BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c24279_g1_i1 len=740 path=[10617:0-376 10994:377-403 12835:404-739]

Length=740
                                                                      Score     E

emb|CDP11876.1|  unnamed protein product                                225   5e-69   
ref|XP_007043431.1|  Myb domain protein 15, putative                    224   2e-68   
ref|XP_011048479.1|  PREDICTED: myb-related protein Myb4-like           221   1e-67   
ref|XP_009353213.1|  PREDICTED: myb-related protein Myb4-like           219   6e-67   
ref|XP_002319935.1|  hypothetical protein POPTR_0013s14560g             219   8e-67   Populus trichocarpa [western balsam poplar]
gb|KDO55822.1|  hypothetical protein CISIN_1g024860mg                   219   1e-66   
ref|NP_001280912.1|  myb-related protein Myb4-like                      217   5e-66   
ref|XP_006447415.1|  hypothetical protein CICLE_v10016303mg             217   5e-66   
gb|ABH02922.1|  MYB transcription factor MYB122                         212   2e-65   Glycine max [soybeans]
ref|XP_008341938.1|  PREDICTED: myb-related protein Myb4-like           215   2e-65   
ref|XP_008230195.1|  PREDICTED: myb-related protein Myb4-like           216   2e-65   
gb|KHN22879.1|  Myb-related protein Myb4                                217   3e-65   
ref|XP_007216710.1|  hypothetical protein PRUPE_ppa026553mg             216   3e-65   
ref|XP_010095861.1|  Myb-related protein Myb4                           216   3e-65   
ref|XP_003540870.1|  PREDICTED: myb-related protein Myb4 isoform X1     216   4e-65   
ref|XP_009350432.1|  PREDICTED: myb-related protein Myb4-like           214   7e-65   
ref|XP_003526304.1|  PREDICTED: myb-related protein Myb4-like           215   2e-64   
ref|XP_009624516.1|  PREDICTED: myb-related protein Myb4-like           211   5e-64   
ref|XP_002272704.1|  PREDICTED: myb-related protein Myb4                211   6e-64   Vitis vinifera
ref|XP_004513559.1|  PREDICTED: myb-related protein Myb4-like iso...    212   6e-64   
emb|CAN72480.1|  hypothetical protein VITISV_019320                     212   7e-64   Vitis vinifera
ref|XP_009779987.1|  PREDICTED: myb-related protein Myb4-like           211   8e-64   
ref|XP_004513558.1|  PREDICTED: myb-related protein Myb4-like iso...    213   1e-63   
ref|XP_009594011.1|  PREDICTED: myb-related protein Myb4-like           210   2e-63   
ref|XP_004243413.1|  PREDICTED: myb-related protein Myb4-like           210   2e-63   
ref|XP_004243822.1|  PREDICTED: transcription factor WER-like           210   2e-63   
ref|XP_011047495.1|  PREDICTED: myb-related protein Myb4-like           208   8e-63   
ref|XP_002325681.1|  hypothetical protein POPTR_0019s14140g             208   9e-63   Populus trichocarpa [western balsam poplar]
ref|XP_006360585.1|  PREDICTED: myb-related protein Myb4-like           208   9e-63   
ref|XP_009800612.1|  PREDICTED: myb-related protein Myb4-like           207   1e-62   
ref|XP_003526305.2|  PREDICTED: myb-related protein Myb4-like           206   4e-62   
gb|KHN41179.1|  Myb-related protein Myb4                                206   4e-62   
ref|XP_007132611.1|  hypothetical protein PHAVU_011G109600g             209   4e-62   
gb|KHN41177.1|  Myb-related protein Myb4                                208   5e-62   
ref|XP_003526303.1|  PREDICTED: myb-related protein Myb4                208   6e-62   
gb|KEH17561.1|  myb-related transcription factor                        206   2e-61   
ref|XP_006360526.1|  PREDICTED: myb-related protein Myb4-like           204   2e-61   
ref|XP_003541925.1|  PREDICTED: myb-related protein Myb4-like           204   2e-61   
ref|XP_007132612.1|  hypothetical protein PHAVU_011G109700g             205   1e-60   
gb|KEH16274.1|  myb-related transcription factor                        203   1e-60   
gb|AFK38645.1|  unknown                                                 203   2e-60   
ref|XP_003597081.1|  MYB transcription factor                           202   2e-60   
gb|KDP44603.1|  hypothetical protein JCGZ_19745                         202   2e-60   
gb|KEH17564.1|  myb-related transcription factor                        203   3e-60   
ref|XP_007149916.1|  hypothetical protein PHAVU_005G109800g             199   1e-59   
gb|KHN04301.1|  Myb-related protein Zm1                                 202   2e-59   
ref|XP_003540332.2|  PREDICTED: myb-related protein Myb4-like           202   2e-59   
ref|XP_010051469.1|  PREDICTED: myb-related protein Myb4-like           199   3e-59   
ref|XP_004293474.1|  PREDICTED: transcription factor MYB28-like         200   3e-59   
ref|XP_007149915.1|  hypothetical protein PHAVU_005G109700g             201   6e-59   
ref|XP_007132610.1|  hypothetical protein PHAVU_011G109500g             197   8e-59   
ref|XP_004252033.1|  PREDICTED: myb-related protein Myb4-like           196   2e-58   
ref|XP_010069815.1|  PREDICTED: myb-related protein Myb4-like           196   2e-58   
ref|XP_010277889.1|  PREDICTED: myb-related protein Myb4-like           196   1e-57   
ref|XP_002276962.1|  PREDICTED: transcription factor MYB114             191   4e-56   Vitis vinifera
gb|KHN04302.1|  Myb-related protein Myb4                                191   6e-56   
ref|XP_003539518.1|  PREDICTED: myb-related protein Myb4-like           191   7e-56   
ref|XP_006593053.1|  PREDICTED: myb-related protein Myb4-like           191   2e-55   
ref|XP_007149917.1|  hypothetical protein PHAVU_005G109900g             189   2e-55   
gb|AES67329.2|  myb transcription factor                                194   3e-55   
ref|XP_006449185.1|  hypothetical protein CICLE_v10017679mg             184   5e-55   
ref|XP_010323706.1|  PREDICTED: transcription factor WER-like           188   5e-55   
gb|KDO75677.1|  hypothetical protein CISIN_1g037956mg                   188   5e-55   
emb|CDP11893.1|  unnamed protein product                                187   1e-54   
ref|XP_009398450.1|  PREDICTED: myb-related protein Myb4-like           187   1e-54   
ref|XP_011047493.1|  PREDICTED: myb-related protein 308-like            187   2e-54   
emb|CDP11892.1|  unnamed protein product                                186   3e-54   
ref|XP_011048477.1|  PREDICTED: transcription factor WER-like           186   3e-54   
ref|XP_007035114.1|  Myb domain protein 13, putative                    189   3e-54   
ref|XP_007132609.1|  hypothetical protein PHAVU_011G109400g             186   4e-54   
ref|XP_010934323.1|  PREDICTED: myb-related protein Myb4-like           186   6e-54   
ref|XP_006467925.1|  PREDICTED: myb-related protein Myb4-like           187   6e-54   
ref|XP_010920477.1|  PREDICTED: myb-related protein Myb4                186   6e-54   
gb|KDP24725.1|  hypothetical protein JCGZ_26464                         186   6e-54   
emb|CDP11890.1|  unnamed protein product                                185   8e-54   
ref|XP_003540869.2|  PREDICTED: myb-related protein Myb4-like           184   2e-53   
ref|XP_010906538.1|  PREDICTED: myb-related protein Myb4-like           185   2e-53   
gb|KHN22878.1|  Myb-related protein Myb4                                184   2e-53   
ref|XP_010277888.1|  PREDICTED: myb-related protein 308-like            184   3e-53   
ref|XP_002325683.2|  hypothetical protein POPTR_0019s14120g             184   4e-53   Populus trichocarpa [western balsam poplar]
ref|XP_003597078.1|  MYB transcription factor                           189   5e-53   
gb|ABH02919.1|  MYB transcription factor MYB117                         182   9e-53   Glycine max [soybeans]
gb|KDO55821.1|  hypothetical protein CISIN_1g042846mg                   182   9e-53   
ref|XP_007043432.1|  Myb domain protein 15, putative                    185   1e-52   
ref|XP_003518022.1|  PREDICTED: myb-related protein Myb4-like           182   1e-52   
ref|XP_006447414.1|  hypothetical protein CICLE_v10017677mg             182   1e-52   
dbj|BAA81732.1|  GmMYB29A2                                              182   1e-52   Glycine max [soybeans]
ref|XP_008785342.1|  PREDICTED: myb-related protein Myb4-like           182   2e-52   
gb|KHN00260.1|  Myb-related protein Myb4                                182   2e-52   
gb|AIT13037.1|  myb-related transcription factor                        182   2e-52   
ref|XP_004976230.1|  PREDICTED: myb-related protein Myb4-like           182   2e-52   
ref|XP_008791593.1|  PREDICTED: myb-related protein Myb4                182   2e-52   
ref|XP_010095860.1|  Myb-related protein Myb4                           182   3e-52   
gb|KHN00294.1|  Myb-related protein Myb4                                181   3e-52   
ref|XP_002285193.1|  PREDICTED: myb-related protein Myb4                181   3e-52   Vitis vinifera
dbj|BAC07544.1|  myb-related transcription factor VlMYBB1-2             181   3e-52   Vitis labrusca x Vitis vinifera [Labruscan grape]
ref|XP_003535693.1|  PREDICTED: myb-related protein Myb4                181   3e-52   
dbj|BAC07543.1|  myb-related transcription factor VlMYBB1-1             181   3e-52   Vitis labrusca x Vitis vinifera [Labruscan grape]
ref|XP_011029827.1|  PREDICTED: myb-related protein Myb4-like           182   3e-52   
ref|XP_008807658.1|  PREDICTED: myb-related protein Myb4-like           182   3e-52   
ref|XP_010274769.1|  PREDICTED: myb-related protein Myb4-like           182   4e-52   
gb|ACU23862.1|  unknown                                                 181   4e-52   Glycine max [soybeans]
ref|XP_008224356.1|  PREDICTED: myb-related protein Myb4-like           181   5e-52   
gb|KHN41181.1|  Myb-related protein Myb4                                180   5e-52   
ref|XP_009392095.1|  PREDICTED: myb-related protein Myb4-like           181   5e-52   
ref|XP_009396976.1|  PREDICTED: myb-related protein Myb4-like           181   5e-52   
ref|XP_007132613.1|  hypothetical protein PHAVU_011G109800g             179   6e-52   
ref|XP_011100326.1|  PREDICTED: myb-related protein Myb4-like           181   7e-52   
ref|XP_010660228.1|  PREDICTED: myb-related protein Myb4-like           179   8e-52   
gb|ABI84253.1|  transcription factor Myb1                               176   9e-52   Arachis hypogaea [goober]
ref|XP_010262320.1|  PREDICTED: myb-related protein Myb4                180   1e-51   
gb|KDP26537.1|  hypothetical protein JCGZ_17695                         181   1e-51   
ref|XP_010111921.1|  Myb-related protein Myb4                           181   1e-51   
gb|AGN52057.1|  MYB-related transcription factor                        179   1e-51   
ref|XP_009762172.1|  PREDICTED: myb-related protein Myb4-like           180   1e-51   
ref|XP_009629052.1|  PREDICTED: myb-related protein Myb4-like           180   1e-51   
ref|XP_003590028.1|  Myb-related protein P                              179   1e-51   
gb|ABR28339.1|  MYB transcription factor MYB51                          179   1e-51   
ref|XP_006442693.1|  hypothetical protein CICLE_v10022057mg             179   2e-51   
gb|ACJ84573.1|  unknown                                                 179   2e-51   Medicago truncatula
gb|KDO60505.1|  hypothetical protein CISIN_1g024492mg                   180   2e-51   
ref|XP_009399470.1|  PREDICTED: myb-related protein Myb4-like           179   2e-51   
ref|XP_006446590.1|  hypothetical protein CICLE_v10017435mg             178   2e-51   
ref|XP_002311670.1|  hypothetical protein POPTR_0008s16660g             180   2e-51   Populus trichocarpa [western balsam poplar]
dbj|BAG71001.1|  myb-related transcription factor                       179   2e-51   Musa balbisiana [starchy banana]
ref|NP_001241360.1|  MYB29 protein                                      180   2e-51   
gb|ABR28344.1|  MYB transcription factor MYB70                          179   2e-51   
gb|KHN30570.1|  Myb-related protein Myb4                                180   2e-51   
emb|CCA29106.1|  putative MYB transcription factor                      179   2e-51   
ref|XP_004289939.1|  PREDICTED: myb-related protein Myb4-like           179   2e-51   
ref|XP_006443843.1|  hypothetical protein CICLE_v10021699mg             179   3e-51   
ref|XP_009631826.1|  PREDICTED: myb-related protein Myb4-like           179   3e-51   
ref|XP_004247733.1|  PREDICTED: myb-related protein Myb4-like           179   3e-51   
ref|XP_006354484.1|  PREDICTED: myb-related protein Myb4-like           179   3e-51   
gb|AAL78372.1|  myb protein                                             176   3e-51   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007030431.1|  Myb domain protein 15, putative                    178   3e-51   
ref|XP_009765014.1|  PREDICTED: myb-related protein Myb4-like           179   4e-51   
ref|XP_006446589.1|  hypothetical protein CICLE_v10018311mg             177   4e-51   
ref|XP_008805219.1|  PREDICTED: myb-related protein Myb4                179   4e-51   
ref|XP_002281274.1|  PREDICTED: myb-related protein Myb4                179   4e-51   Vitis vinifera
ref|XP_010268905.1|  PREDICTED: myb-related protein Myb4-like           178   4e-51   
ref|XP_006470240.1|  PREDICTED: myb-related protein Myb4-like           177   5e-51   
ref|XP_007221832.1|  hypothetical protein PRUPE_ppa020190mg             178   5e-51   
ref|XP_004162391.1|  PREDICTED: myb-related protein Myb4-like           178   5e-51   
ref|XP_004151985.1|  PREDICTED: transcription repressor MYB6-like       178   5e-51   
gb|AAP92750.1|  myb-related protein                                     178   6e-51   Oryza sativa Japonica Group [Japonica rice]
emb|CBI23644.3|  unnamed protein product                                174   6e-51   
ref|XP_009601374.1|  PREDICTED: myb-related protein Myb4-like           179   7e-51   
emb|CAA78387.1|  protein 2                                              179   7e-51   Petunia x hybrida [garden petunia]
ref|NP_001241018.1|  uncharacterized protein LOC100807569               178   7e-51   
ref|NP_001053318.1|  Os04g0517100                                       178   7e-51   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007050304.1|  Myb domain protein 13, putative                    178   7e-51   
gb|EPS74409.1|  hypothetical protein M569_00345                         174   8e-51   
ref|XP_008669188.1|  PREDICTED: myb-related protein Myb4                179   9e-51   
ref|XP_001768811.1|  predicted protein                                  174   9e-51   
ref|XP_002325682.1|  hypothetical protein POPTR_0019s14130g             177   9e-51   Populus trichocarpa [western balsam poplar]
ref|XP_008645950.1|  PREDICTED: myb-related protein Myb4                177   9e-51   
ref|XP_010069126.1|  PREDICTED: myb-related protein Myb4                178   9e-51   
ref|XP_008235684.1|  PREDICTED: myb-related protein Myb4                177   1e-50   
emb|CDO99233.1|  unnamed protein product                                178   1e-50   
ref|XP_007143866.1|  hypothetical protein PHAVU_007G108500g             177   1e-50   
ref|XP_004248359.1|  PREDICTED: transcription factor MYB3-like          179   1e-50   
ref|XP_006487722.1|  PREDICTED: myb-related protein Myb4-like           176   1e-50   
gb|KHN41176.1|  Myb-related protein Myb4                                177   1e-50   
gb|AGQ80898.1|  R2R3-type MYB tanscription factor                       176   1e-50   
ref|XP_007199224.1|  hypothetical protein PRUPE_ppa021921mg             177   1e-50   
ref|XP_004495379.1|  PREDICTED: myb-related protein Myb4-like           177   1e-50   
gb|ACB30359.1|  myb-related transcription factor                        177   1e-50   Capsicum annuum
ref|XP_002454197.1|  hypothetical protein SORBIDRAFT_04g026480          177   2e-50   Sorghum bicolor [broomcorn]
gb|AFK39973.1|  unknown                                                 177   2e-50   
ref|XP_006350689.1|  PREDICTED: myb-related protein Myb4-like           177   2e-50   
ref|XP_010935898.1|  PREDICTED: myb-related protein Myb4 isoform X1     177   2e-50   
gb|ACJ84928.1|  unknown                                                 177   2e-50   Medicago truncatula
ref|XP_009606766.1|  PREDICTED: myb-related protein Myb4-like           176   2e-50   
dbj|BAI49720.1|  putative MYB transcription factor                      176   2e-50   Diospyros kaki [Japanese persimmon]
ref|XP_009374421.1|  PREDICTED: transcription factor RAX2               179   2e-50   
ref|XP_008447428.1|  PREDICTED: myb-related protein Myb4-like           176   2e-50   
ref|XP_004497845.1|  PREDICTED: myb-related protein Myb4-like           177   3e-50   
ref|XP_011047494.1|  PREDICTED: myb-related protein Myb4-like           176   3e-50   
gb|AGN52037.1|  MYB-related transcription factor                        176   3e-50   
ref|XP_006489734.1|  PREDICTED: myb-related protein Myb4-like           177   3e-50   
ref|XP_004958010.1|  PREDICTED: uncharacterized protein LOC101782226    179   3e-50   
ref|NP_001234262.1|  myb-related transcription factor                   176   3e-50   
gb|KDP23708.1|  hypothetical protein JCGZ_23541                         175   3e-50   
ref|XP_010671030.1|  PREDICTED: myb-related protein Myb4-like           177   3e-50   
ref|XP_008224916.1|  PREDICTED: myb-related protein Myb4-like           176   3e-50   
ref|XP_011091315.1|  PREDICTED: myb-related protein Myb4-like           176   3e-50   
ref|XP_010268949.1|  PREDICTED: myb-related protein 308-like            176   3e-50   
ref|XP_010671094.1|  PREDICTED: transcription factor MYB39              179   3e-50   
ref|XP_010102236.1|  Myb-related protein Myb4                           177   4e-50   
gb|AIR07398.1|  MYB12 transcription factor                              176   4e-50   
ref|XP_009383106.1|  PREDICTED: transcription factor MYB34-like         178   4e-50   
ref|XP_010645217.1|  PREDICTED: myb-related protein Myb4                178   4e-50   
ref|XP_004953959.1|  PREDICTED: transcription factor MYB39-like         178   4e-50   
ref|XP_007216491.1|  hypothetical protein PRUPE_ppa025095mg             174   4e-50   
emb|CDO99983.1|  unnamed protein product                                176   4e-50   
ref|XP_002513237.1|  r2r3-myb transcription factor, putative            174   4e-50   Ricinus communis
gb|AGN52147.1|  MYB-related transcription factor                        176   5e-50   
ref|XP_007145850.1|  hypothetical protein PHAVU_007G273400g             176   5e-50   
ref|XP_009629473.1|  PREDICTED: protein ODORANT1-like                   179   5e-50   
gb|KDP20863.1|  hypothetical protein JCGZ_21334                         176   5e-50   
ref|NP_001140890.1|  MYB transcription factor                           176   5e-50   Zea mays [maize]
gb|EPS66172.1|  hypothetical protein M569_08609                         171   5e-50   
ref|XP_006412992.1|  hypothetical protein EUTSA_v10027463mg             176   5e-50   
ref|XP_009802252.1|  PREDICTED: myb-related protein Myb4-like           176   5e-50   
ref|XP_011025983.1|  PREDICTED: myb-related protein Myb4-like           176   5e-50   
ref|XP_008455362.1|  PREDICTED: transcription factor MYB39              178   6e-50   
ref|XP_008358698.1|  PREDICTED: LOW QUALITY PROTEIN: protein ODOR...    178   6e-50   
gb|ABZ89193.1|  putative protein                                        175   6e-50   Coffea canephora [robusta coffee]
ref|XP_009783632.1|  PREDICTED: transcription factor MYB39-like         176   6e-50   
ref|XP_004296369.1|  PREDICTED: myb-related protein Myb4-like           175   6e-50   
ref|XP_002284142.1|  PREDICTED: transcription factor MYB39              177   6e-50   Vitis vinifera
ref|XP_002448188.1|  hypothetical protein SORBIDRAFT_06g022660          176   7e-50   Sorghum bicolor [broomcorn]
gb|EYU24839.1|  hypothetical protein MIMGU_mgv1a020124mg                174   7e-50   
ref|XP_002302045.1|  GmMYB29 family protein                             176   7e-50   Populus trichocarpa [western balsam poplar]
ref|XP_009339621.1|  PREDICTED: myb-related protein Myb4-like           175   8e-50   
ref|XP_011028802.1|  PREDICTED: myb-related protein Myb4-like           176   8e-50   
ref|XP_011022802.1|  PREDICTED: myb-related protein 308-like            177   8e-50   
gb|KHG28925.1|  Myb-related Myb4                                        175   8e-50   
ref|XP_004295360.1|  PREDICTED: myb-related protein Hv1-like            176   8e-50   
gb|AFK45056.1|  unknown                                                 176   8e-50   
ref|XP_010247284.1|  PREDICTED: transcription factor MYB3-like          177   9e-50   
emb|CDO99644.1|  unnamed protein product                                177   9e-50   
ref|XP_004293589.1|  PREDICTED: transcription factor MYB75-like         178   9e-50   
ref|XP_009779489.1|  PREDICTED: myb-related protein Myb4-like           174   9e-50   
gb|KHN41175.1|  Myb-related protein Myb4                                174   1e-49   
ref|XP_002306849.2|  hypothetical protein POPTR_0005s24550g             175   1e-49   Populus trichocarpa [western balsam poplar]
gb|KDP20873.1|  hypothetical protein JCGZ_21344                         177   1e-49   
ref|XP_004953149.1|  PREDICTED: myb-related protein Myb4-like           174   1e-49   
ref|XP_003527470.1|  PREDICTED: myb-related protein Myb4-like           174   1e-49   
ref|XP_006449197.1|  hypothetical protein CICLE_v10015729mg             177   1e-49   
ref|XP_011001151.1|  PREDICTED: protein ODORANT1                        178   1e-49   
ref|XP_002307080.2|  hypothetical protein POPTR_0005s07590g             177   1e-49   Populus trichocarpa [western balsam poplar]
ref|XP_008230194.1|  PREDICTED: myb-related protein Myb4-like           174   1e-49   
ref|XP_011031021.1|  PREDICTED: myb-related protein 308-like            177   1e-49   
ref|XP_008441942.1|  PREDICTED: transcription factor MYB86-like         178   1e-49   
gb|AAS55703.1|  MYB1                                                    171   1e-49   Nicotiana benthamiana
ref|XP_003571882.1|  PREDICTED: myb-related protein Myb4-like           174   1e-49   
ref|XP_006294854.1|  hypothetical protein CARUB_v10023905mg             174   1e-49   
ref|XP_003575392.1|  PREDICTED: myb-related protein Myb4-like           174   1e-49   
ref|XP_007212471.1|  hypothetical protein PRUPE_ppa015081mg             173   1e-49   
ref|XP_009380857.1|  PREDICTED: myb-related protein 308                 176   2e-49   
ref|XP_010037978.1|  PREDICTED: myb-related protein Myb4                174   2e-49   
ref|XP_006469819.1|  PREDICTED: transcription factor RAX2-like          176   2e-49   
gb|AGN52108.1|  MYB-related transcription factor                        176   2e-49   
ref|XP_004288189.1|  PREDICTED: uncharacterized protein LOC101292449    177   2e-49   
gb|ABR28338.1|  MYB transcription factor MYB50                          174   2e-49   
ref|XP_010469752.1|  PREDICTED: myb-related protein Myb4-like           174   2e-49   
ref|XP_002305647.1|  putative MYB transcription factor family pro...    177   2e-49   Populus trichocarpa [western balsam poplar]
ref|XP_003521289.1|  PREDICTED: myb-related protein Myb4-like           175   2e-49   
ref|XP_006467911.1|  PREDICTED: myb-related protein 3R-1-like           177   2e-49   
ref|XP_010087606.1|  Transcription factor                               177   2e-49   
ref|XP_002463015.1|  hypothetical protein SORBIDRAFT_02g036250          177   2e-49   Sorghum bicolor [broomcorn]
gb|AHB59594.1|  putative R2R3 MYB protein 6                             175   2e-49   
emb|CDP11889.1|  unnamed protein product                                174   2e-49   
emb|CBI40862.3|  unnamed protein product                                176   2e-49   
ref|XP_010414171.1|  PREDICTED: myb-related protein Myb4-like           174   2e-49   
ref|XP_010510229.1|  PREDICTED: myb-related protein Myb4-like           174   2e-49   
ref|XP_008342092.1|  PREDICTED: myb-related protein Myb4-like           175   2e-49   
gb|KDO57592.1|  hypothetical protein CISIN_1g024484mg                   173   2e-49   
ref|XP_009801248.1|  PREDICTED: protein ODORANT1-like                   177   2e-49   
gb|AEV91156.1|  R2R3-MYB protein                                        174   2e-49   
ref|XP_011091328.1|  PREDICTED: myb-related protein Myb4-like           174   2e-49   
ref|XP_008670489.1|  PREDICTED: snRNA-activating protein complex ...    177   2e-49   
gb|KDO55797.1|  hypothetical protein CISIN_1g035629mg                   177   2e-49   
ref|XP_011079047.1|  PREDICTED: transcription factor MYB39-like         176   2e-49   
ref|XP_006447404.1|  hypothetical protein CICLE_v10017668mg             177   2e-49   
ref|NP_001280969.1|  uncharacterized protein LOC103420593               174   2e-49   
ref|XP_009774387.1|  PREDICTED: transcription factor MYB34-like         176   2e-49   
ref|XP_010512224.1|  PREDICTED: myb-related protein Myb4-like           175   2e-49   
ref|XP_004159214.1|  PREDICTED: uncharacterized LOC101213017            176   2e-49   
ref|XP_002883414.1|  AtMYB15/AtY19/MYB15                                175   2e-49   
ref|XP_003580139.1|  PREDICTED: myb-related protein Myb4-like           174   2e-49   
ref|XP_008438526.1|  PREDICTED: myb-related protein Myb4-like           174   2e-49   
dbj|BAE54312.1|  transcription factor DcMYB1                            173   2e-49   Daucus carota [carrots]
emb|CDY19003.1|  BnaC01g20650D                                          175   2e-49   
ref|XP_002266049.1|  PREDICTED: protein ODORANT1                        177   2e-49   Vitis vinifera
gb|ABU53925.1|  myb-related transcription factor                        174   2e-49   Datura metel
ref|NP_001064861.1|  Os10g0478300                                       174   2e-49   Oryza sativa Japonica Group [Japonica rice]
emb|CAA74603.1|  R2R3-MYB transcription factor                          174   2e-49   
ref|XP_009144191.1|  PREDICTED: transcription factor MYB39-like         175   2e-49   
ref|XP_007025822.1|  MYB-like 102                                       177   2e-49   
ref|XP_008224927.1|  PREDICTED: transcription repressor MYB6-like       177   3e-49   
ref|XP_009118932.1|  PREDICTED: transcription factor MYB3-like          176   3e-49   
ref|XP_002319387.1|  hypothetical protein POPTR_0013s14480g             177   3e-49   
ref|XP_006420227.1|  hypothetical protein CICLE_v10005629mg             174   3e-49   
ref|NP_001281023.1|  protein ODORANT1-like                              176   3e-49   
ref|XP_011036293.1|  PREDICTED: myb-related protein Myb4-like           172   3e-49   
ref|XP_003520086.2|  PREDICTED: myb-related protein Zm38-like           175   3e-49   
ref|XP_004137011.1|  PREDICTED: uncharacterized protein LOC101213017    176   3e-49   
ref|XP_003553496.1|  PREDICTED: myb-related protein Myb4-like           174   3e-49   
gb|EMT21544.1|  Myb-related protein Myb4                                174   3e-49   
gb|ABH02843.1|  MYB transcription factor MYB88                          172   3e-49   
ref|XP_002881162.1|  predicted protein                                  173   3e-49   
ref|XP_009348003.1|  PREDICTED: protein ODORANT1-like                   176   3e-49   
ref|XP_004137010.1|  PREDICTED: transcription repressor MYB4-like       174   4e-49   
ref|XP_009594598.1|  PREDICTED: transcription factor MYB39-like         176   4e-49   
ref|XP_006345888.1|  PREDICTED: myb-related protein Myb4-like           172   4e-49   
gb|AGN52109.1|  MYB-related transcription factor                        175   4e-49   
ref|XP_009790391.1|  PREDICTED: myb-related protein 315-like            176   4e-49   
ref|XP_003521771.1|  PREDICTED: myb-related protein Myb4                172   4e-49   
gb|KHN14496.1|  Transcription factor MYB28                              171   4e-49   
emb|CAA62032.1|  Y19                                                    169   4e-49   
tpg|DAA63102.1|  TPA: putative MYB DNA-binding domain superfamily...    176   4e-49   
gb|KDO57593.1|  hypothetical protein CISIN_1g024484mg                   174   4e-49   
ref|NP_188966.1|  myb domain protein 15                                 174   4e-49   
gb|EMS67303.1|  Transcription factor MYB39                              175   4e-49   
ref|XP_004232789.1|  PREDICTED: transcription factor MYB39              176   4e-49   
ref|XP_011047483.1|  PREDICTED: myb-related protein 330-like            176   4e-49   
ref|XP_007211464.1|  hypothetical protein PRUPE_ppa007438mg             176   4e-49   
emb|CDY15424.1|  BnaC04g41990D                                          172   4e-49   
ref|XP_008364260.1|  PREDICTED: myb-related protein Myb4-like           174   5e-49   
ref|NP_180676.1|  myb domain protein 14                                 173   5e-49   
ref|XP_009400813.1|  PREDICTED: myb-related protein Myb4-like           173   5e-49   
ref|XP_010686260.1|  PREDICTED: protein ODORANT1-like                   177   5e-49   
gb|KFK31226.1|  hypothetical protein AALP_AA6G084700                    172   5e-49   
gb|KDP46819.1|  hypothetical protein JCGZ_24028                         175   5e-49   
gb|AAN17830.1|  Myb-like protein P                                      173   5e-49   
gb|ABQ51227.1|  R2R3-MYB transcription factor MYB11                     179   5e-49   
ref|XP_004146632.1|  PREDICTED: uncharacterized protein LOC101216901    175   5e-49   
gb|AGN52093.1|  MYB-related transcription factor                        172   5e-49   
ref|XP_006347152.1|  PREDICTED: transcription factor MYB86-like         176   5e-49   
ref|XP_006841861.1|  hypothetical protein AMTR_s00003p00271440          176   5e-49   
ref|XP_011100426.1|  PREDICTED: myb-related protein 308-like            172   5e-49   
ref|XP_008338578.1|  PREDICTED: transcription factor MYB39-like         176   5e-49   
ref|XP_006371644.1|  hypothetical protein POPTR_0019s14070g             176   5e-49   
gb|EMS55339.1|  Myb-related protein Myb4                                172   5e-49   
ref|XP_008455365.1|  PREDICTED: transcription factor WER-like           173   5e-49   
ref|XP_010523151.1|  PREDICTED: myb-related protein Myb4-like           172   6e-49   
ref|XP_011096186.1|  PREDICTED: protein ODORANT1-like                   176   6e-49   
ref|XP_009111962.1|  PREDICTED: transcription factor MYB34-like         174   6e-49   
ref|XP_004155656.1|  PREDICTED: uncharacterized LOC101206909            176   6e-49   
ref|XP_008653224.1|  PREDICTED: transcription factor MYB39              176   6e-49   
gb|ACR48184.1|  MYB domain protein 34-1                                 174   6e-49   
gb|KFK40183.1|  hypothetical protein AALP_AA3G341200                    174   6e-49   
ref|XP_006408360.1|  hypothetical protein EUTSA_v10022405mg             175   6e-49   
ref|XP_004157697.1|  PREDICTED: transcription repressor MYB5-like       173   6e-49   
ref|XP_004134963.1|  PREDICTED: uncharacterized protein LOC101206909    176   6e-49   
ref|XP_010463732.1|  PREDICTED: transcription factor MYB3-like          175   6e-49   
ref|XP_009144594.1|  PREDICTED: myb-related protein 308-like            172   7e-49   
ref|XP_002272561.1|  PREDICTED: transcription factor MYB39              175   7e-49   
ref|XP_008439917.1|  PREDICTED: transcription factor MYB34-like         176   7e-49   
ref|XP_009141138.1|  PREDICTED: myb-related protein Myb4                172   7e-49   
ref|XP_011090566.1|  PREDICTED: transcription factor MYB39-like         174   7e-49   
gb|KHN00098.1|  Transcription factor MYB39                              175   7e-49   
ref|XP_004240193.1|  PREDICTED: myb-related protein Myb4-like           171   7e-49   
ref|XP_003532563.1|  PREDICTED: transcription factor MYB3-like          175   7e-49   
emb|CDY57089.1|  BnaA04g28770D                                          172   7e-49   
ref|XP_008234088.1|  PREDICTED: transcription factor MYB28              175   7e-49   
ref|XP_006410249.1|  hypothetical protein EUTSA_v10017136mg             172   7e-49   
ref|XP_009401945.1|  PREDICTED: myb-related protein Myb4-like           173   7e-49   
ref|XP_007207610.1|  hypothetical protein PRUPE_ppa019923mg             175   7e-49   
ref|XP_007047937.1|  Myb domain protein 93                              174   8e-49   
ref|XP_002882262.1|  MYB107                                             174   8e-49   
gb|AID56313.1|  MYB1                                                    172   8e-49   
ref|XP_003590026.1|  MYB-like protein                                   172   8e-49   
ref|XP_006352596.1|  PREDICTED: protein ODORANT1-like                   174   8e-49   
gb|AEV91155.1|  R2R3-MYB protein                                        172   8e-49   
ref|XP_006357551.1|  PREDICTED: protein ODORANT1-like                   174   9e-49   
emb|CDP11902.1|  unnamed protein product                                174   9e-49   
gb|ACK43221.1|  myb-related transcription factor                        172   9e-49   
ref|XP_010679296.1|  PREDICTED: myb-related protein Myb4                174   9e-49   
emb|CDX84795.1|  BnaA03g14350D                                          172   9e-49   
ref|XP_009351440.1|  PREDICTED: myb-related protein Myb4-like           176   9e-49   
gb|EMS62386.1|  Myb-related protein Myb4                                172   9e-49   
emb|CDX92979.1|  BnaA03g37010D                                          172   9e-49   
ref|XP_002452535.1|  hypothetical protein SORBIDRAFT_04g027540          174   1e-48   
ref|XP_010466641.1|  PREDICTED: myb-related protein Myb4-like iso...    173   1e-48   
ref|XP_008345730.1|  PREDICTED: transcription factor MYB39-like         174   1e-48   
emb|CDY23952.1|  BnaC03g17390D                                          172   1e-48   
ref|XP_010488375.1|  PREDICTED: myb-related protein Myb4-like           173   1e-48   
ref|XP_006286241.1|  hypothetical protein CARUB_v10007810mg             173   1e-48   
ref|XP_010533288.1|  PREDICTED: myb-related protein Myb4                173   1e-48   
ref|XP_011100331.1|  PREDICTED: transcription factor MYB39-like         175   1e-48   
ref|XP_010052407.1|  PREDICTED: myb-related protein Hv1                 175   1e-48   
ref|XP_009370698.1|  PREDICTED: transcription factor MYB39-like         174   1e-48   
ref|XP_010023946.1|  PREDICTED: myb-related protein Myb4-like           174   1e-48   
ref|NP_186944.1|  putative transcription factor MYB107                  174   1e-48   
ref|XP_009384655.1|  PREDICTED: myb-related protein Myb4-like           173   1e-48   
ref|XP_010904805.1|  PREDICTED: transcription factor MYB3-like          175   1e-48   
ref|XP_007162544.1|  hypothetical protein PHAVU_001G161000g             173   1e-48   
emb|CDP01059.1|  unnamed protein product                                174   1e-48   
gb|ADI24681.1|  Myb3                                                    172   1e-48   
ref|XP_009383020.1|  PREDICTED: myb-related protein Myb4-like           171   1e-48   
ref|XP_010448029.1|  PREDICTED: transcription factor MYB39-like         173   1e-48   
ref|XP_010046353.1|  PREDICTED: myb-related protein Myb4-like           172   1e-48   
ref|NP_001152064.1|  myb-related protein Myb4                           172   1e-48   
ref|XP_010504070.1|  PREDICTED: transcription factor MYB3-like          174   1e-48   
ref|XP_009137761.1|  PREDICTED: transcription repressor MYB6-like...    173   1e-48   
ref|XP_007148253.1|  hypothetical protein PHAVU_006G192900g             175   1e-48   
gb|EYU24837.1|  hypothetical protein MIMGU_mgv1a018138mg                172   1e-48   
ref|XP_010095853.1|  Transcription factor                               174   1e-48   
gb|KHN07682.1|  Transcription factor MYB39                              174   1e-48   
gb|AFW63053.1|  putative MYB DNA-binding domain superfamily protein     172   1e-48   
ref|XP_010939659.1|  PREDICTED: transcription repressor MYB6-like       174   1e-48   
ref|XP_006283783.1|  hypothetical protein CARUB_v10004873mg             176   1e-48   
ref|XP_006664815.1|  PREDICTED: myb-related protein Myb4-like           172   1e-48   
emb|CDY68230.1|  BnaCnng58140D                                          173   1e-48   
ref|XP_011073621.1|  PREDICTED: myb-related protein Myb4-like           171   1e-48   
gb|KEH34935.1|  myb transcription factor                                174   1e-48   
ref|XP_009354945.1|  PREDICTED: myb-related protein Myb4-like           172   1e-48   
ref|XP_010538235.1|  PREDICTED: myb-related protein 315-like            174   1e-48   
gb|AEO21928.1|  MYB33                                                   171   1e-48   
gb|ADN96004.1|  MYB1                                                    171   1e-48   
ref|XP_009137762.1|  PREDICTED: transcription repressor MYB6-like...    172   1e-48   
ref|XP_004487343.1|  PREDICTED: transcription factor MYB39-like         174   1e-48   
ref|XP_007018775.1|  Myb domain protein 93                              174   1e-48   
gb|KDP24203.1|  hypothetical protein JCGZ_25860                         174   1e-48   
ref|XP_009758169.1|  PREDICTED: transcription factor MYB39-like         175   1e-48   
ref|XP_003529290.1|  PREDICTED: transcription factor MYB32-like         174   1e-48   
gb|AGN52090.1|  MYB-related transcription factor                        170   1e-48   
gb|KHG22733.1|  Transcription factor MYB39 -like protein                174   1e-48   
gb|KHN24649.1|  Transcription factor MYB28                              173   2e-48   
ref|XP_006300198.1|  hypothetical protein CARUB_v10016434mg             174   2e-48   
gb|AHB59590.1|  putative R2R3 MYB protein 2                             171   2e-48   
ref|XP_009591172.1|  PREDICTED: transcription factor MYB39-like         174   2e-48   
ref|XP_010529388.1|  PREDICTED: transcription factor MYB3-like          174   2e-48   
ref|XP_009761686.1|  PREDICTED: protein ODORANT1-like                   174   2e-48   
ref|NP_001059972.1|  Os07g0558100                                       175   2e-48   
ref|NP_194540.1|  myb domain protein 41                                 172   2e-48   
ref|XP_003540874.1|  PREDICTED: myb-related protein Myb4-like           171   2e-48   
emb|CAA72218.1|  myb                                                    175   2e-48   
ref|XP_004243304.1|  PREDICTED: protein ODORANT1-like                   174   2e-48   
gb|KHN22881.1|  Myb-related protein Myb4                                171   2e-48   
gb|AEW23186.1|  MYB73                                                   171   2e-48   
ref|XP_010433260.1|  PREDICTED: transcription factor MYB39-like         172   2e-48   
ref|XP_002265296.1|  PREDICTED: myb-related protein Myb4                174   2e-48   
gb|KDP40332.1|  hypothetical protein JCGZ_02330                         171   2e-48   
gb|AFK48781.1|  unknown                                                 171   2e-48   
gb|EMT12739.1|  Myb-related protein Myb4                                171   2e-48   
ref|XP_006655921.1|  PREDICTED: transcription factor MYB39-like         173   2e-48   
ref|XP_008351312.1|  PREDICTED: myb-related protein Myb4-like           172   2e-48   
ref|XP_003575391.1|  PREDICTED: myb-related protein Myb4-like           171   2e-48   
ref|XP_008460645.1|  PREDICTED: myb-related protein Myb4-like           172   2e-48   
gb|KDP21585.1|  hypothetical protein JCGZ_03738                         171   2e-48   
ref|XP_010917107.1|  PREDICTED: transcription factor MYB39-like         173   2e-48   
ref|XP_008795437.1|  PREDICTED: transcription factor MYB39              174   2e-48   
ref|XP_004243792.1|  PREDICTED: myb-related protein Myb4-like           170   2e-48   
emb|CAN78108.1|  hypothetical protein VITISV_036780                     174   2e-48   
gb|AFW73493.1|  putative MYB DNA-binding domain superfamily protein     173   2e-48   
ref|XP_003527903.1|  PREDICTED: transcription factor MYB39-like         174   2e-48   
gb|KFK37575.1|  hypothetical protein AALP_AA3G001200                    173   2e-48   
ref|XP_010057758.1|  PREDICTED: transcription factor MYB3-like          174   2e-48   
ref|XP_002464484.1|  hypothetical protein SORBIDRAFT_01g019270          172   2e-48   
ref|XP_010057723.1|  PREDICTED: transcription factor MYB3-like          174   2e-48   
ref|XP_007043450.1|  MYB-like 102, putative                             175   2e-48   
ref|XP_007147213.1|  hypothetical protein PHAVU_006G105200g             170   2e-48   
ref|XP_010269280.1|  PREDICTED: protein ODORANT1                        174   2e-48   
gb|KHN03903.1|  Transcription factor MYB39                              174   2e-48   
emb|CDX87191.1|  BnaC09g05060D                                          172   2e-48   
ref|XP_004982863.1|  PREDICTED: myb-related protein Myb4-like           172   2e-48   
emb|CDX85074.1|  BnaC07g08320D                                          172   2e-48   
ref|XP_009130319.1|  PREDICTED: myb-related protein 330-like            173   2e-48   
ref|XP_006366230.1|  PREDICTED: transcription factor MYB39-like         174   2e-48   
ref|XP_009778686.1|  PREDICTED: transcription factor MYB39-like         173   2e-48   
ref|XP_003517808.1|  PREDICTED: myb-related protein Hv1-like            173   3e-48   
ref|XP_006660233.1|  PREDICTED: transcription factor MYB39-like         169   3e-48   
emb|CDX77536.1|  BnaA07g06740D                                          172   3e-48   
ref|XP_008455366.1|  PREDICTED: transcription repressor MYB6-like       171   3e-48   
gb|AAO21378.1|  R2R3 MYB protein MYB4                                   166   3e-48   
ref|XP_004973754.1|  PREDICTED: myb-related protein Hv33-like           173   3e-48   
ref|XP_008782327.1|  PREDICTED: transcription factor MYB39-like         173   3e-48   
ref|XP_007136252.1|  hypothetical protein PHAVU_009G031200g             173   3e-48   
ref|XP_010027860.1|  PREDICTED: transcription factor MYB34-like         173   3e-48   
ref|XP_004240019.1|  PREDICTED: myb-related protein 315-like            174   3e-48   
ref|XP_010519490.1|  PREDICTED: transcription factor MYB39              173   3e-48   
ref|XP_007132622.1|  hypothetical protein PHAVU_011G110500g             173   3e-48   
ref|NP_001106008.1|  transcription factor MYB39                         171   3e-48   
ref|XP_007153451.1|  hypothetical protein PHAVU_003G036400g             172   3e-48   
gb|AGN52096.1|  MYB-related transcription factor                        170   3e-48   
ref|XP_010686262.1|  PREDICTED: transcription factor MYB39-like         175   3e-48   
gb|AGN52043.1|  MYB-related transcription factor                        173   3e-48   
ref|XP_006406061.1|  hypothetical protein EUTSA_v10022110mg             172   3e-48   
gb|AGN52111.1|  MYB-related transcription factor                        171   3e-48   
ref|XP_006604862.1|  PREDICTED: myb-related protein Myb4-like           169   3e-48   
ref|XP_009102644.1|  PREDICTED: myb-related protein Myb4                172   3e-48   
ref|XP_004160588.1|  PREDICTED: LOW QUALITY PROTEIN: myb-related ...    172   3e-48   
ref|XP_010542737.1|  PREDICTED: myb-related protein Myb4-like           171   3e-48   
gb|AGN52050.1|  MYB-related transcription factor                        173   3e-48   
ref|XP_002310560.2|  hypothetical protein POPTR_0007s05360g             173   3e-48   
ref|XP_010675066.1|  PREDICTED: myb-related protein Myb4-like           169   4e-48   
ref|XP_010267736.1|  PREDICTED: transcription factor MYB39-like         173   4e-48   
gb|KEH30675.1|  myb transcription factor                                173   4e-48   
ref|XP_011097564.1|  PREDICTED: transcription factor MYB39-like         172   4e-48   
ref|XP_009406494.1|  PREDICTED: transcription factor MYB39-like         173   4e-48   
gb|AAM64808.1|  myb-related protein M4                                  173   4e-48   
gb|EYU24849.1|  hypothetical protein MIMGU_mgv1a018812mg                172   4e-48   
ref|XP_009135852.1|  PREDICTED: myb-related protein Myb4-like           172   4e-48   
ref|XP_004147145.1|  PREDICTED: myb-related protein Myb4-like           171   4e-48   
ref|XP_009391307.1|  PREDICTED: myb-related protein Hv1-like            172   4e-48   
ref|XP_004164066.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    173   4e-48   
ref|NP_567626.1|  R2R3 family MYB transcription factor                  173   4e-48   
ref|XP_004143558.1|  PREDICTED: transcription factor MYB39-like         173   4e-48   
ref|XP_006647539.1|  PREDICTED: myb-related protein Myb4-like           171   4e-48   
ref|XP_009596250.1|  PREDICTED: myb-related protein 315                 173   4e-48   
ref|XP_009796309.1|  PREDICTED: myb-related protein 315-like            173   4e-48   
ref|XP_010528356.1|  PREDICTED: transcription factor MYB32-like         173   4e-48   
ref|XP_004505589.1|  PREDICTED: transcription factor MYB39-like         173   4e-48   
gb|EYU24847.1|  hypothetical protein MIMGU_mgv1a019583mg                172   4e-48   
ref|NP_001057174.1|  Os06g0221000                                       172   4e-48   



>emb|CDP11876.1| unnamed protein product [Coffea canephora]
Length=266

 Score =   225 bits (573),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 99/110 (90%), Positives = 106/110 (96%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            MVRTPCCDKSG +KGTWTPEEDRKL AYVTRYGCWNWRQLPKFAGL+RCGKSCRLRWMNY
Sbjct  1    MVRTPCCDKSGLRKGTWTPEEDRKLTAYVTRYGCWNWRQLPKFAGLSRCGKSCRLRWMNY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRPN+KRGNYTKEEDE I+++HE LGN+WSAIAAHLPGRTDNEIKNHWHT
Sbjct  61   LRPNLKRGNYTKEEDELIIKLHESLGNRWSAIAAHLPGRTDNEIKNHWHT  110



>ref|XP_007043431.1| Myb domain protein 15, putative [Theobroma cacao]
 gb|EOX99262.1| Myb domain protein 15, putative [Theobroma cacao]
Length=293

 Score =   224 bits (572),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 99/113 (88%), Positives = 108/113 (96%), Gaps = 0/113 (0%)
 Frame = -2

Query  553  EFDMVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRW  374
            E +MVRTPCCDKSG +KGTWTPEEDRKL+AYVTRYGCWNWRQLPK+AGLARCGKSCRLRW
Sbjct  26   EGNMVRTPCCDKSGLRKGTWTPEEDRKLSAYVTRYGCWNWRQLPKYAGLARCGKSCRLRW  85

Query  373  MNYLRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            MNYLRPNIKRGNY+KEE+ETI+R+HE  GN+WSAIAA LPGRTDNEIKNHWHT
Sbjct  86   MNYLRPNIKRGNYSKEEEETIIRLHESQGNRWSAIAAQLPGRTDNEIKNHWHT  138



>ref|XP_011048479.1| PREDICTED: myb-related protein Myb4-like [Populus euphratica]
Length=256

 Score =   221 bits (562),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 96/110 (87%), Positives = 103/110 (94%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            MVRTPCCDK+G KKG WTPEEDRKL AYVTRYGCWNWRQLPKFAGL RCGKSCRLRW+NY
Sbjct  1    MVRTPCCDKTGLKKGAWTPEEDRKLMAYVTRYGCWNWRQLPKFAGLQRCGKSCRLRWLNY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRPNIKRGNY+KEE+ETI+ +HE LGN+WSAIAA LPGRTDNEIKNHWHT
Sbjct  61   LRPNIKRGNYSKEEEETIISLHETLGNRWSAIAAQLPGRTDNEIKNHWHT  110



>ref|XP_009353213.1| PREDICTED: myb-related protein Myb4-like [Pyrus x bretschneideri]
Length=253

 Score =   219 bits (558),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 97/110 (88%), Positives = 106/110 (96%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            MVRTPC D++G KKGTWTPEEDRKL AYVTRYGCWNWRQLPKFAGL+RCGKSCRLRWMNY
Sbjct  1    MVRTPCRDENGMKKGTWTPEEDRKLIAYVTRYGCWNWRQLPKFAGLSRCGKSCRLRWMNY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRPNIKRGNY+KEE+ETIV++HE+LGN+WSAIAA LPGRTDNEIKNHWHT
Sbjct  61   LRPNIKRGNYSKEEEETIVKLHEKLGNRWSAIAAQLPGRTDNEIKNHWHT  110



>ref|XP_002319935.1| hypothetical protein POPTR_0013s14560g [Populus trichocarpa]
 gb|EEE95858.1| hypothetical protein POPTR_0013s14560g [Populus trichocarpa]
Length=256

 Score =   219 bits (557),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 95/110 (86%), Positives = 103/110 (94%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            MVRTPCCDK+G KKG WTPEEDRKL AYVTRYGCWNWRQLPKFAGL RCGKSCRLRW+NY
Sbjct  1    MVRTPCCDKTGLKKGAWTPEEDRKLMAYVTRYGCWNWRQLPKFAGLQRCGKSCRLRWLNY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRPNIKRGNY+KEE+ETI+ +HE +GN+WSAIAA LPGRTDNEIKNHWHT
Sbjct  61   LRPNIKRGNYSKEEEETIISLHETMGNRWSAIAAQLPGRTDNEIKNHWHT  110



>gb|KDO55822.1| hypothetical protein CISIN_1g024860mg [Citrus sinensis]
Length=261

 Score =   219 bits (557),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 97/110 (88%), Positives = 105/110 (95%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            MVRTPCCDK+G KKGTWTPEEDRKL AYVT+YG WNWRQLPK+AGLARCGKSCRLRWMNY
Sbjct  1    MVRTPCCDKTGLKKGTWTPEEDRKLIAYVTKYGYWNWRQLPKYAGLARCGKSCRLRWMNY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRPNIKRGNYTKEE++TI+R+HE LGN+WSAIAA LPGRTDNEIKNHWHT
Sbjct  61   LRPNIKRGNYTKEEEDTIIRLHESLGNRWSAIAAQLPGRTDNEIKNHWHT  110



>ref|NP_001280912.1| myb-related protein Myb4-like [Malus domestica]
 gb|ADL36759.1| MYB domain class transcription factor [Malus domestica]
Length=253

 Score =   217 bits (552),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 95/110 (86%), Positives = 105/110 (95%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            MVRTPC D++G KKGTWTPEEDRKL  YVTRYGCWNWRQLPKFAGL+RCGKSCRLRWMNY
Sbjct  1    MVRTPCRDENGMKKGTWTPEEDRKLIVYVTRYGCWNWRQLPKFAGLSRCGKSCRLRWMNY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRPNIKRGNY+KEE+ETI+++HE+LGN+WSAIAA LPGRTDNEIKNHWHT
Sbjct  61   LRPNIKRGNYSKEEEETIIKLHEKLGNRWSAIAAQLPGRTDNEIKNHWHT  110



>ref|XP_006447415.1| hypothetical protein CICLE_v10016303mg [Citrus clementina]
 ref|XP_006469810.1| PREDICTED: myb-related protein Myb4-like [Citrus sinensis]
 gb|ESR60655.1| hypothetical protein CICLE_v10016303mg [Citrus clementina]
Length=261

 Score =   217 bits (552),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 96/110 (87%), Positives = 104/110 (95%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            MVRTPCCDK+G KKGTWTPEEDRKL AYVT+YG WNWRQLPK+AGLARCGKSCRLRWMNY
Sbjct  1    MVRTPCCDKTGLKKGTWTPEEDRKLIAYVTKYGYWNWRQLPKYAGLARCGKSCRLRWMNY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRPNIKRGNYTKEE++ I+R+HE LGN+WSAIAA LPGRTDNEIKNHWHT
Sbjct  61   LRPNIKRGNYTKEEEDIIIRLHESLGNRWSAIAAQLPGRTDNEIKNHWHT  110



>gb|ABH02922.1| MYB transcription factor MYB122 [Glycine max]
Length=155

 Score =   212 bits (540),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 94/110 (85%), Positives = 104/110 (95%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            MVRTP CDKSG +KGTWTPEEDRKL AYVTRYG WNWRQLP+FAGLARCGKSCRLRWMNY
Sbjct  1    MVRTPSCDKSGTRKGTWTPEEDRKLIAYVTRYGSWNWRQLPRFAGLARCGKSCRLRWMNY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRPN+KRGN+T++EDE I+RMH++LGNKWSAIAA LPGRTDNEIK+HWHT
Sbjct  61   LRPNVKRGNFTQQEDECIIRMHKKLGNKWSAIAAELPGRTDNEIKDHWHT  110



>ref|XP_008341938.1| PREDICTED: myb-related protein Myb4-like [Malus domestica]
Length=258

 Score =   215 bits (548),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 95/110 (86%), Positives = 105/110 (95%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            MVRTPC D++G KKGTWTP+EDRKL AYVTRYGCWNWRQLPKFAGL+RCGKSCRLRWMNY
Sbjct  1    MVRTPCRDENGMKKGTWTPDEDRKLIAYVTRYGCWNWRQLPKFAGLSRCGKSCRLRWMNY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRPNIKRGNY+ EE+ETIV++HE+LGN+WSAIAA LPGRTDNEIKNHWHT
Sbjct  61   LRPNIKRGNYSTEEEETIVKLHEKLGNRWSAIAAQLPGRTDNEIKNHWHT  110



>ref|XP_008230195.1| PREDICTED: myb-related protein Myb4-like [Prunus mume]
Length=279

 Score =   216 bits (549),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 94/110 (85%), Positives = 106/110 (96%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            MVRTPC D++G KKGTWTPEEDRKL AYVTRYGCWNWRQLP+FAGL+RCGKSCRLRWMNY
Sbjct  1    MVRTPCRDENGMKKGTWTPEEDRKLIAYVTRYGCWNWRQLPRFAGLSRCGKSCRLRWMNY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRPNIKRGNY++EE+ETI+++H+QLGN+WSAIAA LPGRTDNEIKNHWHT
Sbjct  61   LRPNIKRGNYSQEEEETIIKLHQQLGNRWSAIAAQLPGRTDNEIKNHWHT  110



>gb|KHN22879.1| Myb-related protein Myb4 [Glycine soja]
Length=323

 Score =   217 bits (553),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 95/110 (86%), Positives = 104/110 (95%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            MVRTP CDKSG +KGTWTPEED KL AYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY
Sbjct  1    MVRTPSCDKSGMRKGTWTPEEDMKLIAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRPN+KRGN+T+EE+E I+RMH++LGN+WSAIAA LPGRTDNEIKNHWHT
Sbjct  61   LRPNLKRGNFTQEEEECIIRMHKKLGNRWSAIAAELPGRTDNEIKNHWHT  110



>ref|XP_007216710.1| hypothetical protein PRUPE_ppa026553mg [Prunus persica]
 gb|EMJ17909.1| hypothetical protein PRUPE_ppa026553mg [Prunus persica]
Length=279

 Score =   216 bits (549),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 94/110 (85%), Positives = 106/110 (96%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            MVRTPC D++G KKGTWTPEEDRKL AYVTRYGCWNWRQLP+FAGL+RCGKSCRLRWMNY
Sbjct  1    MVRTPCRDENGMKKGTWTPEEDRKLIAYVTRYGCWNWRQLPRFAGLSRCGKSCRLRWMNY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRPNIKRGNY++EE+ETI+++H+QLGN+WSAIAA LPGRTDNEIKNHWHT
Sbjct  61   LRPNIKRGNYSQEEEETIIKLHQQLGNRWSAIAAQLPGRTDNEIKNHWHT  110



>ref|XP_010095861.1| Myb-related protein Myb4 [Morus notabilis]
 gb|EXB62329.1| Myb-related protein Myb4 [Morus notabilis]
Length=296

 Score =   216 bits (550),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 93/110 (85%), Positives = 102/110 (93%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            MVRTP CD++G KKGTWTPEEDRKL AYVTRYGCWNWRQLPKFAGL RCGKSCRLRWMNY
Sbjct  1    MVRTPYCDQNGMKKGTWTPEEDRKLVAYVTRYGCWNWRQLPKFAGLKRCGKSCRLRWMNY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRPN+KRGNY+KEE+ETI+ +HE LGN+WS IAA LPGRTDNE+KNHWHT
Sbjct  61   LRPNLKRGNYSKEEEETIIGLHESLGNRWSTIAAQLPGRTDNEVKNHWHT  110



>ref|XP_003540870.1| PREDICTED: myb-related protein Myb4 isoform X1 [Glycine max]
 gb|KHN22880.1| Myb-related protein Myb4 [Glycine soja]
Length=305

 Score =   216 bits (550),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 95/110 (86%), Positives = 104/110 (95%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            MVRTP CDKSG +KGTWTPEEDRKL AYVTRYG WNWRQLP+FAGLARCGKSCRLRWMNY
Sbjct  1    MVRTPSCDKSGTRKGTWTPEEDRKLIAYVTRYGSWNWRQLPRFAGLARCGKSCRLRWMNY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRPN+KRGN+T++EDE I+RMH++LGNKWSAIAA LPGRTDNEIKNHWHT
Sbjct  61   LRPNVKRGNFTQQEDECIIRMHKKLGNKWSAIAAELPGRTDNEIKNHWHT  110



>ref|XP_009350432.1| PREDICTED: myb-related protein Myb4-like [Pyrus x bretschneideri]
Length=258

 Score =   214 bits (544),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 95/110 (86%), Positives = 105/110 (95%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            MVRTPC D++G KKGTWTP+EDRKL AYVTRYG WNWRQLPKFAGL+RCGKSCRLRWMNY
Sbjct  1    MVRTPCRDENGMKKGTWTPDEDRKLIAYVTRYGYWNWRQLPKFAGLSRCGKSCRLRWMNY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRPNIKRGNY+KEE+ETIV++HE+LGN+WSAIAA LPGRTDNEIKNHWHT
Sbjct  61   LRPNIKRGNYSKEEEETIVKLHEKLGNRWSAIAAQLPGRTDNEIKNHWHT  110



>ref|XP_003526304.1| PREDICTED: myb-related protein Myb4-like [Glycine max]
 gb|KHN41178.1| Myb-related protein Myb4 [Glycine soja]
Length=324

 Score =   215 bits (547),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 94/110 (85%), Positives = 103/110 (94%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            MVRTP CDKSG +KGTWTPEED KL AYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY
Sbjct  1    MVRTPSCDKSGMRKGTWTPEEDMKLIAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRPNIKRGN+T++E+E I+RMH++LGN+WSAIA  LPGRTDNEIKNHWHT
Sbjct  61   LRPNIKRGNFTQQEEECIIRMHKKLGNRWSAIAVELPGRTDNEIKNHWHT  110



>ref|XP_009624516.1| PREDICTED: myb-related protein Myb4-like [Nicotiana tomentosiformis]
Length=248

 Score =   211 bits (538),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 93/110 (85%), Positives = 103/110 (94%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            MVRTP  D++G KKGTWTPEEDRKLAAYVT+YGCWNWRQLPK+AGLARCGKSCRLRWMNY
Sbjct  1    MVRTPSYDENGKKKGTWTPEEDRKLAAYVTKYGCWNWRQLPKYAGLARCGKSCRLRWMNY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRPNIKRGNYTKEED+ I+++H QLGN+WS IA HLPGR+DNEIKNHWHT
Sbjct  61   LRPNIKRGNYTKEEDDIILKLHAQLGNRWSIIAGHLPGRSDNEIKNHWHT  110



>ref|XP_002272704.1| PREDICTED: myb-related protein Myb4 [Vitis vinifera]
 emb|CBI18001.3| unnamed protein product [Vitis vinifera]
Length=257

 Score =   211 bits (538),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 92/110 (84%), Positives = 103/110 (94%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            MVRTPCCDKSG KKGTWTPEED KL AY+TRYGCWNWR+LPK+AGL RCGKSCRLRWMNY
Sbjct  1    MVRTPCCDKSGLKKGTWTPEEDHKLVAYITRYGCWNWRRLPKYAGLMRCGKSCRLRWMNY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRPNIKRGNY+KEE++TI+++H  LGN+WSAIAA LPGRTDNEIKN+WHT
Sbjct  61   LRPNIKRGNYSKEEEDTIIKLHASLGNRWSAIAAQLPGRTDNEIKNYWHT  110



>ref|XP_004513559.1| PREDICTED: myb-related protein Myb4-like isoform X2 [Cicer arietinum]
Length=283

 Score =   212 bits (540),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 91/110 (83%), Positives = 102/110 (93%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            M RTP CDKSG +KGTWT EEDRKL AYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY
Sbjct  1    MARTPSCDKSGMRKGTWTAEEDRKLIAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRPNIKRGN+T++E+E I++MH+++GNKWS IAA LPGRTDNE+KNHWHT
Sbjct  61   LRPNIKRGNFTQDEEELIIKMHKKMGNKWSTIAAELPGRTDNEVKNHWHT  110



>emb|CAN72480.1| hypothetical protein VITISV_019320 [Vitis vinifera]
Length=284

 Score =   212 bits (540),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 92/110 (84%), Positives = 103/110 (94%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            MVRTPCCDKSG KKGTWTPEED KL AY+TRYGCWNWR+LPK+AGL RCGKSCRLRWMNY
Sbjct  1    MVRTPCCDKSGLKKGTWTPEEDHKLVAYITRYGCWNWRRLPKYAGLMRCGKSCRLRWMNY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRPNIKRGNY+KEE++TI+++H  LGN+WSAIAA LPGRTDNEIKN+WHT
Sbjct  61   LRPNIKRGNYSKEEEDTIIKLHASLGNRWSAIAAQLPGRTDNEIKNYWHT  110



>ref|XP_009779987.1| PREDICTED: myb-related protein Myb4-like [Nicotiana sylvestris]
Length=245

 Score =   211 bits (537),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 91/110 (83%), Positives = 103/110 (94%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            M RT C DKSG KKGTWTP+EDRKLAAYV++YGCWNWRQLPKFAGLARCGKSCRLRW+NY
Sbjct  1    MARTRCYDKSGLKKGTWTPDEDRKLAAYVSKYGCWNWRQLPKFAGLARCGKSCRLRWLNY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            L+PNIKRGNYTKEEDE I+++H ++GNKWS IAAHLPGR+DN+IKNHWHT
Sbjct  61   LQPNIKRGNYTKEEDEIIMKLHAEIGNKWSVIAAHLPGRSDNDIKNHWHT  110



>ref|XP_004513558.1| PREDICTED: myb-related protein Myb4-like isoform X1 [Cicer arietinum]
Length=309

 Score =   213 bits (541),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 91/110 (83%), Positives = 102/110 (93%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            M RTP CDKSG +KGTWT EEDRKL AYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY
Sbjct  1    MARTPSCDKSGMRKGTWTAEEDRKLIAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRPNIKRGN+T++E+E I++MH+++GNKWS IAA LPGRTDNE+KNHWHT
Sbjct  61   LRPNIKRGNFTQDEEELIIKMHKKMGNKWSTIAAELPGRTDNEVKNHWHT  110



>ref|XP_009594011.1| PREDICTED: myb-related protein Myb4-like [Nicotiana tomentosiformis]
Length=247

 Score =   210 bits (534),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 91/110 (83%), Positives = 102/110 (93%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            M RT C DKSG KKGTWTP+EDRKLAAYV++YGCWNWRQLPKFAGL+RCGKSCRLRW+NY
Sbjct  1    MARTRCYDKSGLKKGTWTPDEDRKLAAYVSKYGCWNWRQLPKFAGLSRCGKSCRLRWLNY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            L+PNIKRGNYTKEEDE I+++H ++GNKWS IAAHLPGRTDN IKNHWHT
Sbjct  61   LQPNIKRGNYTKEEDEIIMKLHAEIGNKWSVIAAHLPGRTDNGIKNHWHT  110



>ref|XP_004243413.1| PREDICTED: myb-related protein Myb4-like [Solanum lycopersicum]
Length=251

 Score =   210 bits (534),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 94/110 (85%), Positives = 103/110 (94%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            MVRTPC D++G KKGTWTPEEDRKLAAY+T+YG WNWRQLPK+AGLARCGKSCRLRWMNY
Sbjct  1    MVRTPCRDENGRKKGTWTPEEDRKLAAYITKYGSWNWRQLPKYAGLARCGKSCRLRWMNY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRPN+KRGNYTKEEDE I+ +H QLGNKWSAIA HLPGR+DNEIKNHWHT
Sbjct  61   LRPNVKRGNYTKEEDEIILNLHAQLGNKWSAIAIHLPGRSDNEIKNHWHT  110



>ref|XP_004243822.1| PREDICTED: transcription factor WER-like [Solanum lycopersicum]
Length=249

 Score =   210 bits (534),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 93/110 (85%), Positives = 102/110 (93%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            MVRTPC D+ G KKGTWTPEEDRKLAAY+T+YG WNWRQLPK+AGLARCGKSCRLRWMNY
Sbjct  1    MVRTPCHDEHGRKKGTWTPEEDRKLAAYITKYGSWNWRQLPKYAGLARCGKSCRLRWMNY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRPN+KRGNYTKEEDE I+ +H QLGNKWS IA+HLPGR+DNEIKNHWHT
Sbjct  61   LRPNVKRGNYTKEEDEIILNLHAQLGNKWSTIASHLPGRSDNEIKNHWHT  110



>ref|XP_011047495.1| PREDICTED: myb-related protein Myb4-like [Populus euphratica]
Length=249

 Score =   208 bits (530),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 91/110 (83%), Positives = 99/110 (90%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            M RTPCCDK+  KKG+WTPEED KL AYVTRYG WNWRQLPK+AGL RCGKSCRLRW+NY
Sbjct  1    MARTPCCDKTELKKGSWTPEEDMKLMAYVTRYGSWNWRQLPKYAGLQRCGKSCRLRWLNY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRPNIKRGNYTKEE+E I+ +HE LGN+WSAIAA LPGRTDNEIKNHWHT
Sbjct  61   LRPNIKRGNYTKEEEEIIISLHETLGNRWSAIAAQLPGRTDNEIKNHWHT  110



>ref|XP_002325681.1| hypothetical protein POPTR_0019s14140g [Populus trichocarpa]
 gb|EEF00063.1| hypothetical protein POPTR_0019s14140g [Populus trichocarpa]
Length=250

 Score =   208 bits (530),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 91/110 (83%), Positives = 98/110 (89%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            M RTPCCDK+  KKG WTPEED KL AYVTRYG WNWRQLPK+AGL RCGKSCRLRW+NY
Sbjct  1    MARTPCCDKTELKKGAWTPEEDMKLMAYVTRYGSWNWRQLPKYAGLQRCGKSCRLRWLNY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRPNIKRGNYTKEE+E I+ +HE LGN+WSAIAA LPGRTDNEIKNHWHT
Sbjct  61   LRPNIKRGNYTKEEEEIIISLHETLGNRWSAIAAQLPGRTDNEIKNHWHT  110



>ref|XP_006360585.1| PREDICTED: myb-related protein Myb4-like [Solanum tuberosum]
Length=245

 Score =   208 bits (529),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 93/110 (85%), Positives = 102/110 (93%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            MVRTPC D++G KKGTWTPEEDRKLAAY+T+YG WNWRQLPK+AGLARCGKSCRLRWMNY
Sbjct  1    MVRTPCRDENGRKKGTWTPEEDRKLAAYITKYGSWNWRQLPKYAGLARCGKSCRLRWMNY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            L PN+KRGNYTKEEDE I+ +H QLGNKWSAIA HLPGR+DNEIKNHWHT
Sbjct  61   LSPNVKRGNYTKEEDEIILNLHAQLGNKWSAIAVHLPGRSDNEIKNHWHT  110



>ref|XP_009800612.1| PREDICTED: myb-related protein Myb4-like [Nicotiana sylvestris]
Length=242

 Score =   207 bits (528),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 93/110 (85%), Positives = 102/110 (93%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            MVRT   D++G KKGTWTPEEDRKLAAYVT+YGCWNWRQLPK AGLARCGKSCRLRWMNY
Sbjct  1    MVRTTSYDENGKKKGTWTPEEDRKLAAYVTKYGCWNWRQLPKHAGLARCGKSCRLRWMNY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRPNIKRGNYTKEED+ I+++H QLGN+WS IAAHLPGR+DNEIKNHWHT
Sbjct  61   LRPNIKRGNYTKEEDDIILKLHAQLGNRWSTIAAHLPGRSDNEIKNHWHT  110



>ref|XP_003526305.2| PREDICTED: myb-related protein Myb4-like [Glycine max]
Length=230

 Score =   206 bits (524),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 90/110 (82%), Positives = 101/110 (92%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            MVRTP CDK+G KKGTWTPEED+KL  Y+TRYG WNWR LPKFAGLARCGKSCRLRW+NY
Sbjct  2    MVRTPSCDKNGVKKGTWTPEEDKKLVEYITRYGHWNWRLLPKFAGLARCGKSCRLRWLNY  61

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRPN+KRGNYTKEE+ETI+++H  LGN+WSAIAA +PGRTDNEIKNHWHT
Sbjct  62   LRPNLKRGNYTKEEEETIIKLHRHLGNRWSAIAARMPGRTDNEIKNHWHT  111



>gb|KHN41179.1| Myb-related protein Myb4 [Glycine soja]
Length=229

 Score =   206 bits (524),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 90/110 (82%), Positives = 101/110 (92%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            MVRTP CDK+G KKGTWTPEED+KL  Y+TRYG WNWR LPKFAGLARCGKSCRLRW+NY
Sbjct  1    MVRTPSCDKNGVKKGTWTPEEDKKLVEYITRYGHWNWRLLPKFAGLARCGKSCRLRWLNY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRPN+KRGNYTKEE+ETI+++H  LGN+WSAIAA +PGRTDNEIKNHWHT
Sbjct  61   LRPNLKRGNYTKEEEETIIKLHRHLGNRWSAIAARMPGRTDNEIKNHWHT  110



>ref|XP_007132611.1| hypothetical protein PHAVU_011G109600g [Phaseolus vulgaris]
 gb|ESW04605.1| hypothetical protein PHAVU_011G109600g [Phaseolus vulgaris]
Length=323

 Score =   209 bits (531),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 92/110 (84%), Positives = 101/110 (92%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            MVRTP CDKSG +KGTWTPEED KL AYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY
Sbjct  1    MVRTPSCDKSGLRKGTWTPEEDMKLVAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRPN+KRGN+T +E+E I+RM ++ GN+WSAIAA LPGRTDNEIKNHWHT
Sbjct  61   LRPNLKRGNFTPQEEECIIRMLKKHGNRWSAIAAELPGRTDNEIKNHWHT  110



>gb|KHN41177.1| Myb-related protein Myb4 [Glycine soja]
Length=318

 Score =   208 bits (530),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 90/110 (82%), Positives = 102/110 (93%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            MVRTP CDKSG +KGTWT EEDRKL AYVTRYG WNWRQLP+FAGLARCGKSCRLRWMNY
Sbjct  1    MVRTPSCDKSGMRKGTWTLEEDRKLIAYVTRYGSWNWRQLPRFAGLARCGKSCRLRWMNY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRP++KRGN+T++E+E I+RMH++LGN+WS IAA LPGRTDNEIKNHWHT
Sbjct  61   LRPDVKRGNFTQQEEEFIIRMHKKLGNRWSTIAAELPGRTDNEIKNHWHT  110



>ref|XP_003526303.1| PREDICTED: myb-related protein Myb4 [Glycine max]
Length=318

 Score =   208 bits (530),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 90/110 (82%), Positives = 102/110 (93%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            MVRTP CDKSG +KGTWT EEDRKL AYVTRYG WNWRQLP+FAGLARCGKSCRLRWMNY
Sbjct  1    MVRTPSCDKSGMRKGTWTLEEDRKLIAYVTRYGSWNWRQLPRFAGLARCGKSCRLRWMNY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRP++KRGN+T++E+E I+RMH++LGN+WS IAA LPGRTDNEIKNHWHT
Sbjct  61   LRPDVKRGNFTQQEEEFIIRMHKKLGNRWSTIAAELPGRTDNEIKNHWHT  110



>gb|KEH17561.1| myb-related transcription factor [Medicago truncatula]
Length=272

 Score =   206 bits (523),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 91/111 (82%), Positives = 102/111 (92%), Gaps = 1/111 (1%)
 Frame = -2

Query  544  MVRTPCCDK-SGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMN  368
            M RTP CDK SG +KGTWT EEDRKL AYVTRYGCWNWRQLPKFAGL+RCGKSCRLRW+N
Sbjct  1    MARTPSCDKKSGMRKGTWTAEEDRKLIAYVTRYGCWNWRQLPKFAGLSRCGKSCRLRWLN  60

Query  367  YLRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            YLRPNIKRGN+T+EE+E I+RMH++LGN+WS IAA LPGRTDNE+KNHWHT
Sbjct  61   YLRPNIKRGNFTQEEEELIIRMHKKLGNRWSTIAAELPGRTDNEVKNHWHT  111



>ref|XP_006360526.1| PREDICTED: myb-related protein Myb4-like [Solanum tuberosum]
Length=245

 Score =   204 bits (520),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 91/110 (83%), Positives = 101/110 (92%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            MVRTPC D++G KKGTWTPEEDRKLA Y+T+YG WNWRQLPK+AGL RCGKSCRLRWMNY
Sbjct  1    MVRTPCRDENGRKKGTWTPEEDRKLADYITKYGSWNWRQLPKYAGLERCGKSCRLRWMNY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRPN+KRGNYTKEEDE I+ +H QLGNKWSAI+ HLPGR+DNEIKNHWHT
Sbjct  61   LRPNVKRGNYTKEEDEIILNLHAQLGNKWSAISVHLPGRSDNEIKNHWHT  110



>ref|XP_003541925.1| PREDICTED: myb-related protein Myb4-like [Glycine max]
Length=227

 Score =   204 bits (518),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 91/110 (83%), Positives = 102/110 (93%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            MVRTPCCDK+G KKG WTPEEDRKL  YVT+YG WNWR LPKFAGLARCGKSCRLRW+NY
Sbjct  1    MVRTPCCDKNGLKKGPWTPEEDRKLIDYVTKYGHWNWRLLPKFAGLARCGKSCRLRWLNY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRP++KRGN++ EE+ETIVR+HE+LGN+WSAIAA LPGRTDNEIKNHWHT
Sbjct  61   LRPDVKRGNFSHEEEETIVRLHEKLGNRWSAIAAELPGRTDNEIKNHWHT  110



>ref|XP_007132612.1| hypothetical protein PHAVU_011G109700g [Phaseolus vulgaris]
 gb|ESW04606.1| hypothetical protein PHAVU_011G109700g [Phaseolus vulgaris]
Length=324

 Score =   205 bits (522),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 91/110 (83%), Positives = 101/110 (92%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            MVRTP  DKSG +KGTWTPEEDRKL AYVTRYG WNWRQLP+FAGLARCGKSCRLRWMNY
Sbjct  1    MVRTPSWDKSGLRKGTWTPEEDRKLIAYVTRYGSWNWRQLPRFAGLARCGKSCRLRWMNY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRPN+KRGN+T +E+E I+RM ++LGN+WSAIAA LPGRTDNEIKNHWHT
Sbjct  61   LRPNVKRGNFTPQEEECIIRMLKKLGNRWSAIAAELPGRTDNEIKNHWHT  110



>gb|KEH16274.1| myb-related transcription factor [Medicago truncatula]
Length=272

 Score =   203 bits (517),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 90/111 (81%), Positives = 101/111 (91%), Gaps = 1/111 (1%)
 Frame = -2

Query  544  MVRTPCCDK-SGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMN  368
            M RTP CDK SG +KGTWT EEDRKL AYVTRYGCWNWRQLPKFAGL+RCGKSCRLRW+N
Sbjct  1    MARTPSCDKKSGMRKGTWTAEEDRKLIAYVTRYGCWNWRQLPKFAGLSRCGKSCRLRWLN  60

Query  367  YLRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            YLRPNIKRGN+T+EE+E I+RMH+ LGN+WS IAA LPGRTDNE+KN+WHT
Sbjct  61   YLRPNIKRGNFTQEEEELIIRMHKNLGNRWSTIAAELPGRTDNEVKNYWHT  111



>gb|AFK38645.1| unknown [Medicago truncatula]
Length=272

 Score =   203 bits (516),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 91/111 (82%), Positives = 101/111 (91%), Gaps = 1/111 (1%)
 Frame = -2

Query  544  MVRTPCCDK-SGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMN  368
            M RTP CDK SG +KGTWT EEDRKL AYVTRYGCWNWRQLPKFAGL+RCGKSCRLRW+N
Sbjct  1    MARTPSCDKKSGMRKGTWTAEEDRKLIAYVTRYGCWNWRQLPKFAGLSRCGKSCRLRWLN  60

Query  367  YLRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            YLRPNIKRGN+T+EE+E I+RMH++LGN+WS IAA LPGRTDNE KNHWHT
Sbjct  61   YLRPNIKRGNFTQEEEELIIRMHKKLGNRWSTIAAELPGRTDNEEKNHWHT  111



>ref|XP_003597081.1| MYB transcription factor [Medicago truncatula]
 gb|AES67332.1| myb transcription factor [Medicago truncatula]
Length=250

 Score =   202 bits (514),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 86/110 (78%), Positives = 104/110 (95%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            MVRTP CDK+G +KGTWTPEED+KL AYVTRYGCWNWRQLPKFAGL RCGKSCRLRW+NY
Sbjct  1    MVRTPYCDKNGLRKGTWTPEEDKKLIAYVTRYGCWNWRQLPKFAGLERCGKSCRLRWLNY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRP+IKRG+++ EE+ETI+++HE+LGN+W+ I+A+LPGRTDNEIKN+WHT
Sbjct  61   LRPDIKRGSFSHEEEETIIKLHEKLGNRWTMISANLPGRTDNEIKNYWHT  110



>gb|KDP44603.1| hypothetical protein JCGZ_19745 [Jatropha curcas]
 gb|AIT52290.1| MYB family protein [Jatropha curcas]
Length=233

 Score =   202 bits (513),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 86/110 (78%), Positives = 101/110 (92%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            MVRTPCCDKSG KKGTW+PEEDRKL  Y++R GCWNWRQLPK+AGL RCGKSCRLRW+NY
Sbjct  1    MVRTPCCDKSGLKKGTWSPEEDRKLMDYISRNGCWNWRQLPKYAGLLRCGKSCRLRWLNY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRPNIKRGN++KEE++ I+R+H+ LGN+WSAIAA LPGRTDN+IKN WH+
Sbjct  61   LRPNIKRGNFSKEEEDAIIRLHDSLGNRWSAIAAQLPGRTDNDIKNLWHS  110



>gb|KEH17564.1| myb-related transcription factor [Medicago truncatula]
Length=291

 Score =   203 bits (517),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 90/111 (81%), Positives = 101/111 (91%), Gaps = 1/111 (1%)
 Frame = -2

Query  544  MVRTPCCDK-SGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMN  368
            M RTP CDK SG +KGTWT EEDRKL AYVTRYG WNWRQLPKFAGL+RCGKSCRLRW+N
Sbjct  1    MARTPSCDKISGMRKGTWTAEEDRKLIAYVTRYGFWNWRQLPKFAGLSRCGKSCRLRWLN  60

Query  367  YLRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            YLRPNI+RGN+TK+E+E I+RMH++LGNKWS IAA LPGRTDNE+KNHWHT
Sbjct  61   YLRPNIRRGNFTKDEEELIIRMHKKLGNKWSTIAAELPGRTDNEVKNHWHT  111



>ref|XP_007149916.1| hypothetical protein PHAVU_005G109800g [Phaseolus vulgaris]
 gb|ESW21910.1| hypothetical protein PHAVU_005G109800g [Phaseolus vulgaris]
Length=227

 Score =   199 bits (507),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 87/110 (79%), Positives = 100/110 (91%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            M RTPCCDK+G KKG+WT EED+KL AYVT+YG WNWR LPKFAGLARCGKSCRLRW+NY
Sbjct  1    MARTPCCDKNGLKKGSWTREEDKKLIAYVTKYGHWNWRLLPKFAGLARCGKSCRLRWLNY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRP++KRGN++ EE+E IVR+HE+LGN+WS IAA LPGRTDNEIKNHWHT
Sbjct  61   LRPDVKRGNFSDEEEEIIVRLHEKLGNRWSTIAAELPGRTDNEIKNHWHT  110



>gb|KHN04301.1| Myb-related protein Zm1 [Glycine soja]
Length=313

 Score =   202 bits (513),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 90/110 (82%), Positives = 98/110 (89%), Gaps = 1/110 (1%)
 Frame = -2

Query  541  VRTPCCD-KSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            +RTP    KSG  KGTWTPEED KL AY+TRYG WNWRQLP+FAGLARCGKSCRLRW+NY
Sbjct  1    MRTPSSSHKSGLNKGTWTPEEDAKLIAYITRYGSWNWRQLPRFAGLARCGKSCRLRWLNY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRPNIKRGNYTKEE+E I+R+HE+LGNKWS IA HLPGRTDNEIKNHWHT
Sbjct  61   LRPNIKRGNYTKEEEEIIIRLHEKLGNKWSVIATHLPGRTDNEIKNHWHT  110



>ref|XP_003540332.2| PREDICTED: myb-related protein Myb4-like [Glycine max]
Length=313

 Score =   202 bits (513),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 90/110 (82%), Positives = 98/110 (89%), Gaps = 1/110 (1%)
 Frame = -2

Query  541  VRTPCCD-KSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            +RTP    KSG  KGTWTPEED KL AY+TRYG WNWRQLP+FAGLARCGKSCRLRW+NY
Sbjct  1    MRTPSSSHKSGLNKGTWTPEEDAKLIAYITRYGSWNWRQLPRFAGLARCGKSCRLRWLNY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRPNIKRGNYTKEE+E I+R+HE+LGNKWS IA HLPGRTDNEIKNHWHT
Sbjct  61   LRPNIKRGNYTKEEEEIIIRLHEKLGNKWSVIATHLPGRTDNEIKNHWHT  110



>ref|XP_010051469.1| PREDICTED: myb-related protein Myb4-like [Eucalyptus grandis]
 gb|KCW89469.1| hypothetical protein EUGRSUZ_A01767 [Eucalyptus grandis]
Length=242

 Score =   199 bits (506),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 89/110 (81%), Positives = 100/110 (91%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            M RTP  DK+G KKGTWTPEEDRKL AYV++YG WNWRQLPK+AGL+RCGKSCRLRWMNY
Sbjct  1    MARTPGRDKNGMKKGTWTPEEDRKLKAYVSKYGFWNWRQLPKYAGLSRCGKSCRLRWMNY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRP+IKRGNYTKEE++TIVR+   LGNKWSAIA+ LPGRTDNE+KNHWHT
Sbjct  61   LRPDIKRGNYTKEEEDTIVRLQGLLGNKWSAIASQLPGRTDNEVKNHWHT  110



>ref|XP_004293474.1| PREDICTED: transcription factor MYB28-like [Fragaria vesca subsp. 
vesca]
Length=266

 Score =   200 bits (508),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 94/110 (85%), Positives = 102/110 (93%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            MVRTPCCD+ G KKGTWTPEEDRKL AYVTRYGCWNWRQLPKFAGL+RCGKSCRLRW+NY
Sbjct  1    MVRTPCCDERGMKKGTWTPEEDRKLIAYVTRYGCWNWRQLPKFAGLSRCGKSCRLRWLNY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRPNIKRGNYT EE+E I+ +HE+LGNKWSAIAA L GRTDNE+KNHWHT
Sbjct  61   LRPNIKRGNYTTEEEEIIITLHEKLGNKWSAIAAQLEGRTDNEVKNHWHT  110



>ref|XP_007149915.1| hypothetical protein PHAVU_005G109700g [Phaseolus vulgaris]
 gb|ESW21909.1| hypothetical protein PHAVU_005G109700g [Phaseolus vulgaris]
Length=326

 Score =   201 bits (510),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 87/109 (80%), Positives = 98/109 (90%), Gaps = 0/109 (0%)
 Frame = -2

Query  541  VRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNYL  362
            +RTP  D SG KKGTWT EEDRKL AYVTRYG WNWRQLP+FAGL RCGKSCRLRW+NYL
Sbjct  1    MRTPSWDSSGLKKGTWTQEEDRKLVAYVTRYGTWNWRQLPRFAGLTRCGKSCRLRWLNYL  60

Query  361  RPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            RPNIKRGN+T++E+ETI+++HE+LGNKWS IA HLPGRTDNEIKN WHT
Sbjct  61   RPNIKRGNFTEKEEETIIKLHEELGNKWSVIATHLPGRTDNEIKNQWHT  109



>ref|XP_007132610.1| hypothetical protein PHAVU_011G109500g [Phaseolus vulgaris]
 gb|ESW04604.1| hypothetical protein PHAVU_011G109500g [Phaseolus vulgaris]
Length=229

 Score =   197 bits (502),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 86/110 (78%), Positives = 100/110 (91%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            MVRTP  DK+G KKGTWTPEED+KL  Y+TRYG WNWR LPKFAGLARCGKSCRLRW+NY
Sbjct  2    MVRTPSSDKNGLKKGTWTPEEDQKLVDYITRYGHWNWRLLPKFAGLARCGKSCRLRWLNY  61

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRPN+KRGNY++EE+ETI+++H  LGN+WSAIAA +PGRTDNEIKN+WHT
Sbjct  62   LRPNLKRGNYSEEEEETIIKLHRHLGNRWSAIAARIPGRTDNEIKNYWHT  111



>ref|XP_004252033.1| PREDICTED: myb-related protein Myb4-like [Solanum lycopersicum]
Length=233

 Score =   196 bits (499),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 88/111 (79%), Positives = 100/111 (90%), Gaps = 1/111 (1%)
 Frame = -2

Query  544  MVRTPCCDK-SGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMN  368
            M R  C DK SG KKGTWT EED+KLAAYV +YGCWNWRQLPKFAGL+RCGKSCRLRW+N
Sbjct  1    MARIRCYDKKSGLKKGTWTLEEDKKLAAYVNKYGCWNWRQLPKFAGLSRCGKSCRLRWLN  60

Query  367  YLRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            YLRPNIKRGNYT+EED+ I+++H ++GNKWSAIA HLPGR+DNEIKNHWHT
Sbjct  61   YLRPNIKRGNYTREEDQIIMKLHAEIGNKWSAIAIHLPGRSDNEIKNHWHT  111



>ref|XP_010069815.1| PREDICTED: myb-related protein Myb4-like [Eucalyptus grandis]
 gb|KCW89468.1| hypothetical protein EUGRSUZ_A01766 [Eucalyptus grandis]
Length=239

 Score =   196 bits (499),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 88/110 (80%), Positives = 101/110 (92%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            M RTP  DK+G KKGTWTPEED+KL AYV+RYG WNWR+LPK+AGL+RCGKSCRLRWMNY
Sbjct  1    MARTPGRDKNGMKKGTWTPEEDKKLRAYVSRYGYWNWRKLPKYAGLSRCGKSCRLRWMNY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRP+IKRGNYTKEE++TI+R+   LGNKWSAIA+HLPGRTDNE+KNHWHT
Sbjct  61   LRPDIKRGNYTKEEEDTIIRLQGLLGNKWSAIASHLPGRTDNEVKNHWHT  110



>ref|XP_010277889.1| PREDICTED: myb-related protein Myb4-like [Nelumbo nucifera]
Length=276

 Score =   196 bits (498),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 84/110 (76%), Positives = 100/110 (91%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            MV++PCC++ G KKGTWT EED+KL AY+ RYG WNW QLPK+AGL+RCGKSCRLRWMNY
Sbjct  1    MVKSPCCERIGLKKGTWTLEEDQKLIAYIKRYGHWNWLQLPKYAGLSRCGKSCRLRWMNY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRP+IKRGNY++EE+E I+ +HE+LGNKW+AIAA LPGRTDNEIKNHWHT
Sbjct  61   LRPDIKRGNYSREEEEAIINLHEKLGNKWTAIAARLPGRTDNEIKNHWHT  110



>ref|XP_002276962.1| PREDICTED: transcription factor MYB114 [Vitis vinifera]
 emb|CBI18002.3| unnamed protein product [Vitis vinifera]
Length=252

 Score =   191 bits (486),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 85/110 (77%), Positives = 97/110 (88%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            MVR PC DK G KKG W+PEED KL AYV RYG WNWR+LP+FAGL+RCGKSCRLRW+NY
Sbjct  1    MVRNPCYDKYGRKKGAWSPEEDEKLRAYVQRYGHWNWRELPRFAGLSRCGKSCRLRWLNY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRPN+KRGNY+K E+ETI ++HE+LGNKWSAIA  LPGRTDNEIKN+WHT
Sbjct  61   LRPNVKRGNYSKAEEETIKKLHEELGNKWSAIAKKLPGRTDNEIKNYWHT  110



>gb|KHN04302.1| Myb-related protein Myb4 [Glycine soja]
Length=251

 Score =   191 bits (484),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 85/110 (77%), Positives = 97/110 (88%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            MV+    DKSG +KGTWTPEED+KL AY+TRYG WNW  LPKFAGL RCGKSCRLRW+NY
Sbjct  1    MVKNTYSDKSGHRKGTWTPEEDKKLIAYITRYGHWNWNLLPKFAGLERCGKSCRLRWLNY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRPNIKRGNYT+EEDETI++M ++LGN+WS IAA LPGRTDNEIKN+WHT
Sbjct  61   LRPNIKRGNYTQEEDETIIKMVQRLGNRWSLIAAQLPGRTDNEIKNYWHT  110



>ref|XP_003539518.1| PREDICTED: myb-related protein Myb4-like [Glycine max]
Length=251

 Score =   191 bits (484),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 85/110 (77%), Positives = 97/110 (88%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            MV+    DKSG +KGTWTPEED+KL AY+TRYG WNW  LPKFAGL RCGKSCRLRW+NY
Sbjct  1    MVKNTYSDKSGHRKGTWTPEEDKKLIAYITRYGHWNWNLLPKFAGLERCGKSCRLRWLNY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRPNIKRGNYT+EEDETI++M ++LGN+WS IAA LPGRTDNEIKN+WHT
Sbjct  61   LRPNIKRGNYTQEEDETIIKMVQRLGNRWSLIAAQLPGRTDNEIKNYWHT  110



>ref|XP_006593053.1| PREDICTED: myb-related protein Myb4-like [Glycine max]
Length=319

 Score =   191 bits (486),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 83/95 (87%), Positives = 91/95 (96%), Gaps = 0/95 (0%)
 Frame = -2

Query  499  TWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNYLRPNIKRGNYTKEED  320
            TWTPEED KL AYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNYLRPN+KRGN+T+EE+
Sbjct  12   TWTPEEDMKLIAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNYLRPNLKRGNFTQEEE  71

Query  319  ETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            E I+RMH++LGN+WSAIAA LPGRTDNEIKNHWHT
Sbjct  72   ECIIRMHKKLGNRWSAIAAELPGRTDNEIKNHWHT  106



>ref|XP_007149917.1| hypothetical protein PHAVU_005G109900g [Phaseolus vulgaris]
 gb|ESW21911.1| hypothetical protein PHAVU_005G109900g [Phaseolus vulgaris]
Length=232

 Score =   189 bits (479),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 84/110 (76%), Positives = 96/110 (87%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            MV+    +KS  +KGTWTPEED+KL+AYVTRYG WNW  LPKFAGL RCGKSCRLRW+NY
Sbjct  1    MVKCTFSEKSRLRKGTWTPEEDKKLSAYVTRYGHWNWNLLPKFAGLERCGKSCRLRWLNY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRPNIKRGNYTKEEDETI+++ + LGN+WS IAA LPGRTDNEIKN+WHT
Sbjct  61   LRPNIKRGNYTKEEDETIIKLLQSLGNRWSVIAAQLPGRTDNEIKNYWHT  110



>gb|AES67329.2| myb transcription factor [Medicago truncatula]
Length=451

 Score =   194 bits (494),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 81/110 (74%), Positives = 100/110 (91%), Gaps = 1/110 (1%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            MVRTPC D +G +KG+WT EED+KL AYVTRYGCWNWRQLP+FAGL RCGKSCRLRWMNY
Sbjct  1    MVRTPC-DNNGLRKGSWTHEEDKKLIAYVTRYGCWNWRQLPRFAGLERCGKSCRLRWMNY  59

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRP++KRGN+ ++E+E I+++HE+LGN+W+ IA++ PGRTDNEIKNHWHT
Sbjct  60   LRPDVKRGNFNQQEEELIIKLHEKLGNRWTVIASNFPGRTDNEIKNHWHT  109



>ref|XP_006449185.1| hypothetical protein CICLE_v10017679mg, partial [Citrus clementina]
 gb|ESR62425.1| hypothetical protein CICLE_v10017679mg, partial [Citrus clementina]
Length=124

 Score =   184 bits (467),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 78/110 (71%), Positives = 96/110 (87%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            MV+ P  +K   +KG+W PEEDRKL AY+ RYG WNW ++PK+AGL RCGKSCRLRWMNY
Sbjct  1    MVKAPGSEKPSLRKGSWAPEEDRKLIAYIRRYGIWNWSEMPKYAGLLRCGKSCRLRWMNY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRP+I+RGN+T+EEDETI+++H+QLGN+WSAIA+ LP RTDNEIKNHWHT
Sbjct  61   LRPDIRRGNFTQEEDETIIKLHQQLGNRWSAIASRLPRRTDNEIKNHWHT  110



>ref|XP_010323706.1| PREDICTED: transcription factor WER-like [Solanum lycopersicum]
Length=242

 Score =   188 bits (477),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 85/110 (77%), Positives = 99/110 (90%), Gaps = 1/110 (1%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            MVRT C D++G KKG+WT EED+KLAAY+T+YG WNWRQLPK+AGLARCGKSCRLRW+N+
Sbjct  1    MVRTTCYDENGRKKGSWTLEEDKKLAAYITKYGSWNWRQLPKYAGLARCGKSCRLRWINH  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRPN+KRGNYTK EDE I+ +H QLGNKWS IAAHLP R+DNEIKN+WHT
Sbjct  61   LRPNVKRGNYTK-EDEIILNIHAQLGNKWSTIAAHLPERSDNEIKNYWHT  109



>gb|KDO75677.1| hypothetical protein CISIN_1g037956mg, partial [Citrus sinensis]
Length=245

 Score =   188 bits (478),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 79/110 (72%), Positives = 97/110 (88%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            MV+    +K   +KG+WTPEEDRKL AY+ RYG WNW ++PK+AGL RCGKSCRLRWMNY
Sbjct  1    MVKAGGSEKPSLRKGSWTPEEDRKLIAYIRRYGIWNWSEMPKYAGLLRCGKSCRLRWMNY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRP+I+RGN+T+EEDETI+++HEQLGN+WSAIA+ LPGRTDNEIKNHWH+
Sbjct  61   LRPDIRRGNFTQEEDETIIKLHEQLGNRWSAIASRLPGRTDNEIKNHWHS  110



>emb|CDP11893.1| unnamed protein product [Coffea canephora]
Length=241

 Score =   187 bits (475),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 81/110 (74%), Positives = 94/110 (85%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            MVR+P  DK G KKG W+ +ED KL AYV RYG WNWRQLPKFAGL+RCGKSCRLRWMNY
Sbjct  1    MVRSPYIDKKGLKKGAWSEDEDNKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRP +KRGNYT EE++ I+++HEQLGN+WSAIA  LPGR+DNE+KN WHT
Sbjct  61   LRPGLKRGNYTVEEEDLIIKLHEQLGNRWSAIAGKLPGRSDNEVKNFWHT  110



>ref|XP_009398450.1| PREDICTED: myb-related protein Myb4-like [Musa acuminata subsp. 
malaccensis]
Length=265

 Score =   187 bits (476),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 84/110 (76%), Positives = 95/110 (86%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            MVR+PCC+K G KKG WT EED+ L AY+ RYG  NWR LP+ AGL RCGKSCRLRWMNY
Sbjct  1    MVRSPCCEKMGLKKGPWTTEEDQILVAYIKRYGHANWRALPRQAGLLRCGKSCRLRWMNY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRP+IKRGN TKEE+ETI+R+HE+LGN+WSAIAA LPGRTDNEIKN WHT
Sbjct  61   LRPDIKRGNLTKEEEETIIRLHERLGNRWSAIAARLPGRTDNEIKNVWHT  110



>ref|XP_011047493.1| PREDICTED: myb-related protein 308-like [Populus euphratica]
Length=262

 Score =   187 bits (476),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 79/110 (72%), Positives = 94/110 (85%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            MV+T   DK+G +KG W+ EED KL  YV +YG WNWRQLP+FAGL+RCGKSCRLRWMNY
Sbjct  1    MVKTTLVDKNGLRKGAWSKEEDDKLRVYVQKYGHWNWRQLPRFAGLSRCGKSCRLRWMNY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRP++KRGN+++EED  I++MHE+LGNKWS IA  LPGRTDNEIKNHWHT
Sbjct  61   LRPDVKRGNFSEEEDNLIIQMHEELGNKWSIIAGKLPGRTDNEIKNHWHT  110



>emb|CDP11892.1| unnamed protein product [Coffea canephora]
Length=256

 Score =   186 bits (473),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 81/110 (74%), Positives = 94/110 (85%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            MVR P  DK+G KKG W+ EED KL AYV RYG WNWRQLPKFAGL+RCGKSCRLRWMNY
Sbjct  1    MVRAPSVDKNGVKKGAWSEEEDNKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            L+P ++RG YT EE++ I+++HEQ GN+WSAIAA LPGRTDN+IKNHWHT
Sbjct  61   LKPGVRRGKYTIEEEDLIIKLHEQYGNRWSAIAAKLPGRTDNDIKNHWHT  110



>ref|XP_011048477.1| PREDICTED: transcription factor WER-like [Populus euphratica]
Length=243

 Score =   186 bits (472),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 77/110 (70%), Positives = 96/110 (87%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            MV++   DK+G +KG+W+ EED KL  Y+ +YG WNWRQLPKFAGL+RCGKSCRLRWMNY
Sbjct  1    MVKSAYIDKNGHRKGSWSVEEDEKLRVYIQKYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRP++KRGN+++EED  I++MHE+LGNKWS I++ LPGRTDNEIKNHWHT
Sbjct  61   LRPDVKRGNFSEEEDNLIIQMHEELGNKWSIISSKLPGRTDNEIKNHWHT  110



>ref|XP_007035114.1| Myb domain protein 13, putative [Theobroma cacao]
 gb|EOY06040.1| Myb domain protein 13, putative [Theobroma cacao]
Length=335

 Score =   189 bits (479),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 83/110 (75%), Positives = 95/110 (86%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            MVR PCCDK G KKG WTPEED+ L +YV +YG  NWR LPK AGL+RCGKSCRLRW+NY
Sbjct  1    MVRAPCCDKMGMKKGPWTPEEDQILISYVQKYGHANWRALPKQAGLSRCGKSCRLRWINY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRP+IKRGN+T EE+ETI+++HE LGN+WSAIAA LPGRTDNEIKN WHT
Sbjct  61   LRPDIKRGNFTSEEEETIIKLHEMLGNRWSAIAARLPGRTDNEIKNVWHT  110



>ref|XP_007132609.1| hypothetical protein PHAVU_011G109400g [Phaseolus vulgaris]
 gb|ESW04603.1| hypothetical protein PHAVU_011G109400g [Phaseolus vulgaris]
Length=257

 Score =   186 bits (472),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 87/114 (76%), Positives = 97/114 (85%), Gaps = 5/114 (4%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAG-----LARCGKSCRL  380
            MVRTP CDKSG KKGTWTPEED KL AYVT +G  NWRQLPKFAG     ++RCGKSCRL
Sbjct  1    MVRTPYCDKSGLKKGTWTPEEDWKLIAYVTTHGHKNWRQLPKFAGNRSAPVSRCGKSCRL  60

Query  379  RWMNYLRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWH  218
            RWMNYLRP IKRGNYT EE+E IV++H+ LGN+WS IA+HLPGR+DNEIKNHWH
Sbjct  61   RWMNYLRPGIKRGNYTYEEEERIVKLHKILGNRWSVIASHLPGRSDNEIKNHWH  114



>ref|XP_010934323.1| PREDICTED: myb-related protein Myb4-like [Elaeis guineensis]
Length=255

 Score =   186 bits (471),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 84/110 (76%), Positives = 93/110 (85%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            MVR PCC+K G KKG WT EED+ L AY+ RYG  NWR LPK AGL RCGKSCRLRW+NY
Sbjct  1    MVRAPCCEKVGLKKGPWTSEEDQILIAYIQRYGHANWRALPKQAGLFRCGKSCRLRWINY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRPNIKRGN+TKEE+ETI+ +HE LGN+WSAIAA LPGRTDNEIKN WHT
Sbjct  61   LRPNIKRGNFTKEEEETIITLHEMLGNRWSAIAARLPGRTDNEIKNVWHT  110



>ref|XP_006467925.1| PREDICTED: myb-related protein Myb4-like [Citrus sinensis]
Length=292

 Score =   187 bits (474),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 79/110 (72%), Positives = 96/110 (87%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            MV+ P  +K   +KG+W PEEDRKL AY+ RYG WNW ++PK+AGL RCGKSCRLRWMNY
Sbjct  1    MVKAPGSEKPSLRKGSWAPEEDRKLIAYIRRYGIWNWSEMPKYAGLLRCGKSCRLRWMNY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRP+I+RGN+T+EEDETI+++HEQLGN+WSAIA+ LP RTDNEIKNHWHT
Sbjct  61   LRPDIRRGNFTQEEDETIIKLHEQLGNRWSAIASRLPRRTDNEIKNHWHT  110



>ref|XP_010920477.1| PREDICTED: myb-related protein Myb4 [Elaeis guineensis]
Length=257

 Score =   186 bits (471),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 83/110 (75%), Positives = 95/110 (86%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            MVR PCC+K G KKG WTPEED+ L AY+ RYG  NWR LPK AGL RCGKSCRLRW+NY
Sbjct  1    MVRAPCCEKMGLKKGPWTPEEDQILIAYIQRYGHGNWRALPKQAGLLRCGKSCRLRWVNY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRP+IKRGN+T+EE+ETI+ +HE+LGN+WSAIAA LPGRTDNEIKN WHT
Sbjct  61   LRPDIKRGNFTQEEEETIINLHEKLGNRWSAIAARLPGRTDNEIKNVWHT  110



>gb|KDP24725.1| hypothetical protein JCGZ_26464 [Jatropha curcas]
 gb|AIT52287.1| MYB family protein [Jatropha curcas]
Length=257

 Score =   186 bits (471),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 81/110 (74%), Positives = 94/110 (85%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            MVR P  DK+G KKG W+ EED KL AYV RYG WNWR+LPKFAGL+RCGKSCRLRW+NY
Sbjct  1    MVRAPFFDKNGLKKGAWSQEEDDKLRAYVQRYGHWNWRELPKFAGLSRCGKSCRLRWINY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRP +K GNY+KEE++ I+R+HEQ GNKWS IAA LPGRTDNEIKN+WH+
Sbjct  61   LRPGVKHGNYSKEEEDLIIRLHEQFGNKWSKIAAKLPGRTDNEIKNYWHS  110



>emb|CDP11890.1| unnamed protein product [Coffea canephora]
Length=245

 Score =   185 bits (470),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 80/110 (73%), Positives = 93/110 (85%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            MVR P  DK+G KKG W+ EED KL AYV RYG WNWRQLPKFAGL+RCGKSCRLRWMNY
Sbjct  1    MVRAPSVDKNGMKKGAWSEEEDNKLRAYVLRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            L+P ++RG YT EE++ I+++HEQ GN+WSAIAA LP RTDN+IKNHWHT
Sbjct  61   LKPGVRRGKYTIEEEDLIIKLHEQYGNRWSAIAAKLPARTDNDIKNHWHT  110



>ref|XP_003540869.2| PREDICTED: myb-related protein Myb4-like [Glycine max]
Length=234

 Score =   184 bits (466),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 87/110 (79%), Positives = 100/110 (91%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            MVRTP CDK+G KKGTWT EED+KL  Y+TRYG WNWR LPKFAGLARCGKSCRLRW+NY
Sbjct  2    MVRTPSCDKNGLKKGTWTAEEDKKLVDYITRYGHWNWRLLPKFAGLARCGKSCRLRWLNY  61

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRPN+KRGNYT+EE+ETI+++H +LGN+WS IAA +PGRTDNEIKNHWHT
Sbjct  62   LRPNLKRGNYTEEEEETIIKLHRRLGNRWSTIAARMPGRTDNEIKNHWHT  111



>ref|XP_010906538.1| PREDICTED: myb-related protein Myb4-like [Elaeis guineensis]
Length=270

 Score =   185 bits (469),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 84/110 (76%), Positives = 94/110 (85%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            MVR PCC+K G KKG WTPEEDR L +Y+ RYG  NWR LPK AGL RCGKSCRLRW NY
Sbjct  1    MVRAPCCEKMGLKKGPWTPEEDRILVSYIHRYGHGNWRALPKQAGLLRCGKSCRLRWTNY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRP+IKRGN+TKEE+ETI+++HE LGN+WSAIAA LPGRTDNEIKN WHT
Sbjct  61   LRPDIKRGNFTKEEEETIIKLHEMLGNRWSAIAAKLPGRTDNEIKNVWHT  110



>gb|KHN22878.1| Myb-related protein Myb4 [Glycine soja]
Length=233

 Score =   184 bits (466),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 87/110 (79%), Positives = 100/110 (91%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            MVRTP CDK+G KKGTWT EED+KL  Y+TRYG WNWR LPKFAGLARCGKSCRLRW+NY
Sbjct  1    MVRTPSCDKNGLKKGTWTAEEDKKLVDYITRYGHWNWRLLPKFAGLARCGKSCRLRWLNY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRPN+KRGNYT+EE+ETI+++H +LGN+WS IAA +PGRTDNEIKNHWHT
Sbjct  61   LRPNLKRGNYTEEEEETIIKLHRRLGNRWSTIAARMPGRTDNEIKNHWHT  110



>ref|XP_010277888.1| PREDICTED: myb-related protein 308-like [Nelumbo nucifera]
Length=269

 Score =   184 bits (467),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 80/110 (73%), Positives = 95/110 (86%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            M +T  C+K+G KKGTWTPEED KL AY+ RYG WNWR+LP+FAGLARCGKSCRLRW+NY
Sbjct  1    MAKTGYCEKTGLKKGTWTPEEDMKLTAYIKRYGHWNWRELPRFAGLARCGKSCRLRWVNY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRP+IKRG+++ EEDE I++MH  LGN+W+ IA  LPGRTDNEIKNHWHT
Sbjct  61   LRPDIKRGHFSPEEDEIIMKMHASLGNRWTRIATKLPGRTDNEIKNHWHT  110



>ref|XP_002325683.2| hypothetical protein POPTR_0019s14120g [Populus trichocarpa]
 gb|EEF00065.2| hypothetical protein POPTR_0019s14120g [Populus trichocarpa]
Length=262

 Score =   184 bits (467),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 78/110 (71%), Positives = 92/110 (84%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            MV+    DK+G +KG W+ EED KL  YV +YG WNWRQLP+FAGL+RCGKSCRLRWMNY
Sbjct  1    MVKATLVDKNGLRKGAWSKEEDDKLRVYVQKYGHWNWRQLPRFAGLSRCGKSCRLRWMNY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRP++KRGN++ EED  I++MHE+LGNKWS IA  LPGRTDNEIKNHWHT
Sbjct  61   LRPDVKRGNFSDEEDNLIIQMHEELGNKWSIIAGKLPGRTDNEIKNHWHT  110



>ref|XP_003597078.1| MYB transcription factor [Medicago truncatula]
Length=455

 Score =   189 bits (479),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 81/114 (71%), Positives = 100/114 (88%), Gaps = 5/114 (4%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAG----LARCGKSCRLR  377
            MVRTPC D +G +KG+WT EED+KL AYVTRYGCWNWRQLP+FAG    L RCGKSCRLR
Sbjct  1    MVRTPC-DNNGLRKGSWTHEEDKKLIAYVTRYGCWNWRQLPRFAGIRKGLERCGKSCRLR  59

Query  376  WMNYLRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            WMNYLRP++KRGN+ ++E+E I+++HE+LGN+W+ IA++ PGRTDNEIKNHWHT
Sbjct  60   WMNYLRPDVKRGNFNQQEEELIIKLHEKLGNRWTVIASNFPGRTDNEIKNHWHT  113



>gb|ABH02919.1| MYB transcription factor MYB117 [Glycine max]
Length=237

 Score =   182 bits (462),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 78/99 (79%), Positives = 91/99 (92%), Gaps = 0/99 (0%)
 Frame = -2

Query  511  FKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNYLRPNIKRGNYT  332
             +KGTWT EEDRKL AYVTRYG WNWRQLP+FAGLARCGKSCRLRW+ YLRP++KRGN+T
Sbjct  1    MRKGTWTLEEDRKLIAYVTRYGSWNWRQLPRFAGLARCGKSCRLRWIEYLRPDVKRGNFT  60

Query  331  KEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            ++E+E I+RMH++LGN+WS IAA LPGRTDNEIKNHWHT
Sbjct  61   QQEEEFIIRMHKKLGNRWSTIAAELPGRTDNEIKNHWHT  99



>gb|KDO55821.1| hypothetical protein CISIN_1g042846mg [Citrus sinensis]
Length=243

 Score =   182 bits (462),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 80/110 (73%), Positives = 94/110 (85%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            MVR P  D++G KKG W+ EED KL AY+ +YG WNW +LPKFAGL+RCGKSCRLRWMNY
Sbjct  1    MVRAPTYDENGMKKGAWSKEEDDKLRAYILKYGHWNWGELPKFAGLSRCGKSCRLRWMNY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRP+IK GNYTKEE++TI+R+ +Q GNKWS IAA LPGRTDNEIKN+WHT
Sbjct  61   LRPDIKHGNYTKEEEDTIIRLRQQHGNKWSLIAAKLPGRTDNEIKNYWHT  110



>ref|XP_007043432.1| Myb domain protein 15, putative [Theobroma cacao]
 gb|EOX99263.1| Myb domain protein 15, putative [Theobroma cacao]
Length=341

 Score =   185 bits (469),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 79/110 (72%), Positives = 93/110 (85%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            MVR P  DK+G KKG W+ EED KL +Y+ RYG WNWR+LPKFAGL RCGKSCRLRWMNY
Sbjct  1    MVRAPFYDKNGMKKGAWSAEEDHKLRSYIQRYGHWNWRELPKFAGLKRCGKSCRLRWMNY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            L+P +K GNYT+EED  I+++HE+LGN+WS IAA LPGRTDN+IKNHWHT
Sbjct  61   LQPQVKHGNYTEEEDALIMKLHEELGNRWSTIAARLPGRTDNDIKNHWHT  110



>ref|XP_003518022.1| PREDICTED: myb-related protein Myb4-like [Glycine max]
Length=264

 Score =   182 bits (463),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 79/110 (72%), Positives = 93/110 (85%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            MVR PCC+K G KKG WTPEED+ L +Y+ ++G  NWR LPK AGL RCGKSCRLRW+NY
Sbjct  1    MVRAPCCEKMGLKKGPWTPEEDQILMSYIQKHGHGNWRALPKLAGLLRCGKSCRLRWINY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRP+IKRGN++ EE+E I++MHE LGN+WSAIAA LPGRTDNEIKN WHT
Sbjct  61   LRPDIKRGNFSSEEEEIIIKMHELLGNRWSAIAAKLPGRTDNEIKNVWHT  110



>ref|XP_006447414.1| hypothetical protein CICLE_v10017677mg [Citrus clementina]
 gb|ESR60654.1| hypothetical protein CICLE_v10017677mg [Citrus clementina]
Length=243

 Score =   182 bits (461),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 79/110 (72%), Positives = 95/110 (86%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            MVR P  D++G KKG W+ EED KL AY+ +YG WNWR++PKFAGL+RCGKSCRLRWMNY
Sbjct  1    MVRAPTYDENGMKKGAWSKEEDDKLRAYILKYGHWNWREIPKFAGLSRCGKSCRLRWMNY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRP+IK G+YTKEE++TI+R+ +Q GNKWS IAA LPGRTDNEIKN+WHT
Sbjct  61   LRPDIKHGSYTKEEEDTIIRLRQQHGNKWSLIAAKLPGRTDNEIKNYWHT  110



>dbj|BAA81732.1| GmMYB29A2 [Glycine max]
Length=264

 Score =   182 bits (463),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 79/110 (72%), Positives = 93/110 (85%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            MVR PCC+K G KKG WTPEED+ L +Y+ ++G  NWR LPK AGL RCGKSCRLRW+NY
Sbjct  1    MVRAPCCEKMGLKKGPWTPEEDQILMSYIQKHGHGNWRALPKLAGLLRCGKSCRLRWINY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRP+IKRGN++ EE+E I++MHE LGN+WSAIAA LPGRTDNEIKN WHT
Sbjct  61   LRPDIKRGNFSSEEEEIIIKMHELLGNRWSAIAAKLPGRTDNEIKNVWHT  110



>ref|XP_008785342.1| PREDICTED: myb-related protein Myb4-like [Phoenix dactylifera]
Length=259

 Score =   182 bits (462),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 81/110 (74%), Positives = 93/110 (85%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            MVR PCC+K G KKG WT EED+ L  Y+ RYG  NWR LPK AGL+RCGKSCRLRW+NY
Sbjct  1    MVRAPCCEKMGLKKGPWTSEEDQILITYIQRYGHANWRALPKQAGLSRCGKSCRLRWINY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRP+IKRGN+TKEE+ETI+ +HE +GN+WSAIAA LPGRTDNEIKN WHT
Sbjct  61   LRPDIKRGNFTKEEEETIISLHEMIGNRWSAIAARLPGRTDNEIKNVWHT  110



>gb|KHN00260.1| Myb-related protein Myb4 [Glycine soja]
Length=263

 Score =   182 bits (462),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 79/110 (72%), Positives = 93/110 (85%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            MVR PCC+K G KKG WTPEED+ L +Y+ ++G  NWR LPK AGL RCGKSCRLRW+NY
Sbjct  1    MVRAPCCEKMGLKKGPWTPEEDQILMSYIQKHGHGNWRALPKLAGLLRCGKSCRLRWINY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRP+IKRGN++ EE+E I++MHE LGN+WSAIAA LPGRTDNEIKN WHT
Sbjct  61   LRPDIKRGNFSSEEEEIIIKMHELLGNRWSAIAAKLPGRTDNEIKNVWHT  110



>gb|AIT13037.1| myb-related transcription factor [Vitis amurensis]
Length=253

 Score =   182 bits (461),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 80/110 (73%), Positives = 94/110 (85%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            MVR PCCDK G KKG WT +ED+ L AYV ++G  NWR LPK AGL RCGKSCRLRW+NY
Sbjct  1    MVRAPCCDKVGLKKGPWTTQEDQNLTAYVLQHGHGNWRALPKQAGLLRCGKSCRLRWINY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRP+IKRGN+++EE++TI+ +HE+LGNKWSAIAA LPGRTDNEIKN WHT
Sbjct  61   LRPDIKRGNFSREEEDTIIELHEKLGNKWSAIAASLPGRTDNEIKNVWHT  110



>ref|XP_004976230.1| PREDICTED: myb-related protein Myb4-like [Setaria italica]
Length=274

 Score =   182 bits (462),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 80/110 (73%), Positives = 94/110 (85%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            M R PCC+K G KKG WTPEED+ L A++ R+G  NWR LPK AGL RCGKSCRLRW+NY
Sbjct  1    MGRAPCCEKMGLKKGPWTPEEDKVLVAHIQRFGHGNWRALPKQAGLLRCGKSCRLRWINY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRP+IKRGN++KEE++ I+R+HEQLGN+WSAIAA LPGRTDNEIKN WHT
Sbjct  61   LRPDIKRGNFSKEEEDAIIRLHEQLGNRWSAIAARLPGRTDNEIKNVWHT  110



>ref|XP_008791593.1| PREDICTED: myb-related protein Myb4 [Phoenix dactylifera]
Length=263

 Score =   182 bits (461),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 82/110 (75%), Positives = 94/110 (85%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            M R PCC+K G KKG WTPEED+ L A++ RYG  NWR LPK AGL RCGKSCRLRW+NY
Sbjct  1    MGRAPCCEKMGLKKGPWTPEEDQILTAHIRRYGHGNWRALPKQAGLLRCGKSCRLRWINY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRP+IKRGN+TKEE+ETI+ +HE+LGN+WSAIAA LPGRTDNEIKN WHT
Sbjct  61   LRPDIKRGNFTKEEEETIIHLHEKLGNRWSAIAAKLPGRTDNEIKNVWHT  110



>ref|XP_010095860.1| Myb-related protein Myb4 [Morus notabilis]
 gb|EXB62328.1| Myb-related protein Myb4 [Morus notabilis]
Length=277

 Score =   182 bits (462),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 78/110 (71%), Positives = 94/110 (85%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            MVR P  D++G K+G W+ EED KL AYV RYG WNWR+LPK+AGL RCGKSCRLRWMNY
Sbjct  1    MVRAPFYDENGIKRGAWSSEEDDKLRAYVERYGYWNWRELPKYAGLQRCGKSCRLRWMNY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRP+++RGNYT EE+  I+++HE+ GNKWS IAA+LPGRTDNEIKN+WHT
Sbjct  61   LRPDVRRGNYTAEEESLIIKLHEEHGNKWSLIAANLPGRTDNEIKNYWHT  110



>gb|KHN00294.1| Myb-related protein Myb4 [Glycine soja]
Length=264

 Score =   181 bits (460),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 79/110 (72%), Positives = 93/110 (85%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            MVR PCC+K G KKG WTPEED+ L +Y+ ++G  NWR LPK AGL RCGKSCRLRW+NY
Sbjct  1    MVRAPCCEKMGLKKGPWTPEEDQILMSYIQKHGHGNWRALPKLAGLLRCGKSCRLRWINY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRP+IKRGN++ EE+E I++MHE LGN+WSAIAA LPGRTDNEIKN WHT
Sbjct  61   LRPDIKRGNFSSEEEEIIIKMHELLGNRWSAIAAKLPGRTDNEIKNVWHT  110



>ref|XP_002285193.1| PREDICTED: myb-related protein Myb4 [Vitis vinifera]
 emb|CAN63580.1| hypothetical protein VITISV_029015 [Vitis vinifera]
 emb|CBI23645.3| unnamed protein product [Vitis vinifera]
 gb|AHA83524.1| R2R3 MYB15 transcription factor [Vitis vinifera]
Length=253

 Score =   181 bits (459),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 80/110 (73%), Positives = 94/110 (85%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            MVR PCCDK G KKG WT +ED+ L AYV ++G  NWR LPK AGL RCGKSCRLRW+NY
Sbjct  1    MVRAPCCDKVGLKKGPWTTQEDQILTAYVLQHGHGNWRALPKQAGLLRCGKSCRLRWINY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRP+IKRGN+++EE++TI+ +HE+LGNKWSAIAA LPGRTDNEIKN WHT
Sbjct  61   LRPDIKRGNFSREEEDTIIELHEKLGNKWSAIAASLPGRTDNEIKNVWHT  110



>dbj|BAC07544.1| myb-related transcription factor VlMYBB1-2 [Vitis labrusca x 
Vitis vinifera]
Length=253

 Score =   181 bits (459),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 80/110 (73%), Positives = 94/110 (85%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            MVR PCCDK G KKG WT +ED+ L AYV ++G  NWR LPK AGL RCGKSCRLRW+NY
Sbjct  1    MVRAPCCDKVGLKKGPWTTQEDQILTAYVLQHGHGNWRALPKQAGLLRCGKSCRLRWINY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRP+IKRGN+++EE++TI+ +HE+LGNKWSAIAA LPGRTDNEIKN WHT
Sbjct  61   LRPDIKRGNFSREEEDTIIELHEKLGNKWSAIAASLPGRTDNEIKNVWHT  110



>ref|XP_003535693.1| PREDICTED: myb-related protein Myb4 [Glycine max]
 dbj|BAA81730.1| GmMYB29A1 [Glycine max]
 dbj|BAA81731.1| GmMYB29A1 [Glycine max]
Length=264

 Score =   181 bits (460),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 79/110 (72%), Positives = 93/110 (85%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            MVR PCC+K G KKG WTPEED+ L +Y+ ++G  NWR LPK AGL RCGKSCRLRW+NY
Sbjct  1    MVRAPCCEKMGLKKGPWTPEEDQILMSYIQKHGHGNWRALPKLAGLLRCGKSCRLRWINY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRP+IKRGN++ EE+E I++MHE LGN+WSAIAA LPGRTDNEIKN WHT
Sbjct  61   LRPDIKRGNFSSEEEEIIIKMHELLGNRWSAIAAKLPGRTDNEIKNVWHT  110



>dbj|BAC07543.1| myb-related transcription factor VlMYBB1-1 [Vitis labrusca x 
Vitis vinifera]
Length=253

 Score =   181 bits (459),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 80/110 (73%), Positives = 94/110 (85%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            MVR PCCDK G KKG WT +ED+ L AYV ++G  NWR LPK AGL RCGKSCRLRW+NY
Sbjct  1    MVRAPCCDKVGLKKGPWTTQEDQNLTAYVLQHGHGNWRALPKQAGLLRCGKSCRLRWINY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRP+IKRGN+++EE++TI+ +HE+LGNKWSAIAA LPGRTDNEIKN WHT
Sbjct  61   LRPDIKRGNFSREEEDTIIELHEKLGNKWSAIAASLPGRTDNEIKNVWHT  110



>ref|XP_011029827.1| PREDICTED: myb-related protein Myb4-like [Populus euphratica]
Length=283

 Score =   182 bits (462),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 80/110 (73%), Positives = 95/110 (86%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            MVR PCC+K G K+G WTPEED+ L +YV +YG  NWR LPK AGL RCGKSCRLRW+NY
Sbjct  1    MVRAPCCEKMGLKRGPWTPEEDQILISYVQKYGHSNWRALPKQAGLQRCGKSCRLRWVNY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRP+IKRGN++KEE+ETI+++HE LGN+WSAIA+ LPGRTDNEIKN WHT
Sbjct  61   LRPDIKRGNFSKEEEETIIKLHEVLGNRWSAIASRLPGRTDNEIKNVWHT  110



>ref|XP_008807658.1| PREDICTED: myb-related protein Myb4-like [Phoenix dactylifera]
Length=272

 Score =   182 bits (461),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 82/110 (75%), Positives = 92/110 (84%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            MVR PCC+K G KKG WTPEED  L +Y+  YG  NWR LPK AGL RCGKSCRLRW+NY
Sbjct  1    MVRAPCCEKMGLKKGPWTPEEDEILVSYIRSYGHGNWRALPKQAGLLRCGKSCRLRWINY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRP+IKRGN+TKEE+ETI++ HE LGN+WSAIAA LPGRTDNEIKN WHT
Sbjct  61   LRPDIKRGNFTKEEEETIIKWHEMLGNRWSAIAAMLPGRTDNEIKNVWHT  110



>ref|XP_010274769.1| PREDICTED: myb-related protein Myb4-like [Nelumbo nucifera]
Length=277

 Score =   182 bits (461),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 82/110 (75%), Positives = 93/110 (85%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            MVR PCC+K G KKG WTPEED+ L  Y+ +YG  NWR LPK AGL RCGKSCRLRW NY
Sbjct  1    MVRAPCCEKMGMKKGPWTPEEDQILINYIRQYGHGNWRALPKQAGLLRCGKSCRLRWTNY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRP+IKRGN+TKEE+ETI+++HE LGN+WSAIAA LPGRTDNEIKN WHT
Sbjct  61   LRPDIKRGNFTKEEEETIIKLHEMLGNRWSAIAAKLPGRTDNEIKNVWHT  110



>gb|ACU23862.1| unknown [Glycine max]
Length=268

 Score =   181 bits (460),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 79/110 (72%), Positives = 93/110 (85%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            MVR PCC+K G KKG WTPEED+ L +Y+ ++G  NWR LPK AGL RCGKSCRLRW+NY
Sbjct  1    MVRAPCCEKMGLKKGPWTPEEDQILMSYIQKHGHGNWRALPKLAGLLRCGKSCRLRWINY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRP+IKRGN++ EE+E I++MHE LGN+WSAIAA LPGRTDNEIKN WHT
Sbjct  61   LRPDIKRGNFSSEEEEIIIKMHELLGNRWSAIAAKLPGRTDNEIKNVWHT  110



>ref|XP_008224356.1| PREDICTED: myb-related protein Myb4-like [Prunus mume]
Length=254

 Score =   181 bits (458),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 79/110 (72%), Positives = 94/110 (85%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            MVR PCC+K G KKG WTPEED+ L +++ +YG  NWR LPK AGL RCGKSCRLRW+NY
Sbjct  1    MVRAPCCEKMGLKKGPWTPEEDQILVSFIQKYGHGNWRALPKQAGLLRCGKSCRLRWINY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRP+IKRGN+T+EE+E I+++HE LGN+WSAIAA LPGRTDNEIKN WHT
Sbjct  61   LRPDIKRGNFTREEEEAIIKLHEMLGNRWSAIAARLPGRTDNEIKNVWHT  110



>gb|KHN41181.1| Myb-related protein Myb4 [Glycine soja]
Length=242

 Score =   180 bits (457),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 83/110 (75%), Positives = 94/110 (85%), Gaps = 1/110 (1%)
 Frame = -2

Query  544  MVRTPCCDK-SGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMN  368
            MV+TP CDK SG KKGTWTPEED KL A+V  +G  NWRQLPK AGLARCGKSCRLRW+N
Sbjct  1    MVKTPYCDKKSGLKKGTWTPEEDWKLIAHVNAHGHKNWRQLPKLAGLARCGKSCRLRWVN  60

Query  367  YLRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWH  218
            YLRP IKRGNYT EE+ETI+++   LGN+WS IA+HLPGR+DNEIKNHWH
Sbjct  61   YLRPGIKRGNYTHEEEETIIKLRTSLGNRWSVIASHLPGRSDNEIKNHWH  110



>ref|XP_009392095.1| PREDICTED: myb-related protein Myb4-like [Musa acuminata subsp. 
malaccensis]
Length=251

 Score =   181 bits (458),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 80/110 (73%), Positives = 92/110 (84%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            MVR PCC+K G KKG WT EED+ L AY+ ++G  NWR LPK AGL RCGKSCRLRW NY
Sbjct  1    MVRAPCCEKMGLKKGPWTAEEDQVLVAYIQQHGHENWRALPKRAGLLRCGKSCRLRWTNY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRP+IKRGN+TKEE+E I+++HE LGN+WSAIAA LPGRTDNEIKN WHT
Sbjct  61   LRPDIKRGNFTKEEEEAIIKLHEMLGNRWSAIAARLPGRTDNEIKNVWHT  110



>ref|XP_009396976.1| PREDICTED: myb-related protein Myb4-like [Musa acuminata subsp. 
malaccensis]
Length=261

 Score =   181 bits (459),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 80/110 (73%), Positives = 94/110 (85%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            MVR PCC+K G K+G+WTPEED+ L AY+ ++G  NWR LPK AGL RCGKSCRLRW+NY
Sbjct  1    MVRAPCCEKMGLKRGSWTPEEDQILVAYIRQHGHGNWRALPKQAGLLRCGKSCRLRWVNY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRP+IKRGN+TKEE+ETI+R+HE  GN+WSAIA  LPGRTDNEIKN WHT
Sbjct  61   LRPDIKRGNFTKEEEETIIRLHEDYGNRWSAIATKLPGRTDNEIKNVWHT  110



>ref|XP_007132613.1| hypothetical protein PHAVU_011G109800g [Phaseolus vulgaris]
 gb|ESW04607.1| hypothetical protein PHAVU_011G109800g [Phaseolus vulgaris]
Length=224

 Score =   179 bits (455),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 79/110 (72%), Positives = 93/110 (85%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            MVRTP  DK+G KKG W+ EED KL AYV  YG  NWRQLPKFAGLARCGKSCRLRW+NY
Sbjct  1    MVRTPSYDKNGLKKGAWSREEDDKLRAYVQIYGHSNWRQLPKFAGLARCGKSCRLRWLNY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRPN+K GNYT EE+ETI+++H++ GN+WS IA  LPGRTDNE+KN+WH+
Sbjct  61   LRPNLKHGNYTTEEEETIIKLHQEFGNRWSLIAEKLPGRTDNEVKNYWHS  110



>ref|XP_011100326.1| PREDICTED: myb-related protein Myb4-like [Sesamum indicum]
Length=289

 Score =   181 bits (460),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 79/110 (72%), Positives = 93/110 (85%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            MVR P  D +G KKG W+ +ED KL AYV RYG WNWR LPK+AGLARCGKSCRLRW+NY
Sbjct  1    MVRPPYVDSNGLKKGAWSDDEDNKLRAYVQRYGHWNWRLLPKYAGLARCGKSCRLRWVNY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            L+P +KRGN++KEE+  +V++H QLGNKWSAIAA+LPGRTDNEIKN WHT
Sbjct  61   LKPGVKRGNFSKEEEALVVKLHNQLGNKWSAIAANLPGRTDNEIKNFWHT  110



>ref|XP_010660228.1| PREDICTED: myb-related protein Myb4-like [Vitis vinifera]
Length=205

 Score =   179 bits (453),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 78/110 (71%), Positives = 95/110 (86%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            MVRTPCC+  G KKG+WTPEED+ L +++ R+G  NWR LPK AGL RCGKSCRLRW NY
Sbjct  1    MVRTPCCESMGLKKGSWTPEEDQILVSHIQRHGHGNWRALPKEAGLMRCGKSCRLRWTNY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRP+IKRGN++KEE+ETI+++H+ LGN+WSAIAA LPGRTDNEIKN WH+
Sbjct  61   LRPDIKRGNFSKEEEETIIKLHQLLGNRWSAIAARLPGRTDNEIKNFWHS  110



>gb|ABI84253.1| transcription factor Myb1 [Arachis hypogaea]
Length=143

 Score =   176 bits (447),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 79/110 (72%), Positives = 93/110 (85%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            MVR PCC+K G KKG WT EED+ L +Y+ ++G  NWR LPK AGL RCGKSCRLRW+NY
Sbjct  1    MVRAPCCEKMGLKKGPWTAEEDQILISYIQKHGHGNWRALPKQAGLLRCGKSCRLRWINY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRP+IKRGN+T EE+ETI+++HE LGN+WSAIAA LPGRTDNEIKN WHT
Sbjct  61   LRPDIKRGNFTIEEEETIIKLHEMLGNRWSAIAAKLPGRTDNEIKNVWHT  110



>ref|XP_010262320.1| PREDICTED: myb-related protein Myb4 [Nelumbo nucifera]
Length=271

 Score =   180 bits (457),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 81/110 (74%), Positives = 92/110 (84%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            MVR PCC+K G KKG WTPEEDR L  Y+ +YG  NWR LPK AGL RCGKSCRLRW NY
Sbjct  1    MVRAPCCEKMGLKKGPWTPEEDRILINYIQQYGHGNWRALPKQAGLLRCGKSCRLRWTNY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRP+IKRGN++KEE+ETI+ +HE+LGN+WS IAA LPGRTDNEIKN WHT
Sbjct  61   LRPDIKRGNFSKEEEETIIELHEKLGNRWSTIAARLPGRTDNEIKNVWHT  110



>gb|KDP26537.1| hypothetical protein JCGZ_17695 [Jatropha curcas]
 gb|AIT52249.1| MYB family protein [Jatropha curcas]
Length=277

 Score =   181 bits (458),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 80/110 (73%), Positives = 92/110 (84%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            MVR PCC+K G KKG WTPEED  L  Y+ +YG  NWR LPK AGL RCGKSCRLRW NY
Sbjct  1    MVRAPCCEKMGLKKGPWTPEEDHILINYIQQYGHGNWRALPKQAGLLRCGKSCRLRWTNY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRP+IKRGN+T++E+ETI+++HE LGN+WSAIAA LPGRTDNEIKN WHT
Sbjct  61   LRPDIKRGNFTRDEEETIIKLHEMLGNRWSAIAARLPGRTDNEIKNVWHT  110



>ref|XP_010111921.1| Myb-related protein Myb4 [Morus notabilis]
 gb|EXC31955.1| Myb-related protein Myb4 [Morus notabilis]
Length=281

 Score =   181 bits (458),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 80/110 (73%), Positives = 92/110 (84%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            MVR PCC+K G KKG WTPEED+ L +Y+ RYG  NWR LP  AGL RCGKSCRLRW+NY
Sbjct  1    MVRAPCCEKMGLKKGPWTPEEDQILISYIQRYGHANWRALPTQAGLLRCGKSCRLRWINY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRP+IKRGN++ EE+ETI ++HE LGN+WSAIAA LPGRTDNEIKN WHT
Sbjct  61   LRPDIKRGNFSTEEEETIFKLHEMLGNRWSAIAARLPGRTDNEIKNVWHT  110



>gb|AGN52057.1| MYB-related transcription factor [Salvia miltiorrhiza]
 gb|AGN52167.1| MYB-related transcription factor [Salvia miltiorrhiza]
Length=245

 Score =   179 bits (455),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 78/110 (71%), Positives = 93/110 (85%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            MVR PCC+K G KKG W+PEED+ L +Y+ ++G  NWR LPK +GL RCGKSCRLRW+NY
Sbjct  1    MVRAPCCEKMGLKKGPWSPEEDQILVSYIQKHGHGNWRALPKQSGLLRCGKSCRLRWINY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRP+IKRGN+TKEE+E I+ +HE LGN+WSAIAA LPGRTDNEIKN WHT
Sbjct  61   LRPDIKRGNFTKEEEEAIINLHEMLGNRWSAIAARLPGRTDNEIKNVWHT  110



>ref|XP_009762172.1| PREDICTED: myb-related protein Myb4-like [Nicotiana sylvestris]
 dbj|BAA88224.1| myb-related transcription factor LBM4 [Nicotiana tabacum]
Length=281

 Score =   180 bits (457),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 78/110 (71%), Positives = 92/110 (84%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            MVR PCC+K G KKG WTPEED+ L +Y+   G  NWR LPK AGL RCGKSCRLRW NY
Sbjct  1    MVRAPCCEKMGLKKGPWTPEEDQVLVSYIQTNGHGNWRALPKLAGLLRCGKSCRLRWTNY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRP+IKRGN+T+EE+++I+++HE LGN+WSAIAA LPGRTDNEIKN WHT
Sbjct  61   LRPDIKRGNFTREEEDSIIQLHEMLGNRWSAIAARLPGRTDNEIKNVWHT  110



>ref|XP_009629052.1| PREDICTED: myb-related protein Myb4-like [Nicotiana tomentosiformis]
 dbj|BAA88221.1| myb-related transcription factor LBM1 [Nicotiana tabacum]
Length=281

 Score =   180 bits (457),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 78/110 (71%), Positives = 92/110 (84%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            MVR PCC+K G KKG WTPEED+ L +Y+   G  NWR LPK AGL RCGKSCRLRW NY
Sbjct  1    MVRAPCCEKMGLKKGPWTPEEDQILVSYIQTNGHGNWRALPKLAGLLRCGKSCRLRWTNY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRP+IKRGN+T+EE+++I+++HE LGN+WSAIAA LPGRTDNEIKN WHT
Sbjct  61   LRPDIKRGNFTREEEDSIIQLHEMLGNRWSAIAARLPGRTDNEIKNVWHT  110



>ref|XP_003590028.1| Myb-related protein P [Medicago truncatula]
 gb|AES60279.1| myb-related transcription factor LBM1 [Medicago truncatula]
Length=255

 Score =   179 bits (455),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 79/110 (72%), Positives = 92/110 (84%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            MVR PCC+K G KKG WT EED  L +Y+ ++G  NWR LPK AGL RCGKSCRLRW+NY
Sbjct  1    MVRAPCCEKKGLKKGPWTLEEDEILTSYINKHGHSNWRALPKHAGLLRCGKSCRLRWINY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            L+P+IKRGN+T EE+ETI++MHE LGN+WSAIAA LPGRTDNEIKN WHT
Sbjct  61   LKPDIKRGNFTNEEEETIIKMHESLGNRWSAIAAKLPGRTDNEIKNVWHT  110



>gb|ABR28339.1| MYB transcription factor MYB51 [Medicago truncatula]
Length=255

 Score =   179 bits (455),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 79/110 (72%), Positives = 92/110 (84%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            MVR PCC+K G KKG WT EED  L +Y+ ++G  NWR LPK AGL RCGKSCRLRW+NY
Sbjct  1    MVRAPCCEKKGLKKGPWTLEEDEILTSYINKHGHSNWRALPKHAGLLRCGKSCRLRWINY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            L+P+IKRGN+T EE+ETI++MHE LGN+WSAIAA LPGRTDNEIKN WHT
Sbjct  61   LKPDIKRGNFTNEEEETIIKMHESLGNRWSAIAAKLPGRTDNEIKNVWHT  110



>ref|XP_006442693.1| hypothetical protein CICLE_v10022057mg [Citrus clementina]
 gb|ESR55933.1| hypothetical protein CICLE_v10022057mg [Citrus clementina]
Length=231

 Score =   179 bits (453),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 78/110 (71%), Positives = 95/110 (86%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            MVRTPCC+K G KKG WTPEED+ L +++ RYG  NWR LPK AGL RCGKSCRLRW+NY
Sbjct  1    MVRTPCCEKMGLKKGPWTPEEDQILISFIQRYGHGNWRALPKQAGLMRCGKSCRLRWINY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRP+IKRGN++K+E+ETI+++H  LGN+WS IAA LPGRTDNEIKN+WH+
Sbjct  61   LRPDIKRGNFSKDEEETILKLHRVLGNRWSTIAARLPGRTDNEIKNYWHS  110



>gb|ACJ84573.1| unknown [Medicago truncatula]
 gb|AFK39421.1| unknown [Medicago truncatula]
 gb|AFK45867.1| unknown [Medicago truncatula]
Length=255

 Score =   179 bits (455),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 79/110 (72%), Positives = 92/110 (84%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            MVR PCC+K G KKG WT EED  L +Y+ ++G  NWR LPK AGL RCGKSCRLRW+NY
Sbjct  1    MVRAPCCEKKGLKKGPWTLEEDEILTSYINKHGHSNWRALPKHAGLLRCGKSCRLRWINY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            L+P+IKRGN+T EE+ETI++MHE LGN+WSAIAA LPGRTDNEIKN WHT
Sbjct  61   LKPDIKRGNFTNEEEETIIKMHESLGNRWSAIAAKLPGRTDNEIKNVWHT  110



>gb|KDO60505.1| hypothetical protein CISIN_1g024492mg [Citrus sinensis]
Length=267

 Score =   180 bits (456),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 81/110 (74%), Positives = 92/110 (84%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            MVR PCC+K G KKG WTPEED+ L  YV  YG  NWR LPK AGL RCGKSCRLRW+NY
Sbjct  1    MVRAPCCEKMGLKKGPWTPEEDQILINYVKLYGHGNWRALPKQAGLLRCGKSCRLRWINY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRP+IKRGN+T+EE++TI+ +HE LGN+WSAIAA LPGRTDNEIKN WHT
Sbjct  61   LRPDIKRGNFTREEEDTIINLHEMLGNRWSAIAARLPGRTDNEIKNVWHT  110



>ref|XP_009399470.1| PREDICTED: myb-related protein Myb4-like [Musa acuminata subsp. 
malaccensis]
Length=263

 Score =   179 bits (455),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 82/110 (75%), Positives = 91/110 (83%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            MVR PCC+K G KKG WTPEED+ L  YV RYG  NWR LPK AGL RCGKSCRLRW+NY
Sbjct  1    MVRAPCCEKMGLKKGPWTPEEDQVLVDYVHRYGHANWRALPKQAGLLRCGKSCRLRWVNY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRP+IKRGN+T+EE ETI+ +H  LGN+WSAIAA LPGRTDNEIKN WHT
Sbjct  61   LRPDIKRGNFTREEQETIIGLHGMLGNRWSAIAAKLPGRTDNEIKNVWHT  110



>ref|XP_006446590.1| hypothetical protein CICLE_v10017435mg [Citrus clementina]
 gb|ESR59830.1| hypothetical protein CICLE_v10017435mg [Citrus clementina]
Length=217

 Score =   178 bits (451),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 78/110 (71%), Positives = 91/110 (83%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            MVR P  D+ G K+G W+ EED KL AY+ RYG WNW QLPKFAGL+R GKSCRLRWMNY
Sbjct  1    MVRAPTYDEKGMKRGAWSKEEDDKLRAYILRYGHWNWTQLPKFAGLSRSGKSCRLRWMNY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRP+IK GNYTKEE++TI++  +Q GNKW+ IAA LPGRTDNEIKN+WHT
Sbjct  61   LRPDIKHGNYTKEEEDTIIKTRQQHGNKWALIAAKLPGRTDNEIKNYWHT  110



>ref|XP_002311670.1| hypothetical protein POPTR_0008s16660g [Populus trichocarpa]
 gb|EEE89037.1| hypothetical protein POPTR_0008s16660g [Populus trichocarpa]
Length=287

 Score =   180 bits (457),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 79/110 (72%), Positives = 94/110 (85%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            MVR PCC+K G K+G WTPEED+ L +YV +YG  NWR LPK AGL RCGKSCRLRW+NY
Sbjct  1    MVRAPCCEKMGLKRGPWTPEEDQILISYVQKYGHSNWRALPKQAGLQRCGKSCRLRWVNY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRP+IKRGN++KEE+E I+++HE LGN+WSAIA+ LPGRTDNEIKN WHT
Sbjct  61   LRPDIKRGNFSKEEEEAIIKLHEILGNRWSAIASRLPGRTDNEIKNVWHT  110



>dbj|BAG71001.1| myb-related transcription factor [Musa balbisiana]
Length=249

 Score =   179 bits (454),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 80/110 (73%), Positives = 92/110 (84%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            MVR PCC+K G KKG WT EED+ L AY+ ++G  NWR LPK AGL RCGKSCRLRW NY
Sbjct  1    MVRAPCCEKMGLKKGPWTAEEDQVLIAYIQQHGHENWRALPKRAGLLRCGKSCRLRWTNY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRP+IKRGN+TKEE+E I+++HE LGN+WSAIAA LPGRTDNEIKN WHT
Sbjct  61   LRPDIKRGNFTKEEEEAIIKLHEMLGNRWSAIAARLPGRTDNEIKNVWHT  110



>ref|NP_001241360.1| MYB29 protein [Glycine max]
 dbj|BAA81733.2| GmMYB29A2 [Glycine max]
 gb|ACU22997.1| unknown [Glycine max]
Length=275

 Score =   180 bits (456),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 78/110 (71%), Positives = 93/110 (85%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            MVR PCC+K G KKG W PEED+ L +Y+ ++G  NWR LPK AGL RCGKSCRLRW+NY
Sbjct  1    MVRAPCCEKMGLKKGPWAPEEDQILTSYIDKHGHGNWRALPKQAGLLRCGKSCRLRWINY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRP+IKRGN+T EE+ETI+++H+ LGN+WSAIAA LPGRTDNEIKN WHT
Sbjct  61   LRPDIKRGNFTIEEEETIIKLHDMLGNRWSAIAAKLPGRTDNEIKNVWHT  110



>gb|ABR28344.1| MYB transcription factor MYB70 [Medicago truncatula]
Length=255

 Score =   179 bits (454),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 80/110 (73%), Positives = 92/110 (84%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            MVRTP CDK G KKG WT EED  L +Y+ ++G  NWR LPK AGL RCGKSCRLRW+NY
Sbjct  1    MVRTPYCDKKGLKKGPWTLEEDEILTSYINKHGHSNWRALPKHAGLLRCGKSCRLRWINY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            L+P+IKRGN+T EE+ETI++MHE LGN+WSAIAA LPGRTDNEIKN WHT
Sbjct  61   LKPDIKRGNFTNEEEETIIKMHESLGNRWSAIAAKLPGRTDNEIKNVWHT  110



>gb|KHN30570.1| Myb-related protein Myb4 [Glycine soja]
Length=275

 Score =   180 bits (456),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 78/110 (71%), Positives = 93/110 (85%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            MVR PCC+K G KKG W PEED+ L +Y+ ++G  NWR LPK AGL RCGKSCRLRW+NY
Sbjct  1    MVRAPCCEKMGLKKGPWAPEEDQILTSYIDKHGHGNWRALPKQAGLLRCGKSCRLRWINY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRP+IKRGN+T EE+ETI+++H+ LGN+WSAIAA LPGRTDNEIKN WHT
Sbjct  61   LRPDIKRGNFTIEEEETIIKLHDMLGNRWSAIAAKLPGRTDNEIKNVWHT  110



>emb|CCA29106.1| putative MYB transcription factor [Rosa rugosa]
Length=272

 Score =   179 bits (455),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 78/110 (71%), Positives = 91/110 (83%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            MVR PCC+K G KKG WTPEED  L +Y+ +YG  NWR LPK AGL RCGKSCRLRW NY
Sbjct  1    MVRAPCCEKMGLKKGPWTPEEDHVLVSYIQQYGHGNWRALPKLAGLLRCGKSCRLRWTNY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRP+IKRGN+++EE+E I+ +H+ LGN+WSAIAA LPGRTDNEIKN WHT
Sbjct  61   LRPDIKRGNFSREEEEAIINLHQMLGNRWSAIAARLPGRTDNEIKNVWHT  110



>ref|XP_004289939.1| PREDICTED: myb-related protein Myb4-like [Fragaria vesca subsp. 
vesca]
Length=272

 Score =   179 bits (455),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 78/110 (71%), Positives = 91/110 (83%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            MVR PCC+K G KKG WTPEED  L +Y+ +YG  NWR LPK AGL RCGKSCRLRW NY
Sbjct  1    MVRAPCCEKMGLKKGPWTPEEDHVLVSYIQQYGHGNWRALPKLAGLLRCGKSCRLRWTNY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRP+IKRGN+++EE+E I+ +H+ LGN+WSAIAA LPGRTDNEIKN WHT
Sbjct  61   LRPDIKRGNFSREEEEAIINLHQMLGNRWSAIAARLPGRTDNEIKNVWHT  110



>ref|XP_006443843.1| hypothetical protein CICLE_v10021699mg [Citrus clementina]
 ref|XP_006479545.1| PREDICTED: myb-related protein Myb4-like [Citrus sinensis]
 gb|ESR57083.1| hypothetical protein CICLE_v10021699mg [Citrus clementina]
Length=267

 Score =   179 bits (454),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 80/110 (73%), Positives = 92/110 (84%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            MVR PCC+K G KKG WTPEED+ L  Y+  YG  NWR LPK AGL RCGKSCRLRW+NY
Sbjct  1    MVRAPCCEKMGLKKGPWTPEEDQILINYIQLYGHGNWRALPKQAGLLRCGKSCRLRWINY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRP+IKRGN+T+EE++TI+ +HE LGN+WSAIAA LPGRTDNEIKN WHT
Sbjct  61   LRPDIKRGNFTREEEDTIINLHEMLGNRWSAIAARLPGRTDNEIKNVWHT  110



>ref|XP_009631826.1| PREDICTED: myb-related protein Myb4-like [Nicotiana tomentosiformis]
Length=256

 Score =   179 bits (453),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 79/110 (72%), Positives = 92/110 (84%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            MVR PCCDK G KKG W+PEED+ L +Y+ R G  NWR LPK AGL RCGKSCRLRWMNY
Sbjct  1    MVRAPCCDKMGLKKGPWSPEEDQILISYIQRNGHGNWRALPKQAGLLRCGKSCRLRWMNY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            L P+IKRGN+TKEE++TI+ +HE+LGN+WSAIA+ L GRTDNEIKN WHT
Sbjct  61   LSPDIKRGNFTKEEEDTIIHLHEKLGNRWSAIASRLQGRTDNEIKNIWHT  110



>ref|XP_004247733.1| PREDICTED: myb-related protein Myb4-like [Solanum lycopersicum]
Length=268

 Score =   179 bits (454),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 78/110 (71%), Positives = 92/110 (84%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            MVR PCC+K G KKG WTPEED+ L +Y+   G  NWR LPK AGL RCGKSCRLRW NY
Sbjct  1    MVRAPCCEKMGLKKGPWTPEEDQILISYIQSNGHGNWRALPKLAGLLRCGKSCRLRWTNY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRP+IKRGN+T+EE+++I+++HE LGN+WSAIAA LPGRTDNEIKN WHT
Sbjct  61   LRPDIKRGNFTREEEDSIIQLHEMLGNRWSAIAARLPGRTDNEIKNVWHT  110



>ref|XP_006354484.1| PREDICTED: myb-related protein Myb4-like [Solanum tuberosum]
Length=268

 Score =   179 bits (454),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 78/110 (71%), Positives = 92/110 (84%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            MVR PCC+K G KKG WTPEED+ L +Y+   G  NWR LPK AGL RCGKSCRLRW NY
Sbjct  1    MVRAPCCEKMGLKKGPWTPEEDQILISYIQSNGHGNWRALPKLAGLLRCGKSCRLRWTNY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRP+IKRGN+T+EE+++I+++HE LGN+WSAIAA LPGRTDNEIKN WHT
Sbjct  61   LRPDIKRGNFTREEEDSIIQLHEMLGNRWSAIAARLPGRTDNEIKNVWHT  110



>gb|AAL78372.1| myb protein [Oryza sativa]
Length=159

 Score =   176 bits (445),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 79/110 (72%), Positives = 93/110 (85%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            M R PCC+K G KKG WTPEED+ L A++ R+G  NWR LPK AGL RCGKSCRLRW+NY
Sbjct  1    MGRAPCCEKMGLKKGPWTPEEDKVLVAHIQRHGHGNWRALPKQAGLLRCGKSCRLRWINY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRP+IKRGN++KEE++TI+ +HE LGN+WSAIAA LPGRTDNEIKN WHT
Sbjct  61   LRPDIKRGNFSKEEEDTIIHLHELLGNRWSAIAARLPGRTDNEIKNVWHT  110



>ref|XP_007030431.1| Myb domain protein 15, putative [Theobroma cacao]
 gb|EOY10933.1| Myb domain protein 15, putative [Theobroma cacao]
Length=232

 Score =   178 bits (451),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 79/109 (72%), Positives = 91/109 (83%), Gaps = 0/109 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            M R PCC+K G KKG WTPEEDR L +Y+ R+G  NWR LPK AGL RCGKSCRLRW+NY
Sbjct  1    MARAPCCEKMGMKKGPWTPEEDRILISYIQRHGHGNWRALPKQAGLPRCGKSCRLRWINY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWH  218
            LRP+IKRGN+T EE ETI ++H+ LGN+WSAIAA LPGRTDNEIKN+WH
Sbjct  61   LRPDIKRGNFTSEEQETIFKLHQVLGNRWSAIAARLPGRTDNEIKNYWH  109



>ref|XP_009765014.1| PREDICTED: myb-related protein Myb4-like [Nicotiana sylvestris]
Length=257

 Score =   179 bits (453),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 78/110 (71%), Positives = 91/110 (83%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            MVR PCC+K G KKG W+PEED  L +Y+ R G  NWR LPK AGL RCGKSCRLRWMNY
Sbjct  1    MVRAPCCEKMGLKKGPWSPEEDEILISYIQRNGHGNWRALPKQAGLLRCGKSCRLRWMNY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            L P+IKRGN+TKEE++TI+ +HE+ GN+WSAIA+ LPGRTDNEIKN WHT
Sbjct  61   LSPDIKRGNFTKEEEDTIIHLHEKFGNRWSAIASRLPGRTDNEIKNIWHT  110



>ref|XP_006446589.1| hypothetical protein CICLE_v10018311mg [Citrus clementina]
 gb|ESR59829.1| hypothetical protein CICLE_v10018311mg [Citrus clementina]
Length=218

 Score =   177 bits (449),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 78/110 (71%), Positives = 91/110 (83%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            MVR P  D+ G K+G W+ EED KL AY+ RYG WNW QLPKFAGL+R GKSCRLRWMNY
Sbjct  1    MVRAPTYDEKGMKRGAWSKEEDDKLRAYILRYGHWNWTQLPKFAGLSRSGKSCRLRWMNY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRP+IK GNYTKEE++TI++  +Q GNKW+ IAA LPGRTDNEIKN+WHT
Sbjct  61   LRPDIKHGNYTKEEEDTIIKTRQQHGNKWALIAAKLPGRTDNEIKNYWHT  110



>ref|XP_008805219.1| PREDICTED: myb-related protein Myb4 [Phoenix dactylifera]
Length=278

 Score =   179 bits (454),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 81/110 (74%), Positives = 91/110 (83%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            MVR PCC+K G KKG WTPEEDR L +Y+ RYG  NWR LP+ AGL RCGKSCRLRW NY
Sbjct  1    MVRAPCCEKMGLKKGPWTPEEDRILVSYIQRYGHGNWRALPRQAGLLRCGKSCRLRWTNY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRP+IKRGN+TKEE+E I+ +HE LGN+WSAIAA L GRTDNEIKN WHT
Sbjct  61   LRPDIKRGNFTKEEEEIIINLHEMLGNRWSAIAAQLHGRTDNEIKNVWHT  110



>ref|XP_002281274.1| PREDICTED: myb-related protein Myb4 [Vitis vinifera]
Length=267

 Score =   179 bits (453),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 78/110 (71%), Positives = 94/110 (85%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            M R+PCCDK G KKG WTPEED+ L A+V ++G  NWR LPK AGL RCGKSCRLRW+NY
Sbjct  1    MARSPCCDKMGLKKGPWTPEEDKILVAHVQKHGHGNWRALPKQAGLLRCGKSCRLRWVNY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRP+IKRGN+++EE++ I+ +HE+LGN+WSAIAA LPGRTDNEIKN WHT
Sbjct  61   LRPDIKRGNFSREEEDAIIDLHEKLGNRWSAIAARLPGRTDNEIKNVWHT  110



>ref|XP_010268905.1| PREDICTED: myb-related protein Myb4-like [Nelumbo nucifera]
Length=253

 Score =   178 bits (452),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 77/110 (70%), Positives = 94/110 (85%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            MV+T  C+K+G KKG WTP+ED KL  Y+ +YG WNWR+LP+FAGL RCGKSCRLRW+NY
Sbjct  1    MVKTGYCEKTGLKKGAWTPDEDEKLTDYIKKYGHWNWRELPRFAGLKRCGKSCRLRWVNY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRPNI+RG +++ EDE I+ +HE LGNKW+AIAA LPGRTDNE+KNHWHT
Sbjct  61   LRPNIRRGLFSEGEDELIMNLHESLGNKWAAIAAKLPGRTDNEVKNHWHT  110



>ref|XP_006470240.1| PREDICTED: myb-related protein Myb4-like [Citrus sinensis]
Length=216

 Score =   177 bits (449),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 78/110 (71%), Positives = 90/110 (82%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            MVR P  D  G K+G W+ EED KL AY+ RYG WNW QLP+FAGL+R GKSCRLRWMNY
Sbjct  1    MVRAPTYDGKGMKRGAWSKEEDDKLRAYILRYGHWNWTQLPRFAGLSRSGKSCRLRWMNY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRP+IK GNYTKEE++TI++  +Q GNKWS IAA LPGRTDNEIKN+WHT
Sbjct  61   LRPDIKHGNYTKEEEDTIIKTRQQHGNKWSLIAAKLPGRTDNEIKNYWHT  110



>ref|XP_007221832.1| hypothetical protein PRUPE_ppa020190mg [Prunus persica]
 gb|EMJ23031.1| hypothetical protein PRUPE_ppa020190mg [Prunus persica]
Length=264

 Score =   178 bits (452),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 78/110 (71%), Positives = 93/110 (85%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            MVR PCC+K G KKG WT EED+ L +++ +YG  NWR LPK AGL RCGKSCRLRW+NY
Sbjct  1    MVRAPCCEKMGLKKGPWTSEEDQILVSFIQKYGHGNWRALPKQAGLLRCGKSCRLRWINY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRP+IKRGN+T+EE+E I+++HE LGN+WSAIAA LPGRTDNEIKN WHT
Sbjct  61   LRPDIKRGNFTREEEEAIIKLHEMLGNRWSAIAARLPGRTDNEIKNVWHT  110



>ref|XP_004162391.1| PREDICTED: myb-related protein Myb4-like [Cucumis sativus]
Length=245

 Score =   178 bits (451),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 80/110 (73%), Positives = 90/110 (82%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            MVR PCC+K G KKG WTPEED+ L  Y+  YG  NWR LPK AGL RCGKSCRLRW NY
Sbjct  1    MVRAPCCEKMGLKKGPWTPEEDQTLINYINLYGHGNWRALPKQAGLLRCGKSCRLRWTNY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRP+IKRGN+T EE+ETI+ +H+ LGN+WSAIAA LPGRTDNEIKN WHT
Sbjct  61   LRPDIKRGNFTAEEEETIINLHQMLGNRWSAIAARLPGRTDNEIKNVWHT  110



>ref|XP_004151985.1| PREDICTED: transcription repressor MYB6-like [Cucumis sativus]
Length=245

 Score =   178 bits (451),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 80/110 (73%), Positives = 90/110 (82%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            MVR PCC+K G KKG WTPEED+ L  Y+  YG  NWR LPK AGL RCGKSCRLRW NY
Sbjct  1    MVRAPCCEKMGLKKGPWTPEEDQTLINYINLYGHGNWRALPKQAGLLRCGKSCRLRWTNY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRP+IKRGN+T EE+ETI+ +H+ LGN+WSAIAA LPGRTDNEIKN WHT
Sbjct  61   LRPDIKRGNFTAEEEETIINLHQMLGNRWSAIAARLPGRTDNEIKNVWHT  110



>gb|AAP92750.1| myb-related protein [Oryza sativa Japonica Group]
Length=257

 Score =   178 bits (451),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 79/110 (72%), Positives = 93/110 (85%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            M R PCC+K G KKG WTPEED+ L A++ R+G  NWR LPK AGL RCGKSCRLRW+NY
Sbjct  1    MGRAPCCEKMGLKKGPWTPEEDKVLVAHIQRHGHGNWRALPKQAGLLRCGKSCRLRWINY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRP+IKRGN++KEE++TI+ +HE LGN+WSAIAA LPGRTDNEIKN WHT
Sbjct  61   LRPDIKRGNFSKEEEDTIIHLHELLGNRWSAIAARLPGRTDNEIKNVWHT  110



>emb|CBI23644.3| unnamed protein product [Vitis vinifera]
Length=144

 Score =   174 bits (441),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 78/110 (71%), Positives = 94/110 (85%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            M R+PCCDK G KKG WTPEED+ L A+V ++G  NWR LPK AGL RCGKSCRLRW+NY
Sbjct  1    MARSPCCDKMGLKKGPWTPEEDKILVAHVQKHGHGNWRALPKQAGLLRCGKSCRLRWVNY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRP+IKRGN+++EE++ I+ +HE+LGN+WSAIAA LPGRTDNEIKN WHT
Sbjct  61   LRPDIKRGNFSREEEDAIIDLHEKLGNRWSAIAARLPGRTDNEIKNVWHT  110



>ref|XP_009601374.1| PREDICTED: myb-related protein Myb4-like [Nicotiana tomentosiformis]
 gb|AAB41101.1| transcription factor Myb1 [Nicotiana tabacum]
 dbj|BAA88223.1| myb-related transcription factor LBM3 [Nicotiana tabacum]
Length=278

 Score =   179 bits (453),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 79/110 (72%), Positives = 91/110 (83%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            MVR PCC+K G KKG W PEED+ L +++   G  NWR LPK AGL RCGKSCRLRW NY
Sbjct  1    MVRAPCCEKMGLKKGPWIPEEDQILISFIQTNGHGNWRALPKQAGLLRCGKSCRLRWTNY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRP+IKRGN+TKEE+ETI+++HE LGN+WSAIAA LPGRTDNEIKN WHT
Sbjct  61   LRPDIKRGNFTKEEEETIIQLHEMLGNRWSAIAAKLPGRTDNEIKNVWHT  110



>emb|CAA78387.1| protein 2 [Petunia x hybrida]
Length=280

 Score =   179 bits (453),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 78/110 (71%), Positives = 92/110 (84%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            M R PCC+K G KKG WTPEED+ L +Y+ + G  NWR LPK AGL RCGKSCRLRW NY
Sbjct  1    MGRAPCCEKMGLKKGPWTPEEDQILVSYIEKNGHGNWRALPKLAGLLRCGKSCRLRWTNY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRP+IKRGN+T+EE++TI+++HE LGN+WSAIAA LPGRTDNEIKN WHT
Sbjct  61   LRPDIKRGNFTREEEDTIIQLHEMLGNRWSAIAARLPGRTDNEIKNVWHT  110



>ref|NP_001241018.1| uncharacterized protein LOC100807569 [Glycine max]
 dbj|BAA81736.1| GmMYB29B2 [Glycine max]
 gb|ACU21296.1| unknown [Glycine max]
 gb|KHN05063.1| Myb-related protein Myb4 [Glycine soja]
Length=272

 Score =   178 bits (452),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 78/110 (71%), Positives = 92/110 (84%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            MVR PCC+K G KKG W  EED+ L +Y+ ++G  NWR LPK AGL RCGKSCRLRW+NY
Sbjct  1    MVRAPCCEKMGLKKGPWATEEDQILTSYIQKHGHGNWRALPKQAGLLRCGKSCRLRWINY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRP+IKRGN+T EE+ETI+++HE LGN+WSAIAA LPGRTDNEIKN WHT
Sbjct  61   LRPDIKRGNFTIEEEETIIKLHEMLGNRWSAIAAKLPGRTDNEIKNVWHT  110



>ref|NP_001053318.1| Os04g0517100 [Oryza sativa Japonica Group]
 sp|Q7XBH4.2|MYB4_ORYSJ RecName: Full=Myb-related protein Myb4; AltName: Full=OsMyb4; 
AltName: Full=Transcription factor RLTR1 [Oryza sativa Japonica 
Group]
 emb|CAA72217.1| myb [Oryza sativa Japonica Group]
 emb|CAE05446.2| OSJNBa0073E02.6 [Oryza sativa Japonica Group]
 dbj|BAF15232.1| Os04g0517100 [Oryza sativa Japonica Group]
 emb|CAH67222.1| OSIGBa0145M07.4 [Oryza sativa Indica Group]
 gb|EAZ31348.1| hypothetical protein OsJ_15470 [Oryza sativa Japonica Group]
Length=257

 Score =   178 bits (451),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 79/110 (72%), Positives = 93/110 (85%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            M R PCC+K G KKG WTPEED+ L A++ R+G  NWR LPK AGL RCGKSCRLRW+NY
Sbjct  1    MGRAPCCEKMGLKKGPWTPEEDKVLVAHIQRHGHGNWRALPKQAGLLRCGKSCRLRWINY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRP+IKRGN++KEE++TI+ +HE LGN+WSAIAA LPGRTDNEIKN WHT
Sbjct  61   LRPDIKRGNFSKEEEDTIIHLHELLGNRWSAIAARLPGRTDNEIKNVWHT  110



>ref|XP_007050304.1| Myb domain protein 13, putative [Theobroma cacao]
 gb|EOX94461.1| Myb domain protein 13, putative [Theobroma cacao]
Length=268

 Score =   178 bits (452),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 80/110 (73%), Positives = 91/110 (83%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            MVR PCC+K G KKG WTPEED+ L  Y+  YG  NWR LPK AGL RCGKSCRLRW NY
Sbjct  1    MVRAPCCEKMGLKKGPWTPEEDQILINYIKLYGHGNWRALPKQAGLLRCGKSCRLRWTNY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRP+IKRGN+T+EE++TI+ +HE LGN+WSAIAA LPGRTDNEIKN WHT
Sbjct  61   LRPDIKRGNFTREEEDTIINLHEMLGNRWSAIAARLPGRTDNEIKNVWHT  110



>gb|EPS74409.1| hypothetical protein M569_00345, partial [Genlisea aurea]
Length=150

 Score =   174 bits (441),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 78/110 (71%), Positives = 92/110 (84%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            M R+PCCD+SG KKG WTPEED KL  Y+ ++G  +WR LPKFAGL RCGKSCRLRW NY
Sbjct  1    MGRSPCCDESGLKKGPWTPEEDEKLVEYIRKHGHGSWRALPKFAGLNRCGKSCRLRWTNY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRP+IKRG +++EE+ETI+ +H  LGNKWSAIA HLPGRTDNEIKN W+T
Sbjct  61   LRPDIKRGKFSQEEEETILNLHSILGNKWSAIATHLPGRTDNEIKNFWNT  110



>ref|XP_008669188.1| PREDICTED: myb-related protein Myb4 [Zea mays]
 tpg|DAA36984.1| TPA: putative MYB DNA-binding domain superfamily protein [Zea 
mays]
Length=294

 Score =   179 bits (453),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 78/110 (71%), Positives = 92/110 (84%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            M R PCC+K G KKG WTPEED+ L A++  +G  NWR LPK AGL RCGKSCRLRW+NY
Sbjct  1    MGRAPCCEKMGLKKGPWTPEEDKVLVAHIQSFGHSNWRALPKQAGLLRCGKSCRLRWINY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRP+IKRGN++KEE++ I+ +HEQLGN+WSAIAA LPGRTDNEIKN WHT
Sbjct  61   LRPDIKRGNFSKEEEDAIISLHEQLGNRWSAIAARLPGRTDNEIKNVWHT  110



>ref|XP_001768811.1| predicted protein [Physcomitrella patens]
 gb|EDQ66364.1| predicted protein [Physcomitrella patens]
Length=165

 Score =   174 bits (442),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 77/110 (70%), Positives = 92/110 (84%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            MVR PCCDK G KKG WTPEED+KL  Y+ R+G  +WR LPK AGL+RCGKSCRLRW NY
Sbjct  1    MVRAPCCDKMGLKKGPWTPEEDQKLVDYIQRFGHGSWRALPKHAGLSRCGKSCRLRWTNY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRP+IKRG ++ EE++ I+ +H  LGN+WSAIAA+LPGRTDNEIKNHW+T
Sbjct  61   LRPDIKRGQFSFEEEQVIIHLHGLLGNRWSAIAAYLPGRTDNEIKNHWNT  110



>ref|XP_002325682.1| hypothetical protein POPTR_0019s14130g [Populus trichocarpa]
 gb|EEF00064.1| hypothetical protein POPTR_0019s14130g [Populus trichocarpa]
Length=263

 Score =   177 bits (450),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 75/110 (68%), Positives = 93/110 (85%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            MVR P  DK+G KKG W+ EED KL  ++ +YG WNWR++PKFAGL+RCGKSCRLRWMNY
Sbjct  1    MVRAPYFDKNGVKKGAWSEEEDDKLREHIEKYGLWNWREIPKFAGLSRCGKSCRLRWMNY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRP++K GNYTKEE++ I+++HE+ GNKWS IAA LPGRTDNE+KN+WH 
Sbjct  61   LRPDVKHGNYTKEEEDLILKLHEKHGNKWSIIAAKLPGRTDNEVKNYWHA  110



>ref|XP_008645950.1| PREDICTED: myb-related protein Myb4 [Zea mays]
 gb|AFW72399.1| putative MYB DNA-binding domain superfamily protein [Zea mays]
 gb|AIB05681.1| MYB transcription factor, partial [Zea mays]
Length=244

 Score =   177 bits (449),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 76/110 (69%), Positives = 93/110 (85%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            M R PCC+K G K+G WTPEEDR L A++ R+G  NWR LPK AGL RCGKSCRLRW+NY
Sbjct  1    MGRAPCCEKMGLKRGPWTPEEDRILVAHIERHGHSNWRALPKQAGLPRCGKSCRLRWINY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRP+IKRGN+T+EE++ ++++H+ LGN+WSAIAA LPGRTDNEIKN WHT
Sbjct  61   LRPDIKRGNFTREEEDAVIQLHQMLGNRWSAIAARLPGRTDNEIKNVWHT  110



>ref|XP_010069126.1| PREDICTED: myb-related protein Myb4 [Eucalyptus grandis]
Length=275

 Score =   178 bits (451),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 78/110 (71%), Positives = 92/110 (84%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            MVR PCC+K G K+G WTP+ED+ L +Y+ R G  NWR LPK AGL RCGKSCRLRW+NY
Sbjct  1    MVRAPCCEKMGLKRGPWTPDEDQVLISYIQRNGHGNWRALPKQAGLLRCGKSCRLRWINY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRP+IKRGN+  EE+ETI+++HE LGN+WSAIAA LPGRTDNEIKN WHT
Sbjct  61   LRPDIKRGNFNSEEEETIIKLHEMLGNRWSAIAARLPGRTDNEIKNVWHT  110



>ref|XP_008235684.1| PREDICTED: myb-related protein Myb4 [Prunus mume]
Length=264

 Score =   177 bits (450),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 78/110 (71%), Positives = 90/110 (82%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            MVR PCC+K G KKG WTPEED  L  Y+ +YG  NWR LPK AGL RCGKSCRLRW NY
Sbjct  1    MVRAPCCEKMGLKKGPWTPEEDHILVTYIQQYGHGNWRALPKLAGLLRCGKSCRLRWTNY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRP+IKRGN+++EE++ I+ +HE LGN+WSAIAA LPGRTDNEIKN WHT
Sbjct  61   LRPDIKRGNFSREEEDAIINLHEMLGNRWSAIAARLPGRTDNEIKNVWHT  110



>emb|CDO99233.1| unnamed protein product [Coffea canephora]
Length=282

 Score =   178 bits (451),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 78/110 (71%), Positives = 93/110 (85%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            MVR PCC+K G KKG WTPEED+ L +++ + G  NWR LPK AGL RCGKSCRLRW NY
Sbjct  1    MVRAPCCEKMGLKKGPWTPEEDQVLVSHIQKNGHGNWRALPKQAGLLRCGKSCRLRWTNY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRP+IKRGN++KEE++TI+++HE LGN+WSAIAA LPGRTDNEIKN WHT
Sbjct  61   LRPDIKRGNFSKEEEDTIIKLHETLGNRWSAIAARLPGRTDNEIKNVWHT  110



>ref|XP_007143866.1| hypothetical protein PHAVU_007G108500g [Phaseolus vulgaris]
 gb|ESW15860.1| hypothetical protein PHAVU_007G108500g [Phaseolus vulgaris]
Length=267

 Score =   177 bits (450),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 77/110 (70%), Positives = 92/110 (84%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            MVR PCC+K G KKG W PEED+ L +Y+ ++G  NWR LPK AGL RCGKSCRLRW+NY
Sbjct  1    MVRAPCCEKMGLKKGPWAPEEDQILTSYIQKHGHGNWRALPKQAGLLRCGKSCRLRWINY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            L+P+IKRGN+T EE+E I+++HE LGN+WSAIAA LPGRTDNEIKN WHT
Sbjct  61   LKPDIKRGNFTSEEEEIILKLHETLGNRWSAIAAKLPGRTDNEIKNVWHT  110



>ref|XP_004248359.1| PREDICTED: transcription factor MYB3-like [Solanum lycopersicum]
Length=313

 Score =   179 bits (453),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 79/110 (72%), Positives = 92/110 (84%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            M RTPCCDK+G KKG WT EED+KL  Y+ +YG  NWR LPK AGL RCGKSCRLRW+NY
Sbjct  1    MGRTPCCDKNGLKKGPWTTEEDQKLIDYIQKYGSGNWRILPKNAGLQRCGKSCRLRWINY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRP+IKRG ++ EE+ETI+ +H  LGNKWSAIAA LPGRTDNEIKN+W+T
Sbjct  61   LRPDIKRGKFSFEEEETIIHLHSILGNKWSAIAARLPGRTDNEIKNYWNT  110



>ref|XP_006487722.1| PREDICTED: myb-related protein Myb4-like [Citrus sinensis]
Length=231

 Score =   176 bits (447),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 77/110 (70%), Positives = 95/110 (86%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            MVRTPCC+K G KKG WTPEED+ L +++ R+G  NWR LPK AGL RCGKSCRLRW+NY
Sbjct  1    MVRTPCCEKMGSKKGPWTPEEDQILISFIQRFGHGNWRALPKQAGLMRCGKSCRLRWINY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRP+IKRGN++K+E+ETI+++H  LGN+WS IAA LPGRTDNEIKN+WH+
Sbjct  61   LRPDIKRGNFSKDEEETILKLHRVLGNRWSTIAARLPGRTDNEIKNYWHS  110



>gb|KHN41176.1| Myb-related protein Myb4 [Glycine soja]
Length=246

 Score =   177 bits (448),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 77/109 (71%), Positives = 91/109 (83%), Gaps = 0/109 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            MVR P  DK+G KKG W+ EED KL AYV R+G  NWRQLPKFAGLARCGKSCRLRW+NY
Sbjct  1    MVRAPFYDKNGLKKGAWSREEDEKLTAYVKRHGHSNWRQLPKFAGLARCGKSCRLRWLNY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWH  218
            LRPN+K GNYT EE++ I+++H++ GNKWS IA  LPGRTDNE+KN+WH
Sbjct  61   LRPNLKHGNYTLEEEKIIIKLHQEFGNKWSLIAEKLPGRTDNEVKNYWH  109



>gb|AGQ80898.1| R2R3-type MYB tanscription factor [Lithospermum erythrorhizon]
Length=212

 Score =   176 bits (445),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 79/110 (72%), Positives = 93/110 (85%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            MVR PCC+K G KKG WT EED+ L +Y+ RYG  NWR LPK AGL RCGKSCRLRW+NY
Sbjct  1    MVRAPCCEKMGVKKGPWTTEEDQILISYIQRYGHDNWRALPKQAGLLRCGKSCRLRWINY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRP+IKRGN++KEE+ETI+++HE LGN+WSAIA  LPGRTDNEIKN W+T
Sbjct  61   LRPDIKRGNFSKEEEETIIKLHELLGNRWSAIATRLPGRTDNEIKNFWNT  110



>ref|XP_007199224.1| hypothetical protein PRUPE_ppa021921mg [Prunus persica]
 gb|EMJ00423.1| hypothetical protein PRUPE_ppa021921mg [Prunus persica]
Length=258

 Score =   177 bits (449),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 78/110 (71%), Positives = 90/110 (82%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            MVR PCC+K G KKG WTPEED  L  Y+ +YG  NWR LPK AGL RCGKSCRLRW NY
Sbjct  1    MVRAPCCEKMGLKKGPWTPEEDHVLVTYIQQYGHGNWRALPKLAGLLRCGKSCRLRWTNY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRP+IKRGN+++EE++ I+ +HE LGN+WSAIAA LPGRTDNEIKN WHT
Sbjct  61   LRPDIKRGNFSREEEDAIINLHEMLGNRWSAIAARLPGRTDNEIKNVWHT  110



>ref|XP_004495379.1| PREDICTED: myb-related protein Myb4-like [Cicer arietinum]
Length=276

 Score =   177 bits (450),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 75/110 (68%), Positives = 94/110 (85%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            MVR PCC+K G K+G W+ +ED+ L +Y+ ++G  NWR LPK AGL RCGKSCRLRW+NY
Sbjct  1    MVRAPCCEKMGLKRGPWSLDEDQILTSYIQKHGHGNWRALPKLAGLLRCGKSCRLRWINY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            L+P+IKRGN+T EE+ETI+++HE+LGN+WSAIAA LPGRTDNEIKN WHT
Sbjct  61   LKPDIKRGNFTNEEEETIIKLHEKLGNRWSAIAAKLPGRTDNEIKNVWHT  110



>gb|ACB30359.1| myb-related transcription factor [Capsicum annuum]
Length=278

 Score =   177 bits (450),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 77/110 (70%), Positives = 92/110 (84%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            MVR PCC+K G KKG WTPEED+ L +Y+   G  NWR LPK AGL RCGKSCRLRW NY
Sbjct  1    MVRAPCCEKMGLKKGPWTPEEDQILVSYIQANGHGNWRALPKLAGLLRCGKSCRLRWTNY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRP+IKRGN+T+EE+++I+++HE LGN+WSAIAA LPGRTD+EIKN WHT
Sbjct  61   LRPDIKRGNFTREEEDSIIQLHEMLGNRWSAIAARLPGRTDDEIKNVWHT  110



>ref|XP_002454197.1| hypothetical protein SORBIDRAFT_04g026480 [Sorghum bicolor]
 gb|EES07173.1| hypothetical protein SORBIDRAFT_04g026480 [Sorghum bicolor]
Length=258

 Score =   177 bits (448),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 77/110 (70%), Positives = 92/110 (84%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            M R PCC+K G K+G WTPEEDR L A++ R+G  NWR LPK AGL RCGKSCRLRW+NY
Sbjct  1    MGRAPCCEKMGLKRGPWTPEEDRVLVAHIERHGHSNWRALPKQAGLLRCGKSCRLRWINY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRP+IKRGN+T EE++ I+++H+ LGN+WSAIAA LPGRTDNEIKN WHT
Sbjct  61   LRPDIKRGNFTAEEEDAIIQLHQMLGNRWSAIAARLPGRTDNEIKNVWHT  110



>gb|AFK39973.1| unknown [Medicago truncatula]
 gb|KEH42768.1| myb-related transcription factor LBM1 [Medicago truncatula]
Length=258

 Score =   177 bits (448),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 76/110 (69%), Positives = 91/110 (83%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            MVR PCC+K G K+G W+ EED  L +Y+ ++G  NWR LPK AGL RCGKSCRLRW+NY
Sbjct  1    MVRAPCCEKMGLKRGPWSLEEDEILTSYIQKHGHGNWRALPKLAGLLRCGKSCRLRWINY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRP+IKRGN+T EE+E I+++HE LGN+WSAIAA LPGRTDNEIKN WHT
Sbjct  61   LRPDIKRGNFTNEEEENIIKLHEMLGNRWSAIAAKLPGRTDNEIKNVWHT  110



>ref|XP_006350689.1| PREDICTED: myb-related protein Myb4-like [Solanum tuberosum]
Length=268

 Score =   177 bits (449),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 78/110 (71%), Positives = 90/110 (82%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            M R PCC+K G KKG W+PEED  L +Y+   G  NWR LPK AGL RCGKSCRLRW NY
Sbjct  1    MGRAPCCEKMGLKKGPWSPEEDNILISYIQNNGHSNWRALPKLAGLLRCGKSCRLRWTNY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRP+IKRGN+TKEE++TI+++HE LGN+WSAIAA LPGRTDNEIKN WHT
Sbjct  61   LRPDIKRGNFTKEEEDTIIKLHENLGNRWSAIAARLPGRTDNEIKNIWHT  110



>ref|XP_010935898.1| PREDICTED: myb-related protein Myb4 isoform X1 [Elaeis guineensis]
Length=268

 Score =   177 bits (449),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 80/110 (73%), Positives = 91/110 (83%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            MVR PCC+K G KKG WT EEDR L +Y+ R G  NWR LPK AGL RCGKSCRLRW NY
Sbjct  1    MVRAPCCEKMGLKKGPWTLEEDRILVSYIQRNGHGNWRALPKQAGLLRCGKSCRLRWTNY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRP+IKRGN+TKEE+E I+++H+ LGN+WSAIAA LPGRTDNEIKN WHT
Sbjct  61   LRPDIKRGNFTKEEEEIIIKLHDMLGNRWSAIAAQLPGRTDNEIKNVWHT  110



>gb|ACJ84928.1| unknown [Medicago truncatula]
Length=258

 Score =   177 bits (448),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 76/110 (69%), Positives = 91/110 (83%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            MVR PCC+K G K+G W+ EED  L +Y+ ++G  NWR LPK AGL RCGKSCRLRW+NY
Sbjct  1    MVRAPCCEKMGLKRGPWSLEEDEILTSYIQKHGHGNWRALPKLAGLLRCGKSCRLRWINY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRP+IKRGN+T EE+E I+++HE LGN+WSAIAA LPGRTDNEIKN WHT
Sbjct  61   LRPDIKRGNFTNEEEENIIKLHEMLGNRWSAIAAKLPGRTDNEIKNVWHT  110



>ref|XP_009606766.1| PREDICTED: myb-related protein Myb4-like [Nicotiana tomentosiformis]
Length=236

 Score =   176 bits (446),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 75/110 (68%), Positives = 94/110 (85%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            MVR PCC++ G KKG WT EED+ L +++ RYG  NWR LP+ AGL RCGKSCRLRW+NY
Sbjct  1    MVRAPCCERMGLKKGPWTAEEDQILISFIQRYGHENWRALPRQAGLLRCGKSCRLRWINY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRP+IKRGN+++EE+ETI+++H+ LGN+WSAIA+ LPGRTDNEIKN WHT
Sbjct  61   LRPDIKRGNFSEEEEETIIKLHQVLGNRWSAIASRLPGRTDNEIKNFWHT  110



>dbj|BAI49720.1| putative MYB transcription factor [Diospyros kaki]
Length=255

 Score =   176 bits (447),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 82/110 (75%), Positives = 94/110 (85%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            MVR    D++G KKG WTPEED KL AY+ RYG WNWRQLPKFAGL+RCGKSCRLRWMNY
Sbjct  1    MVRAARVDENGMKKGAWTPEEDEKLRAYIQRYGHWNWRQLPKFAGLSRCGKSCRLRWMNY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRPN+KRG YTKEE+E I+ +H+QLGNKWS +A  LPGRTDN+IK+HWHT
Sbjct  61   LRPNVKRGAYTKEEEEIIIELHQQLGNKWSIMAGKLPGRTDNDIKDHWHT  110



>ref|XP_009374421.1| PREDICTED: transcription factor RAX2 [Pyrus x bretschneideri]
Length=347

 Score =   179 bits (454),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 79/110 (72%), Positives = 93/110 (85%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            M RTPCCDK+G KKG WTPEED+KL  Y+ ++G  NWR LPK AGL RCGKSCRLRW NY
Sbjct  1    MGRTPCCDKNGLKKGPWTPEEDQKLMDYIQKHGYGNWRTLPKNAGLQRCGKSCRLRWTNY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRP+IKRG ++ EE+ETI+++H  LGNKWSAIAA LPGRTDNEIKN+W+T
Sbjct  61   LRPDIKRGRFSFEEEETIIQLHSILGNKWSAIAARLPGRTDNEIKNYWNT  110



>ref|XP_008447428.1| PREDICTED: myb-related protein Myb4-like [Cucumis melo]
Length=246

 Score =   176 bits (446),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 80/110 (73%), Positives = 89/110 (81%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            MVR PCC+K G KKG WTPEED+ L  Y+  YG  NWR LPK AGL RCGKSCRLRW NY
Sbjct  1    MVRAPCCEKMGLKKGPWTPEEDQILINYINLYGHGNWRALPKQAGLLRCGKSCRLRWTNY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRP+IKRGN+T EE+ETI+ +HE LGN+WS IAA LPGRTDNEIKN WHT
Sbjct  61   LRPDIKRGNFTPEEEETIINLHEMLGNRWSTIAARLPGRTDNEIKNVWHT  110



>ref|XP_004497845.1| PREDICTED: myb-related protein Myb4-like [Cicer arietinum]
Length=272

 Score =   177 bits (448),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 78/110 (71%), Positives = 90/110 (82%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            MVR PCC+K G KKG WT EED  L +Y+ ++G  NWR LPK AGL RCGKSCRLRW+NY
Sbjct  1    MVRAPCCEKKGLKKGPWTQEEDEILISYIQKHGHSNWRALPKHAGLLRCGKSCRLRWINY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRP+IKRGN+T EE+E I++MHE LGN+WS IAA LPGRTDNEIKN WHT
Sbjct  61   LRPDIKRGNFTNEEEEIIIKMHELLGNRWSVIAAKLPGRTDNEIKNVWHT  110



>ref|XP_011047494.1| PREDICTED: myb-related protein Myb4-like [Populus euphratica]
Length=263

 Score =   176 bits (447),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 75/110 (68%), Positives = 93/110 (85%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            MVR P  DK+G KKG W+ EED KL  ++ +YG WNWR++PKFAGL+RCGKSCRLRWMNY
Sbjct  1    MVRAPYFDKNGIKKGAWSQEEDDKLREHIEKYGLWNWREIPKFAGLSRCGKSCRLRWMNY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRP++K GNYTKEE++ I+++HE+ GNKWS IAA LPGRTDNE+KN+WH 
Sbjct  61   LRPDVKHGNYTKEEEDLILKLHEKHGNKWSIIAAKLPGRTDNEVKNYWHA  110



>gb|AGN52037.1| MYB-related transcription factor [Salvia miltiorrhiza]
Length=259

 Score =   176 bits (447),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 76/110 (69%), Positives = 90/110 (82%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            MVR P  D SG KKG W+ +ED KL AY+ RYG WNWR LPK+AGL RCGKSCRLRW+NY
Sbjct  1    MVRPPSIDSSGMKKGAWSEDEDEKLRAYIHRYGHWNWRLLPKYAGLKRCGKSCRLRWVNY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            L+P +KRG+++KEE E +V++H +LGNKWSAIA  LPGRTDNEIKN WHT
Sbjct  61   LKPGVKRGDFSKEEKEIVVKLHAELGNKWSAIAEQLPGRTDNEIKNFWHT  110



>ref|XP_006489734.1| PREDICTED: myb-related protein Myb4-like [Citrus sinensis]
Length=267

 Score =   177 bits (448),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 79/110 (72%), Positives = 93/110 (85%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            M R PCC+K G KKG WTPEEDR L A++ ++G  NWR LPK AGL RCGKSCRLRW+NY
Sbjct  1    MGRAPCCEKMGLKKGPWTPEEDRILIAHIKKHGHPNWRALPKQAGLLRCGKSCRLRWINY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRP+IKRGN++KEE+ETI+ +H+ LGN+WSAIAA LPGRTDNEIKN WHT
Sbjct  61   LRPDIKRGNFSKEEEETIINLHDMLGNRWSAIAARLPGRTDNEIKNVWHT  110



>ref|XP_004958010.1| PREDICTED: uncharacterized protein LOC101782226 [Setaria italica]
Length=362

 Score =   179 bits (455),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 80/110 (73%), Positives = 93/110 (85%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            M R PCC+KSG KKG WTPEED KL AY+ ++G  NWR LPK AGLARCGKSCRLRW NY
Sbjct  1    MGRAPCCEKSGLKKGPWTPEEDEKLVAYIKKHGQGNWRTLPKNAGLARCGKSCRLRWTNY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRP+IKRG ++ EE+ETI+++H  LGNKWSAIAA LPGRTDNEIKN+W+T
Sbjct  61   LRPDIKRGRFSFEEEETIIQLHSILGNKWSAIAARLPGRTDNEIKNYWNT  110



>ref|NP_001234262.1| myb-related transcription factor [Solanum lycopersicum]
 emb|CAA66952.1| THM18 [Solanum lycopersicum]
Length=265

 Score =   176 bits (447),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 78/110 (71%), Positives = 90/110 (82%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            M R PCC+K G KKG WTP+ED  L +Y+   G  NWR LPK AGL RCGKSCRLRW NY
Sbjct  1    MGRAPCCEKMGLKKGPWTPQEDNILISYIQNNGHSNWRALPKLAGLLRCGKSCRLRWTNY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRP+IKRGN+TKEE++TI+++HE LGN+WSAIAA LPGRTDNEIKN WHT
Sbjct  61   LRPDIKRGNFTKEEEDTIIKLHENLGNRWSAIAARLPGRTDNEIKNIWHT  110



>gb|KDP23708.1| hypothetical protein JCGZ_23541 [Jatropha curcas]
 gb|AIT52250.1| MYB family protein [Jatropha curcas]
Length=212

 Score =   175 bits (443),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 76/110 (69%), Positives = 92/110 (84%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            MVR PCC+  G KKG WTPEED+ L +Y+ RYG  NWR LP+ AGL RCGKSCRLRW+NY
Sbjct  1    MVRIPCCENMGLKKGPWTPEEDQILISYIQRYGHGNWRALPRQAGLLRCGKSCRLRWINY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRP+IKRGN+T EE+ETI+++ + LGN+WS IAA LPGRTDNEIKN+WH+
Sbjct  61   LRPDIKRGNFTDEEEETIIKLRQILGNRWSTIAAKLPGRTDNEIKNYWHS  110



>ref|XP_010671030.1| PREDICTED: myb-related protein Myb4-like [Beta vulgaris subsp. 
vulgaris]
Length=288

 Score =   177 bits (449),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 76/110 (69%), Positives = 94/110 (85%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            M R PCCDK G KKG WTPEED+ L +++ ++G  NWR LPK +GL RCGKSCRLRW+NY
Sbjct  1    MGRAPCCDKVGLKKGPWTPEEDQILISFIQQHGHSNWRALPKQSGLLRCGKSCRLRWINY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRP+IKRGN++KEE++TI+++HE +GN+WSAIAA LPGRTDNEIKN WHT
Sbjct  61   LRPDIKRGNFSKEEEDTIIQLHEMMGNRWSAIAARLPGRTDNEIKNVWHT  110



>ref|XP_008224916.1| PREDICTED: myb-related protein Myb4-like [Prunus mume]
Length=248

 Score =   176 bits (446),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 76/110 (69%), Positives = 94/110 (85%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            MV++  C+K+  KKG W P+ED KL AY+ RYG WNW Q+PK AGLAR GKSCRLRW+NY
Sbjct  1    MVKSQRCEKAAVKKGPWNPDEDHKLIAYIQRYGIWNWSQMPKPAGLARSGKSCRLRWVNY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRP+IKRG+++KEE+E I+++HE LGN+WSAIAA LPGRTDNEIKN+WHT
Sbjct  61   LRPDIKRGSFSKEEEEAILKLHETLGNRWSAIAATLPGRTDNEIKNYWHT  110



>ref|XP_011091315.1| PREDICTED: myb-related protein Myb4-like [Sesamum indicum]
Length=251

 Score =   176 bits (446),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 77/110 (70%), Positives = 93/110 (85%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            MVR PCC+K G KKG W+PEED+ L +Y+ ++G  NWR LPK AGL RCGKSCRLRW NY
Sbjct  1    MVRAPCCEKMGLKKGPWSPEEDQILVSYIQQHGHGNWRALPKQAGLLRCGKSCRLRWTNY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRP+IKRGN+TK+E++TI+ +H+ LGN+WSAIAA LPGRTDNEIKN WHT
Sbjct  61   LRPDIKRGNFTKQEEDTIITLHQCLGNRWSAIAARLPGRTDNEIKNVWHT  110



>ref|XP_010268949.1| PREDICTED: myb-related protein 308-like [Nelumbo nucifera]
Length=265

 Score =   176 bits (447),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 73/102 (72%), Positives = 89/102 (87%), Gaps = 0/102 (0%)
 Frame = -2

Query  520  KSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNYLRPNIKRG  341
            K+  KKG WTPEED KL AY+ RYG WNWR+LP+FAGL+RCGKSCRLRW+NYLRP IKRG
Sbjct  11   KTELKKGAWTPEEDEKLTAYIRRYGHWNWRELPRFAGLSRCGKSCRLRWVNYLRPGIKRG  70

Query  340  NYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            N++ EEDE I+ +H+ LGNKW+AI+A LPGRTDNE+KN+WH+
Sbjct  71   NFSAEEDEIIINLHQSLGNKWAAISAQLPGRTDNEVKNYWHS  112



>ref|XP_010671094.1| PREDICTED: transcription factor MYB39 [Beta vulgaris subsp. vulgaris]
Length=360

 Score =   179 bits (454),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 77/110 (70%), Positives = 91/110 (83%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            M R+PCCD+SG KKG WTPEED++L  Y+ R+G  +WR LPK AGL RCGKSCRLRW NY
Sbjct  2    MGRSPCCDESGLKKGPWTPEEDKQLTDYIQRHGHGSWRALPKLAGLNRCGKSCRLRWTNY  61

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRP+IKRG +T EE +TI+ +H  LGNKWSAIA+HLPGRTDNEIKN W+T
Sbjct  62   LRPDIKRGKFTDEEQQTIINLHSVLGNKWSAIASHLPGRTDNEIKNLWNT  111



>ref|XP_010102236.1| Myb-related protein Myb4 [Morus notabilis]
 gb|EXB93179.1| Myb-related protein Myb4 [Morus notabilis]
Length=280

 Score =   177 bits (448),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 76/109 (70%), Positives = 93/109 (85%), Gaps = 0/109 (0%)
 Frame = -2

Query  541  VRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNYL  362
            +RTPCC+K G KKG WTPEED  L +++ +YG  NWR LPK AGL RCGKSCRLRW+NYL
Sbjct  1    MRTPCCEKMGLKKGPWTPEEDHILISFIQQYGHGNWRALPKQAGLLRCGKSCRLRWINYL  60

Query  361  RPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            RP+IKRG+++K+E+ETI ++H+ LGN+WSAIAA LPGRTDNEIKN WHT
Sbjct  61   RPDIKRGSFSKDEEETITKLHQLLGNRWSAIAAKLPGRTDNEIKNFWHT  109



>gb|AIR07398.1| MYB12 transcription factor [Gossypium hirsutum]
 gb|KHG21229.1| Myb-related Myb4 [Gossypium arboreum]
Length=275

 Score =   176 bits (447),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 79/110 (72%), Positives = 90/110 (82%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            M R PCC+K G KKG WTPEED+ L  Y+  YG  NWR LPK AGL RCGKSCRLRW NY
Sbjct  1    MGRAPCCEKMGLKKGPWTPEEDQILINYINLYGHGNWRALPKQAGLLRCGKSCRLRWTNY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRP+IKRGN+T+EE++TI+ +HE LGN+WSAIAA LPGRTDNEIKN WHT
Sbjct  61   LRPDIKRGNFTREEEDTIINLHEMLGNRWSAIAARLPGRTDNEIKNVWHT  110



>ref|XP_009383106.1| PREDICTED: transcription factor MYB34-like [Musa acuminata subsp. 
malaccensis]
Length=325

 Score =   178 bits (451),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 79/110 (72%), Positives = 94/110 (85%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            M RTPCCDKSG KKG WTPEED+KL  Y+ ++G  +WR LPK AGLARCGKSCRLRW NY
Sbjct  1    MGRTPCCDKSGLKKGPWTPEEDQKLIDYIQKHGHGSWRTLPKNAGLARCGKSCRLRWTNY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRP+IKRG ++ EE+ETI+++H  LGNKWSAIAA LPGRTDNEIKN+W++
Sbjct  61   LRPDIKRGRFSFEEEETIIQLHSILGNKWSAIAARLPGRTDNEIKNYWNS  110



>ref|XP_010645217.1| PREDICTED: myb-related protein Myb4 [Vitis vinifera]
 emb|CBI35631.3| unnamed protein product [Vitis vinifera]
Length=330

 Score =   178 bits (451),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 77/110 (70%), Positives = 92/110 (84%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            M R+PCCD+SG KKG WTPEED+KL  Y+ + G  +WR LPK AGL RCGKSCRLRW NY
Sbjct  1    MGRSPCCDESGLKKGPWTPEEDQKLVKYIQKQGHGSWRALPKLAGLNRCGKSCRLRWTNY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRP+IKRG +++EE+ETI+ +H  LGNKWSAIA+HLPGRTDNEIKN W+T
Sbjct  61   LRPDIKRGKFSREEEETILNLHSILGNKWSAIASHLPGRTDNEIKNFWNT  110



>ref|XP_004953959.1| PREDICTED: transcription factor MYB39-like [Setaria italica]
Length=325

 Score =   178 bits (451),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 77/110 (70%), Positives = 92/110 (84%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            M R+PCCD++G KKG WTPEED KL  Y+ ++G  +WR LPK AGL RCGKSCRLRW NY
Sbjct  1    MGRSPCCDENGLKKGPWTPEEDEKLMEYIQKHGHGSWRALPKLAGLNRCGKSCRLRWTNY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRP+IKRG +T+EE++TI+R+H  LGNKWSAIA HLPGRTDNEIKN W+T
Sbjct  61   LRPDIKRGKFTQEEEQTILRLHSVLGNKWSAIAKHLPGRTDNEIKNFWNT  110



>ref|XP_007216491.1| hypothetical protein PRUPE_ppa025095mg, partial [Prunus persica]
 gb|EMJ17690.1| hypothetical protein PRUPE_ppa025095mg, partial [Prunus persica]
Length=210

 Score =   174 bits (441),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 76/110 (69%), Positives = 89/110 (81%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            MVR P  DKSG KKG W+PEED  L AY+  +G  NWR LPKFAG++RCGKSCRLRW NY
Sbjct  1    MVRAPFYDKSGLKKGAWSPEEDDTLRAYIEEHGHLNWRSLPKFAGISRCGKSCRLRWTNY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRP +KRGNYT+ ED+ I+++HE+ GNKWS IA  LPGRTDNEIKNHW+T
Sbjct  61   LRPGVKRGNYTQAEDDLILKLHEEFGNKWSMIATKLPGRTDNEIKNHWNT  110



>emb|CDO99983.1| unnamed protein product [Coffea canephora]
Length=255

 Score =   176 bits (445),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 76/110 (69%), Positives = 93/110 (85%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            MVR PCC+K G KKG WTPEED+ L ++V  YG  NWR LPK AGL RCGKSCRLRW NY
Sbjct  1    MVRVPCCEKMGLKKGPWTPEEDQILVSFVQHYGHENWRALPKQAGLLRCGKSCRLRWTNY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRP+IKRGN++KEE+E+I+++H+ +GN+WSAIA  LPGRTDNEIKN+W+T
Sbjct  61   LRPDIKRGNFSKEEEESIIKLHQIMGNRWSAIANRLPGRTDNEIKNYWNT  110



>ref|XP_002513237.1| r2r3-myb transcription factor, putative [Ricinus communis]
 gb|EEF49105.1| r2r3-myb transcription factor, putative [Ricinus communis]
Length=218

 Score =   174 bits (442),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 76/87 (87%), Positives = 83/87 (95%), Gaps = 0/87 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            MVRTPCCDKSG KKGTWTPEEDRKL AYVTRYGCWNWRQLPKFAGL+RCGKSCRLRW+NY
Sbjct  1    MVRTPCCDKSGLKKGTWTPEEDRKLMAYVTRYGCWNWRQLPKFAGLSRCGKSCRLRWLNY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGN  284
            LRPNIKRGNYTKEE++TI+++H  LGN
Sbjct  61   LRPNIKRGNYTKEEEDTILKLHASLGN  87



>gb|AGN52147.1| MYB-related transcription factor [Salvia miltiorrhiza]
Length=259

 Score =   176 bits (445),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 75/110 (68%), Positives = 90/110 (82%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            MVR P  D +G KKG W+ +ED KL AY+ RYG WNWR LPK+AGL RCGKSCRLRW+NY
Sbjct  1    MVRPPSIDSNGMKKGAWSEDEDEKLRAYINRYGHWNWRLLPKYAGLKRCGKSCRLRWVNY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            L+P +KRG+++KEE E +V++H +LGNKWSAIA  LPGRTDNEIKN WHT
Sbjct  61   LKPGVKRGDFSKEEKEIVVKLHAELGNKWSAIAEQLPGRTDNEIKNFWHT  110



>ref|XP_007145850.1| hypothetical protein PHAVU_007G273400g [Phaseolus vulgaris]
 gb|ESW17844.1| hypothetical protein PHAVU_007G273400g [Phaseolus vulgaris]
Length=254

 Score =   176 bits (445),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 76/110 (69%), Positives = 92/110 (84%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            MVR PCC+K G KKG WT EED+ L +Y+ ++G  NWR LPK AGL RCGKSCRLRW+NY
Sbjct  1    MVRAPCCEKMGLKKGPWTQEEDQTLISYIQKHGHGNWRALPKLAGLLRCGKSCRLRWINY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            L+P+IKRGN++ EE++ I++MHE LGN+WSAIAA LPGRTDNEIKN WHT
Sbjct  61   LKPDIKRGNFSSEEEDIIIKMHELLGNRWSAIAAKLPGRTDNEIKNVWHT  110



>ref|XP_009629473.1| PREDICTED: protein ODORANT1-like [Nicotiana tomentosiformis]
Length=377

 Score =   179 bits (454),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 79/110 (72%), Positives = 92/110 (84%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            M R PCCDK+G KKG WTPEED+KL  Y+ +YG  NWR LPK AGL RCGKSCRLRW NY
Sbjct  1    MGRAPCCDKNGLKKGPWTPEEDQKLIDYIQKYGYGNWRTLPKNAGLQRCGKSCRLRWTNY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRP+IKRG ++ EE+ETI+++H  LGNKWSAIAA LPGRTDNEIKN+W+T
Sbjct  61   LRPDIKRGRFSFEEEETIIQLHSVLGNKWSAIAARLPGRTDNEIKNYWNT  110



>gb|KDP20863.1| hypothetical protein JCGZ_21334 [Jatropha curcas]
 gb|AIT52288.1| MYB family protein [Jatropha curcas]
Length=274

 Score =   176 bits (446),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 76/99 (77%), Positives = 87/99 (88%), Gaps = 0/99 (0%)
 Frame = -2

Query  511  FKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNYLRPNIKRGNYT  332
             KKGTW+PEEDRKL AY+ RYG WNW ++PK AGL+R GKSCRLRWMNYLRP+IKRGN++
Sbjct  12   LKKGTWSPEEDRKLVAYINRYGIWNWNEMPKAAGLSRSGKSCRLRWMNYLRPDIKRGNFS  71

Query  331  KEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            KEEDETI+ +HE LGN WSAIA  +PGRTDNEIKNHWHT
Sbjct  72   KEEDETILTLHEMLGNSWSAIAKKMPGRTDNEIKNHWHT  110



>ref|NP_001140890.1| MYB transcription factor [Zea mays]
 gb|ACF84889.1| unknown [Zea mays]
 gb|ADX60121.1| MYB transcription factor [Zea mays]
 gb|AFW58863.1| putative MYB DNA-binding domain superfamily protein [Zea mays]
Length=277

 Score =   176 bits (447),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 77/110 (70%), Positives = 92/110 (84%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            M R PCC+K G K+G WTPEED+ L A++  +G  NWR LPK AGL RCGKSCRLRW+NY
Sbjct  1    MGRAPCCEKMGLKRGPWTPEEDKILVAHIQSFGHSNWRALPKQAGLLRCGKSCRLRWINY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRP+IKRGN++KEE++ I+ +HEQLGN+WSAIAA LPGRTDNEIKN WHT
Sbjct  61   LRPDIKRGNFSKEEEDAIITLHEQLGNRWSAIAARLPGRTDNEIKNVWHT  110



>gb|EPS66172.1| hypothetical protein M569_08609, partial [Genlisea aurea]
Length=119

 Score =   171 bits (433),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 75/110 (68%), Positives = 89/110 (81%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            MV+T      G KKG WT EED KL AY+ RYG WNW  LPK+AGLARCGKSCRLRW+NY
Sbjct  1    MVKTSYVGHDGVKKGAWTEEEDEKLRAYIQRYGHWNWNLLPKYAGLARCGKSCRLRWLNY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            L+P +KRGN+TKEE++ I+++H+QLGNKWS IAA  PGRTDN+IKN WHT
Sbjct  61   LKPGVKRGNFTKEEEDLIIQLHDQLGNKWSTIAAQFPGRTDNDIKNFWHT  110



>ref|XP_006412992.1| hypothetical protein EUTSA_v10027463mg [Eutrema salsugineum]
 gb|ESQ54445.1| hypothetical protein EUTSA_v10027463mg [Eutrema salsugineum]
Length=288

 Score =   176 bits (447),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 78/110 (71%), Positives = 92/110 (84%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            M R+PCCDK+G KKG WTPEED+KL  Y+  +G  NWR LPK AGL RCGKSCRLRW NY
Sbjct  1    MGRSPCCDKNGVKKGPWTPEEDQKLIDYIRFHGPGNWRILPKNAGLQRCGKSCRLRWTNY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRP+IKRG ++ EE+ETI+++H  +GNKWSAIAA LPGRTDNEIKNHW+T
Sbjct  61   LRPDIKRGRFSFEEEETIIQLHSVMGNKWSAIAARLPGRTDNEIKNHWNT  110



>ref|XP_009802252.1| PREDICTED: myb-related protein Myb4-like [Nicotiana sylvestris]
 dbj|BAA88222.1| myb-related transcription factor LBM2 [Nicotiana tabacum]
Length=277

 Score =   176 bits (446),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 78/110 (71%), Positives = 92/110 (84%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            M R PCC+K G KKG WTPEED+ L +++ + G  NWR LPK AGL RCGKSCRLRW NY
Sbjct  1    MGRAPCCEKMGLKKGPWTPEEDQILISFIQQNGHGNWRALPKQAGLLRCGKSCRLRWTNY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRP+IKRGN+TKEE++TI+++HE LGN+WSAIAA LPGRTDNEIKN WHT
Sbjct  61   LRPDIKRGNFTKEEEDTIIQLHEMLGNRWSAIAAKLPGRTDNEIKNVWHT  110



>ref|XP_011025983.1| PREDICTED: myb-related protein Myb4-like [Populus euphratica]
Length=272

 Score =   176 bits (446),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 77/110 (70%), Positives = 92/110 (84%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            MVR PCC+K G KKG WT EED+ L  Y+  +G  NWR LPK AGL RCGKSCRLRW+NY
Sbjct  1    MVRAPCCEKMGLKKGPWTAEEDQILINYIQLHGHGNWRALPKQAGLLRCGKSCRLRWINY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRP+IKRGN+++EE++TI+++HE LGN+WSAIAA LPGRTDNEIKN WHT
Sbjct  61   LRPDIKRGNFSREEEDTIIKLHEMLGNRWSAIAARLPGRTDNEIKNVWHT  110



>ref|XP_008455362.1| PREDICTED: transcription factor MYB39 [Cucumis melo]
Length=337

 Score =   178 bits (451),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 79/110 (72%), Positives = 91/110 (83%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            M R PCCDKSG KKG WTPEED+KL  Y+  +G  NWR LPK AGL RCGKSCRLRW NY
Sbjct  1    MGRAPCCDKSGLKKGPWTPEEDQKLVNYIQIHGPGNWRNLPKNAGLQRCGKSCRLRWTNY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRP+IKRG ++ EE+ETI+++H  LGNKWSAIAA LPGRTDNEIKN+W+T
Sbjct  61   LRPDIKRGRFSFEEEETIIQLHSVLGNKWSAIAARLPGRTDNEIKNYWNT  110



>ref|XP_008358698.1| PREDICTED: LOW QUALITY PROTEIN: protein ODORANT1-like [Malus 
domestica]
Length=361

 Score =   178 bits (452),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 79/110 (72%), Positives = 92/110 (84%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            M R PCCDKSG KKG WTPEED+KL  Y+ ++G  NWR LPK AGL RCGKSCRLRW NY
Sbjct  1    MGRAPCCDKSGLKKGPWTPEEDQKLMDYIQKHGYGNWRTLPKNAGLQRCGKSCRLRWTNY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRP+IKRG ++ EE+ETI+++H  LGNKWSAIAA LPGRTDNEIKN+W+T
Sbjct  61   LRPDIKRGRFSFEEEETIIQLHSILGNKWSAIAARLPGRTDNEIKNYWNT  110



>gb|ABZ89193.1| putative protein [Coffea canephora]
Length=255

 Score =   175 bits (444),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 76/110 (69%), Positives = 93/110 (85%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            MVR PCC+K G KKG WTPEED+ L ++V  YG  NWR LPK AGL RCGKSCRLRW NY
Sbjct  1    MVRVPCCEKMGLKKGPWTPEEDQILVSFVQHYGHENWRALPKQAGLLRCGKSCRLRWTNY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRP+IKRGN++KEE+E+I+++H+ +GN+WSAIA  LPGRTDNEIKN+W+T
Sbjct  61   LRPDIKRGNFSKEEEESIIKLHQIMGNRWSAIANRLPGRTDNEIKNYWNT  110



>ref|XP_009783632.1| PREDICTED: transcription factor MYB39-like [Nicotiana sylvestris]
Length=273

 Score =   176 bits (446),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 77/110 (70%), Positives = 92/110 (84%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            M R PCC+K+G KKG WT EED+KL  Y+ ++GC NWR LPK AGL RCGKSCRLRW NY
Sbjct  1    MGRIPCCEKNGLKKGPWTSEEDQKLIDYIQKHGCGNWRLLPKNAGLQRCGKSCRLRWTNY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRP+IKRG ++ EE+ETI+++H  LGNKWSAIAA LPGRTDNEIKN+W+T
Sbjct  61   LRPDIKRGKFSFEEEETIIQLHSILGNKWSAIAASLPGRTDNEIKNYWNT  110



>ref|XP_004296369.1| PREDICTED: myb-related protein Myb4-like [Fragaria vesca subsp. 
vesca]
Length=256

 Score =   175 bits (444),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 77/110 (70%), Positives = 91/110 (83%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            MVR PCC+K G KKG WT EED+ L +Y+  YG  NWR LPK AGL RCGKSCRLRW+NY
Sbjct  1    MVRAPCCEKMGLKKGPWTTEEDQILISYIQTYGHGNWRALPKHAGLLRCGKSCRLRWINY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRP+IKRGN+++EE++ I+ +HE LGN+WSAIAA LPGRTDNEIKN WHT
Sbjct  61   LRPDIKRGNFSREEEDAIINLHEMLGNRWSAIAARLPGRTDNEIKNVWHT  110



>ref|XP_002284142.1| PREDICTED: transcription factor MYB39 [Vitis vinifera]
 emb|CBI19161.3| unnamed protein product [Vitis vinifera]
Length=324

 Score =   177 bits (449),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 76/110 (69%), Positives = 94/110 (85%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            M R+PCCD++G KKG WTPEED+KL +YV ++G  +WR LPK AGL RCGKSCRLRW NY
Sbjct  1    MGRSPCCDENGLKKGPWTPEEDQKLVSYVQKHGHGSWRALPKLAGLNRCGKSCRLRWTNY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRP+IKRG +++EE++TI+ +H  LGNKWSAIA+HLPGRTDNEIKN W+T
Sbjct  61   LRPDIKRGKFSQEEEQTILHLHSILGNKWSAIASHLPGRTDNEIKNFWNT  110



>ref|XP_002448188.1| hypothetical protein SORBIDRAFT_06g022660 [Sorghum bicolor]
 gb|EES12516.1| hypothetical protein SORBIDRAFT_06g022660 [Sorghum bicolor]
Length=272

 Score =   176 bits (445),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 77/110 (70%), Positives = 91/110 (83%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            M R PCC+K G KKG WTPEED+ L  ++  +G  NWR LPK AGL RCGKSCRLRW+NY
Sbjct  1    MGRAPCCEKMGLKKGPWTPEEDKILVNHIQSFGHSNWRALPKQAGLLRCGKSCRLRWINY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRP+IKRGN++KEE++ I+ +HEQLGN+WSAIAA LPGRTDNEIKN WHT
Sbjct  61   LRPDIKRGNFSKEEEDAIITLHEQLGNRWSAIAARLPGRTDNEIKNVWHT  110



>gb|EYU24839.1| hypothetical protein MIMGU_mgv1a020124mg, partial [Erythranthe 
guttata]
Length=212

 Score =   174 bits (440),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 75/110 (68%), Positives = 90/110 (82%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            MVR P  DK+G KKG W+ EED KL AY+ RYG WNWR LPKFAGL RCGKSCRLRW+NY
Sbjct  1    MVRAPFYDKNGVKKGAWSEEEDNKLKAYILRYGHWNWRLLPKFAGLERCGKSCRLRWVNY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            L+P +K+GN++K+E++ IV +H QLG +WS IAA LPGRTDN+IKN WHT
Sbjct  61   LKPGVKKGNFSKQEEDLIVELHAQLGKRWSVIAAKLPGRTDNDIKNFWHT  110



>ref|XP_002302045.1| GmMYB29 family protein [Populus trichocarpa]
 gb|EEE81318.1| GmMYB29 family protein [Populus trichocarpa]
Length=272

 Score =   176 bits (445),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 77/110 (70%), Positives = 92/110 (84%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            MVR PCC+K G K+G WT EEDR L  ++  YG  NWR LPK AGL RCGKSCRLRW+NY
Sbjct  1    MVRAPCCEKMGLKRGPWTAEEDRILINHIQLYGHGNWRALPKQAGLLRCGKSCRLRWINY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRP+IKRGN+++EE++TI+++HE LGN+WSAIAA LPGRTDNEIKN WHT
Sbjct  61   LRPDIKRGNFSREEEDTIIKLHEMLGNRWSAIAARLPGRTDNEIKNVWHT  110



>ref|XP_009339621.1| PREDICTED: myb-related protein Myb4-like [Pyrus x bretschneideri]
 ref|XP_009339622.1| PREDICTED: myb-related protein Myb4-like [Pyrus x bretschneideri]
Length=266

 Score =   175 bits (444),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 78/110 (71%), Positives = 92/110 (84%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            M R PCC+K G KKG WT EED+ L +++ +YG  NWR LPK AGL RCGKSCRLRW+NY
Sbjct  1    MGRAPCCEKMGLKKGPWTSEEDQILTSFIQKYGHGNWRALPKQAGLLRCGKSCRLRWVNY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRP+IKRGN+T+EE+E IV++HE LGN+WSAIAA LPGRTDNEIKN WHT
Sbjct  61   LRPDIKRGNFTREEEEAIVKLHEMLGNRWSAIAARLPGRTDNEIKNVWHT  110



>ref|XP_011028802.1| PREDICTED: myb-related protein Myb4-like [Populus euphratica]
Length=272

 Score =   176 bits (445),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 77/110 (70%), Positives = 92/110 (84%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            MVR PCC+K G K+G WT EEDR L  ++  YG  NWR LPK AGL RCGKSCRLRW+NY
Sbjct  1    MVRAPCCEKMGLKRGPWTAEEDRILINHIQLYGHGNWRALPKQAGLLRCGKSCRLRWINY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRP+IKRGN+++EE++TI+++HE LGN+WSAIAA LPGRTDNEIKN WHT
Sbjct  61   LRPDIKRGNFSREEEDTIIKLHEMLGNRWSAIAARLPGRTDNEIKNVWHT  110



>ref|XP_011022802.1| PREDICTED: myb-related protein 308-like [Populus euphratica]
Length=340

 Score =   177 bits (450),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 75/110 (68%), Positives = 93/110 (85%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            M R+PCCD+SG KKG WTPEED+KL  Y+ ++G  +WR LPK +GL RCGKSCRLRW NY
Sbjct  1    MGRSPCCDESGLKKGPWTPEEDQKLVKYIQKHGHGSWRALPKLSGLNRCGKSCRLRWTNY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRP+IKRG +++EE++TI+ +H  LGNKWSAIA+HLPGRTDNEIKN W+T
Sbjct  61   LRPDIKRGKFSQEEEQTILNLHSVLGNKWSAIASHLPGRTDNEIKNFWNT  110



>gb|KHG28925.1| Myb-related Myb4 [Gossypium arboreum]
Length=259

 Score =   175 bits (444),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 79/110 (72%), Positives = 91/110 (83%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            MVR PCC+K G KKG WTPEED+ L  Y+  +G  NWR LPK AGL RCGKSCRLRW NY
Sbjct  1    MVRAPCCEKMGLKKGPWTPEEDQILINYIQLHGHGNWRALPKQAGLLRCGKSCRLRWTNY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRP+IKRGN+T+EE++TI+ +HE LGN+WSAIAA LPGRTDNEIKN WHT
Sbjct  61   LRPDIKRGNFTREEEDTIINLHEMLGNRWSAIAARLPGRTDNEIKNVWHT  110



>ref|XP_004295360.1| PREDICTED: myb-related protein Hv1-like [Fragaria vesca subsp. 
vesca]
Length=289

 Score =   176 bits (446),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 75/110 (68%), Positives = 91/110 (83%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            MVR P  DKSG KKG W  EED KL +Y+  YG WNWRQLPK+AG++RCGKSCRLRW NY
Sbjct  1    MVRAPFYDKSGVKKGAWDAEEDDKLRSYIQSYGHWNWRQLPKYAGISRCGKSCRLRWKNY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            L+P +K G+YT+EE+  I+++HEQLGN+WS IA+ LPGRTDNEIKN+WHT
Sbjct  61   LQPGVKHGDYTEEEEALIIKLHEQLGNRWSMIASKLPGRTDNEIKNYWHT  110



>gb|AFK45056.1| unknown [Lotus japonicus]
Length=277

 Score =   176 bits (445),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 76/110 (69%), Positives = 90/110 (82%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            MVR PCC+K G KKG W  EED  L +Y+ ++G  NWR LPK AGL RCGKSCRLRW+NY
Sbjct  1    MVRAPCCEKMGLKKGPWAAEEDEILTSYIQKHGHSNWRALPKQAGLLRCGKSCRLRWINY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRP+IKRGN+T EE+E+I+++HE LGN+WS IAA LPGRTDNEIKN WHT
Sbjct  61   LRPDIKRGNFTAEEEESIIKLHEMLGNRWSVIAAKLPGRTDNEIKNVWHT  110



>ref|XP_010247284.1| PREDICTED: transcription factor MYB3-like [Nelumbo nucifera]
Length=340

 Score =   177 bits (450),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 79/108 (73%), Positives = 91/108 (84%), Gaps = 0/108 (0%)
 Frame = -2

Query  538  RTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNYLR  359
            RTPCCDK+G KKG WTP ED KL A++ R+G  NWR LPK AGL RCGKSCRLRW NYLR
Sbjct  5    RTPCCDKTGLKKGPWTPAEDMKLIAFIQRHGHENWRALPKQAGLLRCGKSCRLRWTNYLR  64

Query  358  PNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            P+IKRGN+T EE+E I+++HE LGNKWS IA+HLPGRTDNEIKN W+T
Sbjct  65   PDIKRGNFTVEEEEIIIKLHELLGNKWSKIASHLPGRTDNEIKNVWNT  112



>emb|CDO99644.1| unnamed protein product [Coffea canephora]
Length=337

 Score =   177 bits (449),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 78/110 (71%), Positives = 93/110 (85%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            M R+PCCDK+G KKG WTPEED+KL  Y+ ++G  NWR LPK AGL RCGKSCRLRW NY
Sbjct  1    MGRSPCCDKNGLKKGPWTPEEDQKLIDYIQKHGYGNWRTLPKNAGLQRCGKSCRLRWTNY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRP+IKRG ++ EE+ETI+++H  LGNKWSAIAA LPGRTDNEIKN+W+T
Sbjct  61   LRPDIKRGRFSFEEEETIIQLHSILGNKWSAIAARLPGRTDNEIKNYWNT  110



>ref|XP_004293589.1| PREDICTED: transcription factor MYB75-like [Fragaria vesca subsp. 
vesca]
Length=366

 Score =   178 bits (451),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 79/110 (72%), Positives = 93/110 (85%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            M R+PCCDK+G KKG WTPEED+KL  Y+ ++G  NWR LPK AGL RCGKSCRLRW NY
Sbjct  1    MGRSPCCDKNGLKKGPWTPEEDQKLVDYIQKHGYGNWRTLPKNAGLQRCGKSCRLRWTNY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRP+IKRG ++ EE+ETIV++H  LGNKWSAIAA LPGRTDNEIKN+W+T
Sbjct  61   LRPDIKRGRFSFEEEETIVQLHSILGNKWSAIAARLPGRTDNEIKNYWNT  110



>ref|XP_009779489.1| PREDICTED: myb-related protein Myb4-like [Nicotiana sylvestris]
Length=236

 Score =   174 bits (442),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 75/110 (68%), Positives = 93/110 (85%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            MVR PCC++ G KKG WT EED+ L +++ RYG  NWR LP+ AGL RCGKSCRLRW+NY
Sbjct  1    MVRAPCCERMGLKKGPWTAEEDQILISFIQRYGHENWRALPRQAGLLRCGKSCRLRWINY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRP+IKRGN+++EE+ETI ++H+ LGN+WSAIA+ LPGRTDNEIKN WHT
Sbjct  61   LRPDIKRGNFSEEEEETITKLHQVLGNRWSAIASRLPGRTDNEIKNFWHT  110



>gb|KHN41175.1| Myb-related protein Myb4 [Glycine soja]
Length=235

 Score =   174 bits (441),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 78/110 (71%), Positives = 93/110 (85%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            MVR P  DK+G KKG W+ EED++L AYV RYG  NWRQLPKFAGL RCGKSCRLRWMNY
Sbjct  1    MVRAPYFDKNGIKKGAWSVEEDKRLIAYVERYGHPNWRQLPKFAGLQRCGKSCRLRWMNY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRPN+KRGNYT++E++ I  +H++ GNKWS IA +LPGRTDNEIKN+WH+
Sbjct  61   LRPNLKRGNYTQKEEQIITDLHKKHGNKWSLIAENLPGRTDNEIKNYWHS  110



>ref|XP_002306849.2| hypothetical protein POPTR_0005s24550g [Populus trichocarpa]
 gb|EEE93845.2| hypothetical protein POPTR_0005s24550g [Populus trichocarpa]
Length=273

 Score =   175 bits (444),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 77/110 (70%), Positives = 92/110 (84%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            MVR PCC+K G KKG WT EED+ L  Y+  +G  NWR LPK AGL RCGKSCRLRW+NY
Sbjct  1    MVRAPCCEKMGLKKGPWTAEEDQILINYIQLHGHGNWRALPKQAGLLRCGKSCRLRWINY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRP+IKRGN+++EE++TI+++HE LGN+WSAIAA LPGRTDNEIKN WHT
Sbjct  61   LRPDIKRGNFSREEEDTIIKLHEMLGNRWSAIAARLPGRTDNEIKNVWHT  110



>gb|KDP20873.1| hypothetical protein JCGZ_21344 [Jatropha curcas]
 gb|AIT52303.1| MYB family protein [Jatropha curcas]
Length=358

 Score =   177 bits (450),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 78/110 (71%), Positives = 92/110 (84%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            M R PCCDK+G KKG WTPEED+KL  Y+ ++G  NWR LPK AGL RCGKSCRLRW NY
Sbjct  1    MGRAPCCDKNGLKKGPWTPEEDQKLIDYIQKHGYGNWRTLPKNAGLQRCGKSCRLRWTNY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRP+IKRG ++ EE+ETI+++H  LGNKWSAIAA LPGRTDNEIKN+W+T
Sbjct  61   LRPDIKRGRFSFEEEETIIQLHSILGNKWSAIAARLPGRTDNEIKNYWNT  110



>ref|XP_004953149.1| PREDICTED: myb-related protein Myb4-like [Setaria italica]
Length=249

 Score =   174 bits (442),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 77/110 (70%), Positives = 91/110 (83%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            M R PCC+K G K+G WTPEEDR L A++ R+G  NWR LPK AGL RCGKSCRLRW+NY
Sbjct  1    MGRAPCCEKMGLKRGPWTPEEDRILVAHIERHGHSNWRALPKQAGLLRCGKSCRLRWINY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRP+IKRGN+T+EE++ I+ +H  LGN+WSAIAA LPGRTDNEIKN WHT
Sbjct  61   LRPDIKRGNFTREEEDAIIHLHTVLGNRWSAIAARLPGRTDNEIKNVWHT  110



>ref|XP_003527470.1| PREDICTED: myb-related protein Myb4-like [Glycine max]
Length=235

 Score =   174 bits (441),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 78/110 (71%), Positives = 93/110 (85%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            MVR P  DK+G KKG W+ EED++L AYV RYG  NWRQLPKFAGL RCGKSCRLRWMNY
Sbjct  1    MVRAPYFDKNGIKKGAWSVEEDKRLIAYVERYGHPNWRQLPKFAGLQRCGKSCRLRWMNY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRPN+KRGNYT++E++ I  +H++ GNKWS IA +LPGRTDNEIKN+WH+
Sbjct  61   LRPNLKRGNYTQKEEQIITDLHKKHGNKWSLIAENLPGRTDNEIKNYWHS  110



>ref|XP_006449197.1| hypothetical protein CICLE_v10015729mg [Citrus clementina]
 gb|ESR62437.1| hypothetical protein CICLE_v10015729mg [Citrus clementina]
Length=359

 Score =   177 bits (450),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 79/110 (72%), Positives = 92/110 (84%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            M R PCCDKSG KKG WTPEED+KL  Y+ ++G  NWR LPK AGL RCGKSCRLRW NY
Sbjct  1    MGRAPCCDKSGLKKGPWTPEEDQKLIDYIQKHGYGNWRTLPKNAGLQRCGKSCRLRWTNY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRP+IKRG ++ EE+ETI+++H  LGNKWSAIAA LPGRTDNEIKN+W+T
Sbjct  61   LRPDIKRGRFSFEEEETIIQLHSILGNKWSAIAARLPGRTDNEIKNYWNT  110



>ref|XP_011001151.1| PREDICTED: protein ODORANT1 [Populus euphratica]
Length=376

 Score =   178 bits (451),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 78/110 (71%), Positives = 91/110 (83%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            M R PCCDK+G KKG WTPEED+KL  Y+ ++G  NWR LPK AGL RCGKSCRLRW NY
Sbjct  1    MGRAPCCDKNGLKKGPWTPEEDQKLVDYIEKHGYGNWRTLPKNAGLQRCGKSCRLRWTNY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRP+IKRG +  EE+ETI+++H  LGNKWSAIAA LPGRTDNEIKN+W+T
Sbjct  61   LRPDIKRGQFAFEEEETIIQLHSLLGNKWSAIAARLPGRTDNEIKNYWNT  110



>ref|XP_002307080.2| hypothetical protein POPTR_0005s07590g [Populus trichocarpa]
 gb|EEE94076.2| hypothetical protein POPTR_0005s07590g [Populus trichocarpa]
Length=341

 Score =   177 bits (449),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 76/110 (69%), Positives = 92/110 (84%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            M R+PCCD+SG KKG WTPEED+KL  Y+ ++G  +WR LPK AGL RCGKSCRLRW NY
Sbjct  1    MGRSPCCDESGLKKGPWTPEEDQKLVKYIQKHGHGSWRALPKLAGLNRCGKSCRLRWTNY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRP+IKRG +++EE++TI+ +H  LGNKWSAIA HLPGRTDNEIKN W+T
Sbjct  61   LRPDIKRGKFSQEEEQTILNLHSILGNKWSAIAGHLPGRTDNEIKNFWNT  110



>ref|XP_008230194.1| PREDICTED: myb-related protein Myb4-like [Prunus mume]
Length=252

 Score =   174 bits (442),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 75/110 (68%), Positives = 90/110 (82%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            MVR P  DKSG KKG W+PEED  L  Y+  +G  NWR LPKFAG++RCGKSCRLRW NY
Sbjct  1    MVRAPFYDKSGLKKGAWSPEEDDTLRVYIEEHGHVNWRSLPKFAGISRCGKSCRLRWTNY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRP +KRGNYT++ED+ I+++H++ GNKWS IAA LPGRTDNEIKNHW+T
Sbjct  61   LRPGVKRGNYTQQEDDLILKLHQEFGNKWSMIAAKLPGRTDNEIKNHWNT  110



>ref|XP_011031021.1| PREDICTED: myb-related protein 308-like [Populus euphratica]
Length=341

 Score =   177 bits (449),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 76/110 (69%), Positives = 92/110 (84%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            M R+PCCD+SG KKG WTPEED+KL  Y+ ++G  +WR LPK AGL RCGKSCRLRW NY
Sbjct  1    MGRSPCCDESGLKKGPWTPEEDQKLVKYIQKHGHGSWRALPKLAGLNRCGKSCRLRWTNY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRP+IKRG +++EE++TI+ +H  LGNKWSAIA HLPGRTDNEIKN W+T
Sbjct  61   LRPDIKRGKFSQEEEQTILNLHSILGNKWSAIAGHLPGRTDNEIKNFWNT  110



>ref|XP_008441942.1| PREDICTED: transcription factor MYB86-like [Cucumis melo]
Length=390

 Score =   178 bits (452),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 79/112 (71%), Positives = 92/112 (82%), Gaps = 0/112 (0%)
 Frame = -2

Query  550  FDMVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWM  371
            F M RTPCCDK+G KKG WTPEED+KL  Y+ + G  NWR LPK AGL RCGKSCRLRW 
Sbjct  52   FSMGRTPCCDKNGLKKGPWTPEEDQKLIDYIQKNGHGNWRTLPKNAGLQRCGKSCRLRWT  111

Query  370  NYLRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            NYLRP+IKRG ++ EE+ETI+++H  LGNKWSAIA  LPGRTDNEIKN+W+T
Sbjct  112  NYLRPDIKRGRFSFEEEETIIQLHSVLGNKWSAIATRLPGRTDNEIKNYWNT  163



>gb|AAS55703.1| MYB1, partial [Nicotiana benthamiana]
Length=157

 Score =   171 bits (434),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 77/109 (71%), Positives = 90/109 (83%), Gaps = 0/109 (0%)
 Frame = -2

Query  541  VRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNYL  362
            VR PCC+K G KKG WTPEED+ L +++   G  NWR LPK AGL RCGKSCRLRW NYL
Sbjct  1    VRAPCCEKMGLKKGPWTPEEDQILISFIQTNGHGNWRALPKQAGLLRCGKSCRLRWTNYL  60

Query  361  RPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            RP+IKRGN+TKEE++TI+++HE LGN+WSAIA  LPGRTDNEIKN WHT
Sbjct  61   RPDIKRGNFTKEEEDTIIQLHEMLGNRWSAIAGKLPGRTDNEIKNVWHT  109



>ref|XP_003571882.1| PREDICTED: myb-related protein Myb4-like [Brachypodium distachyon]
Length=252

 Score =   174 bits (442),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 74/110 (67%), Positives = 91/110 (83%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            M R PCCDK G ++G W+P+ED+ LA Y+ ++G  NWR LPK AGL RCGKSCRLRW+NY
Sbjct  1    MGRAPCCDKEGLRRGAWSPDEDQLLADYIAQHGHPNWRALPKHAGLLRCGKSCRLRWINY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRP+IKRGN+T +E++ I+R+H  LGN+WSAIAA LPGRTDNEIKN WHT
Sbjct  61   LRPDIKRGNFTADEEDQIIRLHHSLGNRWSAIAAQLPGRTDNEIKNVWHT  110



>ref|XP_006294854.1| hypothetical protein CARUB_v10023905mg [Capsella rubella]
 gb|EOA27752.1| hypothetical protein CARUB_v10023905mg [Capsella rubella]
Length=253

 Score =   174 bits (442),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 78/110 (71%), Positives = 90/110 (82%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            M R PCC+K G K+G WTPEED+ L  Y+  YG  NWR LPK AGL RCGKSCRLRW+NY
Sbjct  1    MGRAPCCEKMGMKRGPWTPEEDQILVNYIHLYGHSNWRALPKHAGLLRCGKSCRLRWINY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRP+IKRGN+T +E+ETI+ +HE LGN+WSAIAA LPGRTDNEIKN WHT
Sbjct  61   LRPDIKRGNFTPQEEETIINLHESLGNRWSAIAAKLPGRTDNEIKNVWHT  110



>ref|XP_003575392.1| PREDICTED: myb-related protein Myb4-like [Brachypodium distachyon]
Length=255

 Score =   174 bits (442),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 75/110 (68%), Positives = 92/110 (84%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            M R PCC+K G K+G WT EEDR L A++ ++G  NWR LPK AGL RCGKSCRLRW+NY
Sbjct  1    MGRAPCCEKMGLKRGPWTAEEDRTLVAHIEQHGHSNWRALPKQAGLLRCGKSCRLRWINY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRP+IKRGN+T+EE++ I+++H+ LGN+WSAIAA LPGRTDNEIKN WHT
Sbjct  61   LRPDIKRGNFTREEEDAIIQLHDMLGNRWSAIAARLPGRTDNEIKNVWHT  110



>ref|XP_007212471.1| hypothetical protein PRUPE_ppa015081mg, partial [Prunus persica]
 gb|EMJ13670.1| hypothetical protein PRUPE_ppa015081mg, partial [Prunus persica]
Length=226

 Score =   173 bits (439),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 74/110 (67%), Positives = 92/110 (84%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            MV++  C+K   KKG W+P+ED KL AY+ RYG WNW Q+PK AGLAR GKSCRLRW+NY
Sbjct  1    MVKSQQCEKEAVKKGPWSPDEDHKLIAYIQRYGIWNWSQMPKPAGLARSGKSCRLRWVNY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRP+IK G++ KEE+E I+++HE +GN+WSAIAA LPGRTDNEIKN+WHT
Sbjct  61   LRPDIKSGSFNKEEEEAILKLHETMGNRWSAIAATLPGRTDNEIKNYWHT  110



>ref|XP_009380857.1| PREDICTED: myb-related protein 308 [Musa acuminata subsp. malaccensis]
Length=321

 Score =   176 bits (447),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 77/110 (70%), Positives = 91/110 (83%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            M R+PCCD+ G KKG WTPEED+KL  Y+ ++G  +WR LPK AGL RCGKSCRLRW NY
Sbjct  17   MGRSPCCDEHGLKKGPWTPEEDQKLVQYIQKHGHGSWRALPKLAGLNRCGKSCRLRWTNY  76

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRP+IKRGN++ EE++TI+ +H  LGNKWSAIA HLPGRTDNEIKN WHT
Sbjct  77   LRPDIKRGNFSPEEEQTILNLHSILGNKWSAIAMHLPGRTDNEIKNLWHT  126



>ref|XP_010037978.1| PREDICTED: myb-related protein Myb4 [Eucalyptus grandis]
 gb|KCW49770.1| hypothetical protein EUGRSUZ_K03262 [Eucalyptus grandis]
Length=260

 Score =   174 bits (442),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 78/110 (71%), Positives = 92/110 (84%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            M R PCC+K G KKG WTP+EDR L  YV  +G  NWR+LPK AGL RCGKSCRLRW NY
Sbjct  1    MGRAPCCEKMGLKKGPWTPDEDRILINYVQHHGHGNWRRLPKLAGLLRCGKSCRLRWTNY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRP+IKRGN+++EE++TI+++HE LGN+WSAIAA LPGRTDNEIKN WHT
Sbjct  61   LRPDIKRGNFSREEEDTIIQLHEMLGNRWSAIAARLPGRTDNEIKNVWHT  110



>ref|XP_006469819.1| PREDICTED: transcription factor RAX2-like [Citrus sinensis]
Length=330

 Score =   176 bits (447),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 78/110 (71%), Positives = 91/110 (83%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            M R PCCDK+G KKG WTPEED KL +Y+  +G  NWR LPK AGL RCGKSCRLRW NY
Sbjct  1    MGRAPCCDKNGLKKGPWTPEEDHKLISYIQLHGPGNWRNLPKNAGLQRCGKSCRLRWTNY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRP+IKRG ++ EE+ETI+++H  LGNKWSAIAA LPGRTDNEIKN+W+T
Sbjct  61   LRPDIKRGRFSFEEEETIIQLHSILGNKWSAIAARLPGRTDNEIKNYWNT  110



>gb|AGN52108.1| MYB-related transcription factor [Salvia miltiorrhiza]
 gb|AGN52218.1| MYB-related transcription factor [Salvia miltiorrhiza]
Length=317

 Score =   176 bits (446),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 79/110 (72%), Positives = 92/110 (84%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            M RTPCCDK+G KKG WTPEED KL+ Y+  +G  NWR LPK AGL RCGKSCRLRW NY
Sbjct  1    MGRTPCCDKNGLKKGPWTPEEDEKLSRYIHAHGAGNWRNLPKNAGLQRCGKSCRLRWTNY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRP+IKRG ++ EE+ETI+++H  LGNKWSAIAA LPGRTDNEIKN+W+T
Sbjct  61   LRPDIKRGRFSFEEEETIIQLHSVLGNKWSAIAARLPGRTDNEIKNYWNT  110



>ref|XP_004288189.1| PREDICTED: uncharacterized protein LOC101292449 [Fragaria vesca 
subsp. vesca]
Length=349

 Score =   177 bits (448),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 76/110 (69%), Positives = 92/110 (84%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            M R+PCCD SG KKG WTPEED+KL  Y+ ++G  +WR LPK AGL RCGKSCRLRW NY
Sbjct  1    MGRSPCCDDSGLKKGPWTPEEDQKLMNYIQKHGHGSWRALPKLAGLNRCGKSCRLRWTNY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRP+IKRG +++EE++TI+ +H  LGNKWSAIA+HLPGRTDNEIKN W+T
Sbjct  61   LRPDIKRGKFSQEEEQTILNLHSILGNKWSAIASHLPGRTDNEIKNFWNT  110



>gb|ABR28338.1| MYB transcription factor MYB50 [Medicago truncatula]
Length=258

 Score =   174 bits (442),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 75/110 (68%), Positives = 90/110 (82%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            MVR PCC+K G K+G W+ EED  L +Y+ ++   NWR LPK AGL RCGKSCRLRW+NY
Sbjct  1    MVRAPCCEKMGLKRGPWSLEEDEILTSYIQKHDHGNWRALPKLAGLLRCGKSCRLRWINY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRP+IKRGN+T EE+E I+++HE LGN+WSAIAA LPGRTDNEIKN WHT
Sbjct  61   LRPDIKRGNFTNEEEENIIKLHEMLGNRWSAIAAKLPGRTDNEIKNVWHT  110



>ref|XP_010469752.1| PREDICTED: myb-related protein Myb4-like [Camelina sativa]
Length=254

 Score =   174 bits (441),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 78/110 (71%), Positives = 90/110 (82%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            M R PCC+K G K+G WTPEED+ L  Y+  YG  NWR LPK AGL RCGKSCRLRW+NY
Sbjct  1    MGRAPCCEKMGMKRGPWTPEEDQILINYIHLYGHSNWRALPKHAGLLRCGKSCRLRWINY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRP+IKRGN+T +E+ETI+ +HE LGN+WSAIAA LPGRTDNEIKN WHT
Sbjct  61   LRPDIKRGNFTPQEEETIINLHESLGNRWSAIAAKLPGRTDNEIKNVWHT  110



>ref|XP_002305647.1| putative MYB transcription factor family protein [Populus trichocarpa]
 gb|EEE86158.1| putative MYB transcription factor family protein [Populus trichocarpa]
Length=376

 Score =   177 bits (450),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 78/110 (71%), Positives = 92/110 (84%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            M R PCCDK+G KKG WTPEED+KL  Y+ ++G  NWR LPK AGL RCGKSCRLRW NY
Sbjct  1    MGRAPCCDKNGLKKGPWTPEEDQKLVDYIQKHGYGNWRTLPKNAGLQRCGKSCRLRWTNY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRP+IKRG ++ EE+ETI+++H  LGNKWSAIAA LPGRTDNEIKN+W+T
Sbjct  61   LRPDIKRGRFSFEEEETIIQLHSILGNKWSAIAARLPGRTDNEIKNYWNT  110



>ref|XP_003521289.1| PREDICTED: myb-related protein Myb4-like [Glycine max]
 gb|KHN10739.1| Myb-related protein Myb4 [Glycine soja]
Length=294

 Score =   175 bits (444),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 77/110 (70%), Positives = 90/110 (82%), Gaps = 0/110 (0%)
 Frame = -2

Query  544  MVRTPCCDKSGFKKGTWTPEEDRKLAAYVTRYGCWNWRQLPKFAGLARCGKSCRLRWMNY  365
            M R PCC+K G K+G WTPEED+ L  Y+  Y   NWR LPK AGL RCGKSCRLRW+NY
Sbjct  1    MGRAPCCEKMGLKRGPWTPEEDQILINYINTYDHANWRALPKLAGLLRCGKSCRLRWINY  60

Query  364  LRPNIKRGNYTKEEDETIVRMHEQLGNKWSAIAAHLPGRTDNEIKNHWHT  215
            LRP+IKRGN+T+EE++TI+ +HE LGN+WSAIAA LPGRTDNEIKN WHT
Sbjct  61   LRPDIKRGNFTREEEDTIISLHEMLGNRWSAIAARLPGRTDNEIKNVWHT  110



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1277027717487