR-VFYQ  214

Query  620  TGDSVSV---KHWVFTVGVDKSWRKIHSSPY  703
              D  S+   K  V T+G    WR+    PY
Sbjct  215  RDDKTSMLVCKFEVLTLGTINVWRQTEDPPY  245



>gb|EAZ19750.1| hypothetical protein OsJ_35328 [Oryza sativa Japonica Group]
Length=425

 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 59/211 (28%), Positives = 99/211 (47%), Gaps = 21/211 (10%)
 Frame = +2

Query  92   FLPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYP  271
            ++P E++ +++ +LP+KSL+RFK V K +++++    F + H  WS   PS    L++ P
Sbjct  49   YIPDEVMFDVLLRLPSKSLMRFKSVCKAWHAMISSPIFINAHLEWSKLKPSS---LLMAP  105

Query  272  VLWRDRNFTNFNWYYTINYSEENQGNLQANRLQYFDHN-PNLFRKVYLSSSLNGLICFCR  448
              ++ +     N  + +   +   GN     L  F  + P +          +GL+    
Sbjct  106  GFYQKQK-NGQNIAFLMGLYKYQGGNNNVVHLHDFPRDFPQVLDTWTRPVHCDGLLL---  161

Query  449  FSDRSDEIAIHNLSTRQHIPLPS---NCHYDGSCKMNAFGLLGFDSGSRRYKVLKSVEFT  619
             S+ S ++ I+N STR+ + LP    N H     K    G  GFD  S +YKV + V + 
Sbjct  162  VSNMSKKMIIYNPSTREIVSLPKGSRNLH-----KGTGIG-FGFDPRSSKYKVAR-VFYQ  214

Query  620  TGDSVSV---KHWVFTVGVDKSWRKIHSSPY  703
              D  S+   K  V T+G    WR+    PY
Sbjct  215  RDDKTSMLVCKFEVLTLGTINVWRQTEDPPY  245



>ref|XP_002874089.1| hypothetical protein ARALYDRAFT_910273 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50348.1| hypothetical protein ARALYDRAFT_910273 [Arabidopsis lyrata subsp. 
lyrata]
Length=393

 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 66/210 (31%), Positives = 106/210 (50%), Gaps = 32/210 (15%)
 Frame = +2

Query  95   LPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYPV  274
            +P ++ +EI+S+LPAKSL+RF+ VSKF++S++    F D     S T P   R L+ +  
Sbjct  22   IPLDLTLEILSRLPAKSLIRFQAVSKFWFSIIRSKDFVDSFLTRSKTRP---RFLLTF--  76

Query  275  LWRDRNFTNFNWYYTINYSEENQGNLQANRLQYFDHNPNL-FRKVY--LSSSLNGLICFC  445
                +NF +   +  I  + E+Q N +++ + +  H+  +   +VY      +NG +C  
Sbjct  77   ----KNFDSRKRF--IFSAPEHQKNDKSSTV-FARHDMTISADRVYHIRCRPVNGFVCCT  129

Query  446  RFSDRSDEIAIHNLSTRQHIPLPSNCHYDGSCKMNAFGLLGFDSGSRRYKVLKSVEFTTG  625
                R D IA+ N +TRQ + LP +   +G    + +  LG+D    +YKVL  V F   
Sbjct  130  ----RGDSIAVCNPTTRQIVKLP-DVESNG---RHVYARLGYDPVEDQYKVL-CVMFYDP  180

Query  626  DSVSVKH-------WVFTV-GVDKSWRKIH  691
             S   K        +VFT+    K WRKI 
Sbjct  181  YSAKCKRQGTQPEPYVFTLQSQQKEWRKIE  210



>ref|XP_011043919.1| PREDICTED: F-box protein CPR30-like [Populus euphratica]
Length=396

 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 67/226 (30%), Positives = 105/226 (46%), Gaps = 24/226 (11%)
 Frame = +2

Query  95   LPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYPV  274
            LP E++ EI+ +LPAK L+  + VSK + +L+   +F  LH   S+   S + I++    
Sbjct  4    LPLEMIAEILCRLPAKELLCCRSVSKPWCALIDGPNFVKLHLKHSMDTSSNLYIILRTTS  63

Query  275  LWRDRNFT-NFNWYYTINYSEENQGNLQANRLQYFDHNPNLFRKVYLSSSLNGLICFCRF  451
                 +F  N      +   E N        L  ++H       + +  S+NGL+C    
Sbjct  64   HVHYMDFEQNLVLNDCVTLKELNH------PLMCYNHG------IKVLGSVNGLLC---I  108

Query  452  SDRSDEIAIHNLSTRQHIPLP----SNCHYDG--SCKMNAFGLLGFDSGSRRYKVLKSVE  613
            S+  D+IA+ N STR+H  +P        Y G  SC +  FG  G+DS    YK+++  +
Sbjct  109  SNVVDDIAVWNPSTRKHRVMPFLLIELKRYFGTKSCSVYVFG-FGYDSVRDDYKLVRIAQ  167

Query  614  FTTGDSVSVKHWVFTVGVDK-SWRKIHSSPYYHPYNGFNTHFYSTS  748
            F  G   S +  V    + K SWR+I   PY   Y G N  F + +
Sbjct  168  FGGGGKRSFESEVKVYSLRKQSWRRIGDMPYCVHYPGANGVFANGA  213



>ref|XP_004292837.1| PREDICTED: F-box protein At3g07870-like [Fragaria vesca subsp. 
vesca]
Length=426

 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 57/213 (27%), Positives = 99/213 (46%), Gaps = 15/213 (7%)
 Frame = +2

Query  95   LPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYPV  274
            LP+++L+EI+S LPAK+++  K V K +  ++ +  F  LH + S        ILI    
Sbjct  40   LPKDLLIEILSWLPAKTILTCKFVCKTWLLVISEPRFISLHHSRSAAG-----ILIQVWG  94

Query  275  LWRDRNFTNFNWYYTINYSEENQGNLQANRLQYFDHNPNLFRKVYLSSSLNGLICFCRFS  454
              R+RNF     +  ++    +  NL   ++ +   N        +++S NG IC C  +
Sbjct  95   SPRNRNFARRLLFTQVDKCAGDSDNLVMEKMTFTTKNTAPVNVFEVANSCNGFICLCG-T  153

Query  455  DRSDEIAIHNLSTRQHIPLPSNCHYDGSCKMNAFGLLGFDSGSRRYKVLKSVEFTTGDSV  634
              S  I  + L       L +N +     K+   G LG+ S +  YK+L++     G+  
Sbjct  154  QVSSMIVCNPLLNEYITVLTTNNN-----KLGNLGGLGWSSVTNEYKLLRTFYRAPGERN  208

Query  635  SVKHWVFTVGVDKSWRKIHSSP---YYHPYNGF  724
            +++  V+T+G    WR I  +P      P+N F
Sbjct  209  TLEAEVYTIG-SGVWRSIGKAPTDRVVLPFNAF  240



>gb|ABA95877.2| F-box protein interaction domain containing protein, expressed 
[Oryza sativa Japonica Group]
Length=410

 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 59/211 (28%), Positives = 99/211 (47%), Gaps = 21/211 (10%)
 Frame = +2

Query  92   FLPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYP  271
            ++P E++ +++ +LP+KSL+RFK V K +++++    F + H  WS   PS    L++ P
Sbjct  34   YIPDEVMFDVLLRLPSKSLMRFKSVCKAWHAMISSPIFINAHLEWSKLKPSS---LLMAP  90

Query  272  VLWRDRNFTNFNWYYTINYSEENQGNLQANRLQYFDHN-PNLFRKVYLSSSLNGLICFCR  448
              ++ +     N  + +   +   GN     L  F  + P +          +GL+    
Sbjct  91   GFYQKQK-NGQNIAFLMGLYKYQGGNNNVVHLHDFPRDFPQVLDTWTRPVHCDGLLL---  146

Query  449  FSDRSDEIAIHNLSTRQHIPLPS---NCHYDGSCKMNAFGLLGFDSGSRRYKVLKSVEFT  619
             S+ S ++ I+N STR+ + LP    N H     K    G  GFD  S +YKV + V + 
Sbjct  147  VSNMSKKMIIYNPSTREIVSLPKGSRNLH-----KGTGIG-FGFDPRSSKYKVAR-VFYQ  199

Query  620  TGDSVSV---KHWVFTVGVDKSWRKIHSSPY  703
              D  S+   K  V T+G    WR+    PY
Sbjct  200  RDDKTSMLVCKFEVLTLGTINVWRQTEDPPY  230



>ref|XP_006366850.1| PREDICTED: putative F-box protein At1g20657-like [Solanum tuberosum]
Length=357

 Score = 68.6 bits (166),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 58/206 (28%), Positives = 85/206 (41%), Gaps = 59/206 (29%)
 Frame = +2

Query  95   LPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYPV  274
            LPQE++VEI   LP  SL+RF+CVSKFF +LV+D  F  +H   S+T     R L+    
Sbjct  42   LPQELIVEIFLWLPVMSLMRFRCVSKFFDALVLDSDFTHVHHLRSMTRDGGTRFLM----  97

Query  275  LWRDRNFTNFNWYYTINYSEENQGNLQANRLQYFDHNPNLFRKVYLSSSLNGLICFCRFS  454
                                      +A  L  +D  P                      
Sbjct  98   -------------------------GKAEDLYAYDKEP----------------------  110

Query  455  DRSDEIAIHNLSTRQHIPLPSNCHYDGSCKMNAFGLLGFDSGSRRYKVLKSVEFTTGDSV  634
                 + I N S R+ I LP       S K   +  LG++   ++YKVL  V  ++G + 
Sbjct  111  -----VRIFNPSIRKMIVLPYQRKNSHSIKSLYYYSLGYEPVEKKYKVLMQVHNSSGLAQ  165

Query  635  SVKHWVFTVGVDKSWRKIHSSPYYHP  712
            S   ++ T+ +DK WR+I  S  + P
Sbjct  166  S---FILTLSIDKLWREIKDSINFFP  188



>gb|EEC84670.1| hypothetical protein OsI_31579 [Oryza sativa Indica Group]
Length=293

 Score = 67.8 bits (164),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 59/208 (28%), Positives = 98/208 (47%), Gaps = 23/208 (11%)
 Frame = +2

Query  92   FLPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYP  271
            ++P+++L +I+S LP+KSL+RF+ V K +++ +    F + H   S   PS   +L++  
Sbjct  35   YIPEDVLFKILSWLPSKSLIRFRSVCKAWHATISSSRFVNAHLECSKQRPS---LLVIPG  91

Query  272  VLWRDRNFTNFNWYYTI-NYSEENQGNLQANRLQYFDHNPNLFRKVYLSSSLNGLICFCR  448
                 +N  N  +  ++  Y + N  +LQ          P   RK       +GL+    
Sbjct  92   SFEMKKNGENIAFLMSLYKYQDPNIMHLQ--------DFPRGIRKWIRPVHCDGLLL---  140

Query  449  FSDRSDEIAIHNLSTRQHIPLPSNCHYDGSCKMNAFGLLGFDSGSRRYKVLKSV---EFT  619
             S R  ++ I N STR+ + LP   H    C     G  GFD  S +YK+ ++    ++ 
Sbjct  141  ISTRKHKMMICNPSTREIVSLPEGSH--SLCGGMGLG-FGFDPHSNKYKMARAFYQRDYP  197

Query  620  TGDSVSVKHWVFTVGVDKSWRKIHSSPY  703
            T   V  K  V T+G D +WR+    PY
Sbjct  198  TTRQV-CKFEVLTLGTD-AWRQTEDPPY  223



>ref|XP_010277878.1| PREDICTED: F-box protein CPR30-like [Nelumbo nucifera]
Length=364

 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 64/211 (30%), Positives = 107/211 (51%), Gaps = 31/211 (15%)
 Frame = +2

Query  95   LPQEILVEIVSKLPA-KSLVRFKCVSKFFYSLVIDHSFADLH--RNWSLTHPSRMRILIL  265
            +P+EI+V I+S+L A KSL+RF C+ K + +L+ +  F  +H  R+    +PS    LI+
Sbjct  14   VPEEIIVRILSRLSAIKSLLRFWCICKPWGALISNQDFIKMHLKRSSEDQNPS----LIV  69

Query  266  YPVLWRDRNFTNFNWYYTINYSEENQGNLQANRLQY-FDHNPNLFRKVYLSSSLNGLICF  442
            Y    R+ +       Y+I++   +  +L+ N ++  F     L  +  + SS NG++C 
Sbjct  70   Y----REPH------CYSIDF---DAFDLRKNMVRLDFAFLEELSTRFSIQSSCNGVLCL  116

Query  443  CRFSDRSDEIAIHNLSTRQHIPLPSNCHYDGSCKMNAFGLLGFDSGSRRYKVLKSV----  610
                  SD + + N STR+H  LP  C + G   ++ +  LG+   +  YKVL+ +    
Sbjct  117  AN----SDTVFLWNPSTRKHKKLPPQCQFPGVIGISVWT-LGYSPRTEEYKVLRFIYIRD  171

Query  611  EFTTGDSVSVKHWVFTVGVDKSWRKIHSSPY  703
            E      V  +  V TVG D SWR +   P+
Sbjct  172  ESNESLIVGWEVMVHTVGTD-SWRNLGQIPW  201



>ref|XP_009588485.1| PREDICTED: F-box protein CPR30-like [Nicotiana tomentosiformis]
Length=386

 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 62/227 (27%), Positives = 103/227 (45%), Gaps = 27/227 (12%)
 Frame = +2

Query  95   LPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYPV  274
            +P +++++I+  LP KSL+RFKCVSK +Y+LV   +F D+H N           ++L   
Sbjct  12   IPHDVMIDILKNLPGKSLLRFKCVSKTWYNLVNSSNFTDIHYNHDCLSND---FVLLKRY  68

Query  275  LWRDRNFTNFNWYYTIN----YSEENQGNLQANRLQYFDHNPNLFRKVYLSSSLNGLICF  442
            +  D      N+Y   N    +S +     +A  + YFD+    +  V ++   NG++C 
Sbjct  69   IGNDEIDAESNYYKGHNILSCHSIDESFKSRAPNVTYFDN----YIGVSIAGPCNGIVCI  124

Query  443  CRFSDRSDEIAIHNLSTRQHIPLP----SNCHYDGSCKMNAFGLLGFDSGSRRYKVLKSV  610
              +      I ++N + R+   LP    S+   D +  M     +GFD  +  YKV++  
Sbjct  125  GSYR----TIFLYNPTLREFWELPPSQYSSTRQDLNHTMQIVAGIGFDPKTNDYKVIRIF  180

Query  611  EFTTGDSVSVKHWVFTVGV----DKSWRKIHSSP-YYHPYNGFNTHF  736
             F   D   +   V T+ +      SWR+I   P   HP   F   F
Sbjct  181  NF---DEYPLIKDVSTIEIYNLSTNSWREIDEVPSMIHPSRCFKVLF  224



>gb|KDO58461.1| hypothetical protein CISIN_1g047073mg, partial [Citrus sinensis]
Length=316

 Score = 68.2 bits (165),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 60/214 (28%), Positives = 100/214 (47%), Gaps = 35/214 (16%)
 Frame = +2

Query  95   LPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYPV  274
            LP  ILV++ S+LP K++++ KCV K ++SL  D  FA +H        +R    I+   
Sbjct  42   LPLPILVDVFSRLPIKTILQIKCVCKTWHSLCSDPYFAKIHL-------ARAPFSIMILE  94

Query  275  LWRDRNFTNFNWYYTINYSEENQGNLQANRLQYFDHNPNLFRKVYLSSSLNGLICFCRFS  454
             +  R +TN      +     NQG+ +               ++ L SS NGLIC   FS
Sbjct  95   KFCKRIYTN----SLVPLFTLNQGDKE---------------RLSLLSSCNGLICLHEFS  135

Query  455  DRSDEIAIHNLSTRQHIPLPSNCHYDGSCKMNAFGLLGFDSGSRRYKVLKSVEFTTGDSV  634
             + D I++ N     H+ LP     + + ++  F   G++  + +YKV++ + +    ++
Sbjct  136  YKQDIISVCNPILGDHLVLPQLKRKNVATRIRGF---GYNHCTNQYKVIQILSYKDQAAI  192

Query  635  SVKH---WVFTVGVDKSWRKIHSSPYY--HPYNG  721
            S       V T+G + +WR I   PY    PY G
Sbjct  193  SSSKPQVEVHTIGTN-TWRNIGDLPYVLNQPYYG  225



>ref|XP_010479100.1| PREDICTED: F-box protein At1g53790-like isoform X2 [Camelina 
sativa]
 ref|XP_010479101.1| PREDICTED: F-box protein At1g53790-like isoform X2 [Camelina 
sativa]
Length=440

 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 62/217 (29%), Positives = 100/217 (46%), Gaps = 12/217 (6%)
 Frame = +2

Query  95   LPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWS--LTHPSRMRILILY  268
            +P ++L++I S++PAKS+ RF CVSK + S++    FA+ +   S   T P R R  +L+
Sbjct  18   IPTDLLMDIFSRVPAKSVARFCCVSKLWESIICHPDFAEFYFTMSSCTTTPPR-RPPLLF  76

Query  269  PVLWRDRNFTNFNWYYTINYSE---ENQGNLQANRLQYFDHNPNLFRKVYLSSSLNGLIC  439
              L  D     F+  +T    +   EN+ +L + R      N        + S L G IC
Sbjct  77   FTLEDDGKLFFFSSPHTPTQKDPHHENKASLVSTRYHVHRKNTPTNYASDVGSPLCGFIC  136

Query  440  FCRFSDRSDEIAIHNLSTRQHIPLPSNCHYDGSCKMNAFGLLGFDSGSRRYKVLKSVEFT  619
              R     D I I N +T Q + LP       +     F  LG+D   ++ KVL  ++F 
Sbjct  137  H-RDRGSPDTIVICNPATGQSVTLPKVKLKGINTDTRPF--LGYDPIGKQLKVL-CIKFD  192

Query  620  TGDSVSVKHWVFTVGVD--KSWRKIHSSPYYHPYNGF  724
               +   +H V T+  +  + WR +   P+Y   +G 
Sbjct  193  MIPNPCYEHQVLTLEDNGKRLWRTVQCKPHYPKSDGI  229



>ref|XP_002308787.1| hypothetical protein POPTR_0006s01360g [Populus trichocarpa]
 gb|EEE92310.1| hypothetical protein POPTR_0006s01360g [Populus trichocarpa]
Length=396

 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 67/225 (30%), Positives = 110/225 (49%), Gaps = 30/225 (13%)
 Frame = +2

Query  95   LPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYPV  274
            LP E++ EI+ +LPAK L+  + VSK + +L+   +F  LH   S+   S + I++    
Sbjct  4    LPLEMIAEILCRLPAKELLCCRSVSKPWCALIDGPNFVKLHLKHSMDTSSNLYIIL----  59

Query  275  LWRDRNFTNFNWYYTINYSEENQGNLQAN---RLQYFDHNPNLFR-KVYLSSSLNGLICF  442
                R  ++      ++Y +  Q NL  N    L+  +H    +   + +  S+NGL+C 
Sbjct  60   ----RTTSH------VHYMDFEQ-NLVLNDCVTLKELNHPLMCYNHGIKVLGSVNGLLC-  107

Query  443  CRFSDRSDEIAIHNLSTRQH-----IPLPSNCHYD-GSCKMNAFGLLGFDSGSRRYKVLK  604
               S+  D+IA+ N STR+H     +P+    ++   SC +  FG  G+DS    YK+++
Sbjct  108  --ISNVVDDIAVWNPSTRKHRVVPFLPIELKRYFGTKSCSVYVFG-FGYDSVRDDYKLVR  164

Query  605  SVEFTTGDSVSVKHWVFTVGVDK-SWRKIHSSPYYHPYNGFNTHF  736
              +F  G   S +  V    + K SWR+I   PY   Y G N  F
Sbjct  165  IAQFGGGGKRSFESEVKVYSLRKQSWRRIGDMPYCVHYPGANGVF  209



>ref|XP_006413922.1| hypothetical protein EUTSA_v10025237mg [Eutrema salsugineum]
 gb|ESQ55375.1| hypothetical protein EUTSA_v10025237mg [Eutrema salsugineum]
Length=436

 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 65/214 (30%), Positives = 101/214 (47%), Gaps = 22/214 (10%)
 Frame = +2

Query  95   LPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYPV  274
            +P E++ EI+++LPAKSL+RFK VSK + SL+    F +   N+S + P       LY  
Sbjct  46   IPFELVFEILTRLPAKSLMRFKSVSKIWSSLICSKYFTNRFLNFSSSPPR------LYMC  99

Query  275  LWRDRNFTNFNWYYTINYSEENQGNLQANRLQYFDHNPNLFRKVYLSSSLNGLICFCRFS  454
            L  D    N +   + + S ++ GN  ++ +   D          +S    GL+CF    
Sbjct  100  LGID----NSDVILSSSASSDSDGNTISSFVVDQDLTIPALEGYNVSHVFRGLMCFT---  152

Query  455  DRSDEIAIHNLSTRQHIPLP----SNCHYDGSCKMNAFGLLGFDSGSRRYKVLKSVEFTT  622
               D   I+N STRQ + LP    SN   +          +G D    +YKV+ +V  + 
Sbjct  153  -NEDSAQIYNTSTRQLVVLPDIEESNIIAENHESKRIMYCIGHDPVHDQYKVVCTVSTSR  211

Query  623  GDSVSVKHWVFTVGVDKS---WRKIHSS-PYYHP  712
              +  +++WV  +G D S   WRKI S  P + P
Sbjct  212  NQTFLLEYWVLVLGGDVSSRYWRKIPSPCPPHRP  245



>ref|XP_010686233.1| PREDICTED: F-box protein CPR30-like [Beta vulgaris subsp. vulgaris]
Length=443

 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 66/223 (30%), Positives = 109/223 (49%), Gaps = 17/223 (8%)
 Frame = +2

Query  95   LPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPS----RMRILI  262
            LP E++ EI+S LP K L++F  VSK +Y+L+   +F  LH N +L   S     +    
Sbjct  46   LPTELIAEILSNLPVKQLLQFLIVSKSWYNLIKSPNFIKLHLNQTLISDSHRHLILSYSS  105

Query  263  LYPVLWRDRNFTNFNWYYTINYSEENQGNLQANRLQYFDHNPNLFRKVYLSSSLNGLICF  442
            L      DR+F     +  IN+  +   + +  R ++    P     + L  S NG++C 
Sbjct  106  LSSSELHDRHFR----FSEINHPLKTHHH-ENERCRF--REPFESSGIRLLGSCNGVVCI  158

Query  443  CRFSDRSDEIAIHNLSTRQHIPLPSNCHYDGSCKMNAFGLLGFDSGSRRYKVLKSVEFT-  619
                   +++ + N STR +  LPS+   D S K   FG  G+D  S  YKVLK ++   
Sbjct  159  SDIG--KNDVVLFNPSTRTYRKLPSSGDPD-SNKFAVFG-FGYDCSSDDYKVLKLIQCCG  214

Query  620  TGDSVSVKHWVFTVGVDKSWRKIHSSPYYHPYNGFNTHFYSTS  748
              + V     V+++ ++ SW++++  PYY  Y  F+  F + S
Sbjct  215  PNNEVYNDAKVYSLRLN-SWKRVNDFPYYLIYPDFHGAFVANS  256



>ref|XP_010479099.1| PREDICTED: F-box protein At1g53790-like isoform X1 [Camelina 
sativa]
Length=490

 Score = 68.6 bits (166),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 62/217 (29%), Positives = 100/217 (46%), Gaps = 12/217 (6%)
 Frame = +2

Query  95   LPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWS--LTHPSRMRILILY  268
            +P ++L++I S++PAKS+ RF CVSK + S++    FA+ +   S   T P R R  +L+
Sbjct  18   IPTDLLMDIFSRVPAKSVARFCCVSKLWESIICHPDFAEFYFTMSSCTTTPPR-RPPLLF  76

Query  269  PVLWRDRNFTNFNWYYTINYSE---ENQGNLQANRLQYFDHNPNLFRKVYLSSSLNGLIC  439
              L  D     F+  +T    +   EN+ +L + R      N        + S L G IC
Sbjct  77   FTLEDDGKLFFFSSPHTPTQKDPHHENKASLVSTRYHVHRKNTPTNYASDVGSPLCGFIC  136

Query  440  FCRFSDRSDEIAIHNLSTRQHIPLPSNCHYDGSCKMNAFGLLGFDSGSRRYKVLKSVEFT  619
              R     D I I N +T Q + LP       +     F  LG+D   ++ KVL  ++F 
Sbjct  137  H-RDRGSPDTIVICNPATGQSVTLPKVKLKGINTDTRPF--LGYDPIGKQLKVL-CIKFD  192

Query  620  TGDSVSVKHWVFTVGVD--KSWRKIHSSPYYHPYNGF  724
               +   +H V T+  +  + WR +   P+Y   +G 
Sbjct  193  MIPNPCYEHQVLTLEDNGKRLWRTVQCKPHYPKSDGI  229



>ref|XP_006301974.1| hypothetical protein CARUB_v10022454mg [Capsella rubella]
 gb|EOA34872.1| hypothetical protein CARUB_v10022454mg [Capsella rubella]
Length=375

 Score = 68.2 bits (165),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 62/211 (29%), Positives = 101/211 (48%), Gaps = 16/211 (8%)
 Frame = +2

Query  95   LPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYPV  274
            LPQ++  EI+S LP K+L R  CVS+ + SL+    F DL+ + S+  P  M  L++ P 
Sbjct  6    LPQDLHREILSFLPMKTLARCLCVSRQWESLIRGEDFKDLYLSRSMKRPRLM--LVVTPS  63

Query  275  LWRDRNFT-NFNWYYTINYSEENQGNLQANRLQYFDHNPNLFRKVYLSSSLNGLICFCRF  451
             +        F+  Y     +E +  L + + Q     P+      +S  + GLICF   
Sbjct  64   TYPPEPMVFCFHSVY-----QEEEPLLSSGQQQMRIEIPDRTSSYTVSQPVRGLICFMLR  118

Query  452  SDRSDEIAIHNLSTRQHIP-LPSNCHYDGSCKMNAFGLLGFDSGSRRYKVLKSVEFTTGD  628
            +    ++A++N   ++ +  LP    YD    +  F  LG+D  +  +KVL  V      
Sbjct  119  T----KVAVYNPGMKRMVQDLPEIQGYDRGRDLLHF-FLGYDVATNVFKVL-CVTRPGYS  172

Query  629  SVSVKHWVFTVGV-DKSWRKIHSSPYYHPYN  718
              S K+ V+TVG  ++SWR+I     + PY 
Sbjct  173  EPSEKYQVYTVGSREESWRRIKCKRDHQPYT  203



>ref|XP_009364321.1| PREDICTED: F-box/kelch-repeat protein At3g06240-like [Pyrus x 
bretschneideri]
Length=376

 Score = 68.2 bits (165),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 70/219 (32%), Positives = 104/219 (47%), Gaps = 26/219 (12%)
 Frame = +2

Query  95   LPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPS----RMRILI  262
            LP EI+ +I+S+LPAK L RFKCVSK + SL+ D SFA +H      +      R R+ +
Sbjct  13   LPTEIISDILSRLPAKLLCRFKCVSKTWISLITDPSFAQVHYKKLCQNDEVLSQRRRVAL  72

Query  263  LYPVLWRDRNFTNFNWYYTINYSEENQGNLQANRLQ----YFDHNPNLFRKVYLSSSLNG  430
            + P L    +  +F+    +  +++ +  L  +  +    Y   +P  F  V L S+  G
Sbjct  73   VDPGL---NSIYSFDLDEFLVRNDDGRDFLLVSEEEMECVYSSDSPENF--VTLVSACKG  127

Query  431  LICFCRFSDRSDEIAIHNLSTRQ--HIPLPSNCHYDGSCKMNAFGLLGFDSGSRRYKVLK  604
            L+ F     R+ E+ + N + RQ   IP+P      G C  + FG  GFD  +  YKV+ 
Sbjct  128  LLFFAL---RNLEMYLLNPAIRQSKKIPIPPEFGV-GVCSKHLFG-FGFDDNADDYKVVF  182

Query  605  SVEFTTGDSVSVKHWVFTVGVDKSWRKIHSS-PYYHPYN  718
               F  G    V H V T     +WR I    PY   +N
Sbjct  183  GRCFEDGIDFGV-HGVKT----DAWRVIEGRVPYRRIFN  216



>ref|XP_011028178.1| PREDICTED: LOW QUALITY PROTEIN: F-box only protein 8-like [Populus 
euphratica]
Length=433

 Score = 68.2 bits (165),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 68/243 (28%), Positives = 114/243 (47%), Gaps = 49/243 (20%)
 Frame = +2

Query  95   LPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYPV  274
            +P ++++ I+++LPAKS+VRF+CVS+ + S   D  FA LH   SLT  +   +L+ YP 
Sbjct  23   IPDDVILNILTRLPAKSVVRFRCVSRTWCSFTHDPFFASLHHARSLTRDNGSALLLSYP-  81

Query  275  LWRDRNFTNFNWYYTINYSEENQG--NLQANRLQYFDHNPNLFRKVYLSSSLNGLICFCR  448
                      +   + ++ E  QG  NLQ + +          +  +LS  + G++C   
Sbjct  82   -------DPSSSSTSFSFFERKQGFRNLQISNVDQ--------QCTHLSEIIRGILCI--  124

Query  449  FSDRSDEIAIHNLSTRQHIPL--PSNCHYDGSCKMNAFGLL-------GFDSGSRRYKVL  601
               RS  + I N++T++ I L   +N     +  ++ F ++       GF S +R YKVL
Sbjct  125  HDRRSHLVDICNITTQETITLLRSTNIQIRSAAGVD-FDIVYEPRYSFGFHSSTRDYKVL  183

Query  602  KSVEFT---------TGDSV------SVKHWVFTVGVDK---SWRKIHSS-PYYHPYNGF  724
                 T          G S       +V+  +FT+G D+   SWRKI    PY    +G 
Sbjct  184  NICSITRYKLLVNPNNGLSTREVSQRTVEFKIFTIGCDRGAGSWRKIDPGYPYDQELHGL  243

Query  725  NTH  733
            ++ 
Sbjct  244  SSE  246



>ref|XP_003605393.1| F-box/kelch-repeat protein [Medicago truncatula]
 gb|AES87590.1| F-box protein interaction domain protein [Medicago truncatula]
Length=395

 Score = 68.2 bits (165),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 61/208 (29%), Positives = 98/208 (47%), Gaps = 21/208 (10%)
 Frame = +2

Query  95   LPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYPV  274
            LP E++ +I+S LP K L+RF+CV+KF+ +L+ D  F  +H   S  +P+ M       V
Sbjct  9    LPSELMTKILSLLPVKPLMRFRCVNKFYNTLISDPHFIQMHLKNSARNPNLM-------V  61

Query  275  LWRDRNFTNFN---WYYTINYSEENQGNLQANRLQYFDHNPNLFRKVYLSSSLNGLICFC  445
            + R  NF +F+       I+   EN  +       Y   N N       + S NGLIC C
Sbjct  62   IARQHNFNSFDENVLNLPISLLLENSLSTVPYDPYYRLKNENPHCPWLFAGSCNGLICLC  121

Query  446  RFSDRS--DEIAIHNLSTRQHIPLPSNCHYDGSCKMNAFGLLGFDSGSRRYKVLK-SVEF  616
               D S    + + N +TR      +   +D + +       G+D+ +  YKV+   ++ 
Sbjct  122  LDIDTSHGSRLCLWNPATR------TKSEFDLASQECFVFAFGYDNLNGNYKVIAFDIKV  175

Query  617  TTGDSVSVKHWVFTVGVDKSWRKIHSSP  700
             +G++ SV   VF++  D  WR I   P
Sbjct  176  KSGNARSVVK-VFSMR-DNCWRNIQCFP  201



>ref|XP_006393242.1| hypothetical protein EUTSA_v10012379mg [Eutrema salsugineum]
 gb|ESQ30528.1| hypothetical protein EUTSA_v10012379mg [Eutrema salsugineum]
Length=443

 Score = 68.2 bits (165),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 70/220 (32%), Positives = 103/220 (47%), Gaps = 29/220 (13%)
 Frame = +2

Query  95   LPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYPV  274
            +P +++ EI+S+L AKS+ RF+CVSK + S+++   F DL    S   P R+    L+ V
Sbjct  10   IPTDLVNEILSRLHAKSIARFRCVSKLWSSMILRPYFTDLFLTRSSACPQRL----LFAV  65

Query  275  LWRDRNFTNFNWYYTIN-YSEENQGNL--QANRLQYFDHNPNLFRKVYLSSSLNGLICFC  445
                  +  F      N Y EE+  +L   A+R   F  +  L    Y S    GLICFC
Sbjct  66   QLDGDEWCFFTSSQPQNPYDEESSSSLVVTADRHMKFLGDEWLETCGYTS----GLICFC  121

Query  446  R---FSDRSDEIAIHNLSTRQHIPLPSNCHYDGSCKMNAFGLLGFDSGSRRYKVLKSVEF  616
            R    S+      I N ST Q+  LP    +  +C       LGFD   +++KV      
Sbjct  122  RHKAISEVDKHTVICNPSTGQYASLPIPKKW--TCWRR---YLGFDPIGKQFKV---SSL  173

Query  617  TTGDSVSVKHWVFTVGVDK-SWRKIHSSPYYHPYNGFNTH  733
            + G+    ++ + T+G  K  WRKIH      P+N F  H
Sbjct  174  SCGEK-GYQYEILTLGTGKFLWRKIHC-----PFNHFPEH  207



>ref|XP_006292949.1| hypothetical protein CARUB_v10019224mg, partial [Capsella rubella]
 gb|EOA25847.1| hypothetical protein CARUB_v10019224mg, partial [Capsella rubella]
Length=389

 Score = 67.8 bits (164),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 62/215 (29%), Positives = 95/215 (44%), Gaps = 25/215 (12%)
 Frame = +2

Query  95   LPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYPV  274
            +P+E+L+EI+ +LPA S +RFKCVSK + SL+    F +L    SLT   R   + L   
Sbjct  41   IPEEVLIEILVRLPANSAMRFKCVSKHWSSLISSRYFTNLFFQVSLTKRERRVFMFLS--  98

Query  275  LWRDRNFTNFNWYYTINYSEENQGNLQANRLQYFDHNPNLFR-KVYLSSSLNGLICFCRF  451
                      N  +       N  +L+ +   + +H+  L R +    ++L GL+CF   
Sbjct  99   ----------NNEHRCALLLSNNDDLKPDSFSHLNHDLTLPRMRGDFVNALRGLMCF---  145

Query  452  SDRSDEIAIHNLSTRQHIPLP---SNCHYDGSCKMNAFGLLGFDSGSRRYKVLKSVEFTT  622
                  I I NL+T Q   LP   S+  ++           G DS    YKVL +V   +
Sbjct  146  -RVGRVIRICNLTTMQLASLPQVKSSMFHEAHVDFRMQSFFGHDSVRDEYKVLNTVCEVS  204

Query  623  GDS--VSVKHWVFTVGVDKSWRKIHSS---PYYHP  712
             +   V  +H V  +G    WR   S+   P + P
Sbjct  205  EEEGVVRSEHQVLVLGPGAYWRNTQSNIPPPPHRP  239



>ref|XP_006361686.1| PREDICTED: F-box protein CPR30-like [Solanum tuberosum]
Length=453

 Score = 68.2 bits (165),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 66/205 (32%), Positives = 96/205 (47%), Gaps = 20/205 (10%)
 Frame = +2

Query  98   PQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYPVL  277
            P+EIL  I+S+LP +SLVRFKCVSKF+ +L+ D  F   H N +       ++LI     
Sbjct  75   PEEILANILSRLPVRSLVRFKCVSKFWTTLISDPYFTMKHLNRARNDHDSQKLLIYQ---  131

Query  278  WRDRNFTNFNWYYTINYSEENQGNLQANRLQYFDHNPNLF--RKVYLSSSLNGL-ICFCR  448
            W  ++ T F+ Y       +   ++Q  +L      P+    R   +    NGL I   R
Sbjct  132  WGPKDST-FSLYCCPLSPVQQAKDVQKLKLDC----PSTLKPRSCLIHCCYNGLAIIEIR  186

Query  449  FSDRSDEIAIHNLSTRQHIPLPS-NCHYDGSCKMNAFGLLGFDSGSRRYKVLKSVEFTTG  625
              DR  +  + N S R+ I LP   C  DG  +   FG LG+DS S +YK++   +   G
Sbjct  187  DKDRV-KFLLWNPSIRESIVLPPLGCPGDGRSR---FG-LGYDSSSGKYKIIHMHQNLEG  241

Query  626  DSVSVKHWVFTVGVDKSWRKIHSSP  700
             +   +        D SWR I   P
Sbjct  242  PNYPKEILALK---DGSWRSIDEHP  263



>ref|XP_006428799.1| hypothetical protein CICLE_v10011877mg [Citrus clementina]
 ref|XP_006480605.1| PREDICTED: F-box protein CPR30-like isoform X1 [Citrus sinensis]
 ref|XP_006480606.1| PREDICTED: F-box protein CPR30-like isoform X2 [Citrus sinensis]
 ref|XP_006480607.1| PREDICTED: F-box protein CPR30-like isoform X3 [Citrus sinensis]
 gb|ESR42039.1| hypothetical protein CICLE_v10011877mg [Citrus clementina]
Length=405

 Score = 67.8 bits (164),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 57/204 (28%), Positives = 92/204 (45%), Gaps = 19/204 (9%)
 Frame = +2

Query  95   LPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYPV  274
            +P +I+  I  + P KSL+RF+CVSK   SL+    F  LH N S+T  S  R+++    
Sbjct  5    IPLDIITGIFCRQPVKSLLRFRCVSKTCCSLIDSQDFIKLHLNHSITTRSNRRLIL----  60

Query  275  LWRDRNFTNFNWYYTINYSEENQGNLQANRLQYFDHNPNLFRKVYLSSSLNGLICFCRFS  454
                      +  Y +++     G      +Q   H  N+     +  S NGLI  C   
Sbjct  61   -------KGAHDLYALDFDTLTLG----TGVQPHHHPLNIGSGTEVLGSCNGLIALC---  106

Query  455  DRSDEIAIHNLSTRQHIPLPSNCHYDGSCKMNAFGLLGFDSGSRRYKVLKSVEFTTGDSV  634
            +   E+A+ N STR+   LP      G      F   G D  +  YK+++ + F   D  
Sbjct  107  NSVQELALFNPSTRKLKTLPLPPCLVGFPSAFTFYGFGQDKINDDYKLVRVLHFKGNDGD  166

Query  635  SVKHWVFTVGVDKSWRKIHSSPYY  706
             V+  V+++  + SWR+I + P +
Sbjct  167  DVEVEVYSLKTN-SWRRISNLPRF  189



>ref|XP_006484611.1| PREDICTED: F-box protein CPR30-like isoform X1 [Citrus sinensis]
Length=397

 Score = 67.8 bits (164),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 66/223 (30%), Positives = 108/223 (48%), Gaps = 27/223 (12%)
 Frame = +2

Query  95   LPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILIL---  265
            LP +I ++I+S+LP KSL+RFKCVSK F SL+    F  +H   S+   S + +++    
Sbjct  4    LPTDINIDILSRLPVKSLLRFKCVSKSFCSLIDSQEFIKIHLKRSIETNSNLSLILSGTP  63

Query  266  YPVLWRDRNFTNFNWYYTINYSEENQGNLQANRLQYFDHN-PNLFRKVYLSSSLNGLICF  442
             P+L   R      W   I  +  +  NL        DH   N   +  +  S NGLI  
Sbjct  64   APILDSSR-----YWNGKIFSASLDSLNLGVE----LDHPFKNCKGRTPIIDSCNGLIAL  114

Query  443  CRFSDRSDE--IAIHNLSTRQHIPLPSNCHYDGSCKMNAFGLL---GFDSGSRRYKVLKS  607
                 ++DE  IA  N ST++H+ LP    + G  K   + ++   G+D+ +  YKV++ 
Sbjct  115  -----KNDENGIAFWNPSTKEHLILPK---FWGDLKDKVYMVVDGFGYDAVNDDYKVVRL  166

Query  608  VEFTTGDSVSVKHWVFTVGVDKSWRKIHSSPYYHPYNGFNTHF  736
            V F   +    +  V+++  + SWR+I     Y   +G++  F
Sbjct  167  VHFVRENVEYTEVSVYSLRTN-SWRRIRVDFPYSILHGWDGKF  208



>emb|CDP17261.1| unnamed protein product [Coffea canephora]
Length=393

 Score = 67.8 bits (164),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 60/211 (28%), Positives = 104/211 (49%), Gaps = 26/211 (12%)
 Frame = +2

Query  95   LPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYPV  274
            +PQ+IL E++S+LP K L+RF+CVSK + +++    F  LH   SL   S   +++ +  
Sbjct  4    VPQDILEEMLSRLPVKPLLRFRCVSKQWKAIIDSPEFIRLHIAQSLETRSHHSVILRHSY  63

Query  275  LWRDRNFTNFNWYYTINYSEENQGNLQANRLQYFDHNPNLFRKVYLSSSLNGLICFCRFS  454
            L    +F + N      + E N        L+  D+      K  +  S NGL+C     
Sbjct  64   L-HSADFESLNRTNRAIFEELNHP------LKTPDY------KTEILGSCNGLLC---LM  107

Query  455  DRSDEIAIHNLSTRQHIPLPSNCHYDGSCKMNAFGLLGF--DSGSRRYKVLKSVEF--TT  622
            +  ++I + N STR++  LP         ++   G+ GF  D  S  Y+V+K V+F   +
Sbjct  108  NTEEDIILWNPSTRRYQKLPLT-----ETELPGEGIYGFGYDCVSDDYQVVKIVQFYGVS  162

Query  623  GDSVSVKHWVFTVGVDKSWRKIHSSPYYHPY  715
             D+   +  ++++  + SW++I   PYY  Y
Sbjct  163  SDTFDSEVKIYSLRSN-SWKRIQDFPYYLRY  192



>ref|XP_007147813.1| hypothetical protein PHAVU_006G157000g [Phaseolus vulgaris]
 gb|ESW19807.1| hypothetical protein PHAVU_006G157000g [Phaseolus vulgaris]
Length=410

 Score = 67.8 bits (164),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 70/215 (33%), Positives = 102/215 (47%), Gaps = 23/215 (11%)
 Frame = +2

Query  92   FLPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSL--THPSRMRILIL  265
            FLP E++VEI+S+LP KSL++F+CV K + SL+ D  F   H + S   TH +  RI++ 
Sbjct  53   FLPNELVVEILSRLPVKSLLQFRCVCKSWMSLISDPYFMKKHLHLSTRSTHFTHHRIIL-  111

Query  266  YPVLWRDRNFTNFNWYYTINYSEENQGNLQANRLQYFDHNPNLFRKVYLSSSLNGLICFC  445
                        F+       S  N  +   + L Y     N FR   +  S NGL+C  
Sbjct  112  ------SDTTAEFHLKSCSLSSLFNSPSTVCDDLNY--PVKNKFRHDGIVGSCNGLLC--  161

Query  446  RFSDRSDEIAIHNLSTR---QHIPLPSNCHYDGSCKMNAFGLLGFDSGSRRYKVLKSVEF  616
             F+ + D   + N STR   +  PL +N  +   C   AFG LG+D  +  YKV+     
Sbjct  162  -FAIKGDCALLWNPSTRVSKKSPPLGNN--WRPGC-FTAFG-LGYDHVTEDYKVVAVFYD  216

Query  617  TTGDSVSVKHWVFTVGVDKSWRKIHSSPY-YHPYN  718
                    K  V+++  + SWRKI   PY + PY 
Sbjct  217  PNEIYSECKVKVYSMATN-SWRKIQDFPYGFSPYQ  250



>gb|KDO44224.1| hypothetical protein CISIN_1g046902mg [Citrus sinensis]
Length=393

 Score = 67.8 bits (164),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 57/204 (28%), Positives = 92/204 (45%), Gaps = 19/204 (9%)
 Frame = +2

Query  95   LPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYPV  274
            +P +I+  I  + P KSL+RF+CVSK   SL+    F  LH N S+T  S  R+++    
Sbjct  5    IPLDIITGIFCRQPVKSLLRFRCVSKTCCSLIDSQDFIKLHLNHSITTRSNRRLIL----  60

Query  275  LWRDRNFTNFNWYYTINYSEENQGNLQANRLQYFDHNPNLFRKVYLSSSLNGLICFCRFS  454
                      +  Y +++     G      +Q   H  N+     +  S NGLI  C   
Sbjct  61   -------KGAHDLYALDFDTLTLG----TGVQPHHHPLNIGSGTEVLGSCNGLIALC---  106

Query  455  DRSDEIAIHNLSTRQHIPLPSNCHYDGSCKMNAFGLLGFDSGSRRYKVLKSVEFTTGDSV  634
            +   E+A+ N STR+   LP      G      F   G D  +  YK+++ + F   D  
Sbjct  107  NSVQELALFNPSTRKLKTLPLPPCLVGFPSAFTFYGFGQDKINDDYKLVRVLHFKGNDGD  166

Query  635  SVKHWVFTVGVDKSWRKIHSSPYY  706
             V+  V+++  + SWR+I + P +
Sbjct  167  DVEVEVYSLKTN-SWRRISNLPRF  189



>ref|XP_010546896.1| PREDICTED: F-box/kelch-repeat protein At3g06240-like [Tarenaya 
hassleriana]
Length=392

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 68/223 (30%), Positives = 110/223 (49%), Gaps = 26/223 (12%)
 Frame = +2

Query  95   LPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSL---THPSRMRILIL  265
            LP EI+ EI+ +LPAKS+ RF+CVSK F S+ +   FA  H   SL   T  S  R LI 
Sbjct  28   LPPEIIREILLRLPAKSIGRFRCVSKLFRSISLAPEFAKTHLGLSLRNDTFRSGRRRLI-  86

Query  266  YPVLWRDRNFTNFNWYYTINYSEENQGNLQANRLQYF-DHNPNLFRKVY---LSSSLNGL  433
              V  RD    +F+         E+  +++        D   + +++ Y   +  S NGL
Sbjct  87   --VCRRDLYMVDFDSIVDTCDGIEDLDDVEIPESPVMSDLVSSCYQEGYWVQMVGSCNGL  144

Query  434  ICFCRFSDRSDEIAIHNLSTRQHIPLPSNCHYDGS----CKMNAFGLLGFDSGSRRYKVL  601
            +C    ++ ++++ + NL+T +   +PS   +  S     ++   G LGFD+ +  YKV 
Sbjct  145  VC---TTNDNNDVFLFNLTTGESKEIPSLLEFLKSKSKQGRVYVLG-LGFDAITNDYKV-  199

Query  602  KSVEFTTGDSVSVKHWVFTVGVDKSWRKIHSS--PYYHPYNGF  724
              V   +GD  +V   V+++  D SW+ +  S   YY P +G 
Sbjct  200  --VALVSGDVQNVT--VYSLKTD-SWKWVGGSRHGYYGPASGL  237



>ref|XP_003623090.1| F-box protein [Medicago truncatula]
 gb|AES79308.1| F-box protein interaction domain protein [Medicago truncatula]
Length=385

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 69/217 (32%), Positives = 100/217 (46%), Gaps = 34/217 (16%)
 Frame = +2

Query  92   FLPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYP  271
            FLP E++VE++S LP KSL+R KCVSK +  L+ + SFA LH N   T    +R ++ Y 
Sbjct  12   FLPGELIVEVLSFLPVKSLMRLKCVSKSWKYLISEPSFAKLHLN--RTTQDAVRTIVSYH  69

Query  272  VLWRDRNFTNFNWYYTINYSEENQG---NLQANRLQYFDHNPNLFRKVYLSSSLNGLICF  442
            +  RD +FT F          EN     NL  N      H  N     Y+  S NGL+C 
Sbjct  70   MHSRDVSFTVFRLL-------ENPPIIINLPKNPY----HQLNDKDCHYIVGSCNGLLCL  118

Query  443  CRFSD--------RSDEIAIHNLSTRQHIPLPSNCHYDGSCKMNAFGLLGFDSGSRRYKV  598
               +         R + +   N +TR    +    H D           G+D+ +  YKV
Sbjct  119  FGGTGYREDNGGYRENWLRFWNPATRI---ISEKFHGDDGLGFPCNYTFGYDNSTETYKV  175

Query  599  LKSVEFTTGDSVSVKHWVFTVGVDKSWRKIHSSPYYH  709
            +    + T  + +V+  VF++GV+  WR I  SP  H
Sbjct  176  V----YFTRKTTNVR--VFSLGVN-VWRNIQDSPMIH  205



>ref|XP_010264513.1| PREDICTED: F-box/kelch-repeat protein At3g23880-like [Nelumbo 
nucifera]
Length=366

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 63/204 (31%), Positives = 99/204 (49%), Gaps = 17/204 (8%)
 Frame = +2

Query  95   LPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYPV  274
            LP+ ++  I++ LP KSLVRFK V K +  L+ D    D H + +     +   LIL   
Sbjct  4    LPENVVFSILAGLPVKSLVRFKSVDKHWCMLISDPRLVDSHLDRAKMRKKKQG-LILSGR  62

Query  275  LWRDRNFTNFNWYYTINYSEENQGNLQANRLQYFDHNPNLFRKVYLSSSLNGLICFCRFS  454
            +  DR  T    ++++  SE   G      +  +    +L R  ++  S NGLICF    
Sbjct  63   VDGDRYSTIH--FFSLRLSEAGDG----VAVPIYSTTVSLGR-YHVLPSCNGLICFYSI-  114

Query  455  DRSDEIAIHNLSTRQHIPLP-SNCHYDG-SCKMNAFGLLGFDSGSRRYKVLKSVEFTTGD  628
               D I I N + RQ + +  S+  Y   S  MN     GFD  + +YK++K +E ++  
Sbjct  115  ---DRIYICNPNIRQMVTITRSDVDYAASSLSMNMCCGFGFDCSTNQYKIIKLMESSSEP  171

Query  629  SVSVKHWVFTVGVDKSWRKIHSSP  700
             +  +  VF++G  + WRKI  SP
Sbjct  172  RLGAQ--VFSLGTGE-WRKISGSP  192



>emb|CDY15327.1| BnaC04g42960D [Brassica napus]
Length=385

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 62/207 (30%), Positives = 95/207 (46%), Gaps = 19/207 (9%)
 Frame = +2

Query  95   LPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYPV  274
            +P +++ EI S+LP+K++ R  C+SKF+ S++    F +L    S  HP       L  V
Sbjct  19   IPDDLVFEIFSRLPSKAIARCCCISKFWASMLRSQDFTELFLTKSFAHPQ------LLFV  72

Query  275  LWRDRNFTNFNWYYTINYSEENQGNLQANRLQYFDHNPNLFRKVYLSSSLNGLICFCRFS  454
               DR    F+     N  EEN   + AN L  F      +   +L   +N LI  C F 
Sbjct  73   FKEDREIVFFSSPQPEN-PEENSYVVAANHLARFPGREFSYTTGFLCYGVN-LIRNCEF-  129

Query  455  DRSDEIAIHNLSTRQHIPLPSNCHYDGSCKMNAFGLLGFDSGSRRYKVLKSVEFTTGDS-  631
                E  I N ST Q + LP     +   ++     LG+DS ++ +K+L        D  
Sbjct  130  ----EKVICNPSTGQALTLP---RLNSRLRVGMDSYLGYDSIAKEFKLLSMNSSRVTDRW  182

Query  632  VSVKHWVFTVGV-DKSWRKIHSS-PYY  706
            +S +H V T+G  + SWR +    P+Y
Sbjct  183  ISKEHQVLTLGTKNSSWRLVECCIPHY  209



>ref|XP_006344513.1| PREDICTED: F-box protein At1g53790-like [Solanum tuberosum]
Length=348

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 59/199 (30%), Positives = 98/199 (49%), Gaps = 13/199 (7%)
 Frame = +2

Query  101  QEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILI-LYPVL  277
            ++I  EI+S LPAKS++RFKC+ K + + +   +F  LH   S    S  R+L  LYP  
Sbjct  7    EDIASEIISWLPAKSIMRFKCICKAWNTWIEQPNFPKLHLARSEARSSGTRLLFELYPY-  65

Query  278  WRDRNFTNFNWYYTINYSEENQGNLQANRLQYFD--HNPNLFRKVYLSSSLNGLICFCRF  451
              +         Y I +  + Q  L+   L++    +  ++F     S+  NGL+C   +
Sbjct  66   --EPCPHPHPLDYRIRFRSKKQRRLERFSLEFTTRFYIEDMF---ICSNHCNGLVCL--Y  118

Query  452  SDRSDEIAIHNLSTRQHIPLPSNCHYDGSCKMNAFGLLGFDSGSRRYKVLKSVEFTTGDS  631
            S +  ++ + N+STR+   LP +        M+    LGFD  + +YK+L  + +     
Sbjct  119  SSKDTQVYLFNVSTREIKALPFSVEGVKKNTMDPRLYLGFDKVTEKYKLLHII-WEREPR  177

Query  632  VSVKHWVFTVGVDKSWRKI  688
              +KH V T+G + SWR I
Sbjct  178  RMMKHRVLTLGTN-SWRSI  195



>gb|KDO36510.1| hypothetical protein CISIN_1g016891mg [Citrus sinensis]
Length=381

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 69/220 (31%), Positives = 108/220 (49%), Gaps = 30/220 (14%)
 Frame = +2

Query  95   LPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILIL---  265
            LP +I ++I+S+L  K L+RFKCVSK F SL+    F  +H   S+   S + +++    
Sbjct  4    LPTDINIDILSRLSVKCLLRFKCVSKSFCSLIDSQEFIKIHLKRSIETNSNLSLILSGTP  63

Query  266  YPVLWRDRNFTNFNWYYTINYSEENQGNLQANRLQYFDHN-PNLFRKVYLSSSLNGLICF  442
             P+L   R      W   I  +  +  NL        DH   N   +  +  S NGLI F
Sbjct  64   APILDSSR-----YWGGKIFSAGLDSLNLGVE----LDHPFKNCKGRTPIIDSCNGLIAF  114

Query  443  CRFSDRSDE--IAIHNLSTRQHIPLPSNCHYDGSCK--MNAFGLLGFDSGSRRYKVLKSV  610
                 ++DE  IA+ N ST +H+ LP    + G  K  M   G  G+D+ +  YKV++ V
Sbjct  115  -----KNDENGIALWNPSTEEHLILPK---FWGDLKDFMVVDG-FGYDAVNDDYKVVRLV  165

Query  611  EFTTGDSVSVKHWVFTVGVDKSWRKIHSS-PYY--HPYNG  721
            +   G+    +  V+++  + SWR+I    PYY  H ++G
Sbjct  166  QLVIGNVGYTEIAVYSLRTN-SWRRIRVDFPYYILHGWDG  204



>ref|XP_010044316.1| PREDICTED: putative F-box protein At1g50870 [Eucalyptus grandis]
Length=394

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 55/207 (27%), Positives = 92/207 (44%), Gaps = 17/207 (8%)
 Frame = +2

Query  95   LPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYPV  274
            +P+++L EI+ +LP KSL RFKCVS  + SL+ D  F D H   S  HP  +  L  +P 
Sbjct  3    IPEDLLFEILKRLPVKSLCRFKCVSTLWRSLISDPRFVDSHFAHSSNHPKLVISLPSHP-  61

Query  275  LWRDRNFTNFNWYYTINYSEENQGNLQANRLQYFDHNPNLFRKVYLSSSLNGLICFCRFS  454
                        ++  N SE    +       YF       R  Y+S S++GLICF    
Sbjct  62   ----HAGPRARLFFAANLSEPGNDHRPWTVSPYFFALGTACR--YVSQSIHGLICF----  111

Query  455  DRSDEIAIHNLSTRQHIPLPS-NCHYDGSCKMNAFGLLGFDSGSRRYKVLKSVEFTTGDS  631
                 + + N ++ +++   +      G C    +   GFD  +++YKVL+++       
Sbjct  112  QVDGYVGVCNPTSGKYMTSRTVEAKVTGECAYLHYS-FGFDPVAKKYKVLRTLATRRSMP  170

Query  632  VSVKHWVFTVGV----DKSWRKIHSSP  700
              ++  +    V     ++WR+I   P
Sbjct  171  GGLRELIMEQHVLDLASETWRRIEDGP  197



>ref|XP_006285969.1| hypothetical protein CARUB_v10007490mg [Capsella rubella]
 gb|EOA18867.1| hypothetical protein CARUB_v10007490mg [Capsella rubella]
Length=409

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 57/207 (28%), Positives = 97/207 (47%), Gaps = 20/207 (10%)
 Frame = +2

Query  92   FLPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYP  271
            ++P ++  EI+ KLPAKS++RF+CVSK ++S+  D  F +     S     R  +LI + 
Sbjct  32   YVPIDLTREIIMKLPAKSILRFRCVSKLWWSITTDQDFIN-----SFASIPRKSLLITF-  85

Query  272  VLWRDRNFTNFNWYYTINYSEENQGNLQANRLQYFDHNPNLFRKVYLSSSLNGLICFCRF  451
                 R +     + ++   E+        +  +F   P   R  Y ++S++GLI F   
Sbjct  86   -----RQYDTTQIFCSLPLDEKYITTYSDVKSFHFT-PPKQGRYEYHANSVHGLIYF---  136

Query  452  SDRSDEIAIHNLSTRQHIPLPSNCHYDGSCKMNAFGLLGFDSGSRRYKVLKSVEFTTGDS  631
                 E+ I N +T+ H+ L      + S  + +F  LG+D     YK+L     T    
Sbjct  137  -QNKTEVLIWNPTTKDHVTLAKPT--EMSSWVTSF--LGYDPTENTYKLLSLGYGTWNRD  191

Query  632  VSVKHWVFTVGVDKSWRKIHSSPYYHP  712
               K  + T+G  +SWR   +SP ++P
Sbjct  192  KYRKPQILTLGCQESWRVAENSPLHYP  218



>ref|XP_003546182.1| PREDICTED: F-box protein CPR30-like isoform X1 [Glycine max]
Length=394

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 60/210 (29%), Positives = 94/210 (45%), Gaps = 28/210 (13%)
 Frame = +2

Query  95   LPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYPV  274
            LP+E+L EI+S+LP +SL+RF+  SK + SL+       LH   SLT  S   +++    
Sbjct  5    LPREVLTEILSRLPVRSLLRFRSTSKSWKSLIDSQHLNWLHLTRSLTLTSNTSLILRVDS  64

Query  275  LWRDRNFTNFNWYYTINYSEENQGNLQANRLQYFDHNPNLFRKVYLSSSLNGLICFCRFS  454
                 NF   +   ++N+      N                  + L  S NGL+C    S
Sbjct  65   DLYQTNFPTLDPPVSLNHPLMCYSN-----------------SITLLGSCNGLLC---IS  104

Query  455  DRSDEIAIHNLSTRQH-----IPLPSNCHYDGSCKMNAFGLLGFDSGSRRYKVLKSVEFT  619
            + +D+IA  N S RQH     +P+P   H D +         GFD  +R YK+++   F 
Sbjct  105  NVADDIAFWNPSLRQHRILPYLPVPRRRHPDTTLFAARVCGFGFDHKTRDYKLVRISYFV  164

Query  620  TGDSVSVKHWV--FTVGVDKSWRKIHSSPY  703
                 S    V  +T+  + +W+ + S PY
Sbjct  165  DLHDRSFDSQVKLYTLRAN-AWKTLPSLPY  193



>ref|XP_004486105.1| PREDICTED: F-box/kelch-repeat protein At3g23880-like [Cicer arietinum]
Length=384

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 66/223 (30%), Positives = 102/223 (46%), Gaps = 41/223 (18%)
 Frame = +2

Query  95   LPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWS---------LTHPSR  247
            LP E+++EI+S+LP K L++ +CV K + SL+ D  FA +H   S         LT PSR
Sbjct  29   LPFELIIEILSRLPVKFLIQLQCVCKSWKSLISDPKFAKMHLRMSTTRHLVVLTLTKPSR  88

Query  248  MRILILYPVLWRDRNFTNFNWYYTINYSEENQGNLQANRLQYFDHNPNLFRKVYLSSSLN  427
              I+  YP+      FT                   A +L Y  +N N F   ++  S +
Sbjct  89   SLIVKTYPL---SSLFTEI--------------TATATQLAYPLNNDNQFE--FIVGSCH  129

Query  428  GLICFCRFSDRSDEIAIHNLSTRQHIPLPSNCHYDGSCKMNAFGL--LGFDSGSRRYKVL  601
            G++CF    D+S  + + N S R+   LPS    +  C++  + +   G+D  S  YKV+
Sbjct  130  GILCFAI--DQSVAL-LWNPSIRKFTKLPS---LEYPCRLGCYTIYAFGYDHFSDTYKVV  183

Query  602  KSV---EFTTGDS-VSVKHWVFTVGVDKSWRKIHSSPYYHPYN  718
                   F   D     K  + T+G + SWR+I   P   P+ 
Sbjct  184  SVSCYRSFNLTDCFFKTKVKIHTLGTN-SWRRIQDFPTGVPFE  225



>ref|XP_006405041.1| hypothetical protein EUTSA_v10000468mg [Eutrema salsugineum]
 gb|ESQ46494.1| hypothetical protein EUTSA_v10000468mg [Eutrema salsugineum]
Length=384

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 64/216 (30%), Positives = 105/216 (49%), Gaps = 33/216 (15%)
 Frame = +2

Query  95   LPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYPV  274
            LP ++++EI++KLPAK L +F+CVSK + S++   SF D   + SL+ P   RIL+   +
Sbjct  14   LPLDMIIEILTKLPAKFLFKFRCVSKQWCSIIRSRSFIDSFMSLSLSRP---RILLCVSI  70

Query  275  LWRDRNFTNFNWYYTINYSEENQGNLQANRLQYFDHNPNLFRKVYLSSSLNGLICF----  442
            L  D+    F     ++  + N  +     + Y    P L   +   +S+ G+IC     
Sbjct  71   LRGDKRQLLF-LSSPLHLQDSNHSS-----IVYKHDMPEL---ISYCNSVRGIICLSLGD  121

Query  443  CRFSDRSDEIAIHNLSTRQHIPLPSNCHYDGSCK-MNAFGLLGFDSGSRRYKVLKSVEFT  619
            C F        I N +TRQ I LP++   +   K    F  LG+D+ + +YK+L++V   
Sbjct  122  CGF-------MICNPTTRQVITLPNDSLTELESKPCICFMCLGYDTSNDQYKILRTVR--  172

Query  620  TGDSVSVKHWVFTV-------GVDKSWRKIHSSPYY  706
                 S +H V T+           SWR++  S +Y
Sbjct  173  RAPFGSAEHSVCTLRGGGGGRSSFSSWRRVECSFHY  208



>ref|XP_010248476.1| PREDICTED: F-box protein At3g07870-like [Nelumbo nucifera]
Length=466

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 61/212 (29%), Positives = 94/212 (44%), Gaps = 25/212 (12%)
 Frame = +2

Query  95   LPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYPV  274
            LP +++ +I+ KLP KSL+RFKCV K + +L+ D  F   H N         R+L    +
Sbjct  6    LPADVIFDILCKLPVKSLLRFKCVCKSWLALISDPLFIKQHLN---------RVLENITI  56

Query  275  LWRDRNFTNF-----NWYYTINYSEENQGNLQANRLQYFDHNPNLFRKVYLSSSLNGLIC  439
               D   +NF        + ++   E + N  ++R        N  R  +++ S NGL+C
Sbjct  57   PNDDGGSSNFIVISAGIVFHVDNGSETETNDGSSRKLDLPFQ-NSIRSPWVAGSCNGLVC  115

Query  440  FC--RFSDRSDEIAIHNLSTRQHIPLPSNCHYDGSCK---MNAFGLLGFDSGSRRYKVLK  604
                R  D  +++ + N ST  ++ LP             M      G+ S    YKV+K
Sbjct  116  LADERLDDTPEDLFVWNPSTGDYVKLPETPFERPPSSHLLMTDISAFGYISALDEYKVVK  175

Query  605  SVE-FTTGDSVSVKH---WVFTVGVDKSWRKI  688
             ++ F    S  V      V T+G D SWRKI
Sbjct  176  VIDAFDVSRSPGVNRSTVLVHTLGTD-SWRKI  206



>ref|XP_009339954.1| PREDICTED: F-box protein At3g07870-like [Pyrus x bretschneideri]
Length=463

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 58/206 (28%), Positives = 97/206 (47%), Gaps = 17/206 (8%)
 Frame = +2

Query  95   LPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYPV  274
            LP+E++++I+S++  K+L   +CV K++   + D  F  LHR   LT P    I IL   
Sbjct  17   LPKELVMDILSRVSVKALFSCRCVCKYWLYSISDPEFPHLHR---LTSP----IGILSKN  69

Query  275  LWRDRNF---TNFNWYYTINYSEENQGNLQANRLQYFDHNPNLFRKVYLSSSLNGLICFC  445
              R   +    +    +T         + Q  R+Q+   N     K +L +S NGL+C  
Sbjct  70   EPRGPRYHVEDSTKLQFTQLQESACGSDFQVQRMQFTTKNNLPIDKFHLINSYNGLLCLS  129

Query  446  RFSDRSDEIAIHNLSTRQHIPL-PSNCHYDGSCKMNAFGLLGFDSGSRRYKVLKSVEFTT  622
            R  DR D   + N    ++I L P+N H     +   F  +G+ + +  YKVL++     
Sbjct  130  RIMDRDDTFYVCNPILGEYITLPPTNWHSHNWWR--TFSGIGYSATTNEYKVLRTSRTKN  187

Query  623  GDSVSVKHWVFTVGVDKSWRKIHSSP  700
             + VS    ++T+G   +WR I  +P
Sbjct  188  QNLVSE---IYTIGTG-AWRSIGLAP  209



>ref|XP_006415158.1| hypothetical protein EUTSA_v10009644mg [Eutrema salsugineum]
 gb|ESQ33511.1| hypothetical protein EUTSA_v10009644mg [Eutrema salsugineum]
Length=368

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 56/203 (28%), Positives = 92/203 (45%), Gaps = 29/203 (14%)
 Frame = +2

Query  95   LPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYPV  274
            LP ++++EI+ + P K+L+RF  VSK + S++    F   H N SL  P           
Sbjct  29   LPLDLIIEILKRSPVKTLMRFLSVSKLWASIIRSRKFMKQHLNESLNRP-----------  77

Query  275  LWRDRNFTNFNWYYTINYSEENQGNLQANRLQYFDHNPNLFRKVYLSSSLNGLICFCRFS  454
              R   F   + +Y +   E +     A+   Y    P +F     + S++GLIC+   S
Sbjct  78   --RGLVFVFKSKHYGLTTHEASPS--LASLASYLVTCPAIFS----APSVHGLICYGSHS  129

Query  455  DRSDEIAIHNLSTRQHIPLPSNCHYDGSCKMNAFGLLGFDSGSRRYKVL----KSVEFTT  622
                   ++NL TR+ I LP    Y  +     +  LG+D     YKVL    ++ E   
Sbjct  130  TP----GVYNLCTRRSITLPDLDSYSETYITQLY--LGYDPIDSDYKVLCVMIETPESGN  183

Query  623  GDSVSVKHWVFTVGVDKSWRKIH  691
               ++++ WV T+G + SW+ I 
Sbjct  184  TRGLAMEIWVLTLGSENSWKMIQ  206



>ref|XP_010431565.1| PREDICTED: F-box protein At2g21930-like [Camelina sativa]
Length=402

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 55/208 (26%), Positives = 97/208 (47%), Gaps = 25/208 (12%)
 Frame = +2

Query  95   LPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYPV  274
            +P +++ EI   LP KSL RF CVSK + S + +  F   +   S   P  +       +
Sbjct  27   VPADVIPEIFKGLPVKSLARFVCVSKEYASFIRNRDFVKTYLMKSSDSPQSL-------I  79

Query  275  LWRDRNFTNFNWYYTINYSEENQGNLQANRLQYFDHNPNLFRKVYLSSSLNGLICFCRFS  454
               +   +  +++++ +   +++G   ++ L  +    +       + S+NGLIC+    
Sbjct  80   FTFEGKCSGKHFFFS-SLQPQDRGESVSSSLAIYHMKCHFRPYKTFAPSVNGLICY----  134

Query  455  DRSDEIAIHNLSTRQHIPLPSNCHYDGSCKMNAFGLLGFDSGSRRYKVLKSVEFTTGDSV  634
                 + ++N STR+ I LP+      S +++ +  LG+D  S  YKVL     T GD V
Sbjct  135  GPPWRLMVYNPSTRRSITLPNI----DSMRIDIYHFLGYDPISGDYKVLC---MTKGDPV  187

Query  635  SVKHW------VFTVGVDKSWRKIHSSP  700
             ++        + T+G DKSWR I   P
Sbjct  188  GMRFGLAQELRILTLGKDKSWRMIEDFP  215



>ref|XP_010501044.1| PREDICTED: putative F-box protein At1g53370 [Camelina sativa]
Length=397

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 63/218 (29%), Positives = 101/218 (46%), Gaps = 27/218 (12%)
 Frame = +2

Query  95   LPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYPV  274
            +P ++L++I+S++PA S+ RF+CVSK + S++    F +L    S++ P   R+L + PV
Sbjct  29   IPVDLLIDILSRVPAYSIARFRCVSKSWESILRRPDFTELFLTKSVSLP---RLLFVVPV  85

Query  275  LWRDRNFTNFNWYYTINYSEENQGNLQANRLQYFDHNPNLFRKVY---LSSSLNGLICFC  445
                 +   FN    ++ S + Q     + L         FRK     LS  + G + F 
Sbjct  86   NEDSDDEDPFNEASFVSSSPQPQNPDDKSSLVATPFKKCFFRKYIPWDLSPQVVGGLVFL  145

Query  446  RFSDRSDEIAIHNLSTRQHIPLPSNCHYDGSCKMNAFGL----LGFDSGSRRYKVLKSV-  610
            + S R+    I N  T + I LPS         M A G+     GFD  S+++KVL    
Sbjct  146  QHSWRTKPQVIFNPVTGESIFLPS---------MKASGIKRSYFGFDPISKQFKVLCITW  196

Query  611  -EFTTGDSVSVKHWVFTV--GVDKSWRKIHSSPYYHPY  715
              + T D+    H + T+  G+ + WR I      H Y
Sbjct  197  SRYETPDT----HRILTLETGIKRRWRTIQGPVLPHDY  230



>ref|XP_010683823.1| PREDICTED: F-box protein CPR30-like [Beta vulgaris subsp. vulgaris]
Length=377

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 58/202 (29%), Positives = 98/202 (49%), Gaps = 22/202 (11%)
 Frame = +2

Query  92   FLPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYP  271
             LP+EI+V+++ +LPAKSL+RFK V K +Y+L+    F+ LH   SLT  S +  +I  P
Sbjct  10   ILPEEIIVDVLLRLPAKSLMRFKSVCKSWYNLIKCPDFSKLHLERSLTTRSNLHYVIQTP  69

Query  272  VLWRDRNFTNFNWYYTINYSEENQGNLQANRLQYFDHNPNLFRKVYLSSSLNGLICFCRF  451
             ++   +F  F+    +N+              Y  + P+  R V    S NGL+C  R+
Sbjct  70   -MFHLADFDTFDNPIELNHP-------------YKTNYPSDCRVV---GSCNGLLCLHRY  112

Query  452  SDRSDEIAIHNLSTRQHIPLP---SNCHYDGSCKMNAFGLLGFDSGSRRYKVLKSVEFTT  622
             +    + I+N +TR +  LP       ++    M  FG  G+D+ S+ YK ++      
Sbjct  113  FNFQLPLCIYNPTTRTYKLLPFLTVRAPFNYRRSMFTFG-FGYDNASKDYKCVRVFRNLN  171

Query  623  GDSVSVKHWVFTVGV-DKSWRK  685
              + + +  V    + D  WR+
Sbjct  172  KATGTYESEVMVCSLKDDEWRR  193



>ref|XP_004159645.1| PREDICTED: F-box protein CPR30-like [Cucumis sativus]
Length=383

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 65/213 (31%), Positives = 100/213 (47%), Gaps = 27/213 (13%)
 Frame = +2

Query  95   LPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYPV  274
            LP  ++++I+S+LP +SL+RFKCV K +Y+L  D  F   H + SL H     IL+   V
Sbjct  7    LPDGVIIDILSRLPPESLLRFKCVRKSWYALFNDPKFKAKHFSTSLQH---KHILLKRLV  63

Query  275  LWRDRNFTNFNWYYTINYSEENQGNLQANRLQYFDHNPNLFRKVYLSSSLNGLICFCRFS  454
                 N  N    + +  S     +L    L + +     FR   +    +GL+C    +
Sbjct  64   TKHSGNKENIFSLFKLPLSIHPSLSLSDIDLPFHED----FRFFEIRGHSHGLLC---LT  116

Query  455  DRSDEIAIHNLSTRQHIPLPSNC-----------HYDGSCKMNAFGLLGFDSGSRRYKVL  601
            D   +I + N STR+   LP +             YD S   NA G  G+DS SR +KV+
Sbjct  117  DLRKDIFLCNPSTREFHKLPPSILLLTEPPVEPDDYDSS--TNAVG-FGYDSKSRDFKVV  173

Query  602  KSVEFTTGDS--VSVKHWVFTVGVDKSWRKIHS  694
            + V+F  G       +  V+ +  D+ WR+I S
Sbjct  174  RVVDFVEGPGYFYPPRVEVYDLSKDR-WREIES  205



>ref|XP_002300155.2| hypothetical protein POPTR_0001s32570g, partial [Populus trichocarpa]
 gb|EEE84960.2| hypothetical protein POPTR_0001s32570g, partial [Populus trichocarpa]
Length=384

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 65/206 (32%), Positives = 98/206 (48%), Gaps = 20/206 (10%)
 Frame = +2

Query  95   LPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLH--RNWSLTHPSRMRILILY  268
            LPQ+I+V+I++ LP KSLVRFKCV K +  L+ D  F  LH  R     + +R R+L+  
Sbjct  4    LPQDIIVDILTYLPVKSLVRFKCVCKPWQLLISDPRFVKLHLKRAIEGNNINRQRLLVAA  63

Query  269  PVLWRDRNFTNFNWYYTINYSEENQGNLQANRLQYFDHNPNLFRKVYLSSSLNGLICFCR  448
              L+   +F   +    IN   E      A+R + F           +  S +GL+C   
Sbjct  64   EPLYSSVDFEAASDGDGINAVMELPYPSAASRTESFAF-------ASIRGSCDGLVCIRN  116

Query  449  FSDRSDEIAIHNLSTRQ--HIPLPSNCHYDGSCKMNAF-GLLGFDSGSRRYK-VLKSVEF  616
              D  D + + N STR+   +P PS+     S + + F   LG+DS    YK V+  +  
Sbjct  117  GGDVHD-MFLWNPSTRESKKLPKPSS-----SVQKHGFLTGLGYDSTIDDYKLVIACLTT  170

Query  617  TTGDSVSVKHWVFTVGVDKSWRKIHS  694
              G    +   VFT+  + SWR+I  
Sbjct  171  ANGSHQIMAPEVFTLKTN-SWRRIQG  195



>ref|XP_010326062.1| PREDICTED: putative F-box protein At1g50870 isoform X1 [Solanum 
lycopersicum]
Length=462

 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 59/211 (28%), Positives = 107/211 (51%), Gaps = 20/211 (9%)
 Frame = +2

Query  101  QEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYPVLW  280
            +EI+++I+ +LP +S++RFKCVSKF+ SL+ D  F   H   +  + +  ++LI   +L 
Sbjct  96   EEIMMDILRRLPMRSILRFKCVSKFWKSLIDDPYFKRTHYIHNRDNQNSKKVLIAESLLT  155

Query  281  RDRNFTNFNWYYTINYS--EENQGNLQANRLQYFDHNPNLFRKVYLSSSLNGLICFCRFS  454
            +D  F+    +YT + S  E+ Q      +L +      +  +++   S +GL+     S
Sbjct  156  KDDTFS----FYTSSLSMVEDKQ------KLDWPTSCNPMDTRIF--CSCDGLVLIRVCS  203

Query  455  DRS-DEIAIHNLSTRQHIPLPSNCHYDGSCKMNAFGLLGFDSGSRRYKVLKSVEFTTGDS  631
            +   +E+ + N STR+ I LP   H +   K   FG + +D+ S  YK+L +V      S
Sbjct  204  EMGYEELFLWNPSTRESILLP---HLEFRTKHYVFG-MEYDATSECYKIL-AVNLNVKAS  258

Query  632  VSVKHWVFTVGVDKSWRKIHSSPYYHPYNGF  724
            ++    + ++  + SWR+I          GF
Sbjct  259  INTSIEILSLKRNSSWRRIDYPTDIERIRGF  289



>ref|XP_004147498.1| PREDICTED: F-box protein CPR30-like [Cucumis sativus]
Length=376

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 65/213 (31%), Positives = 100/213 (47%), Gaps = 27/213 (13%)
 Frame = +2

Query  95   LPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYPV  274
            LP  ++++I+S+LP +SL+RFKCV K +Y+L  D  F   H + SL H     IL+   V
Sbjct  7    LPDGVIIDILSRLPPESLLRFKCVRKSWYALFNDPKFKAKHFSTSLQH---KHILLKRLV  63

Query  275  LWRDRNFTNFNWYYTINYSEENQGNLQANRLQYFDHNPNLFRKVYLSSSLNGLICFCRFS  454
                 N  N    + +  S     +L    L + +     FR   +    +GL+C    +
Sbjct  64   TKHSGNKENIFSLFKLPLSIHPSLSLSDIDLPFHED----FRFFEIRGHSHGLLC---LT  116

Query  455  DRSDEIAIHNLSTRQHIPLPSNC-----------HYDGSCKMNAFGLLGFDSGSRRYKVL  601
            D   +I + N STR+   LP +             YD S   NA G  G+DS SR +KV+
Sbjct  117  DLRKDIFLCNPSTREFHKLPPSILLLTEPPVEPDDYDSS--TNAVG-FGYDSKSRDFKVV  173

Query  602  KSVEFTTGDS--VSVKHWVFTVGVDKSWRKIHS  694
            + V+F  G       +  V+ +  D+ WR+I S
Sbjct  174  RVVDFVEGPGYFYPPRVEVYDLSKDR-WREIES  205



>ref|XP_006349972.1| PREDICTED: F-box/kelch-repeat protein At3g06240-like [Solanum 
tuberosum]
Length=366

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 59/204 (29%), Positives = 99/204 (49%), Gaps = 23/204 (11%)
 Frame = +2

Query  95   LPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSR--MRILILY  268
            LPQ+I+  I+S+L  K L++FKCVSK + SL+ +  F  LH + +++ P+    RIL + 
Sbjct  12   LPQDIMSNILSRLHVKYLLQFKCVSKSWLSLISNEEFIKLHLSLAISDPNTNHFRILTMS  71

Query  269  PVLWRDRNFTNFNWYYTINYSEENQGNLQANRLQYFDHNPNL-FRKVYLSSSLNGLICFC  445
            P       F + ++    ++ +    +     L Y   +  L    V +  S NGLIC  
Sbjct  72   P-------FKSLDYESPSSFEDHVDDDSAIVDLLYPSMDEGLESNNVEIIGSCNGLICLL  124

Query  446  RFSDRSDEIAIHNLSTRQHIPLPS-NCHYDGSCKMNAFGLLGFDSGSRRYKVLKSVEFTT  622
                 +++I++ N STR    LPS  C++   C +  F   G+DS +  YKV++      
Sbjct  125  LCD--TNKISLWNPSTRVSRDLPSLTCNFHNDCPI--FNGFGYDSINDTYKVVRGTLDGI  180

Query  623  GDSVSVKHWVFTVGVDKSWRKIHS  694
             D       VF+   ++ WR+I  
Sbjct  181  VD-------VFSTSGER-WRRIQG  196



>ref|XP_007023958.1| F-box family protein [Theobroma cacao]
 gb|EOY26580.1| F-box family protein [Theobroma cacao]
Length=380

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 59/218 (27%), Positives = 96/218 (44%), Gaps = 40/218 (18%)
 Frame = +2

Query  98   PQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYPVL  277
            P +++ +I+ +LP K+L+RFKCVSK + SL+ D  F  +H + SL   + +++ +     
Sbjct  5    PSDLITDILCRLPVKTLLRFKCVSKPWGSLIDDSDFVKIHLHQSLKTSTNIKLFL-----  59

Query  278  WRDRNFTNFNWYYTINYSEENQGNLQANRLQY---FDHNPNLFRKVYLSSSLNGLICFCR  448
              D    N N  Y +++          N +Q+   F    N ++   +  S NGL+    
Sbjct  60   --DNCVENDNEAYAVDFDS------LCNLVQFPRPFTAEANKYQS-RIFGSCNGLL---A  107

Query  449  FSDRSDEIAIHNLSTRQHIPLPS-------------NCHYDGSCKMNAFGLLGFDSGSRR  589
               R + IA+ N STR++  LP+              C YD     N     G+D  +  
Sbjct  108  VYHRQEGIALWNPSTRKYHYLPTLGDDITMDHDILPGCGYD----KNTILGFGYDVSNSD  163

Query  590  YKVLKSVEFTTGDSVSVKHWVFTVGVDKSWRKIHSSPY  703
            YKV+K     T +   V  +        SWR+I   PY
Sbjct  164  YKVVKMFRSKTQNCFKVMIYSLKA---NSWRRIKDCPY  198



>gb|KCW54173.1| hypothetical protein EUGRSUZ_I00151 [Eucalyptus grandis]
Length=386

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 67/219 (31%), Positives = 105/219 (48%), Gaps = 35/219 (16%)
 Frame = +2

Query  95   LPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYPV  274
            LPQ++ VEI+ +LPA+SL+RF+CV + + S + D  FA LH + S  H S   +L L+  
Sbjct  10   LPQDVAVEILKRLPARSLLRFRCVCRSWRSTIDDPRFAALHLSHSALHASNWHLLWLH--  67

Query  275  LWRD-RNFTNFNWYYTINYSEENQGNLQANRLQYFDHNP-NLFRKVYLSSSLNGLICFCR  448
             W   RN  +        +S E+      + +     NP N+   V    S NGLIC   
Sbjct  68   -WGGLRNLCSL-------FSNESLAMPSQSEIGMPFANPRNIHGPV---GSCNGLICVKE  116

Query  449  FSDR--SDEIAIHNLSTRQHIPLPSNCHYDGSCKMNAF--GLL---------GFDSGSRR  589
             S R     + + NL  R+H  +P +   D    +  F  G+L         GFD+ S  
Sbjct  117  ISARRYGQTMYLWNLFARKHKVVPRS-GLDSRFFLVGFPCGVLGIPREVLGFGFDARSND  175

Query  590  YKVLKSVEFTTGDSVSV---KHWV--FTVGVDKSWRKIH  691
            YK++K +     +   +   K WV  +++G+D SWR++ 
Sbjct  176  YKIVKILYLLDNNHRCIGGMKPWVETYSLGID-SWRRLE  213



>ref|XP_010326068.1| PREDICTED: putative F-box protein At1g50870 isoform X7 [Solanum 
lycopersicum]
Length=401

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 59/211 (28%), Positives = 107/211 (51%), Gaps = 20/211 (9%)
 Frame = +2

Query  101  QEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYPVLW  280
            +EI+++I+ +LP +S++RFKCVSKF+ SL+ D  F   H   +  + +  ++LI   +L 
Sbjct  35   EEIMMDILRRLPMRSILRFKCVSKFWKSLIDDPYFKRTHYIHNRDNQNSKKVLIAESLLT  94

Query  281  RDRNFTNFNWYYTINYS--EENQGNLQANRLQYFDHNPNLFRKVYLSSSLNGLICFCRFS  454
            +D  F+    +YT + S  E+ Q      +L +      +  +++   S +GL+     S
Sbjct  95   KDDTFS----FYTSSLSMVEDKQ------KLDWPTSCNPMDTRIF--CSCDGLVLIRVCS  142

Query  455  DRS-DEIAIHNLSTRQHIPLPSNCHYDGSCKMNAFGLLGFDSGSRRYKVLKSVEFTTGDS  631
            +   +E+ + N STR+ I LP   H +   K   FG + +D+ S  YK+L +V      S
Sbjct  143  EMGYEELFLWNPSTRESILLP---HLEFRTKHYVFG-MEYDATSECYKIL-AVNLNVKAS  197

Query  632  VSVKHWVFTVGVDKSWRKIHSSPYYHPYNGF  724
            ++    + ++  + SWR+I          GF
Sbjct  198  INTSIEILSLKRNSSWRRIDYPTDIERIRGF  228



>ref|XP_010030321.1| PREDICTED: F-box/kelch-repeat protein At3g23880-like [Eucalyptus 
grandis]
Length=427

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 67/219 (31%), Positives = 105/219 (48%), Gaps = 35/219 (16%)
 Frame = +2

Query  95   LPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYPV  274
            LPQ++ VEI+ +LPA+SL+RF+CV + + S + D  FA LH + S  H S   +L L+  
Sbjct  51   LPQDVAVEILKRLPARSLLRFRCVCRSWRSTIDDPRFAALHLSHSALHASNWHLLWLH--  108

Query  275  LWRD-RNFTNFNWYYTINYSEENQGNLQANRLQYFDHNP-NLFRKVYLSSSLNGLICFCR  448
             W   RN  +        +S E+      + +     NP N+   V    S NGLIC   
Sbjct  109  -WGGLRNLCSL-------FSNESLAMPSQSEIGMPFANPRNIHGPV---GSCNGLICVKE  157

Query  449  FSDR--SDEIAIHNLSTRQHIPLPSNCHYDGSCKMNAF--GLL---------GFDSGSRR  589
             S R     + + NL  R+H  +P +   D    +  F  G+L         GFD+ S  
Sbjct  158  ISARRYGQTMYLWNLFARKHKVVPRS-GLDSRFFLVGFPCGVLGIPREVLGFGFDARSND  216

Query  590  YKVLKSVEFTTGDSVSV---KHWV--FTVGVDKSWRKIH  691
            YK++K +     +   +   K WV  +++G+D SWR++ 
Sbjct  217  YKIVKILYLLDNNHRCIGGMKPWVETYSLGID-SWRRLE  254



>emb|CDX88816.1| BnaA03g08330D [Brassica napus]
Length=390

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 60/204 (29%), Positives = 101/204 (50%), Gaps = 22/204 (11%)
 Frame = +2

Query  95   LPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYPV  274
            +P ++++EI+S LPAKSL RF+ VSK ++S +    F DL +  S + P  +  L L   
Sbjct  20   IPFDLIIEILSLLPAKSLFRFQSVSKQWFSTIRSKFFVDLFQTRSKSRPRLLLSLYL---  76

Query  275  LWRDRNFTNFNWYYTINYSEENQGNLQANRLQYFDHNPNLFRKVYLSSSLNGLICFCRFS  454
                R+      +    ++ ++  +   + +  +D + +      L  ++NG +CF +FS
Sbjct  77   ----RDAEEQFIFSAPEHTYDDDKSSSTSVMARYDMSISAPGYNVLYGAVNGFVCFKKFS  132

Query  455  DRSDEIAIHNLSTRQHIPLPS---NCHYDGSCKMNAFGLLGFDSGSRRYKVLKSVEFTTG  625
               + IA++N +TRQ + LP    N  Y     M+A   LG+D    +YKVL  V+    
Sbjct  133  --CNTIAVYNPTTRQIVKLPDFTPNGRY-----MHA--RLGYDPVEDQYKVL-CVKMFDH  182

Query  626  DSVSVKHWVFTVGVD--KSWRKIH  691
                 +H+V TV     + WRKI 
Sbjct  183  KRQQQEHFVCTVSSSQKQEWRKIE  206



>ref|XP_010474403.1| PREDICTED: F-box protein At2g21930-like [Camelina sativa]
Length=289

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 59/204 (29%), Positives = 98/204 (48%), Gaps = 24/204 (12%)
 Frame = +2

Query  95   LPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYPV  274
            +P +++ EI+     ++L RF+CVS  + S++    F    +++ +   +R + LI   +
Sbjct  24   IPHDVIEEILKVSTVETLARFRCVSTQYASMIRSREFI---KSYLIKSSTRPKSLI---I  77

Query  275  LWRDRNFTNFNWYYTINYSE-ENQGNL-QANRLQYFDHNPNLFRKVYLSSSLNGLICFCR  448
             +++     F   +  + S+ +NQG L  ++   Y     +L    Y ++S++GLIC   
Sbjct  78   SFKEFEPLGFGKPFFFSASQPQNQGELSSSSSATYLLSYQHLLHTTY-AASVHGLIC---  133

Query  449  FSDRSDEIAIHNLSTRQHIPLPSNCHYDGSCKMNAFGLLGFDSGSRRYKVLKSVEFTTGD  628
                   I I+N STR+ I LP   +    C    +  LG+D     YKVL  V+     
Sbjct  134  -HGSPSMIEIYNPSTRKSITLPKVDYESFPC----YSYLGYDPIDGDYKVLCRVK-----  183

Query  629  SVSVKHWVFTVGVDKSWRKIHSSP  700
              +    VFTVG DKSWRKI   P
Sbjct  184  --AGYFQVFTVGKDKSWRKIEDFP  205



>ref|XP_009791674.1| PREDICTED: putative F-box protein At1g32420 [Nicotiana sylvestris]
Length=321

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 58/196 (30%), Positives = 88/196 (45%), Gaps = 11/196 (6%)
 Frame = +2

Query  104  EILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYPVLWR  283
            +I+ +I++ LP KSL+RFKCVSK  +++  D  F  LH       PS  R+L L+ V   
Sbjct  8    DIVFQILTWLPTKSLMRFKCVSKT-WNIQHDPDFVKLHN----ARPSTTRLL-LFEVEVC  61

Query  284  DRNFTNFNWYYTINYSEENQGNLQANRLQYFDHNPNLFRKVYLSSSLNGLICFCRFSDRS  463
             R   + +        E     L A R  YF    N ++    S+  NGL+C   F D  
Sbjct  62   PRREDDLSIKKKRPELERFSVQLLAPR-HYF----NYYQMSVCSNYCNGLVCLYSFKDTQ  116

Query  464  DEIAIHNLSTRQHIPLPSNCHYDGSCKMNAFGLLGFDSGSRRYKVLKSVEFTTGDSVSVK  643
              +        + +P   N        ++    LGFDS + +YK+L         +  +K
Sbjct  117  TYLYSVTTGEIKALPFSMNQEIQAQYPLDPQLFLGFDSITEKYKLLHIFVGKNNGNRVIK  176

Query  644  HWVFTVGVDKSWRKIH  691
              + T+G+D SWRK H
Sbjct  177  TRIRTLGIDSSWRKFH  192



>ref|XP_009131849.1| PREDICTED: F-box protein At1g30790-like [Brassica rapa]
Length=389

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 60/204 (29%), Positives = 101/204 (50%), Gaps = 22/204 (11%)
 Frame = +2

Query  95   LPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYPV  274
            +P ++++EI+S LPAKSL RF+ VSK ++S +    F DL +  S + P  +  L L   
Sbjct  19   IPFDLIIEILSLLPAKSLFRFQSVSKQWFSTIRSKFFVDLFQTRSKSRPRLLLSLYL---  75

Query  275  LWRDRNFTNFNWYYTINYSEENQGNLQANRLQYFDHNPNLFRKVYLSSSLNGLICFCRFS  454
                R+      +    ++ ++  +   + +  +D + +      L  ++NG +CF +FS
Sbjct  76   ----RDAEEQFIFSAPEHTYDDDKSSSTSVMARYDMSISAPGYNVLYGAVNGFVCFKKFS  131

Query  455  DRSDEIAIHNLSTRQHIPLPS---NCHYDGSCKMNAFGLLGFDSGSRRYKVLKSVEFTTG  625
               + IA++N +TRQ + LP    N  Y     M+A   LG+D    +YKVL  V+    
Sbjct  132  --CNTIAVYNPTTRQIVKLPDFTPNGRY-----MHA--RLGYDPVEDQYKVL-CVKMFDH  181

Query  626  DSVSVKHWVFTVGV--DKSWRKIH  691
                 +H+V TV     + WRKI 
Sbjct  182  KRQQQEHFVCTVSSSQKQEWRKIE  205



>emb|CDP12767.1| unnamed protein product [Coffea canephora]
Length=384

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 58/213 (27%), Positives = 103/213 (48%), Gaps = 21/213 (10%)
 Frame = +2

Query  95   LPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYPV  274
            +PQE+ V+I+ +LPAKS+ +F+CVSK + SL+ D  F   H    L +P +   LI +  
Sbjct  22   IPQELTVDILLRLPAKSIGKFRCVSKPWRSLLSDPLFITAHLTLHLHYPQK---LIFFSS  78

Query  275  LWRDRNFTNFNWYYTINYSEENQGNLQANRLQYFDHNPNLFRKV-----YLSSSLNGLIC  439
                 +  +    YT+ ++  +     A  LQ    + N+   +      +  S NGL+ 
Sbjct  79   SPVPPSSRSI---YTLTFTTADNPGSDA-VLQKLTLSENILENLSSKYASIVGSCNGLVL  134

Query  440  FCRFSDR---SDEIAIHNLSTRQHIPLPSNCHYDGSCKMNAFGLLGFDSGSRRYKVLK-S  607
               F       D + + N +T + + LP++     + ++   G+LG+DS +  YK++  S
Sbjct  135  VLGFRMEIGFRDTMYLINPTTMEFVKLPASPLVREAVRIG--GVLGYDSSNDDYKIVTVS  192

Query  608  VEFTTGDSVSVKHWVFTVGVDKSWRKIHSSPYY  706
             +  T +  SV  +    G   SW++I S PY+
Sbjct  193  CDEPTSNETSVDVFSLRSG---SWKRIKSLPYH  222



>ref|XP_010686238.1| PREDICTED: F-box protein CPR30-like [Beta vulgaris subsp. vulgaris]
Length=391

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 59/215 (27%), Positives = 102/215 (47%), Gaps = 22/215 (10%)
 Frame = +2

Query  95   LPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYPV  274
            +P +++ +I+ +LPAK L+RFKCV K +Y+L+ D SF   H   SL   S +  +I  P+
Sbjct  13   IPLDVIRDILLQLPAKPLLRFKCVCKSWYNLINDPSFIRRHVEQSLATQSNLHFVIRTPM  72

Query  275  LWRDRNFTNFNWYYTINYSEENQGNLQANRLQYFDHNPNLFRKVYLSSSLNGLICFCRFS  454
            L    +F  F+    ++Y  +N  +                    +  S NGL C   + 
Sbjct  73   L-HLADFDTFDNPVELDYPFKNSSDGGGE----------------IVGSCNGLFCLWNY-  114

Query  455  DRSDEIAIHNLSTRQHIPLPS-NCHYDGSCKMNAFGL-LGFDSGSRRYKVLKSVEFTTGD  628
            D    + ++N +T+ H  LP        S +++ F +  G+D+ S  YK ++ ++    +
Sbjct  115  DYGLSLFLYNPTTQTHKILPDLPIIAPFSFRLSKFDIGFGYDNISEDYKCVRILQNHDKE  174

Query  629  SVSVKHWVFTVGV-DKSWRKIHSSPYY-HPYNGFN  727
            + SV+  V    +   SWR+    PYY H +NG  
Sbjct  175  AGSVESEVMVYSLKSDSWRRGPDVPYYFHYHNGLG  209



>gb|KHN33084.1| F-box/kelch-repeat protein [Glycine soja]
Length=366

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 66/209 (32%), Positives = 101/209 (48%), Gaps = 22/209 (11%)
 Frame = +2

Query  92   FLPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFAD--LHRNWSLTHPSRMRILIL  265
            FLP E++VEI+S+LP KSL++F+CV K + SL+ D  F    LH +   TH +  RI++ 
Sbjct  9    FLPDELVVEILSRLPVKSLLQFRCVCKSWMSLIYDPYFMKKHLHLSSRSTHFTHHRIIL-  67

Query  266  YPVLWRDRNFTNFNWYYTINYSEENQGNLQANRLQYFDHNPNLFRKVYLSSSLNGLICFC  445
                        F+       S  N  +   + L Y   N   FR   +  S NGL+C  
Sbjct  68   ------SATTAEFHLKSCSLSSLFNNLSTVCDELNYPVKNK--FRHDGIVGSCNGLLC--  117

Query  446  RFSDRSDEIAIHNLSTR---QHIPLPSNCHYDGSCKMNAFGLLGFDSGSRRYKVLKSVEF  616
             F+ + D + + N S R   +  PL +N  +   C   AFG LG+D  +  YKV+     
Sbjct  118  -FAIKGDCVLLWNPSIRVSKKSPPLGNN--WRPGC-FTAFG-LGYDHVNEDYKVVAVFCD  172

Query  617  TTGDSVSVKHWVFTVGVDKSWRKIHSSPY  703
             +   +  K  V+++  + SWRKI   P+
Sbjct  173  PSEYFIECKVKVYSMATN-SWRKIQDFPH  200



>ref|XP_007035349.1| F-box family protein, putative [Theobroma cacao]
 gb|EOY06275.1| F-box family protein, putative [Theobroma cacao]
Length=474

 Score = 66.2 bits (160),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 67/246 (27%), Positives = 102/246 (41%), Gaps = 62/246 (25%)
 Frame = +2

Query  92   FLPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLT----HPSRMRIL  259
             LPQEI+VEI+S+LP KSL +F+CVSK + SL+ D   A  H   ++     +  R R++
Sbjct  80   ILPQEIIVEILSRLPIKSLCQFRCVSKLWLSLISDPLLAKAHLKQTIKNDYFYSQRKRVI  139

Query  260  ILYPVLWRDRNFTNFNWYYTINYSEENQGNLQANRLQY-FDHNPNLFRKVYLSS------  418
            I         N  +   Y +I        NL A+ L Y    NPN   ++  S+      
Sbjct  140  I------SSHNLYSLE-YESIGKDASCDENLVASELDYPLKDNPNGLAELLDSAKDGFLY  192

Query  419  -------------------------------SLNGLICFCRFSDRSDEIAIHNLSTRQHI  505
                                           S NGL+C    +   D + + N STR+  
Sbjct  193  CERSEDDEFPVMVKLNLPCCVNPRNWVDILGSCNGLVC---IAPDEDTLFLFNPSTRESK  249

Query  506  PLPSNCHYDGSCKMNAFGLLGFDSGSRRYKVLKSVEFTTGDSVSVKHWVFTVGVDKSWRK  685
             +P       +  ++ +G  GFD  +  YKV+K    T          V+++  D SWRK
Sbjct  250  RIPDPPSEYAASGLSVYG-FGFDFVNDDYKVVKLGSGTV--------CVYSLRTD-SWRK  299

Query  686  IHSSPY  703
            + S P+
Sbjct  300  VVSFPF  305



>ref|XP_008443403.1| PREDICTED: F-box protein CPR30-like [Cucumis melo]
Length=380

 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 62/210 (30%), Positives = 100/210 (48%), Gaps = 21/210 (10%)
 Frame = +2

Query  95   LPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYPV  274
            LP  +++EI+S+LP +SL+RFKCV K +Y+L  D  F   H + SL H    + L+L  +
Sbjct  7    LPDGVIIEILSRLPPESLLRFKCVRKSWYALFNDPKFKAKHFSTSLQH----KHLLLKRL  62

Query  275  LWRDRNFTNFNWYYTINYSEENQGNLQANRLQYFDHNPNLFRKVYLSSSLNGLICFCRFS  454
            + +D      N +  +        +L  + +    H    F +++  S  +GL+C    +
Sbjct  63   VTKDSGKKE-NIFSILKLPLSIHSSLSISDIDLPFHEDFRFFEIHGHS--HGLLC---LT  116

Query  455  DRSDEIAIHNLSTRQH---------IPLPSNCHYDGSCKMNAFGLLGFDSGSRRYKVLKS  607
            D   +I + N STR+          +P PS    D     NA G  G+DS SR +KV++ 
Sbjct  117  DLRKDIFLCNPSTREFHQLPPSILLLPEPSAEPDDYDSSTNAVG-FGYDSKSRDFKVVRV  175

Query  608  VEFTTGDSVSVKHWVFTVGVDKS-WRKIHS  694
            V+F  G        V    + K  WR+I +
Sbjct  176  VDFVEGPGYFYPPKVEVYDLSKERWREIQT  205



>gb|KHN15107.1| F-box/kelch-repeat protein [Glycine soja]
Length=383

 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 60/213 (28%), Positives = 94/213 (44%), Gaps = 20/213 (9%)
 Frame = +2

Query  95   LPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYPV  274
            L +++ VEI+S LP K L+RFKCVSK + SL+       LH    L   S+    +L  +
Sbjct  13   LAEDLSVEILSWLPVKVLIRFKCVSKTWNSLIFHPMLVKLH----LERSSKNTHTLLKFI  68

Query  275  LWRDRNFTNFNW--YYTINYSEENQGNLQANRLQYFDHNPNLFRKVYLSSSLNGLICFCR  448
              +  N+  + W  + +I    EN  +   +   YF  +   +       S NGL+C   
Sbjct  69   DIKCENYYAYPWGAFCSIRSLLENPSSTIDDGCHYFKKDCYFY-----VGSCNGLVCLHD  123

Query  449  FSDRSDEIAIHNLSTR------QHIPLPSNCHYDGSCKMNAFGLLGFDSGSRRYKVLKSV  610
            +S     +   N +TR       H+ L S C+  G   +  F   G+D  S  YKV+  +
Sbjct  124  YSSDEQWVRFWNPATRIMSEDSPHLRLHSGCYNAGPNSVEWFLGFGYDDWSDTYKVVVIL  183

Query  611  EFTTGDSVSVKHWVFTVG-VDKSWRKIHSSPYY  706
              T    + V   V  +G  D  WR I + P++
Sbjct  184  SNTKTHEMEVS--VHCMGDTDTCWRNILTCPWF  214



>ref|XP_004252679.2| PREDICTED: F-box protein At5g65850-like [Solanum lycopersicum]
Length=347

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 60/214 (28%), Positives = 96/214 (45%), Gaps = 38/214 (18%)
 Frame = +2

Query  95   LPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYPV  274
            L ++++VEI   LP  SL+RF+CVSKFF +LV+D  F  +H   S+T     R L+    
Sbjct  10   LSRDLIVEIFLWLPVISLMRFRCVSKFFNALVLDSDFTHVHHQRSMTRDGGTRFLMGKA-  68

Query  275  LWRDRNFTNFNWYYTINYSEENQGNLQANRLQYFDHNPNLFRKVYLSSSLNGLICFCRFS  454
               D    + N Y  I+    ++ +      QYF+              +NG  C   + 
Sbjct  69   --EDLCAVDLNKYGNISRWNFDRPD------QYFN-----------GPCVNGSYCIWEYD  109

Query  455  DRSDEIAIHNLSTRQHIPLPSNCHYDGSCKMNAFGLLGFDSGSRRYKVLKSVEFTTGDSV  634
               + + I N S R+ + LP         + N+  +       + YKVL  V  ++G + 
Sbjct  110  --KEPVRIFNPSIRKMVVLPYQ-------RKNSAPV------EKSYKVLMQVHNSSGHAQ  154

Query  635  SVKHWVFTVGVDKSWRKIHSSPYYHPYNGFNTHF  736
            S   ++FT+ +DKSWRKI     + P      +F
Sbjct  155  S---FIFTLSIDKSWRKIKDIINFFPCYSMKNYF  185



>ref|XP_006601442.1| PREDICTED: F-box/kelch-repeat protein At3g23880-like [Glycine 
max]
Length=385

 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 60/213 (28%), Positives = 94/213 (44%), Gaps = 20/213 (9%)
 Frame = +2

Query  95   LPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYPV  274
            L +++ VEI+S LP K L+RFKCVSK + SL+       LH    L   S+    +L  +
Sbjct  15   LAEDLSVEILSWLPVKVLIRFKCVSKTWNSLIFHPMLVKLH----LERSSKNTHTLLKFI  70

Query  275  LWRDRNFTNFNW--YYTINYSEENQGNLQANRLQYFDHNPNLFRKVYLSSSLNGLICFCR  448
              +  N+  + W  + +I    EN  +   +   YF  +   +       S NGL+C   
Sbjct  71   DIKCENYYAYPWGAFCSIRSLLENPSSTIDDGCHYFKKDCYFY-----VGSCNGLVCLHD  125

Query  449  FSDRSDEIAIHNLSTR------QHIPLPSNCHYDGSCKMNAFGLLGFDSGSRRYKVLKSV  610
            +S     +   N +TR       H+ L S C+  G   +  F   G+D  S  YKV+  +
Sbjct  126  YSSDEQWVRFWNPATRIMSEDSPHLRLHSGCYNAGPNSVEWFLGFGYDDWSDTYKVVVIL  185

Query  611  EFTTGDSVSVKHWVFTVG-VDKSWRKIHSSPYY  706
              T    + V   V  +G  D  WR I + P++
Sbjct  186  SNTKTHEMEVS--VHCMGDTDTCWRNILTCPWF  216



>ref|XP_006294273.1| hypothetical protein CARUB_v10023270mg [Capsella rubella]
 gb|EOA27171.1| hypothetical protein CARUB_v10023270mg [Capsella rubella]
Length=385

 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 58/212 (27%), Positives = 98/212 (46%), Gaps = 13/212 (6%)
 Frame = +2

Query  95   LPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYPV  274
            LP ++L+ I S++P KS+ RF+CVSK + S++    F++ +   S T P      +L+  
Sbjct  4    LPSDVLMNIFSRVPGKSIARFRCVSKLWESILNHPDFSEFYLATSHTRPP-----LLFFT  58

Query  275  LWRDRNFTNFNWYYTINYSEENQGNLQANRLQYFDHNPNLFRKVYLSSSLNGLICFCRFS  454
            L    NF  F+  +  +  +EN  +L  +R      N       YL+S L G IC  R  
Sbjct  59   LEDKDNFFFFSSPHPPH--DENASSLVPSRYHIHHKNTPTTLTAYLASPLCGFICH-RDW  115

Query  455  DRSDEIAIHNLSTRQHIPLPSNCHYDGSCKMNAFGLLGFDSGSRRYKVLKSVEFTTGDSV  634
               D + + N  T + IPLP       + +   +  LG+D   ++ KVL  ++       
Sbjct  116  GSHDSLVVCNPLTGESIPLPKVSLKSNNTQTRPY--LGYDPIEKQLKVL-CIKSDNLPYR  172

Query  635  SVKHWVFTVGVD--KSWRKIHSSPYYHPYNGF  724
              +H V T+  +  + WR +   P+Y   +G 
Sbjct  173  CDEHQVLTLAENGKRLWRTLQCKPHYPISDGI  204



>ref|XP_009760177.1| PREDICTED: F-box/kelch-repeat protein At3g23880-like [Nicotiana 
sylvestris]
Length=452

 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 59/187 (32%), Positives = 94/187 (50%), Gaps = 17/187 (9%)
 Frame = +2

Query  92   FLPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYP  271
            +LP+++LVEI+SKLP KSL+    V K +YSL+ + +F  +H N  +   +  R L+   
Sbjct  4    YLPKDVLVEILSKLPLKSLIHCTTVCKSWYSLITNPNFISVHHNTQIISNTNRRPLLFV-  62

Query  272  VLWRDRNFTNFNWYYTINYSEENQGNL-QANRLQ-YFDHN-PNLFRKVYLS--SSLNGLI  436
               R  N  +    Y +++ +E++ +    +  Q Y +   P   R  YL      NGLI
Sbjct  63   ---RHYNMFDRVERYALHFDDEDENDSPDVDSFQEYLELKCPEKSRSEYLRIIGCCNGLI  119

Query  437  CFCRFSDR-SDEIAIHNLSTRQHIPLP-SNCHYD--GSCKMNAFGLLGFDSGSRRYKVLK  604
            C     D+ +D + + N   R+H+ LP  N  Y+  GSC    +G  GFD     YKV++
Sbjct  120  CLSDDYDKYTDTVILWNPIIRKHLKLPRPNLGYNGRGSC---IYG-FGFDVVKNDYKVVR  175

Query  605  SVEFTTG  625
             V  +T 
Sbjct  176  VVYNSTA  182



>ref|XP_006294272.1| hypothetical protein CARUB_v10023270mg [Capsella rubella]
 gb|EOA27170.1| hypothetical protein CARUB_v10023270mg [Capsella rubella]
Length=427

 Score = 65.9 bits (159),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 58/212 (27%), Positives = 98/212 (46%), Gaps = 13/212 (6%)
 Frame = +2

Query  95   LPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYPV  274
            LP ++L+ I S++P KS+ RF+CVSK + S++    F++ +   S T P      +L+  
Sbjct  4    LPSDVLMNIFSRVPGKSIARFRCVSKLWESILNHPDFSEFYLATSHTRPP-----LLFFT  58

Query  275  LWRDRNFTNFNWYYTINYSEENQGNLQANRLQYFDHNPNLFRKVYLSSSLNGLICFCRFS  454
            L    NF  F+  +  +  +EN  +L  +R      N       YL+S L G IC  R  
Sbjct  59   LEDKDNFFFFSSPHPPH--DENASSLVPSRYHIHHKNTPTTLTAYLASPLCGFICH-RDW  115

Query  455  DRSDEIAIHNLSTRQHIPLPSNCHYDGSCKMNAFGLLGFDSGSRRYKVLKSVEFTTGDSV  634
               D + + N  T + IPLP       + +   +  LG+D   ++ KVL  ++       
Sbjct  116  GSHDSLVVCNPLTGESIPLPKVSLKSNNTQTRPY--LGYDPIEKQLKVL-CIKSDNLPYR  172

Query  635  SVKHWVFTVGVD--KSWRKIHSSPYYHPYNGF  724
              +H V T+  +  + WR +   P+Y   +G 
Sbjct  173  CDEHQVLTLAENGKRLWRTLQCKPHYPISDGI  204



>ref|XP_006597565.1| PREDICTED: F-box/kelch-repeat protein At3g23880-like isoform 
X2 [Glycine max]
Length=383

 Score = 65.5 bits (158),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 66/209 (32%), Positives = 101/209 (48%), Gaps = 22/209 (11%)
 Frame = +2

Query  92   FLPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFAD--LHRNWSLTHPSRMRILIL  265
            FLP E++VEI+S+LP KSL++F+CV K + SL+ D  F    LH +   TH +  RI++ 
Sbjct  26   FLPDELVVEILSRLPVKSLLQFRCVCKSWMSLIYDPYFMKKHLHLSSRSTHFTHHRIIL-  84

Query  266  YPVLWRDRNFTNFNWYYTINYSEENQGNLQANRLQYFDHNPNLFRKVYLSSSLNGLICFC  445
                        F+       S  N  +   + L Y     N FR   +  S NGL+C  
Sbjct  85   ------SATTAEFHLKSCSLSSLFNNLSTVCDELNY--PVKNKFRHDGIVGSCNGLLC--  134

Query  446  RFSDRSDEIAIHNLSTR---QHIPLPSNCHYDGSCKMNAFGLLGFDSGSRRYKVLKSVEF  616
             F+ + D + + N S R   +  PL +N  +   C   AFG LG+D  +  YKV+     
Sbjct  135  -FAIKGDCVLLWNPSIRVSKKSPPLGNN--WRPGC-FTAFG-LGYDHVNEDYKVVAVFCD  189

Query  617  TTGDSVSVKHWVFTVGVDKSWRKIHSSPY  703
             +   +  K  V+++  + SWRKI   P+
Sbjct  190  PSEYFIECKVKVYSMATN-SWRKIQDFPH  217



>ref|XP_003546119.1| PREDICTED: F-box/kelch-repeat protein At3g23880-like isoform 
X1 [Glycine max]
Length=405

 Score = 65.5 bits (158),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 66/209 (32%), Positives = 101/209 (48%), Gaps = 22/209 (11%)
 Frame = +2

Query  92   FLPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFAD--LHRNWSLTHPSRMRILIL  265
            FLP E++VEI+S+LP KSL++F+CV K + SL+ D  F    LH +   TH +  RI++ 
Sbjct  48   FLPDELVVEILSRLPVKSLLQFRCVCKSWMSLIYDPYFMKKHLHLSSRSTHFTHHRIIL-  106

Query  266  YPVLWRDRNFTNFNWYYTINYSEENQGNLQANRLQYFDHNPNLFRKVYLSSSLNGLICFC  445
                        F+       S  N  +   + L Y   N   FR   +  S NGL+C  
Sbjct  107  ------SATTAEFHLKSCSLSSLFNNLSTVCDELNYPVKNK--FRHDGIVGSCNGLLC--  156

Query  446  RFSDRSDEIAIHNLSTR---QHIPLPSNCHYDGSCKMNAFGLLGFDSGSRRYKVLKSVEF  616
             F+ + D + + N S R   +  PL +N  +   C   AFG LG+D  +  YKV+     
Sbjct  157  -FAIKGDCVLLWNPSIRVSKKSPPLGNN--WRPGC-FTAFG-LGYDHVNEDYKVVAVFCD  211

Query  617  TTGDSVSVKHWVFTVGVDKSWRKIHSSPY  703
             +   +  K  V+++  + SWRKI   P+
Sbjct  212  PSEYFIECKVKVYSMATN-SWRKIQDFPH  239



>ref|XP_008370996.1| PREDICTED: F-box protein CPR30-like [Malus domestica]
 ref|XP_008370997.1| PREDICTED: F-box protein CPR30-like [Malus domestica]
 ref|XP_008370998.1| PREDICTED: F-box protein CPR30-like [Malus domestica]
 ref|XP_008370999.1| PREDICTED: F-box protein CPR30-like [Malus domestica]
 ref|XP_008371001.1| PREDICTED: F-box protein CPR30-like [Malus domestica]
Length=409

 Score = 65.5 bits (158),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 57/215 (27%), Positives = 105/215 (49%), Gaps = 28/215 (13%)
 Frame = +2

Query  95   LPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYPV  274
            LP E++V+I+S+LP   L+RF+ ++K + SL+    F DLH   S    S + +     +
Sbjct  24   LPPEVIVDILSRLPVCLLLRFRSIAKPWRSLIDSSYFVDLHLTQSAESKSHLSL-----I  78

Query  275  LWRDRNFTNFNWYYTINYSEENQGNLQANRLQYFDHNPNLFRKVYLSSSLNGLICFCRFS  454
            L +D +       Y I++   N      + L  + +      ++ +  S NGL+C C   
Sbjct  79   LRKDSDL------YCIDFDSLNDAVELNHPLMCYSN------RIRVLGSCNGLLCICNV-  125

Query  455  DRSDEIAIHNLSTRQH--IP-LPSNCHYDGS---CKMNAFGLLGFDSGSRRYKVLKSVEF  616
              +++IA  N ST+++  +P LPS+   D +   C    +G LG+D+    YK+++  +F
Sbjct  126  --AEDIAFWNPSTKKYRILPSLPSDRKRDSNMCLCGARVYG-LGYDAVHDDYKLVRISQF  182

Query  617  TTGDSVSVKHWVFTVGV-DKSWRKIHSSPYYHPYN  718
               D +S    V    + + +W+++   PY   Y 
Sbjct  183  IGLDYLSFVSEVRVFSLRNNAWKRLEDMPYVLCYT  217



>ref|XP_010523116.1| PREDICTED: putative F-box protein At1g20657 [Tarenaya hassleriana]
Length=355

 Score = 65.5 bits (158),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 63/211 (30%), Positives = 98/211 (46%), Gaps = 23/211 (11%)
 Frame = +2

Query  95   LPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYPV  274
            +P +++ EI+++LPAKSL RF CVSK + S +    F +     S T PS   IL+    
Sbjct  18   IPHDLVTEILARLPAKSLARFVCVSKTWASTIRSRDFHNSFVTRSSTRPS---ILLALSD  74

Query  275  LWRDRNFTNFNWYYTINYSEENQGNLQANRLQYFDHNPNLFRKVYLSSSLNGLICF-CRF  451
              RDR ++ F+  + I+ +EE+        L Y  H     R   +  S+ GLIC  C  
Sbjct  75   THRDRRYSFFS--FPISDNEESPS------LAY--HGYMKRRTFSMFHSVRGLICLKC--  122

Query  452  SDRSDEIAIHNLSTRQHIPLPSNCHYDGSCKMNAFGLLGFDSGSRRYKVLK---SVEFTT  622
               S    I N S R+ + LP         + + +  LG+D     YKVL     + + +
Sbjct  123  ---SSSPVILNPSLRKAVTLPVTTPNLRPEENDRYCYLGYDPIEDHYKVLSIETRLSYRS  179

Query  623  GDSVSVKHWVFTVGVDK-SWRKIHSSPYYHP  712
            G     +  + T+G D+  WRKI    ++ P
Sbjct  180  GTCSFQEIRILTLGEDRLQWRKIEGGRFHFP  210



>ref|XP_009596513.1| PREDICTED: F-box/kelch-repeat protein At3g23880-like [Nicotiana 
tomentosiformis]
Length=378

 Score = 65.5 bits (158),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 55/185 (30%), Positives = 90/185 (49%), Gaps = 16/185 (9%)
 Frame = +2

Query  95   LPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYPV  274
            LP++++ EI+++LP  SL+RFKCV K +YSL+ + +    H        + +R+LI    
Sbjct  18   LPEDVIFEILTRLPVTSLIRFKCVCKLWYSLIKNPNLISKHLQNLSRKKNYVRLLIS---  74

Query  275  LWRDRNFTNFNWYYTINYSEENQGNLQANRLQYFDHNPNLFRKVYLSSSLNGLICFCRFS  454
              R  N TN     +++ ++     +  +   YF+     F  V L    NG++C C + 
Sbjct  75   --RRGNITN-KRVVSLSINDTLDVFINQDFPSYFNDK---FGHVRLIGPCNGIVCLCGY-  127

Query  455  DRSDEIAIHNLSTRQHIPLPSNC---HYDGSCKMNAFGLLGFDSGSRRYKVLKSVEFTTG  625
               D I I N S R +  LP +        + + + FG LGFDS    YKV++ +   + 
Sbjct  128  --PDNIVIWNPSIRDYKILPQSQIQRLVGSTVRGSDFG-LGFDSKRNDYKVIQILFCLSN  184

Query  626  DSVSV  640
            D V V
Sbjct  185  DRVVV  189



>ref|XP_010274506.1| PREDICTED: F-box protein CPR30-like [Nelumbo nucifera]
Length=363

 Score = 65.5 bits (158),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 61/210 (29%), Positives = 103/210 (49%), Gaps = 27/210 (13%)
 Frame = +2

Query  92   FLPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYP  271
             +P+EI+V+I+S+LPAKSL+RF+CV K +Y+L+   SF  +H N ++   +  +I++   
Sbjct  4    IIPEEIMVDILSRLPAKSLLRFRCVCKSWYTLLHRPSFIQIHLNRAVETENDRKIIL---  60

Query  272  VLWRDRNFTNFNWYYTINYSEENQGNLQANRLQYFDHNPNLFRKVYLSSSLNGLICFCRF  451
                    +     Y+++Y   ++  L  + L            V L  S NGL+C  + 
Sbjct  61   ------TCSGTRSLYSVDYDACDKAVLLKHPLGK--------SVVELLGSCNGLLC-TKA  105

Query  452  SDRSDEIAIHNLSTRQH--IPLPSNCHYDGS--CKMNAFGLLGFDSGSRRYKVLKSVEFT  619
            SD  D + I N ST ++  +P      ++ S   ++  FG   FD     YK++K V   
Sbjct  106  SDTGD-MFIWNPSTGEYNIVPKTDTKPWNDSEVWRLAVFG-FAFDPMIHDYKLVKIVSIY  163

Query  620  TGDS--VSVKHWVFTVGVDKSWRKIHSSPY  703
              D      +  V+T+G   SWR+I   P+
Sbjct  164  KADIHFCESEVEVYTLG-SNSWRRIPHIPF  192



>ref|XP_010255762.1| PREDICTED: F-box protein At3g07870-like [Nelumbo nucifera]
Length=448

 Score = 65.5 bits (158),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 72/224 (32%), Positives = 107/224 (48%), Gaps = 38/224 (17%)
 Frame = +2

Query  95   LPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYPV  274
            LP +IL+EI+S+LPA+ L++ +CV K + +LV D   A +H   +  H  R   LI    
Sbjct  68   LPYDILLEILSRLPARFLLQCRCVCKSWLTLVRDPRLAKMHLARASQH--RNPSLIFN--  123

Query  275  LWRDRNFTNFNWYYTINYSEENQGNLQANRLQY-FDHNPNLFRKV-----YLSS------  418
             +RD    + N    +N+      ++  NR+ Y FD N      V     +LSS      
Sbjct  124  -FRDNGTADLN--LILNF------HVNGNRVLYLFDLNEEGCEAVTIELPFLSSGSPNPF  174

Query  419  ----SLNGLICFCR-FSDRSD-EIAIHNLSTRQHIPLPSNCHYDGSCKMNAFGLLGFDSG  580
                S NGL+C  R FS  SD +I I N  TR+   LP  C    S    AF   G+   
Sbjct  175  SILGSCNGLVCVARGFSLPSDPDIYIFNPITRECTMLPEPCIAHTSRADYAF---GYHPA  231

Query  581  SRRYKVLKSVEFTTG---DSVSVKHWVFTVGVDKSWRKIHSSPY  703
            +  YKV++++   T     S   K  V+T+G  KSWR++  + +
Sbjct  232  TDEYKVVRTLFTGTNPLTGSYQTKVEVYTLG-SKSWRRLEDTEF  274



>ref|XP_010920812.1| PREDICTED: F-box/kelch-repeat protein At3g06240-like [Elaeis 
guineensis]
Length=407

 Score = 65.5 bits (158),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 63/202 (31%), Positives = 98/202 (49%), Gaps = 22/202 (11%)
 Frame = +2

Query  95   LPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYPV  274
            +P  +++ I+S+LP KS+ RF+ VSK + SL  + SFA L +  +  + +R   LIL   
Sbjct  41   IPPNVMILILSRLPTKSVARFRSVSKLWNSLTCEPSFA-LQQFRNGPNKNRPSALILS--  97

Query  275  LWRDRNFTNFNWYYTINYSEENQGNLQANRLQYFDHNPNLFRKVYLSSSLNGLICFCRFS  454
             WR       N  +++   EE  G   + +L +    P       +++S NGLIC     
Sbjct  98   -WR------CNIEFSLKQFEE--GRPLSEKLYFI--GPKRLPCYVMTNSCNGLICV--LG  144

Query  455  DRSDEIAIHNLSTRQHIPLPSNCHYDGSCKMNAFGLLGFDSGSRRYKVLKSVEFTTGDSV  634
             RS  +   N  T + I LP       + K+   G LGFD  +  YKV   V F     +
Sbjct  145  LRSAIMV--NPGTGKVIMLPEGTIACNNSKLPISGGLGFDVSTGEYKV---VRFVHCLDL  199

Query  635  SVKHWVFTVGVDKSWRKIHSSP  700
            +V   V T+G  +SWR+I ++P
Sbjct  200  TVACEVLTLG-SQSWRRISNAP  220



>ref|XP_009358253.1| PREDICTED: F-box protein At1g30790-like [Pyrus x bretschneideri]
Length=397

 Score = 65.1 bits (157),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 62/229 (27%), Positives = 109/229 (48%), Gaps = 21/229 (9%)
 Frame = +2

Query  95   LPQEIL-VEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYP  271
            LP EI+  +I+S++ AKSL+RFK V K + SL+ + SF + HR +     S + +L  + 
Sbjct  7    LPSEIIGFQILSRISAKSLMRFKSVCKSWSSLIRNPSFVNAHRKFYRNKHSHL-LLTTWD  65

Query  272  VLWRDRNFTNFNWYYTINYSEENQGNLQANRLQYFDHNPNLFRKVYLSSSLNGLIC----  439
               R ++F      +++  ++E    L  + L+          ++Y + S+NGL+C    
Sbjct  66   ESARQQHF------FSVKINQEGSPTLVTHLLKLPTPPGKNVERLYEALSINGLVCLYLS  119

Query  440  ---FCRFSDRSDEIAIHNLSTRQHIPLPSNCHYDGSCKMNAFGLLGFDSGSRRYKVLKSV  610
               F   +D +  + I N  TR+ I LP +     + ++      GF S +  YKVL+  
Sbjct  120  DTLFPNQTDHNHPVRIFNPCTRECIVLPHDLPAYRTIRVTHH--FGFSSQTNEYKVLQVK  177

Query  611  EFTTGDS---VSVKHWVFTVGVDKSWRKIHSSPYYHPYNGFNTHFYSTS  748
             F   +S   +S    +F +G   SWR+I +  +  P++     F   S
Sbjct  178  RFQPLNSTRDMSFMVKIFKLGT-SSWRRIEADIHDLPFDPLKCQFERRS  225



>ref|XP_006437777.1| hypothetical protein CICLE_v10033302mg, partial [Citrus clementina]
 gb|ESR51017.1| hypothetical protein CICLE_v10033302mg, partial [Citrus clementina]
Length=353

 Score = 65.1 bits (157),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 60/207 (29%), Positives = 97/207 (47%), Gaps = 29/207 (14%)
 Frame = +2

Query  104  EILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSR-MRILILYPVLW  280
            EI+ +I++KLP KSL+RF+C+SK   S +   SFA+LH   +L  P + + +L+  P   
Sbjct  17   EIIYDILTKLPIKSLMRFRCLSKLCSSYITAPSFAELH---ALNFPIKTVGLLVTCPA--  71

Query  281  RDRNFTNFNWYYTINYSEENQGNLQANRLQYFDHNPNLFRKVYLSSSLNGLICFCRFSDR  460
                      ++++++     G L    L      P  F + Y + S+NG+I      D 
Sbjct  72   ---RLQTAQHFFSVDF----DGGLAVPLLTI----PPRFSR-YTTRSVNGII----LMDF  115

Query  461  SDEIAIHNLSTRQHIPLPSNCHYDGSCKMNAFGLL---GFDSGSRRYKVLKSVEFTTGDS  631
                 + N STRQ    P  C        + +  +   GFD  S++YKVL S      D 
Sbjct  116  GLYATLCNPSTRQTFNTPFVCSLTSPSVNSTYFCVNSFGFDPVSKKYKVLNSWAIPGRDP  175

Query  632  VSVKHWVFTVGVDKSWRKIHSSPYYHP  712
               ++ +F +G + SWR +   P Y+P
Sbjct  176  ---EYRIFELGTN-SWRPLKGGPNYYP  198



>ref|XP_010319105.1| PREDICTED: putative F-box protein At1g47790 [Solanum lycopersicum]
Length=195

 Score = 63.2 bits (152),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 58/197 (29%), Positives = 95/197 (48%), Gaps = 25/197 (13%)
 Frame = +2

Query  107  ILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLH--RNWSLTHPSRMRILI-LYPVL  277
            I  EI+S LP KS+VRFKCV K + + +   +F+ L   R+  LT     R+L  LYP  
Sbjct  9    ITSEIISWLPVKSIVRFKCVCKAWNTWIEHPNFSKLQLARSQGLT-----RLLFELYPC-  62

Query  278  WRDRNFTNFNWYYTINYSEENQGNLQANRLQYFDHNPNLFRKVYLSSSLNGLICFCRFSD  457
                   ++            + +L+  R  YF+   ++F     S+  NGL+C   +S 
Sbjct  63   ------KSYRSKKKKKQRRLERYSLEFTRRFYFE---DMF---ICSNHCNGLVCL--YSS  108

Query  458  RSDEIAIHNLSTRQHIPLPSNCHYDGSCKMNAFGLLGFDSGSRRYKVLKSVEFTTGDSVS  637
            +  ++ + N+STR+   LP +        M+    LGFD  + +YK+L  +       + 
Sbjct  109  KDGQVYLFNVSTREFKALPVSVEGVRKNSMDPRLYLGFDKVTEKYKLLHIIRIPNSPRI-  167

Query  638  VKHWVFTVGVDKSWRKI  688
            +KH + T+G + SWR I
Sbjct  168  MKHMILTLGTN-SWRSI  183



>ref|XP_010548778.1| PREDICTED: F-box/kelch-repeat protein At3g06240-like, partial 
[Tarenaya hassleriana]
Length=368

 Score = 65.1 bits (157),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 60/212 (28%), Positives = 103/212 (49%), Gaps = 29/212 (14%)
 Frame = +2

Query  107  ILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPS----RMRILILYPV  274
            I+ EI+ +LPAKS+ RF+CVSK F SL  D +FA  H + SL + +    R R+++ YP 
Sbjct  19   IIREILLRLPAKSIGRFRCVSKLFRSLSSDPAFAKAHLDLSLRNDAFPSGRRRLIVSYP-  77

Query  275  LWRDRNFTNFNWYYTINYSEENQGNLQANRLQYFDHNPNLFRKVY-------LSSSLNGL  433
                 N    ++   ++  +  + +L A  +       NL    Y       ++ S NGL
Sbjct  78   ----HNLYTVDFDSVVDACDGTR-DLGAVEIPQSPVMSNLASSYYRDGLEAEVAGSCNGL  132

Query  434  ICFCRFSDRSDEIAIHNLSTRQHIPLPSNCHY--DGSCKMNAFGLLGFDSGSRRYKVLKS  607
            +C     +  D++ + NL+T +   +P    +   GS  +   G  GFD  +  YK+   
Sbjct  133  VCTI---NEEDDVFLFNLTTGESKRIPDVLEFLKSGSKGVRMLG-FGFDDITDDYKL---  185

Query  608  VEFTTGDSVSVKHWVFTVGVDKSWRKIHSSPY  703
            V   TGD ++    V+++ ++ SW+ +  S Y
Sbjct  186  VALVTGDVLN--GCVYSLKIE-SWKWVGDSRY  214



>ref|XP_010546890.1| PREDICTED: F-box/kelch-repeat protein At3g06240-like [Tarenaya 
hassleriana]
Length=394

 Score = 65.1 bits (157),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 65/216 (30%), Positives = 104/216 (48%), Gaps = 33/216 (15%)
 Frame = +2

Query  104  EILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPS----RMRILILYP  271
            EI+ EI+ +LPAKS+ RF+CVSK F SL  D +FA  H + SL + +    R R+++ Y 
Sbjct  28   EIIREILLRLPAKSIGRFRCVSKLFRSLSSDPAFAKTHLDLSLRNDAFPSGRTRLVVNYR  87

Query  272  VLWRDRNFTNFNWYYTINYSEENQGNLQANRLQYFDHNPNLFRKVY-------LSSSLNG  430
                  NF     + +I ++ E   +L A  +       NL    Y       +  S NG
Sbjct  88   -----HNFYTVG-FDSIVHACEGIRDLGAVEIPQSPVMSNLVSSCYRKDLWIEMVGSCNG  141

Query  431  LICFCRFSDRSDEIAIHNLSTRQHIPLPS-----NCHYDGSCKMNAFGLLGFDSGSRRYK  595
            L+C    ++   ++ + NL+T +   +P      N    G  ++N FG  GFD+ +  Y 
Sbjct  142  LLC---TTNEVADVFLFNLTTGESKRIPGVLELVNLGSKGG-RINGFG-FGFDAITDDYT  196

Query  596  VLKSVEFTTGDSVSVKHWVFTVGVDKSWRKIHSSPY  703
            +   V   TGD ++    V++V  D SW+ +  S Y
Sbjct  197  L---VALVTGDVLNAT--VYSVKTD-SWKWVRDSRY  226



>ref|XP_010023845.1| PREDICTED: F-box/kelch-repeat protein At3g06240-like [Eucalyptus 
grandis]
 gb|KCW60222.1| hypothetical protein EUGRSUZ_H02934 [Eucalyptus grandis]
Length=371

 Score = 65.1 bits (157),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 51/177 (29%), Positives = 88/177 (50%), Gaps = 27/177 (15%)
 Frame = +2

Query  95   LPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYP-  271
            +P++++V+I+ +LPAKSLVRFKCV K + SL+ D +FA        +H  R++   L P 
Sbjct  5    IPEDVVVDILLRLPAKSLVRFKCVCKRWRSLISDRAFAK-------SHLQRVKAADLIPS  57

Query  272  --VLWRDRNFTNFNWYYTINYSEENQGNLQANRLQYFDHNPNLFRKVYLSSSLNGLICFC  445
              ++   RN        T++Y   + G     R+    H      +  +  S +GL+C  
Sbjct  58   QRIIIGGRNSP----LKTVDYEALDGGG--EGRM-VVPHGIKPLWESRIVGSCDGLVCLL  110

Query  446  RFSDRSDEIAIHNLSTRQHIPLPSN------CHYDGSCKMNAFGLLGFDSGSRRYKV  598
              S+      I+N +T ++I LPS+       ++    + ++F   G+DS S  YK+
Sbjct  111  GPSN----FVIYNPTTGEYIELPSSDFVDHAMYFSSGARYDSFYGFGYDSQSDDYKI  163



>gb|KDO70159.1| hypothetical protein CISIN_1g017140mg [Citrus sinensis]
Length=376

 Score = 65.1 bits (157),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 60/207 (29%), Positives = 97/207 (47%), Gaps = 29/207 (14%)
 Frame = +2

Query  104  EILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSR-MRILILYPVLW  280
            EI+ +I++KLP KSL+RF+C+SK   S +   SFA+LH   +L  P + + +L+  P   
Sbjct  17   EIIYDILTKLPIKSLMRFRCLSKLCSSYITAPSFAELH---ALNFPIKTVGLLVTCPA--  71

Query  281  RDRNFTNFNWYYTINYSEENQGNLQANRLQYFDHNPNLFRKVYLSSSLNGLICFCRFSDR  460
                      ++++++     G L    L      P  F + Y + S+NG+I      D 
Sbjct  72   ---RLQTAQHFFSVDF----DGGLAVPLLTI----PPRFSR-YTTRSVNGIILM----DF  115

Query  461  SDEIAIHNLSTRQHIPLPSNCHYDGSCKMNAFGLL---GFDSGSRRYKVLKSVEFTTGDS  631
                 + N STRQ    P  C        + +  +   GFD  S++YKVL S      D 
Sbjct  116  GLYATLCNPSTRQTFNTPFVCSLTSPSVNSTYFCVNSFGFDPVSKKYKVLNSWAIPGRDP  175

Query  632  VSVKHWVFTVGVDKSWRKIHSSPYYHP  712
               ++ +F +G + SWR +   P Y+P
Sbjct  176  ---EYRIFELGTN-SWRPLKGGPNYYP  198



>ref|XP_010688549.1| PREDICTED: F-box protein CPR30-like [Beta vulgaris subsp. vulgaris]
Length=231

 Score = 63.5 bits (153),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 55/179 (31%), Positives = 87/179 (49%), Gaps = 20/179 (11%)
 Frame = +2

Query  95   LPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYPV  274
            LP +I+  I+++LP KSL+RFKCVSK + SL+   +F ++H   SL+  S+ ++LI    
Sbjct  4    LPLDIITSILTRLPTKSLIRFKCVSKSWNSLIKSPNFVNIHLTQSLS--SKKQLLIF---  58

Query  275  LWRDRNFTNFNWYYTINYSEENQGNLQANRLQYFDHNPNLFR--KVYLSSSLNGLICF-C  445
                    N+  +      + +  +L       FD  P  F   +V +  S NGL+   C
Sbjct  59   --------NYGSFLESTPLKLSLSDLHVTTSARFDL-PTCFSGYEVSVCGSCNGLLALVC  109

Query  446  RFSDRSD--EIAIHNLSTRQHIPLPSNCHYD-GSCKMNAFGLLGFDSGSRRYKVLKSVE  613
            +  D     EI + N ST  H  LP N H D G+  M      G+D     Y++++ V+
Sbjct  110  KNGDDPLLFEIILWNPSTNIHFILPRNTHVDFGTDFMGVSFGFGYDCNVDDYRIVRIVD  168



>ref|XP_002874091.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50350.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=267

 Score = 64.3 bits (155),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 52/171 (30%), Positives = 81/171 (47%), Gaps = 22/171 (13%)
 Frame = +2

Query  95   LPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYPV  274
            +P ++ +EI+SKLPAKSL+RF+ VSK ++S++    F D     S T P   R+L     
Sbjct  116  IPFDLTLEILSKLPAKSLIRFQAVSKLWFSIIRSKDFTDSFLTRSKTRP---RLLF----  168

Query  275  LWRDRNFTNFNWYYTINYSEENQGNLQANRLQYFDHNPNLFRKVY--LSSSLNGLICFCR  448
                  F +F+      +S     N   +      H+  +   VY   S  +NG +C   
Sbjct  169  -----TFKHFDSRKRFIFSAPEHDNNDKSSTVVARHDMTISDLVYYIRSRPVNGFVCCT-  222

Query  449  FSDRSDEIAIHNLSTRQHIPLPSNCHYDGSCKMNAFGLLGFDSGSRRYKVL  601
               R D IA+ N +TRQ +  P +   +G    + +  LG+D    +YKVL
Sbjct  223  ---RGDSIAVCNPTTRQIVKFP-DVKSNG---RDVYARLGYDPVQDQYKVL  266



>ref|XP_006484376.1| PREDICTED: F-box protein At1g30790-like [Citrus sinensis]
Length=377

 Score = 65.1 bits (157),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 60/207 (29%), Positives = 97/207 (47%), Gaps = 29/207 (14%)
 Frame = +2

Query  104  EILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSR-MRILILYPVLW  280
            EI+ +I++KLP KSL+RF+C+SK   S +   SFA+LH   +L  P + + +L+  P   
Sbjct  18   EIIYDILTKLPIKSLMRFRCLSKLCSSYITAPSFAELH---ALNFPIKTVGLLVTCPA--  72

Query  281  RDRNFTNFNWYYTINYSEENQGNLQANRLQYFDHNPNLFRKVYLSSSLNGLICFCRFSDR  460
                      ++++++     G L    L      P  F + Y + S+NG+I      D 
Sbjct  73   ---RLQTAQHFFSVDF----DGGLAVPLLTI----PPRFSR-YTTRSVNGIILM----DF  116

Query  461  SDEIAIHNLSTRQHIPLPSNCHYDGSCKMNAFGLL---GFDSGSRRYKVLKSVEFTTGDS  631
                 + N STRQ    P  C        + +  +   GFD  S++YKVL S      D 
Sbjct  117  GLYATLCNPSTRQTFNTPFVCSLTSPSVNSTYFCVNSFGFDPVSKKYKVLNSWAIPGRDP  176

Query  632  VSVKHWVFTVGVDKSWRKIHSSPYYHP  712
               ++ +F +G + SWR +   P Y+P
Sbjct  177  ---EYRIFELGTN-SWRPLKGGPNYYP  199



>ref|XP_004486101.1| PREDICTED: F-box/kelch-repeat protein At3g23880-like [Cicer arietinum]
Length=405

 Score = 65.1 bits (157),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 72/225 (32%), Positives = 104/225 (46%), Gaps = 22/225 (10%)
 Frame = +2

Query  92   FLPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSL--THPSRMRILIL  265
            FLP+E++VEI++KLP KSL+RF+CVSK + SL+ D  F   H  +S   TH +    +IL
Sbjct  45   FLPEELIVEILTKLPVKSLLRFRCVSKSWLSLISDRYFIKKHIFFSTKNTHFTTHHRIIL  104

Query  266  YPVLWRDRNFTNFNWYYTINYSEENQGNLQANRLQYFDHNPNLFRKVYLSSSLNGLICFC  445
                        F+       S  N  +  +  L Y   N   FR   +  S NG +C  
Sbjct  105  ------SATTAEFHLKSCSISSLFNSPSTISEDLNYPVKNK--FRHDGIVGSCNGFLC--  154

Query  446  RFSDRSDEIAIHNLSTR---QHIPLPSNCHYDGSCKMNAFGLLGFDSGSRRYKVLKSVEF  616
             F+ + D + + N S R   +  PL +N  +   C   +FG LG+D     YKV+     
Sbjct  155  -FAIKGDCVLLWNPSIRVSKKSPPLGNN--WRPGC-FTSFG-LGYDHVDEDYKVVAVFCD  209

Query  617  TTGDSVSVKHWVFTVGVDKSWRKIHSSPY-YHPYNGFNTHFYSTS  748
                    K  VF++  + SWRKIH  P    PY   +  F S +
Sbjct  210  PNQIFSESKVKVFSLATN-SWRKIHDFPRGVSPYQNSSGKFVSGT  253



>ref|XP_008793681.1| PREDICTED: F-box/kelch-repeat protein At3g06240-like [Phoenix 
dactylifera]
Length=398

 Score = 65.1 bits (157),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 61/202 (30%), Positives = 94/202 (47%), Gaps = 22/202 (11%)
 Frame = +2

Query  95   LPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYPV  274
            +P  ++ EI+S+LP KS+ RF+  SK + SL  + SFA L +  +  + +R  +LIL   
Sbjct  28   IPPNVMAEILSRLPTKSVARFRSASKLWNSLTCESSFA-LQQFKNGPNKNRPSVLILN--  84

Query  275  LWRDRNFTNFNWYYTINYSEENQGNLQANRLQYFDHNPNLFRKVYLSSSLNGLICFCRFS  454
             WR       N  +++N  EE  G   + +L      P       +++S NGLIC     
Sbjct  85   -WR------CNIEFSLNQFEE--GRPLSEKLYCI--GPKRLPCYVMTNSCNGLICVLGLR  133

Query  455  DRSDEIAIHNLSTRQHIPLPSNCHYDGSCKMNAFGLLGFDSGSRRYKVLKSVEFTTGDSV  634
                   + N  T + + LP         K+   G LGFD  +  YKV   V F      
Sbjct  134  S----AVMVNPGTGEVMMLPEGTIGCNVHKLPVSGGLGFDISTGEYKV---VRFVHCLDR  186

Query  635  SVKHWVFTVGVDKSWRKIHSSP  700
            +V   V T+G  +SWR+I ++P
Sbjct  187  TVASEVLTLG-SESWRRISNAP  207



>ref|XP_004977725.1| PREDICTED: uncharacterized protein LOC101783053 [Setaria italica]
Length=805

 Score = 65.5 bits (158),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 61/221 (28%), Positives = 102/221 (46%), Gaps = 21/221 (10%)
 Frame = +2

Query  92   FLPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWS-LTHPSRMRILILY  268
            ++P ++++ I+ +LPAKS++RF+CVSK + +++   SF D H  +S    P+ + +   Y
Sbjct  31   YIPDDLILAILRRLPAKSVLRFRCVSKAWLAMLSSRSFVDAHLEFSAAARPTMLIVPGKY  90

Query  269  PVLWRDRNFTNFNWYYTINYSEENQGNLQANRLQYFDHNPNLFRKVYLSSSLNGLICFCR  448
             +L   R  T F W     Y+           L + +  P      +     +GLI    
Sbjct  91   HLLDPRRLRTAF-WMGFYKYTSGGAD----TELLHGERFPGGVASWFKPMHCDGLIL---  142

Query  449  FSDRSDEIAIHNLSTRQHIPLPSNCHYDG-SCKMNAFGLLGFDSGSRRYKVLK---SVEF  616
               R  E+ + N +TR+ + L      D  SC  +A G  G D  S  YKV++   S E 
Sbjct  143  VYTRHQELMVCNPATREFVQLLRETERDCLSCLHDAVG-FGRDPRSNTYKVVRLFYSSEH  201

Query  617  TTG--DSVSVKHWVFTVGVDKSWRKIHSSPYYHPYNGFNTH  733
              G  +  S +  V T+G ++ WR++ + P       FN H
Sbjct  202  GGGLVNVFSCRAEVLTLGTNQQWRRVATPPRL-----FNPH  237



>ref|XP_004304889.1| PREDICTED: F-box/kelch-repeat protein At3g06240-like [Fragaria 
vesca subsp. vesca]
Length=414

 Score = 65.1 bits (157),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 60/228 (26%), Positives = 105/228 (46%), Gaps = 42/228 (18%)
 Frame = +2

Query  95   LPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYPV  274
            +P++++VE +S+LP KSL+RFKC+ K +Y+L+ D  F D H + S    S    L+   V
Sbjct  7    MPKQMIVEFLSRLPPKSLMRFKCIRKSWYALINDPKFIDKHLH-SYNKDSYTCFLLKRTV  65

Query  275  LWRDRNFTN---FNWYYTINYSEENQGNLQ-----------------ANRLQYFDHNPNL  394
            + R +       F++ Y +N  +    + Q                  N ++      + 
Sbjct  66   VPRSQTIKEEILFSFLYVLNDHDAEDSHPQCVVEDIYIPSSMGLKTKGNIIEL--PGSDA  123

Query  395  FRKVYLSSSLNGLICFCRFSDRSDEIAIHNLSTRQHIPLPSNC-HYDGSCKMNAFGLLGF  571
             R +Y++   +G+IC   ++     + ++N S R+   LP +C H   SC +      G+
Sbjct  124  IRTIYITDHCDGIICLVLYTGH---LVLYNPSIRELNILPPSCLHESFSCNVG----FGY  176

Query  572  DSGSRRYKVLKSVEFTTGDSVS---------VKHWVFTVGVDKSWRKI  688
            D   + YKV+  VE +  DS            +  V+T+G   SWR+I
Sbjct  177  DPKCKDYKVVNIVE-SGEDSYDHNQRLVIHPPRAEVYTLGT-ASWRQI  222



>ref|XP_006421004.1| hypothetical protein CICLE_v10006809mg [Citrus clementina]
 gb|ESR34244.1| hypothetical protein CICLE_v10006809mg [Citrus clementina]
Length=340

 Score = 64.7 bits (156),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 63/217 (29%), Positives = 97/217 (45%), Gaps = 37/217 (17%)
 Frame = +2

Query  95   LPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPS---RMRILIL  265
            LPQ+I+ +I+S+LP KSL+RFKCVSK ++SL+ D  FA      + +  S   R  +L  
Sbjct  4    LPQDIVADILSRLPVKSLLRFKCVSKPWFSLISDSQFAKTQLKQAKSDCSGNIRRVLLTT  63

Query  266  YPVLWRDRNFTNFNWYYTINYSEENQGNLQANRLQYFDHNPNLFRKVYLSSSLNGLICFC  445
             P+   D        Y    + E +  N+ A      +  P       +  S NGL+C  
Sbjct  64   SPLQSID--------YEAFGFGEGSDTNITAQLGYPGEKVPE--DDADIIGSCNGLVC--  111

Query  446  RFSDRSDEIAIHNLSTR------QHIPLPSNCHYDGSCKMNAFGLLGFDSGSRRYKVLKS  607
                 S  + + N STR      +  P P    +        F  LG+D+    YKV++ 
Sbjct  112  -IDFDSTNMVLWNPSTRVSRELTRPAPFPEQGTF--------FYGLGYDTSGDDYKVIRG  162

Query  608  VEFTTGD---SVSVKHWVFTVGVDKSWRKIHSSPYYH  709
               T G+   S   K  VF++  + SW++I    Y+H
Sbjct  163  FISTIGNGNVSRETKVQVFSLK-NNSWKEIQ---YFH  195



>ref|XP_007047848.1| F-box family protein, putative [Theobroma cacao]
 gb|EOX92005.1| F-box family protein, putative [Theobroma cacao]
Length=349

 Score = 64.7 bits (156),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 62/213 (29%), Positives = 101/213 (47%), Gaps = 22/213 (10%)
 Frame = +2

Query  95   LPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYPV  274
            +P + +  I+S+LP KSL+RFK VSK +YSL+ D  F  LH   S+     + I  +   
Sbjct  6    IPMDAVSSILSRLPLKSLLRFKSVSKEWYSLINDLYFIKLHHRQSVETKVNIIIKEIRSD  65

Query  275  LWRDRNF--TNFNWYYTINYSEENQGNLQANRLQYFDHNPNLFRKVYLSSSLNGLICFCR  448
             +   NF   NFN   TI++S ++        +            V L  S NGL+C   
Sbjct  66   KFLSTNFDGINFNNPTTIDHSLKHLSGCDEGGID-----------VLLFGSCNGLVCLI-  113

Query  449  FSDRSDEIAIHNLSTRQH--IPLPSNCHYDGSCKMNAFGLLGFDSGSRRYKVLKSVEFTT  622
                S  I + N+STR +  I   S    D   K++ F   G+D+ +  YK++K V+   
Sbjct  114  ---NSMTIVLWNISTRDYKIILNKSWKERDAWWKISNFCGFGYDTINDDYKIVKVVQEVD  170

Query  623  G--DSVSVKHWVFTVGVDKSWRKIHSSPYYHPY  715
               D++  +  ++++  + +WR+    PYY  Y
Sbjct  171  SLTDTLISEAKIYSLKTN-TWRRGEEIPYYFCY  202



>ref|XP_010546881.1| PREDICTED: F-box/kelch-repeat protein At3g06240-like [Tarenaya 
hassleriana]
 ref|XP_010546882.1| PREDICTED: F-box/kelch-repeat protein At3g06240-like [Tarenaya 
hassleriana]
 ref|XP_010546883.1| PREDICTED: F-box/kelch-repeat protein At3g06240-like [Tarenaya 
hassleriana]
 ref|XP_010546884.1| PREDICTED: F-box/kelch-repeat protein At3g06240-like [Tarenaya 
hassleriana]
 ref|XP_010546885.1| PREDICTED: F-box/kelch-repeat protein At3g06240-like [Tarenaya 
hassleriana]
Length=388

 Score = 65.1 bits (157),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 66/213 (31%), Positives = 107/213 (50%), Gaps = 28/213 (13%)
 Frame = +2

Query  104  EILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPS----RMRILILYP  271
            EI+ EI+ +LPAKS+ RF+CVSK F SL +D  FA  H + SL + +    R R+++ Y 
Sbjct  28   EIIREILLRLPAKSIGRFRCVSKLFRSLSLDPEFAKTHLDLSLRNDAFRSGRRRLIVYYH  87

Query  272  VLWRDRNFTNFNWYYTINYSEENQGNLQANRLQYFDHNPNLFRKVY------LSSSLNGL  433
               RD    +F+   +I  + E   +L A  +       NL    Y      +  S NGL
Sbjct  88   ---RDLYTVDFD---SIVDACEGIRDLGAVEIPQSPVLSNLVSSYYPKYWVQMVGSCNGL  141

Query  434  ICFCRFSDRSDEIAIHNLSTRQHIPLPS--NCHYDGSCKMNAFGL-LGFDSGSRRYKVLK  604
            +C    S+ + ++ + NL+T +   +P   +     + + + FGL  GFD+ +  YKV  
Sbjct  142  VC---TSNGAADVFLFNLTTGESKRIPGFRDFLISRAEEESFFGLGFGFDAITDDYKV--  196

Query  605  SVEFTTGDSVSVKHWVFTVGVDKSWRKIHSSPY  703
             V   TGD ++    V++V  + SW+ +  S Y
Sbjct  197  -VALVTGDVLNA--CVYSVKTE-SWKWVGDSRY  225



>ref|XP_010669281.1| PREDICTED: F-box/kelch-repeat protein At3g06240-like [Beta vulgaris 
subsp. vulgaris]
Length=379

 Score = 64.7 bits (156),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 66/219 (30%), Positives = 102/219 (47%), Gaps = 27/219 (12%)
 Frame = +2

Query  92   FLPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYP  271
             L QEI+V+I+++LPAKS+ RF+CVSK + SL+    F   H N +  H  R   LIL+ 
Sbjct  3    MLHQEIIVDILTRLPAKSIGRFRCVSKPWKSLLSQPHFIKTHLNRT-KHDLREESLILF-  60

Query  272  VLWRDRNFTNFNWYYTINYSEENQGNL------QANRLQYFDHNPNLFRKVYLS--SSLN  427
                          Y+I  + +N  ++       A +L ++DH+ N     +    +S +
Sbjct  61   -------CDESQSMYSIQLNNKNAHHVFDKITTPATKLCFYDHH-NFASTTFARNMASCD  112

Query  428  GLICFCRFSDRSDEIAIHNLSTRQHIPLPSNCH-YDGSCKMNAFGLLGFDSGSRRYKVLK  604
            GLI      D  D++ + N +TR+   LP + +  D       +G LG+DS S  YKV+ 
Sbjct  113  GLI---LVRDEEDKLVLVNPTTREVKELPCSPYALDPGASFTMYG-LGYDSVSDDYKVVT  168

Query  605  SVEFTTGDSVSVKHWVFTVGV----DKSWRKIHSSPYYH  709
               + T +          V V      SW+   SSPY H
Sbjct  169  ISYYDTDNEHEPDCTEMFVNVYSVRHGSWKCADSSPYDH  207



>ref|XP_010324105.1| PREDICTED: F-box protein CPR30-like [Solanum lycopersicum]
Length=365

 Score = 64.7 bits (156),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 60/202 (30%), Positives = 98/202 (49%), Gaps = 20/202 (10%)
 Frame = +2

Query  95   LPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYPV  274
            L ++++ EI+++LP  SL+RFKCV KF+YSL+ + +F   H +      + + +LI    
Sbjct  3    LSEDVIFEILTRLPVISLIRFKCVCKFWYSLIKNPNFISNHLHNLNNKQNHLHLLIS---  59

Query  275  LWRDRNFTNFNWYYTINYSEENQGNLQANR--LQYFDHNPNLFRKVYLSSSLNGLICFCR  448
              R  N TN      ++ S+ +  ++  N+   +YF+     F  + L    NG++C C 
Sbjct  60   --RRGNITN---KRILSLSQNDTFDVFINQDFPEYFNDK---FGHIRLIGPCNGIVCLCG  111

Query  449  FSDRSDEIAIHNLSTRQHIPLPSNC---HYDGSCKMNAFGLLGFDSGSRRYKVLKSVEFT  619
            + D    I + N S R +  LP +        + + + FG LGFDS    YKV++ +   
Sbjct  112  YPDN---IVLWNPSIRDYKILPQSQIQRLVGSTIRGSDFG-LGFDSKKNDYKVIQILFCL  167

Query  620  TGDSVSVKHWVFTVGVDKSWRK  685
            T D V V           SWRK
Sbjct  168  TIDRVFVYQVEIYSLNTNSWRK  189



>ref|XP_010431577.1| PREDICTED: putative F-box protein At1g32420 [Camelina sativa]
Length=423

 Score = 64.7 bits (156),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 65/209 (31%), Positives = 103/209 (49%), Gaps = 24/209 (11%)
 Frame = +2

Query  95   LPQEIL-VEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYP  271
            +P ++L V+I+SKLP KSL RF+CVSK + S++      DL +  +LT P R+ ++    
Sbjct  36   IPLDVLTVDILSKLPVKSLARFQCVSKLWSSVI-----TDLIKTRNLTQP-RLLLVFQPD  89

Query  272  VLWRDRNFTNFNWYYTINYSEENQGNLQANRLQYFDHNPNLFRKVYLSSSLNGLICFCRF  451
            +L +   F++    YT      NQ  + A++ +      N      L   +NGLIC    
Sbjct  90   LLSQCLYFSS----YTYPDPNTNQTFISADKEREISCGFN----CRLYQYVNGLICCL--  139

Query  452  SDRSDEIAIHNLSTRQHIPLPSNCHYDGSCKMNAFGLLGFDSGSRRYKVLKSVEFTTGDS  631
               S + AI+N +T+Q + LP    YDG   ++  GL G+D    +YKV   V     + 
Sbjct  140  -SNSKQFAIYNPTTKQSLLLP-KVVYDGMTFVD--GLFGYDPVENQYKVFSLVRVYNVEP  195

Query  632  VSVKHWVFTVG--VDKSWRKIHSSPYYHP  712
                  VFT+G   ++ WR I+    + P
Sbjct  196  -EYTCQVFTLGGPKEQQWRNINIKDNFTP  223



>ref|XP_009127532.1| PREDICTED: F-box protein DOR-like [Brassica rapa]
Length=359

 Score = 64.7 bits (156),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 58/205 (28%), Positives = 96/205 (47%), Gaps = 25/205 (12%)
 Frame = +2

Query  95   LPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYPV  274
            +P ++++E++ +LP KS+ + +C SK + S++    F +L         SR R  +L   
Sbjct  32   IPTDLIIEVLLRLPPKSIPKCRCASKLWDSILRRADFTEL-----FITRSRARPQLLLSC  86

Query  275  LWRDRNFTNFNWYYTINYSEENQGNLQANRLQYFDHNPNLFRKVYLSSSLNGLICFCRFS  454
            +  +  F      ++I    +NQ  + AN    F       R   +   + GL+C     
Sbjct  87   VENEELF-----LFSIPQEVQNQDVVTANYHTRFPCG----RSSKIIGPVRGLVCLTHLR  137

Query  455  D-RSDEIAIHNLSTRQHIPLPSNCHYDGSCKMNAFGLLGFDSGSRRYKVLKSVEFTTGDS  631
              +     I N ST Q +PLP+      S  +N F  LGFD   +++K+L     TT D 
Sbjct  138  KYKKTAPVICNPSTGQSLPLPNV--KTRSTLVNTF--LGFDPVGKQFKIL---SMTTRDY  190

Query  632  VSV-KHWVFTVGVDK--SWRKIHSS  697
            ++  +H V T+G +K  SWRKI  S
Sbjct  191  INCEEHQVLTLGTEKKMSWRKIECS  215



>ref|XP_006599477.1| PREDICTED: F-box/kelch-repeat protein At3g06240-like [Glycine 
max]
Length=289

 Score = 64.3 bits (155),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 57/203 (28%), Positives = 94/203 (46%), Gaps = 19/203 (9%)
 Frame = +2

Query  92   FLPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYP  271
            FLPQE+++EI+ +LP KSLVRFKCV K + SL+ D  FA  H   +  H  R+  ++L P
Sbjct  13   FLPQELIIEILLRLPVKSLVRFKCVCKLWLSLISDPHFAISHFEQAAIHNERL--VLLAP  70

Query  272  VLWRDRNFTNFNWYYTINYSEENQGNLQANRLQYFDHNPNLFRKVYLSSSLNGLICFCRF  451
                 R F + ++    N S  +     A +L +    P   R   +  S  G +     
Sbjct  71   CA---REFRSIDF----NASLHDNSASAALKLDFLPPKPYYVR---ILGSCRGFVLL---  117

Query  452  SDRSDEIAIHNLSTRQHIPLP-SNCHYDGSCKMNAFGL-LGFDSGSRRYKVLKSVEFTTG  625
             D    + + N ST  H  +P S    D   +   F    G+D  +  Y V+++    + 
Sbjct  118  -DCCQSLHVWNPSTGVHKQVPRSPIVSDMDVRFFTFLYGFGYDPSTHDYLVVQASNNPSS  176

Query  626  DSVSVKHWVFTVGVDKSWRKIHS  694
            D  + +   F++G + +W++I  
Sbjct  177  DDYATRVEFFSLGAN-AWKEIEE  198



>ref|XP_007143916.1| hypothetical protein PHAVU_007G113100g [Phaseolus vulgaris]
 gb|ESW15910.1| hypothetical protein PHAVU_007G113100g [Phaseolus vulgaris]
Length=400

 Score = 64.7 bits (156),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 55/209 (26%), Positives = 96/209 (46%), Gaps = 19/209 (9%)
 Frame = +2

Query  95   LPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYPV  274
            +P ++++EI+S++P K+L+RF+CVSK++ S V D +   LH   S      +  L  Y  
Sbjct  30   MPDDLMMEILSRIPVKALMRFRCVSKYWNSFVFDPNLVKLHLQRSPRDNPILYTLSEY--  87

Query  275  LWRDRNFTNFNWYYTIN--YSEENQGNLQANRLQYFDHNPNLFRKVYLSSSL----NGLI  436
                R +  ++ Y   +  +    Q  LQ       +H       V++   +    NGL+
Sbjct  88   ----REYGEYDEYDDAHSLHRSSTQSLLQNPLSVVGNHEDEDAVPVFVDYDIVGVCNGLV  143

Query  437  CFCRFSDRSDEIAIH--NLSTRQHIPLPSNCHYDGSCKMNAFGLLGFDSGSRRYKVLKSV  610
            C  R     DEI +   N +TR       +C+ +  C   AF   G D+ +  YKV+ +V
Sbjct  144  CLSRIHTNLDEIWVRFWNPATRLSSNESPSCYIECGCANMAF---GHDASTDTYKVVAAV  200

Query  611  EFTTGDSVSVKHWVFTVGVDKSWRKIHSS  697
              +      ++  V+ +  D  WR+I +S
Sbjct  201  -MSDAKCHKIELRVYNLA-DDCWREIPTS  227



>ref|XP_002300154.1| hypothetical protein POPTR_0001s32580g [Populus trichocarpa]
 gb|EEE84959.1| hypothetical protein POPTR_0001s32580g [Populus trichocarpa]
Length=372

 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 58/209 (28%), Positives = 101/209 (48%), Gaps = 36/209 (17%)
 Frame = +2

Query  95   LPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLH----RNWSLTHPSRMRILI  262
            LPQ+I+V+I++ LP KSL+RFKCV K ++SL+ D  F   H    R  +     R+ +  
Sbjct  4    LPQDIMVDILTYLPVKSLLRFKCVCKLWHSLISDPKFVKSHLKTAREVNSNKSQRLLLST  63

Query  263  LYPVLWRDRNFTNFNWYYTINYSEENQGNLQANRLQYFDHNPNLFRK-----VYLSSSLN  427
              P               ++++   ++G+ + N +Q  ++ P++ R      + +  S +
Sbjct  64   RTP--------------QSVDFEAASEGD-EDNAVQELEY-PDVVRCSPTYFIGIMGSCD  107

Query  428  GLICFCRFSDRSDEIAIHNLSTR--QHIPLPSNCHYDGSCKMNAFGLLGFDSGSRRYKVL  601
            GLIC   F D + ++ + N STR  + +P PS  H       + F  +G+DS +  YK +
Sbjct  108  GLICL--FVDYA-KLVLWNPSTRDYKEMPKPSCDH-----GFDFFAGIGYDSSNDDYKFV  159

Query  602  KSVEFTTGDSVSVKHWVFTVGVDKSWRKI  688
                 T   S  +   V T+  +  WRK+
Sbjct  160  IPSCTTADGSEQIMVEVLTLKTN-VWRKV  187



>ref|XP_002894025.1| hypothetical protein ARALYDRAFT_336831 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH70284.1| hypothetical protein ARALYDRAFT_336831 [Arabidopsis lyrata subsp. 
lyrata]
Length=488

 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 58/211 (27%), Positives = 98/211 (46%), Gaps = 11/211 (5%)
 Frame = +2

Query  95   LPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYPV  274
            +P ++L++I S++PAKS+  F+CVSKF+ S++    F +L+ N      S +R  +L+  
Sbjct  13   IPIDVLMDIFSRVPAKSIAMFRCVSKFWDSILCHPDFTELYMN-----TSSIRQPLLFFT  67

Query  275  LWRDRNFTNFNWYYTINYSEENQGNLQANRLQYFDHNPNLFRKVYLSSSLNGLICFCRFS  454
            L  +     F+  +  N  +EN   +      + +H+P  F    +S  L G +C  R  
Sbjct  68   LEDNGKLFFFSSPHPQNPPDENTSLVPTRYHVHHNHSPTDFSS-EVSFPLRGFVC-SRDK  125

Query  455  DRSDEIAIHNLSTRQHIPLPSNCHYDGSCKMNAFGLLGFDSGSRRYKVLKSVEFTTGDSV  634
               D + I N  T + + LP       S        LG+D   ++ KVL  ++F    + 
Sbjct  126  GSLDTMVICNPVTGEFVSLPKV--ELKSVNTETRPYLGYDPIDKQLKVL-CIKFDDIPNT  182

Query  635  SVKHWVFTVGVDKS-WRKIHSSPYYHPYNGF  724
              +H V T+   K  WR I   P+Y   +G 
Sbjct  183  CDEHQVLTLENGKHLWRTIQCKPHYPKSDGI  213



>ref|XP_009762226.1| PREDICTED: F-box/kelch-repeat protein At3g23880-like [Nicotiana 
sylvestris]
Length=380

 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 61/202 (30%), Positives = 96/202 (48%), Gaps = 20/202 (10%)
 Frame = +2

Query  95   LPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYPV  274
            LP++++ EI+ +LP  SLVRFKCV K +YSL+ + +    H +   +  + +R+LI    
Sbjct  20   LPEDVIFEILIRLPVTSLVRFKCVCKSWYSLIENPNLISKHLHNLSSRKNYVRLLIS---  76

Query  275  LWRDRNFTNFNWYYTINYSEENQGNLQANR--LQYFDHNPNLFRKVYLSSSLNGLICFCR  448
              R  N TN      ++ S  +  ++  N+    YF+     F  V L    NG++C C 
Sbjct  77   --RRGNITN---KRVVSLSMNDTFDVFINQDFPSYFNDK---FGHVRLIGPCNGIVCLCG  128

Query  449  FSDRSDEIAIHNLSTRQHIPLPSNC---HYDGSCKMNAFGLLGFDSGSRRYKVLKSVEFT  619
            +    D I I N S R +  LP +        + + + FG LGFDS    YKV++ +   
Sbjct  129  Y---PDNIVIWNPSIRDYKILPQSQIQRLVGSTVRGSDFG-LGFDSKRNDYKVIQILFCL  184

Query  620  TGDSVSVKHWVFTVGVDKSWRK  685
            + D V V         +  WRK
Sbjct  185  SNDRVVVYQVEIYSLNENIWRK  206



>ref|XP_006280484.1| hypothetical protein CARUB_v10026421mg [Capsella rubella]
 gb|EOA13382.1| hypothetical protein CARUB_v10026421mg [Capsella rubella]
Length=437

 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 66/218 (30%), Positives = 97/218 (44%), Gaps = 22/218 (10%)
 Frame = +2

Query  95   LPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYPV  274
            +P ++ +EI+++LPA+SL RF+CVSK + S++ +  F D     S    SR R   L  V
Sbjct  41   IPLDLTIEILTRLPARSLKRFQCVSKEWISVIRNRVFID-----SFCSVSRTRSRFLVAV  95

Query  275  -LWRDRNFTNFNWYYTINYSEENQGNLQANRLQ---------YFDHN-PNLFRKVYLSSS  421
             +  +R                N+  L+  +L          Y +   P L   +   SS
Sbjct  96   RIAENRVILLSTAPNETELPSPNETELRCCQLNPILYSSLHTYLEMTLPGLPVDLVHCSS  155

Query  422  LNGLICFCRFSDRSDEIAIHNLSTRQHIPLPSNCHYDGSCKMNAFGLLGFDSGSRRYKVL  601
            ++GL C    SD      I N STRQ I LP+     G  + N    LG+D  +  YK  
Sbjct  156  IHGLFCLSHPSD-PGRFTICNPSTRQVITLPNIKASSGRRRENISMFLGYDPVANEYKAF  214

Query  602  KSVEFTTGDSVSVKHWVFTVGVDK-SWRKIHS--SPYY  706
             S  +  G+    +H V T+G  K SWR I    +P Y
Sbjct  215  CSTTW-HGEPFQ-EHKVLTIGGGKLSWRSIKGRITPRY  250



>ref|XP_007211962.1| hypothetical protein PRUPE_ppa006542mg [Prunus persica]
 gb|EMJ13161.1| hypothetical protein PRUPE_ppa006542mg [Prunus persica]
Length=406

 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 56/215 (26%), Positives = 104/215 (48%), Gaps = 28/215 (13%)
 Frame = +2

Query  95   LPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYPV  274
            LP E+++ I+S+L    L+ F+ ++K + SL+    F DLH   S    S + +     +
Sbjct  21   LPPEVIINILSRLQVGRLLCFRSIAKTWRSLIDSPYFVDLHLEKSAEAKSHLSL-----I  75

Query  275  LWRDRNFTNFNWYYTINYSEENQGNLQANRLQYFDHNPNLFRKVYLSSSLNGLICFCRFS  454
            L +D +       Y IN+   +      + L  + +      ++ +  S NGL+C C   
Sbjct  76   LRKDSDL------YYINFDSLDDAVELNHPLMCYSN------RIRVLGSCNGLLCICNV-  122

Query  455  DRSDEIAIHNLSTRQH--IP-LPSNCHYDGS---CKMNAFGLLGFDSGSRRYKVLKSVEF  616
              +++IA+ N ST+++  +P LPS+   D     C    +G LG+D+G   YK+++  +F
Sbjct  123  --AEDIALWNPSTKKYRVLPSLPSDRKRDSGMCLCGARVYG-LGYDAGHDDYKLVRISQF  179

Query  617  TTGDSVSVKHWVFTVGV-DKSWRKIHSSPYYHPYN  718
               D +S +  V    + + +W+K+   PY   Y 
Sbjct  180  IGLDYLSFESEVKVYSLRNNAWKKVEDMPYVLCYT  214



>ref|XP_002312730.1| F-box family protein [Populus trichocarpa]
 gb|EEE90097.1| F-box family protein [Populus trichocarpa]
Length=445

 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 62/221 (28%), Positives = 94/221 (43%), Gaps = 19/221 (9%)
 Frame = +2

Query  95   LPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLH----RNWSLTHPSRMRILI  262
            LP E+++EI+S+LPAKSL++F+CVSK F SL+ +  F   H    +N S   P       
Sbjct  79   LPHELIIEILSRLPAKSLIKFRCVSKSFKSLISNPQFIKTHLEKVKNLSRNDPD------  132

Query  263  LYPVLWRDRNFTNFNWYYTINYSEENQGNLQANRLQYFDHNPNLFRKVYLSSSLNGLICF  442
              P +    +   F       YS  N     A  + Y+    +++R  ++  S +GL+C 
Sbjct  133  FSPEIVISSSEPLFRLKSCSLYSVYNNPVTDAVVIDYYLLK-DIYRYDWVVGSCDGLVC-  190

Query  443  CRFSDRSDEIAIHNLSTRQHIPLPSNCHYDGSCKMNAFGLLGFDSGSRRYKVLKSVEFTT  622
                 + D + + N STR    LP             FG  G+DS    YKVL    F T
Sbjct  191  --LGIKQDFVVLWNPSTRVFNRLPDLGFAKKLGSYTVFG-FGYDSQIDDYKVLAMFCFLT  247

Query  623  GDSVSVKHWVFTVGV----DKSWRKIHSSPYYHPYNGFNTH  733
                    +V  + V     + WR++       PY+    H
Sbjct  248  KSVYGGSRYVTRIKVCALKGECWRRLEDFGLGLPYDVSGKH  288



>ref|XP_008227473.1| PREDICTED: F-box protein CPR30-like [Prunus mume]
Length=406

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 56/215 (26%), Positives = 104/215 (48%), Gaps = 28/215 (13%)
 Frame = +2

Query  95   LPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYPV  274
            LP E+++ I+S+L    L+ F+ ++K + SL+    F DLH   S    S + +     +
Sbjct  21   LPPEVIINILSRLQVGRLLCFRSIAKTWRSLIDSPYFVDLHLEKSAEAKSHLSL-----I  75

Query  275  LWRDRNFTNFNWYYTINYSEENQGNLQANRLQYFDHNPNLFRKVYLSSSLNGLICFCRFS  454
            L +D +       Y IN+   +      + L  + +      ++ +  S NGL+C C   
Sbjct  76   LRKDSDL------YYINFDSLDDAVELNHPLMCYSN------RIRVLGSCNGLLCICNV-  122

Query  455  DRSDEIAIHNLSTRQH--IP-LPSNCHYDGS---CKMNAFGLLGFDSGSRRYKVLKSVEF  616
              +++IA+ N ST+++  +P LPS+   D     C    +G LG+D+G   YK+++  +F
Sbjct  123  --AEDIALWNPSTKKYRVLPSLPSDRKRDSGMCLCGARVYG-LGYDAGHDDYKLVRISQF  179

Query  617  TTGDSVSVKHWVFTVGV-DKSWRKIHSSPYYHPYN  718
               D +S +  V    + + +W+K+   PY   Y 
Sbjct  180  IGLDYLSFESEVKVYSLRNNAWKKVEDMPYVLCYT  214



>ref|XP_004305866.1| PREDICTED: F-box/kelch-repeat protein At3g23880-like [Fragaria 
vesca subsp. vesca]
Length=381

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 62/206 (30%), Positives = 93/206 (45%), Gaps = 25/206 (12%)
 Frame = +2

Query  101  QEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYPVLW  280
             +++ EI+S LP KSL+RF+CV K +++L+ +  F D H      H +++      P+L 
Sbjct  25   DDVIAEILSWLPVKSLLRFRCVCKAWHALISESYFVDKH-----LHRTKIN-----PLLK  74

Query  281  RDRNFTNFNWYYTINYSEENQGNLQANRLQYFDHN------PNLFRKVYLSSSLNGLICF  442
            R  +      Y  +     N G + +  L Y   N      P  F  V L  S NGLIC 
Sbjct  75   RKSHIFRSIEYQALLNCLSNDGPILSRELDYPLMNLPVSIKPGTFNWV-LIGSCNGLICI  133

Query  443  CRFSDRSDEIAIHNLSTR--QHIPLPSNCHYDGSCKMNAFGLLGFDSGSRRYKVLKSVEF  616
                  +  + + NL TR  Q +P P +  +D  C    FG  G+DS +  YKV+ +   
Sbjct  134  -LIDWFTKLVMLWNLCTRISQVLPQPCDLDFDLCC----FG-FGYDSTTDDYKVILNGIL  187

Query  617  TTGDSVSVKHWVFTVGVDKSWRKIHS  694
              GD  S +  V       SW K+ S
Sbjct  188  NGGDYSSDQSVVVFTVKTGSWGKVKS  213



>ref|NP_001241466.1| uncharacterized protein LOC100815072 [Glycine max]
 gb|ACU18857.1| unknown [Glycine max]
Length=406

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 65/212 (31%), Positives = 105/212 (50%), Gaps = 27/212 (13%)
 Frame = +2

Query  92   FLPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFAD--LHRNWSLTHPSRMRILIL  265
            FLP E++VEI+S+LP KSL++F+CV K + SL+ D  F    LH +   TH +  RI++ 
Sbjct  48   FLPDELVVEILSRLPVKSLLQFRCVCKSWMSLISDPYFMKKHLHLSSRCTHFTHHRIIL-  106

Query  266  YPVLWRDRNFTNFNWYY---TINYSEENQGNLQANRLQYFDHNPNLFRKVYLSSSLNGLI  436
                    + T   ++    +++    N  +   + L Y     N FR   +  S NGL+
Sbjct  107  --------SATTAEFHLKSCSLSSLFNNPSSTVCDDLNY--PVKNKFRHDGIVGSCNGLL  156

Query  437  CFCRFSDRSDEIAIHNLSTR---QHIPLPSNCHYDGSCKMNAFGLLGFDSGSRRYKVLKS  607
            C   F+ + D + + N S R   +  PL +N  +   C   AFG LG+D  +  YKV+  
Sbjct  157  C---FAIKGDCVLLWNPSIRVSKKSPPLGNN--WRPGC-FTAFG-LGYDHVNEDYKVVAV  209

Query  608  VEFTTGDSVSVKHWVFTVGVDKSWRKIHSSPY  703
                +   +  K  V+++  + SWRKI   P+
Sbjct  210  FCDPSEYFIECKVKVYSMATN-SWRKIQDFPH  240



>ref|NP_174520.1| putative F-box protein [Arabidopsis thaliana]
 sp|Q9LQL5.1|FB30_ARATH RecName: Full=Putative F-box protein At1g32420 [Arabidopsis thaliana]
 gb|AAF81340.1|AC007767_20 Contains similarity to a hypothetical protein F6D8.29 gi|5903056 
from Arabidopsis thaliana BAC F6D8 gb|AC008016 [Arabidopsis 
thaliana]
 gb|AEE31485.1| putative F-box protein [Arabidopsis thaliana]
Length=302

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 65/221 (29%), Positives = 100/221 (45%), Gaps = 44/221 (20%)
 Frame = +2

Query  95   LPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVID-HSFADLHRNWSLTHPSRMRILILY-  268
            +P ++ VEI+ KLPAKSL+RF+CVSK + S++     F D     SLT P    I +++ 
Sbjct  37   IPLDLTVEILKKLPAKSLLRFQCVSKQWLSIISSRRDFIDSIVTRSLTQPPPRDIKLIFH  96

Query  269  -PVLWRDRNFTNFNWYYTINYSEENQGNLQANRLQYFDHNPNLFRKVYLSSSLNGLICFC  445
              VL+   +F  F+  Y  N  +E+    +A+   Y                + GLIC  
Sbjct  97   HQVLYPGPHFFIFSSTYPQNTDKESL-TTRASSYHY----------------VRGLICC-  138

Query  446  RFSDRSDEIAIHNLSTRQHIPLPSNCHYD--GSCKMNAFGLLGFDSGSRRYKVLKSVEFT  619
             +S     + I+N +TRQ+  +P    Y    +C        G+D    +YKV+   ++ 
Sbjct  139  -WSHCPTTVDIYNPTTRQYYTVPDTNRYQYIETC------FFGYDPVENQYKVMVLPKYY  191

Query  620  TGDSVSVKHWVFTVG--VDKSWRKIHSSPYYHPYNGFNTHF  736
              +S      VFTVG  ++K WR I          G   HF
Sbjct  192  MEESPC---QVFTVGDPIEKPWRDIQ---------GIGVHF  220



>ref|XP_007216437.1| hypothetical protein PRUPE_ppa021853mg [Prunus persica]
 gb|EMJ17636.1| hypothetical protein PRUPE_ppa021853mg [Prunus persica]
Length=334

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 52/205 (25%), Positives = 87/205 (42%), Gaps = 54/205 (26%)
 Frame = +2

Query  92   FLPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYP  271
            ++P+EIL+ I+S+LP KSL+RF CV K + SL+    F  +H N ++ HP          
Sbjct  11   YIPEEILINILSRLPVKSLIRFICVCKLWSSLIRSSRFIGMHLNRNIKHP----------  60

Query  272  VLWRDRNFTNFNWYYTINYSEENQGNLQANRLQYFDHNPNLFRKVYLSSSLNGLICFC-R  448
                                      L   ++              +  S NGL+C    
Sbjct  61   --------------------------LTGPKID-------------IHGSSNGLVCLSYE  81

Query  449  FSDRSDEIAIHNLSTRQHIPLPSNCHYDGSCKMNAFGL-LGFDSGSRRYKVLKSVEFTTG  625
              +    I + NLS ++H+ LP            A G+  GF  G   YKV++ + F  G
Sbjct  82   LGNLDTAIYLCNLSIQKHVVLPPTSILCFPWPEYATGVAFGFHPGLNDYKVVRLLAFFVG  141

Query  626  DSVSVKHWVFTVGVDKSWRKIHSSP  700
            + + V+  V+++  + SW++I + P
Sbjct  142  NCIEVE--VYSLSTN-SWKRIDAIP  163



>ref|XP_007032644.1| S locus F-box protein with the low allelic sequence polymorphism 
1-S2, putative [Theobroma cacao]
 gb|EOY03570.1| S locus F-box protein with the low allelic sequence polymorphism 
1-S2, putative [Theobroma cacao]
Length=381

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 65/232 (28%), Positives = 115/232 (50%), Gaps = 34/232 (15%)
 Frame = +2

Query  95   LPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRIL-ILYP  271
            LP+++ +E+  +LP +SL RF+CV K +Y+L  +  F  +H +++ ++   + I   L  
Sbjct  7    LPRDLFLEVCLRLPVESLTRFRCVCKSWYALFKNPKFISMHLSYNSSNNEFVLIKRCLLT  66

Query  272  VLWRDRNFTNFNWYYTINYSEENQGNLQANRLQYFDHNPNLFRKVYLSSSLNGLICFCRF  451
             L +  N   F+   + ++S  N     A  L  +   P L     L    +G+IC    
Sbjct  67   CLGKKVNM--FSLVSSKDFSFAN----VAVDLPLYKKEPYL----QLLGHCDGIIC---L  113

Query  452  SDRSDEIAIHNLSTRQHIPLPSNCHYDGSC------KMNAFGLLGFDSGSRRYKVLKSVE  613
            S+  D+I + N +T++   LP +C    S       + NA G  G+D  +++YKV++ V 
Sbjct  114  SNYRDDIVLCNPATKESTVLPKSCLPCFSSNPNLIPRTNALG-FGYDLKNQQYKVVRIVS  172

Query  614  FTT--GD----SVSVKHWVFTVGVDKSWR-----KIHSSPYYHPYNGFNTHF  736
            +    GD     +S+   V+T+G D SWR     K+ ++  Y P   F+T+F
Sbjct  173  YLEEFGDHSLPQLSMVE-VYTMGTD-SWREVKNVKVSANVQYCPIPCFDTYF  222



>ref|XP_010091000.1| F-box protein [Morus notabilis]
 gb|EXB41585.1| F-box protein [Morus notabilis]
Length=390

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 62/219 (28%), Positives = 105/219 (48%), Gaps = 32/219 (15%)
 Frame = +2

Query  92   FLPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYP  271
            FLP EI+V+I+ +LP K L+R++ VSK + SL+  H F  LH N SL   S +       
Sbjct  4    FLPWEIIVDILCRLPVKDLLRYRSVSKSWCSLIDGHDFIKLHLNHSLKTNSDV------G  57

Query  272  VLWRDRNFTNFNWYYTINYSEENQGNLQANRLQYFDHNPNLFRKVYLSSSLNGLICFCRF  451
            V++  RN   +     +N +E               H  ++   + +    NGL+     
Sbjct  58   VVFGGRNDLCWLDLDDLNSAER------------LPHPIDIGTGIDVVGGCNGLLALM--  103

Query  452  SDRSDEIAIHNLSTRQHIPLPSNCHYDGSCKMNAFGLL----GFDSGSRRYKVLKSVEFT  619
             + + ++A+ N STR++I LP + H+  S   + F +L    G D  +  +KVL  + F+
Sbjct  104  -NSNGDMAVWNPSTRRYISLPISDHF-ASFPFHVFQVLITGFGHDPITDDHKVLLMINFS  161

Query  620  --TGDSVSVKHWVFTVGVDKSWRKIHSSP---YYHPYNG  721
                DS   +  V+++   K+W+++   P    YH  NG
Sbjct  162  GIIVDSFHCEAKVYSLKA-KTWKRLDHFPNHIVYHRENG  199



>ref|XP_007049216.1| F-box and associated interaction domains-containing protein, 
putative isoform 2 [Theobroma cacao]
 ref|XP_007049217.1| F-box and associated interaction domains-containing protein, 
putative isoform 2 [Theobroma cacao]
 gb|EOX93373.1| F-box and associated interaction domains-containing protein, 
putative isoform 2 [Theobroma cacao]
 gb|EOX93374.1| F-box and associated interaction domains-containing protein, 
putative isoform 2 [Theobroma cacao]
Length=365

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 55/213 (26%), Positives = 96/213 (45%), Gaps = 33/213 (15%)
 Frame = +2

Query  95   LPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYPV  274
            LPQ+++++I+S+LP  SLV+ K V + + S++     A+ H    L+H S     I++  
Sbjct  4    LPQDVVLDILSRLPITSLVQSKSVCRSWRSIIQGSLLANKH----LSHMSDYDPGIIFQS  59

Query  275  LWRDRNFTNFNWYYTINYSEENQGNLQANRLQYFDHNPNLFRKVYLSSSLNGLICFCRFS  454
             W  +     N YY ++++   +GN    ++ +   + NL        S NGL+CFC  S
Sbjct  60   HWPSQ-----NQYYFVDFAAYPEGNKILKKISFSTKHANLV------GSCNGLLCFCNAS  108

Query  455  DRSDEIAIHNLSTRQHIPLPSNCHYDGSCKMNAFGLLGFDSGSRRYKVLKSV--------  610
                +I I N  T+  I LP      G   +  F   GF   ++ YK+++ V        
Sbjct  109  ----QIHICNPLTKDSIELPKLLKGPGEVGILGF---GFSPTTKEYKLIEIVYQRKRPGV  161

Query  611  --EFTTGDSVSVKHWVFTVGVDKSWRKIHSSPY  703
                   +    +  + T+G  + WR +   PY
Sbjct  162  WSHVAVSNPFQAEVRILTLGGSR-WRSLGMVPY  193



>ref|XP_010679277.1| PREDICTED: F-box protein CPR30-like [Beta vulgaris subsp. vulgaris]
Length=211

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 67/211 (32%), Positives = 101/211 (48%), Gaps = 24/211 (11%)
 Frame = +2

Query  95   LPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILI-LYP  271
            LP +I+V I+SKLP KSL+RF+ V K + SL+  H+F  +H N +L+      +L+ +  
Sbjct  4    LPMDIIV-ILSKLPVKSLLRFQYVCKSWQSLIESHNFTKIHLNQTLSFNFDRHLLVSIDD  62

Query  272  VLWRDRNFTNFNWYYTINYSEENQGNLQANRLQYFDHNPNLFRKVYLSSSLNGLICFCRF  451
                      FN   ++++SE         R     H P       L  S NG++C    
Sbjct  63   SSLHSSELNLFNNQLSLSFSEL--------RYPLKRHQP-----FNLVGSCNGVVC---V  106

Query  452  SDRSD-EIAIHNLSTRQHIPLP-SNCHYDGSCKMNAFGLLGFDSGSRRYKVLKSV-EFTT  622
            S+RS  ++ + N  T  H  LP SN      C+   FG  G+DS +  YKVL+ + E   
Sbjct  107  SNRSKIDVVLFNPLTNSHRKLPYSNVSIPNFCR-TVFG-FGYDSENNDYKVLRFIQELEN  164

Query  623  GDSVSVKHWVFTVGVDKSWRKIHSSPYYHPY  715
             D  + K  V+++  + SWR I    YY  Y
Sbjct  165  IDVSNDKVEVYSLK-NNSWRCIRGIQYYLGY  194



>ref|XP_006355905.1| PREDICTED: F-box protein At5g65850-like [Solanum tuberosum]
Length=347

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 58/182 (32%), Positives = 84/182 (46%), Gaps = 40/182 (22%)
 Frame = +2

Query  203  FADLHRNWSLTHPSRMRILILYPVLWRDRNFTNFNWYYTIN---YSEENQGNLQANRL-Q  370
            F D+HR +S+THP            W +        YYT+    Y + +   LQ  R  +
Sbjct  33   FVDIHRCYSMTHPG-----------WTNFLLHGVGVYYTVEQKKYGKHSDSFLQIERYNK  81

Query  371  YFDHNPNLFRKVYLS--SSLNGLICFCR-FSDRSDEIAIHNLSTRQHIPLPSNCHYDGSC  541
             FDH P      Y S  + +NGL C  + FS +    AI N STR+   LP         
Sbjct  82   IFDHAP-----AYSSCLNCINGLFCVWKPFSMQPA--AIFNPSTREVRFLPD--------  126

Query  542  KMNAFGL----LGFDSGSRRYKVLKSVEFTTGDSVSVKHWVFTVGVDKSWRKIHSSPYYH  709
             +N F L    +GF+   +++KVL S +      V  K+WV T+G+DK+WR+  S   + 
Sbjct  127  -LNDFFLYNYSIGFEPKEKKFKVLMSAKHVKEGYV--KYWVLTLGIDKTWRETQSISPFT  183

Query  710  PY  715
            PY
Sbjct  184  PY  185



>ref|XP_008443401.1| PREDICTED: F-box protein CPR30-like [Cucumis melo]
Length=380

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 63/211 (30%), Positives = 100/211 (47%), Gaps = 23/211 (11%)
 Frame = +2

Query  95   LPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYPV  274
            LP  +++EI+S+LP +SL+RFKCV K +Y+L  D  F + H + SL H     +L+   V
Sbjct  7    LPDGVIIEILSRLPPESLLRFKCVRKSWYALFNDPKFKEKHFSTSLQH---KHVLLKRFV  63

Query  275  LWRDRNFTNFNWYYTINYSEENQGNLQANRLQYFDHNPNLFRKVYLSSSLNGLICFCRFS  454
                 N  N      +  S  +  ++    L + +     FR   L    +GL+C    +
Sbjct  64   TKESGNEENIFSILKLPLSIHSSLSISDIDLPFHED----FRFFELHGHSHGLLC---LT  116

Query  455  DRSDEIAIHNLSTRQHIPLPSN--------CHYDG-SCKMNAFGLLGFDSGSRRYKVLKS  607
            D   +I + N STR+   LP +           DG     NA G  G+DS SR +KV++ 
Sbjct  117  DLLKDIFLCNPSTREFHKLPPSILLLTEPPAEPDGYDSSTNAVG-FGYDSKSRDFKVVRV  175

Query  608  VEFTTGDS--VSVKHWVFTVGVDKSWRKIHS  694
            V+F  G       K  V+ +  ++ WR+I +
Sbjct  176  VDFVEGPGYFYPPKVEVYDLSTER-WREIQT  205



>ref|XP_003534732.1| PREDICTED: F-box protein CPR30-like isoform X1 [Glycine max]
Length=392

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 61/211 (29%), Positives = 97/211 (46%), Gaps = 29/211 (14%)
 Frame = +2

Query  95   LPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYPV  274
            LP+E++ +I+S+LPAKSL+RF+  SK + SL+    F  +H + SL+  S   +++    
Sbjct  5    LPREVVTDILSRLPAKSLLRFRSTSKSWKSLIDSQHFNSVHLSRSLSLTSNTTLILRLDS  64

Query  275  LWRDRNFTNFNWYYTINYSEENQGNLQANRLQYFDHNPNLFRKVYLSSSLNGLICFCRFS  454
                 NF   +    +N+            L  + +N      + L  S NGL+C    S
Sbjct  65   DLYQTNFPTLDPPLFLNHP-----------LMCYSNN------ITLLGSCNGLLC---IS  104

Query  455  DRSDEIAIHNLSTRQHIPLPS------NCHYDGSCKMNAFGLLGFDSGSRRYKVLKSVEF  616
            + +D+IA  N S RQH  LPS        H D +         GFD  S  YK+++   F
Sbjct  105  NVADDIAFWNPSLRQHRILPSLPLPRRRLHPDTTLFAARVYGFGFDHTSPDYKLVRISYF  164

Query  617  TTGDSVSVKHWV--FTVGVDKSWRKIHSSPY  703
                  S    V  +T+  + +W+ + S PY
Sbjct  165  VDLQDRSFDSQVKLYTLRAN-AWKTLPSMPY  194



>ref|XP_010916704.1| PREDICTED: F-box protein At3g07870-like [Elaeis guineensis]
Length=385

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 59/213 (28%), Positives = 98/213 (46%), Gaps = 20/213 (9%)
 Frame = +2

Query  92   FLPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYP  271
            +LP +IL  I+S+LP KS++RF CVSK+++ ++ D  F  LH   S T P+ +       
Sbjct  16   YLPCDILFSILSRLPLKSVLRFCCVSKYWFDVITDPDFRRLHFLQSATDPTVL-------  68

Query  272  VLWRDRNFTNFNWYYTINYSEENQGNLQANRLQYFDHNPNLFRKVYLSSSLNGLICFCRF  451
            +L   ++  N      +N  E    ++  N + +      +     L  + NGL+CF   
Sbjct  69   ILLHRKSMENIISMNLLNVKEHGV-HVGTNAISHM----VISGSCKLVGTCNGLLCFTS-  122

Query  452  SDRSDEIAIHNLSTRQHIPLPSNCH-YDGSCKMNAFGLLGFDSGSRRYKVLKSVEFTTG-  625
            S++ + I + N  TR+ + LP           M  +G  GFD  +++YKV++    T   
Sbjct  123  SNQGESIFVCNPITRELVTLPKPTRTAPPESSMLIYG-FGFDYLTKKYKVVRVFYPTNSR  181

Query  626  ---DSVSVKHWVFTVGVD-KSWRKIHSSPYYHP  712
                   V   V T+G   K+ R  +  PY  P
Sbjct  182  FRNPRFGVTAEVCTLGATWKAVRGFNHPPYSRP  214



>ref|XP_010326072.1| PREDICTED: putative F-box protein At3g16210 isoform X12 [Solanum 
lycopersicum]
Length=316

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 59/211 (28%), Positives = 106/211 (50%), Gaps = 22/211 (10%)
 Frame = +2

Query  104  EILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYPVLWR  283
            EI+++I+ +LP +S++RFKCVSKF+ SL+ D  F   H   +  + +  +ILI   ++ +
Sbjct  97   EIMMDILRRLPMRSILRFKCVSKFWKSLIDDTYFKRTHYIHNRDNQNSKKILIAERLVNK  156

Query  284  DRNFTNFNWYYTINYS--EENQGNLQANRLQYFDHNPNLFRKVYLSSSLNGLICFCRFSD  457
            D  F+    +YT + S  E+ Q      +L +      +  +++   S +GL+   R   
Sbjct  157  DETFS----FYTSSLSMVEDKQ------KLDWPTSCNPVDARIF--CSCDGLV-LTRVCS  203

Query  458  R--SDEIAIHNLSTRQHIPLPSNCHYDGSCKMNAFGLLGFDSGSRRYKVLKSVEFTTGDS  631
            +   +E+ + N STR+ I LP   H +       FG L +D+ S  YK+L +V+     S
Sbjct  204  KMFDEELLLWNPSTRESILLP---HPEYRIMTYVFG-LEYDATSEGYKIL-AVKLNGKKS  258

Query  632  VSVKHWVFTVGVDKSWRKIHSSPYYHPYNGF  724
            +++     ++  + SWR+I          GF
Sbjct  259  INISIEFLSIKRNSSWRRIDYPTDIQRVRGF  289



>gb|KDP39340.1| hypothetical protein JCGZ_01097 [Jatropha curcas]
Length=356

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 54/206 (26%), Positives = 95/206 (46%), Gaps = 22/206 (11%)
 Frame = +2

Query  95   LPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYPV  274
            LPQE++VEI+S+LP K L+RFKCV K +  ++ D  FA L    ++ + + +    +   
Sbjct  4    LPQELIVEILSRLPVKPLIRFKCVCKTWQFIISDPEFAKLQLKRAMENNNNVNCYRVLLS  63

Query  275  LWRDRNFTNFNWYYTINYSEENQGNLQANRLQY-----FDHNPNLFRKVYLSSSLNGLIC  439
             W  +         ++++ E   G++    ++          PN F  V +  S NGL+C
Sbjct  64   TWPPQ---------SVDFEEPCNGDISNAVIELRYPAIVKGPPNDFY-VGILGSCNGLVC  113

Query  440  FCRFSDRSDEIAIHNLSTRQHIPLPSNCHYDGSCKMNAFGLLGFDSGSRRYKVLKSVEFT  619
                 D    + + N +T ++  LP     DG+        LG++  +  Y VL +  FT
Sbjct  114  LL---DAYGSMFLWNPTTGKYKELPKP---DGARYGMYLHGLGYNFSTDDYVVLFASHFT  167

Query  620  TGDSVSVKHWVFTVGVDKSWRKIHSS  697
            + DS      ++T+     WR+I  +
Sbjct  168  SNDSKETIFELYTLKTG-IWRRIEDT  192



>ref|XP_002880405.1| hypothetical protein ARALYDRAFT_900620 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56664.1| hypothetical protein ARALYDRAFT_900620 [Arabidopsis lyrata subsp. 
lyrata]
Length=390

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 57/213 (27%), Positives = 98/213 (46%), Gaps = 22/213 (10%)
 Frame = +2

Query  92   FLPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYP  271
             LP ++ +EI+ +LP K+L RF C+SK + S++    F  L+   S   P R+       
Sbjct  14   LLPIDLKMEILKRLPVKTLGRFLCLSKEYASIIRRRDFMKLYLTESTNSPQRLIFTFENK  73

Query  272  VLWRDRNFTNFNWYYTINYSEENQGNLQ-----ANRLQYFDHNPNLFRKVY--LSSSLNG  430
              W+   F+   W       EE++ + Q     ++      ++     + Y  ++ S++G
Sbjct  74   THWKHFFFSASPW----EQEEEDEMSPQNEDESSSSACVATYHMKCHSQPYTTIAPSVHG  129

Query  431  LICFCRFSDRSDEIAIHNLSTRQHIPLPSNCHYDGSCKMNAFGLLGFDSGSRRYKVL---  601
            LIC+   S    ++ ++N STR+ I LP       S ++N +  LG+D     YKVL   
Sbjct  130  LICYGHPS----KLMVYNPSTRRSITLPKI----DSQRINMYHFLGYDPIHGDYKVLCMT  181

Query  602  KSVEFTTGDSVSVKHWVFTVGVDKSWRKIHSSP  700
              +    G  ++ +  V T+G   SWR I   P
Sbjct  182  VGMHVYKGRGMAQELRVLTLGNGNSWRLIEDFP  214



>ref|XP_007049215.1| F-box and associated interaction domains-containing protein, 
putative isoform 1 [Theobroma cacao]
 gb|EOX93372.1| F-box and associated interaction domains-containing protein, 
putative isoform 1 [Theobroma cacao]
Length=428

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 55/213 (26%), Positives = 96/213 (45%), Gaps = 33/213 (15%)
 Frame = +2

Query  95   LPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYPV  274
            LPQ+++++I+S+LP  SLV+ K V + + S++     A+ H    L+H S     I++  
Sbjct  4    LPQDVVLDILSRLPITSLVQSKSVCRSWRSIIQGSLLANKH----LSHMSDYDPGIIFQS  59

Query  275  LWRDRNFTNFNWYYTINYSEENQGNLQANRLQYFDHNPNLFRKVYLSSSLNGLICFCRFS  454
             W  +     N YY ++++   +GN    ++ +   + NL        S NGL+CFC  S
Sbjct  60   HWPSQ-----NQYYFVDFAAYPEGNKILKKISFSTKHANLV------GSCNGLLCFCNAS  108

Query  455  DRSDEIAIHNLSTRQHIPLPSNCHYDGSCKMNAFGLLGFDSGSRRYKVLKSV--------  610
                +I I N  T+  I LP      G   +  F   GF   ++ YK+++ V        
Sbjct  109  ----QIHICNPLTKDSIELPKLLKGPGEVGILGF---GFSPTTKEYKLIEIVYQRKRPGV  161

Query  611  --EFTTGDSVSVKHWVFTVGVDKSWRKIHSSPY  703
                   +    +  + T+G  + WR +   PY
Sbjct  162  WSHVAVSNPFQAEVRILTLGGSR-WRSLGMVPY  193



>gb|KHN41302.1| F-box/kelch-repeat protein [Glycine soja]
Length=223

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 57/208 (27%), Positives = 95/208 (46%), Gaps = 19/208 (9%)
 Frame = +2

Query  92   FLPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYP  271
            FLPQE+++EI+ +LP KSLVRFKCV K + SL+ D  FA  H   +  H  R+  ++L P
Sbjct  13   FLPQELIIEILLRLPVKSLVRFKCVCKLWLSLISDPHFAISHFEQAAIHNERL--VLLAP  70

Query  272  VLWRDRNFTNFNWYYTINYSEENQGNLQANRLQYFDHNPNLFRKVYLSSSLNGLICFCRF  451
                 R F + ++    N S  +     A +L +    P   R   +  S  G +     
Sbjct  71   CA---REFRSIDF----NASLHDNSASAALKLDFLPPKPYYVR---ILGSCRGFVLL---  117

Query  452  SDRSDEIAIHNLSTRQHIPLP-SNCHYDGSCKMNAFGL-LGFDSGSRRYKVLKSVEFTTG  625
             D    + + N ST  H  +P S    D   +   F    G+D  +  Y V+++    + 
Sbjct  118  -DCCQSLHVWNPSTGVHKQVPRSPIVSDMDVRFFTFLYGFGYDPSTHDYLVVQASNNPSS  176

Query  626  DSVSVKHWVFTVGVDKSWRKIHSSPYYH  709
            D  + +   F++  + +W++I    + H
Sbjct  177  DDYATRVEFFSLRAN-AWKEIEVMQWEH  203



>ref|XP_006295463.1| hypothetical protein CARUB_v10024565mg [Capsella rubella]
 gb|EOA28361.1| hypothetical protein CARUB_v10024565mg [Capsella rubella]
Length=394

 Score = 63.5 bits (153),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 58/204 (28%), Positives = 100/204 (49%), Gaps = 15/204 (7%)
 Frame = +2

Query  104  EILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYPVLWR  283
            +I VEI+++LP KSL++F+ VSK + S++   +F     +  ++ PS + ++ L      
Sbjct  26   DITVEILTRLPVKSLMKFQHVSKTWCSIIRSKNFI----SSLVSTPSPLFLISLMTNQTT  81

Query  284  DRNFTNFNWYYTINYSEENQGNLQANRLQYFDHNPNLFRKVYLSSSLNGLICFCRFSDRS  463
              N     + YT +  E+++ +L AN       + + F      +S+NG I        +
Sbjct  82   KENAKKSLFLYT-SLQEKDESSLVANLDMTLTSDADNFS--IKCASVNGFISL----SHN  134

Query  464  DEIAIHNLSTRQHIPLPSNCHYDGSCKMNAFGLLGFDSGSRRYKVLKSVEFTTGDSVSVK  643
               A+ N ST+Q I LP  C   G+   + +  LG+D  + +YK L    FT  D     
Sbjct  135  GRFAVCNSSTKQVILLP-KCETAGTKWGSVYKYLGYDPVNDQYKALCKKMFTKPDE-DED  192

Query  644  HWVFTVGVDK--SWRKIHSSPYYH  709
            H V T+G  K  +WR+I   P+++
Sbjct  193  HIVLTLGAGKTHTWRQIKGPPHHY  216



>emb|CAN70931.1| hypothetical protein VITISV_034638 [Vitis vinifera]
Length=265

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 58/207 (28%), Positives = 96/207 (46%), Gaps = 17/207 (8%)
 Frame = +2

Query  95   LPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPS---RMRILIL  265
            LP EI++EI+S LP KSL+RFKCV K +  ++ D  FA    N +        ++R+++ 
Sbjct  4    LPNEIILEILSLLPVKSLMRFKCVCKSWRLMISDPEFAKKQLNVATKESGKLDKLRLILH  63

Query  266  YPVLWRDRNFTNFNWYYTINYSEENQGNLQANRLQYFDHNPNLFRKVYLSSSLNGLICFC  445
             P L          +Y    YS  +          Y   +  +  ++      NGL+C  
Sbjct  64   SPYLRIKSCSLPSLFYEPFGYSINH---------DYPGRDLGVINEIV--GCYNGLVCIS  112

Query  446  RFSDRSDEIAIHNLSTRQHIPLPSNCHYDGSCKMNAFGLLGFDSGSRRYKVLKSVEFTTG  625
                  D I + N S ++   LPS   ++    + ++   G+DS +  YKV++ V  +  
Sbjct  113  IRDMEKDTIFVWNPSIKESKRLPSK-PFEQLFYLVSYA-FGYDSITDDYKVVRLVCCSIN  170

Query  626  DSVSVKHWVFTVGVDKSWRKIHSSPYY  706
            DS      VF++  + +WRKI S PY+
Sbjct  171  DSYEYHVEVFSLRSN-AWRKIRSFPYF  196



>ref|XP_002531022.1| Transitional endoplasmic reticulum ATPase, putative [Ricinus 
communis]
 gb|EEF31360.1| Transitional endoplasmic reticulum ATPase, putative [Ricinus 
communis]
Length=1029

 Score = 63.9 bits (154),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 69/220 (31%), Positives = 91/220 (41%), Gaps = 36/220 (16%)
 Frame = +2

Query  92   FLPQEILVEIVSKLPAKSLVRFKCV-----SKFFYSLVIDHSFAD--LHRNWSLTHPSRM  250
             LP +I+ +I+S+LP KSL  FKCV     SK + SL+ D  FA+  LHR          
Sbjct  624  LLPHDIITDILSRLPVKSLFWFKCVSKHWLSKHWLSLIGDRGFAEKHLHR----------  673

Query  251  RILILYPVLWRDRNFTNFNWYYTINYSEENQGNLQANRLQYFDHNPNLFRKVYLSSSLNG  430
               +L       R F N     T+  S     N   + L++F+  P     V +  S NG
Sbjct  674  ---VLEDEGIHQRLFAN-----TVVPSSLGLNNDFEDDLEFFNSFPFYGPDVNIVGSCNG  725

Query  431  LICFCRFSDRSDEIAIHNLSTRQHIPLPSNCHYDGSCKMNAFGLLGFDSGSRRYKVLKSV  610
            LIC     D S    + N  T++   LP    Y        F   G+D+ +  YKVLK  
Sbjct  726  LICIAL--DLSTFFVL-NPGTKECRALPDPGSYPDGVAYYGF---GYDASADDYKVLKGH  779

Query  611  EFTTGDSVSVKHWVFTVGV----DKSWRKIH-SSPYYHPY  715
                      +H    V V      SWR I  SSP Y PY
Sbjct  780  TRVVVKEAGYEHHESIVKVFSLRTNSWRTIQDSSPSYLPY  819



>gb|KDO71683.1| hypothetical protein CISIN_1g046204mg [Citrus sinensis]
Length=392

 Score = 63.5 bits (153),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 57/175 (33%), Positives = 89/175 (51%), Gaps = 19/175 (11%)
 Frame = +2

Query  95   LPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYPV  274
            +P +I VE++S+LPAKSL+RFK V K ++SL+ D  FA L    S  + S ++IL     
Sbjct  4    IPYDIAVEVLSRLPAKSLLRFKSVCKQWFSLISDSKFAVLQYKHSAKN-SPLKILT----  58

Query  275  LWRDRNFTNFNWYYTINYSEENQGNLQANRLQYFDHNPNLFRKVYLSSSLNGLICFCRFS  454
               +   + ++   +++ S ++  + +A R   F        K  L  S NGLIC     
Sbjct  59   --SNYYISPYSTLRSLDCSTKSLDDPRALRRLNFPFATQDTSK--LVGSCNGLICLA-LG  113

Query  455  DRSDEIAIHNLSTRQHIPLPSNCH------YDGSCKMNAFGLLGFDSGSRRYKVL  601
             R  +I I N ST  +I LP + H      YD   + N++   G+DS +  YKV+
Sbjct  114  KRCADIFIWNPSTGAYIKLPDHKHLHFKLEYD---RDNSYRGFGYDSSTNDYKVI  165



>gb|KDP21618.1| hypothetical protein JCGZ_03289 [Jatropha curcas]
Length=365

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 62/214 (29%), Positives = 100/214 (47%), Gaps = 25/214 (12%)
 Frame = +2

Query  92   FLPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYP  271
            +LP  I+ EI+S+L  K+L+RFK VSK F +L+   SF +LH        S+  +L L+ 
Sbjct  4    YLPPIIIQEILSRLDVKTLIRFKSVSKSFTNLISSPSFQELH-----NRRSQRNLLFLFR  58

Query  272  VL--WRDRNFTNFNWYYTINYSEENQGNLQANRLQYFDHNPNLFRKVYLSSSLNGLICFC  445
                + D +      +     S +N+G + +  +   D    L     +  S  GL+CF 
Sbjct  59   STSPYYDEHADATRRFVYQFVSVDNRGMVHSKFIARVDDPIKL-----VLPSCCGLVCFA  113

Query  446  RFSDRSDEIAIHNLSTRQHIPLPSNCHYDGSCKMNAFGLLGFDSGSRRYKVLKSVEFTTG  625
                 +  I + N +TRQ  PLP    Y     ++ FG  G+    + YKV++ V     
Sbjct  114  ----TNTRIYLCNPATRQLAPLP-RYPYQQRTPISGFG-FGYAGSVKGYKVVQLVHRVIQ  167

Query  626  DSVS--VKHWVFTVG----VDKSWRKI-HSSPYY  706
             S++  ++  VFT+G    VD  WR +    PY+
Sbjct  168  PSIAHKIECSVFTIGFGGRVDNGWRVLKEGCPYF  201



>gb|AIG62970.1| S-locus F-box protein type-2 [Solanum habrochaites]
Length=393

 Score = 63.5 bits (153),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 50/180 (28%), Positives = 93/180 (52%), Gaps = 11/180 (6%)
 Frame = +2

Query  95   LPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYPV  274
            L ++++++I+ +LP KSL+RFK +SK  Y+L+    F +LHRN        + IL   P+
Sbjct  9    LHEDVVIQILLELPVKSLIRFKSISKILYTLIHSSIFINLHRNRRRNTNDELLIL-KRPI  67

Query  275  LWRDRNFTNFNWYYTINYSEENQGNLQAN-RLQYFDHNPNLFRKVYLSSSLNGLICFCRF  451
               +  + N  ++ + NY+++   ++     + YFD++  +  +  + SS +GLI    +
Sbjct  68   FLDENLYKNIMYFLSSNYNDDTLKHVSPEIDVPYFDNDFCVQFQQLIGSS-HGLIALTDY  126

Query  452  SDRSDEIAIHNLSTRQHIPLPSN---CHYDGSCKMNAFGLLGFDSGSRRYKVLKSVEFTT  622
             D    I   N +TR++  LP +   C  D        G  G+DS  + YKV++  E ++
Sbjct  127  ED----IIFLNPTTRKYRLLPHSPFRCPKDFVFVPRGIG-FGYDSIEKDYKVVRFYELSS  181



>ref|XP_006281449.1| hypothetical protein CARUB_v10027527mg [Capsella rubella]
 gb|EOA14347.1| hypothetical protein CARUB_v10027527mg [Capsella rubella]
Length=407

 Score = 63.5 bits (153),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 58/210 (28%), Positives = 104/210 (50%), Gaps = 23/210 (11%)
 Frame = +2

Query  95   LPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYPV  274
            +P ++L+ I+++LPAKSL+RFKCVSK + SL+    F++ +    LT  S+ R+ I +  
Sbjct  42   IPMDLLIGILTRLPAKSLMRFKCVSKQWSSLIRCRYFSNCY---DLTVASKPRLYIGFVG  98

Query  275  LWRDRNFTNFNWYYTINYSEENQGNLQANRLQYFDHNPNLFRKVYLSSSLNGLICFCRFS  454
               D    +F+   + + S     +L+   L             Y+  +L GLI +   +
Sbjct  99   EAGDSALLSFS---SSSSSSAESFDLETTILGVGGQ--------YMDVTLRGLILYTVCA  147

Query  455  DRSDEIAIHNLSTRQHIPLPSNCH---YDGSCKMNAFGLLGFDSGSRRYKVLKSVEFTTG  625
                +  I+N +TRQ + LP+  H    +   + +    LG D    +YKV+ +V   + 
Sbjct  148  ----KACIYNPTTRQSVTLPAVNHSIFAEEGLRKSIRYFLGHDPVLDQYKVVCTVVVFSK  203

Query  626  D--SVSVKHWVFTVGVDKSWRKIHSSPYYH  709
            D   ++ +HWVF +    SW++I    ++H
Sbjct  204  DFERITSEHWVFVLEAGGSWKRIEFDQHHH  233



>ref|XP_006404833.1| hypothetical protein EUTSA_v10000190mg [Eutrema salsugineum]
 gb|ESQ46286.1| hypothetical protein EUTSA_v10000190mg [Eutrema salsugineum]
Length=401

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 55/211 (26%), Positives = 97/211 (46%), Gaps = 24/211 (11%)
 Frame = +2

Query  95   LPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFAD--LHRNWSLTHPSRMRILILY  268
            +P +++ +I+  LP K+L RF CVSK + S++ +  F    L ++ S THP  +      
Sbjct  27   IPLDLIQDILKGLPVKTLARFLCVSKPWASIIRNRDFVKSYLTKSSSSTHPQSLIFTF--  84

Query  269  PVLWRDRNFTNFNWYYTINYSEENQGNLQANRLQYFDHNPNLFRKVYLSSSLNGLICFCR  448
                          YY  + S+   G+       +   +   +  +  S S++GLIC+  
Sbjct  85   -------KSKRQGEYYFFSSSQPQNGDESCVASYHMKCHSQPYTAI--SPSVHGLICYGP  135

Query  449  FSDRSDEIAIHNLSTRQHIPLPSNCHYDGSCKMNAFGLLGFDSGSRRYKVL---KSVEFT  619
             S    ++ ++N STR+ I LP       S ++  +  LG+D     YK+L   +++   
Sbjct  136  PS----KLMVYNPSTRRSIALPKI----DSHRIRMYHFLGYDPIDGDYKMLCMSRAMHVR  187

Query  620  TGDSVSVKHWVFTVGVDKSWRKIHSSPYYHP  712
             G  ++ K  V T+G   SWR I + P + P
Sbjct  188  RGRGLAQKIQVLTLGNGNSWRMIENCPPHSP  218



>sp|Q9SSQ2.1|FB55_ARATH RecName: Full=F-box protein At1g52490 [Arabidopsis thaliana]
 gb|AAD55615.1|AC008016_25 F6D8.29 [Arabidopsis thaliana]
Length=423

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 67/209 (32%), Positives = 97/209 (46%), Gaps = 22/209 (11%)
 Frame = +2

Query  95   LPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVID--HSFADLHRNWSLTHPS-RMRILIL  265
            LP +++VEI+ KLP KSL+RF+CVSK  +S +I     F +     SL  P  ++ + I 
Sbjct  55   LPLDLIVEILKKLPTKSLMRFRCVSK-PWSFIISKRRDFVESIMARSLRQPPHKLPVFIF  113

Query  266  YPVLWRDRNFTNFNWYYTINYSEENQGNLQANRLQYFDHNPNLFRKVYLSSSLNGLICFC  445
            +    +    T F    T + S + + ++   R  Y     N FR  Y    + G IC C
Sbjct  114  H----QCDPGTFFTVSSTFSQSTKPKVSIMPGRNHY-----NAFRYQY----VRGFIC-C  159

Query  446  RFSDRSDEIAIHNLSTRQHIPLPSNCHYDGSCKMNAFGLLGFDSGSRRYKVLKSVEFTTG  625
              S   D + I+N +TRQ +PLP       S K +     G+D     YKVL  V     
Sbjct  160  S-SSVYDLVTIYNPTTRQCLPLPKIESMVLSPKRHKHCYFGYDHVMNEYKVLAMV--NDS  216

Query  626  DSVSVKHWVFTVGVD-KSWRKIHSSPYYH  709
              ++    VFT+G D   WRKI  +  Y 
Sbjct  217  QELTQTFHVFTLGRDCPQWRKIRGNIDYE  245



>ref|XP_006404713.1| hypothetical protein EUTSA_v10000505mg, partial [Eutrema salsugineum]
 gb|ESQ46166.1| hypothetical protein EUTSA_v10000505mg, partial [Eutrema salsugineum]
Length=390

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 61/207 (29%), Positives = 90/207 (43%), Gaps = 21/207 (10%)
 Frame = +2

Query  92   FLPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYP  271
             LP ++++EI  +LP K+L RF C+SK + S +    F  L+   S +  +R R   L  
Sbjct  27   LLPIDLVIEIFIRLPVKTLARFLCLSKIWKSTIRSRYFKKLYIAESSSSSNRHRPRSLIF  86

Query  272  VLWRDRNFTNFNWYYTINYSEENQGNLQANRLQYFDHNPNLFRKVYLSSSLNGLICFCRF  451
             L RD        +Y   +S     N       +  H  N F     SSS++G IC+   
Sbjct  87   SLRRD----GHECFY---FSSLQTKNPSGEATYHLSHPTNKF--TINSSSIHGFICY---  134

Query  452  SDRSDEIAIHNLSTRQHIPLPSNCHYDGSCKMNAFGLLGFDSGSRRYKVLKSVEFTTGDS  631
               + +  ++N   R+ I LP       S K      LG+D     YK+L     TTG  
Sbjct  135  -GTASKARLYNTIKRRSIALP----MVDSKKKLLHQFLGYDPIDGVYKLLC---MTTGKK  186

Query  632  VSVKH-WVFTVGVDKSWRKIHSSPYYH  709
               K   V T+G + SWRKI +  + H
Sbjct  187  AVAKEIQVLTLGKETSWRKIETCAFVH  213



>ref|XP_010326063.1| PREDICTED: putative F-box protein At3g16210 isoform X2 [Solanum 
lycopersicum]
Length=459

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 59/211 (28%), Positives = 106/211 (50%), Gaps = 22/211 (10%)
 Frame = +2

Query  104  EILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYPVLWR  283
            EI+++I+ +LP +S++RFKCVSKF+ SL+ D  F   H   +  + +  +ILI   ++ +
Sbjct  94   EIMMDILRRLPMRSILRFKCVSKFWKSLIDDTYFKRTHYIHNRDNQNSKKILIAERLVNK  153

Query  284  DRNFTNFNWYYTINYS--EENQGNLQANRLQYFDHNPNLFRKVYLSSSLNGLICFCRFSD  457
            D  F+    +YT + S  E+ Q      +L +      +  +++   S +GL+   R   
Sbjct  154  DETFS----FYTSSLSMVEDKQ------KLDWPTSCNPVDARIF--CSCDGLV-LTRVCS  200

Query  458  R--SDEIAIHNLSTRQHIPLPSNCHYDGSCKMNAFGLLGFDSGSRRYKVLKSVEFTTGDS  631
            +   +E+ + N STR+ I LP   H +       FG L +D+ S  YK+L +V+     S
Sbjct  201  KMFDEELLLWNPSTRESILLP---HPEYRIMTYVFG-LEYDATSEGYKIL-AVKLNGKKS  255

Query  632  VSVKHWVFTVGVDKSWRKIHSSPYYHPYNGF  724
            +++     ++  + SWR+I          GF
Sbjct  256  INISIEFLSIKRNSSWRRIDYPTDIQRVRGF  286



>ref|XP_010326064.1| PREDICTED: putative F-box protein At3g16210 isoform X3 [Solanum 
lycopersicum]
Length=447

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 59/211 (28%), Positives = 106/211 (50%), Gaps = 22/211 (10%)
 Frame = +2

Query  104  EILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYPVLWR  283
            EI+++I+ +LP +S++RFKCVSKF+ SL+ D  F   H   +  + +  +ILI   ++ +
Sbjct  82   EIMMDILRRLPMRSILRFKCVSKFWKSLIDDTYFKRTHYIHNRDNQNSKKILIAERLVNK  141

Query  284  DRNFTNFNWYYTINYS--EENQGNLQANRLQYFDHNPNLFRKVYLSSSLNGLICFCRFSD  457
            D  F+    +YT + S  E+ Q      +L +      +  +++   S +GL+   R   
Sbjct  142  DETFS----FYTSSLSMVEDKQ------KLDWPTSCNPVDARIF--CSCDGLV-LTRVCS  188

Query  458  R--SDEIAIHNLSTRQHIPLPSNCHYDGSCKMNAFGLLGFDSGSRRYKVLKSVEFTTGDS  631
            +   +E+ + N STR+ I LP   H +       FG L +D+ S  YK+L +V+     S
Sbjct  189  KMFDEELLLWNPSTRESILLP---HPEYRIMTYVFG-LEYDATSEGYKIL-AVKLNGKKS  243

Query  632  VSVKHWVFTVGVDKSWRKIHSSPYYHPYNGF  724
            +++     ++  + SWR+I          GF
Sbjct  244  INISIEFLSIKRNSSWRRIDYPTDIQRVRGF  274



>ref|XP_002453434.1| hypothetical protein SORBIDRAFT_04g005990 [Sorghum bicolor]
 gb|EES06410.1| hypothetical protein SORBIDRAFT_04g005990 [Sorghum bicolor]
Length=400

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 64/221 (29%), Positives = 104/221 (47%), Gaps = 25/221 (11%)
 Frame = +2

Query  95   LPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYPV  274
            L +EI++EI+ +LP KSL+RF+ V K + +++ +  F   H   S +   +    I+ P 
Sbjct  18   LMEEIIMEILLRLPVKSLLRFRSVCKAWRAMINNPMFIRDHLRHSASKWEQSPCFIVSPH  77

Query  275  LWRDRNFTNFNWYYTI-NYSEENQGNLQANR--LQYFDHN--PNLFRKVYLSSSLNGLIC  439
               DR   +  W  T  N+    Q  LQ N     + D    P  F+++      +GL+ 
Sbjct  78   TL-DRIIPDELWPTTFSNHFPFYQWQLQPNNNVATFLDSKDFPGQFKRLRHFMHCDGLV-  135

Query  440  FCRFSDRSDEIAIHNLSTRQHIPLPSN------CHYDGSCKMNAFGLLGFDSGSRRYKVL  601
               F+     + + N +TR+ I LP++          GSC    FGL   D  + +YKV+
Sbjct  136  ---FAPTDSSLYLFNPATREAITLPNSRRNNLRAGGRGSCYCAGFGL---DPRTGKYKVV  189

Query  602  ----KSVEFTTGDSVSVKHWVFTVGVDK--SWRKIHSSPYY  706
                +S++  TG    +   VFTV  D   +WR+I S+P Y
Sbjct  190  QAFYRSLDPDTGMGTDMGMEVFTVAGDDGGAWREITSNPPY  230



>ref|XP_011045685.1| PREDICTED: F-box/kelch-repeat protein At3g06240-like [Populus 
euphratica]
Length=330

 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 59/211 (28%), Positives = 102/211 (48%), Gaps = 40/211 (19%)
 Frame = +2

Query  95   LPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLH----RNWSLTHPSRMRILI  262
            LPQ+I+V+I++ LP KSL+RFKCV K ++SL+ D  F   H    R  +     R+ +  
Sbjct  4    LPQDIMVDILTYLPVKSLLRFKCVCKLWHSLISDPKFVKSHLKIAREVNSNKCQRLLLST  63

Query  263  LYPVLWRDRNFTNFNWYYTINYSEENQGNLQANRLQYFDHNPNLFRK-----VYLSSSLN  427
              P               ++++   ++G+ + N +Q  ++ P++ R      + +  S +
Sbjct  64   RTP--------------QSVDFEAASEGD-EDNAVQELEY-PDVIRCSPTYFIGIMGSCD  107

Query  428  GLICFCRFSDRSDEIAIHNLSTR--QHIPLPSNCHYDGSCKMNAFGLLGFDSGSRRYK-V  598
            GLIC   F D + ++ + N STR  + +P PS  H       + F  +G+DS +  YK V
Sbjct  108  GLICL--FVDYA-KLVLWNPSTRDYKELPKPSCDH-----GFDFFAGIGYDSSNDDYKFV  159

Query  599  LKSVEFTTG-DSVSVKHWVFTVGVDKSWRKI  688
            + S     G + + V+       V   WRK+
Sbjct  160  IPSCTTADGSEQIMVEVLALKTNV---WRKV  187



>ref|XP_002869958.1| hypothetical protein ARALYDRAFT_914664 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46217.1| hypothetical protein ARALYDRAFT_914664 [Arabidopsis lyrata subsp. 
lyrata]
Length=428

 Score = 63.2 bits (152),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 62/210 (30%), Positives = 100/210 (48%), Gaps = 26/210 (12%)
 Frame = +2

Query  95   LPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYPV  274
            +P ++++EI+++LPAKSL+RFK VSK +  L+   +F +L +  S + P       LY  
Sbjct  43   IPFDLVIEILTRLPAKSLMRFKSVSKLWSLLICSRTFTNLFQKVSSSPPR------LY--  94

Query  275  LWRDRNFTNFNWYYTINYSEENQGNLQANRLQYFDHNPNLFRKVYLSSSLNGLICFCRFS  454
            +W D +  N     + +  + +  +   +  Q     PN  +  YLS    GL+CF   S
Sbjct  95   MWLDVDNRNVLLSTSSSPDDSDVSSFVID--QELTIPPN--KGYYLSHVFGGLMCFVNES  150

Query  455  DRSDEIAIHNLSTRQHIPLP----SNCHYDGSCKMNAFGLLGFDSGSRRYKVLKSVEFTT  622
                   I+N +TRQ + LP    SN   +          +G D    +YKV+  V   +
Sbjct  151  ----RAKIYNTTTRQLVVLPDIEESNMIAEDHKYKKIMYHIGHDPVHDQYKVVCIVSRPS  206

Query  623  GD----SVSVKHWVFTVGVDKS--WRKIHS  694
             +    S   +HW+  +G D+S  WRKI S
Sbjct  207  DEYGEHSYLSEHWILLLGGDRSNRWRKIPS  236



>ref|XP_010546887.1| PREDICTED: F-box/kelch-repeat protein At3g06240-like [Tarenaya 
hassleriana]
Length=392

 Score = 63.2 bits (152),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 62/205 (30%), Positives = 102/205 (50%), Gaps = 25/205 (12%)
 Frame = +2

Query  104  EILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPS----RMRILILYP  271
            EI+ EI+ +LPAKS+ RF+CVSK F SL  D +FA  H + SL + +    R R+++ Y 
Sbjct  28   EIIREILLRLPAKSIGRFRCVSKLFRSLSSDPAFAKTHLDLSLRNDAFPSGRTRLVVNYR  87

Query  272  ----VLWRDRNFTNFNWYYTINYSEENQGNLQANRLQYFDHNPNLFRKVYLSSSLNGLIC  439
                 +  D      +    +   E  Q  + +N +  +D + +L+ +V    S NGL+C
Sbjct  88   HNFYTVGFDSIVDACDGIRDLGAVEIPQSPVMSNLVSSYDQD-DLWIEVV--GSWNGLVC  144

Query  440  FCRFSDRSDEIAIHNLSTRQHIPLPSNCHYDGS----CKMNAFGLLGFDSGSRRYKVLKS  607
                 +   ++ + NL+T +   +PS      S     K+N FG  GFD+ +  YK    
Sbjct  145  TI---NEEADVFLFNLTTGESKRIPSVLELLNSGSKRGKINRFG-FGFDAITDDYKF---  197

Query  608  VEFTTGDSVSVKHWVFTVGVDKSWR  682
            V   TGD ++    V+++  D SW+
Sbjct  198  VALVTGDVLNAS--VYSLKTD-SWK  219



>ref|XP_004246756.1| PREDICTED: putative F-box protein At3g16210 isoform X9 [Solanum 
lycopersicum]
Length=396

 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 61/211 (29%), Positives = 104/211 (49%), Gaps = 20/211 (9%)
 Frame = +2

Query  101  QEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYPVLW  280
             EI+++I+ +LP +S++RFKCVSKF+ SL+ D  F   H   +  + +  +ILI   ++ 
Sbjct  30   DEIMMDILRRLPMRSILRFKCVSKFWKSLIDDTYFKRTHYIHNRDNQNSKKILIAERLVN  89

Query  281  RDRNFTNFNWYYTINYSE-ENQGNLQANRLQYFDHNPNLFRKVYLSSSLNGLICFCRFSD  457
            +D  F+    +YT + S  E++  L          NP   R   +  S +GL+   R   
Sbjct  90   KDETFS----FYTSSLSMVEDKQKLDWPT----SCNPVDAR---IFCSCDGLV-LTRVCS  137

Query  458  R--SDEIAIHNLSTRQHIPLPSNCHYDGSCKMNAFGLLGFDSGSRRYKVLKSVEFTTGDS  631
            +   +E+ + N STR+ I LP   H +       FG L +D+ S  YK+L +V+     S
Sbjct  138  KMFDEELLLWNPSTRESILLP---HPEYRIMTYVFG-LEYDATSEGYKIL-AVKLNGKKS  192

Query  632  VSVKHWVFTVGVDKSWRKIHSSPYYHPYNGF  724
            +++     ++  + SWR+I          GF
Sbjct  193  INISIEFLSIKRNSSWRRIDYPTDIQRVRGF  223



>ref|XP_010665455.1| PREDICTED: F-box/kelch-repeat protein At3g23880-like [Vitis vinifera]
Length=315

 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 58/213 (27%), Positives = 96/213 (45%), Gaps = 29/213 (14%)
 Frame = +2

Query  95   LPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRI--LILY  268
            LP EI++EI+S LP KSL+RFKCV K +  ++ D  FA    N +     ++    LIL+
Sbjct  26   LPNEIILEILSLLPVKSLMRFKCVCKSWRLMISDPEFAKKQLNVATKESGKLDKLRLILH  85

Query  269  PVLWRDRN-------FTNFNWYYTINYSEENQGNLQANRLQYFDHNPNLFRKVYLSSSLN  427
                R ++       +  F +    +Y   + G +                   +    N
Sbjct  86   SPYLRIKSCSLPSLFYEPFGYSINHDYPGRDLGVINE-----------------IVGCYN  128

Query  428  GLICFCRFSDRSDEIAIHNLSTRQHIPLPSNCHYDGSCKMNAFGLLGFDSGSRRYKVLKS  607
            GL+C        D I + N S ++   LPS   ++    + ++   G+DS +  YKV++ 
Sbjct  129  GLVCISIRDMEKDTIFVWNPSIKESKRLPSK-PFEQLFYLVSYA-FGYDSITDDYKVVRL  186

Query  608  VEFTTGDSVSVKHWVFTVGVDKSWRKIHSSPYY  706
            V  +  DS      VF++  + +WRKI S PY+
Sbjct  187  VCCSINDSYEYHVEVFSLRSN-AWRKIRSFPYF  218



>ref|XP_002440131.1| hypothetical protein SORBIDRAFT_09g026600 [Sorghum bicolor]
 gb|EES18561.1| hypothetical protein SORBIDRAFT_09g026600 [Sorghum bicolor]
Length=429

 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 69/226 (31%), Positives = 112/226 (50%), Gaps = 29/226 (13%)
 Frame = +2

Query  95   LPQEILVE-IVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYP  271
            L +EI+VE I+ +LP KSLVRFK V K + + + D  F   H   S T   +   +I+ P
Sbjct  24   LSEEIIVEEILVRLPVKSLVRFKSVCKAWRATISDPIFIRAHLRHSATKQEQDPCVIISP  83

Query  272  VLW--------RDRNFTNFNWYYTINYSEENQGNLQANRLQYFDHNPNLFRKVYLSSSLN  427
            ++         R   F+N   +Y  ++ + N G+  +++ Q   H   ++ K   S  + 
Sbjct  84   LIMDNVIPGESRPSTFSNQFRFYQWHHLQANGGSTPSSK-QTATH---IYTKDLGSGEVI  139

Query  428  GLICFCRFSD-----RSD-EIAIHNLSTRQHIPLPSNCHYD-GSCKMNAFGLLGFDSGSR  586
              + +  F D     R+D ++ + N +TR  + LP N     G    N+ G LG D  S 
Sbjct  140  RQMGYFAFCDGLVLVRTDTKLYLLNPATRDSLTLPDNKRNKLGREFCNSAG-LGLDPRSG  198

Query  587  RYKVL----KSVEFTTGDSVSVKHWVFTVGVD--KSWRKI-HSSPY  703
            +YKV+    +S++ TT ++  +   VFTVG    ++WRKI H  PY
Sbjct  199  KYKVVRAFYRSLDITT-NAYGMGMEVFTVGAGRRRAWRKIAHDVPY  243



>ref|XP_004304895.1| PREDICTED: F-box/kelch-repeat protein At3g17530-like [Fragaria 
vesca subsp. vesca]
Length=387

 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 56/211 (27%), Positives = 105/211 (50%), Gaps = 30/211 (14%)
 Frame = +2

Query  95   LPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYPV  274
            + +EIL++I+S+ P KSL+RFKC+ K +YS++ D  FA  H +      S    L+  PV
Sbjct  7    MTEEILMQILSRTPPKSLMRFKCIHKSWYSMINDTQFAAKHLHSYNNPSSSTSFLVKRPV  66

Query  275  LWRDRNFTNFNWYYTINYSEENQGNLQANRLQYF----DHNPNLFRKVYLSSSLNGLICF  442
            + R               S EN   L   RL+ +    D +P+   +  +   L GL   
Sbjct  67   ILRSET------------SNENV-VLSYLRLETYSNADDEDPHFVVEDLIVPPLKGLKAK  113

Query  443  CRFSDR-------SDEIAIHNLSTRQHIPLPSNCHYDGSCKMNAFGLLGFDSGSRRYKVL  601
             +F D        + ++ ++N + ++   +P++C++  +C  +  G  G+D   + Y +L
Sbjct  114  GQFIDGIIFLTMYAGDLFLYNPAIKEFKIIPASCYH--ACFWSMVG-FGYDLKCKDYIIL  170

Query  602  KSVEFTTGDSVSVKHWVFTVGVDKSWRKIHS  694
            + +    G++   K  ++T+G D SWR+I++
Sbjct  171  E-IANCYGENAP-KAAIYTLGTD-SWREINT  198



>gb|KDP32919.1| hypothetical protein JCGZ_13700 [Jatropha curcas]
Length=413

 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 59/213 (28%), Positives = 107/213 (50%), Gaps = 26/213 (12%)
 Frame = +2

Query  95   LPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYPV  274
            +P +++ +I+ +LP KSL+RF+C+SK   SL+    F  LH + SL   S + +++    
Sbjct  4    IPHDVINDILLQLPVKSLLRFRCLSKPLCSLIDGPDFIHLHLSHSLQTRSNLSLIL----  59

Query  275  LWRDRNFTNFNWYYTINYSEENQGNLQANRLQYFDHNPNLFRKVYLSSSLNGLICFCRFS  454
              RD N  +F++      S +  G++ +  ++   H  ++        S NGL+   R S
Sbjct  60   --RDWNLYSFDF-----DSLDVPGSVPS--VETLVHPLHIGGGTEAVGSCNGLVAL-RNS  109

Query  455  DRSDEIAIHNLSTRQHIPLPSN----CHYDGSCKMNAFGLLGFDSGSRRYKVLKSVEFT-  619
            +R  ++A +NLSTR+   LP +     H         +G  G+DS +  YK+++   F+ 
Sbjct  110  ER--DVAFYNLSTRKCKRLPVSEIKPPHRALKTGYVFYG-FGYDSSNEDYKLIRMATFSG  166

Query  620  TGDSVSVKHWVFTVGV----DKSWRKIHSSPYY  706
              D   V  + + V +    + SW++I+  PYY
Sbjct  167  DDDGCEVFDYDYEVKIYSLKNDSWKRINDLPYY  199



>ref|XP_008384140.1| PREDICTED: F-box protein CPR30 [Malus domestica]
 ref|XP_008384141.1| PREDICTED: F-box protein CPR30 [Malus domestica]
 ref|XP_008384142.1| PREDICTED: F-box protein CPR30 [Malus domestica]
 ref|XP_008384143.1| PREDICTED: F-box protein CPR30 [Malus domestica]
 ref|XP_008384144.1| PREDICTED: F-box protein CPR30 [Malus domestica]
Length=409

 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 55/210 (26%), Positives = 102/210 (49%), Gaps = 28/210 (13%)
 Frame = +2

Query  95   LPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYPV  274
            LP E++V+I+S+LP   L+RF+ ++K + SL+    F  LH   S    S + +     +
Sbjct  24   LPPEVIVDILSRLPVARLLRFRSIAKPWRSLIDSSYFVHLHLTQSAESKSHLSL-----I  78

Query  275  LWRDRNFTNFNWYYTINYSEENQGNLQANRLQYFDHNPNLFRKVYLSSSLNGLICFCRFS  454
            L RD +       Y I++   N      + L  + +      ++ +  S NGL+C C   
Sbjct  79   LKRDSDL------YCISFDSLNDAVELNHPLMCYSN------RIRVLGSCNGLLCLCNV-  125

Query  455  DRSDEIAIHNLSTRQH--IP-LPSNCHYDGS---CKMNAFGLLGFDSGSRRYKVLKSVEF  616
              +++IA+ N ST+++  +P LPS+   D +   C    +G LG+ +    YK+++  +F
Sbjct  126  --AEDIALWNPSTKKYRILPSLPSDRKRDSNMCLCGARVYG-LGYXAIQDDYKLVRISQF  182

Query  617  TTGDSVSVKHWVFTVGV-DKSWRKIHSSPY  703
               D +S    V    + +  W+++   PY
Sbjct  183  IGLDHLSFHSEVRVYSLRNNEWKRVEDMPY  212



>ref|XP_010456489.1| PREDICTED: F-box/kelch-repeat protein At3g04660-like [Camelina 
sativa]
Length=399

 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 64/201 (32%), Positives = 95/201 (47%), Gaps = 35/201 (17%)
 Frame = +2

Query  95   LPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYPV  274
            LP++++ +I+ KLPAKS+ +   VSK + S++   SF DL+   SLT P     LI +  
Sbjct  22   LPRDLIEKILLKLPAKSVPKLIVVSKLWSSIIRSKSFIDLYLKRSLTRPC---FLITF--  76

Query  275  LWRDRNFTNFNWYYTI-NYSEENQGNLQANRLQYFDHNPNLFRKVYLSSSLN------GL  433
                 N  +  ++++I   S E      +          +L RK   S S N      GL
Sbjct  77   -----NRDDIRFFHSIYQQSLEAASPSSSYTSTISSFPLSLDRKRLFSQSYNVSPPVRGL  131

Query  434  ICFCRFSDRSDEIAIHNLSTRQHIPLPSNCHYDGSCKMNAFGL---LGFDSGSRRYKVL-  601
            ICF       D++ + NLST Q + LP         K+   G+   LG+D     YKVL 
Sbjct  132  ICFQDL----DKVVVSNLSTGQFLVLP---------KVRKLGISWFLGYDPVGDEYKVLC  178

Query  602  KSVEF-TTGDSVSVKHWVFTV  661
             +V F  +G  VS +H VFT+
Sbjct  179  TTVVFQVSGAVVSEEHQVFTL  199



>gb|EAZ44931.1| hypothetical protein OsJ_29572 [Oryza sativa Japonica Group]
 dbj|BAG91874.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG92064.1| unnamed protein product [Oryza sativa Japonica Group]
Length=380

 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 55/208 (26%), Positives = 94/208 (45%), Gaps = 20/208 (10%)
 Frame = +2

Query  92   FLPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYP  271
            ++P +++  I+S LP+KSL+RFK V K +++++    F D H   S  +PS    +++ P
Sbjct  15   YIPDDVMFNILSWLPSKSLIRFKSVCKAWHAMISSPCFTDAHLECSKRNPS----ILMVP  70

Query  272  VLWRDRNFTNFNWYYTINYSEENQGNLQANRLQYFDHNPNLFRKVYLSSSLNGLICFCRF  451
              +  +       +  + Y       ++   +Q F     ++ +       NGL+     
Sbjct  71   GAYEKQEDGENIAFMMVLYKYHGGKTMELVHMQNFPLGIGVWTR---PVHCNGLL---LI  124

Query  452  SDRSDEIAIHNLSTRQHIPLPSNCHYDGSCKMNAFGLLGFDSGSRRYKVLKSVEFTTGDS  631
               + E+ I N STRQ + LP      G+         GFD  S +YKV +S  F   DS
Sbjct  125  PTMNLEMMICNPSTRQIVFLPK---VSGNICTGTRAGFGFDPHSNKYKVARS--FYQRDS  179

Query  632  ----VSVKHWVFTVGVDKSWRKIHSSPY  703
                +  K  V T+G + +WR+    PY
Sbjct  180  ETQELVCKFEVLTLGTN-AWRQTEDPPY  206



>ref|XP_009352591.1| PREDICTED: F-box protein CPR30 [Pyrus x bretschneideri]
 ref|XP_009352664.1| PREDICTED: F-box protein CPR30 [Pyrus x bretschneideri]
 ref|XP_009352731.1| PREDICTED: F-box protein CPR30 [Pyrus x bretschneideri]
 ref|XP_009352807.1| PREDICTED: F-box protein CPR30 [Pyrus x bretschneideri]
 ref|XP_009352882.1| PREDICTED: F-box protein CPR30 [Pyrus x bretschneideri]
Length=409

 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 56/215 (26%), Positives = 105/215 (49%), Gaps = 28/215 (13%)
 Frame = +2

Query  95   LPQEILVEIVSKLPAKSLVRFKCVSKFFYSLVIDHSFADLHRNWSLTHPSRMRILILYPV  274
            LP E++V+I+S+LP   L+RF+ ++K + SL+    F DLH   S    S + +     +
Sbjct  24   LPPEVIVDILSRLPVCLLLRFRSIAKPWRSLIDSSYFVDLHLTQSAESKSHLCL-----I  78

Query  275  LWRDRNFTNFNWYYTINYSEENQGNLQANRLQYFDHNPNLFRKVYLSSSLNGLICFCRFS  454
            L +D +       Y I++   +      + L  + +      ++ +  S NGL+C C   
Sbjct  79   LRKDSDL------YCISFDSLDDAVELNHPLMCYSN------RIRVLGSCNGLLCICNV-  125

Query  455  DRSDEIAIHNLSTRQH--IP-LPSNCHYDGS---CKMNAFGLLGFDSGSRRYKVLKSVEF  616
              +++IA  N ST+++  +P LPS+   D +   C    +G LG+D+    YK+++  +F
Sbjct  126  --AEDIAFWNPSTKKYRILPSLPSDRKRDSNMCLCGARVYG-LGYDAVHDDYKLVRISQF  182

Query  617  TTGDSVSVKHWVFTVGV-DKSWRKIHSSPYYHPYN  718
               D +S    V    + + +W+++   PY   Y 
Sbjct  183  IGLDYLSFVSEVRVYSLRNNAWKRLEDMPYVLCYT  217



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1284566944336