BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c24279_g6_i1 len=607 path=[9679:0-360 10040:361-384 10040:385-408
10064:409-606]

Length=607
                                                                      Score     E

ref|XP_009624516.1|  PREDICTED: myb-related protein Myb4-like         57.0    1e-06   
ref|XP_009800612.1|  PREDICTED: myb-related protein Myb4-like         56.2    2e-06   



>ref|XP_009624516.1| PREDICTED: myb-related protein Myb4-like [Nicotiana tomentosiformis]
Length=248

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 32/61 (52%), Positives = 40/61 (66%), Gaps = 1/61 (2%)
 Frame = +1

Query  67   DDQTVQGEFGHMECDESFWSEPFIMDN-FWSNNELVVPSIDFGLLSPPSPFRDYDFLGSF  243
            D Q  Q E   ME   SFW+EPF++D+ F S  + VVPSID  L+ PPSPF  ++FL SF
Sbjct  182  DYQVFQEEAILMENSGSFWTEPFLVDSSFSSRTDYVVPSIDCELVCPPSPFIGHEFLSSF  241

Query  244  D  246
            D
Sbjct  242  D  242



>ref|XP_009800612.1| PREDICTED: myb-related protein Myb4-like [Nicotiana sylvestris]
Length=242

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 42/62 (68%), Gaps = 2/62 (3%)
 Frame = +1

Query  67   DDQTVQGEFGHMECDESFWSEPFIMDNFWSNN--ELVVPSIDFGLLSPPSPFRDYDFLGS  240
            D Q +Q E   ME   SFW+EPF++D  +S+   + VVPSID+ L+ PPSPF  ++FL S
Sbjct  175  DYQVIQEEGILMENSGSFWTEPFLVDTSFSSRSTDYVVPSIDWELVCPPSPFIGHEFLSS  234

Query  241  FD  246
            FD
Sbjct  235  FD  236



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 767563575474