BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c24261_g2_i3 len=987 path=[5957:0-20 5493:21-117 639:118-147
669:148-561 1083:562-650 1172:651-651 1173:652-652 1174:653-685
6103:686-708 3383:709-986]

Length=987
                                                                      Score     E

ref|XP_009791264.1|  PREDICTED: protein TRANSPARENT TESTA 12            458   2e-155   
ref|XP_009591643.1|  PREDICTED: protein TRANSPARENT TESTA 12            452   5e-153   
ref|XP_006357607.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    448   2e-151   
ref|XP_010320933.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       444   3e-150   
ref|XP_006357606.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    444   3e-150   
emb|CDP13216.1|  unnamed protein product                                444   8e-150   
ref|XP_004239126.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       436   5e-147   
ref|XP_006371335.1|  hypothetical protein POPTR_0019s09190g             432   2e-144   
ref|XP_010999529.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       430   2e-144   
ref|XP_003628949.1|  Protein TRANSPARENT TESTA                          425   1e-142   
ref|XP_009605336.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       424   2e-142   
ref|XP_008389731.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       425   2e-142   
gb|KCW86669.1|  hypothetical protein EUGRSUZ_B03295                     424   3e-142   
ref|XP_008340112.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       424   5e-142   
ref|XP_008353026.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       423   1e-141   
gb|AHI48503.1|  multidrug and toxic extrusion transporter               422   1e-141   
emb|CDP13215.1|  unnamed protein product                                422   1e-141   
ref|XP_010044581.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       422   2e-141   
ref|XP_010646476.1|  PREDICTED: protein TRANSPARENT TESTA 12            421   5e-141   
ref|XP_003551225.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       419   2e-140   
ref|XP_009359227.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       419   4e-140   
ref|XP_010251087.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       419   4e-140   
ref|XP_008447003.1|  PREDICTED: protein TRANSPARENT TESTA 12            414   6e-140   
ref|XP_007153779.1|  hypothetical protein PHAVU_003G064300g             417   2e-139   
ref|XP_009765840.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       415   8e-139   
ref|XP_006357608.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       414   4e-138   
ref|XP_006586536.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       407   6e-138   
ref|XP_006306102.1|  hypothetical protein CARUB_v10011529mg             412   1e-137   
ref|XP_009629826.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       412   2e-137   
ref|XP_009359346.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       412   3e-137   
ref|XP_002311767.2|  hypothetical protein POPTR_0008s19130g             411   3e-137   Populus trichocarpa [western balsam poplar]
ref|XP_004135268.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       411   4e-137   
ref|XP_007222487.1|  hypothetical protein PRUPE_ppa004113mg             411   5e-137   
gb|KDP26652.1|  hypothetical protein JCGZ_17810                         410   5e-137   
ref|XP_008221919.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       411   7e-137   
ref|XP_004239125.2|  PREDICTED: protein TRANSPARENT TESTA 12-like       410   9e-137   
ref|XP_010100393.1|  Protein TRANSPARENT TESTA 12                       412   1e-136   
ref|XP_010458735.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       409   2e-136   
ref|XP_010905904.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       409   4e-136   
ref|XP_010476276.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       409   5e-136   
ref|XP_006353110.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       408   5e-136   
ref|XP_010044578.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       408   1e-135   
emb|CDY26602.1|  BnaA09g46750D                                          407   2e-135   
ref|XP_006388162.1|  hypothetical protein POPTR_0307s00210g             406   2e-135   
ref|XP_009118041.1|  PREDICTED: protein TRANSPARENT TESTA 12            407   3e-135   
ref|XP_010494806.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       406   3e-135   
ref|XP_011086627.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       407   3e-135   
emb|CDY16041.1|  BnaC08g40820D                                          406   3e-135   
ref|XP_004310154.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       407   3e-135   
ref|XP_002527924.1|  multidrug resistance pump, putative                406   5e-135   Ricinus communis
ref|XP_011034092.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       405   6e-135   
ref|XP_009110609.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       405   7e-135   
ref|XP_004251995.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       404   1e-134   
gb|KFK33585.1|  hypothetical protein AALP_AA5G032800                    404   2e-134   
gb|KHG29776.1|  Protein TRANSPARENT TESTA 12 -like protein              403   5e-134   
emb|CAA66405.1|  orf04                                                  400   6e-134   Arabidopsis thaliana [mouse-ear cress]
emb|CDY34598.1|  BnaC03g56980D                                          403   8e-134   
ref|XP_010502591.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    399   9e-134   
ref|XP_006438287.1|  hypothetical protein CICLE_v10031274mg             399   1e-133   
ref|XP_002868811.1|  mate efflux family protein                         401   1e-133   
emb|CBI23362.3|  unnamed protein product                                420   1e-133   
ref|XP_010044580.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       403   1e-133   
ref|XP_011086626.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    400   1e-133   
ref|XP_010425356.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       401   2e-133   
ref|XP_006417171.1|  hypothetical protein EUTSA_v10007376mg             402   2e-133   
ref|XP_010514303.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       400   4e-133   
ref|XP_010556333.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       400   5e-133   
ref|XP_006852294.1|  hypothetical protein AMTR_s00049p00187420          400   5e-133   
ref|NP_189291.1|  MATE efflux family protein                            400   6e-133   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009601126.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       394   6e-133   
ref|XP_010100394.1|  Protein TRANSPARENT TESTA 12                       400   6e-133   
ref|XP_010100396.1|  Protein TRANSPARENT TESTA 12                       402   8e-133   
ref|XP_003517712.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       400   1e-132   
ref|XP_011086624.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    399   2e-132   
ref|XP_007044785.1|  MATE efflux family protein isoform 2               397   3e-132   
ref|XP_007044783.1|  MATE efflux family protein                         399   3e-132   
emb|CDY13643.1|  BnaA06g32800D                                          398   5e-132   
ref|XP_003613128.1|  Protein TRANSPARENT TESTA                          398   5e-132   
ref|XP_010502590.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    397   5e-132   
ref|XP_010554152.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       397   6e-132   
ref|XP_002876984.1|  mate efflux family protein                         397   7e-132   
ref|XP_006438289.1|  hypothetical protein CICLE_v10031274mg             397   7e-132   
ref|XP_009152044.1|  PREDICTED: protein TRANSPARENT TESTA 12            398   7e-132   
emb|CDX83627.1|  BnaC07g23670D                                          397   8e-132   
ref|XP_009796678.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       397   8e-132   
ref|XP_011086620.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       398   1e-131   
ref|NP_198619.1|  MATE efflux family protein                            397   1e-131   Arabidopsis thaliana [mouse-ear cress]
gb|EPS68503.1|  hypothetical protein M569_06267                         397   2e-131   
ref|NP_172755.1|  root hair specific 2                                  397   2e-131   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006483933.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       396   2e-131   
ref|XP_009607569.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       396   2e-131   
ref|XP_010533240.1|  PREDICTED: protein TRANSPARENT TESTA 12            395   3e-131   
ref|XP_004309983.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       395   5e-131   
ref|XP_004242792.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       394   7e-131   
gb|EYU30642.1|  hypothetical protein MIMGU_mgv1a004692mg                394   1e-130   
gb|KDP26653.1|  hypothetical protein JCGZ_17811                         393   2e-130   
dbj|BAE99795.1|  hypothetical protein                                   394   4e-130   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011086621.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       394   4e-130   
ref|XP_007158403.1|  hypothetical protein PHAVU_002G150200g             394   5e-130   
ref|XP_007044782.1|  MATE efflux family protein                         392   8e-130   
ref|XP_010528103.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       392   9e-130   
ref|XP_006367697.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       390   2e-129   
ref|XP_011086623.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       392   2e-129   
ref|XP_010044579.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       392   2e-129   
ref|XP_009759747.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    383   5e-129   
gb|AFK46935.1|  unknown                                                 390   7e-129   
ref|XP_009759746.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    383   7e-129   
ref|XP_009759744.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    383   3e-128   
emb|CAN64516.1|  hypothetical protein VITISV_023506                     385   6e-128   Vitis vinifera
ref|XP_002272214.2|  PREDICTED: protein TRANSPARENT TESTA 12-like...    387   1e-127   Vitis vinifera
gb|KFK43564.1|  hypothetical protein AALP_AA1G142600                    386   2e-127   
ref|XP_006290950.1|  hypothetical protein CARUB_v10017066mg             384   8e-127   
gb|KFK32791.1|  hypothetical protein AALP_AA6G288700                    384   8e-127   
ref|XP_006395543.1|  hypothetical protein EUTSA_v10005286mg             384   9e-127   
ref|XP_009764749.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       380   4e-126   
gb|KFK43565.1|  hypothetical protein AALP_AA1G142700                    380   5e-125   
ref|XP_011086625.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    378   2e-124   
gb|ABR16195.1|  unknown                                                 377   8e-124   Picea sitchensis
ref|XP_002273431.2|  PREDICTED: protein TRANSPARENT TESTA 12            377   9e-124   Vitis vinifera
ref|XP_010682437.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       374   3e-122   
ref|XP_006438290.1|  hypothetical protein CICLE_v10033839mg             369   3e-121   
ref|XP_010646478.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    368   2e-120   
ref|XP_002272251.2|  PREDICTED: protein TRANSPARENT TESTA 12            366   1e-119   Vitis vinifera
ref|NP_173744.1|  MATE efflux family protein                            365   2e-119   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006483932.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       365   3e-119   
gb|AAF87016.1|AC005292_25  F26F24.14                                    366   3e-119   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008220742.1|  PREDICTED: protein TRANSPARENT TESTA 12            363   6e-119   
ref|XP_009764056.1|  PREDICTED: protein TRANSPARENT TESTA 12            363   9e-119   
ref|XP_006306460.1|  hypothetical protein CARUB_v10012410mg             363   9e-119   
gb|KDP38452.1|  hypothetical protein JCGZ_04377                         362   2e-118   
ref|XP_011087098.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       362   3e-118   
ref|XP_009590886.1|  PREDICTED: protein TRANSPARENT TESTA 12            362   3e-118   
ref|XP_010254988.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       361   4e-118   
gb|KHG14298.1|  Protein TRANSPARENT TESTA 12 -like protein              361   5e-118   
ref|XP_009118930.1|  PREDICTED: protein TRANSPARENT TESTA 12            360   8e-118   
emb|CDY17070.1|  BnaC06g00030D                                          360   1e-117   
ref|XP_010266880.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       361   1e-117   
ref|XP_002891365.1|  hypothetical protein ARALYDRAFT_473896             360   1e-117   
ref|XP_002510329.1|  multidrug resistance pump, putative                360   1e-117   Ricinus communis
ref|XP_010684414.1|  PREDICTED: protein TRANSPARENT TESTA 12            360   2e-117   
ref|XP_007222800.1|  hypothetical protein PRUPE_ppa005018mg             359   4e-117   
ref|XP_007017441.1|  MATE efflux family protein                         358   4e-117   
emb|CAN62306.1|  hypothetical protein VITISV_023691                     359   5e-117   Vitis vinifera
ref|NP_175184.1|  MATE efflux family protein                            358   6e-117   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002281913.1|  PREDICTED: protein TRANSPARENT TESTA 12            358   6e-117   Vitis vinifera
ref|XP_010479157.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       358   1e-116   
ref|XP_010100395.1|  Protein TRANSPARENT TESTA 12                       358   1e-116   
ref|XP_006393573.1|  hypothetical protein EUTSA_v10011437mg             358   1e-116   
ref|XP_010530370.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       357   1e-116   
ref|XP_008377358.1|  PREDICTED: protein TRANSPARENT TESTA 12            357   1e-116   
ref|XP_010461550.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    357   3e-116   
ref|XP_007160797.1|  hypothetical protein PHAVU_001G017400g             356   3e-116   
gb|AAL24258.1|  At1g47530/F16N3_20                                      356   4e-116   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010500276.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       356   4e-116   
ref|XP_011083755.1|  PREDICTED: protein TRANSPARENT TESTA 12            356   5e-116   
ref|XP_010461551.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    356   7e-116   
gb|KFK36142.1|  hypothetical protein AALP_AA4G082800                    355   1e-115   
ref|XP_010525623.1|  PREDICTED: protein TRANSPARENT TESTA 12            355   2e-115   
ref|XP_009365621.1|  PREDICTED: protein TRANSPARENT TESTA 12 isof...    354   3e-115   
ref|XP_009365620.1|  PREDICTED: protein TRANSPARENT TESTA 12 isof...    354   4e-115   
ref|XP_009395378.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       354   4e-115   
ref|XP_006307362.1|  hypothetical protein CARUB_v10008985mg             353   8e-115   
ref|XP_006434915.1|  hypothetical protein CICLE_v10000947mg             352   1e-114   
ref|XP_006393574.1|  hypothetical protein EUTSA_v10011435mg             352   2e-114   
ref|XP_006473428.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       352   2e-114   
emb|CAN79163.1|  hypothetical protein VITISV_019245                     351   2e-114   Vitis vinifera
ref|XP_006434916.1|  hypothetical protein CICLE_v10000947mg             352   3e-114   
gb|AHI48500.1|  multidrug and toxic extrusion transporter               351   4e-114   
ref|XP_003550359.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    350   1e-113   
gb|EYU30643.1|  hypothetical protein MIMGU_mgv1a023413mg                347   6e-113   
ref|NP_001183424.1|  putative MATE efflux family protein                349   6e-113   
ref|XP_010060900.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    347   1e-112   
gb|KCW88053.1|  hypothetical protein EUGRSUZ_A00475                     347   2e-112   
ref|XP_010025046.1|  PREDICTED: protein TRANSPARENT TESTA 12            347   2e-112   
ref|XP_004291916.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       347   2e-112   
ref|XP_003544433.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       347   3e-112   
ref|XP_004171488.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       340   3e-112   
gb|KHN21009.1|  Protein TRANSPARENT TESTA 12                            346   3e-112   
ref|XP_010060899.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    346   4e-112   
ref|XP_006416102.1|  hypothetical protein EUTSA_v10009930mg             346   7e-112   
gb|KDO82260.1|  hypothetical protein CISIN_1g0101212mg                  340   1e-111   
gb|KDO82261.1|  hypothetical protein CISIN_1g0101212mg                  340   1e-111   
gb|KCW86662.1|  hypothetical protein EUGRSUZ_B03290                     345   1e-111   
ref|XP_010243274.1|  PREDICTED: protein TRANSPARENT TESTA 12 isof...    345   1e-111   
ref|XP_006478466.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       338   2e-111   
ref|XP_008779773.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       338   2e-111   
gb|KDP46214.1|  hypothetical protein JCGZ_10054                         345   2e-111   
ref|XP_002444617.1|  hypothetical protein SORBIDRAFT_07g024790          344   5e-111   Sorghum bicolor [broomcorn]
ref|XP_008347416.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       345   8e-111   
emb|CDO97089.1|  unnamed protein product                                343   9e-111   
ref|XP_008778454.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       335   1e-110   
ref|XP_010243273.1|  PREDICTED: protein TRANSPARENT TESTA 12 isof...    342   3e-110   
ref|XP_009383439.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       342   4e-110   
ref|XP_008796381.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       340   1e-109   
ref|XP_002445728.1|  hypothetical protein SORBIDRAFT_07g024780          340   2e-109   Sorghum bicolor [broomcorn]
ref|XP_010941347.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       340   2e-109   
ref|XP_010935395.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       339   3e-109   
ref|XP_010028564.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       340   3e-109   
ref|XP_002519100.1|  multidrug resistance pump, putative                339   4e-109   Ricinus communis
ref|XP_004974154.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       339   5e-109   
gb|AAL06936.1|  AT5g38030/F16F17_30                                     330   1e-108   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010927288.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       337   2e-108   
gb|AES59561.2|  MATE efflux family protein                              336   4e-108   
ref|XP_010927461.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       336   4e-108   
ref|XP_006856152.1|  hypothetical protein AMTR_s00059p00169820          336   4e-108   
ref|NP_001062445.1|  Os08g0550200                                       336   7e-108   Oryza sativa Japonica Group [Japonica rice]
emb|CDO97090.1|  unnamed protein product                                334   3e-107   
emb|CDP13217.1|  unnamed protein product                                334   4e-107   
ref|XP_011088336.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    332   2e-106   
ref|XP_006852302.1|  hypothetical protein AMTR_s00049p00190590          324   2e-106   
gb|EPS63161.1|  hypothetical protein M569_11626                         330   2e-106   
ref|XP_010250481.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    330   5e-106   
ref|XP_010250482.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    330   7e-106   
gb|EYU37755.1|  hypothetical protein MIMGU_mgv1a025801mg                328   2e-105   
emb|CDP07803.1|  unnamed protein product                                329   6e-105   
ref|XP_008654862.1|  PREDICTED: uncharacterized protein LOC100280...    328   9e-105   
ref|XP_008797000.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       327   1e-104   
ref|NP_001146663.1|  uncharacterized protein LOC100280263               327   2e-104   Zea mays [maize]
ref|XP_009802671.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       327   2e-104   
ref|XP_009605026.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       327   2e-104   
ref|XP_008808887.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       325   3e-104   
gb|AFW84961.1|  putative MATE efflux family protein                     327   9e-104   
ref|XP_007042719.1|  MATE efflux family protein                         325   9e-104   
ref|XP_009793955.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    325   1e-103   
gb|KFK44418.1|  hypothetical protein AALP_AA1G254300                    323   2e-103   
ref|XP_010941933.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       323   2e-103   
emb|CDY28209.1|  BnaA01g06400D                                          314   8e-103   
ref|XP_006659668.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       323   1e-102   
ref|XP_010941927.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    318   1e-102   
ref|XP_010941919.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    318   2e-102   
ref|XP_006365501.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       322   2e-102   
ref|XP_009399295.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       320   2e-102   
ref|XP_004231422.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       321   3e-102   
ref|XP_010270616.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       321   4e-102   
ref|XP_010941911.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    318   4e-102   
ref|XP_002458553.1|  hypothetical protein SORBIDRAFT_03g035610          320   5e-102   Sorghum bicolor [broomcorn]
ref|XP_006423184.1|  hypothetical protein CICLE_v10028264mg             320   6e-102   
gb|KDO51435.1|  hypothetical protein CISIN_1g010173mg                   321   6e-102   
ref|XP_004982390.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       320   6e-102   
gb|KDO51434.1|  hypothetical protein CISIN_1g010173mg                   320   6e-102   
emb|CDP01532.1|  unnamed protein product                                320   7e-102   
ref|XP_006827533.1|  hypothetical protein AMTR_s00009p00209360          318   9e-102   
ref|XP_010941884.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    318   9e-102   
ref|XP_006423183.1|  hypothetical protein CICLE_v10028264mg             320   9e-102   
ref|XP_010941865.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    318   2e-101   
ref|XP_009626790.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    318   2e-101   
ref|NP_001050703.1|  Os03g0626700                                       317   5e-101   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008804797.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       317   7e-101   
ref|XP_006365500.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       317   9e-101   
tpg|DAA50400.1|  TPA: putative MATE efflux family protein               317   1e-100   
ref|XP_006650317.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       316   1e-100   
ref|XP_010916697.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       316   2e-100   
ref|XP_009409170.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       316   2e-100   
ref|XP_006426305.1|  hypothetical protein CICLE_v10025480mg             309   1e-99    
ref|XP_009419039.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       313   2e-99    
gb|KDO60642.1|  hypothetical protein CISIN_1g011371mg                   306   1e-98    
ref|XP_003562258.1|  PREDICTED: protein TRANSPARENT TESTA 12            311   1e-98    
ref|XP_010941348.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       310   3e-98    
ref|XP_010327442.1|  PREDICTED: protein TRANSPARENT TESTA 12 isof...    310   4e-98    
ref|XP_004248728.1|  PREDICTED: protein TRANSPARENT TESTA 12 isof...    310   4e-98    
ref|XP_006426304.1|  hypothetical protein CICLE_v10025480mg             308   6e-98    
ref|XP_009802754.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       310   8e-98    
ref|XP_006349613.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    308   1e-97    
ref|XP_009796048.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    309   1e-97    
ref|XP_002464213.1|  hypothetical protein SORBIDRAFT_01g014210          308   2e-97    Sorghum bicolor [broomcorn]
ref|XP_006426307.1|  hypothetical protein CICLE_v10025480mg             308   2e-97    
ref|XP_009605041.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       308   2e-97    
ref|XP_003569893.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       308   3e-97    
ref|XP_006466280.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       308   4e-97    
gb|KCW86664.1|  hypothetical protein EUGRSUZ_B03292                     305   4e-97    
ref|XP_003589310.1|  Protein TRANSPARENT TESTA                          307   5e-97    
dbj|BAJ93540.1|  predicted protein                                      307   6e-97    
ref|XP_010671652.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       307   6e-97    
gb|KDO60641.1|  hypothetical protein CISIN_1g011371mg                   306   7e-97    
ref|XP_004152435.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       307   7e-97    
ref|NP_001234398.1|  ripening regulated protein DDTFR18                 305   7e-97    
ref|XP_003572490.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       308   8e-97    
ref|XP_004165027.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       307   8e-97    
ref|XP_008787420.1|  PREDICTED: protein TRANSPARENT TESTA 12 isof...    307   1e-96    
ref|XP_007044784.1|  MATE efflux family protein isoform 1               303   1e-96    
ref|XP_010320056.1|  PREDICTED: ripening regulated protein DDTFR1...    306   1e-96    
gb|KDO60639.1|  hypothetical protein CISIN_1g011371mg                   306   1e-96    
gb|KDO60636.1|  hypothetical protein CISIN_1g011035mg                   301   2e-96    
gb|KDO60638.1|  hypothetical protein CISIN_1g011371mg                   306   2e-96    
gb|KDO60640.1|  hypothetical protein CISIN_1g011371mg                   305   3e-96    
gb|KDP26651.1|  hypothetical protein JCGZ_17809                         303   3e-96    
ref|XP_008437344.1|  PREDICTED: protein TRANSPARENT TESTA 12            305   3e-96    
gb|KHN14526.1|  Protein TRANSPARENT TESTA 12                            305   4e-96    
ref|XP_010935783.1|  PREDICTED: protein TRANSPARENT TESTA 12            305   6e-96    
ref|XP_003556119.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       305   7e-96    
ref|XP_003517710.1|  PREDICTED: protein TRANSPARENT TESTA 12            305   7e-96    
ref|XP_002310871.1|  hypothetical protein POPTR_0007s14390g             304   1e-95    
gb|KDO60634.1|  hypothetical protein CISIN_1g011035mg                   302   1e-95    
ref|XP_006466279.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       303   2e-95    
ref|XP_007044786.1|  MATE efflux family protein isoform 3               300   2e-95    
gb|ADV04045.1|  MATE2 transporter                                       303   3e-95    
ref|XP_008219362.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       303   4e-95    
gb|ABK24651.1|  unknown                                                 303   5e-95    
ref|XP_003592215.1|  Protein TRANSPARENT TESTA                          303   5e-95    
gb|KDO60632.1|  hypothetical protein CISIN_1g011035mg                   302   8e-95    
ref|XP_006426302.1|  hypothetical protein CICLE_v10025455mg             301   1e-94    
ref|XP_007143457.1|  hypothetical protein PHAVU_007G073400g             301   1e-94    
ref|XP_007226903.1|  hypothetical protein PRUPE_ppa016334mg             301   1e-94    
ref|XP_009393552.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       301   1e-94    
ref|XP_009413656.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       301   1e-94    
ref|XP_010255290.1|  PREDICTED: protein TRANSPARENT TESTA 12            301   2e-94    
ref|XP_009408129.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       301   2e-94    
ref|XP_003536453.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       300   3e-94    
ref|XP_004496534.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       300   3e-94    
ref|XP_010671653.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       301   3e-94    
ref|XP_011021836.1|  PREDICTED: protein TRANSPARENT TESTA 12            300   4e-94    
ref|XP_003561965.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       300   6e-94    
gb|KCW62062.1|  hypothetical protein EUGRSUZ_H04732                     299   7e-94    
ref|XP_006856153.1|  hypothetical protein AMTR_s00059p00170320          299   7e-94    
ref|XP_010106306.1|  Protein TRANSPARENT TESTA 12                       299   8e-94    
ref|XP_010941873.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    298   8e-94    
gb|KDO60635.1|  hypothetical protein CISIN_1g011035mg                   295   9e-94    
ref|XP_006338107.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       299   9e-94    
ref|XP_004240722.1|  PREDICTED: protein TRANSPARENT TESTA 12 isof...    299   1e-93    
ref|XP_008234189.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       299   1e-93    
gb|KCW86666.1|  hypothetical protein EUGRSUZ_B03293                     295   1e-93    
ref|XP_008235361.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       298   2e-93    
gb|AHI48502.1|  multidrug and toxic extrusion transporter               298   2e-93    
ref|XP_002513666.1|  multidrug resistance pump, putative                298   3e-93    
ref|XP_004308030.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       298   3e-93    
gb|EPS58112.1|  hypothetical protein M569_16704                         290   3e-93    
gb|KDO81079.1|  hypothetical protein CISIN_1g011186mg                   296   3e-93    
ref|XP_010025407.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       298   3e-93    
ref|XP_010530703.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       297   4e-93    
ref|XP_004237959.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       298   4e-93    
ref|XP_002285728.2|  PREDICTED: protein TRANSPARENT TESTA 12-like       297   6e-93    
dbj|BAJ95959.1|  predicted protein                                      297   6e-93    
gb|KCW86665.1|  hypothetical protein EUGRSUZ_B03293                     294   7e-93    
ref|XP_006338137.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       297   8e-93    
emb|CDP01535.1|  unnamed protein product                                296   9e-93    
ref|XP_008383420.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       296   9e-93    
ref|XP_009380883.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       296   9e-93    
ref|XP_008219413.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       296   1e-92    
emb|CBI19217.3|  unnamed protein product                                297   1e-92    
ref|XP_007047830.1|  MATE efflux family protein                         296   1e-92    
gb|KFK39486.1|  hypothetical protein AALP_AA3G250400                    296   1e-92    
ref|XP_006827931.1|  hypothetical protein AMTR_s00008p00178100          294   1e-92    
ref|XP_006433900.1|  hypothetical protein CICLE_v10000950mg             296   2e-92    
ref|XP_007158392.1|  hypothetical protein PHAVU_002G149300g             296   2e-92    
ref|XP_006389632.1|  hypothetical protein POPTR_0021s00810g             296   2e-92    
ref|XP_003613099.1|  Protein TRANSPARENT TESTA                          295   2e-92    
ref|XP_004489769.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       295   2e-92    
ref|XP_009373462.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       296   2e-92    
gb|KDO54650.1|  hypothetical protein CISIN_1g0100251mg                  291   2e-92    
ref|XP_006472534.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       295   3e-92    
ref|XP_007205111.1|  hypothetical protein PRUPE_ppa004771mg             295   3e-92    
gb|KFK39487.1|  hypothetical protein AALP_AA3G250500                    296   3e-92    
ref|XP_010519285.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    292   4e-92    
ref|XP_007018127.1|  MATE efflux family protein isoform 1               295   4e-92    
ref|XP_011076127.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       295   4e-92    
ref|XP_010096865.1|  Protein TRANSPARENT TESTA 12                       293   5e-92    
ref|XP_007224466.1|  hypothetical protein PRUPE_ppa022569mg             294   5e-92    
ref|XP_009789596.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    295   6e-92    
emb|CDP17870.1|  unnamed protein product                                294   6e-92    
ref|XP_006363330.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       295   6e-92    
ref|XP_010448397.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       294   6e-92    
ref|XP_009596939.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       294   7e-92    
ref|XP_010317564.1|  PREDICTED: uncharacterized protein LOC543899...    295   8e-92    
ref|XP_006389631.1|  hypothetical protein POPTR_0021s00800g             294   8e-92    
ref|NP_001234424.1|  uncharacterized protein LOC543899                  295   8e-92    
ref|XP_009614057.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       294   8e-92    
ref|XP_004231421.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       293   9e-92    
ref|XP_004973711.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       293   1e-91    
emb|CDM84330.1|  unnamed protein product                                293   1e-91    
dbj|BAK06394.1|  predicted protein                                      293   1e-91    
ref|XP_009599386.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       294   1e-91    
ref|XP_011092680.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       294   1e-91    
ref|XP_002513990.1|  multidrug resistance pump, putative                293   1e-91    
gb|KDO45799.1|  hypothetical protein CISIN_1g0118571mg                  288   1e-91    
gb|EMT26118.1|  Protein TRANSPARENT TESTA 12                            295   2e-91    
gb|KDP29740.1|  hypothetical protein JCGZ_18675                         293   2e-91    
ref|XP_011047996.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       293   2e-91    
ref|XP_006353906.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       293   2e-91    
gb|KHG27903.1|  Protein TRANSPARENT TESTA 12 -like protein              293   2e-91    
ref|XP_011047997.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    293   2e-91    
gb|KFK39485.1|  hypothetical protein AALP_AA3G250300                    293   2e-91    
ref|XP_004289485.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       290   3e-91    
ref|XP_010547604.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       292   4e-91    
ref|XP_010923890.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       293   4e-91    
ref|XP_004308062.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       293   4e-91    
gb|EYU25124.1|  hypothetical protein MIMGU_mgv1a005208mg                292   4e-91    
ref|XP_010045479.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       292   5e-91    
ref|XP_006389633.1|  hypothetical protein POPTR_0021s00820g             292   7e-91    
gb|EMT19795.1|  Protein TRANSPARENT TESTA 12                            291   8e-91    
ref|XP_010519277.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    291   9e-91    
ref|XP_009145464.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       291   9e-91    
emb|CDY33129.1|  BnaCnng07000D                                          291   1e-90    
ref|XP_009373472.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    291   1e-90    
gb|KDO56754.1|  hypothetical protein CISIN_1g043161mg                   290   1e-90    
ref|XP_010026078.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       291   1e-90    
ref|XP_011076124.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       291   1e-90    
ref|XP_010647092.1|  PREDICTED: protein TRANSPARENT TESTA 12            291   1e-90    
ref|XP_010675571.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       291   1e-90    
ref|XP_006449716.1|  hypothetical protein CICLE_v10014968mg             291   1e-90    
ref|XP_010433607.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       291   1e-90    
gb|EYU25122.1|  hypothetical protein MIMGU_mgv1a004973mg                291   1e-90    
ref|XP_006406243.1|  hypothetical protein EUTSA_v10020526mg             290   1e-90    
gb|EPS60149.1|  hypothetical protein M569_14655                         288   1e-90    
dbj|BAJ34389.1|  unnamed protein product                                286   1e-90    
ref|XP_010098694.1|  Protein TRANSPARENT TESTA 12                       290   2e-90    
emb|CDX97005.1|  BnaC09g46200D                                          290   2e-90    
ref|XP_006447549.1|  hypothetical protein CICLE_v10014926mg             291   2e-90    
ref|XP_007219057.1|  hypothetical protein PRUPE_ppa004822mg             290   3e-90    
ref|XP_007045634.1|  MATE efflux family protein isoform 2               288   3e-90    
ref|XP_006646357.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       290   3e-90    
emb|CDP08789.1|  unnamed protein product                                290   3e-90    
emb|CDP11782.1|  unnamed protein product                                291   3e-90    
ref|XP_010093281.1|  Protein TRANSPARENT TESTA 12                       291   4e-90    
ref|XP_004967732.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    290   4e-90    
ref|XP_004137180.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       289   4e-90    
ref|XP_002518493.1|  multidrug resistance pump, putative                290   4e-90    
ref|XP_002533973.1|  multidrug resistance pump, putative                290   4e-90    
ref|XP_006490661.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       290   4e-90    
ref|XP_008812639.1|  PREDICTED: protein TRANSPARENT TESTA 12            290   5e-90    
ref|XP_004299689.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       290   5e-90    
ref|XP_004967731.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    289   5e-90    
ref|XP_006421996.1|  hypothetical protein CICLE_v10004833mg             289   6e-90    
gb|EEC74654.1|  hypothetical protein OsI_10313                          289   6e-90    
ref|XP_010681038.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       290   7e-90    
ref|XP_002533972.1|  multidrug resistance pump, putative                289   7e-90    
ref|XP_011016879.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       289   7e-90    
ref|XP_003574646.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       289   7e-90    
ref|XP_006365523.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       288   7e-90    
ref|XP_007038778.1|  Detoxifying efflux carrier 35 isoform 4            287   8e-90    
ref|XP_006283622.1|  hypothetical protein CARUB_v10004679mg             289   8e-90    
ref|XP_011085018.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       289   9e-90    
ref|XP_002532702.1|  multidrug resistance pump, putative                290   1e-89    
gb|KDP22243.1|  hypothetical protein JCGZ_26074                         288   1e-89    
ref|XP_006406242.1|  hypothetical protein EUTSA_v10020526mg             289   1e-89    
ref|XP_006478600.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       288   1e-89    
ref|XP_002302326.1|  hypothetical protein POPTR_0002s10250g             288   1e-89    
ref|XP_010041730.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       283   1e-89    
gb|KDP41437.1|  hypothetical protein JCGZ_15844                         288   2e-89    
emb|CDX92726.1|  BnaC07g39840D                                          291   2e-89    
ref|XP_006467446.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    288   2e-89    
ref|XP_010060062.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       288   2e-89    
ref|XP_007026057.1|  MATE efflux family protein                         288   2e-89    
ref|NP_001146227.1|  uncharacterized protein LOC100279798               289   2e-89    
ref|XP_007038777.1|  Detoxifying efflux carrier 35 isoform 3            287   3e-89    
gb|EMT32313.1|  Protein TRANSPARENT TESTA 12                            287   3e-89    
ref|NP_001147792.1|  transparent testa 12 protein                       287   3e-89    
emb|CDY50190.1|  BnaA03g47580D                                          290   3e-89    
ref|XP_002518492.1|  multidrug resistance pump, putative                287   3e-89    
emb|CDY19294.1|  BnaC01g31860D                                          288   4e-89    
emb|CDY40093.1|  BnaC02g00370D                                          287   4e-89    
ref|XP_006490695.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       287   4e-89    
emb|CDP01124.1|  unnamed protein product                                288   4e-89    
ref|XP_006442840.1|  hypothetical protein CICLE_v10024205mg             286   4e-89    
emb|CAB43695.1|  putative protein                                       286   5e-89    
ref|XP_006339601.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       286   5e-89    
emb|CDY39494.1|  BnaA01g24940D                                          287   5e-89    
ref|XP_009768339.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       287   5e-89    
ref|NP_001064286.1|  Os10g0195000                                       286   5e-89    
ref|XP_009125302.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       287   6e-89    
emb|CDP11780.1|  unnamed protein product                                287   6e-89    
ref|XP_007051759.1|  MATE efflux family protein                         287   6e-89    
ref|XP_004229913.2|  PREDICTED: protein TRANSPARENT TESTA 12            287   6e-89    
gb|EEC66673.1|  hypothetical protein OsI_32968                          286   6e-89    
emb|CDP01121.1|  unnamed protein product                                286   6e-89    
tpg|DAA43788.1|  TPA: putative MATE efflux family protein               286   7e-89    
ref|XP_010275704.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       289   7e-89    
gb|KCW66759.1|  hypothetical protein EUGRSUZ_F00509                     286   7e-89    
ref|XP_011076125.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       286   8e-89    
ref|XP_009388870.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       287   8e-89    
ref|NP_194294.2|  detoxifying efflux carrier 35                         286   8e-89    
gb|KDO56753.1|  hypothetical protein CISIN_1g035514mg                   286   9e-89    
ref|XP_010681037.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       287   9e-89    
ref|XP_006467445.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    286   9e-89    
ref|NP_567173.3|  MATE efflux family protein                            288   9e-89    
gb|AGT17303.1|  hypothetical protein SHCRBa_168_J15_F_360               285   9e-89    
ref|XP_004152620.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       285   1e-88    
gb|KDO78208.1|  hypothetical protein CISIN_1g010561mg                   286   1e-88    
ref|XP_010276072.1|  PREDICTED: protein TRANSPARENT TESTA 12            286   1e-88    
ref|XP_007038775.1|  Detoxifying efflux carrier 35 isoform 1            287   1e-88    
gb|KDP20756.1|  hypothetical protein JCGZ_21227                         297   1e-88    
ref|XP_006383933.1|  hypothetical protein POPTR_0004s01620g             286   1e-88    
ref|XP_003605914.1|  Transparent testa 12 protein                       286   1e-88    
gb|KHG24176.1|  Protein TRANSPARENT TESTA 12 -like protein              286   1e-88    
emb|CDY33962.1|  BnaC02g43750D                                          280   1e-88    
ref|XP_002302325.2|  hypothetical protein POPTR_0002s10240g             285   1e-88    
ref|XP_002267053.2|  PREDICTED: protein TRANSPARENT TESTA 12            286   2e-88    
ref|XP_007045633.1|  MATE efflux family protein isoform 1               286   2e-88    
ref|XP_006852299.1|  hypothetical protein AMTR_s00049p00189540          283   2e-88    
ref|XP_010026089.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       286   2e-88    
ref|XP_009618512.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    283   2e-88    
gb|KFK30626.1|  hypothetical protein AALP_AA6G006400                    286   2e-88    
ref|XP_008234190.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       285   2e-88    
dbj|BAE98568.1|  hypothetical protein                                   285   2e-88    
gb|KFK25316.1|  hypothetical protein AALP_AA8G096900                    285   2e-88    
ref|NP_001190838.1|  detoxifying efflux carrier 35                      286   2e-88    
ref|XP_009150628.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       285   3e-88    
ref|XP_010510494.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       285   3e-88    
emb|CDX92916.1|  BnaA03g36380D                                          285   3e-88    
ref|XP_006576298.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    284   3e-88    
ref|XP_010681039.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       285   3e-88    



>ref|XP_009791264.1| PREDICTED: protein TRANSPARENT TESTA 12 [Nicotiana sylvestris]
Length=523

 Score =   458 bits (1178),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 220/309 (71%), Positives = 254/309 (82%), Gaps = 0/309 (0%)
 Frame = -1

Query  948  SFDADAGDIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHVGNI  769
            SF AD  DI+QI+ VK+ IREF  ESKKLWYLAAPAIFT   QYSIGA+TQVFAGHVG I
Sbjct  41   SFKADEDDIQQIRGVKDLIREFSVESKKLWYLAAPAIFTSVCQYSIGAVTQVFAGHVGTI  100

Query  768  QLAAVAVENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNATAIP  589
            QLAAV++EN++IAGFAFG+M GMGSALETLCGQAFGAK+LEMLG Y+QRSW+IL  TA+ 
Sbjct  101  QLAAVSIENSVIAGFAFGVMLGMGSALETLCGQAFGAKQLEMLGTYMQRSWVILTTTALV  160

Query  588  LTTLYIFSTPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYVMAS  409
            L   YIF+TP+LK + Q P ISK  G FAVWMIPQLFAY   FPIQ+FLQ+QSKI VMA+
Sbjct  161  LIFPYIFATPLLKFIGQTPDISKWAGMFAVWMIPQLFAYALNFPIQKFLQAQSKIMVMAA  220

Query  408  VSDVALVGHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKGFSQ  229
            ++ V L+GH LFSWL MLKL WGL GGAVVLN +WWF+ VAQ VY++SG CG AW GFS 
Sbjct  221  IAAVGLIGHTLFSWLLMLKLGWGLVGGAVVLNGSWWFIVVAQLVYILSGTCGQAWSGFSL  280

Query  228  RAFQNLTGFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGWTLMV  49
            +AFQNL  FV+LS AS VM CLE+WYF+ALIL+AGY KNAEV+VD  SICMNI GW  MV
Sbjct  281  KAFQNLWDFVKLSFASAVMLCLEMWYFMALILVAGYLKNAEVAVDAISICMNIEGWMFMV  340

Query  48   GVGFSAAIS  22
             +GF+AAIS
Sbjct  341  ALGFNAAIS  349



>ref|XP_009591643.1| PREDICTED: protein TRANSPARENT TESTA 12 [Nicotiana tomentosiformis]
Length=524

 Score =   452 bits (1163),  Expect = 5e-153, Method: Compositional matrix adjust.
 Identities = 217/309 (70%), Positives = 252/309 (82%), Gaps = 0/309 (0%)
 Frame = -1

Query  948  SFDADAGDIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHVGNI  769
            SF AD  DI+QI+ VK+ IREF  ESKKLWYLAAPAIFT   QYSIGA+TQVFAGHVG I
Sbjct  42   SFKADEDDIQQIRGVKDLIREFSVESKKLWYLAAPAIFTSVCQYSIGAVTQVFAGHVGTI  101

Query  768  QLAAVAVENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNATAIP  589
            QLAAV++EN++IAGFAFG+M GMGSALETLCGQAFGAK+LEMLG Y+QRSW+IL  TA+ 
Sbjct  102  QLAAVSIENSVIAGFAFGVMLGMGSALETLCGQAFGAKQLEMLGTYMQRSWVILTTTALV  161

Query  588  LTTLYIFSTPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYVMAS  409
            L   YIF+TP+LK + Q   ISK  G FAVWMIPQLFAY   FPIQ+FLQ+QSKI VMA+
Sbjct  162  LIFPYIFATPLLKFIGQTADISKWAGMFAVWMIPQLFAYALNFPIQKFLQAQSKIMVMAA  221

Query  408  VSDVALVGHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKGFSQ  229
            ++ + L+GH L SWL M+KL WGL GGAVVLN +WWF+ VAQ VY+ SG CG AW GFS 
Sbjct  222  IAAIGLIGHTLLSWLLMIKLGWGLVGGAVVLNGSWWFIVVAQLVYIFSGTCGQAWSGFSL  281

Query  228  RAFQNLTGFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGWTLMV  49
            +AFQNL  FV+LS AS VM CLE+WYF+ALIL+AGY KNAEV+VD  SICMNI GWT MV
Sbjct  282  KAFQNLWDFVKLSFASAVMLCLEMWYFMALILVAGYLKNAEVAVDAISICMNIEGWTFMV  341

Query  48   GVGFSAAIS  22
             +GF+AAIS
Sbjct  342  ALGFNAAIS  350



>ref|XP_006357607.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Solanum 
tuberosum]
Length=512

 Score =   448 bits (1152),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 216/304 (71%), Positives = 254/304 (84%), Gaps = 0/304 (0%)
 Frame = -1

Query  933  AGDIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHVGNIQLAAV  754
            + DI +I  VK+F+REF +ESKKLWYLAAPAIFT   QYSIGAITQVFAGHVG IQLAAV
Sbjct  35   SDDINEINGVKDFVREFSAESKKLWYLAAPAIFTSLCQYSIGAITQVFAGHVGTIQLAAV  94

Query  753  AVENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNATAIPLTTLY  574
            ++EN++IAGF+FGIM GMGSALETLCGQAFGAK+LEMLG Y+QRSWIIL +TA+ L   Y
Sbjct  95   SIENSVIAGFSFGIMLGMGSALETLCGQAFGAKQLEMLGTYMQRSWIILTSTALILLFPY  154

Query  573  IFSTPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYVMASVSDVA  394
            IF+TP+L+ + Q  +ISK  GTFAVWMIPQLFAY   FPIQ+FLQ+QSKI V A ++  A
Sbjct  155  IFATPLLRFIGQTSNISKWAGTFAVWMIPQLFAYALNFPIQKFLQAQSKIMVTAVIAGFA  214

Query  393  LVGHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKGFSQRAFQN  214
            LVGH LFSWL MLKLRWGL G AVVLN++WWF+ VA+ VY+ SGACG+AW GFS +AFQN
Sbjct  215  LVGHTLFSWLLMLKLRWGLVGAAVVLNSSWWFLVVAKLVYIFSGACGEAWSGFSMKAFQN  274

Query  213  LTGFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGWTLMVGVGFS  34
            L  FV+LS AS VM CLE+WYF+ALIL AGY KNAEV+VD  +ICMNI GWT+MV +GF+
Sbjct  275  LWEFVKLSFASAVMLCLEIWYFMALILFAGYLKNAEVAVDAIAICMNIQGWTVMVAIGFN  334

Query  33   AAIS  22
            AAIS
Sbjct  335  AAIS  338



>ref|XP_010320933.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Solanum lycopersicum]
Length=504

 Score =   444 bits (1143),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 218/315 (69%), Positives = 256/315 (81%), Gaps = 0/315 (0%)
 Frame = -1

Query  966  NMSSVYSFDADAGDIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFA  787
            N S+  SF  D+ DI  I  VK+ IR+F +ESKKLWYLAAPAIFT   QYSIGAITQ+FA
Sbjct  16   NHSNGSSFKPDSYDIEVINGVKDLIRQFSAESKKLWYLAAPAIFTSICQYSIGAITQIFA  75

Query  786  GHVGNIQLAAVAVENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIIL  607
            GHVG IQLAAV++EN++IAGFAFG+M GMGSALETLCGQAFGAK+L+MLG Y+QRSWIIL
Sbjct  76   GHVGTIQLAAVSIENSVIAGFAFGVMLGMGSALETLCGQAFGAKQLDMLGTYMQRSWIIL  135

Query  606  NATAIPLTTLYIFSTPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSK  427
             AT++ L   YIF+T +L+L+ Q   ISK  GTFAVWMIPQLFAY   FPIQ FLQ+QSK
Sbjct  136  IATSLILMLPYIFATSLLRLIGQTSDISKWAGTFAVWMIPQLFAYALNFPIQIFLQAQSK  195

Query  426  IYVMASVSDVALVGHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDA  247
            I VMA ++ V L+GH LFSWLFMLKL WGL G AVVLN +WWF+ VA+ +Y+ SGACG+A
Sbjct  196  IMVMAVIAAVGLIGHTLFSWLFMLKLGWGLVGAAVVLNGSWWFVVVAKLLYIFSGACGEA  255

Query  246  WKGFSQRAFQNLTGFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNIS  67
            W GFS +AFQNL  FV+LS AS VM CLE+WYF+ALIL+AGY KNAEV+VD  SICMNI 
Sbjct  256  WSGFSIKAFQNLWEFVKLSFASAVMLCLEIWYFMALILVAGYLKNAEVAVDAISICMNIQ  315

Query  66   GWTLMVGVGFSAAIS  22
            GWT MV +GF+AAIS
Sbjct  316  GWTFMVALGFNAAIS  330



>ref|XP_006357606.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Solanum 
tuberosum]
Length=512

 Score =   444 bits (1143),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 217/309 (70%), Positives = 252/309 (82%), Gaps = 0/309 (0%)
 Frame = -1

Query  948  SFDADAGDIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHVGNI  769
            SF  D+ DI  I  VK+ +REF +ESKKLWYLAAPAIFT   QYSIGAITQVFAGHVG I
Sbjct  30   SFKPDSYDIEVIHGVKDLVREFSAESKKLWYLAAPAIFTSICQYSIGAITQVFAGHVGTI  89

Query  768  QLAAVAVENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNATAIP  589
            QLAAV++EN++IAGF+FGIM GMGSALETLCGQAFGAK+L+MLG Y+QRSWIIL AT++ 
Sbjct  90   QLAAVSIENSVIAGFSFGIMLGMGSALETLCGQAFGAKQLDMLGTYMQRSWIILTATSLI  149

Query  588  LTTLYIFSTPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYVMAS  409
            L   YIF+T +L+L+ Q   ISK  GTFAVWMIPQLFAY   FPIQ FLQ+QSKI VMA 
Sbjct  150  LMLPYIFATSLLRLIGQTSDISKWAGTFAVWMIPQLFAYALNFPIQIFLQAQSKIMVMAG  209

Query  408  VSDVALVGHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKGFSQ  229
            ++ V L+GH LFSWLFM KL WGL G AVVLN +WWF+ VA+ VY+ SGACG+AW GFS 
Sbjct  210  IAAVGLIGHTLFSWLFMFKLGWGLVGAAVVLNGSWWFVVVAKLVYIFSGACGEAWSGFSI  269

Query  228  RAFQNLTGFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGWTLMV  49
            +AFQNL  FV+LS AS VM CLE+WYF+ALIL+AGY KNAEV+VD  SICMNI GWT MV
Sbjct  270  KAFQNLWEFVKLSFASAVMLCLEIWYFMALILVAGYLKNAEVAVDAISICMNIQGWTFMV  329

Query  48   GVGFSAAIS  22
             +GF+AAIS
Sbjct  330  ALGFNAAIS  338



>emb|CDP13216.1| unnamed protein product [Coffea canephora]
Length=517

 Score =   444 bits (1141),  Expect = 8e-150, Method: Compositional matrix adjust.
 Identities = 213/322 (66%), Positives = 258/322 (80%), Gaps = 0/322 (0%)
 Frame = -1

Query  987  KNTQIS*NMSSVYSFDADAGDIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIG  808
             + Q + + S+  SFDAD  DI+ I   ++F REF +ESKKLWYLA PAIFT   QYSIG
Sbjct  22   DSLQAAFHKSNNLSFDADEDDIQPINGARDFFREFAAESKKLWYLAGPAIFTSICQYSIG  81

Query  807  AITQVFAGHVGNIQLAAVAVENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYL  628
            A+TQVFAG VG I+LAAV+VEN+++AGFAFG+M GMGSALETLCGQAFGA +L MLGVY+
Sbjct  82   ALTQVFAGQVGTIELAAVSVENSVVAGFAFGMMLGMGSALETLCGQAFGAGQLNMLGVYM  141

Query  627  QRSWIILNATAIPLTTLYIFSTPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQR  448
            QRSW+ILNA A+ L  + IF+  IL+L+ Q P ISK  GTFAVWMIPQ+FAY F FPIQ+
Sbjct  142  QRSWVILNAAALVLMLVQIFAAQILRLIGQTPDISKWAGTFAVWMIPQIFAYAFNFPIQK  201

Query  447  FLQSQSKIYVMASVSDVALVGHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVV  268
            FLQ+QSKI VMA ++ VA+VGH L SWLFMLKL WGL GGA +LN +WWF+ VAQ VY+ 
Sbjct  202  FLQAQSKIIVMAIIAAVAIVGHALLSWLFMLKLGWGLVGGAAMLNASWWFIVVAQLVYIF  261

Query  267  SGACGDAWKGFSQRAFQNLTGFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGT  88
            SG CG+AW GFS +AFQNL GFV+LSLAS +M CLE WYF +L+L AGY KNAE++VD  
Sbjct  262  SGTCGEAWSGFSWKAFQNLWGFVKLSLASAIMLCLEFWYFTSLVLFAGYLKNAEIAVDAL  321

Query  87   SICMNISGWTLMVGVGFSAAIS  22
            SICMN+ GWT+MV +GF+AAIS
Sbjct  322  SICMNVLGWTIMVAIGFNAAIS  343



>ref|XP_004239126.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Solanum lycopersicum]
Length=514

 Score =   436 bits (1122),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 209/309 (68%), Positives = 253/309 (82%), Gaps = 0/309 (0%)
 Frame = -1

Query  948  SFDADAGDIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHVGNI  769
            S   ++ DI++I  VK+ +REF +ESKKLW LAAPAIFT   QYSIGAITQVFAGHVG I
Sbjct  35   SSSNNSDDIKEIDGVKDLVREFSAESKKLWNLAAPAIFTSLCQYSIGAITQVFAGHVGTI  94

Query  768  QLAAVAVENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNATAIP  589
            QLAA+++EN++IAGF+FG+M GMGSALETLCGQA+GAK+LEMLG Y+QRSWIIL +TA+ 
Sbjct  95   QLAAISIENSVIAGFSFGVMLGMGSALETLCGQAYGAKQLEMLGTYMQRSWIILTSTALI  154

Query  588  LTTLYIFSTPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYVMAS  409
            L   YIF+T +L+ + Q  +ISK  GTFA+WMIPQLFAY   FPIQ+FLQ+QSKI V A 
Sbjct  155  LLFPYIFATQLLRFIGQTSNISKWAGTFAIWMIPQLFAYALNFPIQKFLQAQSKIMVTAV  214

Query  408  VSDVALVGHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKGFSQ  229
            ++  AL GH LFSWL MLKLRWGL G AVVLN++WWF+ VA+ VY+ +GACG+AW GFS 
Sbjct  215  IAGFALAGHTLFSWLLMLKLRWGLVGAAVVLNSSWWFLVVAKLVYIFNGACGEAWSGFSM  274

Query  228  RAFQNLTGFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGWTLMV  49
            +AFQNL  FV+LS AS VM CLE+WYF+ALIL AGY KNAEV+VD  SICMNI GWT+MV
Sbjct  275  KAFQNLWEFVKLSFASAVMLCLEIWYFMALILFAGYLKNAEVAVDAISICMNIQGWTVMV  334

Query  48   GVGFSAAIS  22
             +GF+AAIS
Sbjct  335  AIGFNAAIS  343



>ref|XP_006371335.1| hypothetical protein POPTR_0019s09190g [Populus trichocarpa]
 gb|ERP49132.1| hypothetical protein POPTR_0019s09190g [Populus trichocarpa]
Length=572

 Score =   432 bits (1111),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 208/315 (66%), Positives = 253/315 (80%), Gaps = 0/315 (0%)
 Frame = -1

Query  966  NMSSVYSFDADAGDIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFA  787
            N S   SF ADA DI+ I  V++F REF  ES KLW+LAAPAIFT   QYS+GAITQVFA
Sbjct  80   NNSFASSFVADADDIQPINSVRDFFREFCRESVKLWFLAAPAIFTTVCQYSLGAITQVFA  139

Query  786  GHVGNIQLAAVAVENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIIL  607
            GHVG + LAAV++EN++IAGF+FG+M GMGSALETLCGQAFGA +L+MLG+Y+QRSW+IL
Sbjct  140  GHVGTLALAAVSIENSVIAGFSFGLMLGMGSALETLCGQAFGAGQLDMLGIYMQRSWLIL  199

Query  606  NATAIPLTTLYIFSTPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSK  427
            N TA+ L+ +YIFS  +LKL+ Q   ISKA G F++WM+PQLFAY F FP+ +FLQSQSK
Sbjct  200  NTTALLLSLVYIFSAQLLKLIGQTASISKAAGMFSIWMLPQLFAYAFNFPMAKFLQSQSK  259

Query  426  IYVMASVSDVALVGHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDA  247
            I VMA +S V L+ H +FSWL M+KL+WGL G AVVLN +W  + ++QFVY++SG CG A
Sbjct  260  IMVMAVISVVVLILHTVFSWLLMIKLKWGLVGAAVVLNASWVIIDISQFVYIISGTCGRA  319

Query  246  WKGFSQRAFQNLTGFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNIS  67
            W GFS +AFQNL  FVRLSLAS VM CLE+WYF+ALIL AGY KNAEV+VD  SICMNI 
Sbjct  320  WSGFSWKAFQNLWSFVRLSLASAVMLCLEVWYFMALILFAGYLKNAEVAVDALSICMNIL  379

Query  66   GWTLMVGVGFSAAIS  22
            GWT+MV +G +AAIS
Sbjct  380  GWTVMVALGMNAAIS  394



>ref|XP_010999529.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Populus euphratica]
Length=521

 Score =   430 bits (1106),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 207/315 (66%), Positives = 254/315 (81%), Gaps = 0/315 (0%)
 Frame = -1

Query  966  NMSSVYSFDADAGDIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFA  787
            N S   SF ADA DI+ I  V++F REF  ES KLWYLAAPAIFT   QYS+GAITQVFA
Sbjct  31   NNSFASSFVADADDIQPINGVRDFFREFCRESVKLWYLAAPAIFTSVCQYSLGAITQVFA  90

Query  786  GHVGNIQLAAVAVENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIIL  607
            GHVG ++LAAV++EN++IAGF+FG+M GMGSALETLCGQAFGA +L+MLG+Y+QRSW+IL
Sbjct  91   GHVGTLELAAVSIENSVIAGFSFGLMLGMGSALETLCGQAFGAGQLDMLGIYMQRSWLIL  150

Query  606  NATAIPLTTLYIFSTPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSK  427
            N TA+ L+ +YIF+  +L+L+ Q   ISKA G F++WMIPQLFAY F FP+ +FLQSQSK
Sbjct  151  NTTALLLSLVYIFAAKLLRLIGQTASISKAAGIFSIWMIPQLFAYAFNFPMAKFLQSQSK  210

Query  426  IYVMASVSDVALVGHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDA  247
            I VMA +S V L+ H +FSWL M+KL+WGL G AVVLN +W  + ++QFVY++SG CG A
Sbjct  211  IMVMALISVVVLILHTVFSWLLMIKLKWGLVGAAVVLNASWVIIDISQFVYIISGTCGRA  270

Query  246  WKGFSQRAFQNLTGFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNIS  67
            W GFS +AFQ+L  FVRLSLAS VM CLE+WYF+ALIL AGY KNAEV+VD  SICMNI 
Sbjct  271  WNGFSWKAFQSLWSFVRLSLASAVMLCLEVWYFMALILFAGYLKNAEVAVDALSICMNIL  330

Query  66   GWTLMVGVGFSAAIS  22
            GWT+MV +G +AAIS
Sbjct  331  GWTVMVALGMNAAIS  345



>ref|XP_003628949.1| Protein TRANSPARENT TESTA [Medicago truncatula]
 gb|AET03425.1| MATE efflux family protein [Medicago truncatula]
Length=512

 Score =   425 bits (1093),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 209/308 (68%), Positives = 245/308 (80%), Gaps = 0/308 (0%)
 Frame = -1

Query  945  FDADAGDIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHVGNIQ  766
            F A + DI  I    +F REF +ESKKLWYLA PAIFT  SQYS+GA+TQVFAG VG +Q
Sbjct  28   FTAKSDDISPITGAGDFAREFLNESKKLWYLAGPAIFTSISQYSLGAVTQVFAGQVGTLQ  87

Query  765  LAAVAVENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNATAIPL  586
            LAAV+VEN++IAGF  GI  GMGSALETLCGQAFGA KL+MLG+Y+QRSW+ILNATAI L
Sbjct  88   LAAVSVENSVIAGFCLGITMGMGSALETLCGQAFGAGKLDMLGIYMQRSWLILNATAIIL  147

Query  585  TTLYIFSTPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYVMASV  406
              LYIF++P+LKL+ Q   IS+A G FA+WMIPQLFAY   FPIQ+FLQ+QSKI  MA +
Sbjct  148  CFLYIFASPLLKLIGQTTAISEAAGVFALWMIPQLFAYAMNFPIQKFLQAQSKIMAMAWI  207

Query  405  SDVALVGHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKGFSQR  226
            S  ALVGH  FSW  ML L WGL G AVVLN++WWF+ +AQ VYV+SG+CG+AW GFS +
Sbjct  208  SAAALVGHTFFSWFLMLHLGWGLVGAAVVLNSSWWFIVLAQIVYVLSGSCGEAWSGFSFQ  267

Query  225  AFQNLTGFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGWTLMVG  46
            AFQNL GFVRLSLAS VM CLE+WYF+ALIL AGY +NAEVSVD  SIC NI GWT+M  
Sbjct  268  AFQNLWGFVRLSLASAVMMCLEVWYFMALILFAGYLENAEVSVDALSICTNILGWTVMAS  327

Query  45   VGFSAAIS  22
             G +AA+S
Sbjct  328  FGVNAAVS  335



>ref|XP_009605336.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Nicotiana tomentosiformis]
Length=491

 Score =   424 bits (1090),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 201/316 (64%), Positives = 252/316 (80%), Gaps = 1/316 (0%)
 Frame = -1

Query  966  NMSSVYSFDADAGDIRQIKK-VKEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVF  790
            N+  + S ++DA DI+   + VK+ IR+F SESKKLWYLAAPA+FT+  QYSI AITQ+F
Sbjct  5    NVLLLTSSNSDADDIQLPNRGVKDLIRDFSSESKKLWYLAAPAVFTLVCQYSINAITQIF  64

Query  789  AGHVGNIQLAAVAVENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWII  610
            AGH+G IQLAA++V+N++IAGFAFGIM+GMGSALETLCGQA+GAK+LEMLG+Y+QRSWII
Sbjct  65   AGHIGTIQLAAISVQNSVIAGFAFGIMFGMGSALETLCGQAYGAKQLEMLGIYMQRSWII  124

Query  609  LNATAIPLTTLYIFSTPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQS  430
            +  TA+ L   Y+F+T +LKL+ Q+P ISK  GTFAVWMIPQLFA    FPI++FLQ+QS
Sbjct  125  VGTTALVLMFPYMFATSLLKLIGQDPEISKWAGTFAVWMIPQLFANAINFPIRKFLQAQS  184

Query  429  KIYVMASVSDVALVGHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGD  250
            K+ VMA+++ V +VGH LFSWL MLK+ WGLPG A+ LN + WFM +A   Y+ SG CG 
Sbjct  185  KVMVMAAIAGVTVVGHTLFSWLLMLKMGWGLPGAALALNASSWFMVLANLAYIFSGTCGQ  244

Query  249  AWKGFSQRAFQNLTGFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNI  70
            AW GFS +AFQNL GFVRLS AS VM CLE+WY++ALIL AGY KNAE++VD  SIC NI
Sbjct  245  AWSGFSCKAFQNLWGFVRLSFASAVMICLEMWYYMALILFAGYLKNAEIAVDAISICSNI  304

Query  69   SGWTLMVGVGFSAAIS  22
              WT MV +G + A+S
Sbjct  305  CAWTFMVSLGLNVAVS  320



>ref|XP_008389731.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Malus domestica]
Length=524

 Score =   425 bits (1092),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 207/313 (66%), Positives = 248/313 (79%), Gaps = 0/313 (0%)
 Frame = -1

Query  960  SSVYSFDADAGDIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGH  781
            +S  SF  DA DI  I  V++F REF+ E+KKLW+LA PAIFT   QYS+GAITQVFAG 
Sbjct  37   TSTASFTPDADDISPIVSVRDFFREFFKEAKKLWFLAGPAIFTSLCQYSLGAITQVFAGQ  96

Query  780  VGNIQLAAVAVENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNA  601
            VG + LAAV++EN++IAGF+FG+M GMGSALETLCGQA GA +L+MLG+Y+QRSW+ILN+
Sbjct  97   VGTLDLAAVSIENSVIAGFSFGVMLGMGSALETLCGQAVGAGQLDMLGIYMQRSWVILNS  156

Query  600  TAIPLTTLYIFSTPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIY  421
            TA+ L+ LYIF+  +LK + Q   ISKA G FA+WMIPQLFAY   FPI +FLQSQSK+ 
Sbjct  157  TAVLLSFLYIFAQQLLKAIGQTADISKAAGVFAIWMIPQLFAYAMNFPIAKFLQSQSKMM  216

Query  420  VMASVSDVALVGHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWK  241
            VMA +S V LV H LFSWL MLK+ WGL G AVVLNT+WW + +AQ  Y+ SG CG AW 
Sbjct  217  VMAVISVVVLVLHTLFSWLLMLKVGWGLVGAAVVLNTSWWLIVLAQLGYIFSGTCGQAWV  276

Query  240  GFSQRAFQNLTGFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGW  61
            GFS +AFQNL  FV+LSLAS VM CLE+WYF+ALIL AGY KNAEVSVDG SICMNI GW
Sbjct  277  GFSWKAFQNLWAFVKLSLASAVMLCLEVWYFMALILFAGYLKNAEVSVDGLSICMNILGW  336

Query  60   TLMVGVGFSAAIS  22
            T+MV +G +AAIS
Sbjct  337  TVMVAMGMNAAIS  349



>gb|KCW86669.1| hypothetical protein EUGRSUZ_B03295 [Eucalyptus grandis]
Length=499

 Score =   424 bits (1089),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 204/321 (64%), Positives = 250/321 (78%), Gaps = 0/321 (0%)
 Frame = -1

Query  984  NTQIS*NMSSVYSFDADAGDIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGA  805
            N  +S  ++  ++F A A DI  IK  ++F+REF  ESKKLW+LA PAIFT   QYS+GA
Sbjct  36   NLPLSTTVNDAFTFTARADDIPPIKGPRDFVREFAKESKKLWFLAGPAIFTSICQYSLGA  95

Query  804  ITQVFAGHVGNIQLAAVAVENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQ  625
            ITQVFAGHVG + LAAV++EN++IAGF+FG+M GMGSALETLCGQA+GA +++MLG+Y+Q
Sbjct  96   ITQVFAGHVGTLALAAVSIENSVIAGFSFGVMLGMGSALETLCGQAYGAGQIDMLGIYMQ  155

Query  624  RSWIILNATAIPLTTLYIFSTPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRF  445
            RSW+ILN TA+ L  LYIF+  +L+L+ Q   IS+  G FAVWMIPQLFAY   FPI +F
Sbjct  156  RSWVILNTTAVALCLLYIFAAKLLRLIGQTEAISEEAGMFAVWMIPQLFAYAMNFPIAKF  215

Query  444  LQSQSKIYVMASVSDVALVGHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVS  265
            LQ+QSKI VMA ++ V LV H +FSWL MLKL WGL G A+VLN +W  + VAQ VY+ S
Sbjct  216  LQAQSKIMVMAVIAAVVLVLHTVFSWLLMLKLGWGLVGAAIVLNASWVVIVVAQLVYIFS  275

Query  264  GACGDAWKGFSQRAFQNLTGFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTS  85
            G CG AW GFS +AF+NL GFVRLSLAS VM CLE+WYF+ALIL AGY KNAE+SVD  S
Sbjct  276  GTCGRAWTGFSWKAFENLWGFVRLSLASAVMLCLEVWYFMALILFAGYLKNAEISVDALS  335

Query  84   ICMNISGWTLMVGVGFSAAIS  22
            ICMNI GWTLM  +G +AAIS
Sbjct  336  ICMNILGWTLMEALGMNAAIS  356



>ref|XP_008340112.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Malus domestica]
Length=534

 Score =   424 bits (1091),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 205/304 (67%), Positives = 244/304 (80%), Gaps = 0/304 (0%)
 Frame = -1

Query  933  AGDIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHVGNIQLAAV  754
            AGDI  I   + F R+FY E+KKLWYLA PAIFT  SQYSIGAITQ+FAGHVG ++LA V
Sbjct  30   AGDIPPIVSFRGFSRQFYKETKKLWYLAGPAIFTSLSQYSIGAITQIFAGHVGTLELATV  89

Query  753  AVENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNATAIPLTTLY  574
            +VEN++IAGF+FG MYGMGSALETLCGQAFGA +L+MLG+Y+QRSW+ILNATA+ L+ LY
Sbjct  90   SVENSVIAGFSFGFMYGMGSALETLCGQAFGAGQLDMLGIYMQRSWVILNATAVLLSFLY  149

Query  573  IFSTPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYVMASVSDVA  394
            IF+  +LK++ Q   ISKA G FA+WMIPQLFAY   FP+ +FLQSQSKI VMA++S VA
Sbjct  150  IFAEQLLKMIGQPDDISKAAGQFAIWMIPQLFAYAMNFPLAKFLQSQSKIMVMAAISAVA  209

Query  393  LVGHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKGFSQRAFQN  214
            LV H LFSWL  LKL WGL G AVVLNT+WWF+ +AQ VY+ SG CG AW GFS +AF N
Sbjct  210  LVLHTLFSWLLTLKLGWGLXGAAVVLNTSWWFIVLAQLVYIFSGTCGRAWAGFSWKAFHN  269

Query  213  LTGFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGWTLMVGVGFS  34
            L  FV+LS+ASG+M CLE WYF+AL+L AGY KNA VSVDG SIC+NI GWT M  +G +
Sbjct  270  LWDFVKLSMASGIMLCLEXWYFMALVLFAGYLKNARVSVDGMSICLNIFGWTFMAALGMT  329

Query  33   AAIS  22
             AIS
Sbjct  330  TAIS  333



>ref|XP_008353026.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Malus domestica]
Length=534

 Score =   423 bits (1088),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 205/304 (67%), Positives = 243/304 (80%), Gaps = 0/304 (0%)
 Frame = -1

Query  933  AGDIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHVGNIQLAAV  754
            AGDI  I   + F R+FY E+KKLWYLA PAIFT  SQYSIGAITQ+FAGHVG ++LA V
Sbjct  30   AGDIPPIVSFRGFSRQFYKETKKLWYLAGPAIFTSLSQYSIGAITQIFAGHVGTLELATV  89

Query  753  AVENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNATAIPLTTLY  574
            +VEN++IAGF+FG MYGMGSALETLCGQAFGA +L+MLG+Y+QRSW+ILNATA+ L+ LY
Sbjct  90   SVENSVIAGFSFGFMYGMGSALETLCGQAFGAGQLDMLGIYMQRSWVILNATAVLLSFLY  149

Query  573  IFSTPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYVMASVSDVA  394
            IF+  +LK++ Q   ISKA G FA+WMIPQLFAY   FP+ +FLQSQSKI VMA++S VA
Sbjct  150  IFAEQLLKMIGQPDDISKAAGQFAIWMIPQLFAYAMNFPLAKFLQSQSKIMVMAAISAVA  209

Query  393  LVGHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKGFSQRAFQN  214
            LV H LFSWL  LKL WGL G AVVLNT+WWF+ +AQ VY+ SG CG AW GFS +AF N
Sbjct  210  LVLHTLFSWLLTLKLGWGLXGAAVVLNTSWWFIVLAQLVYIFSGTCGRAWAGFSWKAFHN  269

Query  213  LTGFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGWTLMVGVGFS  34
            L  FV+LS+ASG+M CLE WYF+AL+L AGY KNA VSVDG SIC NI GWT M  +G +
Sbjct  270  LWDFVKLSMASGIMLCLEXWYFMALVLFAGYLKNARVSVDGMSICXNIFGWTFMAALGMT  329

Query  33   AAIS  22
             AIS
Sbjct  330  TAIS  333



>gb|AHI48503.1| multidrug and toxic extrusion transporter [Vaccinium corymbosum]
Length=518

 Score =   422 bits (1086),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 206/306 (67%), Positives = 246/306 (80%), Gaps = 0/306 (0%)
 Frame = -1

Query  939  ADAGDIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHVGNIQLA  760
            ADA DI  I  V +F ++F  ES+KLWYLA PAIFT   QYS+GAITQ FAGHVG ++LA
Sbjct  39   ADADDITAIAGVGDFFKKFGVESRKLWYLAGPAIFTSVCQYSLGAITQTFAGHVGTLELA  98

Query  759  AVAVENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNATAIPLTT  580
            AV++EN++IAGF+FG++ GMGSALETLCGQAFGA +++MLG+Y+QRSW+ILN TA  +  
Sbjct  99   AVSIENSVIAGFSFGLLLGMGSALETLCGQAFGAGQVDMLGIYMQRSWVILNTTAFVMMF  158

Query  579  LYIFSTPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYVMASVSD  400
            LYIF+T +LKL+ Q   IS+A GTFAVWMIPQL+AY   FPI +FLQ+QSKI VMA ++ 
Sbjct  159  LYIFATQLLKLIGQTTEISEAAGTFAVWMIPQLYAYALNFPIAKFLQAQSKIMVMAVIAA  218

Query  399  VALVGHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKGFSQRAF  220
            V LV H LFSWL MLKL WGL G AVVLN +WWF+ +AQ VY+ SG CG AW GFS +AF
Sbjct  219  VVLVLHTLFSWLLMLKLGWGLVGAAVVLNASWWFIVIAQLVYIWSGTCGRAWAGFSLKAF  278

Query  219  QNLTGFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGWTLMVGVG  40
            QNL GFVRLSLAS VM CLE+WYF+ALIL AGY KNAEVSVD  SICMNI GWT+MV +G
Sbjct  279  QNLWGFVRLSLASAVMLCLEVWYFMALILFAGYLKNAEVSVDALSICMNILGWTVMVALG  338

Query  39   FSAAIS  22
             +AAIS
Sbjct  339  NNAAIS  344



>emb|CDP13215.1| unnamed protein product [Coffea canephora]
Length=520

 Score =   422 bits (1086),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 209/315 (66%), Positives = 245/315 (78%), Gaps = 0/315 (0%)
 Frame = -1

Query  966  NMSSVYSFDADAGDIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFA  787
            N+S   SF ADA DI  I  V++F REF  ESKKLWYLA PAIFT   QYS+GAITQ  A
Sbjct  34   NISFASSFVADADDIPPINGVRDFFREFTIESKKLWYLAGPAIFTSICQYSLGAITQTLA  93

Query  786  GHVGNIQLAAVAVENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIIL  607
            GH+G ++LAAV++EN++IAG +FGIM GMGSALETLCGQA+GA ++EMLGVY+QRSW+IL
Sbjct  94   GHLGTLELAAVSIENSVIAGLSFGIMLGMGSALETLCGQAYGAGQIEMLGVYMQRSWVIL  153

Query  606  NATAIPLTTLYIFSTPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSK  427
            N TA+ L  LYIF+   L+L+ Q   IS+A GT AVWMIPQLFAY   FPI +FLQSQSK
Sbjct  154  NTTALILMLLYIFAEAFLRLIGQTEDISRAAGTLAVWMIPQLFAYAANFPIAKFLQSQSK  213

Query  426  IYVMASVSDVALVGHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDA  247
            I VMA +S + LV H +FSWL MLK  WGL G AVVLN +WWF+ VAQ +Y+ SG CG A
Sbjct  214  IMVMAWISAIGLVLHSVFSWLLMLKFGWGLVGAAVVLNLSWWFIVVAQLLYIFSGTCGRA  273

Query  246  WKGFSQRAFQNLTGFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNIS  67
            W GFS +AFQNL GFVRLSLAS +M CLE WYF+ALIL AGY KNAEVSVD  SIC N+ 
Sbjct  274  WSGFSWKAFQNLWGFVRLSLASAIMLCLETWYFMALILFAGYLKNAEVSVDALSICTNLL  333

Query  66   GWTLMVGVGFSAAIS  22
            GWT+MV VG +AAIS
Sbjct  334  GWTVMVAVGCNAAIS  348



>ref|XP_010044581.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Eucalyptus grandis]
 gb|KCW86668.1| hypothetical protein EUGRSUZ_B03295 [Eucalyptus grandis]
Length=532

 Score =   422 bits (1086),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 204/321 (64%), Positives = 250/321 (78%), Gaps = 0/321 (0%)
 Frame = -1

Query  984  NTQIS*NMSSVYSFDADAGDIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGA  805
            N  +S  ++  ++F A A DI  IK  ++F+REF  ESKKLW+LA PAIFT   QYS+GA
Sbjct  36   NLPLSTTVNDAFTFTARADDIPPIKGPRDFVREFAKESKKLWFLAGPAIFTSICQYSLGA  95

Query  804  ITQVFAGHVGNIQLAAVAVENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQ  625
            ITQVFAGHVG + LAAV++EN++IAGF+FG+M GMGSALETLCGQA+GA +++MLG+Y+Q
Sbjct  96   ITQVFAGHVGTLALAAVSIENSVIAGFSFGVMLGMGSALETLCGQAYGAGQIDMLGIYMQ  155

Query  624  RSWIILNATAIPLTTLYIFSTPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRF  445
            RSW+ILN TA+ L  LYIF+  +L+L+ Q   IS+  G FAVWMIPQLFAY   FPI +F
Sbjct  156  RSWVILNTTAVALCLLYIFAAKLLRLIGQTEAISEEAGMFAVWMIPQLFAYAMNFPIAKF  215

Query  444  LQSQSKIYVMASVSDVALVGHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVS  265
            LQ+QSKI VMA ++ V LV H +FSWL MLKL WGL G A+VLN +W  + VAQ VY+ S
Sbjct  216  LQAQSKIMVMAVIAAVVLVLHTVFSWLLMLKLGWGLVGAAIVLNASWVVIVVAQLVYIFS  275

Query  264  GACGDAWKGFSQRAFQNLTGFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTS  85
            G CG AW GFS +AF+NL GFVRLSLAS VM CLE+WYF+ALIL AGY KNAE+SVD  S
Sbjct  276  GTCGRAWTGFSWKAFENLWGFVRLSLASAVMLCLEVWYFMALILFAGYLKNAEISVDALS  335

Query  84   ICMNISGWTLMVGVGFSAAIS  22
            ICMNI GWTLM  +G +AAIS
Sbjct  336  ICMNILGWTLMEALGMNAAIS  356



>ref|XP_010646476.1| PREDICTED: protein TRANSPARENT TESTA 12 [Vitis vinifera]
Length=509

 Score =   421 bits (1082),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 206/309 (67%), Positives = 248/309 (80%), Gaps = 0/309 (0%)
 Frame = -1

Query  948  SFDADAGDIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHVGNI  769
            +F+AD  DI  I  V++F +EF  ESKKLWYLA PAIFT   QYS+GAITQVFAGHVG +
Sbjct  29   TFNADESDIGPINGVRDFYKEFIVESKKLWYLAGPAIFTSLCQYSLGAITQVFAGHVGTL  88

Query  768  QLAAVAVENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNATAIP  589
            +LAAV+VEN++IAGF+FG+M GMGSALETLCGQAFGA +L+MLGVY+QRSW+IL +TA+ 
Sbjct  89   ELAAVSVENSVIAGFSFGVMLGMGSALETLCGQAFGAGQLDMLGVYMQRSWVILTSTAVL  148

Query  588  LTTLYIFSTPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYVMAS  409
            L+ LYIFS  +LKL+ Q   ISK  G FAVWM+PQLFAY   FP+ +FLQ+QSKI VMA 
Sbjct  149  LSFLYIFSARLLKLIGQTEAISKEAGMFAVWMLPQLFAYAVNFPLAKFLQAQSKIMVMAV  208

Query  408  VSDVALVGHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKGFSQ  229
            ++ V LV H +FSWL MLKL+WGL G AVVLN +W  + VAQ +Y+ SG CG AW GFS 
Sbjct  209  IAAVVLVLHTVFSWLLMLKLQWGLVGAAVVLNASWVLIDVAQLLYIFSGTCGRAWTGFSW  268

Query  228  RAFQNLTGFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGWTLMV  49
            +AFQ+L GFVRLSLAS VM CLE+WYF+ALIL AGY KNAE+SVD  SICMNI GWT+MV
Sbjct  269  KAFQSLWGFVRLSLASAVMLCLEVWYFMALILFAGYLKNAEISVDALSICMNILGWTVMV  328

Query  48   GVGFSAAIS  22
             +G +AAIS
Sbjct  329  ALGCNAAIS  337



>ref|XP_003551225.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Glycine max]
Length=509

 Score =   419 bits (1078),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 201/308 (65%), Positives = 244/308 (79%), Gaps = 0/308 (0%)
 Frame = -1

Query  945  FDADAGDIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHVGNIQ  766
            F A + DI  I    +F REF++ESKKLWYLA PAIFT   QYS+GA+TQVF+GHV  + 
Sbjct  25   FTAKSDDIAPIAGAGDFAREFFAESKKLWYLAGPAIFTSVCQYSLGAVTQVFSGHVSTLA  84

Query  765  LAAVAVENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNATAIPL  586
            LAA+++EN++IAGF  GI +GMGSALETLCGQA+GA ++ MLGVY+QRSW+ILNATAI L
Sbjct  85   LAAISIENSVIAGFCLGITFGMGSALETLCGQAYGAGQVHMLGVYMQRSWVILNATAILL  144

Query  585  TTLYIFSTPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYVMASV  406
            T LYIF+ P+L+ + Q   IS A G FAVWMIPQLFAY   +P Q+FLQ+QS+I VMA +
Sbjct  145  TLLYIFAAPLLRAIGQTEAISAAAGDFAVWMIPQLFAYAVNYPAQKFLQAQSRIMVMAWI  204

Query  405  SDVALVGHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKGFSQR  226
            +  ALV H +FSWL MLKLRWGL G AVVLN +WWF+ +AQ VY++ GACG+AW GF+ +
Sbjct  205  AAAALVLHTVFSWLLMLKLRWGLVGAAVVLNASWWFIDLAQLVYIMGGACGEAWSGFTFK  264

Query  225  AFQNLTGFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGWTLMVG  46
            AF NL GFVRLSLAS VM CLE+WYF+ALIL AGY KNAEVSVD  SICMNI GWT+MV 
Sbjct  265  AFHNLWGFVRLSLASAVMLCLEVWYFMALILFAGYLKNAEVSVDALSICMNILGWTIMVS  324

Query  45   VGFSAAIS  22
             G +AA+S
Sbjct  325  FGMNAAVS  332



>ref|XP_009359227.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Pyrus x bretschneideri]
Length=518

 Score =   419 bits (1077),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 201/304 (66%), Positives = 241/304 (79%), Gaps = 0/304 (0%)
 Frame = -1

Query  933  AGDIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHVGNIQLAAV  754
            AGDI  I   + F  +FY E+KKLWYLA PAIFT  SQYSIGAITQ+FAGHVG ++LA V
Sbjct  14   AGDIPPIVSFRGFSHQFYKETKKLWYLAGPAIFTSLSQYSIGAITQIFAGHVGTLELATV  73

Query  753  AVENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNATAIPLTTLY  574
            +VEN++IAGF+FG MYGMGSALETLCGQAFGA +L+MLG+Y+QRSW+ILNATA+ L+ LY
Sbjct  74   SVENSVIAGFSFGFMYGMGSALETLCGQAFGAGQLDMLGIYMQRSWVILNATAVLLSFLY  133

Query  573  IFSTPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYVMASVSDVA  394
             F+  +LK++ Q   ISKA G FA+WMIPQLFAY   FP+ +FLQSQSKI VMA++S  A
Sbjct  134  FFAEQLLKMIGQTDDISKAAGQFAIWMIPQLFAYAMNFPLAKFLQSQSKIMVMAAISAGA  193

Query  393  LVGHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKGFSQRAFQN  214
            LV H LFSWL M KL WGL G AVVLN +WWF+ +AQ +Y+ SG CG AW GFS +AF N
Sbjct  194  LVLHTLFSWLLMFKLGWGLVGAAVVLNASWWFIVLAQLIYIFSGTCGRAWVGFSLKAFHN  253

Query  213  LTGFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGWTLMVGVGFS  34
            L  FV+LS+ASG+M CLE WYF+AL+L AGY KNA VSVDG SIC+NI GWTLM  +G +
Sbjct  254  LWDFVKLSMASGIMLCLECWYFMALVLFAGYLKNARVSVDGMSICLNIFGWTLMAALGMT  313

Query  33   AAIS  22
             AIS
Sbjct  314  TAIS  317



>ref|XP_010251087.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Nelumbo nucifera]
Length=534

 Score =   419 bits (1078),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 208/315 (66%), Positives = 247/315 (78%), Gaps = 0/315 (0%)
 Frame = -1

Query  966  NMSSVYSFDADAGDIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFA  787
            N S   SF A+AGDI  I    +F REF  ES+KLW+LA PAIFT   QYS+GAITQVFA
Sbjct  50   NSSFGSSFTAEAGDIDPIINAGDFFREFGIESRKLWFLAGPAIFTSICQYSLGAITQVFA  109

Query  786  GHVGNIQLAAVAVENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIIL  607
            G VG + LAAV+VEN++IAGF+FG+M GMGSALETLCGQAFGA +L+MLG+Y+QRSW+IL
Sbjct  110  GQVGTLDLAAVSVENSVIAGFSFGVMLGMGSALETLCGQAFGAGQLDMLGIYMQRSWVIL  169

Query  606  NATAIPLTTLYIFSTPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSK  427
            N TAI L  LYIF+ P LKL+ +   I++A G+F+VWMIPQLFAY   FPI +FLQ+QSK
Sbjct  170  NTTAIVLCFLYIFAGPFLKLIGEQHQIAEAAGSFSVWMIPQLFAYAMNFPIAKFLQAQSK  229

Query  426  IYVMASVSDVALVGHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDA  247
            + VMA +S VAL+ H  FSWL ML+L WGL G AVVLN +W F+ VAQ VY+ SG CG A
Sbjct  230  MMVMAVISAVALILHTFFSWLLMLRLGWGLVGAAVVLNASWIFIVVAQLVYIFSGTCGRA  289

Query  246  WKGFSQRAFQNLTGFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNIS  67
            W GFS +AFQNL GFVRLSLAS VM CLE+WYF+ALIL AGY K+AEVSVD  SICMNI 
Sbjct  290  WSGFSMKAFQNLWGFVRLSLASAVMLCLEVWYFMALILFAGYLKDAEVSVDALSICMNIL  349

Query  66   GWTLMVGVGFSAAIS  22
            GW +MV +G +AAIS
Sbjct  350  GWAVMVALGCNAAIS  364



>ref|XP_008447003.1| PREDICTED: protein TRANSPARENT TESTA 12, partial [Cucumis melo]
Length=383

 Score =   414 bits (1063),  Expect = 6e-140, Method: Compositional matrix adjust.
 Identities = 199/308 (65%), Positives = 241/308 (78%), Gaps = 0/308 (0%)
 Frame = -1

Query  945  FDADAGDIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHVGNIQ  766
            F  DA DI  I   ++F REF  E KKLWYLAAPA+FT   QYS GAITQ+FAG V  I 
Sbjct  33   FAPDADDIPPINTTRDFYREFCIELKKLWYLAAPAVFTSVCQYSFGAITQLFAGQVSTIA  92

Query  765  LAAVAVENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNATAIPL  586
            LAAV+VEN++IAGF+FGIM GMGSALETLCGQA+GA +L+M+GVY+QRSW+IL  +A+ L
Sbjct  93   LAAVSVENSVIAGFSFGIMLGMGSALETLCGQAYGAGQLDMMGVYMQRSWVILVISAVVL  152

Query  585  TTLYIFSTPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYVMASV  406
            T +YIFS P+LKL+ Q   IS+A G  ++WMIPQL+AY   FPI +FLQ+QSK+  M+ +
Sbjct  153  TPVYIFSAPLLKLIGQTEEISEAAGVLSIWMIPQLYAYALNFPISKFLQAQSKMMAMSVI  212

Query  405  SDVALVGHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKGFSQR  226
            S VALV H  F+WLFMLKL WGL GGA+VLN +WW + +AQ VY++SG+CG AW GFS +
Sbjct  213  SAVALVFHTFFTWLFMLKLGWGLAGGAIVLNASWWVIDLAQIVYILSGSCGRAWSGFSWQ  272

Query  225  AFQNLTGFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGWTLMVG  46
            AF NL GFVRLSLAS VM CLE+WYF+ALIL AGY KNAEVS+D  SIC NI GWT+MV 
Sbjct  273  AFHNLWGFVRLSLASAVMLCLEIWYFMALILFAGYLKNAEVSIDALSICTNILGWTVMVA  332

Query  45   VGFSAAIS  22
             G +AAIS
Sbjct  333  FGINAAIS  340



>ref|XP_007153779.1| hypothetical protein PHAVU_003G064300g [Phaseolus vulgaris]
 gb|ESW25773.1| hypothetical protein PHAVU_003G064300g [Phaseolus vulgaris]
Length=507

 Score =   417 bits (1071),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 202/308 (66%), Positives = 241/308 (78%), Gaps = 0/308 (0%)
 Frame = -1

Query  945  FDADAGDIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHVGNIQ  766
            F A + DI  I    +F REF  ESKKLWYLA PA+FT   QYS+GAITQVF+GHV  I 
Sbjct  27   FTAQSDDIAPIAGAADFAREFLVESKKLWYLAGPAMFTSVCQYSLGAITQVFSGHVSTIA  86

Query  765  LAAVAVENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNATAIPL  586
            LAAV+VEN++IAGF  GI +GMGSALETLCGQA+GA ++ MLGVY+QRSW+ILNATAI L
Sbjct  87   LAAVSVENSVIAGFCLGITFGMGSALETLCGQAYGAGQVHMLGVYMQRSWVILNATAILL  146

Query  585  TTLYIFSTPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYVMASV  406
            T LYIF+ P+L+ + Q   IS + G FA+WMIPQLFAY   +P+Q+FLQSQS+I VMA +
Sbjct  147  TLLYIFAGPLLRAIGQTAAISASAGEFAIWMIPQLFAYAMNYPMQKFLQSQSRIMVMAWI  206

Query  405  SDVALVGHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKGFSQR  226
            +  ALV H++FSWL ML L WGL G AVVLN +WWF+ V QF Y++SG CG+AW GFS +
Sbjct  207  AAAALVLHIVFSWLLMLHLGWGLVGAAVVLNASWWFIDVGQFAYILSGTCGEAWSGFSLK  266

Query  225  AFQNLTGFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGWTLMVG  46
            AF NL GFVRLSLAS VM CLE+WYF+ALIL AGY KNAEVSVD  SICMNI GWT+MV 
Sbjct  267  AFHNLWGFVRLSLASAVMLCLEVWYFMALILFAGYLKNAEVSVDALSICMNILGWTIMVS  326

Query  45   VGFSAAIS  22
             G +AA+S
Sbjct  327  FGLNAAVS  334



>ref|XP_009765840.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Nicotiana sylvestris]
Length=495

 Score =   415 bits (1066),  Expect = 8e-139, Method: Compositional matrix adjust.
 Identities = 199/309 (64%), Positives = 244/309 (79%), Gaps = 0/309 (0%)
 Frame = -1

Query  948  SFDADAGDIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHVGNI  769
            SF AD+ DI  I  +++F REF  ESKKLWYLA PAIFT   QYS+GA+TQ FAGHVG +
Sbjct  37   SFVADSDDIPPITGIQDFFREFSVESKKLWYLAGPAIFTSLCQYSLGAVTQTFAGHVGTL  96

Query  768  QLAAVAVENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNATAIP  589
            +LAAV+VEN++IAGF+FG+M GMGSALETLCGQAFGA ++++LGVY+QRSW+ILN TA+ 
Sbjct  97   ELAAVSVENSVIAGFSFGVMLGMGSALETLCGQAFGAGQIDLLGVYMQRSWVILNTTAVI  156

Query  588  LTTLYIFSTPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYVMAS  409
            L   YIF+ P L+L+ Q   IS+  G  A++MIPQL+AY   FPI +FLQSQSKI VMA 
Sbjct  157  LMLFYIFAAPFLRLIGQTEDISREAGKMALYMIPQLYAYAMNFPIAKFLQSQSKIMVMAW  216

Query  408  VSDVALVGHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKGFSQ  229
            ++ +ALV H  FSWLFMLKL WGL G AVVLN++WWF+ VAQ +Y+ +G CG AW GFS 
Sbjct  217  IAAIALVLHSFFSWLFMLKLGWGLVGAAVVLNSSWWFIVVAQLLYIFNGTCGQAWSGFSW  276

Query  228  RAFQNLTGFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGWTLMV  49
            +AF NL GFVRLSLAS VM CLE+WYF+AL+L AGY KNAEV+VD  SICMNI GW +M 
Sbjct  277  KAFHNLWGFVRLSLASAVMLCLEVWYFMALVLFAGYLKNAEVAVDALSICMNILGWAVMA  336

Query  48   GVGFSAAIS  22
             +G +AAIS
Sbjct  337  AIGCNAAIS  345



>ref|XP_006357608.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Solanum tuberosum]
Length=514

 Score =   414 bits (1063),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 201/309 (65%), Positives = 243/309 (79%), Gaps = 0/309 (0%)
 Frame = -1

Query  948  SFDADAGDIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHVGNI  769
            SF ADA DI  I  +++F REF  ESKKLWYLA PAIFT   QYS+GA+TQ FAGH+G +
Sbjct  37   SFVADADDIPPITGIQDFFREFTVESKKLWYLAGPAIFTSICQYSLGAVTQTFAGHLGTL  96

Query  768  QLAAVAVENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNATAIP  589
            +LAAV+VEN++IAGF+FG+M GMGSALETLCGQAFGA +++MLGVY+QRSW+ILN+TA+ 
Sbjct  97   ELAAVSVENSVIAGFSFGVMLGMGSALETLCGQAFGAGQIDMLGVYMQRSWVILNSTAVI  156

Query  588  LTTLYIFSTPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYVMAS  409
            L  LYIF+   L+L+ Q   IS+  G  A++MIPQLFAY   FPI +FLQSQSKI VMA 
Sbjct  157  LMFLYIFAAQFLRLIGQTEDISREAGKMALYMIPQLFAYAMNFPIAKFLQSQSKIMVMAW  216

Query  408  VSDVALVGHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKGFSQ  229
            ++ +ALV H  FSWL MLKL WGL G AVVLN++WWF+ VAQ +Y+ SG CG AW GFS 
Sbjct  217  IAAIALVFHTFFSWLLMLKLGWGLVGAAVVLNSSWWFIVVAQMLYIFSGTCGQAWSGFSW  276

Query  228  RAFQNLTGFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGWTLMV  49
            +AF NL GFVRLSLAS VM CLE WYF+AL+L AGY KNAEV+VD  SICMNI GW +M 
Sbjct  277  KAFVNLWGFVRLSLASAVMLCLETWYFMALVLFAGYLKNAEVAVDALSICMNILGWAVMA  336

Query  48   GVGFSAAIS  22
             +G +AAIS
Sbjct  337  AIGCNAAIS  345



>ref|XP_006586536.1| PREDICTED: protein TRANSPARENT TESTA 12-like, partial [Glycine 
max]
Length=350

 Score =   407 bits (1047),  Expect = 6e-138, Method: Compositional matrix adjust.
 Identities = 198/313 (63%), Positives = 243/313 (78%), Gaps = 0/313 (0%)
 Frame = -1

Query  960  SSVYSFDADAGDIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGH  781
            SS   F A + DI  I    +F REF++ESKKLWYLA PAIFT   QYS+G +TQVF+ H
Sbjct  21   SSAVVFTATSDDIAPIGGAGDFAREFFAESKKLWYLAGPAIFTSVCQYSLGGVTQVFSVH  80

Query  780  VGNIQLAAVAVENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNA  601
            V  + LAAV+VEN++IAGF+ GI +GMGSALETLCGQA+GA ++ MLGVY+QRSW+ILNA
Sbjct  81   VNTLALAAVSVENSVIAGFSLGITFGMGSALETLCGQAYGAGQVHMLGVYMQRSWVILNA  140

Query  600  TAIPLTTLYIFSTPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIY  421
            TAI L+ LYIF+  +L+ + Q   IS A G FA+WMIPQLFAY   +P Q+FLQ+QS+I 
Sbjct  141  TAILLSLLYIFAGHMLRAIGQTEAISAAAGEFALWMIPQLFAYAVNYPAQKFLQAQSRIM  200

Query  420  VMASVSDVALVGHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWK  241
            VMA ++  ALV H LFSWL +L+  WGL G AVVLN +WWF+ +AQ VY+VSGACG+AW 
Sbjct  201  VMAWIAAAALVLHTLFSWLLILEFGWGLVGAAVVLNASWWFIDIAQLVYIVSGACGEAWS  260

Query  240  GFSQRAFQNLTGFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGW  61
            GF+ +AF NL GFVRLSLAS VM CLE+WYF+AL+L AGY KNAEVSVD  SICMNI GW
Sbjct  261  GFTFKAFHNLWGFVRLSLASAVMLCLEVWYFMALVLFAGYLKNAEVSVDALSICMNILGW  320

Query  60   TLMVGVGFSAAIS  22
            T+MV  G +AA+S
Sbjct  321  TIMVSFGMNAAVS  333



>ref|XP_006306102.1| hypothetical protein CARUB_v10011529mg [Capsella rubella]
 gb|EOA39000.1| hypothetical protein CARUB_v10011529mg [Capsella rubella]
Length=519

 Score =   412 bits (1060),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 203/313 (65%), Positives = 242/313 (77%), Gaps = 0/313 (0%)
 Frame = -1

Query  960  SSVYSFDADAGDIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGH  781
            SS+ SF + A DI  I  V +F+REF  ESKKLW LA PAIFT  SQYS+GA+TQVFAGH
Sbjct  37   SSLVSFSSTAVDIPPISNVGDFVREFRIESKKLWKLAGPAIFTSMSQYSLGAVTQVFAGH  96

Query  780  VGNIQLAAVAVENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNA  601
            +  I LAAV++EN++IAGF+FGIM GMGSALETLCGQAFGA K+ MLGVYLQRSW+IL+ 
Sbjct  97   ISTIALAAVSIENSVIAGFSFGIMLGMGSALETLCGQAFGAGKVSMLGVYLQRSWVILSV  156

Query  600  TAIPLTTLYIFSTPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIY  421
            TA+ L+ LYIF+ PIL  + Q   IS A G F+++MIPQ+FAY   FP  +FLQSQSKI 
Sbjct  157  TALFLSLLYIFAAPILTFIGQTAAISAAAGIFSIYMIPQIFAYAINFPTAKFLQSQSKIM  216

Query  420  VMASVSDVALVGHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWK  241
            VMA +S V LV H  F+WL M +L WGLPG A+VLNT+WWF+ VAQ VY+ SG CG+AW 
Sbjct  217  VMAGISGVVLVIHSFFTWLVMSRLHWGLPGLALVLNTSWWFIVVAQLVYIFSGTCGEAWS  276

Query  240  GFSQRAFQNLTGFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGW  61
            GF+  AF NL GFV+LSLAS VM CLE+WYF+AL+L AGY KNAEVSV   SICMNI GW
Sbjct  277  GFTWEAFHNLWGFVKLSLASAVMLCLEIWYFMALVLFAGYLKNAEVSVAALSICMNILGW  336

Query  60   TLMVGVGFSAAIS  22
              MV VG +AA+S
Sbjct  337  AAMVSVGTNAAVS  349



>ref|XP_009629826.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Nicotiana tomentosiformis]
Length=505

 Score =   412 bits (1058),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 195/313 (62%), Positives = 245/313 (78%), Gaps = 0/313 (0%)
 Frame = -1

Query  960  SSVYSFDADAGDIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGH  781
            +S  SF A+A DI  I  +++F REF+ ESKKLWYLA PAIFT   +YS+GA+TQ FAGH
Sbjct  21   TSASSFVANADDIPHITGIQDFFREFFVESKKLWYLAGPAIFTSLCRYSLGAVTQTFAGH  80

Query  780  VGNIQLAAVAVENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNA  601
            +G ++LAAV+VEN++IAGF+FG+M GMGSALETLCGQAFGA +++MLGVY+QRSW+ILN 
Sbjct  81   LGTLELAAVSVENSVIAGFSFGVMLGMGSALETLCGQAFGAGQIDMLGVYMQRSWVILNT  140

Query  600  TAIPLTTLYIFSTPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIY  421
             A+ L  LYIF+ P L+L+ Q   IS+  G  A++MIPQL+AY   FPI +FLQ+QSKI 
Sbjct  141  AAVILMLLYIFAAPFLRLIGQTEDISREAGKMALYMIPQLYAYAMNFPIAKFLQAQSKIM  200

Query  420  VMASVSDVALVGHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWK  241
            VMA ++ +ALV H  FSWLFMLKL WGL G AVVLN++WWF+ VAQ +Y+ SG CG AW 
Sbjct  201  VMAWIAAIALVLHTFFSWLFMLKLGWGLVGAAVVLNSSWWFIVVAQLLYIFSGTCGQAWS  260

Query  240  GFSQRAFQNLTGFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGW  61
            GFS +AF NL GFV+LSLAS VM CLE WYF+AL+L AGY KNAE++VD  SIC NI GW
Sbjct  261  GFSWKAFHNLWGFVKLSLASAVMLCLETWYFMALVLFAGYLKNAEIAVDALSICTNILGW  320

Query  60   TLMVGVGFSAAIS  22
             +M  +G +AA+S
Sbjct  321  AVMAAIGCNAAVS  333



>ref|XP_009359346.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Pyrus x bretschneideri]
Length=513

 Score =   412 bits (1058),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 200/304 (66%), Positives = 241/304 (79%), Gaps = 0/304 (0%)
 Frame = -1

Query  933  AGDIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHVGNIQLAAV  754
            AGDI  I   ++F R FY E+K LWYLA PAIFT  SQYSI AITQ+FAGHVG ++LA V
Sbjct  14   AGDIPPILSFRDFSRLFYRETKTLWYLAGPAIFTSLSQYSIAAITQIFAGHVGILELATV  73

Query  753  AVENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNATAIPLTTLY  574
            +V N++I GF+FG+M GMGSALETLCGQAFGA +L+MLG+Y+QRSW+ILNATA+ L+  +
Sbjct  74   SVANSVITGFSFGVMLGMGSALETLCGQAFGAGRLDMLGIYMQRSWVILNATAVLLSFFH  133

Query  573  IFSTPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYVMASVSDVA  394
            IF+  +LKL+ Q   ISKA G FA+WMIPQLFAY   FP+ +FLQSQSKI VMA+VS VA
Sbjct  134  IFAQQLLKLIGQPDDISKAAGQFAIWMIPQLFAYAMNFPLAKFLQSQSKIMVMAAVSAVA  193

Query  393  LVGHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKGFSQRAFQN  214
            LV H LFSWL MLKL WGL G AVV N +WWF+ +AQ VY+ SG CG AW GFS +AF N
Sbjct  194  LVLHTLFSWLLMLKLGWGLAGAAVVFNASWWFIVLAQLVYIFSGTCGRAWVGFSWKAFHN  253

Query  213  LTGFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGWTLMVGVGFS  34
            L GFV+LS+ASG+M CLE WYF+AL+L AGY KNA+V+VDG SIC++ISGWT MV  G +
Sbjct  254  LWGFVKLSVASGIMICLEYWYFMALVLFAGYLKNAKVAVDGLSICVSISGWTFMVAFGMN  313

Query  33   AAIS  22
             AIS
Sbjct  314  TAIS  317



>ref|XP_002311767.2| hypothetical protein POPTR_0008s19130g [Populus trichocarpa]
 gb|EEE89134.2| hypothetical protein POPTR_0008s19130g [Populus trichocarpa]
Length=503

 Score =   411 bits (1056),  Expect = 3e-137, Method: Compositional matrix adjust.
 Identities = 205/315 (65%), Positives = 248/315 (79%), Gaps = 0/315 (0%)
 Frame = -1

Query  966  NMSSVYSFDADAGDIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFA  787
            N S   SF  D  DI  I  V++F REF+ ESKKLWYLA PAIFT   QYS+GAITQ+ A
Sbjct  26   NSSIASSFTPDPDDIPLINSVRDFSREFFRESKKLWYLAGPAIFTTLCQYSLGAITQLLA  85

Query  786  GHVGNIQLAAVAVENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIIL  607
            GHVG + LAAV+VEN++IAGF+FGIM GMGSALETLCGQA+GA +L+MLG+Y+QRSW+IL
Sbjct  86   GHVGKLDLAAVSVENSVIAGFSFGIMLGMGSALETLCGQAYGAGQLDMLGLYMQRSWVIL  145

Query  606  NATAIPLTTLYIFSTPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSK  427
            NATA+ LT LYIF+ P LKL+ Q   IS+A G F+VWMIPQLFAY   FPI +FLQ+QSK
Sbjct  146  NATAVILTLLYIFAGPFLKLIGQTAEISQAAGMFSVWMIPQLFAYAMNFPIAKFLQAQSK  205

Query  426  IYVMASVSDVALVGHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDA  247
            +  MA+++ VA+V H +FSWL MLKL WGL G AVVLN +WWF+ +AQ +Y+ SG CG+A
Sbjct  206  MMAMAAIAAVAIVFHAVFSWLLMLKLGWGLVGAAVVLNASWWFIVIAQLLYIFSGTCGEA  265

Query  246  WKGFSQRAFQNLTGFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNIS  67
            W G S +AFQNL GFVRLSLAS VM CLE+WYF+ALIL AGY KNAE++VD  SI  NI 
Sbjct  266  WTGLSWKAFQNLWGFVRLSLASAVMLCLEVWYFMALILFAGYLKNAELAVDALSISTNIV  325

Query  66   GWTLMVGVGFSAAIS  22
            GW LM+ +G +AAIS
Sbjct  326  GWALMIAIGINAAIS  340



>ref|XP_004135268.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Cucumis sativus]
 gb|KGN51764.1| hypothetical protein Csa_5G598720 [Cucumis sativus]
Length=504

 Score =   411 bits (1056),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 200/308 (65%), Positives = 239/308 (78%), Gaps = 0/308 (0%)
 Frame = -1

Query  945  FDADAGDIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHVGNIQ  766
            F  DA DI  I   ++F REF  E KKLWYLAAPA+FT   QYS GAITQ+FAG V  I 
Sbjct  32   FAPDADDIPPINTARDFYREFCIELKKLWYLAAPAVFTSICQYSFGAITQLFAGQVSTIA  91

Query  765  LAAVAVENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNATAIPL  586
            LAAV+VEN++IAGF+FGIM GMGSALETLCGQA+GA +L M+GVYLQRSW+IL  TA+ L
Sbjct  92   LAAVSVENSVIAGFSFGIMLGMGSALETLCGQAYGAGQLGMMGVYLQRSWVILLTTAVVL  151

Query  585  TTLYIFSTPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYVMASV  406
            T +YIFS P+LKL+ Q   IS+A G  ++WMIPQL+AY   FP+ +FLQ+QSK+  M+ +
Sbjct  152  TPIYIFSAPLLKLIGQTAEISEAAGVLSIWMIPQLYAYALNFPVSKFLQAQSKMMAMSVI  211

Query  405  SDVALVGHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKGFSQR  226
            S VALV H  F+WLFMLKL WGL GGA+VLN +WW +  AQ VY++SG+CG AW GFS +
Sbjct  212  SAVALVFHTFFTWLFMLKLGWGLAGGAIVLNASWWVIDFAQIVYILSGSCGRAWSGFSWQ  271

Query  225  AFQNLTGFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGWTLMVG  46
            AF NL GFVRLSLAS VM CLE+WYF+ALIL AGY KNAEVS+D  SIC NI GWT+MV 
Sbjct  272  AFHNLWGFVRLSLASAVMLCLEIWYFMALILFAGYLKNAEVSIDALSICTNILGWTVMVA  331

Query  45   VGFSAAIS  22
             G +AAIS
Sbjct  332  FGINAAIS  339



>ref|XP_007222487.1| hypothetical protein PRUPE_ppa004113mg [Prunus persica]
 gb|EMJ23686.1| hypothetical protein PRUPE_ppa004113mg [Prunus persica]
Length=529

 Score =   411 bits (1057),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 205/309 (66%), Positives = 248/309 (80%), Gaps = 0/309 (0%)
 Frame = -1

Query  948  SFDADAGDIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHVGNI  769
            SF  DA DI  I   ++F REFY E+KKLWYLA PAIFT   QYS+GAITQVFAG VG +
Sbjct  43   SFTPDADDIPPILSFRDFFREFYKETKKLWYLAGPAIFTSLCQYSLGAITQVFAGQVGTL  102

Query  768  QLAAVAVENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNATAIP  589
            +LAAV++EN++IAGF+FG+M GMGSALETLCGQAFGA +L+MLG+Y+QRSW+ILN T + 
Sbjct  103  ELAAVSIENSVIAGFSFGVMLGMGSALETLCGQAFGAGQLDMLGIYMQRSWVILNTTGVL  162

Query  588  LTTLYIFSTPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYVMAS  409
            L  LYIF+  +L+L+ Q   ISKA G FA+WMIPQLFAY   FPI +FLQ+QSKI VMA+
Sbjct  163  LCFLYIFAQQLLRLIGQTAEISKAAGVFAIWMIPQLFAYAMNFPIAKFLQAQSKIMVMAA  222

Query  408  VSDVALVGHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKGFSQ  229
            ++ VALV H +FSWL MLKL W L GGAVVLN +WWF+ +AQ +Y+ SG CG AW GFS 
Sbjct  223  IAAVALVLHTVFSWLLMLKLGWALVGGAVVLNVSWWFIVLAQLIYIFSGTCGRAWVGFSW  282

Query  228  RAFQNLTGFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGWTLMV  49
            +AFQNL  FV+LSLAS +M CLE+WYF+ALIL AGY KNAEVSVDG SICMNI GWT+M+
Sbjct  283  KAFQNLWSFVKLSLASAIMLCLEVWYFMALILFAGYLKNAEVSVDGLSICMNILGWTVMI  342

Query  48   GVGFSAAIS  22
             +G +AAIS
Sbjct  343  AMGMNAAIS  351



>gb|KDP26652.1| hypothetical protein JCGZ_17810 [Jatropha curcas]
Length=512

 Score =   410 bits (1055),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 206/309 (67%), Positives = 247/309 (80%), Gaps = 0/309 (0%)
 Frame = -1

Query  948  SFDADAGDIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHVGNI  769
            SF  DA DI  IK V +F REFY ESKKLWYLA PAIFT   QYS+GAITQVF+G VG +
Sbjct  28   SFVPDADDIPPIKDVGDFFREFYRESKKLWYLAGPAIFTSICQYSLGAITQVFSGQVGTL  87

Query  768  QLAAVAVENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNATAIP  589
            +LAAV+VEN++IAGF+FG+M GMGSALETLCGQAFGA +L+MLG+YLQRSW+IL  TA  
Sbjct  88   ELAAVSVENSVIAGFSFGVMLGMGSALETLCGQAFGAGQLDMLGIYLQRSWVILGTTASL  147

Query  588  LTTLYIFSTPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYVMAS  409
            L  LY+F+  +LKL+ Q   ISK  G F++WMIPQLFAY   FP+ +FLQ+QSKI VMA 
Sbjct  148  LCLLYVFAAQLLKLIGQTAAISKTAGIFSIWMIPQLFAYAMNFPMAKFLQAQSKIMVMAV  207

Query  408  VSDVALVGHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKGFSQ  229
            ++  ALV H +FSWL MLKL WGL G AVVL+ +WWF+ ++QF+Y++SG CG AW GFS 
Sbjct  208  IAAAALVLHTVFSWLLMLKLGWGLVGAAVVLDASWWFIDLSQFLYIISGTCGRAWNGFSW  267

Query  228  RAFQNLTGFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGWTLMV  49
            +AFQN+ GFVRLSLAS VM CLE+WYF+ALIL AGY KNAEVSVD  SICMNI GWT+MV
Sbjct  268  KAFQNVWGFVRLSLASAVMLCLEVWYFMALILFAGYLKNAEVSVDALSICMNILGWTIMV  327

Query  48   GVGFSAAIS  22
             +G +AAIS
Sbjct  328  ALGVNAAIS  336



>ref|XP_008221919.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Prunus mume]
Length=529

 Score =   411 bits (1056),  Expect = 7e-137, Method: Compositional matrix adjust.
 Identities = 205/313 (65%), Positives = 249/313 (80%), Gaps = 0/313 (0%)
 Frame = -1

Query  960  SSVYSFDADAGDIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGH  781
            +S  SF  DA DI  I   ++F REFY E+KKLWYLA PAIFT   QYS+GA+TQVFAG 
Sbjct  39   NSNASFAPDADDISPILGFRDFFREFYKETKKLWYLAGPAIFTSLCQYSLGAVTQVFAGQ  98

Query  780  VGNIQLAAVAVENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNA  601
            VG ++LAAV++EN++IAGF+FG+M GMGSALETLCGQAFGA +L+MLG+Y+QRSW+ILN 
Sbjct  99   VGTLELAAVSIENSVIAGFSFGVMLGMGSALETLCGQAFGAGQLDMLGIYMQRSWVILNT  158

Query  600  TAIPLTTLYIFSTPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIY  421
            T + L  LYIF+  +L+L+ Q   ISKA G FA+WMIPQLFAY   FPI +FLQ+QSKI 
Sbjct  159  TGVVLCFLYIFAQQLLRLIGQTADISKAAGVFAIWMIPQLFAYAMNFPIAKFLQAQSKIM  218

Query  420  VMASVSDVALVGHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWK  241
            VMA+++  ALV H +FSWL MLKL WGL GGAVVLN +WW + +AQ VY+ SG CG AW 
Sbjct  219  VMAAIAAAALVLHTVFSWLLMLKLGWGLVGGAVVLNVSWWLIVLAQLVYIFSGTCGRAWV  278

Query  240  GFSQRAFQNLTGFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGW  61
            GFS +AFQNL  FV+LSLAS +M CLE+WYF+ALIL AGY KNAEVSVDG SICMNI GW
Sbjct  279  GFSWKAFQNLWSFVKLSLASAIMLCLEVWYFMALILFAGYLKNAEVSVDGLSICMNILGW  338

Query  60   TLMVGVGFSAAIS  22
            T+M+ +G +AAIS
Sbjct  339  TVMIAMGMNAAIS  351



>ref|XP_004239125.2| PREDICTED: protein TRANSPARENT TESTA 12-like [Solanum lycopersicum]
Length=515

 Score =   410 bits (1054),  Expect = 9e-137, Method: Compositional matrix adjust.
 Identities = 199/309 (64%), Positives = 242/309 (78%), Gaps = 0/309 (0%)
 Frame = -1

Query  948  SFDADAGDIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHVGNI  769
            SF AD  DI  I  +++F REF  ESKKLWYLA PAIFT   QYS+GA+TQ FAGH+G +
Sbjct  38   SFVADVDDIPPIIGIQDFCREFSVESKKLWYLAGPAIFTSICQYSLGAVTQTFAGHLGTL  97

Query  768  QLAAVAVENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNATAIP  589
            QLAAV+VEN++IAGF+FG+M GMGSALETLCGQAFGA +++MLGVY+QRSW+ILN+TA+ 
Sbjct  98   QLAAVSVENSVIAGFSFGVMLGMGSALETLCGQAFGAGQIDMLGVYMQRSWVILNSTAVI  157

Query  588  LTTLYIFSTPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYVMAS  409
            L  LYIF+   L+L+ Q   IS+  G  A++MIPQLFAY   FPI +FLQSQSK+ VMA 
Sbjct  158  LMLLYIFAAQFLRLIGQTEDISREAGKMALYMIPQLFAYAMNFPIAKFLQSQSKMMVMAW  217

Query  408  VSDVALVGHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKGFSQ  229
            ++ +ALV H  FSWL MLKL WGL G AVVLN++WWF+ VAQ +Y+ SG CG AW GF+ 
Sbjct  218  IAAIALVFHTFFSWLLMLKLGWGLVGAAVVLNSSWWFIVVAQMLYIFSGTCGQAWSGFTW  277

Query  228  RAFQNLTGFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGWTLMV  49
            +AF NL GFVRLSLAS VM CLE WYF+AL+L AGY KNAEV+VD  SICMNI GW +M 
Sbjct  278  KAFLNLWGFVRLSLASAVMLCLETWYFMALVLFAGYLKNAEVAVDALSICMNILGWAVMA  337

Query  48   GVGFSAAIS  22
             +G +AAIS
Sbjct  338  AIGCNAAIS  346



>ref|XP_010100393.1| Protein TRANSPARENT TESTA 12 [Morus notabilis]
 gb|EXB82527.1| Protein TRANSPARENT TESTA 12 [Morus notabilis]
Length=577

 Score =   412 bits (1058),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 200/309 (65%), Positives = 238/309 (77%), Gaps = 0/309 (0%)
 Frame = -1

Query  948  SFDADAGDIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHVGNI  769
            SF   A DI  I  V++F REF +ESK+LWYLA PAIFT   QYS+GA+TQVFAG V  +
Sbjct  31   SFTPGADDIPPIGGVRDFYREFCAESKRLWYLAGPAIFTTICQYSLGAVTQVFAGQVDTL  90

Query  768  QLAAVAVENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNATAIP  589
             LAA +VEN++IAGF+FG+M GMGSALETLCGQAFGA +L+MLG+Y+QRSW+ILN   + 
Sbjct  91   SLAAFSVENSVIAGFSFGVMLGMGSALETLCGQAFGAGQLDMLGIYMQRSWVILNGMGLV  150

Query  588  LTTLYIFSTPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYVMAS  409
            L  LYIF+  +LKL+ Q   IS+A G  A+WMIPQLFAY   FPI +FLQ+QSK+  MA 
Sbjct  151  LLFLYIFAERLLKLIGQTTEISEAAGELAIWMIPQLFAYAVNFPIAKFLQAQSKMAAMAW  210

Query  408  VSDVALVGHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKGFSQ  229
            ++ V LV H  FSWL MLKL WGL GGAVVLN +WWF+ VAQ VY+ SG CG AW GFS 
Sbjct  211  IAAVVLVLHTFFSWLLMLKLGWGLAGGAVVLNASWWFIVVAQLVYIFSGTCGRAWSGFSW  270

Query  228  RAFQNLTGFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGWTLMV  49
            +AFQNL GFVRLSL S VM CLE WYF+AL+L AGY KNAE+SVD  SICMNI GWT+MV
Sbjct  271  KAFQNLWGFVRLSLESAVMLCLETWYFMALVLFAGYLKNAEISVDALSICMNILGWTVMV  330

Query  48   GVGFSAAIS  22
             +G +AAIS
Sbjct  331  AIGINAAIS  339



>ref|XP_010458735.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Camelina sativa]
Length=519

 Score =   409 bits (1052),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 200/313 (64%), Positives = 242/313 (77%), Gaps = 0/313 (0%)
 Frame = -1

Query  960  SSVYSFDADAGDIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGH  781
            SS+ SF + A DI  I  V +F+REF  ESKKLW LA PAIFT  SQYS+GA+TQVFAGH
Sbjct  37   SSLVSFSSTAVDIPPISNVGDFVREFRIESKKLWKLAGPAIFTSMSQYSLGAVTQVFAGH  96

Query  780  VGNIQLAAVAVENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNA  601
            +  I LAAV++EN++IAGF+FGIM GMGSALETLCGQAFGA K+ MLGVYLQRSW+IL  
Sbjct  97   ISTIALAAVSIENSVIAGFSFGIMLGMGSALETLCGQAFGAGKVSMLGVYLQRSWVILGV  156

Query  600  TAIPLTTLYIFSTPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIY  421
            TA+ L+ LYIF+ PIL  + Q   IS A G F+++MIPQ+FAY   FP  +FLQSQSKI 
Sbjct  157  TALFLSLLYIFAAPILAFIGQTAAISAAAGIFSIYMIPQIFAYAVNFPTAKFLQSQSKIM  216

Query  420  VMASVSDVALVGHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWK  241
            VMA+++ V LV H  F+WL M +L WGLPG A+VLNT+WWF+ VAQ VY+ +G CG+AW 
Sbjct  217  VMAAIAGVVLVFHSFFTWLVMCRLNWGLPGLALVLNTSWWFIVVAQLVYIFNGTCGEAWS  276

Query  240  GFSQRAFQNLTGFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGW  61
            GF+  AF NL GFV+LSLAS VM CLE+WYF+AL+L AGY KNAEVSV   SICMNI GW
Sbjct  277  GFTWEAFHNLWGFVKLSLASAVMLCLEIWYFMALVLFAGYLKNAEVSVAALSICMNILGW  336

Query  60   TLMVGVGFSAAIS  22
              MV +G +AA+S
Sbjct  337  AAMVSIGTNAAVS  349



>ref|XP_010905904.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Elaeis guineensis]
Length=513

 Score =   409 bits (1050),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 195/305 (64%), Positives = 240/305 (79%), Gaps = 0/305 (0%)
 Frame = -1

Query  936  DAGDIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHVGNIQLAA  757
            D GDI  I   ++F +EF  ESKKLWYLA PAIFT   QYS+GAITQ+FAGHVG ++LAA
Sbjct  40   DLGDIGSISGPRDFWKEFVVESKKLWYLAGPAIFTSLCQYSLGAITQMFAGHVGTLELAA  99

Query  756  VAVENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNATAIPLTTL  577
            V+VEN++I GF+FG+M GMGSALETLCGQA+GA +L+M+GVY+QRSW+ILN TA+ L+ L
Sbjct  100  VSVENSVIGGFSFGVMLGMGSALETLCGQAYGAGQLDMMGVYMQRSWVILNTTALLLSLL  159

Query  576  YIFSTPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYVMASVSDV  397
            Y+F+  +L+L+ Q   I+ A GTF+VWMIPQLFAY   FPI +FLQ+QS++  MA VS V
Sbjct  160  YVFARALLRLIGQTEEIAAAAGTFSVWMIPQLFAYAMNFPIAKFLQAQSRMMAMAVVSTV  219

Query  396  ALVGHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKGFSQRAFQ  217
            AL+ H LFSWL ML+L WGL G AVVLN +WWF+ + Q  Y+  GACG AW GFS +AF 
Sbjct  220  ALLLHTLFSWLLMLRLEWGLVGAAVVLNASWWFIVLGQLAYIFGGACGRAWSGFSLKAFV  279

Query  216  NLTGFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGWTLMVGVGF  37
            NL GFVRLSLAS VM CLE+WYF+ALIL AGY +N E+SVD  SICM I GWT+MV +G 
Sbjct  280  NLWGFVRLSLASAVMLCLEVWYFMALILFAGYLQNPEISVDALSICMTILGWTVMVAMGA  339

Query  36   SAAIS  22
            +AAIS
Sbjct  340  NAAIS  344



>ref|XP_010476276.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Camelina sativa]
Length=519

 Score =   409 bits (1050),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 201/313 (64%), Positives = 241/313 (77%), Gaps = 0/313 (0%)
 Frame = -1

Query  960  SSVYSFDADAGDIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGH  781
            SS+ SF + A DI  I  V +F+REF  ESKKLW LA PAIFT  SQYS+GA+TQVFAGH
Sbjct  37   SSLVSFSSTAVDIPPIANVGDFLREFRIESKKLWKLAGPAIFTSMSQYSLGAVTQVFAGH  96

Query  780  VGNIQLAAVAVENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNA  601
            +  I LAAV+VEN +IAGF+FGIM GMGSALETLCGQAFGA K+ MLGVYLQRSW+IL  
Sbjct  97   ISTIALAAVSVENTVIAGFSFGIMLGMGSALETLCGQAFGAGKVSMLGVYLQRSWVILGV  156

Query  600  TAIPLTTLYIFSTPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIY  421
            TA+ L+ LYIF+ PIL  + Q   IS A G F+++MIPQ+FAY   FP  +FLQSQSKI 
Sbjct  157  TALFLSLLYIFAAPILAFIGQTAAISAAAGIFSIYMIPQIFAYAVNFPTAKFLQSQSKIM  216

Query  420  VMASVSDVALVGHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWK  241
            VMA+++ V LV H  F+WL M +L WGLPG A+VLNT+WWF+ VAQ VY+ +G CG+AW 
Sbjct  217  VMAAIAGVVLVFHSFFTWLVMCRLDWGLPGLALVLNTSWWFIVVAQLVYLFNGTCGEAWS  276

Query  240  GFSQRAFQNLTGFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGW  61
            GF+  AF NL GFV+LSLAS VM CLE+WYF+AL+L AGY KNAEVSV   SICMNI GW
Sbjct  277  GFTWEAFHNLWGFVKLSLASAVMLCLEIWYFMALVLFAGYLKNAEVSVAALSICMNILGW  336

Query  60   TLMVGVGFSAAIS  22
              MV +G +AA+S
Sbjct  337  AAMVSIGTNAAVS  349



>ref|XP_006353110.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Solanum tuberosum]
Length=501

 Score =   408 bits (1048),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 196/310 (63%), Positives = 248/310 (80%), Gaps = 1/310 (0%)
 Frame = -1

Query  948  SFDADAGDIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHVGNI  769
            SFDAD  DI+ I  VK F++EF+ ESKKLWYLA PAIFT   QYS+GA+TQ+FAGHVG I
Sbjct  18   SFDADEDDIKAINGVKSFVKEFHYESKKLWYLAGPAIFTSLCQYSLGAVTQIFAGHVGTI  77

Query  768  QLAAVAVENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNATAIP  589
            QLAAV+++ ++IAGF+ GI+ GMGSALETLCGQA+GAK+ +MLG+Y+QRSWIIL+ATA+ 
Sbjct  78   QLAAVSIQISVIAGFSEGILLGMGSALETLCGQAYGAKQKDMLGIYMQRSWIILHATALV  137

Query  588  LTTLYIFSTPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYVMAS  409
            L  L IF+T IL+L+ Q   I++  G F++WMIP +FAY F FPI +FLQ+QSKI  MA 
Sbjct  138  LMFLNIFATQILRLIGQQEKIAEWAGQFSLWMIPMVFAYAFEFPIMKFLQAQSKIMTMAV  197

Query  408  VSDVALVGHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSG-ACGDAWKGFS  232
            ++ V+   H L +WLFMLKL WGL  GAVVLN +WWFM  A+ +Y++ G +CG+AW GFS
Sbjct  198  IAGVSFAMHTLLTWLFMLKLGWGLAAGAVVLNCSWWFMVTAKMMYILWGNSCGEAWSGFS  257

Query  231  QRAFQNLTGFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGWTLM  52
              AF+NL GFVRLSLASGVM CLELWYF++LIL AGY ++AE++VD TSIC NI GWT M
Sbjct  258  WEAFKNLWGFVRLSLASGVMICLELWYFMSLILAAGYVEDAEIAVDATSICANIIGWTFM  317

Query  51   VGVGFSAAIS  22
            + +GF+AAIS
Sbjct  318  LCIGFNAAIS  327



>ref|XP_010044578.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Eucalyptus grandis]
Length=533

 Score =   408 bits (1048),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 198/321 (62%), Positives = 244/321 (76%), Gaps = 0/321 (0%)
 Frame = -1

Query  984  NTQIS*NMSSVYSFDADAGDIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGA  805
            N  +S  ++  ++F     DI  IK  ++F+REF  ESKKLW+LA PAIFT   +YSIGA
Sbjct  37   NMPLSTTVNDTFTFTPHTDDIPPIKGPRDFLREFAKESKKLWFLAGPAIFTSICRYSIGA  96

Query  804  ITQVFAGHVGNIQLAAVAVENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQ  625
            ITQVFAG VG ++LAAV+VEN++IAGF+FG+M GMGSALETLCGQA+GA +L+MLG+YLQ
Sbjct  97   ITQVFAGQVGTLELAAVSVENSVIAGFSFGVMLGMGSALETLCGQAYGAGQLDMLGIYLQ  156

Query  624  RSWIILNATAIPLTTLYIFSTPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRF  445
            RSW+ILN TA+ L  LYI +  +L+L+ Q   IS+  G FAVWMIPQ+F Y   FPI +F
Sbjct  157  RSWVILNTTAVALCFLYILAAKLLRLIGQTEAISEEAGMFAVWMIPQVFMYAMNFPIAKF  216

Query  444  LQSQSKIYVMASVSDVALVGHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVS  265
            LQ+QS+I VMA ++ V LV H  FSWL MLKL WGL G AVVLN +W  +  AQ  Y+ S
Sbjct  217  LQAQSRIMVMAVIAGVVLVLHTAFSWLLMLKLGWGLVGAAVVLNASWVVIVAAQLAYIFS  276

Query  264  GACGDAWKGFSQRAFQNLTGFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTS  85
            GACG AW GFS +AF+NL GFVRLSLAS VM CLE+WYF+ALIL AGY KNAE+SVD  +
Sbjct  277  GACGRAWTGFSWKAFENLWGFVRLSLASAVMLCLEIWYFMALILFAGYLKNAEISVDALA  336

Query  84   ICMNISGWTLMVGVGFSAAIS  22
            ICMNI GWT+M  +G +AAIS
Sbjct  337  ICMNILGWTVMQALGMNAAIS  357



>emb|CDY26602.1| BnaA09g46750D [Brassica napus]
Length=519

 Score =   407 bits (1046),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 200/313 (64%), Positives = 239/313 (76%), Gaps = 0/313 (0%)
 Frame = -1

Query  960  SSVYSFDADAGDIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGH  781
            SS+ SF + A DI  I  VK+F REF  ESKKLW LA PAIFT  +Q+S+GAITQVFAGH
Sbjct  37   SSLVSFSSTAVDIPPISNVKDFAREFRIESKKLWKLAGPAIFTSMAQFSLGAITQVFAGH  96

Query  780  VGNIQLAAVAVENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNA  601
            +  I LAAV++EN++IAGF+FGIM GMGSALETLCGQAFGA K+ +LGVYLQRSW+IL  
Sbjct  97   ISTIALAAVSIENSVIAGFSFGIMLGMGSALETLCGQAFGAGKVSLLGVYLQRSWVILTV  156

Query  600  TAIPLTTLYIFSTPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIY  421
            TA+ L+ LYIF+ PIL  + Q   IS   G F+++MIPQ+FAY   FP  +FLQSQSKI 
Sbjct  157  TALILSLLYIFAAPILTFIGQTAAISAMAGIFSIYMIPQIFAYAINFPSAKFLQSQSKIM  216

Query  420  VMASVSDVALVGHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWK  241
            VMA++S  ALV H L +WL M K  WGLPG A VLNT+WWF+ VAQ VY+ SG CG+AW 
Sbjct  217  VMAAISGAALVIHTLLTWLVMSKFHWGLPGLAFVLNTSWWFIVVAQVVYIFSGTCGEAWS  276

Query  240  GFSQRAFQNLTGFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGW  61
            GF+  AF NL GF++LSLAS VM CLE+WYF+AL+L AGY KNAEVSV   SICMNI GW
Sbjct  277  GFTWEAFHNLWGFIKLSLASAVMLCLEIWYFMALVLFAGYLKNAEVSVAALSICMNILGW  336

Query  60   TLMVGVGFSAAIS  22
              MV VG +AA+S
Sbjct  337  AAMVSVGINAAVS  349



>ref|XP_006388162.1| hypothetical protein POPTR_0307s00210g [Populus trichocarpa]
 gb|ERP47076.1| hypothetical protein POPTR_0307s00210g [Populus trichocarpa]
Length=512

 Score =   406 bits (1044),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 206/315 (65%), Positives = 247/315 (78%), Gaps = 0/315 (0%)
 Frame = -1

Query  966  NMSSVYSFDADAGDIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFA  787
            N S   SF  D  DI  I  V++F  EF  ESKKLWYLA PAIFT   QYS+GAITQ+ A
Sbjct  26   NSSIASSFTPDPDDIPLINSVRDFSIEFCRESKKLWYLAGPAIFTTLCQYSLGAITQLLA  85

Query  786  GHVGNIQLAAVAVENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIIL  607
            GHVG + LAAV+VEN++IAGF+FGIM GMGSALETLCGQA+GA +L+MLG+Y+QRSW+IL
Sbjct  86   GHVGTLDLAAVSVENSVIAGFSFGIMLGMGSALETLCGQAYGAGQLDMLGIYMQRSWVIL  145

Query  606  NATAIPLTTLYIFSTPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSK  427
            NATA+ LT LYIF+ P LKL+ Q   IS+A G F+VWMIPQLFAY   FPI +FLQSQSK
Sbjct  146  NATAVILTLLYIFAGPFLKLIGQTAEISQAAGMFSVWMIPQLFAYAMNFPIAKFLQSQSK  205

Query  426  IYVMASVSDVALVGHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDA  247
            + VMA+++ VALV H +FSWL MLKL WGL G AVVLN +WWF+ +AQ +Y+ SG CG+A
Sbjct  206  MMVMAAIAAVALVFHAVFSWLLMLKLGWGLVGAAVVLNASWWFIVIAQLLYIFSGTCGEA  265

Query  246  WKGFSQRAFQNLTGFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNIS  67
            W G S +AFQNL GFVRLSLAS VM CLE+WYF+ALIL AGY KNAE++VD  SI  NI 
Sbjct  266  WTGLSWKAFQNLWGFVRLSLASAVMLCLEVWYFMALILFAGYLKNAELAVDALSISTNIV  325

Query  66   GWTLMVGVGFSAAIS  22
            GW +M+ +G +AAIS
Sbjct  326  GWAVMIAIGINAAIS  340



>ref|XP_009118041.1| PREDICTED: protein TRANSPARENT TESTA 12 [Brassica rapa]
Length=519

 Score =   407 bits (1045),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 200/313 (64%), Positives = 239/313 (76%), Gaps = 0/313 (0%)
 Frame = -1

Query  960  SSVYSFDADAGDIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGH  781
            SS+ SF + A DI  I  VK+F REF  ESKKLW LA PAIFT  +Q+S+GAITQVFAGH
Sbjct  37   SSLVSFSSTAVDIPPISNVKDFAREFRIESKKLWKLAGPAIFTSIAQFSLGAITQVFAGH  96

Query  780  VGNIQLAAVAVENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNA  601
            +  I LAAV++EN++IAGF+FGIM GMGSALETLCGQAFGA K+ +LGVYLQRSW+IL  
Sbjct  97   ISTIALAAVSIENSVIAGFSFGIMLGMGSALETLCGQAFGAGKVSLLGVYLQRSWVILTV  156

Query  600  TAIPLTTLYIFSTPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIY  421
            TA+ L+ LYIF+ PIL  + Q   IS   G F+++MIPQ+FAY   FP  +FLQSQSKI 
Sbjct  157  TALILSLLYIFAAPILTFIGQTAGISAMAGIFSIYMIPQIFAYAINFPSAKFLQSQSKIM  216

Query  420  VMASVSDVALVGHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWK  241
            VMA++S  ALV H L +WL M K  WGLPG A VLNT+WWF+ VAQ VY+ SG CG+AW 
Sbjct  217  VMAAISGAALVIHTLLTWLVMSKFHWGLPGLAFVLNTSWWFIVVAQVVYIFSGTCGEAWS  276

Query  240  GFSQRAFQNLTGFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGW  61
            GF+  AF NL GF++LSLAS VM CLE+WYF+AL+L AGY KNAEVSV   SICMNI GW
Sbjct  277  GFTWEAFHNLWGFIKLSLASAVMLCLEIWYFMALVLFAGYLKNAEVSVAALSICMNILGW  336

Query  60   TLMVGVGFSAAIS  22
              MV VG +AA+S
Sbjct  337  AAMVSVGINAAVS  349



>ref|XP_010494806.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Camelina sativa]
Length=519

 Score =   406 bits (1044),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 201/313 (64%), Positives = 241/313 (77%), Gaps = 0/313 (0%)
 Frame = -1

Query  960  SSVYSFDADAGDIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGH  781
            SS+ SF + A DI  I  V +F+REF  ESKKLW LA PAIFT  SQYS+GA+TQVFAGH
Sbjct  37   SSLVSFSSTAVDIPPISNVGDFVREFRIESKKLWKLAGPAIFTSMSQYSLGAVTQVFAGH  96

Query  780  VGNIQLAAVAVENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNA  601
            +  I LAAV++EN++IAGF+FGIM GMGSALETLCGQAFGA K+ MLGVYLQRSW+IL  
Sbjct  97   ISTIALAAVSIENSVIAGFSFGIMLGMGSALETLCGQAFGAGKVSMLGVYLQRSWVILGV  156

Query  600  TAIPLTTLYIFSTPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIY  421
            TA+ L+ LYIF+ PIL  + Q   IS A G F+++MIPQ+FAY   FP  +FLQSQSKI 
Sbjct  157  TALFLSLLYIFAAPILAFIGQTAAISAAAGIFSIYMIPQIFAYAVNFPTAKFLQSQSKIM  216

Query  420  VMASVSDVALVGHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWK  241
            VMA++S V LV H  F+WL M +L  GLPG A+VLNT+WWF+ VAQ VY+ +G CG+AW 
Sbjct  217  VMAAISGVVLVFHSFFTWLVMCRLDLGLPGLALVLNTSWWFIVVAQLVYIFNGTCGEAWS  276

Query  240  GFSQRAFQNLTGFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGW  61
            GF+  AF NL GFV+LSLAS VM CLE+WYF+AL+L AGY KNAEVSV   SICMNI GW
Sbjct  277  GFTWEAFHNLWGFVKLSLASAVMLCLEIWYFMALVLFAGYLKNAEVSVAALSICMNILGW  336

Query  60   TLMVGVGFSAAIS  22
              MV VG +AA+S
Sbjct  337  AAMVSVGTNAAVS  349



>ref|XP_011086627.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Sesamum indicum]
Length=527

 Score =   407 bits (1045),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 201/313 (64%), Positives = 238/313 (76%), Gaps = 0/313 (0%)
 Frame = -1

Query  960  SSVYSFDADAGDIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGH  781
            S V SF  D  DI  I   + F + F  ESKKLWYLA PAIFT   QYS+GAITQ FAGH
Sbjct  37   SFVSSFVDDGDDIPPIVSPRRFFKAFTRESKKLWYLAGPAIFTSICQYSLGAITQTFAGH  96

Query  780  VGNIQLAAVAVENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNA  601
            VG + LAA ++EN +IAG +FG+M GMGSALETLCGQA+GA ++EMLGVY+QRSW+IL  
Sbjct  97   VGTLDLAAFSIENTVIAGLSFGVMLGMGSALETLCGQAYGAGQIEMLGVYMQRSWVILLT  156

Query  600  TAIPLTTLYIFSTPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIY  421
            TA  LT +YIF+ P L+L+ Q   IS+  G FA+WMIPQL+AY   FPI +FLQ+QSKI 
Sbjct  157  TAFLLTFIYIFAFPFLQLIGQAEDISRLAGKFALWMIPQLYAYALNFPIAKFLQAQSKIM  216

Query  420  VMASVSDVALVGHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWK  241
             +A +S VAL  HVLFSWL MLKL WG+ GGAVVLN +WWF+ VAQ VY+ SG CG AW 
Sbjct  217  GLAWISMVALALHVLFSWLLMLKLGWGMAGGAVVLNASWWFIVVAQLVYIFSGTCGRAWT  276

Query  240  GFSQRAFQNLTGFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGW  61
            GFS RAFQNL GF+RLSLAS VM CLE WYF+AL+L AGY KNAE++VD  SIC NI GW
Sbjct  277  GFSWRAFQNLWGFMRLSLASAVMLCLETWYFMALVLFAGYLKNAEIAVDALSICTNIVGW  336

Query  60   TLMVGVGFSAAIS  22
             +MV +GF+AAIS
Sbjct  337  AVMVAIGFNAAIS  349



>emb|CDY16041.1| BnaC08g40820D [Brassica napus]
Length=519

 Score =   406 bits (1044),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 199/313 (64%), Positives = 239/313 (76%), Gaps = 0/313 (0%)
 Frame = -1

Query  960  SSVYSFDADAGDIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGH  781
            SS+ SF + A DI  I  VK+F REF  ES+KLW LA PAIFT  +Q+S+GAITQVFAGH
Sbjct  37   SSLVSFSSTAVDIPPISNVKDFTREFRIESRKLWKLAGPAIFTSMAQFSLGAITQVFAGH  96

Query  780  VGNIQLAAVAVENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNA  601
            +  I LAAV++EN++IAGF+FGIM GMGSALETLCGQAFGA K+ +LGVYLQRSW+IL  
Sbjct  97   ISTIALAAVSIENSVIAGFSFGIMLGMGSALETLCGQAFGAGKVSLLGVYLQRSWVILTV  156

Query  600  TAIPLTTLYIFSTPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIY  421
            TA+ L+ LYIF+ PIL  + Q   IS   G F+++MIPQ+FAY   FP  +FLQSQSKI 
Sbjct  157  TALILSLLYIFAAPILTFIGQTAGISAMAGIFSIYMIPQIFAYAINFPSAKFLQSQSKIM  216

Query  420  VMASVSDVALVGHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWK  241
            VMA++S  ALV H L +WL M K  WGLPG A VLNT+WWF+ VAQ VY+ SG CG+AW 
Sbjct  217  VMAAISGAALVIHTLLTWLVMSKFHWGLPGLAFVLNTSWWFIVVAQVVYIFSGTCGEAWS  276

Query  240  GFSQRAFQNLTGFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGW  61
            GF+  AF NL GF++LSLAS VM CLE+WYF+AL+L AGY KNAEVSV   SICMNI GW
Sbjct  277  GFTWEAFHNLWGFIKLSLASAVMLCLEIWYFMALVLFAGYLKNAEVSVAALSICMNILGW  336

Query  60   TLMVGVGFSAAIS  22
              MV VG +AA+S
Sbjct  337  AAMVSVGINAAVS  349



>ref|XP_004310154.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Fragaria vesca 
subsp. vesca]
Length=531

 Score =   407 bits (1045),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 199/312 (64%), Positives = 243/312 (78%), Gaps = 0/312 (0%)
 Frame = -1

Query  957  SVYSFDADAGDIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHV  778
            S  +F+ D+ DI  IK V++F REF  ESKKLW+LA PAIFT   QYS+GA+TQVFAG V
Sbjct  44   SSTTFNPDSDDIPPIKGVRDFFREFNRESKKLWFLAGPAIFTSLCQYSLGAVTQVFAGQV  103

Query  777  GNIQLAAVAVENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNAT  598
              + LAAV+VEN++IAGF FG + GMGSALETLCGQAFGA +L+MLG+Y+QRSW+ILNA 
Sbjct  104  STLDLAAVSVENSVIAGFCFGALLGMGSALETLCGQAFGAGQLDMLGIYMQRSWVILNAA  163

Query  597  AIPLTTLYIFSTPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYV  418
            ++ L  LYIF+  IL  + Q   ISKA G FA++MIPQLFAY   FP+ +FLQSQSK+ V
Sbjct  164  SVVLCFLYIFAQQILYGIGQTAAISKAAGVFAIYMIPQLFAYAMIFPLSKFLQSQSKMMV  223

Query  417  MASVSDVALVGHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKG  238
            MA+++ V L+ H +FSWL MLKL WGL G AVVL+ +WW + VAQ VY+VSG CG AW G
Sbjct  224  MAAIAAVTLILHTVFSWLLMLKLGWGLVGAAVVLDASWWIIVVAQMVYIVSGTCGRAWTG  283

Query  237  FSQRAFQNLTGFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGWT  58
            FS +AF  L GFV+LSLAS VM CLE+WYF+ALIL AGY KNAE+SVDG SICMNI GWT
Sbjct  284  FSWKAFHGLWGFVKLSLASAVMLCLEVWYFMALILFAGYLKNAEISVDGLSICMNILGWT  343

Query  57   LMVGVGFSAAIS  22
            +M+  G +AAIS
Sbjct  344  IMMSFGMNAAIS  355



>ref|XP_002527924.1| multidrug resistance pump, putative [Ricinus communis]
 gb|EEF34481.1| multidrug resistance pump, putative [Ricinus communis]
Length=531

 Score =   406 bits (1044),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 206/309 (67%), Positives = 245/309 (79%), Gaps = 0/309 (0%)
 Frame = -1

Query  948  SFDADAGDIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHVGNI  769
            +F  D+ DI  I   + F REFY ESKKLWYLA PAIFT   QYS+GA+TQVF+G VG +
Sbjct  47   AFVPDSDDIPPITGFRNFFREFYRESKKLWYLAGPAIFTSICQYSLGAVTQVFSGQVGTL  106

Query  768  QLAAVAVENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNATAIP  589
             LAAV+VEN++IAGF+FGIM GMGSALETLCGQA+GAK+L+MLG+YLQRSW+IL  TA  
Sbjct  107  DLAAVSVENSVIAGFSFGIMLGMGSALETLCGQAYGAKQLDMLGIYLQRSWVILGTTASF  166

Query  588  LTTLYIFSTPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYVMAS  409
            L  LY+F+  ILK + Q P ISKA G FA+WMIPQLFAY   FP+ +FLQ+QSKI VMA 
Sbjct  167  LCLLYVFAAQILKSIGQTPAISKAAGVFAIWMIPQLFAYAMNFPMAKFLQAQSKIMVMAM  226

Query  408  VSDVALVGHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKGFSQ  229
            ++  ALV H +FSWL MLKL WGL G AVVLN +WWF+ +AQF+Y++SG CG AW GFS 
Sbjct  227  IAAAALVLHAVFSWLLMLKLGWGLVGAAVVLNASWWFIDLAQFLYIISGTCGRAWNGFSW  286

Query  228  RAFQNLTGFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGWTLMV  49
            +AFQNL  FVRLSLAS VM CLE+WYF+ALIL AGY KNAEVSVD  SICMNI GWT+M+
Sbjct  287  KAFQNLWSFVRLSLASAVMLCLEVWYFMALILFAGYLKNAEVSVDALSICMNILGWTVMI  346

Query  48   GVGFSAAIS  22
             +G +AAIS
Sbjct  347  AIGMNAAIS  355



>ref|XP_011034092.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Populus euphratica]
Length=512

 Score =   405 bits (1042),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 204/318 (64%), Positives = 250/318 (79%), Gaps = 0/318 (0%)
 Frame = -1

Query  975  IS*NMSSVYSFDADAGDIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQ  796
            +S N S   SF  D  DI  I  V++F  EF  ESKKLWYLA PAIFT   +YS+GAITQ
Sbjct  23   LSTNSSIASSFTPDPDDIPLINSVRDFSIEFCRESKKLWYLAGPAIFTTLCKYSLGAITQ  82

Query  795  VFAGHVGNIQLAAVAVENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSW  616
            + AGHVG + LAAV+VEN+++AGF+FGIM GMGSALETLCGQA+GA +L+MLG+Y+QRSW
Sbjct  83   LLAGHVGTVDLAAVSVENSVVAGFSFGIMLGMGSALETLCGQAYGAGQLDMLGIYMQRSW  142

Query  615  IILNATAIPLTTLYIFSTPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQS  436
            +ILNATA+ LT LYIF+ P LKL+ Q   IS+A G F+VWMIPQLFAY   FPI +FLQ+
Sbjct  143  VILNATAVILTLLYIFAGPFLKLIGQTAEISQAAGMFSVWMIPQLFAYAMNFPIAKFLQA  202

Query  435  QSKIYVMASVSDVALVGHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGAC  256
            QSK+ VMA+++ VALV H +FSWL MLKL WGL G AVVLN +WWF+ +AQ +Y++SG C
Sbjct  203  QSKMMVMAAIAAVALVFHAVFSWLLMLKLGWGLVGAAVVLNASWWFIVIAQLLYILSGTC  262

Query  255  GDAWKGFSQRAFQNLTGFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICM  76
            G+AW G S +AFQNL GFVRLSLAS VM CLE+WYF+ALIL AGY KNAE++VD  SI  
Sbjct  263  GEAWTGLSWKAFQNLWGFVRLSLASAVMLCLEVWYFMALILFAGYLKNAELAVDALSIST  322

Query  75   NISGWTLMVGVGFSAAIS  22
            NI GW +M+ +G +AAIS
Sbjct  323  NIVGWAVMIAIGINAAIS  340



>ref|XP_009110609.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Brassica rapa]
 emb|CDY21076.1| BnaA08g24490D [Brassica napus]
Length=519

 Score =   405 bits (1042),  Expect = 7e-135, Method: Compositional matrix adjust.
 Identities = 198/313 (63%), Positives = 240/313 (77%), Gaps = 0/313 (0%)
 Frame = -1

Query  960  SSVYSFDADAGDIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGH  781
            SS+ SF + A DI  I  V +F+REF  ESKKLW LA PAIFT  +Q+S+GAITQVFAGH
Sbjct  37   SSLVSFSSTAVDIPPISNVGDFVREFRIESKKLWKLAGPAIFTSMAQFSLGAITQVFAGH  96

Query  780  VGNIQLAAVAVENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNA  601
            +  I LAAV++EN++IAGF+FGIM GMGSALETLCGQAFGA K  +LGVYLQRSW+IL+A
Sbjct  97   ISTIALAAVSIENSVIAGFSFGIMLGMGSALETLCGQAFGAGKASLLGVYLQRSWVILSA  156

Query  600  TAIPLTTLYIFSTPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIY  421
            TA+ L+ LY+F+ PIL  + Q   IS   G F+++MIPQ+FAY   FP  +FLQSQSKI 
Sbjct  157  TALILSLLYVFAAPILSFIGQTAAISAMAGIFSIYMIPQIFAYAINFPTAKFLQSQSKIM  216

Query  420  VMASVSDVALVGHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWK  241
            VMA +S VALV H   +WL M +L WGLPG A+VLN +WWF+ VAQ VY+  G CG+AW 
Sbjct  217  VMAGISGVALVIHTFLTWLVMSRLHWGLPGLALVLNASWWFIVVAQLVYIFGGTCGEAWS  276

Query  240  GFSQRAFQNLTGFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGW  61
            GF+  AF NL GFV+LSLAS VM CLE+WYF+AL+L AGY KNAEVSV   SICMNI GW
Sbjct  277  GFTWEAFHNLWGFVKLSLASAVMICLEVWYFMALVLFAGYLKNAEVSVAALSICMNILGW  336

Query  60   TLMVGVGFSAAIS  22
             +MV VG +AA+S
Sbjct  337  AVMVSVGINAAVS  349



>ref|XP_004251995.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Solanum lycopersicum]
Length=502

 Score =   404 bits (1038),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 196/314 (62%), Positives = 246/314 (78%), Gaps = 1/314 (0%)
 Frame = -1

Query  960  SSVYSFDADAGDIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGH  781
            SS  SFDAD  DIR I  VK F++EF+ ESKKLWYLA PAIFT   QYS+GA+TQ+FAGH
Sbjct  15   SSKASFDADEDDIRSINGVKSFVKEFHYESKKLWYLAGPAIFTSLCQYSLGAVTQIFAGH  74

Query  780  VGNIQLAAVAVENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNA  601
            VG IQLAAV+++ ++IAGF+ GI+ GMGSALETLCGQA+GAK+ +MLG+Y+QRSWIILN 
Sbjct  75   VGTIQLAAVSIQISVIAGFSEGILLGMGSALETLCGQAYGAKQKDMLGIYMQRSWIILNV  134

Query  600  TAIPLTTLYIFSTPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIY  421
            TA+ L  L IF+T IL+ + Q   I++  G F++WMIP +FAY F FPI +FLQ+QSKI 
Sbjct  135  TALVLMFLNIFATQILRFIGQQEKIAEWAGQFSLWMIPMVFAYAFEFPIMKFLQAQSKIM  194

Query  420  VMASVSDVALVGHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSG-ACGDAW  244
             MA ++ V+   H L +W+FMLKL  GL  GAV+LN +WW M  A+ VY++ G +CGDAW
Sbjct  195  TMAVIAGVSCAMHALLTWIFMLKLGLGLAAGAVILNCSWWLMVTAKMVYILWGNSCGDAW  254

Query  243  KGFSQRAFQNLTGFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNISG  64
             GFS  AF+NL GFVRLSLASGVM CLELWYF++LIL AGY ++AE++VD TSIC NI G
Sbjct  255  SGFSWEAFKNLWGFVRLSLASGVMICLELWYFMSLILAAGYVEDAEIAVDATSICANIIG  314

Query  63   WTLMVGVGFSAAIS  22
            WT M+ +GF+AAIS
Sbjct  315  WTFMLCIGFNAAIS  328



>gb|KFK33585.1| hypothetical protein AALP_AA5G032800 [Arabis alpina]
Length=500

 Score =   404 bits (1037),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 196/306 (64%), Positives = 234/306 (76%), Gaps = 0/306 (0%)
 Frame = -1

Query  939  ADAGDIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHVGNIQLA  760
            + AGDI  I  +  F++EF  E+KKLWYLA PAIFT  +QYS+GA+TQVFAGHV  I LA
Sbjct  24   SSAGDIPPITTIGGFVKEFNVEAKKLWYLAGPAIFTSVTQYSLGAVTQVFAGHVSTIALA  83

Query  759  AVAVENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNATAIPLTT  580
            AV+VEN++IAGF+FGIM GMGSALETLCGQAFGA KL MLGVYLQRSW+ILN TA+ L+ 
Sbjct  84   AVSVENSVIAGFSFGIMLGMGSALETLCGQAFGAGKLSMLGVYLQRSWVILNVTALVLSL  143

Query  579  LYIFSTPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYVMASVSD  400
            LYIF+ PIL  + Q   IS A G F+++MIPQ+FAY   FP  +FLQSQSKI VMA++S 
Sbjct  144  LYIFAAPILAFIGQTAAISSAAGIFSIYMIPQIFAYAVNFPTAKFLQSQSKIMVMAAISA  203

Query  399  VALVGHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKGFSQRAF  220
            VAL  HV  +W  M KL+WG+ G AVVLN +WWF+  AQ  Y+ SG CG+AW GFS  AF
Sbjct  204  VALALHVPLTWFVMEKLKWGMVGLAVVLNASWWFIVTAQVAYIASGTCGEAWSGFSFEAF  263

Query  219  QNLTGFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGWTLMVGVG  40
             NL  FVRLSLAS VM CLE+WYF+A+IL AGY KNAEVSV   SICMNI GWT M+ +G
Sbjct  264  HNLWSFVRLSLASAVMLCLEVWYFMAIILFAGYLKNAEVSVAALSICMNILGWTAMIAIG  323

Query  39   FSAAIS  22
             + A+S
Sbjct  324  MNTAVS  329



>gb|KHG29776.1| Protein TRANSPARENT TESTA 12 -like protein [Gossypium arboreum]
Length=514

 Score =   403 bits (1036),  Expect = 5e-134, Method: Compositional matrix adjust.
 Identities = 196/309 (63%), Positives = 242/309 (78%), Gaps = 0/309 (0%)
 Frame = -1

Query  948  SFDADAGDIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHVGNI  769
            +F A   DI  I  V++F RE+  ESKKLW+LA PAIFT   QYS+GAITQVF+G VG +
Sbjct  28   TFTAGTDDIPPINSVRDFFREYLIESKKLWFLAGPAIFTSVCQYSLGAITQVFSGQVGTL  87

Query  768  QLAAVAVENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNATAIP  589
             LAAV+VEN++IAGF FGIM GMGSALETLCGQA+GA +L+MLGVY+QRS +IL ATA+ 
Sbjct  88   ALAAVSVENSVIAGFCFGIMLGMGSALETLCGQAYGAGQLDMLGVYMQRSCVILTATALM  147

Query  588  LTTLYIFSTPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYVMAS  409
            L+ LYIF+  +L ++ Q   I++A G FA+WMIPQLFAY F FP+ +FLQ+QSK+  MA 
Sbjct  148  LSLLYIFAVQLLTVIGQTESIAEAAGIFAIWMIPQLFAYAFNFPMAKFLQAQSKMMAMAM  207

Query  408  VSDVALVGHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKGFSQ  229
            +S VALV H LFSWL MLKL WGL G A+VLN +W  + VAQF+Y++SG CG AW GFS 
Sbjct  208  ISGVALVLHCLFSWLLMLKLGWGLVGAAIVLNGSWIAIDVAQFLYIISGTCGQAWTGFSW  267

Query  228  RAFQNLTGFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGWTLMV  49
            +AFQ+L GFVRLS AS +M CLE+WYF+ALIL AGY KNA++SVD  SIC+NI GWT+MV
Sbjct  268  KAFQHLWGFVRLSFASAIMLCLEVWYFMALILFAGYLKNADISVDALSICLNILGWTIMV  327

Query  48   GVGFSAAIS  22
              G +AAIS
Sbjct  328  AFGMNAAIS  336



>emb|CAA66405.1| orf04 [Arabidopsis thaliana]
Length=446

 Score =   400 bits (1029),  Expect = 6e-134, Method: Compositional matrix adjust.
 Identities = 195/302 (65%), Positives = 234/302 (77%), Gaps = 0/302 (0%)
 Frame = -1

Query  927  DIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHVGNIQLAAVAV  748
            DI  I  V  F+REF  E+KKLWYLA PAIFT  +QYS+GAITQVFAGH+  I LAAV+V
Sbjct  28   DIPPITTVGGFVREFNVETKKLWYLAGPAIFTSVNQYSLGAITQVFAGHISTIALAAVSV  87

Query  747  ENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNATAIPLTTLYIF  568
            EN+++AGF+FGIM GMGSALETLCGQAFGA KL MLGVYLQRSW+ILN TA+ L+ LYIF
Sbjct  88   ENSVVAGFSFGIMLGMGSALETLCGQAFGAGKLSMLGVYLQRSWVILNVTALILSLLYIF  147

Query  567  STPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYVMASVSDVALV  388
            + PIL  + Q   IS A G F+++MIPQ+FAY   FP  +FLQSQSKI VMA +S VALV
Sbjct  148  AAPILASIGQTAAISSAAGIFSIYMIPQIFAYAINFPTAKFLQSQSKIMVMAVISAVALV  207

Query  387  GHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKGFSQRAFQNLT  208
             HV  +W  ++KL+WG+PG AVVLN +W F+ +AQ VY+ SG CG+AW GFS  AF NL 
Sbjct  208  IHVPLTWFVIVKLQWGMPGLAVVLNASWCFIDMAQLVYIFSGTCGEAWSGFSWEAFHNLW  267

Query  207  GFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGWTLMVGVGFSAA  28
             FVRLSLAS VM CLE+WYF+A+IL AGY KNAE+SV   SICMNI GWT M+ +G + A
Sbjct  268  SFVRLSLASAVMLCLEVWYFMAIILFAGYLKNAEISVAALSICMNILGWTAMIAIGMNTA  327

Query  27   IS  22
            +S
Sbjct  328  VS  329



>emb|CDY34598.1| BnaC03g56980D [Brassica napus]
Length=519

 Score =   403 bits (1035),  Expect = 8e-134, Method: Compositional matrix adjust.
 Identities = 196/313 (63%), Positives = 238/313 (76%), Gaps = 0/313 (0%)
 Frame = -1

Query  960  SSVYSFDADAGDIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGH  781
            SS+ SF + A DI  I  V +F+REF  ESKKLW LA PAIFT  +Q+S+GAITQVFAGH
Sbjct  37   SSLVSFSSTAVDIPPISNVGDFVREFRIESKKLWKLAGPAIFTSMAQFSLGAITQVFAGH  96

Query  780  VGNIQLAAVAVENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNA  601
            +  I LAAV++EN++IAGF+FGIM GMGSALETLCGQAFGA +  MLGVYLQRSW+IL+A
Sbjct  97   ISTIALAAVSIENSVIAGFSFGIMLGMGSALETLCGQAFGAGRASMLGVYLQRSWVILSA  156

Query  600  TAIPLTTLYIFSTPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIY  421
            TA+ L+ LY+F+ PIL  + Q   IS   G F+++MIPQ+FAY   FP  +FLQSQSKI 
Sbjct  157  TALILSLLYVFAAPILSFIGQTAAISAMAGIFSIYMIPQIFAYAINFPTAKFLQSQSKIM  216

Query  420  VMASVSDVALVGHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWK  241
             MA +S VALV H   +WL M +  WGLPG A+VLN +WWF+ VAQ VY+  G CG+AW 
Sbjct  217  AMAGISGVALVIHTFLTWLVMSRFNWGLPGLALVLNASWWFIVVAQLVYIFGGTCGEAWS  276

Query  240  GFSQRAFQNLTGFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGW  61
            GF+  AF NL GFV+LSLAS VM CLE+WYF+AL+L AGY KNAEVSV   SICMNI GW
Sbjct  277  GFTWEAFHNLWGFVKLSLASAVMICLEVWYFMALVLFAGYLKNAEVSVAALSICMNILGW  336

Query  60   TLMVGVGFSAAIS  22
             +MV VG +AA+S
Sbjct  337  AVMVSVGINAAVS  349



>ref|XP_010502591.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Camelina 
sativa]
Length=423

 Score =   399 bits (1026),  Expect = 9e-134, Method: Compositional matrix adjust.
 Identities = 191/306 (62%), Positives = 234/306 (76%), Gaps = 0/306 (0%)
 Frame = -1

Query  939  ADAGDIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHVGNIQLA  760
            + A DI  I  V  F+REF  E+KKLWYLA PAIFT  +QYS+GA+TQVFAGH+  + LA
Sbjct  25   SPADDISPITTVGGFVREFNVETKKLWYLAGPAIFTSMNQYSLGAVTQVFAGHISTVSLA  84

Query  759  AVAVENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNATAIPLTT  580
            AV+VEN+++AGF+FGIM GMGSALETLCGQAFGA KL MLGVYLQRSW+ILN TA+ LT 
Sbjct  85   AVSVENSVVAGFSFGIMLGMGSALETLCGQAFGAGKLSMLGVYLQRSWVILNVTALILTL  144

Query  579  LYIFSTPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYVMASVSD  400
            LYIF+ PIL  + Q   IS A G F+++MIPQ+FAY   FP  +FLQSQSKI VMA++S 
Sbjct  145  LYIFAAPILAFIGQTAAISSAAGIFSIYMIPQIFAYAVNFPTAKFLQSQSKIMVMAAISA  204

Query  399  VALVGHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKGFSQRAF  220
            VALV HV  +W  + +L+WG+PG AVVLN +WW +  AQ VY+ SG CG+AW G S  AF
Sbjct  205  VALVVHVPLTWFVIERLQWGMPGLAVVLNLSWWLIVTAQLVYIFSGTCGEAWSGLSWEAF  264

Query  219  QNLTGFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGWTLMVGVG  40
             +L  FVRLSLAS VM CLE+WYF+A+IL AGY K+AE+SV   SICMNI GWT M+ +G
Sbjct  265  HHLWSFVRLSLASAVMLCLEVWYFMAIILFAGYLKDAEISVAALSICMNILGWTAMIAIG  324

Query  39   FSAAIS  22
             + A+S
Sbjct  325  MNTAVS  330



>ref|XP_006438287.1| hypothetical protein CICLE_v10031274mg [Citrus clementina]
 gb|ESR51527.1| hypothetical protein CICLE_v10031274mg [Citrus clementina]
Length=421

 Score =   399 bits (1025),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 205/315 (65%), Positives = 242/315 (77%), Gaps = 0/315 (0%)
 Frame = -1

Query  966  NMSSVYSFDADAGDIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFA  787
            N SS   F A+  DI  I    +F REF  ESKKLWYLA PAIFT   QYS+GA+TQVFA
Sbjct  26   NTSSSAIFIAEVDDIPPITGAVDFFREFSKESKKLWYLAGPAIFTSVCQYSLGAVTQVFA  85

Query  786  GHVGNIQLAAVAVENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIIL  607
            GHV  I LAAV+VEN++IAGF+FG M GMGSALETLCGQA+GA +L+MLGVY+QRSW+IL
Sbjct  86   GHVSTIALAAVSVENSVIAGFSFGAMMGMGSALETLCGQAYGAGQLDMLGVYMQRSWVIL  145

Query  606  NATAIPLTTLYIFSTPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSK  427
            NATA+ L  +YIF+  +L L+ Q P ISKA GT ++WMIPQLFAY   FPI +FLQ+QSK
Sbjct  146  NATALILMLIYIFAQQLLSLIGQTPSISKAAGTLSIWMIPQLFAYAVNFPIAKFLQAQSK  205

Query  426  IYVMASVSDVALVGHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDA  247
            + VMA ++  ALV H L SWL ML+L WGL G AVVLN +WWF+ +AQ  Y+ SG CG A
Sbjct  206  MMVMAIIAASALVLHTLLSWLLMLELGWGLVGAAVVLNASWWFIDLAQMFYIFSGTCGRA  265

Query  246  WKGFSQRAFQNLTGFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNIS  67
            W GFS +AF NL  FVRLSLAS VM CLE+WYF+ALIL AGY KNAE+SVD  SICMNI 
Sbjct  266  WNGFSWKAFHNLWAFVRLSLASAVMLCLEVWYFMALILFAGYLKNAELSVDALSICMNIL  325

Query  66   GWTLMVGVGFSAAIS  22
            GWT+MV +G +AAIS
Sbjct  326  GWTVMVAIGMNAAIS  340



>ref|XP_002868811.1| mate efflux family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH45070.1| mate efflux family protein [Arabidopsis lyrata subsp. lyrata]
Length=498

 Score =   401 bits (1031),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 196/306 (64%), Positives = 234/306 (76%), Gaps = 0/306 (0%)
 Frame = -1

Query  939  ADAGDIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHVGNIQLA  760
            +   DI  I  V+ F+REF  E KKLWYLA PAIF   +QYS+GA TQVFAGH+  I LA
Sbjct  24   SSVDDIPPITTVRGFLREFNVEVKKLWYLAGPAIFMSLTQYSLGAATQVFAGHISTIALA  83

Query  759  AVAVENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNATAIPLTT  580
            AV+VEN++IAGF+FG+M GMGSALETLCGQAFGA KL MLGVYLQRSW+ILN TAI L+ 
Sbjct  84   AVSVENSVIAGFSFGVMLGMGSALETLCGQAFGAGKLSMLGVYLQRSWVILNVTAILLSL  143

Query  579  LYIFSTPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYVMASVSD  400
            LYIF+ PIL  + Q P IS A G F+++MIPQ+FAY   +P  +FLQSQSKI VMA++S 
Sbjct  144  LYIFAAPILAFIGQTPAISSATGIFSIYMIPQIFAYAVNYPTAKFLQSQSKIMVMAAISA  203

Query  399  VALVGHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKGFSQRAF  220
            VALV HVLF+W  +  L+WG  G AVVLN +WWF+ VAQ VY+ SG CG+AW GFS  AF
Sbjct  204  VALVLHVLFTWFVIEGLQWGTAGLAVVLNASWWFIVVAQLVYIFSGTCGEAWSGFSWEAF  263

Query  219  QNLTGFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGWTLMVGVG  40
             NL  FVRLSLAS VM CLE+WY +A+IL AGY KNAE+SV   SICMNI GWT M+ +G
Sbjct  264  HNLWSFVRLSLASAVMLCLEVWYLMAVILFAGYLKNAEISVAALSICMNILGWTAMIAIG  323

Query  39   FSAAIS  22
             +AA+S
Sbjct  324  MNAAVS  329



>emb|CBI23362.3| unnamed protein product [Vitis vinifera]
Length=1152

 Score =   420 bits (1079),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 206/309 (67%), Positives = 248/309 (80%), Gaps = 0/309 (0%)
 Frame = -1

Query  948  SFDADAGDIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHVGNI  769
            +F+AD  DI  I  V++F +EF  ESKKLWYLA PAIFT   QYS+GAITQVFAGHVG +
Sbjct  672  TFNADESDIGPINGVRDFYKEFIVESKKLWYLAGPAIFTSLCQYSLGAITQVFAGHVGTL  731

Query  768  QLAAVAVENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNATAIP  589
            +LAAV+VEN++IAGF+FG+M GMGSALETLCGQAFGA +L+MLGVY+QRSW+IL +TA+ 
Sbjct  732  ELAAVSVENSVIAGFSFGVMLGMGSALETLCGQAFGAGQLDMLGVYMQRSWVILTSTAVL  791

Query  588  LTTLYIFSTPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYVMAS  409
            L+ LYIFS  +LKL+ Q   ISK  G FAVWM+PQLFAY   FP+ +FLQ+QSKI VMA 
Sbjct  792  LSFLYIFSARLLKLIGQTEAISKEAGMFAVWMLPQLFAYAVNFPLAKFLQAQSKIMVMAV  851

Query  408  VSDVALVGHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKGFSQ  229
            ++ V LV H +FSWL MLKL+WGL G AVVLN +W  + VAQ +Y+ SG CG AW GFS 
Sbjct  852  IAAVVLVLHTVFSWLLMLKLQWGLVGAAVVLNASWVLIDVAQLLYIFSGTCGRAWTGFSW  911

Query  228  RAFQNLTGFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGWTLMV  49
            +AFQ+L GFVRLSLAS VM CLE+WYF+ALIL AGY KNAE+SVD  SICMNI GWT+MV
Sbjct  912  KAFQSLWGFVRLSLASAVMLCLEVWYFMALILFAGYLKNAEISVDALSICMNILGWTVMV  971

Query  48   GVGFSAAIS  22
             +G +AAIS
Sbjct  972  ALGCNAAIS  980


 Score =   386 bits (991),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 186/302 (62%), Positives = 231/302 (76%), Gaps = 0/302 (0%)
 Frame = -1

Query  927  DIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHVGNIQLAAVAV  748
            D+  I  V +F REF  ESKKLW++A PAIFT   +YS+GAITQVF GH+G +QLAA AV
Sbjct  68   DMDPINGVGDFFREFRVESKKLWHIAGPAIFTYLCRYSLGAITQVFVGHIGALQLAAFAV  127

Query  747  ENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNATAIPLTTLYIF  568
            EN++I+ F+ G M GMGSALETLCGQAFGA +L+MLGVY+QRSWIIL  TA+PL+ +YIF
Sbjct  128  ENSVISMFSLGTMLGMGSALETLCGQAFGAGQLDMLGVYMQRSWIILVTTALPLSLIYIF  187

Query  567  STPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYVMASVSDVALV  388
            +  ILKL+ +   ISKA G FA+WM+PQLF+Y  +FPI +FLQSQ K+ V++  + V LV
Sbjct  188  AEQILKLIGETEEISKAAGVFALWMLPQLFSYALSFPISKFLQSQRKMLVLSLTAGVTLV  247

Query  387  GHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKGFSQRAFQNLT  208
             H  FSWL ++KL WGL G AVVLN + W    A F Y++SG+CG AW GFS +AFQNL 
Sbjct  248  LHAFFSWLLIMKLGWGLVGAAVVLNVSSWLPVAANFSYILSGSCGQAWSGFSSKAFQNLW  307

Query  207  GFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGWTLMVGVGFSAA  28
             FV+LSLAS VM CLE+WYF+ LIL AGY KNAEVSVD  SICM I GW +M+ +GF+AA
Sbjct  308  AFVKLSLASAVMLCLEVWYFMVLILFAGYLKNAEVSVDALSICMTILGWAVMLSIGFNAA  367

Query  27   IS  22
            +S
Sbjct  368  VS  369



>ref|XP_010044580.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Eucalyptus grandis]
Length=537

 Score =   403 bits (1035),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 200/321 (62%), Positives = 241/321 (75%), Gaps = 0/321 (0%)
 Frame = -1

Query  984  NTQIS*NMSSVYSFDADAGDIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGA  805
            N  +S  ++  + F   A DI  IK  ++F+REF  ESKKLW+LA PAIFT    YS+GA
Sbjct  41   NQPLSTTVNHAFIFTPRADDIPPIKGPRDFLREFAKESKKLWFLAGPAIFTSLCWYSLGA  100

Query  804  ITQVFAGHVGNIQLAAVAVENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQ  625
            ITQVFAGHVG + LAAV+VEN++IA F+ G+M GMGSALETLCGQA+GA +L+MLG+YLQ
Sbjct  101  ITQVFAGHVGTLDLAAVSVENSVIACFSTGVMLGMGSALETLCGQAYGAGQLDMLGIYLQ  160

Query  624  RSWIILNATAIPLTTLYIFSTPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRF  445
            RSW+ILN TA+ L  LYIF+  +L+L+ Q   IS   G FAVWMIPQLF Y   FPI +F
Sbjct  161  RSWVILNTTAVALCFLYIFAAKLLRLIGQTEAISDEAGMFAVWMIPQLFMYAMNFPIAKF  220

Query  444  LQSQSKIYVMASVSDVALVGHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVS  265
            LQ+QSKI VMA ++ V LV H++FSWL MLKL WGL G AVVL+ +W  +  A   Y+ S
Sbjct  221  LQAQSKIMVMAVIAGVVLVLHIVFSWLLMLKLGWGLVGAAVVLDASWVVIVAALLAYIFS  280

Query  264  GACGDAWKGFSQRAFQNLTGFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTS  85
            G CG AW GFS +AF+NL GFVRLSLAS VM CLE+WYF+ALIL AGY KNAEVSVD  S
Sbjct  281  GTCGRAWTGFSWKAFENLWGFVRLSLASAVMLCLEVWYFMALILFAGYLKNAEVSVDALS  340

Query  84   ICMNISGWTLMVGVGFSAAIS  22
            ICMNI GWTLM  +G +AAIS
Sbjct  341  ICMNILGWTLMEALGMNAAIS  361



>ref|XP_011086626.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X3 [Sesamum 
indicum]
Length=448

 Score =   400 bits (1027),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 200/308 (65%), Positives = 236/308 (77%), Gaps = 0/308 (0%)
 Frame = -1

Query  945  FDADAGDIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHVGNIQ  766
            F  D  DI  I  V  F   F  ES+KLWYLA PAIFT   Q+S+GAITQ  AGHVG + 
Sbjct  38   FIVDGDDIPPITGVGSFFEAFKVESEKLWYLAGPAIFTAFCQFSLGAITQTLAGHVGTLD  97

Query  765  LAAVAVENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNATAIPL  586
            LAA A+EN +IAGF+FGIM+GMGSALETLCGQA+GA +++MLGVY+QRS ++L  T++ L
Sbjct  98   LAAFAIENTVIAGFSFGIMWGMGSALETLCGQAYGAGQIDMLGVYMQRSCVVLLTTSLLL  157

Query  585  TTLYIFSTPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYVMASV  406
            T LYIF+ PIL LL Q   +SKA G  ++WMIPQL+AY   FPI RFLQ+QSKI  MA +
Sbjct  158  TFLYIFAEPILLLLGQKEDMSKAAGRLSLWMIPQLYAYAMNFPISRFLQAQSKIMAMAWI  217

Query  405  SDVALVGHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKGFSQR  226
            S V LV HV FSWLFMLKL WG+ GGAVVLN +WWF+ VAQ VY+ SGACGDAW GFS +
Sbjct  218  SAVGLVLHVFFSWLFMLKLEWGMAGGAVVLNISWWFIVVAQLVYIFSGACGDAWTGFSWK  277

Query  225  AFQNLTGFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGWTLMVG  46
            AFQNL GFVRLSLAS VM CLE+WY  AL+L AGY KNAEV+VD  SIC+NI GWT MV 
Sbjct  278  AFQNLWGFVRLSLASAVMMCLEVWYMTALVLFAGYVKNAEVAVDALSICINIDGWTKMVA  337

Query  45   VGFSAAIS  22
            +G +AA+S
Sbjct  338  IGLNAAVS  345



>ref|XP_010425356.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Camelina sativa]
 ref|XP_010425357.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Camelina sativa]
Length=500

 Score =   401 bits (1031),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 195/306 (64%), Positives = 234/306 (76%), Gaps = 0/306 (0%)
 Frame = -1

Query  939  ADAGDIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHVGNIQLA  760
            + A DI  I  V  F+REF  E+KKLWYLA PAIFT  +QYS+GA+TQVFAGH+  I LA
Sbjct  24   SPADDIPPITTVGGFVREFNVETKKLWYLAGPAIFTSMNQYSLGAVTQVFAGHINTISLA  83

Query  759  AVAVENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNATAIPLTT  580
            AV+VEN++IAGF+FGIM GMGSALETLCGQAFGA KL MLGVYLQRSW+ILN TA+ LT 
Sbjct  84   AVSVENSVIAGFSFGIMLGMGSALETLCGQAFGAGKLSMLGVYLQRSWVILNVTALILTL  143

Query  579  LYIFSTPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYVMASVSD  400
            LYIF+ PIL  + Q   IS A G F+++MIPQ+FAY   FP  +FLQSQSKI VMA++S 
Sbjct  144  LYIFAAPILAFIGQTAAISSAAGIFSIYMIPQIFAYAVNFPTAKFLQSQSKIMVMAAISA  203

Query  399  VALVGHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKGFSQRAF  220
            VALV HV  +W  + +L+WG+PG AVVLN +WW +  AQ VY+ SG CG+AW G S  AF
Sbjct  204  VALVVHVPLTWFVIERLQWGMPGLAVVLNLSWWLIVTAQLVYIFSGTCGEAWSGLSWEAF  263

Query  219  QNLTGFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGWTLMVGVG  40
             NL  FVRLSLAS VM CLE+WYF+A+IL AGY K+AEVSV   SICMNI GWT M+ +G
Sbjct  264  HNLWSFVRLSLASAVMLCLEVWYFMAIILFAGYLKDAEVSVAALSICMNILGWTAMIAIG  323

Query  39   FSAAIS  22
             + A+S
Sbjct  324  MNTAVS  329



>ref|XP_006417171.1| hypothetical protein EUTSA_v10007376mg [Eutrema salsugineum]
 gb|ESQ35524.1| hypothetical protein EUTSA_v10007376mg [Eutrema salsugineum]
Length=519

 Score =   402 bits (1032),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 197/313 (63%), Positives = 238/313 (76%), Gaps = 0/313 (0%)
 Frame = -1

Query  960  SSVYSFDADAGDIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGH  781
            SS+ SF + A DI  I  V +FIREF  ESKKLW LA PAIFT  +Q+S+GA+TQVFAGH
Sbjct  37   SSLVSFSSTAVDIPPISGVGDFIREFRIESKKLWKLAGPAIFTSMAQFSLGAVTQVFAGH  96

Query  780  VGNIQLAAVAVENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNA  601
            +  I LAAV++EN++IAGF+FGIM GMGSALETLCGQAFGA K+ +LGVYLQRSW+IL A
Sbjct  97   ISTIALAAVSIENSVIAGFSFGIMLGMGSALETLCGQAFGAGKVSLLGVYLQRSWVILTA  156

Query  600  TAIPLTTLYIFSTPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIY  421
            TA+ L+ LYIF+ PIL  + Q P IS   G F+++MIPQ+FAY   FP  +FLQSQSKI 
Sbjct  157  TALILSLLYIFAAPILTFIGQTPAISAMAGLFSIYMIPQIFAYAINFPTAKFLQSQSKIM  216

Query  420  VMASVSDVALVGHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWK  241
             MA++S VALV H   +WL M + +WGLPG A VLNT+W F+ VAQ VY+ SG CG+AW 
Sbjct  217  AMAAISGVALVTHTFLTWLVMSRFQWGLPGLAFVLNTSWLFIVVAQLVYIFSGTCGEAWS  276

Query  240  GFSQRAFQNLTGFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGW  61
            G +  AF NL GFV+LSLAS VM CLE+WYF+AL+L AGY KNAEVSV   SICMNI GW
Sbjct  277  GLTWEAFHNLWGFVKLSLASAVMICLEVWYFMALVLFAGYLKNAEVSVAALSICMNILGW  336

Query  60   TLMVGVGFSAAIS  22
              MV  G +AA+S
Sbjct  337  AAMVSFGINAAVS  349



>ref|XP_010514303.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Camelina sativa]
Length=498

 Score =   400 bits (1028),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 193/306 (63%), Positives = 234/306 (76%), Gaps = 0/306 (0%)
 Frame = -1

Query  939  ADAGDIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHVGNIQLA  760
            + A DI  I  V  F+REF  E+KKLWYLA PAIFT  +QYS+GA+TQVFAGH+  I LA
Sbjct  22   SSADDIPPITTVGGFVREFNVETKKLWYLAGPAIFTSMNQYSLGAVTQVFAGHISTISLA  81

Query  759  AVAVENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNATAIPLTT  580
            AV+VEN+++AGF+FGIM GMGSALETLCGQAFGA KL MLGVYLQRSW+ILN TA+ LT 
Sbjct  82   AVSVENSVVAGFSFGIMLGMGSALETLCGQAFGAGKLSMLGVYLQRSWVILNVTALILTL  141

Query  579  LYIFSTPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYVMASVSD  400
            LYIF+ PIL  + Q   IS   G F+++MIPQ+FAY   FP  +FLQSQSKI VMA++S 
Sbjct  142  LYIFAAPILAFIGQTAAISSTAGIFSIYMIPQIFAYAVNFPTAKFLQSQSKIMVMAAISA  201

Query  399  VALVGHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKGFSQRAF  220
            VALV HV  +W  + +L+WG+PG AVVLN +WW +  AQ VY+ SGACG+AW G S  AF
Sbjct  202  VALVVHVPLTWFVIERLQWGMPGLAVVLNLSWWLIVTAQLVYIFSGACGEAWSGLSWEAF  261

Query  219  QNLTGFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGWTLMVGVG  40
             NL  FVRLSLAS VM CLE+WYF+A+IL AGY K+AE+SV   SICMNI GWT M+ +G
Sbjct  262  HNLWSFVRLSLASAVMLCLEVWYFMAIILFAGYLKDAEISVAALSICMNILGWTAMIAIG  321

Query  39   FSAAIS  22
             + A+S
Sbjct  322  MNTAVS  327



>ref|XP_010556333.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Tarenaya hassleriana]
Length=511

 Score =   400 bits (1029),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 196/303 (65%), Positives = 232/303 (77%), Gaps = 0/303 (0%)
 Frame = -1

Query  930  GDIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHVGNIQLAAVA  751
            GDI  I    +F+REF  ESKKLWYLA PAIFT  SQYS+GA+TQVFAGH+  + LAAV+
Sbjct  38   GDIPPISGFGDFVREFNVESKKLWYLAGPAIFTSLSQYSLGAVTQVFAGHISTLSLAAVS  97

Query  750  VENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNATAIPLTTLYI  571
            VEN++IAGF+FGIM GMGSALETLCGQAFGA KL MLGVYLQRSW+ILNATAI L  LY+
Sbjct  98   VENSVIAGFSFGIMLGMGSALETLCGQAFGAGKLSMLGVYLQRSWVILNATAIILCLLYV  157

Query  570  FSTPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYVMASVSDVAL  391
            F+  IL  + Q   IS+A G F+++MIPQLFAY   FP  +FLQ+QSKI  MA +S  AL
Sbjct  158  FAAQILAFIGQTRSISQAAGLFSIYMIPQLFAYALNFPTAKFLQAQSKIMAMAVISAAAL  217

Query  390  VGHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKGFSQRAFQNL  211
            V H LFSW+ + KLRWG+ G A VLN +WWF+ VAQ  Y++ G CG++W GFS  AF NL
Sbjct  218  VMHALFSWVTVAKLRWGMEGLAAVLNGSWWFIVVAQIAYILGGTCGESWSGFSWEAFHNL  277

Query  210  TGFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGWTLMVGVGFSA  31
              FVRLSLAS VM CLE+WYF+AL+L AGY KNAEVSV   SICMNI GW  MV +G +A
Sbjct  278  WSFVRLSLASAVMLCLEVWYFMALVLFAGYLKNAEVSVAALSICMNILGWAAMVAIGTNA  337

Query  30   AIS  22
            A+S
Sbjct  338  AVS  340



>ref|XP_006852294.1| hypothetical protein AMTR_s00049p00187420 [Amborella trichopoda]
 gb|ERN13761.1| hypothetical protein AMTR_s00049p00187420 [Amborella trichopoda]
Length=496

 Score =   400 bits (1027),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 189/303 (62%), Positives = 240/303 (79%), Gaps = 0/303 (0%)
 Frame = -1

Query  930  GDIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHVGNIQLAAVA  751
            GD+  ++ + EF REF  ESKKLWYLA PAIFT   QYS+GAITQ FAGHVG ++LAAV+
Sbjct  25   GDVEPVRSLGEFNREFVVESKKLWYLAGPAIFTSICQYSLGAITQAFAGHVGTLELAAVS  84

Query  750  VENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNATAIPLTTLYI  571
            +EN++IAGF+ G++ GMGSALETLCGQA+GA +L+MLG+Y+QRSW+IL  TA+ L+  Y+
Sbjct  85   MENSVIAGFSLGLLLGMGSALETLCGQAYGAGQLDMLGIYMQRSWVILLTTALILSIFYV  144

Query  570  FSTPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYVMASVSDVAL  391
            F+TP L L+ Q+  I+ A G F+++MIPQLFAY   FPIQ+FLQ+QSK+  MA ++ +AL
Sbjct  145  FATPFLILIGQDHSIAHATGLFSLYMIPQLFAYAVYFPIQKFLQAQSKMMSMAVIASIAL  204

Query  390  VGHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKGFSQRAFQNL  211
            + H+ FSWL M+KL WG+ G AVVLN +WWF+ VAQ VY+ SG+CG AW GFS +AFQNL
Sbjct  205  LLHIFFSWLVMIKLNWGMVGAAVVLNGSWWFIVVAQLVYIFSGSCGRAWSGFSWKAFQNL  264

Query  210  TGFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGWTLMVGVGFSA  31
             GF RLSLAS VM CLE+WYF+ LIL AGY KN EVSVDG SICMNI GW +M+ +G +A
Sbjct  265  WGFFRLSLASAVMLCLEVWYFMVLILFAGYLKNPEVSVDGMSICMNILGWAVMLAIGSNA  324

Query  30   AIS  22
            A S
Sbjct  325  ATS  327



>ref|NP_189291.1| MATE efflux family protein [Arabidopsis thaliana]
 emb|CAA66809.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAB01841.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAL15295.1| AT3g26590/MFE16_11 [Arabidopsis thaliana]
 gb|AAN73299.1| At3g26590/MFE16_11 [Arabidopsis thaliana]
 gb|AEE77183.1| MATE efflux family protein [Arabidopsis thaliana]
Length=500

 Score =   400 bits (1027),  Expect = 6e-133, Method: Compositional matrix adjust.
 Identities = 195/302 (65%), Positives = 234/302 (77%), Gaps = 0/302 (0%)
 Frame = -1

Query  927  DIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHVGNIQLAAVAV  748
            DI  I  V  F+REF  E+KKLWYLA PAIFT  +QYS+GAITQVFAGH+  I LAAV+V
Sbjct  28   DIPPITTVGGFVREFNVETKKLWYLAGPAIFTSVNQYSLGAITQVFAGHISTIALAAVSV  87

Query  747  ENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNATAIPLTTLYIF  568
            EN+++AGF+FGIM GMGSALETLCGQAFGA KL MLGVYLQRSW+ILN TA+ L+ LYIF
Sbjct  88   ENSVVAGFSFGIMLGMGSALETLCGQAFGAGKLSMLGVYLQRSWVILNVTALILSLLYIF  147

Query  567  STPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYVMASVSDVALV  388
            + PIL  + Q   IS A G F+++MIPQ+FAY   FP  +FLQSQSKI VMA +S VALV
Sbjct  148  AAPILASIGQTAAISSAAGIFSIYMIPQIFAYAINFPTAKFLQSQSKIMVMAVISAVALV  207

Query  387  GHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKGFSQRAFQNLT  208
             HV  +W  ++KL+WG+PG AVVLN +W F+ +AQ VY+ SG CG+AW GFS  AF NL 
Sbjct  208  IHVPLTWFVIVKLQWGMPGLAVVLNASWCFIDMAQLVYIFSGTCGEAWSGFSWEAFHNLW  267

Query  207  GFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGWTLMVGVGFSAA  28
             FVRLSLAS VM CLE+WYF+A+IL AGY KNAE+SV   SICMNI GWT M+ +G + A
Sbjct  268  SFVRLSLASAVMLCLEVWYFMAIILFAGYLKNAEISVAALSICMNILGWTAMIAIGMNTA  327

Query  27   IS  22
            +S
Sbjct  328  VS  329



>ref|XP_009601126.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Nicotiana tomentosiformis]
Length=326

 Score =   394 bits (1011),  Expect = 6e-133, Method: Compositional matrix adjust.
 Identities = 195/313 (62%), Positives = 235/313 (75%), Gaps = 11/313 (4%)
 Frame = -1

Query  987  KNTQIS*NMSSVY-----------SFDADAGDIRQIKKVKEFIREFYSESKKLWYLAAPA  841
            K+ QI+   S  Y           SF AD+ DI  I   ++F REF  ESKKLWYLA PA
Sbjct  13   KDPQITDQASDNYLIRLSHTSFASSFVADSDDIPPITGFRDFFREFSVESKKLWYLAGPA  72

Query  840  IFTIASQYSIGAITQVFAGHVGNIQLAAVAVENNLIAGFAFGIMYGMGSALETLCGQAFG  661
            IFT   QYS+GA+TQ FAGHVG ++LAAV+VEN++IAGF+FG+M GMGSALETLCGQAFG
Sbjct  73   IFTSLCQYSLGAVTQTFAGHVGTLELAAVSVENSVIAGFSFGVMLGMGSALETLCGQAFG  132

Query  660  AKKLEMLGVYLQRSWIILNATAIPLTTLYIFSTPILKLLHQNPHISKAVGTFAVWMIPQL  481
            A +++MLGVY+QRSW+ILN TA+ L  LYIF+ P L+L+ Q   IS+  G  A++MIPQL
Sbjct  133  AGQIDMLGVYMQRSWVILNTTAVILMLLYIFAAPFLRLIGQTEDISREAGKMALYMIPQL  192

Query  480  FAYVFTFPIQRFLQSQSKIYVMASVSDVALVGHVLFSWLFMLKLRWGLPGGAVVLNTTWW  301
            +AY   FPI +FLQSQSKI VMA ++ +ALV H  FSWLFMLKL WGL G AVVLN++WW
Sbjct  193  YAYAMNFPIAKFLQSQSKIMVMAWIAAIALVLHTFFSWLFMLKLGWGLVGAAVVLNSSWW  252

Query  300  FMAVAQFVYVVSGACGDAWKGFSQRAFQNLTGFVRLSLASGVMFCLELWYFVALILIAGY  121
            F+ VAQ +Y+ SG CG AW GFS +AF NL GFVRLSLAS VM CLE WYF+AL+L AGY
Sbjct  253  FIVVAQLLYIFSGTCGQAWSGFSWKAFHNLWGFVRLSLASAVMLCLETWYFMALVLFAGY  312

Query  120  TKNAEVSVDGTSI  82
             KNAEV+VD  SI
Sbjct  313  LKNAEVAVDALSI  325



>ref|XP_010100394.1| Protein TRANSPARENT TESTA 12 [Morus notabilis]
 gb|EXB82528.1| Protein TRANSPARENT TESTA 12 [Morus notabilis]
Length=521

 Score =   400 bits (1029),  Expect = 6e-133, Method: Compositional matrix adjust.
 Identities = 200/305 (66%), Positives = 240/305 (79%), Gaps = 0/305 (0%)
 Frame = -1

Query  936  DAGDIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHVGNIQLAA  757
            DA DI  I +V++F REF +ESKKLWYLA PAIFT   QYS+GA+TQVFAG V  + LAA
Sbjct  45   DADDIPPIGRVRDFYREFCTESKKLWYLAGPAIFTSICQYSLGAVTQVFAGQVDTLSLAA  104

Query  756  VAVENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNATAIPLTTL  577
             +VEN++IAGF+FGIM GMGSALETLCGQAFGA +L+MLG+Y+QRSW+ILN+TA+ L+ +
Sbjct  105  FSVENSVIAGFSFGIMVGMGSALETLCGQAFGAGQLDMLGIYMQRSWVILNSTALILSFI  164

Query  576  YIFSTPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYVMASVSDV  397
            YIF+ P+LKL+ Q   IS+A G  A+WMIPQLFAY   FPI +FLQ+QSK+  MA ++  
Sbjct  165  YIFAEPLLKLIGQTTEISEAAGVVAIWMIPQLFAYAIYFPISKFLQAQSKMAAMAWIAAA  224

Query  396  ALVGHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKGFSQRAFQ  217
            ALV H  FSWL MLKL WGL GGA+VLN +WWF+ VAQ VY+ SG CG AW GFS +AFQ
Sbjct  225  ALVLHTFFSWLLMLKLGWGLAGGALVLNASWWFIVVAQLVYIFSGTCGRAWSGFSWKAFQ  284

Query  216  NLTGFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGWTLMVGVGF  37
            NL GFVRLS+ S VM CLE WYF+ALIL AGY KNA VSV   SI MNI GWT+MV +G 
Sbjct  285  NLWGFVRLSIESAVMLCLETWYFMALILFAGYLKNAVVSVAALSIFMNILGWTIMVALGI  344

Query  36   SAAIS  22
            +AAIS
Sbjct  345  NAAIS  349



>ref|XP_010100396.1| Protein TRANSPARENT TESTA 12 [Morus notabilis]
 gb|EXB82530.1| Protein TRANSPARENT TESTA 12 [Morus notabilis]
Length=556

 Score =   402 bits (1032),  Expect = 8e-133, Method: Compositional matrix adjust.
 Identities = 206/315 (65%), Positives = 246/315 (78%), Gaps = 0/315 (0%)
 Frame = -1

Query  966  NMSSVYSFDADAGDIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFA  787
            N SS  SF     DI  I  V++F REF SESKKLWYLA PAIFT   +YS+GAITQVFA
Sbjct  34   NPSSSSSFTPSDHDIPPIDGVRDFFREFRSESKKLWYLAGPAIFTSICRYSLGAITQVFA  93

Query  786  GHVGNIQLAAVAVENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIIL  607
            GH+  + LAAV+VEN++IAGF+FG+M GMGSALETLCGQA+GA +++MLGVYLQRSW+IL
Sbjct  94   GHIDTLALAAVSVENSVIAGFSFGVMLGMGSALETLCGQAYGAGQIDMLGVYLQRSWVIL  153

Query  606  NATAIPLTTLYIFSTPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSK  427
              T + L+ +YIF+ P+LKL+ Q P IS+A GTFA+WMIPQLFAY   FPI +FLQ+QSK
Sbjct  154  LTTGVILSPIYIFAEPLLKLIGQTPEISEAAGTFAIWMIPQLFAYSMNFPIAKFLQAQSK  213

Query  426  IYVMASVSDVALVGHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDA  247
            I VMA+++  ALV H  FSWL +LKL WGL G AVVLN +WWF+ VA  VY+ SG+CG A
Sbjct  214  IMVMAAIAAAALVLHTFFSWLLILKLGWGLVGAAVVLNASWWFIIVALLVYIFSGSCGRA  273

Query  246  WKGFSQRAFQNLTGFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNIS  67
            W GFS +AF NL GFV+LS AS VM CLE WYF+ALIL AGY KNA+VSVD  SICMNI 
Sbjct  274  WSGFSWKAFHNLWGFVKLSFASAVMLCLETWYFMALILFAGYLKNAQVSVDALSICMNIL  333

Query  66   GWTLMVGVGFSAAIS  22
            GWT+MV  G +AAIS
Sbjct  334  GWTIMVSFGINAAIS  348



>ref|XP_003517712.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Glycine max]
Length=518

 Score =   400 bits (1027),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 201/319 (63%), Positives = 241/319 (76%), Gaps = 4/319 (1%)
 Frame = -1

Query  945  FDADAGDIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHVGNIQ  766
            F A   DI  I    +F REF  ESKKLWYLA PAIF+  S+YS+GA TQ+FAGHVG I 
Sbjct  35   FSAGTPDIAPITGAGDFYREFMVESKKLWYLAGPAIFSFVSKYSLGAFTQIFAGHVGTID  94

Query  765  LAAVAVENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNATAIPL  586
            LAAV+VEN+LIAGF++GIM GMGSALETLCGQA GA KL+MLGVY+QRSW++L +TA  L
Sbjct  95   LAAVSVENSLIAGFSYGIMLGMGSALETLCGQAVGAGKLDMLGVYMQRSWVLLLSTACVL  154

Query  585  TTLYIFSTPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYVMASV  406
              LYIF+  +LKL+ Q+  IS+A GTFA+WMIPQLFAY   FP+ +FLQ+QSK+ V+A++
Sbjct  155  CPLYIFAGQVLKLIGQDTEISEAAGTFAIWMIPQLFAYALNFPVAKFLQAQSKVMVIAAI  214

Query  405  SDVALVGHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKGFSQR  226
            + +A+V H + SWL M+KL WGL G AVVLN +WWF+ VAQ VYV  G C  AW GFS  
Sbjct  215  AGMAMVLHPVLSWLLMVKLEWGLVGAAVVLNGSWWFVVVAQLVYVFGGWCWPAWNGFSWE  274

Query  225  AFQNLTGFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGWTLMVG  46
            AF++L GF RLSLAS VM CLE WYF+ALIL AGY KNA+VSVD  SICMNI GWT+MV 
Sbjct  275  AFRSLWGFFRLSLASAVMLCLETWYFMALILFAGYLKNAQVSVDAFSICMNILGWTIMVS  334

Query  45   VGFSAA----ISNNLFRRR  1
             G +AA    ISN L  R 
Sbjct  335  FGMNAATSVRISNELGARH  353



>ref|XP_011086624.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Sesamum 
indicum]
Length=516

 Score =   399 bits (1026),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 200/308 (65%), Positives = 236/308 (77%), Gaps = 0/308 (0%)
 Frame = -1

Query  945  FDADAGDIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHVGNIQ  766
            F  D  DI  I  V  F   F  ES+KLWYLA PAIFT   Q+S+GAITQ  AGHVG + 
Sbjct  38   FIVDGDDIPPITGVGSFFEAFKVESEKLWYLAGPAIFTAFCQFSLGAITQTLAGHVGTLD  97

Query  765  LAAVAVENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNATAIPL  586
            LAA A+EN +IAGF+FGIM+GMGSALETLCGQA+GA +++MLGVY+QRS ++L  T++ L
Sbjct  98   LAAFAIENTVIAGFSFGIMWGMGSALETLCGQAYGAGQIDMLGVYMQRSCVVLLTTSLLL  157

Query  585  TTLYIFSTPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYVMASV  406
            T LYIF+ PIL LL Q   +SKA G  ++WMIPQL+AY   FPI RFLQ+QSKI  MA +
Sbjct  158  TFLYIFAEPILLLLGQKEDMSKAAGRLSLWMIPQLYAYAMNFPISRFLQAQSKIMAMAWI  217

Query  405  SDVALVGHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKGFSQR  226
            S V LV HV FSWLFMLKL WG+ GGAVVLN +WWF+ VAQ VY+ SGACGDAW GFS +
Sbjct  218  SAVGLVLHVFFSWLFMLKLEWGMAGGAVVLNISWWFIVVAQLVYIFSGACGDAWTGFSWK  277

Query  225  AFQNLTGFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGWTLMVG  46
            AFQNL GFVRLSLAS VM CLE+WY  AL+L AGY KNAEV+VD  SIC+NI GWT MV 
Sbjct  278  AFQNLWGFVRLSLASAVMMCLEVWYMTALVLFAGYVKNAEVAVDALSICINIDGWTKMVA  337

Query  45   VGFSAAIS  22
            +G +AA+S
Sbjct  338  IGLNAAVS  345



>ref|XP_007044785.1| MATE efflux family protein isoform 2, partial [Theobroma cacao]
 gb|EOY00617.1| MATE efflux family protein isoform 2, partial [Theobroma cacao]
Length=475

 Score =   397 bits (1020),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 203/302 (67%), Positives = 240/302 (79%), Gaps = 0/302 (0%)
 Frame = -1

Query  927  DIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHVGNIQLAAVAV  748
            D+  I  V++F REF +ESKKLW+LA PAIFT   QYS+GAITQVF+G VG + LAAV+V
Sbjct  2    DVPPINGVRDFSREFLTESKKLWFLAGPAIFTSICQYSLGAITQVFSGQVGTLALAAVSV  61

Query  747  ENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNATAIPLTTLYIF  568
            EN++IAGF+FG M GMGSALETLCGQAFGA  ++MLGVY+QRSWIILN+TA+ L  LYIF
Sbjct  62   ENSVIAGFSFGAMLGMGSALETLCGQAFGAGHIDMLGVYMQRSWIILNSTALVLLFLYIF  121

Query  567  STPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYVMASVSDVALV  388
            +  ILKL+ Q   ISKA GTFA+WMIPQLFAY   FPI +FLQSQSKI VMA ++  ALV
Sbjct  122  AEQILKLIGQTEEISKAAGTFAIWMIPQLFAYAMNFPIAKFLQSQSKIMVMAVIAAAALV  181

Query  387  GHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKGFSQRAFQNLT  208
             H +FSWL ML+L WGL G A+VLN +W F+  AQF Y++SG CG AW GFS +AFQNL 
Sbjct  182  LHTVFSWLLMLRLGWGLVGAALVLNASWIFIVAAQFSYIISGTCGRAWTGFSWKAFQNLW  241

Query  207  GFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGWTLMVGVGFSAA  28
            GFVRLSLAS VM CLE+WYF+ALIL AGY KNAEVSVD  SIC NI GWT+MV +G + A
Sbjct  242  GFVRLSLASAVMLCLEVWYFMALILFAGYLKNAEVSVDALSICCNILGWTVMVALGMNVA  301

Query  27   IS  22
            +S
Sbjct  302  VS  303



>ref|XP_007044783.1| MATE efflux family protein [Theobroma cacao]
 gb|EOY00615.1| MATE efflux family protein [Theobroma cacao]
Length=520

 Score =   399 bits (1024),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 204/312 (65%), Positives = 249/312 (80%), Gaps = 0/312 (0%)
 Frame = -1

Query  957  SVYSFDADAGDIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHV  778
            S  +F   A D+  I  V++F REF +ESKKLW+LA PAIFT   QYS+GAITQVF+G V
Sbjct  35   SSTTFTPAAHDVPPINGVRDFSREFLTESKKLWFLAGPAIFTSICQYSLGAITQVFSGQV  94

Query  777  GNIQLAAVAVENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNAT  598
            G + LAAV+VEN++IAGF+FG M GMGSALETLCGQAFGA +L+MLG+Y+QRSW+ILN+T
Sbjct  95   GTLALAAVSVENSVIAGFSFGAMLGMGSALETLCGQAFGAGQLDMLGIYMQRSWVILNST  154

Query  597  AIPLTTLYIFSTPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYV  418
            A+ L+ LYIF+ PIL L+ Q   ISKA G F++WMIPQLFAY   FP+ +FLQ+QSKI V
Sbjct  155  ALILSLLYIFAAPILNLIGQTASISKAAGIFSIWMIPQLFAYAVNFPMAKFLQAQSKIMV  214

Query  417  MASVSDVALVGHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKG  238
            MA ++ VALV H LFSWL MLKL  GL G A+VLN +W F+ VAQF+Y++SG CG AW G
Sbjct  215  MAVIAGVALVLHTLFSWLLMLKLGLGLVGAAIVLNASWIFIDVAQFLYIISGTCGRAWTG  274

Query  237  FSQRAFQNLTGFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGWT  58
            FS +AFQ+L GFVRLSLAS +M CLE+WYF+ALIL AGY K+AEVSVD  SICMNI GWT
Sbjct  275  FSWKAFQHLWGFVRLSLASAIMLCLEVWYFMALILFAGYLKDAEVSVDALSICMNILGWT  334

Query  57   LMVGVGFSAAIS  22
            +MV +G +AAIS
Sbjct  335  VMVALGMNAAIS  346



>emb|CDY13643.1| BnaA06g32800D [Brassica napus]
Length=503

 Score =   398 bits (1022),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 199/306 (65%), Positives = 235/306 (77%), Gaps = 0/306 (0%)
 Frame = -1

Query  939  ADAGDIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHVGNIQLA  760
            + A DI  I  +  F++EF  E+KKLWYLA PAIFT  +QYS+GA+TQVFAGHV  I LA
Sbjct  27   SPANDIPPITTIGGFVKEFNVETKKLWYLAGPAIFTSVNQYSLGAVTQVFAGHVSTIALA  86

Query  759  AVAVENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNATAIPLTT  580
            AV+VEN++IAGF+FGIM GMGSALETLCGQAFGA KL MLGVYLQRSW+ILN TA+ LT 
Sbjct  87   AVSVENSVIAGFSFGIMLGMGSALETLCGQAFGAGKLSMLGVYLQRSWVILNVTALILTL  146

Query  579  LYIFSTPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYVMASVSD  400
            LYIF+ PIL  + Q P IS A G F+++MIPQ+FAY   FP  +FLQSQSKI VMA++S 
Sbjct  147  LYIFAAPILASIGQTPAISSAAGLFSIYMIPQIFAYAVNFPTAKFLQSQSKIMVMAAISA  206

Query  399  VALVGHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKGFSQRAF  220
             AL  HV  +W  M KL+WG+ G AVVLN +WWF+ VAQ VY+ SG CG+AW G S  AF
Sbjct  207  AALALHVPITWFVMEKLKWGMAGLAVVLNASWWFIDVAQLVYIFSGTCGEAWSGLSWEAF  266

Query  219  QNLTGFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGWTLMVGVG  40
             NL GFVRLSLAS VM CLE+WYF+A+IL AGY KNAEVSV   SICMNI GWT MV +G
Sbjct  267  HNLWGFVRLSLASAVMLCLEVWYFMAIILFAGYLKNAEVSVAALSICMNILGWTAMVAIG  326

Query  39   FSAAIS  22
             + A+S
Sbjct  327  MNTAVS  332



>ref|XP_003613128.1| Protein TRANSPARENT TESTA [Medicago truncatula]
 gb|AES96086.1| MATE efflux family protein [Medicago truncatula]
Length=517

 Score =   398 bits (1023),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 198/321 (62%), Positives = 240/321 (75%), Gaps = 0/321 (0%)
 Frame = -1

Query  984  NTQIS*NMSSVYSFDADAGDIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGA  805
            NT      S+   F A A D+  I   K+F ++F  ESKKLWYLA PAIF+  S+YS+GA
Sbjct  21   NTNFPSPPSNTAIFTAAAPDMDLITSPKDFFKQFIVESKKLWYLAGPAIFSFVSKYSLGA  80

Query  804  ITQVFAGHVGNIQLAAVAVENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQ  625
            +TQ+FAGHV  I LAAV+VEN+LIAGF+FG+M GMGSALETLCGQA GA KL+MLG+Y+Q
Sbjct  81   VTQIFAGHVSTIDLAAVSVENSLIAGFSFGLMLGMGSALETLCGQAVGAGKLDMLGIYMQ  140

Query  624  RSWIILNATAIPLTTLYIFSTPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRF  445
            RSW+IL + A PL  LYIF+  ILK + Q   IS+A GTFA++MIPQLFAY   FP+ +F
Sbjct  141  RSWVILFSMAFPLCLLYIFAGSILKFIGQTTEISEAAGTFALYMIPQLFAYALNFPVAKF  200

Query  444  LQSQSKIYVMASVSDVALVGHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVS  265
            LQ+QS + V+A +S VA+V H +FSWL M+K  WGL G AV LN +WWF+ VAQ  YV S
Sbjct  201  LQAQSMVIVIAVISGVAMVLHPVFSWLLMVKFGWGLVGAAVSLNGSWWFIVVAQLGYVFS  260

Query  264  GACGDAWKGFSQRAFQNLTGFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTS  85
            G CG AW GFS  AF+NL GF RLSLAS VM CLE WYF+ALIL AGY KNAE+SVD  S
Sbjct  261  GKCGIAWNGFSFEAFRNLWGFFRLSLASAVMLCLETWYFMALILFAGYLKNAEISVDAFS  320

Query  84   ICMNISGWTLMVGVGFSAAIS  22
            ICMNI GWT+MV +G + A+S
Sbjct  321  ICMNILGWTVMVSLGMNVAVS  341



>ref|XP_010502590.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Camelina 
sativa]
Length=501

 Score =   397 bits (1021),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 191/306 (62%), Positives = 234/306 (76%), Gaps = 0/306 (0%)
 Frame = -1

Query  939  ADAGDIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHVGNIQLA  760
            + A DI  I  V  F+REF  E+KKLWYLA PAIFT  +QYS+GA+TQVFAGH+  + LA
Sbjct  25   SPADDISPITTVGGFVREFNVETKKLWYLAGPAIFTSMNQYSLGAVTQVFAGHISTVSLA  84

Query  759  AVAVENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNATAIPLTT  580
            AV+VEN+++AGF+FGIM GMGSALETLCGQAFGA KL MLGVYLQRSW+ILN TA+ LT 
Sbjct  85   AVSVENSVVAGFSFGIMLGMGSALETLCGQAFGAGKLSMLGVYLQRSWVILNVTALILTL  144

Query  579  LYIFSTPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYVMASVSD  400
            LYIF+ PIL  + Q   IS A G F+++MIPQ+FAY   FP  +FLQSQSKI VMA++S 
Sbjct  145  LYIFAAPILAFIGQTAAISSAAGIFSIYMIPQIFAYAVNFPTAKFLQSQSKIMVMAAISA  204

Query  399  VALVGHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKGFSQRAF  220
            VALV HV  +W  + +L+WG+PG AVVLN +WW +  AQ VY+ SG CG+AW G S  AF
Sbjct  205  VALVVHVPLTWFVIERLQWGMPGLAVVLNLSWWLIVTAQLVYIFSGTCGEAWSGLSWEAF  264

Query  219  QNLTGFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGWTLMVGVG  40
             +L  FVRLSLAS VM CLE+WYF+A+IL AGY K+AE+SV   SICMNI GWT M+ +G
Sbjct  265  HHLWSFVRLSLASAVMLCLEVWYFMAIILFAGYLKDAEISVAALSICMNILGWTAMIAIG  324

Query  39   FSAAIS  22
             + A+S
Sbjct  325  MNTAVS  330



>ref|XP_010554152.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Tarenaya hassleriana]
Length=505

 Score =   397 bits (1021),  Expect = 6e-132, Method: Compositional matrix adjust.
 Identities = 197/312 (63%), Positives = 238/312 (76%), Gaps = 1/312 (0%)
 Frame = -1

Query  957  SVYSFDADAGDIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHV  778
            S+ S   DA DI  I  V +F REF  ESKKLW LA PAI T  SQYS+GA+TQVFAGH+
Sbjct  24   SLTSSIGDA-DIGPISGVGDFAREFNVESKKLWSLAGPAILTCVSQYSLGAVTQVFAGHI  82

Query  777  GNIQLAAVAVENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNAT  598
              + LAAV++EN++I+GF+FGIM GMGSALETLCGQAFGA KL MLG+YLQRSW+IL+AT
Sbjct  83   STLSLAAVSIENSVISGFSFGIMLGMGSALETLCGQAFGAGKLSMLGLYLQRSWVILHAT  142

Query  597  AIPLTTLYIFSTPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYV  418
            AI L  +Y+F+TP L  + Q P+IS+A G F+++MIPQLFAY   FP  +FLQSQSK+ V
Sbjct  143  AIVLCLMYVFATPFLAFIGQTPNISRAAGLFSLYMIPQLFAYALNFPASKFLQSQSKMAV  202

Query  417  MASVSDVALVGHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKG  238
            MA +S  ALV H LFSW+ +  LRWGL G AV LN +WWF+AV Q VY++ G CG+AW G
Sbjct  203  MAVISAAALVLHALFSWVAVAILRWGLEGLAVALNGSWWFIAVGQIVYILCGTCGEAWTG  262

Query  237  FSQRAFQNLTGFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGWT  58
             S  AF +L  FVRLSLAS VM CLE+WYF+AL+L AGY KNAEVSV   SICMNI GW 
Sbjct  263  LSWEAFHHLWSFVRLSLASAVMLCLEIWYFMALVLFAGYLKNAEVSVAALSICMNILGWA  322

Query  57   LMVGVGFSAAIS  22
             MV +GF+AA+S
Sbjct  323  AMVAIGFNAAVS  334



>ref|XP_002876984.1| mate efflux family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH53243.1| mate efflux family protein [Arabidopsis lyrata subsp. lyrata]
Length=500

 Score =   397 bits (1020),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 192/302 (64%), Positives = 233/302 (77%), Gaps = 0/302 (0%)
 Frame = -1

Query  927  DIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHVGNIQLAAVAV  748
            DI  I  V  F+REF  E+KKLWYLA PAIFT  +QYS+GAITQVFAGH+  I LAAV+V
Sbjct  28   DIPPITTVGGFVREFNVETKKLWYLAGPAIFTSVNQYSLGAITQVFAGHISTIALAAVSV  87

Query  747  ENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNATAIPLTTLYIF  568
            EN+++AGF+FGIM GMGSALETLCGQAFGA KL MLG+YLQRSW+ILN TA+ L+ LYIF
Sbjct  88   ENSVVAGFSFGIMLGMGSALETLCGQAFGAGKLSMLGIYLQRSWVILNVTALILSLLYIF  147

Query  567  STPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYVMASVSDVALV  388
            + PIL  + Q   IS A G F+++MIPQ+FAY   FP  +FLQSQSKI VMA++S VALV
Sbjct  148  AAPILASIGQTAAISSAAGIFSIYMIPQIFAYAINFPTAKFLQSQSKIMVMAAISAVALV  207

Query  387  GHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKGFSQRAFQNLT  208
             HV  +W  ++KL WG+PG A+VLN +W F+ +AQ VY+ SG CG+AW G S  AF NL 
Sbjct  208  IHVPLTWFVIVKLHWGMPGLAIVLNASWVFIDMAQLVYIFSGTCGEAWSGLSWEAFHNLW  267

Query  207  GFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGWTLMVGVGFSAA  28
             FVRLSLAS VM CLE+WYF+A+IL AGY KNAE+SV   SICMNI GWT M+ +G + A
Sbjct  268  SFVRLSLASAVMLCLEVWYFMAIILFAGYLKNAEISVAALSICMNILGWTAMIAIGMNTA  327

Query  27   IS  22
            +S
Sbjct  328  VS  329



>ref|XP_006438289.1| hypothetical protein CICLE_v10031274mg [Citrus clementina]
 gb|ESR51529.1| hypothetical protein CICLE_v10031274mg [Citrus clementina]
Length=511

 Score =   397 bits (1021),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 205/315 (65%), Positives = 242/315 (77%), Gaps = 0/315 (0%)
 Frame = -1

Query  966  NMSSVYSFDADAGDIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFA  787
            N SS   F A+  DI  I    +F REF  ESKKLWYLA PAIFT   QYS+GA+TQVFA
Sbjct  26   NTSSSAIFIAEVDDIPPITGAVDFFREFSKESKKLWYLAGPAIFTSVCQYSLGAVTQVFA  85

Query  786  GHVGNIQLAAVAVENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIIL  607
            GHV  I LAAV+VEN++IAGF+FG M GMGSALETLCGQA+GA +L+MLGVY+QRSW+IL
Sbjct  86   GHVSTIALAAVSVENSVIAGFSFGAMMGMGSALETLCGQAYGAGQLDMLGVYMQRSWVIL  145

Query  606  NATAIPLTTLYIFSTPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSK  427
            NATA+ L  +YIF+  +L L+ Q P ISKA GT ++WMIPQLFAY   FPI +FLQ+QSK
Sbjct  146  NATALILMLIYIFAQQLLSLIGQTPSISKAAGTLSIWMIPQLFAYAVNFPIAKFLQAQSK  205

Query  426  IYVMASVSDVALVGHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDA  247
            + VMA ++  ALV H L SWL ML+L WGL G AVVLN +WWF+ +AQ  Y+ SG CG A
Sbjct  206  MMVMAIIAASALVLHTLLSWLLMLELGWGLVGAAVVLNASWWFIDLAQMFYIFSGTCGRA  265

Query  246  WKGFSQRAFQNLTGFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNIS  67
            W GFS +AF NL  FVRLSLAS VM CLE+WYF+ALIL AGY KNAE+SVD  SICMNI 
Sbjct  266  WNGFSWKAFHNLWAFVRLSLASAVMLCLEVWYFMALILFAGYLKNAELSVDALSICMNIL  325

Query  66   GWTLMVGVGFSAAIS  22
            GWT+MV +G +AAIS
Sbjct  326  GWTVMVAIGMNAAIS  340



>ref|XP_009152044.1| PREDICTED: protein TRANSPARENT TESTA 12 [Brassica rapa]
Length=530

 Score =   398 bits (1023),  Expect = 7e-132, Method: Compositional matrix adjust.
 Identities = 199/306 (65%), Positives = 235/306 (77%), Gaps = 0/306 (0%)
 Frame = -1

Query  939  ADAGDIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHVGNIQLA  760
            + A DI  I  +  F++EF  E+KKLWYLA PAIFT  +QYS+GA+TQVFAGHV  I LA
Sbjct  54   SPANDIPPITTIGGFVKEFNVETKKLWYLAGPAIFTSVNQYSLGAVTQVFAGHVSTIALA  113

Query  759  AVAVENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNATAIPLTT  580
            AV+VEN++IAGF+FGIM GMGSALETLCGQAFGA KL MLGVYLQRSW+ILN TA+ LT 
Sbjct  114  AVSVENSVIAGFSFGIMLGMGSALETLCGQAFGAGKLSMLGVYLQRSWVILNVTALILTL  173

Query  579  LYIFSTPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYVMASVSD  400
            LYIF+ PIL  + Q P IS A G F+++MIPQ+FAY   FP  +FLQSQSKI VMA++S 
Sbjct  174  LYIFAAPILASIGQTPAISSAAGLFSIYMIPQIFAYAVNFPTAKFLQSQSKIMVMAAISA  233

Query  399  VALVGHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKGFSQRAF  220
             AL  HV  +W  M KL+WG+ G AVVLN +WWF+ VAQ VY+ SG CG+AW G S  AF
Sbjct  234  AALALHVPITWFVMEKLKWGMAGLAVVLNASWWFIDVAQLVYIFSGTCGEAWSGLSWEAF  293

Query  219  QNLTGFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGWTLMVGVG  40
             NL GFVRLSLAS VM CLE+WYF+A+IL AGY KNAEVSV   SICMNI GWT MV +G
Sbjct  294  HNLWGFVRLSLASAVMLCLEVWYFMAIILFAGYLKNAEVSVAALSICMNILGWTAMVAIG  353

Query  39   FSAAIS  22
             + A+S
Sbjct  354  MNTAVS  359



>emb|CDX83627.1| BnaC07g23670D [Brassica napus]
Length=503

 Score =   397 bits (1020),  Expect = 8e-132, Method: Compositional matrix adjust.
 Identities = 199/306 (65%), Positives = 235/306 (77%), Gaps = 0/306 (0%)
 Frame = -1

Query  939  ADAGDIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHVGNIQLA  760
            + A DI  I  +  F++EF  E+KKLWYLA PAIFT  +QYS+GA+TQVFAGHV  I LA
Sbjct  27   SPANDIPPITTIGGFVKEFNVEAKKLWYLAGPAIFTSVNQYSLGAVTQVFAGHVSTIALA  86

Query  759  AVAVENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNATAIPLTT  580
            AV+VEN++IAGF+FGIM GMGSALETLCGQAFGA KL MLGVYLQRSW+ILN TA+ LT 
Sbjct  87   AVSVENSVIAGFSFGIMLGMGSALETLCGQAFGAGKLSMLGVYLQRSWVILNVTALILTL  146

Query  579  LYIFSTPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYVMASVSD  400
            LYIF+ PIL  + Q P IS A G F+++MIPQ+FAY   FP  +FLQSQSKI VMA++S 
Sbjct  147  LYIFAAPILASIGQTPAISSAAGVFSIYMIPQIFAYAVNFPTAKFLQSQSKIMVMAAISA  206

Query  399  VALVGHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKGFSQRAF  220
             AL  HV  +W  M KL+WG+ G AVVLN +WWF+ VAQ VY+ SG CG+AW G S  AF
Sbjct  207  AALALHVPITWFVMEKLKWGMAGLAVVLNGSWWFIDVAQLVYIFSGTCGEAWSGLSWEAF  266

Query  219  QNLTGFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGWTLMVGVG  40
             NL GFVRLSLAS VM CLE+WYF+A+IL AGY KNAEVSV   SICMNI GWT MV +G
Sbjct  267  HNLWGFVRLSLASAVMLCLEVWYFMAIILFAGYLKNAEVSVAALSICMNILGWTAMVAIG  326

Query  39   FSAAIS  22
             + A+S
Sbjct  327  MNTAVS  332



>ref|XP_009796678.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Nicotiana sylvestris]
Length=501

 Score =   397 bits (1020),  Expect = 8e-132, Method: Compositional matrix adjust.
 Identities = 189/312 (61%), Positives = 240/312 (77%), Gaps = 0/312 (0%)
 Frame = -1

Query  957  SVYSFDADAGDIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHV  778
             +  + +D  DI  I  ++ F REF  ESKKLWYLA PAIFT   QYS+GA+TQ+FAGHV
Sbjct  24   EIPKWPSDENDILPINGIRNFFREFSYESKKLWYLAGPAIFTSLCQYSLGAVTQLFAGHV  83

Query  777  GNIQLAAVAVENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNAT  598
            G IQLAAV+VEN++I G A G++ GMGSALETLCGQ++GAK+L MLG+Y+QRSWIILN  
Sbjct  84   GPIQLAAVSVENSVIMGIAEGVLLGMGSALETLCGQSYGAKELNMLGIYMQRSWIILNTA  143

Query  597  AIPLTTLYIFSTPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYV  418
            AI LT + IF+T IL L+ Q  +IS+  G FA+WMIPQ+F++   FPI +FLQ+QSKI V
Sbjct  144  AILLTLINIFATQILMLIGQPENISRWAGKFAMWMIPQVFSFALEFPIMKFLQAQSKIMV  203

Query  417  MASVSDVALVGHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKG  238
            MA ++ ++ V H  F+WL MLKL WGLP GA VLN +WWFM + + VY+  G+CG+AW G
Sbjct  204  MAVIAGISFVLHTFFTWLLMLKLGWGLPAGAAVLNGSWWFMVIGKLVYIFLGSCGEAWSG  263

Query  237  FSQRAFQNLTGFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGWT  58
            FS +AF +L  FVRLSLASG+M CLE WYF++LIL AGY KNA+++VD TSIC NI GWT
Sbjct  264  FSWKAFHHLWEFVRLSLASGIMICLEYWYFMSLILSAGYLKNADIAVDATSICTNIVGWT  323

Query  57   LMVGVGFSAAIS  22
             M+ +GF+AAIS
Sbjct  324  FMLCIGFNAAIS  335



>ref|XP_011086620.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Sesamum indicum]
Length=534

 Score =   398 bits (1022),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 192/315 (61%), Positives = 238/315 (76%), Gaps = 0/315 (0%)
 Frame = -1

Query  966  NMSSVYSFDADAGDIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFA  787
            N S   SF  D+ DI  I  +++F  EF  ES+KLWYLA PAIFT   QYS+GA TQ FA
Sbjct  45   NRSFTASFVIDSDDIPPITGIRQFFFEFLVESRKLWYLAGPAIFTNICQYSLGAFTQTFA  104

Query  786  GHVGNIQLAAVAVENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIIL  607
            GHVG +QL A ++EN++IAG + G++ GMGSA+ETLCGQA+GA +LEMLGVYLQRSW+IL
Sbjct  105  GHVGTLQLDAFSIENSVIAGLSLGVLLGMGSAVETLCGQAYGAGQLEMLGVYLQRSWVIL  164

Query  606  NATAIPLTTLYIFSTPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSK  427
              T+  LT LYIF+ P L L+ Q  +IS+A G  A+WMIPQLFAY   FP  +FLQ+QSK
Sbjct  165  LGTSCLLTFLYIFALPFLLLIGQTENISRAAGKLALWMIPQLFAYALNFPTAKFLQAQSK  224

Query  426  IYVMASVSDVALVGHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDA  247
            I  MA +S VAL  H++FSWL MLKL WG+ GGA +L+ +WWF+ VAQ +Y++SG CG A
Sbjct  225  IMAMALISAVALGLHIVFSWLLMLKLGWGMAGGAAMLDASWWFIVVAQLIYILSGTCGKA  284

Query  246  WKGFSQRAFQNLTGFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNIS  67
            W GF+ RAFQNL GFVRLS+AS VM CLE WYF+AL+L AGY K+AEVSV   S+C NI 
Sbjct  285  WTGFTLRAFQNLWGFVRLSVASAVMLCLETWYFMALVLFAGYLKDAEVSVAALSVCTNIM  344

Query  66   GWTLMVGVGFSAAIS  22
            GWT M+ +GF+AAIS
Sbjct  345  GWTNMIAIGFNAAIS  359



>ref|NP_198619.1| MATE efflux family protein [Arabidopsis thaliana]
 gb|AAK50109.1|AF372972_1 AT5g38030/F16F17_30 [Arabidopsis thaliana]
 dbj|BAA97535.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAO11623.1| At5g38030/F16F17_30 [Arabidopsis thaliana]
 gb|AED94259.1| MATE efflux family protein [Arabidopsis thaliana]
Length=498

 Score =   397 bits (1019),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 193/302 (64%), Positives = 231/302 (76%), Gaps = 0/302 (0%)
 Frame = -1

Query  927  DIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHVGNIQLAAVAV  748
            DI  I  V  F++EF  E KKLWYLA PAIF   +QYS+GA TQVFAGH+  I LAAV+V
Sbjct  28   DIPPITTVGGFVKEFNVEVKKLWYLAGPAIFMSITQYSLGAATQVFAGHISTIALAAVSV  87

Query  747  ENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNATAIPLTTLYIF  568
            EN++IAGF+FG+M GMGSALETLCGQAFGA KL MLGVYLQRSW+ILN TA+ L+ LYIF
Sbjct  88   ENSVIAGFSFGVMLGMGSALETLCGQAFGAGKLSMLGVYLQRSWVILNVTAVILSLLYIF  147

Query  567  STPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYVMASVSDVALV  388
            + PIL  + Q P IS A G F+++MIPQ+FAY   +P  +FLQSQSKI VMA++S VALV
Sbjct  148  AAPILAFIGQTPAISSATGIFSIYMIPQIFAYAVNYPTAKFLQSQSKIMVMAAISAVALV  207

Query  387  GHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKGFSQRAFQNLT  208
             HVL +W  +  L+WG  G AVVLN +WWF+ VAQ VY+ SG CG+AW GFS  AF NL 
Sbjct  208  LHVLLTWFVIEGLQWGTAGLAVVLNASWWFIVVAQLVYIFSGTCGEAWSGFSWEAFHNLW  267

Query  207  GFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGWTLMVGVGFSAA  28
             FVRLSLAS VM CLE+WY +A+IL AGY KNAE+SV   SICMNI GWT M+ +G +AA
Sbjct  268  SFVRLSLASAVMLCLEVWYLMAVILFAGYLKNAEISVAALSICMNILGWTAMIAIGMNAA  327

Query  27   IS  22
            +S
Sbjct  328  VS  329



>gb|EPS68503.1| hypothetical protein M569_06267, partial [Genlisea aurea]
Length=514

 Score =   397 bits (1019),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 193/309 (62%), Positives = 233/309 (75%), Gaps = 0/309 (0%)
 Frame = -1

Query  948  SFDADAGDIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHVGNI  769
            SF  + GD   I  V++F + F  E +KLWYLA PAIFT   QYS+GAITQ FAGHVG +
Sbjct  39   SFVDEGGDFPPITGVRDFGKAFKKEGEKLWYLAGPAIFTSVCQYSLGAITQTFAGHVGTL  98

Query  768  QLAAVAVENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNATAIP  589
             LAA ++EN++IAG +FG+M GMGSALETLCGQA+GA ++EMLGVY+QRSW+IL ATA  
Sbjct  99   DLAAFSIENSVIAGLSFGVMLGMGSALETLCGQAYGAGQVEMLGVYMQRSWVILTATAFV  158

Query  588  LTTLYIFSTPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYVMAS  409
            L  LYIF+ P L L+ Q   IS A G  A+WMIPQL+AY   FPI +FLQ+QSKI  MA 
Sbjct  159  LMFLYIFAAPFLILIGQKREISLAAGKLALWMIPQLYAYALNFPIAKFLQAQSKIMAMAW  218

Query  408  VSDVALVGHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKGFSQ  229
            +S   LV HV  SW+FMLKL WGL GGA VLN +WW + VAQ VY+ +G+CG AW GFS 
Sbjct  219  ISVATLVLHVALSWIFMLKLGWGLAGGAAVLNFSWWLIVVAQLVYIFAGSCGRAWSGFSW  278

Query  228  RAFQNLTGFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGWTLMV  49
            RAFQNL GFVRLSLAS VM CLE WYF+AL+L AGY +NAEV+VD  S+C NI GWT M+
Sbjct  279  RAFQNLWGFVRLSLASAVMLCLETWYFMALLLFAGYLENAEVAVDALSVCTNIVGWTTMI  338

Query  48   GVGFSAAIS  22
             +GF+AA+S
Sbjct  339  AIGFNAAVS  347



>ref|NP_172755.1| root hair specific 2 [Arabidopsis thaliana]
 gb|AAF78500.1|AC012187_20 Strong similarity to an unknown protein orf4 gi|1402878 from 
Arabidopsis thaliana 81kb genomic sequence gb|X98130 and is 
a member of an uncharacterized membrane protein PF|01554 family. 
EST gb|AI998833 comes from this gene [Arabidopsis thaliana]
 gb|AAY56428.1| At1g12950 [Arabidopsis thaliana]
 gb|AEE28953.1| root hair specific 2 [Arabidopsis thaliana]
Length=522

 Score =   397 bits (1019),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 194/313 (62%), Positives = 237/313 (76%), Gaps = 0/313 (0%)
 Frame = -1

Query  960  SSVYSFDADAGDIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGH  781
            SS+ SF + A DI  I  V +F+REF  ES+KLW LA PAIFT  SQYS+GA+TQVFAGH
Sbjct  39   SSLVSFSSTAVDIPPISGVGDFVREFRIESRKLWKLAGPAIFTTMSQYSLGAVTQVFAGH  98

Query  780  VGNIQLAAVAVENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNA  601
            +  + LAAV++EN++IAGF+FGIM GMGSALETLCGQAFGA K+ MLGVYLQRSW+IL+ 
Sbjct  99   ISTLALAAVSIENSVIAGFSFGIMLGMGSALETLCGQAFGAGKVSMLGVYLQRSWVILSV  158

Query  600  TAIPLTTLYIFSTPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIY  421
            TA+ L+ +YIF+ PIL  + Q   IS   G F+++MIPQ+FAY   FP  +FLQSQSKI 
Sbjct  159  TALFLSLIYIFAAPILTFIGQTAAISAMAGIFSIYMIPQIFAYAINFPTAKFLQSQSKIM  218

Query  420  VMASVSDVALVGHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWK  241
            VMA +S V LV H  F+WL M +L WGLPG A+VLNT+WW + VAQ VY+ +  CG+AW 
Sbjct  219  VMAGISGVVLVIHSFFTWLVMSRLHWGLPGLALVLNTSWWVIVVAQLVYIFNCTCGEAWS  278

Query  240  GFSQRAFQNLTGFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGW  61
            GF+  AF NL GFV+LSLAS  M CLE+WYF+AL+L AGY KNAEVSV   SICMNI GW
Sbjct  279  GFTWEAFHNLWGFVKLSLASAAMLCLEIWYFMALVLFAGYLKNAEVSVAALSICMNILGW  338

Query  60   TLMVGVGFSAAIS  22
              MV  G +AA+S
Sbjct  339  AAMVAFGTNAAVS  351



>ref|XP_006483933.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Citrus sinensis]
Length=511

 Score =   396 bits (1018),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 204/315 (65%), Positives = 242/315 (77%), Gaps = 0/315 (0%)
 Frame = -1

Query  966  NMSSVYSFDADAGDIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFA  787
            N SS   F A+  DI  I    +F REF  ESKKLWYLA PAIFT   QYS+GA+TQVF+
Sbjct  26   NTSSSAIFIAEVDDIPPITGAVDFFREFSKESKKLWYLAGPAIFTSVCQYSLGAVTQVFS  85

Query  786  GHVGNIQLAAVAVENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIIL  607
            GHV  I LAAV+VEN++IAGF+FG M GMGSALETLCGQA+GA +L+MLGVY+QRSW+IL
Sbjct  86   GHVSTIALAAVSVENSVIAGFSFGAMMGMGSALETLCGQAYGAGQLDMLGVYMQRSWVIL  145

Query  606  NATAIPLTTLYIFSTPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSK  427
            NATA+ L  +YIF+  +L L+ Q P ISKA GT ++WMIPQLFAY   FPI +FLQ+QSK
Sbjct  146  NATALILMLIYIFAQQLLSLIGQTPSISKAAGTLSIWMIPQLFAYAVNFPIAKFLQAQSK  205

Query  426  IYVMASVSDVALVGHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDA  247
            + VMA ++  ALV H L SWL ML+L WGL G AVVLN +WWF+ +AQ  Y+ SG CG A
Sbjct  206  MMVMAIIAASALVLHTLLSWLLMLELGWGLVGAAVVLNASWWFIDLAQMFYIFSGTCGRA  265

Query  246  WKGFSQRAFQNLTGFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNIS  67
            W GFS +AF NL  FVRLSLAS VM CLE+WYF+ALIL AGY KNAE+SVD  SICMNI 
Sbjct  266  WNGFSWKAFHNLWAFVRLSLASAVMLCLEIWYFMALILFAGYLKNAELSVDALSICMNIL  325

Query  66   GWTLMVGVGFSAAIS  22
            GWT+MV +G +AAIS
Sbjct  326  GWTVMVAIGMNAAIS  340



>ref|XP_009607569.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Nicotiana tomentosiformis]
Length=499

 Score =   396 bits (1017),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 189/322 (59%), Positives = 244/322 (76%), Gaps = 0/322 (0%)
 Frame = -1

Query  987  KNTQIS*NMSSVYSFDADAGDIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIG  808
            + T++   +S +  + +D  DI  I  ++ F +EF  ESKKLWYLA PAIFT   QYS+G
Sbjct  12   EETKVPLLLSKLPKWPSDEDDILPINGIRNFFQEFNYESKKLWYLAGPAIFTSLCQYSLG  71

Query  807  AITQVFAGHVGNIQLAAVAVENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYL  628
            A+TQ+FAGHVG IQLAAV+VEN++I G A G++ GMGSALETLCGQA+GAK+L MLG+Y+
Sbjct  72   AVTQLFAGHVGTIQLAAVSVENSVIMGIAEGVLLGMGSALETLCGQAYGAKELNMLGIYM  131

Query  627  QRSWIILNATAIPLTTLYIFSTPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQR  448
            QRSWIILN  AI LT + IF+T IL L+ Q  +IS+  G FA+WMIPQ+F++   FPI +
Sbjct  132  QRSWIILNTAAILLTLINIFATQILMLIGQPENISRWAGKFALWMIPQVFSFALEFPIMK  191

Query  447  FLQSQSKIYVMASVSDVALVGHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVV  268
            FLQ+QSK+ VMA ++ V+   H  F+WL MLKL WGLP  A VLN +WWFM + + VY+ 
Sbjct  192  FLQAQSKMMVMAVIAGVSFALHTFFTWLLMLKLGWGLPAAAAVLNGSWWFMVIGKLVYIF  251

Query  267  SGACGDAWKGFSQRAFQNLTGFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGT  88
             G+CG+AW GFS +AF +L  FVRLSLASG+M CLE WYF++LIL AGY KNA+++VD T
Sbjct  252  LGSCGEAWSGFSWKAFHHLWEFVRLSLASGIMICLEYWYFMSLILSAGYLKNADIAVDAT  311

Query  87   SICMNISGWTLMVGVGFSAAIS  22
            SIC NI GWT M+ +GF+AAIS
Sbjct  312  SICTNIVGWTFMLCIGFNAAIS  333



>ref|XP_010533240.1| PREDICTED: protein TRANSPARENT TESTA 12 [Tarenaya hassleriana]
Length=493

 Score =   395 bits (1016),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 188/315 (60%), Positives = 240/315 (76%), Gaps = 1/315 (0%)
 Frame = -1

Query  966  NMSSVYSFDADAGDIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFA  787
            N+  V   D D GD+  I  +++F R F +ES+KLW+LA PAI T   QYS+GA+TQV A
Sbjct  3    NLDDVSGQD-DGGDMPPISGLRDFFRRFAAESRKLWWLAVPAISTSICQYSLGAVTQVLA  61

Query  786  GHVGNIQLAAVAVENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIIL  607
            GHV  + LAAV+VEN++IAGF+ G++ GMGSALETLCGQA+GA ++EM+G+YLQRSWIIL
Sbjct  62   GHVSTLALAAVSVENSVIAGFSLGVLLGMGSALETLCGQAYGAGQVEMMGIYLQRSWIIL  121

Query  606  NATAIPLTTLYIFSTPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSK  427
              +A+ L+  Y+F+TP+L+L+ Q P IS A G  ++WMIPQLFAY   FP  +FLQ+QSK
Sbjct  122  FTSALLLSLYYVFATPLLRLIGQTPAISSAAGKLSLWMIPQLFAYALNFPTAKFLQAQSK  181

Query  426  IYVMASVSDVALVGHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDA  247
            + VMA +S VAL  H + SW  MLKLRWG+ GGA VLN +WW + VAQ VY+ +GACG A
Sbjct  182  VMVMAVISAVALPLHGVLSWWMMLKLRWGMAGGAAVLNVSWWLVQVAQIVYIATGACGRA  241

Query  246  WKGFSQRAFQNLTGFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNIS  67
            W GFS++AF+NL GF RLS+AS VM CLE+WYF+ALIL AGY KNA+VSV   SICMNI 
Sbjct  242  WSGFSRKAFKNLRGFARLSIASAVMICLEVWYFMALILFAGYLKNAQVSVAALSICMNIL  301

Query  66   GWTLMVGVGFSAAIS  22
            GW +MV  G +AA+S
Sbjct  302  GWMVMVAFGINAAVS  316



>ref|XP_004309983.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Fragaria vesca 
subsp. vesca]
Length=518

 Score =   395 bits (1016),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 196/309 (63%), Positives = 242/309 (78%), Gaps = 0/309 (0%)
 Frame = -1

Query  948  SFDADAGDIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHVGNI  769
            +F+ D+ DI  I  V++F REF  ESKKLW+LA PA+FT   QYS+GA+TQ+FAG VG +
Sbjct  33   TFNPDSDDIPPITSVRDFFREFNRESKKLWFLAGPAVFTSICQYSLGAVTQIFAGQVGTL  92

Query  768  QLAAVAVENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNATAIP  589
             LAAV++EN++IAGF+FG++ GMGSALETLCGQAFGA +L+MLG+Y+QRSW+ILN T + 
Sbjct  93   DLAAVSIENSVIAGFSFGLLLGMGSALETLCGQAFGAGQLDMLGIYMQRSWVILNITGLA  152

Query  588  LTTLYIFSTPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYVMAS  409
            L  LYIF+  IL  + Q   ISKA G FA++MIPQLFAY   FPI +FLQSQSKI VMA 
Sbjct  153  LCFLYIFAQQILYGIGQTAEISKAAGVFALYMIPQLFAYAMNFPITKFLQSQSKIMVMAV  212

Query  408  VSDVALVGHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKGFSQ  229
            ++ V L+ H + SWL MLKL WGL G AVVLN +WW + +AQ  Y+VSG CG AW GFS 
Sbjct  213  IAVVVLIIHTVLSWLLMLKLGWGLVGAAVVLNLSWWIIVLAQLGYIVSGTCGRAWTGFSW  272

Query  228  RAFQNLTGFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGWTLMV  49
            +AF NL GFV+LSLAS VM CLE+WYF+ALIL AGY K+AE+SVDG SICMNI GWT+MV
Sbjct  273  KAFNNLWGFVKLSLASAVMLCLEVWYFMALILFAGYLKDAEISVDGLSICMNILGWTVMV  332

Query  48   GVGFSAAIS  22
             +G +AAIS
Sbjct  333  SLGMNAAIS  341



>ref|XP_004242792.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Solanum lycopersicum]
Length=480

 Score =   394 bits (1012),  Expect = 7e-131, Method: Compositional matrix adjust.
 Identities = 192/309 (62%), Positives = 243/309 (79%), Gaps = 1/309 (0%)
 Frame = -1

Query  948  SFDADAGDIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHVGNI  769
            SF+++  D++ I  +K F  EFY ESKKLW LA+PAI T   QYSI  ITQ+FAGH+G +
Sbjct  10   SFNSE-DDMQSIDGLKTFFHEFYIESKKLWSLASPAISTSICQYSIAQITQLFAGHLGVL  68

Query  768  QLAAVAVENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNATAIP  589
            QLAAV+VEN++IAG  +G + GMGSALETLCGQA+GAK+L+MLGVYLQRS IILN  A+ 
Sbjct  69   QLAAVSVENSVIAGLCYGALLGMGSALETLCGQAYGAKQLDMLGVYLQRSLIILNTAALV  128

Query  588  LTTLYIFSTPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYVMAS  409
            L  LY+F+T IL  + Q   I+K  G F++WMIPQLFAY   FPIQ+FLQ+QSK+ VMA 
Sbjct  129  LMFLYLFATQILLFIGQPMDIAKWAGKFSIWMIPQLFAYAMNFPIQKFLQAQSKMMVMAV  188

Query  408  VSDVALVGHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKGFSQ  229
            ++ +ALVGH L SWLFM+K+  GL  GAVVLN +WWFM +AQFVY++ G CG+AW GF+ 
Sbjct  189  IAAIALVGHTLLSWLFMMKMDLGLVAGAVVLNGSWWFMVLAQFVYILCGTCGEAWSGFTF  248

Query  228  RAFQNLTGFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGWTLMV  49
            +AF+NL GFVRLSLASGVM CLE WYF+ALI+ AGY K+A+++VD  SIC +I GWT M+
Sbjct  249  KAFENLWGFVRLSLASGVMICLEYWYFMALIISAGYVKDAKIAVDAVSICTSIVGWTFML  308

Query  48   GVGFSAAIS  22
             +GF+AAIS
Sbjct  309  CIGFNAAIS  317



>gb|EYU30642.1| hypothetical protein MIMGU_mgv1a004692mg [Erythranthe guttata]
Length=514

 Score =   394 bits (1013),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 204/313 (65%), Positives = 240/313 (77%), Gaps = 0/313 (0%)
 Frame = -1

Query  960  SSVYSFDADAGDIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGH  781
            S V SF  D  DI  I     F + F  ESKKLWYLA PAIFT   QYS+GAITQ FAGH
Sbjct  32   SFVSSFVVDGEDIPPITGAGLFFKAFTRESKKLWYLAGPAIFTSICQYSLGAITQTFAGH  91

Query  780  VGNIQLAAVAVENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNA  601
            VG + LAA ++EN++IAG +FG+M GMGSALETLCGQA+GA ++EMLGVY+QRSW+IL A
Sbjct  92   VGTLDLAAFSIENSVIAGLSFGVMLGMGSALETLCGQAYGAGQIEMLGVYMQRSWVILVA  151

Query  600  TAIPLTTLYIFSTPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIY  421
            TA  L  LYIF+TP L L+ Q   IS+A G FA+WMIPQL+AY   FPI +FLQ+QS+I 
Sbjct  152  TAFLLMFLYIFATPFLLLIGQTEDISRAAGKFALWMIPQLYAYALNFPIAKFLQAQSRIM  211

Query  420  VMASVSDVALVGHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWK  241
             MA ++  ALV HV FSWL MLKL WG+ GGAVVLN +WWF+ VAQ VY+ SG+CG AW 
Sbjct  212  AMAWIAAAALVLHVAFSWLLMLKLGWGMAGGAVVLNLSWWFIVVAQLVYIFSGSCGGAWT  271

Query  240  GFSQRAFQNLTGFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGW  61
            GFS RAFQNL GFVRLSLAS VM CLE WYF+AL+L AGY KNAE++VD  SIC NI GW
Sbjct  272  GFSWRAFQNLWGFVRLSLASAVMLCLETWYFMALVLFAGYLKNAEIAVDALSICTNILGW  331

Query  60   TLMVGVGFSAAIS  22
            T+MV +GF+AAIS
Sbjct  332  TVMVSMGFNAAIS  344



>gb|KDP26653.1| hypothetical protein JCGZ_17811 [Jatropha curcas]
Length=500

 Score =   393 bits (1010),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 195/322 (61%), Positives = 240/322 (75%), Gaps = 9/322 (3%)
 Frame = -1

Query  987  KNTQIS*NMSSVYSFDADAGDIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIG  808
            +NT IS           D+ DI  I    +F ++FY+E KKLWYLA PA FT   QYS+G
Sbjct  16   QNTSIS---------TPDSEDIPPINGFHDFSKQFYAEFKKLWYLAGPATFTSLCQYSLG  66

Query  807  AITQVFAGHVGNIQLAAVAVENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYL  628
            AITQVFAGHV  I LAAV+VEN+ IAGF+FG+M GMGSALETLCGQAFGA +++MLG+Y+
Sbjct  67   AITQVFAGHVSTIALAAVSVENSAIAGFSFGLMLGMGSALETLCGQAFGAGQVDMLGIYM  126

Query  627  QRSWIILNATAIPLTTLYIFSTPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQR  448
            QRSW+ILN TA+ L  LYIF+ P L L+ Q   ISKA GTF +WMIPQLFAY   FP+ +
Sbjct  127  QRSWVILNTTALILCFLYIFAGPFLNLIGQTEAISKAAGTFTLWMIPQLFAYAMNFPLAK  186

Query  447  FLQSQSKIYVMASVSDVALVGHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVV  268
            FLQ+QSK+  MA +S  AL  H LFSWL MLK+ WGL G A+VLN++WW + VAQF+Y++
Sbjct  187  FLQAQSKMMAMALISVAALALHTLFSWLLMLKMGWGLVGAALVLNSSWWLIVVAQFLYIL  246

Query  267  SGACGDAWKGFSQRAFQNLTGFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGT  88
             G CG  W GFS +AFQNL  FVRLSLAS VM CLE+WY++ALI+ AGY KNAEVSV   
Sbjct  247  GGTCGRTWTGFSWKAFQNLWAFVRLSLASAVMLCLEVWYYMALIVFAGYLKNAEVSVGAF  306

Query  87   SICMNISGWTLMVGVGFSAAIS  22
            S+ +NI GWT+M+ +G +AAIS
Sbjct  307  SVSINILGWTVMLSLGINAAIS  328



>dbj|BAE99795.1| hypothetical protein [Arabidopsis thaliana]
Length=522

 Score =   394 bits (1011),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 193/313 (62%), Positives = 236/313 (75%), Gaps = 0/313 (0%)
 Frame = -1

Query  960  SSVYSFDADAGDIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGH  781
            SS+ SF + A DI  I  V +F+REF  ES+KLW LA PAIFT  SQYS+GA+TQVFAGH
Sbjct  39   SSLVSFSSTAVDIPPISGVGDFVREFRIESRKLWKLAGPAIFTTMSQYSLGAVTQVFAGH  98

Query  780  VGNIQLAAVAVENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNA  601
            +  + LAAV++EN++IAGF+FGIM GMGSALETLCGQAFGA K+ MLGVYLQRSW+IL+ 
Sbjct  99   ISTLALAAVSIENSVIAGFSFGIMLGMGSALETLCGQAFGAGKVSMLGVYLQRSWVILSV  158

Query  600  TAIPLTTLYIFSTPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIY  421
            TA+ L+ +YIF+ PIL  + Q   IS   G F+++MIPQ+FAY   FP  +FLQSQSKI 
Sbjct  159  TALFLSLIYIFAAPILTFIGQTAAISAMAGIFSIYMIPQIFAYAINFPTAKFLQSQSKIM  218

Query  420  VMASVSDVALVGHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWK  241
            VMA +S V LV H  F+WL M +L WGLPG A+VLNT+WW + VAQ VY+ +  CG+AW 
Sbjct  219  VMAGISGVVLVIHSFFTWLVMSRLHWGLPGLALVLNTSWWVIVVAQLVYIFNCTCGEAWS  278

Query  240  GFSQRAFQNLTGFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGW  61
            GF+  AF NL  FV+LSLAS  M CLE+WYF+AL+L AGY KNAEVSV   SICMNI GW
Sbjct  279  GFTWEAFHNLWRFVKLSLASAAMLCLEIWYFMALVLFAGYLKNAEVSVAALSICMNILGW  338

Query  60   TLMVGVGFSAAIS  22
              MV  G +AA+S
Sbjct  339  AAMVAFGTNAAVS  351



>ref|XP_011086621.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Sesamum indicum]
Length=530

 Score =   394 bits (1011),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 191/315 (61%), Positives = 235/315 (75%), Gaps = 0/315 (0%)
 Frame = -1

Query  966  NMSSVYSFDADAGDIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFA  787
            N+S   SF AD  DI  I+    F+  F  ES KLWYLA PAIF+  +QY++GA+TQ FA
Sbjct  34   NLSFFSSFVADEDDIAPIESFGGFMSAFKEESGKLWYLAGPAIFSSVAQYALGAMTQTFA  93

Query  786  GHVGNIQLAAVAVENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIIL  607
            GHVG + LAA ++EN++IAG + G+M GMGSA+ETLCGQAFGA +L+MLGVYLQRSWIIL
Sbjct  94   GHVGTLDLAAFSIENSVIAGLSLGVMLGMGSAVETLCGQAFGAGQLDMLGVYLQRSWIIL  153

Query  606  NATAIPLTTLYIFSTPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSK  427
             ATA  +  LYIF+ P L ++ Q P IS+  G FA+WMIPQLFAY   FP  +FLQ+QSK
Sbjct  154  LATAFVMMFLYIFALPFLLVIGQTPSISRTAGKFAIWMIPQLFAYALNFPTAKFLQAQSK  213

Query  426  IYVMASVSDVALVGHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDA  247
            I  MA +S VALV H+LFSWL MLKL WG+  GA VL+ +WWF+ +AQ +Y+ SG CG A
Sbjct  214  ILAMAVISAVALVLHILFSWLLMLKLGWGMAAGAAVLDASWWFIVIAQVIYIFSGTCGKA  273

Query  246  WKGFSQRAFQNLTGFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNIS  67
            W GF+ R+FQN+ GFVRLSLAS VM CLE WYF+AL+L AGY KNAEV+V   S+C NI 
Sbjct  274  WPGFTLRSFQNIWGFVRLSLASAVMLCLETWYFMALVLFAGYLKNAEVAVAALSVCTNIL  333

Query  66   GWTLMVGVGFSAAIS  22
            G T  + VGF+AAIS
Sbjct  334  GLTNTIAVGFNAAIS  348



>ref|XP_007158403.1| hypothetical protein PHAVU_002G150200g, partial [Phaseolus vulgaris]
 ref|XP_007158404.1| hypothetical protein PHAVU_002G150200g, partial [Phaseolus vulgaris]
 gb|ESW30397.1| hypothetical protein PHAVU_002G150200g, partial [Phaseolus vulgaris]
 gb|ESW30398.1| hypothetical protein PHAVU_002G150200g, partial [Phaseolus vulgaris]
Length=536

 Score =   394 bits (1011),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 197/329 (60%), Positives = 237/329 (72%), Gaps = 4/329 (1%)
 Frame = -1

Query  987  KNTQIS*NMSSVYSFDADAGDIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIG  808
            ++ QI     +   F A   DI  I    EF REF +ESKKLWYLA P IF+  S+YS+G
Sbjct  40   ESHQIHSQRGTAAVFTAGTADIDPITSPGEFYREFVAESKKLWYLAGPGIFSFVSKYSLG  99

Query  807  AITQVFAGHVGNIQLAAVAVENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYL  628
            A TQ+FAGH+G I L AV+VEN+LIAGF++GIM GMGSALETLCGQA GA KL MLGVY+
Sbjct  100  AFTQIFAGHIGTIALTAVSVENSLIAGFSYGIMLGMGSALETLCGQAVGAGKLNMLGVYM  159

Query  627  QRSWIILNATAIPLTTLYIFSTPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQR  448
            QRSW++L  TA  L   YIF+   L L+ QNP IS+A G FA+WMIPQLFAY   FP+ +
Sbjct  160  QRSWVLLFGTACVLCFFYIFAGSFLILIGQNPEISRAAGKFAIWMIPQLFAYAVNFPVAK  219

Query  447  FLQSQSKIYVMASVSDVALVGHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVV  268
            FLQ+QSK+ V+A++S V +  H L SWL ++K  WGLPG AVVLN +WWF+ VAQ  YV+
Sbjct  220  FLQTQSKVIVIAAISGVTMAVHPLLSWLLIMKAEWGLPGAAVVLNGSWWFIVVAQLGYVL  279

Query  267  SGACGDAWKGFSQRAFQNLTGFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGT  88
            SG CG AWKGFS  AF NL GF RLSLAS VM CLE WYF+AL+L AGY KNA++ +   
Sbjct  280  SGRCGAAWKGFSWEAFGNLWGFFRLSLASAVMLCLETWYFMALLLFAGYLKNAKIYLGAF  339

Query  87   SICMNISGWTLMVGVGFSAA----ISNNL  13
            SICMNI GWT+MV  G +AA    ISN L
Sbjct  340  SICMNILGWTIMVSFGLNAATSVRISNEL  368



>ref|XP_007044782.1| MATE efflux family protein [Theobroma cacao]
 gb|EOY00614.1| MATE efflux family protein [Theobroma cacao]
Length=520

 Score =   392 bits (1008),  Expect = 8e-130, Method: Compositional matrix adjust.
 Identities = 201/312 (64%), Positives = 246/312 (79%), Gaps = 0/312 (0%)
 Frame = -1

Query  957  SVYSFDADAGDIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHV  778
            S  +F     D+  I  V++F REF +ESKKLW+LA PAIFT   QYS+GAITQVF+G V
Sbjct  35   SSTTFTPGTHDVPPINSVRDFFREFLTESKKLWFLAGPAIFTSICQYSLGAITQVFSGQV  94

Query  777  GNIQLAAVAVENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNAT  598
            G + LAAV+VEN++IAGF+FG M GMGSALETLCGQAFGA + +MLG+Y+QRSW+ILN+T
Sbjct  95   GTLALAAVSVENSVIAGFSFGAMLGMGSALETLCGQAFGAGQHDMLGIYMQRSWVILNST  154

Query  597  AIPLTTLYIFSTPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYV  418
            A+ L+ LYIF+ PIL L+ Q   ISKA G F++WMIPQLFAY   FP+ +FLQ+QSK+ V
Sbjct  155  ALILSLLYIFAGPILNLIGQTASISKAAGIFSIWMIPQLFAYAVNFPMAKFLQAQSKMMV  214

Query  417  MASVSDVALVGHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKG  238
            MA ++ VAL  H +FSWL MLKL  GL G A+VLN +W F+ VAQF+Y++SG CG AW G
Sbjct  215  MAVIAGVALFLHTVFSWLLMLKLGLGLVGAAIVLNASWIFIDVAQFLYIISGTCGRAWTG  274

Query  237  FSQRAFQNLTGFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGWT  58
            FS +AFQ+L GFVRLSLAS VM CLE+WYF+ALIL AGY KNAEVSVD  SICMNI GWT
Sbjct  275  FSWKAFQHLWGFVRLSLASAVMLCLEIWYFMALILFAGYLKNAEVSVDALSICMNILGWT  334

Query  57   LMVGVGFSAAIS  22
            +MV +G +AAIS
Sbjct  335  VMVALGMNAAIS  346



>ref|XP_010528103.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Tarenaya hassleriana]
Length=509

 Score =   392 bits (1007),  Expect = 9e-130, Method: Compositional matrix adjust.
 Identities = 199/315 (63%), Positives = 239/315 (76%), Gaps = 0/315 (0%)
 Frame = -1

Query  966  NMSSVYSFDADAGDIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFA  787
            +++S  +      DI  I  V +F+REF  ESKKLWYLA PAIFT  SQYS+GAITQVFA
Sbjct  24   SLTSSAALTIGDADIPPISGVGDFVREFNVESKKLWYLAGPAIFTSLSQYSLGAITQVFA  83

Query  786  GHVGNIQLAAVAVENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIIL  607
            GH+  + LAAV+VEN++IAGF+FGIM GMGSALETLCGQAFGA KL MLGVYLQRSW+IL
Sbjct  84   GHISTLSLAAVSVENSVIAGFSFGIMLGMGSALETLCGQAFGAGKLSMLGVYLQRSWVIL  143

Query  606  NATAIPLTTLYIFSTPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSK  427
              TA+ L+ LYIF+TP+L  + Q   ISKA G F+++MIPQLFAY   FP  +FLQ+QSK
Sbjct  144  IVTALLLSLLYIFATPLLAFIGQTQSISKAAGLFSIYMIPQLFAYALNFPTAKFLQAQSK  203

Query  426  IYVMASVSDVALVGHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDA  247
            I VMA +S  ALV H L SW+ ++ LRWGL G AV+LN +WWF+ V Q VY++ G CG+A
Sbjct  204  IMVMAVISAAALVLHALLSWVAVVNLRWGLEGLAVMLNASWWFIVVIQIVYILGGTCGEA  263

Query  246  WKGFSQRAFQNLTGFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNIS  67
            W GFS  AF NL  FVRLSLAS VM CLE+WYF+AL+L AGY KNAEVSV   SICMNI 
Sbjct  264  WSGFSWEAFHNLWSFVRLSLASAVMLCLEVWYFMALVLFAGYLKNAEVSVAALSICMNIL  323

Query  66   GWTLMVGVGFSAAIS  22
            GW  MV +G +AA+S
Sbjct  324  GWAAMVAIGTNAAVS  338



>ref|XP_006367697.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Solanum tuberosum]
Length=480

 Score =   390 bits (1003),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 191/309 (62%), Positives = 240/309 (78%), Gaps = 1/309 (0%)
 Frame = -1

Query  948  SFDADAGDIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHVGNI  769
            SFD++  D+++I  VK F  EF  ESKKLW LA+PAI T   QYSI  ITQ+FAGH+G +
Sbjct  10   SFDSEH-DMQRIDGVKTFFHEFCIESKKLWCLASPAISTSICQYSIAQITQLFAGHLGVL  68

Query  768  QLAAVAVENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNATAIP  589
            QLAAV+VEN++IAG  +G + GMGSALETLCGQA+GAK+++MLGVYLQRS IILN  A+ 
Sbjct  69   QLAAVSVENSVIAGLCYGALLGMGSALETLCGQAYGAKQVDMLGVYLQRSLIILNTAALA  128

Query  588  LTTLYIFSTPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYVMAS  409
            L  LY+F+T IL L+ Q   I+K  G F++WMIPQLFAY   FPIQ+FLQ+QSK+ VM  
Sbjct  129  LMFLYLFATQILLLIGQPMDIAKWAGKFSLWMIPQLFAYAMNFPIQKFLQAQSKMMVMTI  188

Query  408  VSDVALVGHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKGFSQ  229
            ++ VAL GH L SWLFM+K+  G+  GAVVLN +WWFM +AQFVY++ G CG+AW GFS 
Sbjct  189  IAAVALAGHTLLSWLFMMKMDLGIVAGAVVLNGSWWFMVLAQFVYIICGTCGEAWSGFSY  248

Query  228  RAFQNLTGFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGWTLMV  49
            +AF+NL GFVRLSLASGVM CLE WYF+ALI+ AGY K+ ++ VD  SIC +I GWT M+
Sbjct  249  KAFENLWGFVRLSLASGVMICLEYWYFMALIITAGYVKDPKIVVDAVSICTSIVGWTFML  308

Query  48   GVGFSAAIS  22
             +GF+AAIS
Sbjct  309  CIGFNAAIS  317



>ref|XP_011086623.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Sesamum indicum]
Length=521

 Score =   392 bits (1006),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 195/319 (61%), Positives = 238/319 (75%), Gaps = 0/319 (0%)
 Frame = -1

Query  978  QIS*NMSSVYSFDADAGDIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGAIT  799
            QI  N S   SF     DI  I  V  F   F +ES KLWYLA PAI T   QYS+GAIT
Sbjct  31   QILSNHSFFSSFVIGDDDIPPITSVGGFFSAFQAESSKLWYLAGPAILTSIFQYSLGAIT  90

Query  798  QVFAGHVGNIQLAAVAVENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRS  619
            Q FAGHVG + LAA ++ENN+IAG  FG+M GMGSALETLCGQA+GA ++ MLGVY+QRS
Sbjct  91   QTFAGHVGTLDLAAFSLENNIIAGLCFGVMMGMGSALETLCGQAYGAGQINMLGVYMQRS  150

Query  618  WIILNATAIPLTTLYIFSTPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQ  439
            W+IL +T+  L  +YIF+ P+L LL Q   ISKA G F++WMIPQL+AY   FPI +FLQ
Sbjct  151  WVILVSTSFLLMFMYIFAEPLLLLLGQAEDISKAAGKFSLWMIPQLYAYALNFPIAKFLQ  210

Query  438  SQSKIYVMASVSDVALVGHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGA  259
            +QS I  MA +S VAL  H+LFSWL MLKL WG+ G AVVLN++WWF+ VAQ +++ SGA
Sbjct  211  AQSNIMAMAWISAVALGLHILFSWLLMLKLGWGMIGAAVVLNSSWWFLVVAQLLFIFSGA  270

Query  258  CGDAWKGFSQRAFQNLTGFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSIC  79
            CG+AW GFS +AFQNL GFVRLS+AS VM CLE+WY+ ALIL AGY KNAEV+VD  SIC
Sbjct  271  CGEAWTGFSWKAFQNLWGFVRLSVASAVMLCLEVWYYTALILFAGYLKNAEVAVDALSIC  330

Query  78   MNISGWTLMVGVGFSAAIS  22
            +N+  WT+ V +GF+AA+S
Sbjct  331  INVLAWTVTVALGFNAAVS  349



>ref|XP_010044579.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Eucalyptus grandis]
Length=539

 Score =   392 bits (1007),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 198/315 (63%), Positives = 241/315 (77%), Gaps = 0/315 (0%)
 Frame = -1

Query  966  NMSSVYSFDADAGDIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFA  787
             ++  ++F   A DI  IK   +F+REF  ESKKLW+LA PAIFT   +YS+GAITQVFA
Sbjct  49   TVNDAFTFTPQADDIPPIKGPCDFLREFARESKKLWFLAGPAIFTSLCRYSLGAITQVFA  108

Query  786  GHVGNIQLAAVAVENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIIL  607
            GHVG ++LAAV+VEN++IAGF+ GIM GMGSALETLCGQA+GA +L+M+G+YLQRSW+IL
Sbjct  109  GHVGTLELAAVSVENSVIAGFSMGIMLGMGSALETLCGQAYGAGQLDMMGIYLQRSWVIL  168

Query  606  NATAIPLTTLYIFSTPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSK  427
            N TA+ L  LYIF+  +L+L+ Q   IS+  G FA+WMIPQLF Y   FPI +FLQ+QSK
Sbjct  169  NTTAVALCFLYIFAAKLLRLIGQTEAISEEAGMFAIWMIPQLFMYAMNFPIAKFLQAQSK  228

Query  426  IYVMASVSDVALVGHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDA  247
            I VMA V+ V LV H +FSWL MLKL WGL G AVVL+ +W  +  A   Y+ SG CG A
Sbjct  229  IMVMAVVAGVVLVLHTVFSWLLMLKLGWGLVGAAVVLDASWVVIVAALLAYIFSGTCGRA  288

Query  246  WKGFSQRAFQNLTGFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNIS  67
            W GFS +AF+NL GFVRLSLAS VM CLE+WY++ALIL AGY KNAEVSVD  SICMNI 
Sbjct  289  WTGFSWKAFENLWGFVRLSLASAVMLCLEVWYYMALILFAGYLKNAEVSVDALSICMNIL  348

Query  66   GWTLMVGVGFSAAIS  22
            GWTLM  +G +AAIS
Sbjct  349  GWTLMAALGMNAAIS  363



>ref|XP_009759747.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X3 [Nicotiana 
sylvestris]
Length=310

 Score =   383 bits (984),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 181/283 (64%), Positives = 225/283 (80%), Gaps = 0/283 (0%)
 Frame = -1

Query  930  GDIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHVGNIQLAAVA  751
             DI  I  +++F REF+ ESKKLWYLA PAIFT   +YS+GA+TQ FAGH+G ++LAAV+
Sbjct  28   ADIPPITGIQDFFREFFVESKKLWYLAGPAIFTSLCRYSLGAVTQTFAGHLGTLELAAVS  87

Query  750  VENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNATAIPLTTLYI  571
            VEN++IAGF+FGIM GMGSALETLCGQAFGA +++MLGVY+QRSW+ILN TA+ L  LYI
Sbjct  88   VENSVIAGFSFGIMLGMGSALETLCGQAFGAGQIDMLGVYMQRSWVILNTTAVILMLLYI  147

Query  570  FSTPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYVMASVSDVAL  391
            F+ P L+L+ Q   IS+  G  A++MIPQL+AY   FPI +FLQ+QSKI VMA ++ ++L
Sbjct  148  FAAPFLRLIGQTEDISREAGKMALYMIPQLYAYAMNFPIAKFLQAQSKIMVMAWIAAISL  207

Query  390  VGHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKGFSQRAFQNL  211
            V H  FSWLFMLKL WGL G AVVLN++WWF+ VAQ +Y+ SG CG AW GFS +AF NL
Sbjct  208  VLHTFFSWLFMLKLGWGLVGAAVVLNSSWWFIVVAQLLYIFSGTCGQAWSGFSWKAFHNL  267

Query  210  TGFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSI  82
             GFV+LSLAS VM CLE WYF+AL+L AGY KNAE++VD  SI
Sbjct  268  WGFVKLSLASAVMLCLETWYFMALVLFAGYLKNAEIAVDALSI  310



>gb|AFK46935.1| unknown [Medicago truncatula]
Length=517

 Score =   390 bits (1002),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 196/321 (61%), Positives = 237/321 (74%), Gaps = 0/321 (0%)
 Frame = -1

Query  984  NTQIS*NMSSVYSFDADAGDIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGA  805
            NT      S+   F A A D+  I   K+F ++F  ESKKLWYLA PAIF+  S+YS+GA
Sbjct  21   NTNFPSPPSNTAIFTAAAPDMDLITSPKDFFKQFIVESKKLWYLAGPAIFSFVSKYSLGA  80

Query  804  ITQVFAGHVGNIQLAAVAVENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQ  625
             TQ+FAGHV  I LAAV+VEN+LIAGF+FG+M GMGSA ETLCGQA GA KL+MLG+Y+Q
Sbjct  81   ATQIFAGHVSTIDLAAVSVENSLIAGFSFGLMLGMGSAFETLCGQAVGAGKLDMLGIYMQ  140

Query  624  RSWIILNATAIPLTTLYIFSTPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRF  445
            RSW+IL + A PL  LYIF+  ILK + Q   IS+A GTFA++MIPQLFAY   FP+ +F
Sbjct  141  RSWVILFSMAFPLCLLYIFAGSILKFIGQTTEISEAAGTFALYMIPQLFAYALNFPVAKF  200

Query  444  LQSQSKIYVMASVSDVALVGHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVS  265
            LQ+QS + V+A +S VA+V H +FSWL M+K  WGL G AV LN + WF+ VAQ  YV S
Sbjct  201  LQAQSMVIVIAVISGVAMVLHPVFSWLLMVKFGWGLVGAAVSLNGSRWFIVVAQLGYVFS  260

Query  264  GACGDAWKGFSQRAFQNLTGFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTS  85
            G CG AW GFS  AF+NL GF RLSLAS VM CLE WYF+ALIL AGY KNAE+SVD  S
Sbjct  261  GKCGIAWNGFSFEAFRNLWGFFRLSLASAVMLCLETWYFMALILFAGYLKNAEISVDAFS  320

Query  84   ICMNISGWTLMVGVGFSAAIS  22
            ICMNI GWT+MV +G + A+S
Sbjct  321  ICMNILGWTVMVSLGMNVAVS  341



>ref|XP_009759746.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Nicotiana 
sylvestris]
Length=312

 Score =   383 bits (983),  Expect = 7e-129, Method: Compositional matrix adjust.
 Identities = 181/283 (64%), Positives = 225/283 (80%), Gaps = 0/283 (0%)
 Frame = -1

Query  930  GDIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHVGNIQLAAVA  751
             DI  I  +++F REF+ ESKKLWYLA PAIFT   +YS+GA+TQ FAGH+G ++LAAV+
Sbjct  28   ADIPPITGIQDFFREFFVESKKLWYLAGPAIFTSLCRYSLGAVTQTFAGHLGTLELAAVS  87

Query  750  VENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNATAIPLTTLYI  571
            VEN++IAGF+FGIM GMGSALETLCGQAFGA +++MLGVY+QRSW+ILN TA+ L  LYI
Sbjct  88   VENSVIAGFSFGIMLGMGSALETLCGQAFGAGQIDMLGVYMQRSWVILNTTAVILMLLYI  147

Query  570  FSTPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYVMASVSDVAL  391
            F+ P L+L+ Q   IS+  G  A++MIPQL+AY   FPI +FLQ+QSKI VMA ++ ++L
Sbjct  148  FAAPFLRLIGQTEDISREAGKMALYMIPQLYAYAMNFPIAKFLQAQSKIMVMAWIAAISL  207

Query  390  VGHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKGFSQRAFQNL  211
            V H  FSWLFMLKL WGL G AVVLN++WWF+ VAQ +Y+ SG CG AW GFS +AF NL
Sbjct  208  VLHTFFSWLFMLKLGWGLVGAAVVLNSSWWFIVVAQLLYIFSGTCGQAWSGFSWKAFHNL  267

Query  210  TGFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSI  82
             GFV+LSLAS VM CLE WYF+AL+L AGY KNAE++VD  SI
Sbjct  268  WGFVKLSLASAVMLCLETWYFMALVLFAGYLKNAEIAVDALSI  310



>ref|XP_009759744.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Nicotiana 
sylvestris]
Length=364

 Score =   383 bits (984),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 188/309 (61%), Positives = 236/309 (76%), Gaps = 0/309 (0%)
 Frame = -1

Query  927  DIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHVGNIQLAAVAV  748
            DI  I  +++F REF+ ESKKLWYLA PAIFT   +YS+GA+TQ FAGH+G ++LAAV+V
Sbjct  29   DIPPITGIQDFFREFFVESKKLWYLAGPAIFTSLCRYSLGAVTQTFAGHLGTLELAAVSV  88

Query  747  ENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNATAIPLTTLYIF  568
            EN++IAGF+FGIM GMGSALETLCGQAFGA +++MLGVY+QRSW+ILN TA+ L  LYIF
Sbjct  89   ENSVIAGFSFGIMLGMGSALETLCGQAFGAGQIDMLGVYMQRSWVILNTTAVILMLLYIF  148

Query  567  STPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYVMASVSDVALV  388
            + P L+L+ Q   IS+  G  A++MIPQL+AY   FPI +FLQ+QSKI VMA ++ ++LV
Sbjct  149  AAPFLRLIGQTEDISREAGKMALYMIPQLYAYAMNFPIAKFLQAQSKIMVMAWIAAISLV  208

Query  387  GHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKGFSQRAFQNLT  208
             H  FSWLFMLKL WGL G AVVLN++WWF+ VAQ +Y+ SG CG AW GFS +AF NL 
Sbjct  209  LHTFFSWLFMLKLGWGLVGAAVVLNSSWWFIVVAQLLYIFSGTCGQAWSGFSWKAFHNLW  268

Query  207  GFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGWTLMVGVGFSAA  28
            GFV+LSLAS VM CLE WYF+AL+L AGY KNAE++VD  SI    S  +    V +S A
Sbjct  269  GFVKLSLASAVMLCLETWYFMALVLFAGYLKNAEIAVDALSIWFCDSLSSSSCCVFWSRA  328

Query  27   ISNNLFRRR  1
                ++RRR
Sbjct  329  SGCLVWRRR  337



>emb|CAN64516.1| hypothetical protein VITISV_023506 [Vitis vinifera]
Length=444

 Score =   385 bits (989),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 185/301 (61%), Positives = 230/301 (76%), Gaps = 0/301 (0%)
 Frame = -1

Query  924  IRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHVGNIQLAAVAVE  745
            +  I  V +F REF  ESKKLW++A PAIFT   +YS+GAITQVF GH+G +QLAA AVE
Sbjct  1    MDPINGVGDFFREFRVESKKLWHIAGPAIFTYLCRYSLGAITQVFVGHIGALQLAAFAVE  60

Query  744  NNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNATAIPLTTLYIFS  565
            N++I+ F+ G M GMGSALETLCGQAFGA +L+MLGVY+QRSWIIL  TA+PL+ +YIF+
Sbjct  61   NSVISMFSLGTMLGMGSALETLCGQAFGAGQLDMLGVYMQRSWIILVTTALPLSLIYIFA  120

Query  564  TPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYVMASVSDVALVG  385
              ILKL+ +   ISKA G FA+WM+PQLF+Y  +FPI +FLQSQ K+ V++  + V LV 
Sbjct  121  EQILKLIGETEEISKAAGVFALWMLPQLFSYALSFPISKFLQSQRKMLVLSLTAGVTLVL  180

Query  384  HVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKGFSQRAFQNLTG  205
            H  FSWL ++KL WGL G AVVLN + W    A F Y++SG+CG AW GFS +AFQNL  
Sbjct  181  HAFFSWLLIMKLGWGLVGAAVVLNXSSWLPVAANFSYILSGSCGQAWSGFSSKAFQNLWA  240

Query  204  FVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGWTLMVGVGFSAAI  25
            FV+LSLAS VM CLE+WYF+ LIL AGY KNAEVSVD  SICM I GW +M+ +GF+AA+
Sbjct  241  FVKLSLASAVMLCLEVWYFMVLILFAGYLKNAEVSVDALSICMTILGWAVMLSIGFNAAV  300

Query  24   S  22
            S
Sbjct  301  S  301



>ref|XP_002272214.2| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Vitis 
vinifera]
 ref|XP_010646477.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Vitis 
vinifera]
Length=512

 Score =   387 bits (993),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 186/302 (62%), Positives = 231/302 (76%), Gaps = 0/302 (0%)
 Frame = -1

Query  927  DIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHVGNIQLAAVAV  748
            D+  I  V +F REF  ESKKLW++A PAIFT   +YS+GAITQVF GH+G +QLAA AV
Sbjct  39   DMDPINGVGDFFREFRVESKKLWHIAGPAIFTYLCRYSLGAITQVFVGHIGALQLAAFAV  98

Query  747  ENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNATAIPLTTLYIF  568
            EN++I+ F+ G M GMGSALETLCGQAFGA +L+MLGVY+QRSWIIL  TA+PL+ +YIF
Sbjct  99   ENSVISMFSLGTMLGMGSALETLCGQAFGAGQLDMLGVYMQRSWIILVTTALPLSLIYIF  158

Query  567  STPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYVMASVSDVALV  388
            +  ILKL+ +   ISKA G FA+WM+PQLF+Y  +FPI +FLQSQ K+ V++  + V LV
Sbjct  159  AEQILKLIGETEEISKAAGVFALWMLPQLFSYALSFPISKFLQSQRKMLVLSLTAGVTLV  218

Query  387  GHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKGFSQRAFQNLT  208
             H  FSWL ++KL WGL G AVVLN + W    A F Y++SG+CG AW GFS +AFQNL 
Sbjct  219  LHAFFSWLLIMKLGWGLVGAAVVLNVSSWLPVAANFSYILSGSCGQAWSGFSSKAFQNLW  278

Query  207  GFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGWTLMVGVGFSAA  28
             FV+LSLAS VM CLE+WYF+ LIL AGY KNAEVSVD  SICM I GW +M+ +GF+AA
Sbjct  279  AFVKLSLASAVMLCLEVWYFMVLILFAGYLKNAEVSVDALSICMTILGWAVMLSIGFNAA  338

Query  27   IS  22
            +S
Sbjct  339  VS  340



>gb|KFK43564.1| hypothetical protein AALP_AA1G142600 [Arabis alpina]
Length=519

 Score =   386 bits (992),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 192/313 (61%), Positives = 235/313 (75%), Gaps = 0/313 (0%)
 Frame = -1

Query  960  SSVYSFDADAGDIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGH  781
            SS+ SF + A DI  I  V +F+REF  ESKKLW LA PAIFT  +Q+S+GA+TQVFAGH
Sbjct  38   SSLVSFSSTAVDIPPISGVGDFVREFRIESKKLWKLAGPAIFTSLAQFSLGAVTQVFAGH  97

Query  780  VGNIQLAAVAVENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNA  601
            +  I LAAV++EN++IAGF+FGIM GMGSALETLCGQAFGA K+ MLGVYLQRSW+IL+ 
Sbjct  98   MSTIALAAVSIENSVIAGFSFGIMLGMGSALETLCGQAFGAGKVSMLGVYLQRSWVILSV  157

Query  600  TAIPLTTLYIFSTPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIY  421
            TA+ L+ +YIF+ PIL  + Q   IS   G F+++MIPQ+FAY   FP  +FLQSQSKI 
Sbjct  158  TALFLSLIYIFAAPILLFIGQTAAISTMAGLFSIYMIPQIFAYAINFPSAKFLQSQSKIM  217

Query  420  VMASVSDVALVGHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWK  241
             MA++S VALV H   +WL   +  WGLPG A+VLNT+W F+ VAQ VY+  G CG+AW 
Sbjct  218  AMAAISGVALVIHTFLTWLVTSRFDWGLPGLALVLNTSWVFIVVAQLVYIFGGTCGEAWP  277

Query  240  GFSQRAFQNLTGFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGW  61
            GF+  AF NL GFV+LSLAS VM CLE+WYF+AL+L AGY KNAEVSV   SICMNI  W
Sbjct  278  GFTWEAFHNLWGFVKLSLASAVMICLEVWYFMALVLFAGYLKNAEVSVAALSICMNILVW  337

Query  60   TLMVGVGFSAAIS  22
              MV  G +AA+S
Sbjct  338  AAMVSFGINAAVS  350



>ref|XP_006290950.1| hypothetical protein CARUB_v10017066mg [Capsella rubella]
 gb|EOA23848.1| hypothetical protein CARUB_v10017066mg [Capsella rubella]
Length=501

 Score =   384 bits (987),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 194/302 (64%), Positives = 233/302 (77%), Gaps = 0/302 (0%)
 Frame = -1

Query  927  DIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHVGNIQLAAVAV  748
            DI  I  +  F+REF  E+KKLWYLA PAIFT  SQYS+GA+TQVFAGH+  I LAAV+V
Sbjct  29   DIPPITTIGGFVREFNVETKKLWYLAGPAIFTCMSQYSLGAVTQVFAGHISTISLAAVSV  88

Query  747  ENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNATAIPLTTLYIF  568
            EN++IAGF+FGIM GMGSALETLCGQAFGA KL MLGVYLQRSW+ILN TA+ LT LYIF
Sbjct  89   ENSVIAGFSFGIMLGMGSALETLCGQAFGAGKLSMLGVYLQRSWVILNVTALILTLLYIF  148

Query  567  STPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYVMASVSDVALV  388
            + PIL  + Q   IS+A G F+++MIPQ+FAY   FP  +FLQSQSKI VMA+++ VAL 
Sbjct  149  AAPILAFIGQTAAISRAAGIFSIYMIPQIFAYAINFPTAKFLQSQSKIMVMAAIAAVALA  208

Query  387  GHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKGFSQRAFQNLT  208
             HV  +W  ++KL WG+ G AVVLN +WWF+  AQ VY+ SG CG+AW G S  AF+NL 
Sbjct  209  IHVPLTWFVVVKLHWGMAGLAVVLNASWWFIDTAQIVYIFSGTCGEAWSGLSWEAFRNLW  268

Query  207  GFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGWTLMVGVGFSAA  28
             FVRLSLAS VM CLE+WYF+A+IL AGY K+AEVSV   SICMNI GWT M+  G +AA
Sbjct  269  SFVRLSLASAVMLCLEVWYFMAIILFAGYLKDAEVSVAALSICMNILGWTAMIAFGMNAA  328

Query  27   IS  22
            +S
Sbjct  329  VS  330



>gb|KFK32791.1| hypothetical protein AALP_AA6G288700 [Arabis alpina]
Length=502

 Score =   384 bits (987),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 187/306 (61%), Positives = 229/306 (75%), Gaps = 0/306 (0%)
 Frame = -1

Query  939  ADAGDIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHVGNIQLA  760
            +  GDI  I  +  F++EF  E+KKLWYLA PAIFT  +QYS+GA+TQ+FAGHV    LA
Sbjct  26   SSEGDIPPITTIGGFVKEFNVEAKKLWYLAGPAIFTSVTQYSLGAVTQIFAGHVSTRALA  85

Query  759  AVAVENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNATAIPLTT  580
            AV+VEN++IAGF++GIM+GMGSALETLCGQAFGA KL MLGVYLQRSW+ILN TA+ L+ 
Sbjct  86   AVSVENSVIAGFSYGIMFGMGSALETLCGQAFGAGKLSMLGVYLQRSWVILNVTALILSL  145

Query  579  LYIFSTPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYVMASVSD  400
            LYIF+ PIL  + Q   IS A G F+++MIPQ+FAY   FP  +FLQSQSKI VMA+ S 
Sbjct  146  LYIFAAPILAFIGQTAAISSAAGIFSIYMIPQIFAYAVNFPTAKFLQSQSKIMVMAATSA  205

Query  399  VALVGHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKGFSQRAF  220
            VAL  HV  +W  M + +W + G A VLN +W F+ VAQ  Y+ SG CG+AW GFS  AF
Sbjct  206  VALALHVPLTWFVMERFKWSMAGLAAVLNASWLFIVVAQAAYIFSGTCGEAWSGFSWEAF  265

Query  219  QNLTGFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGWTLMVGVG  40
             NL  FVRLSLAS VM CLE+WYF+A+IL AGY KNAEVSV   SIC+NI GWT M+ +G
Sbjct  266  HNLWSFVRLSLASAVMLCLEVWYFMAIILFAGYLKNAEVSVAALSICINILGWTAMIAIG  325

Query  39   FSAAIS  22
             + A+S
Sbjct  326  MNPAVS  331



>ref|XP_006395543.1| hypothetical protein EUTSA_v10005286mg, partial [Eutrema salsugineum]
 gb|ESQ32829.1| hypothetical protein EUTSA_v10005286mg, partial [Eutrema salsugineum]
Length=494

 Score =   384 bits (986),  Expect = 9e-127, Method: Compositional matrix adjust.
 Identities = 195/306 (64%), Positives = 237/306 (77%), Gaps = 0/306 (0%)
 Frame = -1

Query  939  ADAGDIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHVGNIQLA  760
            + A DI  I  V  F++EF  E+KKLWYLA PAIFT  SQYS+GA+TQVFAGH+  I LA
Sbjct  27   STADDISPITTVGGFVKEFNVEAKKLWYLAGPAIFTSMSQYSLGAVTQVFAGHISTISLA  86

Query  759  AVAVENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNATAIPLTT  580
            AV+VEN++IAGF+FG+M GMGSALETLCGQAFGA +L+MLGVYLQRSW+ILN TA+ L+ 
Sbjct  87   AVSVENSVIAGFSFGVMLGMGSALETLCGQAFGAGQLKMLGVYLQRSWVILNVTALILSL  146

Query  579  LYIFSTPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYVMASVSD  400
            LYIF+ PIL  + Q P IS A G F+++MIPQ+FAY   FP  +FLQSQSKI VMA+++ 
Sbjct  147  LYIFAAPILASIGQTPAISSAAGIFSIYMIPQIFAYAVNFPTAKFLQSQSKIMVMAAIAA  206

Query  399  VALVGHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKGFSQRAF  220
            VALV HV  +W  + KL+WG+ G AVVLN +WWF+ VAQ VY+ SG CG+AW G S  AF
Sbjct  207  VALVLHVPLTWFVVGKLKWGMAGLAVVLNGSWWFIVVAQLVYIFSGTCGEAWSGLSWEAF  266

Query  219  QNLTGFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGWTLMVGVG  40
             NL  FVRLSLAS VM CLE+WYF+A+IL AGY KNAEVSV   SICMNI GWT M+ +G
Sbjct  267  HNLWSFVRLSLASAVMLCLEVWYFMAVILFAGYLKNAEVSVAALSICMNILGWTAMIAIG  326

Query  39   FSAAIS  22
             + A+S
Sbjct  327  MNTAVS  332



>ref|XP_009764749.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Nicotiana sylvestris]
Length=437

 Score =   380 bits (977),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 188/291 (65%), Positives = 232/291 (80%), Gaps = 0/291 (0%)
 Frame = -1

Query  894  IREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHVGNIQLAAVAVENNLIAGFAFG  715
            IREF  E+KKLWYLAAPA+FT+  QYSI  ITQ+FAGHVG +QLAA++V+N++IAGFAFG
Sbjct  37   IREFSRETKKLWYLAAPAVFTLVCQYSISGITQMFAGHVGTVQLAAISVQNSVIAGFAFG  96

Query  714  IMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNATAIPLTTLYIFSTPILKLLHQN  535
            +M+GMGSALETLCGQA+GAK+LEMLG+Y+QRSWII+  TA+ L   YIF+TP+LKL+ Q+
Sbjct  97   VMFGMGSALETLCGQAYGAKQLEMLGIYMQRSWIIVGTTALVLMFPYIFATPLLKLIGQD  156

Query  534  PHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYVMASVSDVALVGHVLFSWLFML  355
            P ISK  G FAVWMIPQLFA    FPI++FLQ+QSK+ VMA+++ V +VGH LFSWL ML
Sbjct  157  PEISKWAGKFAVWMIPQLFANAINFPIRKFLQAQSKVVVMAAIAGVTVVGHTLFSWLLML  216

Query  354  KLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKGFSQRAFQNLTGFVRLSLASGV  175
            K+ WGL G A+ LN + WFM VA   Y+ SG CG AW GFS +AFQNL GFV+LS AS V
Sbjct  217  KMGWGLAGAALALNASSWFMVVANLAYIFSGTCGRAWSGFSCKAFQNLWGFVQLSFASAV  276

Query  174  MFCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGWTLMVGVGFSAAIS  22
            M CLE+WY++ALIL  GY KNAE++VD  +IC NI  WT MV  G + A+S
Sbjct  277  MICLEMWYYMALILFTGYLKNAEIAVDAIAICSNICAWTFMVSFGLNVAVS  327



>gb|KFK43565.1| hypothetical protein AALP_AA1G142700 [Arabis alpina]
Length=523

 Score =   380 bits (977),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 186/313 (59%), Positives = 231/313 (74%), Gaps = 0/313 (0%)
 Frame = -1

Query  960  SSVYSFDADAGDIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGH  781
            SS+ SF + A DI  I  V +F+REF +ESKKLW LA PA+FT  +Q+S+G +TQ+FAGH
Sbjct  38   SSLVSFSSTAVDIPPISGVGDFVREFRTESKKLWKLAGPAVFTSLAQFSLGTVTQIFAGH  97

Query  780  VGNIQLAAVAVENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNA  601
            +  I LAAV++EN++I GF FGIM GMGSALETLCGQAFGA K+ MLGVYLQRSW+IL+ 
Sbjct  98   MSTIALAAVSIENSVITGFTFGIMLGMGSALETLCGQAFGAGKVSMLGVYLQRSWVILSV  157

Query  600  TAIPLTTLYIFSTPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIY  421
            TA+ L+ +YIF+ PIL  + Q   IS   G F+++MIPQ+FAY   FP  +FLQSQSK+ 
Sbjct  158  TALFLSLIYIFAGPILLFIGQTAAISAMAGLFSIYMIPQIFAYAINFPSAKFLQSQSKVM  217

Query  420  VMASVSDVALVGHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWK  241
             MA++S VALV H   +WL   +  WGLPG A V NT+W F+ VAQ VY+  G CG+AW 
Sbjct  218  AMAAISGVALVIHTFLTWLVTSRFDWGLPGLAFVFNTSWVFIVVAQLVYIFGGTCGEAWP  277

Query  240  GFSQRAFQNLTGFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGW  61
            GF+  AF NL GFV+LSLAS VM CLE+WYF+ L+L AGY KNAEVSV   SICMNI GW
Sbjct  278  GFTWEAFHNLWGFVKLSLASAVMICLEVWYFMVLVLFAGYLKNAEVSVAALSICMNILGW  337

Query  60   TLMVGVGFSAAIS  22
              MV  G +AA+S
Sbjct  338  AAMVSFGINAAVS  350



>ref|XP_011086625.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Sesamum 
indicum]
Length=497

 Score =   378 bits (971),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 190/293 (65%), Positives = 224/293 (76%), Gaps = 0/293 (0%)
 Frame = -1

Query  945  FDADAGDIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHVGNIQ  766
            F  D  DI  I  V  F   F  ES+KLWYLA PAIFT   Q+S+GAITQ  AGHVG + 
Sbjct  38   FIVDGDDIPPITGVGSFFEAFKVESEKLWYLAGPAIFTAFCQFSLGAITQTLAGHVGTLD  97

Query  765  LAAVAVENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNATAIPL  586
            LAA A+EN +IAGF+FGIM+GMGSALETLCGQA+GA +++MLGVY+QRS ++L  T++ L
Sbjct  98   LAAFAIENTVIAGFSFGIMWGMGSALETLCGQAYGAGQIDMLGVYMQRSCVVLLTTSLLL  157

Query  585  TTLYIFSTPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYVMASV  406
            T LYIF+ PIL LL Q   +SKA G  ++WMIPQL+AY   FPI RFLQ+QSKI  MA +
Sbjct  158  TFLYIFAEPILLLLGQKEDMSKAAGRLSLWMIPQLYAYAMNFPISRFLQAQSKIMAMAWI  217

Query  405  SDVALVGHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKGFSQR  226
            S V LV HV FSWLFMLKL WG+ GGAVVLN +WWF+ VAQ VY+ SGACGDAW GFS +
Sbjct  218  SAVGLVLHVFFSWLFMLKLEWGMAGGAVVLNISWWFIVVAQLVYIFSGACGDAWTGFSWK  277

Query  225  AFQNLTGFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNIS  67
            AFQNL GFVRLSLAS VM CLE+WY  AL+L AGY KNAEV+VD  SIC+ +S
Sbjct  278  AFQNLWGFVRLSLASAVMMCLEVWYMTALVLFAGYVKNAEVAVDALSICVRVS  330



>gb|ABR16195.1| unknown [Picea sitchensis]
Length=500

 Score =   377 bits (967),  Expect = 8e-124, Method: Compositional matrix adjust.
 Identities = 178/315 (57%), Positives = 230/315 (73%), Gaps = 3/315 (1%)
 Frame = -1

Query  966  NMSSVYSFDADAGDIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFA  787
            ++   Y F  D    R I   +      + ESKKLWYL+ PAIFT   QYS+GA+TQ FA
Sbjct  26   DLPHRYDFPDDR---RPITDCRSLANGCWEESKKLWYLSGPAIFTSVCQYSLGALTQTFA  82

Query  786  GHVGNIQLAAVAVENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIIL  607
            GH+G ++LAAV++EN++IAG +FGIM GMGSALETLCGQ+ GA++L++LG+Y+QRSWIIL
Sbjct  83   GHIGELELAAVSIENSVIAGLSFGIMMGMGSALETLCGQSVGARRLDLLGLYMQRSWIIL  142

Query  606  NATAIPLTTLYIFSTPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSK  427
             +TA+ ++ +YIF+TPIL L+ Q   I+   G FAVWM+PQLFAY   FP+ +FLQ+QSK
Sbjct  143  LSTALIMSLIYIFATPILVLIGQQKDIADMAGKFAVWMLPQLFAYAMNFPLAKFLQAQSK  202

Query  426  IYVMASVSDVALVGHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDA  247
            + VM+ ++  ALV HVL SW+ + K+ WGLP  A+VLN +WW + +AQ  YV SGAC DA
Sbjct  203  VMVMSIIAGCALVVHVLLSWILIFKVGWGLPAAALVLNLSWWIIVLAQIGYVFSGACRDA  262

Query  246  WKGFSQRAFQNLTGFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNIS  67
            W GFS  AF NL  FVRLSLASGVM CLE WY   LIL+AGY KN  ++VD  SICMN+ 
Sbjct  263  WAGFSWSAFSNLGAFVRLSLASGVMLCLEAWYLYLLILLAGYLKNPTIAVDAISICMNLM  322

Query  66   GWTLMVGVGFSAAIS  22
            GW  M+ +GF+ AIS
Sbjct  323  GWEFMIAIGFNIAIS  337



>ref|XP_002273431.2| PREDICTED: protein TRANSPARENT TESTA 12 [Vitis vinifera]
 emb|CBI23364.3| unnamed protein product [Vitis vinifera]
Length=516

 Score =   377 bits (968),  Expect = 9e-124, Method: Compositional matrix adjust.
 Identities = 199/317 (63%), Positives = 242/317 (76%), Gaps = 2/317 (1%)
 Frame = -1

Query  966  NMSSVYSFDADAG-DIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVF  790
            N S   S +A+ G DI  I  V +F REF+ ESKKLW LA PAIF+   +YS+GA+TQVF
Sbjct  28   NTSLFSSHNANYGNDIDPINGVGDFFREFFVESKKLWRLAGPAIFSSLCRYSLGAVTQVF  87

Query  789  AGHVGNIQLAAVAVENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWII  610
            AGH+  + LAA A+EN++I GF+ GI++GMGSALETLCGQAFGA++ +MLG+YLQRSW+I
Sbjct  88   AGHLSALDLAAFAIENSVIGGFSSGILFGMGSALETLCGQAFGARRPDMLGIYLQRSWVI  147

Query  609  LNATAIPLTTL-YIFSTPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQ  433
            L  T++ L +  YIF+  ILKL+ Q   ISKA G FA WMIPQLFAY   FPI +FLQSQ
Sbjct  148  LITTSLLLLSFLYIFAGQILKLIGQTEAISKAAGIFARWMIPQLFAYATYFPIIKFLQSQ  207

Query  432  SKIYVMASVSDVALVGHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACG  253
             KI +MA +S VAL+ H LFSWL MLKL WGL G AVVLN +WWF+ VA  +YV+SG+CG
Sbjct  208  RKIMMMAWISFVALILHTLFSWLLMLKLGWGLVGAAVVLNASWWFIVVALLLYVLSGSCG  267

Query  252  DAWKGFSQRAFQNLTGFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMN  73
             AW GFS +AFQNL  FVRLSLASGVM CLE+WYF+AL L AGY KNAEVSVD  SIC++
Sbjct  268  HAWSGFSWKAFQNLWAFVRLSLASGVMLCLEVWYFMALTLFAGYLKNAEVSVDALSICLS  327

Query  72   ISGWTLMVGVGFSAAIS  22
            +  WT MV +G +AAIS
Sbjct  328  VLSWTTMVSLGCNAAIS  344



>ref|XP_010682437.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010682438.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Beta vulgaris subsp. 
vulgaris]
Length=525

 Score =   374 bits (959),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 178/298 (60%), Positives = 227/298 (76%), Gaps = 0/298 (0%)
 Frame = -1

Query  915  IKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHVGNIQLAAVAVENNL  736
            IK  + F + ++ E KK  YLA P+ F    QYS+GAIT   +G +  + LAA +VEN++
Sbjct  50   IKSPEIFFKVYWLELKKTMYLAGPSTFMRTCQYSLGAITITISGQLSTLDLAAFSVENSV  109

Query  735  IAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNATAIPLTTLYIFSTPI  556
            IAGF+FGI+ GMGSALETLCGQAFGAK++ MLGVYLQRSW+ILN TA+ L+ LYIF+TP+
Sbjct  110  IAGFSFGILLGMGSALETLCGQAFGAKRINMLGVYLQRSWVILNTTALLLSLLYIFATPL  169

Query  555  LKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYVMASVSDVALVGHVL  376
            LKL+ +   IS+A G  A WMIPQLFAY   FPI ++LQ+Q K+  MA+++ +AL+ H  
Sbjct  170  LKLIGETTAISEAAGRVATWMIPQLFAYAMVFPIIKYLQAQRKVMTMAAITGIALLLHAF  229

Query  375  FSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKGFSQRAFQNLTGFVR  196
            FSWL MLK  WGL GGA VLN +WWF+ +++  Y+ SG CG+AW GFS +AF +L GFVR
Sbjct  230  FSWLLMLKFGWGLAGGAAVLNISWWFIVLSELAYIFSGRCGEAWSGFSWKAFYDLWGFVR  289

Query  195  LSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGWTLMVGVGFSAAIS  22
            LS+AS VM CLE WYF+ALIL AGY KNAEVSVD  S+CMNI GWT+MV +GF+AA+S
Sbjct  290  LSVASAVMLCLETWYFMALILFAGYLKNAEVSVDALSVCMNILGWTMMVALGFNAAVS  347



>ref|XP_006438290.1| hypothetical protein CICLE_v10033839mg [Citrus clementina]
 gb|ESR51530.1| hypothetical protein CICLE_v10033839mg [Citrus clementina]
Length=486

 Score =   369 bits (948),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 188/308 (61%), Positives = 233/308 (76%), Gaps = 0/308 (0%)
 Frame = -1

Query  945  FDADAGDIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHVGNIQ  766
            F A   DI  I  V++F REF  E KKLWYLA PAIF    QYS+GAITQVF+GH+  + 
Sbjct  43   FTAGTDDIPPINGVRDFSREFLKEGKKLWYLAGPAIFMTICQYSLGAITQVFSGHISTLA  102

Query  765  LAAVAVENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNATAIPL  586
            LAAV+VEN++IAGF+FG M GMGSALETLCGQA+GA +L+M+GVYLQRSWIIL  TA+ L
Sbjct  103  LAAVSVENSVIAGFSFGAMLGMGSALETLCGQAYGAGQLDMMGVYLQRSWIILITTALML  162

Query  585  TTLYIFSTPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYVMASV  406
              +YIF+  IL L+ Q   IS A GTFA+WMIPQLFAY   FP+ +FLQ+QSKI V+A +
Sbjct  163  MFMYIFAQQILSLIGQTQEISNAAGTFAIWMIPQLFAYALNFPMVKFLQAQSKIMVLAVI  222

Query  405  SDVALVGHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKGFSQR  226
            + VAL+ H + SWL +LKL  GL G AV LN +WWF+ + + +Y+ SGACG  W GFS +
Sbjct  223  AAVALLLHTILSWLLILKLGLGLVGAAVALNASWWFIDITRLLYIFSGACGPTWSGFSWK  282

Query  225  AFQNLTGFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGWTLMVG  46
            AF +L  FVRLSLAS VM C+E+WYF+ALIL AGY KNA++SV G SICMNI GW+ MV 
Sbjct  283  AFHSLWSFVRLSLASAVMLCVEIWYFMALILFAGYLKNAKLSVAGLSICMNILGWSNMVS  342

Query  45   VGFSAAIS  22
            +G +AA+S
Sbjct  343  IGMNAAVS  350



>ref|XP_010646478.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Vitis 
vinifera]
Length=493

 Score =   368 bits (944),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 177/287 (62%), Positives = 219/287 (76%), Gaps = 0/287 (0%)
 Frame = -1

Query  927  DIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHVGNIQLAAVAV  748
            D+  I  V +F REF  ESKKLW++A PAIFT   +YS+GAITQVF GH+G +QLAA AV
Sbjct  39   DMDPINGVGDFFREFRVESKKLWHIAGPAIFTYLCRYSLGAITQVFVGHIGALQLAAFAV  98

Query  747  ENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNATAIPLTTLYIF  568
            EN++I+ F+ G M GMGSALETLCGQAFGA +L+MLGVY+QRSWIIL  TA+PL+ +YIF
Sbjct  99   ENSVISMFSLGTMLGMGSALETLCGQAFGAGQLDMLGVYMQRSWIILVTTALPLSLIYIF  158

Query  567  STPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYVMASVSDVALV  388
            +  ILKL+ +   ISKA G FA+WM+PQLF+Y  +FPI +FLQSQ K+ V++  + V LV
Sbjct  159  AEQILKLIGETEEISKAAGVFALWMLPQLFSYALSFPISKFLQSQRKMLVLSLTAGVTLV  218

Query  387  GHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKGFSQRAFQNLT  208
             H  FSWL ++KL WGL G AVVLN + W    A F Y++SG+CG AW GFS +AFQNL 
Sbjct  219  LHAFFSWLLIMKLGWGLVGAAVVLNVSSWLPVAANFSYILSGSCGQAWSGFSSKAFQNLW  278

Query  207  GFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNIS  67
             FV+LSLAS VM CLE+WYF+ LIL AGY KNAEVSVD  SIC+ +S
Sbjct  279  AFVKLSLASAVMLCLEVWYFMVLILFAGYLKNAEVSVDALSICVRVS  325



>ref|XP_002272251.2| PREDICTED: protein TRANSPARENT TESTA 12 [Vitis vinifera]
 emb|CBI23363.3| unnamed protein product [Vitis vinifera]
Length=501

 Score =   366 bits (939),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 183/303 (60%), Positives = 225/303 (74%), Gaps = 1/303 (0%)
 Frame = -1

Query  927  DIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHVGNIQLAAVAV  748
            DI  I  V++F+++F  ESKKLW LA P I     QYS+GAITQVFAG VG + LAA A 
Sbjct  28   DIDPINGVEDFVKKFLIESKKLWRLAGPTILLYLCQYSLGAITQVFAGQVGVLDLAAFAY  87

Query  747  ENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNATAIPLTTLYIF  568
            EN +IAGF+ GI+YGMGSA+ETLCGQAFGA +++MLGVYLQRSWIIL AT++ L  LYIF
Sbjct  88   ENLVIAGFSSGILYGMGSAVETLCGQAFGAGRVDMLGVYLQRSWIILLATSLVLCFLYIF  147

Query  567  STPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYVMASVSDVALV  388
            +  +LK L ++  I+KA G FA WM+PQLFAY   +PI +FLQSQ K+ VM  +S VAL+
Sbjct  148  AEQLLKFLGESDEIAKAAGDFAPWMLPQLFAYALNYPISKFLQSQRKMMVMCYISAVALI  207

Query  387  GHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKGFSQRAFQNLT  208
             H +FSWL MLKL WGL G AVVLN +WWF+ VAQ +Y++SG+CG AW G S  AF NL 
Sbjct  208  LHTVFSWLLMLKLGWGLVGAAVVLNVSWWFIVVAQLLYILSGSCGRAWSGLSWEAFHNLW  267

Query  207  GFVRLSLASGVMFCLELWYFVALILIAGYTK-NAEVSVDGTSICMNISGWTLMVGVGFSA  31
             F++LS+AS VM  LE+WY   LI+ AGY K N EVSVD  S+CMNI  W LMV +GF+A
Sbjct  268  EFLKLSIASAVMLSLEVWYLAILIVFAGYVKTNEEVSVDAMSVCMNILAWALMVFLGFNA  327

Query  30   AIS  22
             IS
Sbjct  328  GIS  330



>ref|NP_173744.1| MATE efflux family protein [Arabidopsis thaliana]
 gb|AEE30369.1| MATE efflux family protein [Arabidopsis thaliana]
Length=515

 Score =   365 bits (938),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 183/302 (61%), Positives = 230/302 (76%), Gaps = 0/302 (0%)
 Frame = -1

Query  927  DIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHVGNIQLAAVAV  748
            D+  I   ++FIR+F +ESKKLW+LA PAIFT   QYS+GA+TQ+ AGHV  + LAAV++
Sbjct  27   DMPPISGGRDFIRQFAAESKKLWWLAGPAIFTSFCQYSLGAVTQILAGHVNTLALAAVSI  86

Query  747  ENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNATAIPLTTLYIF  568
            +N++I+GF+ GIM GMGSAL TLCGQA+GA +LEM+G+YLQRSWIILN+ A+ L   Y+F
Sbjct  87   QNSVISGFSVGIMLGMGSALATLCGQAYGAGQLEMMGIYLQRSWIILNSCALLLCLFYVF  146

Query  567  STPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYVMASVSDVALV  388
            +TP+L LL Q+P ISKA G F++WMIPQLFAY   F   +FLQ+QSK+  MA ++   L+
Sbjct  147  ATPLLSLLGQSPEISKAAGKFSLWMIPQLFAYAVNFATAKFLQAQSKVIAMAVIAATVLL  206

Query  387  GHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKGFSQRAFQNLT  208
             H L SWL MLKLRWG+ GGAVVLN +WW + V Q VY+  G+ G AW G S  AF+NL 
Sbjct  207  QHTLLSWLLMLKLRWGMAGGAVVLNMSWWLIDVTQIVYICGGSSGRAWSGLSWMAFKNLR  266

Query  207  GFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGWTLMVGVGFSAA  28
            GF RLSLAS VM CLE+WYF+ALIL AGY KN +VSV   SICMNI GW +MV  GF+AA
Sbjct  267  GFARLSLASAVMVCLEVWYFMALILFAGYLKNPQVSVAALSICMNILGWPIMVAFGFNAA  326

Query  27   IS  22
            +S
Sbjct  327  VS  328



>ref|XP_006483932.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Citrus sinensis]
Length=517

 Score =   365 bits (938),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 187/308 (61%), Positives = 231/308 (75%), Gaps = 0/308 (0%)
 Frame = -1

Query  945  FDADAGDIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHVGNIQ  766
            F A   DI  I  V++F REF  E KKLWYLA PAIF    QY +GAITQVF+GH+  + 
Sbjct  43   FTAGTDDIPPINGVRDFSREFLKEGKKLWYLAGPAIFMTICQYPLGAITQVFSGHISTLA  102

Query  765  LAAVAVENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNATAIPL  586
            LAAV+VEN++IAGF+FG M GMGSALETLCGQA+GA +L+M+GVYLQRSWIIL  TA+ L
Sbjct  103  LAAVSVENSVIAGFSFGAMLGMGSALETLCGQAYGAGQLDMMGVYLQRSWIILITTALML  162

Query  585  TTLYIFSTPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYVMASV  406
              +YIF+  IL L+ Q   IS A GTFA WMIPQLFAY   FP+ +FLQ+QSKI V+A +
Sbjct  163  MFMYIFAQQILSLIGQTQEISNAAGTFATWMIPQLFAYALNFPMVKFLQAQSKIMVLAVI  222

Query  405  SDVALVGHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKGFSQR  226
            + VAL+ H + SWL +LKL  GL G AV LN +WWF+ + + +Y+ SGACG  W GFS +
Sbjct  223  AAVALLLHTILSWLLILKLGLGLVGAAVALNASWWFIDITRLLYIFSGACGPTWSGFSWK  282

Query  225  AFQNLTGFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGWTLMVG  46
            AF +L  FVRLSLAS VM C+E+WYF+ALIL AGY KNA++SV G SICMNI GW+ MV 
Sbjct  283  AFHSLWSFVRLSLASAVMLCVEIWYFMALILFAGYLKNAKLSVAGLSICMNILGWSNMVS  342

Query  45   VGFSAAIS  22
            +G +AA+S
Sbjct  343  IGMNAAVS  350



>gb|AAF87016.1|AC005292_25 F26F24.14 [Arabidopsis thaliana]
Length=536

 Score =   366 bits (939),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 183/302 (61%), Positives = 230/302 (76%), Gaps = 0/302 (0%)
 Frame = -1

Query  927  DIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHVGNIQLAAVAV  748
            D+  I   ++FIR+F +ESKKLW+LA PAIFT   QYS+GA+TQ+ AGHV  + LAAV++
Sbjct  27   DMPPISGGRDFIRQFAAESKKLWWLAGPAIFTSFCQYSLGAVTQILAGHVNTLALAAVSI  86

Query  747  ENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNATAIPLTTLYIF  568
            +N++I+GF+ GIM GMGSAL TLCGQA+GA +LEM+G+YLQRSWIILN+ A+ L   Y+F
Sbjct  87   QNSVISGFSVGIMLGMGSALATLCGQAYGAGQLEMMGIYLQRSWIILNSCALLLCLFYVF  146

Query  567  STPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYVMASVSDVALV  388
            +TP+L LL Q+P ISKA G F++WMIPQLFAY   F   +FLQ+QSK+  MA ++   L+
Sbjct  147  ATPLLSLLGQSPEISKAAGKFSLWMIPQLFAYAVNFATAKFLQAQSKVIAMAVIAATVLL  206

Query  387  GHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKGFSQRAFQNLT  208
             H L SWL MLKLRWG+ GGAVVLN +WW + V Q VY+  G+ G AW G S  AF+NL 
Sbjct  207  QHTLLSWLLMLKLRWGMAGGAVVLNMSWWLIDVTQIVYICGGSSGRAWSGLSWMAFKNLR  266

Query  207  GFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGWTLMVGVGFSAA  28
            GF RLSLAS VM CLE+WYF+ALIL AGY KN +VSV   SICMNI GW +MV  GF+AA
Sbjct  267  GFARLSLASAVMVCLEVWYFMALILFAGYLKNPQVSVAALSICMNILGWPIMVAFGFNAA  326

Query  27   IS  22
            +S
Sbjct  327  VS  328



>ref|XP_008220742.1| PREDICTED: protein TRANSPARENT TESTA 12 [Prunus mume]
Length=481

 Score =   363 bits (933),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 177/300 (59%), Positives = 225/300 (75%), Gaps = 1/300 (0%)
 Frame = -1

Query  921  RQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHVGNIQLAAVAVEN  742
             Q +KV   ++EF  ESKKLW +A PAIFT   QYS+GA+TQVF+G VG+++LAAV+VEN
Sbjct  16   EQEEKVG-IVKEFGIESKKLWKIAGPAIFTAICQYSLGALTQVFSGFVGDVELAAVSVEN  74

Query  741  NLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNATAIPLTTLYIFST  562
            +++AG AFG+M GMGSALETLCGQA+GA ++ MLGVY+QRSWIIL  TA  L  +Y++S 
Sbjct  75   SVVAGLAFGVMLGMGSALETLCGQAYGAGQIRMLGVYMQRSWIILLVTACVLVPVYVWSP  134

Query  561  PILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYVMASVSDVALVGH  382
            PIL+L+ +   IS+A G FA+WMIPQLFAY   FPIQ+FLQ+Q K++VMA +S V LV H
Sbjct  135  PILELVGETDEISEAAGKFALWMIPQLFAYALNFPIQKFLQAQRKVFVMAWISAVVLVIH  194

Query  381  VLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKGFSQRAFQNLTGF  202
             LFSWL MLKL WGL G AV+LNT+WW + +AQ +Y+       AW GFS  AF +L GF
Sbjct  195  TLFSWLLMLKLGWGLIGAAVMLNTSWWLIVIAQLLYIFITKSDGAWSGFSWLAFADLFGF  254

Query  201  VRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGWTLMVGVGFSAAIS  22
            V+LSLAS VM CLE WY + L++I G   N  + VD  SICMNI+GW  M+ +GF+AAIS
Sbjct  255  VKLSLASAVMLCLEFWYLMVLVVITGRLNNPLIPVDAISICMNINGWDAMIAIGFNAAIS  314



>ref|XP_009764056.1| PREDICTED: protein TRANSPARENT TESTA 12 [Nicotiana sylvestris]
 ref|XP_009764057.1| PREDICTED: protein TRANSPARENT TESTA 12 [Nicotiana sylvestris]
Length=490

 Score =   363 bits (932),  Expect = 9e-119, Method: Compositional matrix adjust.
 Identities = 178/313 (57%), Positives = 221/313 (71%), Gaps = 3/313 (1%)
 Frame = -1

Query  951  YSFDADAGDIRQIKKVKE---FIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGH  781
            +  D +   +   +   +   F++EF  ESK+LW LA PAIFT   QYS+GA+TQ FAG 
Sbjct  12   HQLDGEEKQVVSRRGTNDDVGFVKEFGWESKRLWELAGPAIFTTVCQYSLGALTQTFAGQ  71

Query  780  VGNIQLAAVAVENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNA  601
            +G ++LAAV++EN++IAG AFG+M GMGSALETLCGQAFGA +L MLG+Y+QRSW+IL  
Sbjct  72   IGELELAAVSIENSVIAGLAFGVMLGMGSALETLCGQAFGAGQLRMLGIYMQRSWVILLT  131

Query  600  TAIPLTTLYIFSTPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIY  421
            TA  L  +Y+FS PIL L  Q   IS A G FA+WMIPQLFAY   FPIQ+FLQ+Q K+ 
Sbjct  132  TACILVPVYVFSPPILLLAGQTTRISNAAGKFALWMIPQLFAYAMNFPIQKFLQAQRKVL  191

Query  420  VMASVSDVALVGHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWK  241
            VMA +S   LV HV FSWLF+LKL+WGL G AV LN +WW + + Q VY+       AW 
Sbjct  192  VMAWISGGVLVLHVFFSWLFILKLKWGLVGAAVTLNISWWLIVILQLVYIFVTKSDGAWT  251

Query  240  GFSQRAFQNLTGFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGW  61
            GFS  AFQ+L GFV+LSLAS VM CLE WY + LI+I G   N  V VD  SICMNI+GW
Sbjct  252  GFSSLAFQDLFGFVKLSLASAVMLCLEFWYLMILIIITGLLPNPLVPVDAMSICMNINGW  311

Query  60   TLMVGVGFSAAIS  22
              M+ +GF+AAIS
Sbjct  312  QAMISLGFNAAIS  324



>ref|XP_006306460.1| hypothetical protein CARUB_v10012410mg, partial [Capsella rubella]
 gb|EOA39358.1| hypothetical protein CARUB_v10012410mg, partial [Capsella rubella]
Length=505

 Score =   363 bits (933),  Expect = 9e-119, Method: Compositional matrix adjust.
 Identities = 180/302 (60%), Positives = 230/302 (76%), Gaps = 0/302 (0%)
 Frame = -1

Query  927  DIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHVGNIQLAAVAV  748
            D+  I   ++F+R+F +ESKKLW+LA PAIFT   QYS+GA+TQ+ AGHV  + LAAV++
Sbjct  32   DMPPISDGRDFLRQFAAESKKLWWLAGPAIFTSFCQYSLGAVTQILAGHVNTLALAAVSI  91

Query  747  ENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNATAIPLTTLYIF  568
            +N++I+GF+ G+M GMGSAL TLCGQA+GA +LEM+G+YLQRSWIILN+ A+ L+  Y+F
Sbjct  92   QNSVISGFSVGVMLGMGSALATLCGQAYGAGQLEMMGIYLQRSWIILNSCALLLSLFYVF  151

Query  567  STPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYVMASVSDVALV  388
            +TP+L LL Q+P ISKA G F++WMIPQLFAY   F   +FLQ+QSK+  MA ++   L 
Sbjct  152  ATPLLSLLGQSPEISKAAGKFSLWMIPQLFAYAVNFATAKFLQAQSKVNAMAIIAATVLF  211

Query  387  GHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKGFSQRAFQNLT  208
             H L SWL MLKL WG+ GGA VLN +WW +  AQ VY+  G+CG AW G S +AF+NL 
Sbjct  212  QHALLSWLLMLKLGWGMAGGAAVLNVSWWLIDGAQIVYICGGSCGRAWSGLSWKAFKNLR  271

Query  207  GFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGWTLMVGVGFSAA  28
            GF RLSLAS VM CLE+WYF+ALIL AGY KN +VSV   SICMNI GW +MV  GF+AA
Sbjct  272  GFARLSLASAVMVCLEVWYFMALILFAGYLKNPQVSVAALSICMNILGWPIMVAFGFNAA  331

Query  27   IS  22
            +S
Sbjct  332  VS  333



>gb|KDP38452.1| hypothetical protein JCGZ_04377 [Jatropha curcas]
Length=489

 Score =   362 bits (929),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 181/325 (56%), Positives = 228/325 (70%), Gaps = 13/325 (4%)
 Frame = -1

Query  963  MSSVYSFDADA-----------GDIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQY  817
            MS++YS +A A           GD  Q  K    I+EF  ESK+LW LA PAIFT   QY
Sbjct  1    MSNIYSTEAVAMETPLLDNHNNGD--QEHKPVSTIKEFGEESKRLWKLAGPAIFTAICQY  58

Query  816  SIGAITQVFAGHVGNIQLAAVAVENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLG  637
            S+GA+TQ FAG VG ++LAAV+VEN++IAG AFG+M GMGSALETLCGQA+GA KL MLG
Sbjct  59   SLGALTQTFAGLVGEVELAAVSVENSVIAGLAFGVMLGMGSALETLCGQAYGAGKLRMLG  118

Query  636  VYLQRSWIILNATAIPLTTLYIFSTPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFP  457
            +Y+QRSW+IL  TA  L  +Y++S PIL+L+ +   IS A G FA+WM+PQLFAY   FP
Sbjct  119  IYMQRSWVILLTTACLLVPVYVWSPPILELIGETTEISNAAGKFALWMLPQLFAYAMNFP  178

Query  456  IQRFLQSQSKIYVMASVSDVALVGHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFV  277
            IQ+FLQSQ K++VMA VS V LV H +FSWL +LKL WGL G A+ LNT+WW + + Q +
Sbjct  179  IQKFLQSQRKVFVMAWVSAVVLVLHAIFSWLLILKLGWGLTGAAITLNTSWWLIVIGQLL  238

Query  276  YVVSGACGDAWKGFSQRAFQNLTGFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSV  97
            Y+       AW GFS  AF +L GFV+LSLAS +M CLE WY + L+++ G   N  + V
Sbjct  239  YIFITKSDGAWSGFSWLAFSDLWGFVKLSLASAIMLCLEFWYLMILVVVTGRLPNPLIPV  298

Query  96   DGTSICMNISGWTLMVGVGFSAAIS  22
            D  SICMNI GW  M+ +GF+AAIS
Sbjct  299  DAISICMNIQGWDAMIALGFNAAIS  323



>ref|XP_011087098.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Sesamum indicum]
Length=498

 Score =   362 bits (930),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 176/274 (64%), Positives = 215/274 (78%), Gaps = 0/274 (0%)
 Frame = -1

Query  843  AIFTIASQYSIGAITQVFAGHVGNIQLAAVAVENNLIAGFAFGIMYGMGSALETLCGQAF  664
            AI T   QYS+GAITQ FAGHVG + LAA +VEN++I+G  FG+M GMGSALETLCGQA+
Sbjct  54   AILTSIFQYSLGAITQTFAGHVGTLDLAAFSVENSVISGLCFGVMMGMGSALETLCGQAY  113

Query  663  GAKKLEMLGVYLQRSWIILNATAIPLTTLYIFSTPILKLLHQNPHISKAVGTFAVWMIPQ  484
            GA +++MLGVY+QRSW+IL  T+  LT +YIF+ PIL LL Q   IS+  G FA+WM+PQ
Sbjct  114  GAGQIDMLGVYMQRSWVILLVTSFLLTFMYIFAEPILLLLGQTEAISQTAGKFALWMVPQ  173

Query  483  LFAYVFTFPIQRFLQSQSKIYVMASVSDVALVGHVLFSWLFMLKLRWGLPGGAVVLNTTW  304
            L+AY   FPI +FLQ+QS I  MA +S  AL  HVLFSWL MLKL WG+ GGAVVLN +W
Sbjct  174  LYAYALNFPIAKFLQAQSDIMAMAWISAAALGLHVLFSWLLMLKLGWGMAGGAVVLNISW  233

Query  303  WFMAVAQFVYVVSGACGDAWKGFSQRAFQNLTGFVRLSLASGVMFCLELWYFVALILIAG  124
            WF+ VAQ +Y+ SGAC ++W GFS +AFQNL GFVRLS+AS VM CLE+WYF ALIL AG
Sbjct  234  WFLVVAQLIYIFSGACAESWTGFSWKAFQNLWGFVRLSVASAVMLCLEIWYFTALILFAG  293

Query  123  YTKNAEVSVDGTSICMNISGWTLMVGVGFSAAIS  22
            Y KNAE++VD  SIC+NISGW  M+ +GF+AAIS
Sbjct  294  YLKNAEIAVDALSICVNISGWISMIALGFNAAIS  327



>ref|XP_009590886.1| PREDICTED: protein TRANSPARENT TESTA 12 [Nicotiana tomentosiformis]
Length=490

 Score =   362 bits (929),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 180/316 (57%), Positives = 220/316 (70%), Gaps = 8/316 (3%)
 Frame = -1

Query  945  FDADAGDIRQIKKVKE--------FIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVF  790
             D D  D  + + V          F++EF  ESK+LW LA PAIFT   QYS+GA+TQ F
Sbjct  9    LDNDQLDGEEKQAVSRRGNNDDVGFVKEFGWESKRLWELAGPAIFTTVCQYSLGALTQTF  68

Query  789  AGHVGNIQLAAVAVENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWII  610
            AG +G ++LAAV++EN++I G AFG+M GMGSALETLCGQAFGA  L MLG+Y+QRSW+I
Sbjct  69   AGQIGELELAAVSIENSVITGLAFGVMLGMGSALETLCGQAFGAGHLRMLGIYMQRSWVI  128

Query  609  LNATAIPLTTLYIFSTPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQS  430
            L  TA  L  +Y+FS PIL L  Q   IS A G FA+WMIPQLFAY   FPIQ+FLQ+Q 
Sbjct  129  LLTTACILVPVYVFSPPILLLAGQTTRISNAAGKFALWMIPQLFAYAMNFPIQKFLQAQR  188

Query  429  KIYVMASVSDVALVGHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGD  250
            K+ VMA +S   LV HVLFSWLF+LKL+WGL G AV LN +WW + + Q +Y+       
Sbjct  189  KVLVMAWISAGVLVLHVLFSWLFILKLKWGLIGAAVTLNISWWLIVILQLLYIFVTKSDG  248

Query  249  AWKGFSQRAFQNLTGFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNI  70
            AW GFS  AFQ+L GFV+LSLAS VM CLE WY + LI+I G   N  V VD  SICMNI
Sbjct  249  AWTGFSSLAFQDLFGFVKLSLASAVMLCLEFWYLMILIIITGLLPNPLVPVDAMSICMNI  308

Query  69   SGWTLMVGVGFSAAIS  22
            +GW  M+ +GF+AAIS
Sbjct  309  NGWQAMISLGFNAAIS  324



>ref|XP_010254988.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Nelumbo nucifera]
Length=480

 Score =   361 bits (927),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 174/307 (57%), Positives = 220/307 (72%), Gaps = 1/307 (0%)
 Frame = -1

Query  942  DADAGDIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHVGNIQL  763
            D +   + +  K    +++   ESKKLW +A PAIFT   QYS+GAITQVF GHVG ++L
Sbjct  9    DQEQNQVTR-NKSSVLLKQVGEESKKLWNIAGPAIFTAICQYSLGAITQVFVGHVGTLEL  67

Query  762  AAVAVENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNATAIPLT  583
            AAV+VEN+++AG AFG+M GMGSALETLCGQAFGA  L MLG+Y+QRSW+IL  TA+ L 
Sbjct  68   AAVSVENSVVAGLAFGVMLGMGSALETLCGQAFGAGNLRMLGIYMQRSWVILLCTALVLV  127

Query  582  TLYIFSTPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYVMASVS  403
             +Y+FS P+L+LL Q   IS A G FA+WMIPQLFAY   FPIQ+FLQ+Q K+ VMA VS
Sbjct  128  PVYVFSPPLLRLLGQTAQISDAAGVFALWMIPQLFAYALNFPIQKFLQAQRKVMVMAYVS  187

Query  402  DVALVGHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKGFSQRA  223
             + LV HV+ SWL  LKL WGL G A  LN +WW + + Q +Y+       AW GFS  A
Sbjct  188  AIVLVIHVVLSWLVTLKLGWGLVGAAFTLNLSWWLVVLGQLLYIFIWKSDGAWTGFSLLA  247

Query  222  FQNLTGFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGWTLMVGV  43
            F +L GFV+LSLAS +M CLE WY + +I+I G+ KN  + VD  SICMNI+GW LM+ +
Sbjct  248  FADLYGFVKLSLASAIMLCLEFWYLMLIIVITGHLKNPLIPVDAISICMNINGWDLMIAI  307

Query  42   GFSAAIS  22
            GF+AAIS
Sbjct  308  GFNAAIS  314



>gb|KHG14298.1| Protein TRANSPARENT TESTA 12 -like protein [Gossypium arboreum]
Length=484

 Score =   361 bits (927),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 173/307 (56%), Positives = 223/307 (73%), Gaps = 0/307 (0%)
 Frame = -1

Query  942  DADAGDIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHVGNIQL  763
            D D  DI + +K+  +++EF SESK+LW++A PAIFT   QYS+GA T  FAG +  + L
Sbjct  11   DRDGNDINKGEKLVSWVKEFGSESKRLWHIAGPAIFTALCQYSLGAFTLTFAGRLSELDL  70

Query  762  AAVAVENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNATAIPLT  583
            AAV+VEN++IAG +FG+M GMGSALETLCGQA+GA +L MLGVY+QRSW+IL  TA  L 
Sbjct  71   AAVSVENSVIAGLSFGVMLGMGSALETLCGQAYGAGRLRMLGVYMQRSWVILLVTACLLV  130

Query  582  TLYIFSTPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYVMASVS  403
             +YI+S PIL L  +   IS A G FA+WM+PQLFAY   FP+Q+FLQ+Q K+ VMA +S
Sbjct  131  PIYIWSPPILVLFGETTEISTAAGKFALWMLPQLFAYALNFPLQKFLQAQRKVMVMAWIS  190

Query  402  DVALVGHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKGFSQRA  223
             + LV HV FSWL +LKL WGL G A+ LNT+WW + + QF+Y++      AW GFS  A
Sbjct  191  AMVLVLHVFFSWLLILKLGWGLIGAAITLNTSWWLIVIGQFLYILITKSDGAWSGFSWLA  250

Query  222  FQNLTGFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGWTLMVGV  43
            F +L GFV+LSLAS +M CLE WY + LI+I G+  N  V VD  SICMNI+GW  M+ +
Sbjct  251  FVDLFGFVKLSLASAIMLCLEFWYLMMLIVITGHLSNPLVPVDAISICMNINGWDAMIAI  310

Query  42   GFSAAIS  22
            GF+AAIS
Sbjct  311  GFNAAIS  317



>ref|XP_009118930.1| PREDICTED: protein TRANSPARENT TESTA 12 [Brassica rapa]
 emb|CDY06731.1| BnaA10g05100D [Brassica napus]
Length=484

 Score =   360 bits (925),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 171/309 (55%), Positives = 225/309 (73%), Gaps = 7/309 (2%)
 Frame = -1

Query  927  DIRQIKKVKE-------FIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHVGNI  769
            D R+  ++ E       + +EF  ESK+LW LA PAIFT  SQYS+GA+TQ F+G +G +
Sbjct  11   DPREPPELTETKPASKVWAKEFRQESKRLWELAGPAIFTAISQYSLGALTQTFSGRIGEL  70

Query  768  QLAAVAVENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNATAIP  589
            +LAAV+VEN++I+G AFG+M GMGSALETLCGQA+GA +L MLG+Y+QRSW+IL  TA+ 
Sbjct  71   ELAAVSVENSVISGLAFGVMLGMGSALETLCGQAYGAGQLRMLGIYMQRSWVILFTTALC  130

Query  588  LTTLYIFSTPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYVMAS  409
            L  +YI++ PIL    + PHISKA G FA+WMIPQLFAY   FPIQ+FLQSQ K+ VMA 
Sbjct  131  LLPVYIWAPPILSFFGEAPHISKAAGKFALWMIPQLFAYSANFPIQKFLQSQGKVLVMAW  190

Query  408  VSDVALVGHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKGFSQ  229
            +S V L+ H +FSWLF++  +WGL G A+ LNT+WW + + Q +Y++      AW GFS 
Sbjct  191  ISGVVLIIHAVFSWLFIIHFKWGLVGAAITLNTSWWLVVIGQLLYILITKSDGAWSGFSW  250

Query  228  RAFQNLTGFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGWTLMV  49
             AF++L GFV+LSLAS VM CLE WY + L+++ G   N  + VD  SICMNI GWT M+
Sbjct  251  LAFRDLYGFVKLSLASAVMLCLEFWYLMVLVVVTGLLPNPLIPVDAISICMNIEGWTAMI  310

Query  48   GVGFSAAIS  22
             +GF+AAIS
Sbjct  311  SIGFNAAIS  319



>emb|CDY17070.1| BnaC06g00030D [Brassica napus]
Length=484

 Score =   360 bits (925),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 171/309 (55%), Positives = 225/309 (73%), Gaps = 7/309 (2%)
 Frame = -1

Query  927  DIRQIKKVKE-------FIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHVGNI  769
            D R+  ++ E       + +EF  ESK+LW LA PAIFT  SQYS+GA+TQ F+G +G +
Sbjct  11   DPREPPELTETKPASKVWAKEFRQESKRLWELAGPAIFTAISQYSLGALTQTFSGRIGEL  70

Query  768  QLAAVAVENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNATAIP  589
            +LAAV+VEN++I+G AFG+M GMGSALETLCGQA+GA +L MLG+Y+QRSW+IL  TA+ 
Sbjct  71   ELAAVSVENSVISGLAFGVMLGMGSALETLCGQAYGAGQLRMLGIYMQRSWVILFTTALC  130

Query  588  LTTLYIFSTPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYVMAS  409
            L  +YI++ PIL    + PHISKA G FA+WMIPQLFAY   FPIQ+FLQSQ K+ VMA 
Sbjct  131  LLPVYIWAPPILSFFGEAPHISKAAGKFALWMIPQLFAYSANFPIQKFLQSQGKVLVMAW  190

Query  408  VSDVALVGHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKGFSQ  229
            +S V L+ H +FSWLF++  +WGL G A+ LNT+WW + + Q +Y++      AW GFS 
Sbjct  191  ISGVVLIIHAVFSWLFIIHFKWGLVGAAITLNTSWWLVVIGQLLYILITKSDGAWSGFSW  250

Query  228  RAFQNLTGFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGWTLMV  49
             AF++L GFV+LSLAS VM CLE WY + L+++ G   N  + VD  SICMNI GWT M+
Sbjct  251  LAFRDLYGFVKLSLASAVMLCLEFWYLMVLVVVTGLLPNPLIPVDAISICMNIEGWTAMI  310

Query  48   GVGFSAAIS  22
             +GF+AAIS
Sbjct  311  SIGFNAAIS  319



>ref|XP_010266880.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Nelumbo nucifera]
Length=503

 Score =   361 bits (926),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 178/302 (59%), Positives = 229/302 (76%), Gaps = 0/302 (0%)
 Frame = -1

Query  927  DIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHVGNIQLAAVAV  748
            DI +I     F++E  +E+KKLWYLAAPAIFT  +QYS+GAITQVFAGH+  ++L AV+ 
Sbjct  21   DIEEIGSCVHFVKEAINENKKLWYLAAPAIFTSIAQYSLGAITQVFAGHLTTLELDAVST  80

Query  747  ENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNATAIPLTTLYIF  568
            EN +IAG AFGIM GMGSALETLCGQAFGAKKL MLGVY+QRSW+ILN T + L  +YIF
Sbjct  81   ENMVIAGLAFGIMLGMGSALETLCGQAFGAKKLHMLGVYMQRSWVILNVTCVCLLPIYIF  140

Query  567  STPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYVMASVSDVALV  388
            +TPILKL  QN  I++  G F+++MIPQLFAY F FPIQ+FLQ+QSK+  MA VS VAL+
Sbjct  141  ATPILKLFGQNDQIAELAGKFSLYMIPQLFAYGFNFPIQKFLQAQSKVMTMAWVSGVALL  200

Query  387  GHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKGFSQRAFQNLT  208
             H+L SWLF+++ + GL G A  LN +WW + + QF Y+  G C  AW GFS  AF++L 
Sbjct  201  FHILLSWLFIVQFKLGLAGAAAALNISWWVVVLGQFAYIAMGYCPGAWTGFSWSAFRDLG  260

Query  207  GFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGWTLMVGVGFSAA  28
             F RLS+AS +M CLE WY++ LI++AG  +NAE++V   SIC N++GW +M+  GF+AA
Sbjct  261  AFARLSVASAIMMCLEFWYYMVLIVLAGRLQNAEIAVAAISICNNLNGWEIMIFFGFNAA  320

Query  27   IS  22
            IS
Sbjct  321  IS  322



>ref|XP_002891365.1| hypothetical protein ARALYDRAFT_473896 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH67624.1| hypothetical protein ARALYDRAFT_473896 [Arabidopsis lyrata subsp. 
lyrata]
Length=484

 Score =   360 bits (924),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 168/294 (57%), Positives = 220/294 (75%), Gaps = 0/294 (0%)
 Frame = -1

Query  903  KEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHVGNIQLAAVAVENNLIAGF  724
            K + +EF  ESK+LW LA PAIFT  SQYS+GA+TQ F+G +G ++LAAV+VEN++I+G 
Sbjct  26   KVWAKEFGEESKRLWELAGPAIFTAISQYSLGALTQTFSGRIGELELAAVSVENSVISGL  85

Query  723  AFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNATAIPLTTLYIFSTPILKLL  544
            AFG+M GMGSALETLCGQA+GA ++ M+G+Y+QRSW+IL  TA+ L  +YI++ PIL   
Sbjct  86   AFGVMLGMGSALETLCGQAYGAGQIRMMGIYMQRSWVILFTTALCLLPVYIWAPPILSFF  145

Query  543  HQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYVMASVSDVALVGHVLFSWL  364
             + PHISKA G FA+WMIPQLFAY   FPIQ+FLQSQ K+ VMA +S V LV H +FSWL
Sbjct  146  GEAPHISKAAGKFALWMIPQLFAYAANFPIQKFLQSQRKVLVMAWISAVVLVIHAVFSWL  205

Query  363  FMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKGFSQRAFQNLTGFVRLSLA  184
            F+L  +WGL G A+ LNT+WW + + Q +Y++      AW GFS  AF++L GFV+LSLA
Sbjct  206  FILYFKWGLVGAAITLNTSWWLIVIGQLLYILITKSDGAWTGFSMLAFRDLYGFVKLSLA  265

Query  183  SGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGWTLMVGVGFSAAIS  22
            S +M CLE WY + L+++ G   N  + VD  SICMNI GWT M+ +GF+AAIS
Sbjct  266  SALMLCLEFWYLMVLVVVTGLLPNPLIPVDAISICMNIEGWTAMISIGFNAAIS  319



>ref|XP_002510329.1| multidrug resistance pump, putative [Ricinus communis]
 gb|EEF52516.1| multidrug resistance pump, putative [Ricinus communis]
Length=483

 Score =   360 bits (924),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 174/311 (56%), Positives = 224/311 (72%), Gaps = 1/311 (0%)
 Frame = -1

Query  954  VYSFDADAGDIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHVG  775
            ++   +  G + + K V   ++EF  ESK+LW LA PAIFT   QYS+GA+TQ FAG VG
Sbjct  8    LHDHTSGNGHLDEEKPVS-VLKEFSDESKRLWKLAGPAIFTSICQYSLGALTQTFAGLVG  66

Query  774  NIQLAAVAVENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNATA  595
             + LAAV+VEN++IAG AFG+M GMGSALETLCGQA+GA +L MLGVY+QRSW+IL  TA
Sbjct  67   EVDLAAVSVENSVIAGLAFGVMLGMGSALETLCGQAYGAGQLRMLGVYMQRSWVILLTTA  126

Query  594  IPLTTLYIFSTPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYVM  415
              L  +Y++S PIL+L+ +   IS+A G FA+WM+PQLFAY   FPIQ+FLQSQSK+YVM
Sbjct  127  CLLVPIYVWSPPILELIGETTQISEAAGKFAIWMLPQLFAYAVNFPIQKFLQSQSKVYVM  186

Query  414  ASVSDVALVGHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKGF  235
            A +S   LV H +FSWL +LKL WGL G A+ LNT+WW + +AQ +Y+       AW GF
Sbjct  187  AWISAAVLVLHAIFSWLLILKLGWGLTGAAITLNTSWWIIVIAQLLYIFITKSDGAWSGF  246

Query  234  SQRAFQNLTGFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGWTL  55
            +  AF +L GFV+LSLAS VM CLE WY + L++I G   N  + VD  SICMN+ GW  
Sbjct  247  TWLAFADLGGFVKLSLASAVMLCLEFWYLMILVVITGRLPNPLIPVDAISICMNLQGWDA  306

Query  54   MVGVGFSAAIS  22
            M+ +GF+AAIS
Sbjct  307  MIALGFNAAIS  317



>ref|XP_010684414.1| PREDICTED: protein TRANSPARENT TESTA 12 [Beta vulgaris subsp. 
vulgaris]
Length=487

 Score =   360 bits (923),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 176/293 (60%), Positives = 216/293 (74%), Gaps = 0/293 (0%)
 Frame = -1

Query  900  EFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHVGNIQLAAVAVENNLIAGFA  721
              I+ F  ESKKLW +A PAIFT   QYS+GA+TQ FAG VG+++LAAV+VEN++IAG  
Sbjct  29   SLIKVFNHESKKLWSIAGPAIFTAVCQYSMGALTQTFAGQVGDLELAAVSVENSVIAGLG  88

Query  720  FGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNATAIPLTTLYIFSTPILKLLH  541
            FG+M GMGSALETLCGQAFGA K +MLGVY+QRSW+IL ATA  LT LY +S  IL+L  
Sbjct  89   FGVMLGMGSALETLCGQAFGAGKPKMLGVYMQRSWVILFATACLLTPLYTYSPYILQLSG  148

Query  540  QNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYVMASVSDVALVGHVLFSWLF  361
              P IS+A G FA+WMIPQLFAY F FPIQ+FLQ+Q K++VMA VS + LV HV FSWLF
Sbjct  149  NTPEISQAAGKFALWMIPQLFAYAFHFPIQKFLQAQRKVFVMAWVSAIVLVIHVFFSWLF  208

Query  360  MLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKGFSQRAFQNLTGFVRLSLAS  181
            MLK  WGL G AVVLN +WW + + Q +Y+ +     AW GFS  AF +L GFV+LSLAS
Sbjct  209  MLKYGWGLAGAAVVLNGSWWLIVILQLIYIFATKSDGAWSGFSWLAFADLWGFVKLSLAS  268

Query  180  GVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGWTLMVGVGFSAAIS  22
             VM CLE WY + L++I G   +  + VD  SICMN+ GW  M+ +GF+AAIS
Sbjct  269  AVMLCLEFWYLMVLVVIVGSLPDPLIPVDAISICMNLQGWDAMIAIGFNAAIS  321



>ref|XP_007222800.1| hypothetical protein PRUPE_ppa005018mg [Prunus persica]
 gb|EMJ23999.1| hypothetical protein PRUPE_ppa005018mg [Prunus persica]
Length=481

 Score =   359 bits (921),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 174/300 (58%), Positives = 224/300 (75%), Gaps = 1/300 (0%)
 Frame = -1

Query  921  RQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHVGNIQLAAVAVEN  742
             Q +KV   ++EF  ESKKLW +A PAIFT   QYS+GA+TQVF+G VG+++LAAV+VEN
Sbjct  16   EQEEKVG-IVKEFGIESKKLWKIAGPAIFTAICQYSLGALTQVFSGFVGDVELAAVSVEN  74

Query  741  NLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNATAIPLTTLYIFST  562
            ++IAG AFG+M GMGSALETLCGQA+GA ++ MLG+Y+QRSWIIL  TA  L  +Y++S 
Sbjct  75   SVIAGLAFGVMLGMGSALETLCGQAYGAGQIRMLGIYMQRSWIILLVTACVLVPVYVWSP  134

Query  561  PILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYVMASVSDVALVGH  382
            PIL+L+ +   IS+A G FA+WM+PQLFAY   FPIQ+FLQ+Q K++VMA +S V LV H
Sbjct  135  PILELVGETDQISEAAGKFALWMLPQLFAYALNFPIQKFLQAQRKVFVMAWISAVVLVLH  194

Query  381  VLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKGFSQRAFQNLTGF  202
             +FSWL +LKL WGL G AV LN +WW + +AQ +Y+       AW GFS  AF +L GF
Sbjct  195  AVFSWLLILKLGWGLTGAAVTLNISWWLIVIAQLLYIFITKSDGAWSGFSWLAFADLFGF  254

Query  201  VRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGWTLMVGVGFSAAIS  22
            V+LSLAS VM CLE WY + L++I G  KN  + VD  SICMNI+GW  M+ +GF+AAIS
Sbjct  255  VKLSLASAVMLCLEFWYLMVLVVITGRLKNPLIPVDAISICMNINGWDAMIAIGFNAAIS  314



>ref|XP_007017441.1| MATE efflux family protein [Theobroma cacao]
 gb|EOY14666.1| MATE efflux family protein [Theobroma cacao]
Length=482

 Score =   358 bits (920),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 172/308 (56%), Positives = 220/308 (71%), Gaps = 0/308 (0%)
 Frame = -1

Query  945  FDADAGDIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHVGNIQ  766
             +    D  QI+K   +++EF  ESK+LW++A PAI T   QYS+GA+TQ FAGHV  + 
Sbjct  9    LNTHGADSNQIEKPVRWVKEFGYESKRLWHIAGPAILTAICQYSLGALTQTFAGHVSELD  68

Query  765  LAAVAVENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNATAIPL  586
            LAAV+VEN+++AG AFG+M GMGSALETLCGQA+GA ++ MLGVY+QRSW+IL  TA  L
Sbjct  69   LAAVSVENSVVAGLAFGVMLGMGSALETLCGQAYGAGRIRMLGVYMQRSWVILFTTACLL  128

Query  585  TTLYIFSTPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYVMASV  406
              +YI+S PIL+L  +   IS A G FAVWM+PQLFAY   FPIQ+FLQ+Q K+ VMA V
Sbjct  129  VPVYIWSPPILELFGETTEISNAAGKFAVWMLPQLFAYAINFPIQKFLQAQRKVMVMAWV  188

Query  405  SDVALVGHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKGFSQR  226
            S + LV H LFSWL +LKL WGL G A+ LNT+WW + + Q +Y+       AW GFS  
Sbjct  189  SAIVLVLHALFSWLLILKLGWGLIGAAITLNTSWWLIVIGQLLYIFITKSDGAWCGFSWL  248

Query  225  AFQNLTGFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGWTLMVG  46
            AF +L GFV+LSLAS VM CLE WY + L++I G   N  + VD  SIC+NI+GW  M+ 
Sbjct  249  AFADLFGFVKLSLASAVMLCLEFWYLMVLVVITGRLPNPLIPVDAISICLNINGWDAMIA  308

Query  45   VGFSAAIS  22
            +GF+AAIS
Sbjct  309  IGFNAAIS  316



>emb|CAN62306.1| hypothetical protein VITISV_023691 [Vitis vinifera]
Length=503

 Score =   359 bits (922),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 189/302 (63%), Positives = 231/302 (76%), Gaps = 2/302 (1%)
 Frame = -1

Query  966  NMSSVYSFDADAG-DIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVF  790
            N S   S +A+ G DI  I  V +F REF+ ESKKLW LA PAIF+   +YS+GA+TQVF
Sbjct  28   NTSLFSSHNANYGNDIDPINGVGDFFREFFVESKKLWRLAGPAIFSSLCRYSLGAVTQVF  87

Query  789  AGHVGNIQLAAVAVENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWII  610
            AGH+  + LAA A+EN++I GF+ GI++GMGSALETLCGQAFGA++ +MLG+YLQRSW+I
Sbjct  88   AGHLSALDLAAFAIENSVIGGFSSGILFGMGSALETLCGQAFGARRPDMLGIYLQRSWVI  147

Query  609  LNATAIPLTTL-YIFSTPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQ  433
            L  T++ L +  YIF+  ILKL+ Q   ISKA G FA WMIPQLFAY   FPI +FLQSQ
Sbjct  148  LITTSLLLLSFLYIFAGQILKLIGQTEAISKAAGIFARWMIPQLFAYATYFPIIKFLQSQ  207

Query  432  SKIYVMASVSDVALVGHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACG  253
             KI +MA +S VAL+ H +FSWL MLKL WGL G AVVLN +WWF+ VA  +YV+SG+CG
Sbjct  208  RKIMMMAWISFVALILHTVFSWLLMLKLGWGLVGAAVVLNASWWFIVVALLLYVLSGSCG  267

Query  252  DAWKGFSQRAFQNLTGFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMN  73
             AW GFS +AFQNL  FVRLSLASGVM CLE+WYF+AL L AGY K+AEVSVD  SIC+ 
Sbjct  268  HAWSGFSWKAFQNLWAFVRLSLASGVMLCLEVWYFMALTLFAGYLKDAEVSVDALSICVR  327

Query  72   IS  67
            +S
Sbjct  328  VS  329



>ref|NP_175184.1| MATE efflux family protein [Arabidopsis thaliana]
 gb|AAD46034.1|AC007519_19 F16N3.20 [Arabidopsis thaliana]
 gb|AEE32181.1| MATE efflux family protein [Arabidopsis thaliana]
Length=484

 Score =   358 bits (920),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 168/294 (57%), Positives = 220/294 (75%), Gaps = 0/294 (0%)
 Frame = -1

Query  903  KEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHVGNIQLAAVAVENNLIAGF  724
            K + +EF  ESK+LW LA PAIFT  SQYS+GA+TQ F+G +G ++LAAV+VEN++I+G 
Sbjct  26   KVWAKEFGEESKRLWELAGPAIFTAISQYSLGALTQTFSGRLGELELAAVSVENSVISGL  85

Query  723  AFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNATAIPLTTLYIFSTPILKLL  544
            AFG+M GMGSALETLCGQA+GA ++ M+G+Y+QRSW+IL  TA+ L  +YI++ PIL   
Sbjct  86   AFGVMLGMGSALETLCGQAYGAGQIRMMGIYMQRSWVILFTTALFLLPVYIWAPPILSFF  145

Query  543  HQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYVMASVSDVALVGHVLFSWL  364
             + PHISKA G FA+WMIPQLFAY   FPIQ+FLQSQ K+ VMA +S V LV H +FSWL
Sbjct  146  GEAPHISKAAGKFALWMIPQLFAYAANFPIQKFLQSQRKVLVMAWISGVVLVIHAVFSWL  205

Query  363  FMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKGFSQRAFQNLTGFVRLSLA  184
            F+L  +WGL G A+ LNT+WW + + Q +Y++      AW GFS  AF++L GFV+LSLA
Sbjct  206  FILYFKWGLVGAAITLNTSWWLIVIGQLLYILITKSDGAWTGFSMLAFRDLYGFVKLSLA  265

Query  183  SGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGWTLMVGVGFSAAIS  22
            S +M CLE WY + L+++ G   N  + VD  SICMNI GWT M+ +GF+AAIS
Sbjct  266  SALMLCLEFWYLMVLVVVTGLLPNPLIPVDAISICMNIEGWTAMISIGFNAAIS  319



>ref|XP_002281913.1| PREDICTED: protein TRANSPARENT TESTA 12 [Vitis vinifera]
 emb|CBI19626.3| unnamed protein product [Vitis vinifera]
Length=479

 Score =   358 bits (919),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 172/300 (57%), Positives = 220/300 (73%), Gaps = 0/300 (0%)
 Frame = -1

Query  921  RQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHVGNIQLAAVAVEN  742
              ++K   F R+F +ESKKLW LA PAIFT   QYS+GA+TQ FAG VG  +LAAV+VEN
Sbjct  14   EDVEKPVSFPRKFCAESKKLWKLAGPAIFTAICQYSLGALTQTFAGLVGETELAAVSVEN  73

Query  741  NLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNATAIPLTTLYIFST  562
            ++IAG AFG+M GMGSALETLCGQA+GA K+ MLG+Y+QRSW+IL  TA  L  +Y+F+ 
Sbjct  74   SVIAGLAFGVMLGMGSALETLCGQAYGAGKIRMLGIYMQRSWVILLTTACCLVPIYVFAP  133

Query  561  PILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYVMASVSDVALVGH  382
            PIL+L+ +   IS+A G FA+WMIPQLFAY   FPIQ+FLQ+Q K++VMA +S V LV H
Sbjct  134  PILELIGETTQISEAAGQFALWMIPQLFAYALNFPIQKFLQAQRKVFVMAWISVVVLVIH  193

Query  381  VLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKGFSQRAFQNLTGF  202
             + SWL +LKL +GL G AV+LN +WW + ++Q +Y+       AW GFS  AF +L GF
Sbjct  194  AVLSWLLILKLGYGLVGAAVMLNLSWWLIVISQLLYIFITTSDGAWSGFSMLAFADLYGF  253

Query  201  VRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGWTLMVGVGFSAAIS  22
            V+LSLAS VM CLE WY + L++I G  KN  + VD  SICMNI GW  M+ +GF+AAIS
Sbjct  254  VKLSLASAVMLCLEFWYLMILVVITGRLKNPLIPVDAISICMNIQGWDAMIALGFNAAIS  313



>ref|XP_010479157.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Camelina sativa]
Length=485

 Score =   358 bits (918),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 170/306 (56%), Positives = 224/306 (73%), Gaps = 1/306 (0%)
 Frame = -1

Query  936  DAGDIRQIKKV-KEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHVGNIQLA  760
            D  ++   K   K + +EF  ESK+LW LA PAIFT  SQYS+GA+TQ F+G +G ++LA
Sbjct  15   DPPELNGTKPASKVWAKEFGEESKRLWELAGPAIFTAISQYSLGALTQTFSGRLGELELA  74

Query  759  AVAVENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNATAIPLTT  580
            AV+VEN++I+G AFG+M GMGSALETLCGQA+GA ++ M+G+Y+QRSW+IL  TA+ L  
Sbjct  75   AVSVENSVISGLAFGVMLGMGSALETLCGQAYGAGQIRMMGIYMQRSWVILFTTALFLLP  134

Query  579  LYIFSTPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYVMASVSD  400
            +YI++ PIL    + P ISKA G FA+WMIPQLFAY   FPIQ+FLQSQ K+ VMA +S 
Sbjct  135  VYIWAPPILSFFGEAPKISKAAGKFALWMIPQLFAYAANFPIQKFLQSQRKVLVMAWISG  194

Query  399  VALVGHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKGFSQRAF  220
            V LV H +FSWLF+L  +WGL G A+ LNT+WW + + Q +Y++      AW GFS+ AF
Sbjct  195  VVLVIHAVFSWLFILYFKWGLVGAAITLNTSWWLIVIGQLLYILITKSDGAWTGFSRLAF  254

Query  219  QNLTGFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGWTLMVGVG  40
            Q+L GFV+LSLAS +M CLE WY + L+++ G   N  + VD  SICMNI GWT M+ +G
Sbjct  255  QDLYGFVKLSLASALMLCLEFWYLMVLVVVTGLLPNPLIPVDAISICMNIEGWTAMISIG  314

Query  39   FSAAIS  22
            F+AAIS
Sbjct  315  FNAAIS  320



>ref|XP_010100395.1| Protein TRANSPARENT TESTA 12 [Morus notabilis]
 gb|EXB82529.1| Protein TRANSPARENT TESTA 12 [Morus notabilis]
Length=485

 Score =   358 bits (918),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 179/300 (60%), Positives = 223/300 (74%), Gaps = 0/300 (0%)
 Frame = -1

Query  966  NMSSVYSFDADAGDIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFA  787
            N S   SF  D  D   I  V++F REF  E KKL YLA PAIFT   QYS+ A++QVFA
Sbjct  18   NHSVSSSFTTDTDDTPPIDGVRDFCREFSKEFKKLGYLAGPAIFTYVFQYSLCAVSQVFA  77

Query  786  GHVGNIQLAAVAVENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIIL  607
            G+V  + LAA +VEN++IAGF++GIM GMGSAL+TLCGQAFGA ++ MLG+Y+QRSW+IL
Sbjct  78   GNVSTLALAAFSVENSVIAGFSYGIMLGMGSALDTLCGQAFGAGQVNMLGIYMQRSWVIL  137

Query  606  NATAIPLTTLYIFSTPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSK  427
            N T + L+ LYIF+ P+LKL+ Q P ISK  G  ++WMIPQL AY    PI +FLQ+QSK
Sbjct  138  NTTGLLLSFLYIFAEPLLKLIGQTPEISKTAGMLSIWMIPQLLAYAMNIPITKFLQAQSK  197

Query  426  IYVMASVSDVALVGHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDA  247
            I VMA+ + +ALV H  FSWL +LKL WGL G AVVLN++WWF+ VAQ VY+ SG CG A
Sbjct  198  IMVMAAAAAMALVLHTFFSWLLILKLGWGLAGAAVVLNSSWWFIVVAQLVYIFSGNCGRA  257

Query  246  WKGFSQRAFQNLTGFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNIS  67
            W GFS +AFQNL GFV+LS+AS VM CL+ WYF+A IL   Y KNA+VS+D  SIC+ +S
Sbjct  258  WSGFSWKAFQNLWGFVKLSVASAVMLCLQTWYFMATILFTSYLKNAQVSLDALSICVRVS  317



>ref|XP_006393573.1| hypothetical protein EUTSA_v10011437mg [Eutrema salsugineum]
 gb|ESQ30859.1| hypothetical protein EUTSA_v10011437mg [Eutrema salsugineum]
Length=484

 Score =   358 bits (918),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 169/309 (55%), Positives = 225/309 (73%), Gaps = 7/309 (2%)
 Frame = -1

Query  927  DIRQIKKVKE-------FIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHVGNI  769
            D R+  ++ E       + +EF  ES++LW LA PAIFT  SQYS+GA+TQ F+G +G +
Sbjct  11   DPREPPELSETKPASKVWAKEFGEESRRLWELAGPAIFTAISQYSLGALTQTFSGRLGEL  70

Query  768  QLAAVAVENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNATAIP  589
            +LAAV+VEN++I+G AFG+M GMGSALETLCGQA+GA +L MLG+Y+QRSW+IL  TA+ 
Sbjct  71   ELAAVSVENSVISGLAFGVMLGMGSALETLCGQAYGAGQLRMLGIYMQRSWVILFTTALC  130

Query  588  LTTLYIFSTPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYVMAS  409
            +  +YI++ PIL    + PHISKA G FA+WMIPQLFAY   FPIQ+FLQSQ K+ VMA 
Sbjct  131  MLPIYIWAPPILSFFGEAPHISKAAGKFALWMIPQLFAYSANFPIQKFLQSQGKVLVMAW  190

Query  408  VSDVALVGHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKGFSQ  229
            +S + L+ H +FSWLF+L  +WGL G A+ LNT+WW + + Q +Y++      AW GFS 
Sbjct  191  ISGLVLIIHAVFSWLFILYFKWGLVGAAITLNTSWWLIVIGQLLYILITKSDGAWSGFSW  250

Query  228  RAFQNLTGFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGWTLMV  49
             AF++L GFV+LSLAS VM CLE WY + L+++ G   N  + VD  SICMNI GWT M+
Sbjct  251  LAFRDLYGFVKLSLASAVMLCLEFWYLMVLVVVTGLLPNPLIPVDAISICMNIEGWTAMI  310

Query  48   GVGFSAAIS  22
             +GF+AAIS
Sbjct  311  SIGFNAAIS  319



>ref|XP_010530370.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Tarenaya hassleriana]
Length=479

 Score =   357 bits (917),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 170/290 (59%), Positives = 212/290 (73%), Gaps = 0/290 (0%)
 Frame = -1

Query  891  REFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHVGNIQLAAVAVENNLIAGFAFGI  712
            REF  ES++LW LA PAIFT   QYS+GA+TQ FAGH+G ++LAAV+VEN+++AG AFG+
Sbjct  25   REFGEESRRLWKLAGPAIFTAICQYSLGALTQTFAGHIGELELAAVSVENSVVAGLAFGV  84

Query  711  MYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNATAIPLTTLYIFSTPILKLLHQNP  532
            M GMGSALETLCGQAFGA +L MLGVY+QRSW+IL  TA  L  +Y++S PIL    + P
Sbjct  85   MLGMGSALETLCGQAFGAGQLRMLGVYMQRSWVILFVTACCLLPVYVWSPPILSFFGEAP  144

Query  531  HISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYVMASVSDVALVGHVLFSWLFMLK  352
             IS+A G FA+WMIPQLFAY   FPIQ+FLQSQ K+ VMA +S   LV H + SWL +LK
Sbjct  145  PISRAAGKFALWMIPQLFAYAMNFPIQKFLQSQGKVLVMAWISAAVLVIHAIVSWLLILK  204

Query  351  LRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKGFSQRAFQNLTGFVRLSLASGVM  172
            L WGL G A+ LNT+WW + + Q +Y+       AW GFS  AF++L  FV+LSLAS VM
Sbjct  205  LNWGLVGAAITLNTSWWLIVIGQLLYIFITTSDGAWNGFSWLAFRDLYAFVKLSLASAVM  264

Query  171  FCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGWTLMVGVGFSAAIS  22
             CLE WY + L+++ G   N  V VD  SICMNI GWT M+ +GF+AAIS
Sbjct  265  LCLEFWYLMVLVVVTGLLPNPLVPVDAISICMNIEGWTAMISIGFNAAIS  314



>ref|XP_008377358.1| PREDICTED: protein TRANSPARENT TESTA 12 [Malus domestica]
Length=487

 Score =   357 bits (917),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 170/291 (58%), Positives = 219/291 (75%), Gaps = 0/291 (0%)
 Frame = -1

Query  894  IREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHVGNIQLAAVAVENNLIAGFAFG  715
            +++F  ESKKLW +A PAIFT   QYS+GA+TQVFAG VG+++LAAV++EN++IAG AFG
Sbjct  29   VKQFGIESKKLWKIAGPAIFTALCQYSLGALTQVFAGFVGDLELAAVSIENSVIAGLAFG  88

Query  714  IMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNATAIPLTTLYIFSTPILKLLHQN  535
            +M+GMGSALETLCGQA+GA ++ MLGVY+QRSWIIL  TA  L  +Y++S PIL+L+ + 
Sbjct  89   VMWGMGSALETLCGQAYGAGQIRMLGVYMQRSWIILLVTACVLVPIYVWSPPILELIGET  148

Query  534  PHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYVMASVSDVALVGHVLFSWLFML  355
              IS+A G FAVWM+PQLFAY   FPIQ+FLQ+QSK+ VMA +S   LV H  FSWL +L
Sbjct  149  TEISEAAGKFAVWMLPQLFAYALNFPIQKFLQAQSKVSVMAWISVAVLVEHAFFSWLLIL  208

Query  354  KLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKGFSQRAFQNLTGFVRLSLASGV  175
            KL WGL G A+ LN +WWF+ + Q +Y+       AW GFS  AF +L GFVRLSL+S V
Sbjct  209  KLEWGLTGAAITLNVSWWFIIIGQLLYIFITKSDGAWGGFSWLAFADLWGFVRLSLSSAV  268

Query  174  MFCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGWTLMVGVGFSAAIS  22
            M CLE WY + L++I G  KN  + +D  SICMNI+GW  M+ +GF+AAIS
Sbjct  269  MLCLEFWYLMVLVVITGRLKNPLIPIDAISICMNINGWDAMIALGFNAAIS  319



>ref|XP_010461550.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Camelina 
sativa]
Length=485

 Score =   357 bits (915),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 170/306 (56%), Positives = 222/306 (73%), Gaps = 1/306 (0%)
 Frame = -1

Query  936  DAGDIRQIKKV-KEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHVGNIQLA  760
            D  +I   K   K + +EF  ESK+LW LA PAIFT  SQYS+GA+TQ F+G +G ++LA
Sbjct  15   DPPEINGTKPASKVWAKEFGEESKRLWELAGPAIFTAISQYSLGALTQTFSGRLGELELA  74

Query  759  AVAVENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNATAIPLTT  580
            AV+VEN++I+G AFG+M GMGSALETLCGQA+GA ++ M+G+Y+QRSW+IL  TA+ L  
Sbjct  75   AVSVENSVISGLAFGVMLGMGSALETLCGQAYGAGQIRMMGIYMQRSWVILFTTALCLLP  134

Query  579  LYIFSTPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYVMASVSD  400
            +YI++ PIL    + P IS A G FA+WMIPQLFAY   FPIQ+FLQSQ K+ VMA +S 
Sbjct  135  VYIWAPPILSFFGEAPKISNAAGKFALWMIPQLFAYAANFPIQKFLQSQRKVLVMAWISG  194

Query  399  VALVGHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKGFSQRAF  220
            V LV H +FSWL +L  +WGL G A+ LNT+WW + + Q +Y++      AW GFS+ AF
Sbjct  195  VVLVIHAVFSWLLILYFKWGLVGAAITLNTSWWLIVIGQLLYILITKSDGAWTGFSRLAF  254

Query  219  QNLTGFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGWTLMVGVG  40
            Q+L GFV+LSLAS VM CLE WY + L+++ G   N  + VD  SICMNI GWT M+ +G
Sbjct  255  QDLYGFVKLSLASAVMLCLEFWYLMVLVVVTGLLPNPLIPVDAISICMNIEGWTAMISIG  314

Query  39   FSAAIS  22
            F+AAIS
Sbjct  315  FNAAIS  320



>ref|XP_007160797.1| hypothetical protein PHAVU_001G017400g [Phaseolus vulgaris]
 gb|ESW32791.1| hypothetical protein PHAVU_001G017400g [Phaseolus vulgaris]
Length=481

 Score =   356 bits (914),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 175/305 (57%), Positives = 218/305 (71%), Gaps = 0/305 (0%)
 Frame = -1

Query  936  DAGDIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHVGNIQLAA  757
            +  DI + K VK  ++ F  ESKKLW LA PAI T   QYS+GA+TQ FAG VG++ LAA
Sbjct  10   ENSDIGEEKTVKSAVKNFGFESKKLWRLAGPAILTSVFQYSLGALTQTFAGQVGDLDLAA  69

Query  756  VAVENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNATAIPLTTL  577
            V+VEN+++AG AFG+M GMGSALETLCGQAFGA ++ MLGVY+QRSW+IL  TA+ +  +
Sbjct  70   VSVENSVVAGLAFGVMLGMGSALETLCGQAFGAGQIRMLGVYMQRSWVILFITALLMLPI  129

Query  576  YIFSTPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYVMASVSDV  397
            Y+ S PIL LL Q   IS A G FAVWMIPQLFAY   FPIQ+FLQ+Q K+ VM  VS  
Sbjct  130  YVCSPPILVLLGQTSQISTAAGKFAVWMIPQLFAYALNFPIQKFLQAQGKVLVMLWVSGG  189

Query  396  ALVGHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKGFSQRAFQ  217
             LV H  FSWL +LKL WGL G A+ LNT+WW + +AQ +Y+       AW GF+  AF 
Sbjct  190  VLVLHTFFSWLLILKLEWGLIGAAITLNTSWWLIVIAQLLYIFITKSDGAWSGFTWLAFV  249

Query  216  NLTGFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGWTLMVGVGF  37
            +L GFV+LSLAS VM CLE WY + L++I G  +N  + VD  SICMNI+GW  M+ +GF
Sbjct  250  DLFGFVKLSLASAVMLCLEFWYLMILVVITGRLENPLIPVDAISICMNINGWDAMIAIGF  309

Query  36   SAAIS  22
            +AAIS
Sbjct  310  NAAIS  314



>gb|AAL24258.1| At1g47530/F16N3_20 [Arabidopsis thaliana]
 gb|AAO23589.1| At1g47530/F16N3_20 [Arabidopsis thaliana]
Length=484

 Score =   356 bits (914),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 167/294 (57%), Positives = 219/294 (74%), Gaps = 0/294 (0%)
 Frame = -1

Query  903  KEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHVGNIQLAAVAVENNLIAGF  724
            K + +EF  ESK+LW LA PAIFT   QYS+GA+TQ F+G +G ++LAAV+VEN++I+G 
Sbjct  26   KVWAKEFGEESKRLWELAGPAIFTAIGQYSLGALTQTFSGRLGELELAAVSVENSVISGL  85

Query  723  AFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNATAIPLTTLYIFSTPILKLL  544
            AFG+M GMGSALETLCGQA+GA ++ M+G+Y+QRSW+IL  TA+ L  +YI++ PIL   
Sbjct  86   AFGVMLGMGSALETLCGQAYGAGQIRMMGIYMQRSWVILFTTALFLLPVYIWAPPILSFF  145

Query  543  HQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYVMASVSDVALVGHVLFSWL  364
             + PHISKA G FA+WMIPQLFAY   FPIQ+FLQSQ K+ VMA +S V LV H +FSWL
Sbjct  146  GEAPHISKAAGKFALWMIPQLFAYAANFPIQKFLQSQRKVLVMAWISGVVLVIHAVFSWL  205

Query  363  FMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKGFSQRAFQNLTGFVRLSLA  184
            F+L  +WGL G A+ LNT+WW + + Q +Y++      AW GFS  AF++L GFV+LSLA
Sbjct  206  FILYFKWGLVGAAITLNTSWWLIVIGQLLYILITKSDGAWTGFSMLAFRDLYGFVKLSLA  265

Query  183  SGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGWTLMVGVGFSAAIS  22
            S +M CLE WY + L+++ G   N  + VD  SICMNI GWT M+ +GF+AAIS
Sbjct  266  SALMLCLEFWYLMVLVVVTGLLPNPLIPVDAISICMNIEGWTAMISIGFNAAIS  319



>ref|XP_010500276.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Camelina sativa]
Length=485

 Score =   356 bits (914),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 170/306 (56%), Positives = 222/306 (73%), Gaps = 1/306 (0%)
 Frame = -1

Query  936  DAGDIRQIKKV-KEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHVGNIQLA  760
            D  +I   K   K + +EF  ESK+LW LA PAIFT  SQYS+GA+TQ F+G +G ++LA
Sbjct  15   DPPEINGTKPASKVWAKEFGEESKRLWELAGPAIFTAISQYSLGALTQTFSGRLGELELA  74

Query  759  AVAVENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNATAIPLTT  580
            AV+VEN++I+G AFG+M GMGSALETLCGQA+GA ++ M+G+Y+QRSW+IL  TA+ L  
Sbjct  75   AVSVENSVISGLAFGVMLGMGSALETLCGQAYGAGQIRMMGIYMQRSWVILFTTALCLLP  134

Query  579  LYIFSTPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYVMASVSD  400
            +YI++ PIL    + P IS A G FA+WMIPQLFAY   FPIQ+FLQSQ K+ VMA +S 
Sbjct  135  VYIWAPPILSFFGEAPKISNAAGKFALWMIPQLFAYAANFPIQKFLQSQRKVLVMAWISG  194

Query  399  VALVGHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKGFSQRAF  220
            V LV H +FSWL +L  +WGL G A+ LNT+WW + + Q +Y++      AW GFS+ AF
Sbjct  195  VVLVIHAVFSWLLILYFKWGLVGAAITLNTSWWMIVIGQLLYILITKSDGAWTGFSRLAF  254

Query  219  QNLTGFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGWTLMVGVG  40
            Q+L GFV+LSLAS VM CLE WY + L+++ G   N  + VD  SICMNI GWT M+ +G
Sbjct  255  QDLYGFVKLSLASAVMLCLEFWYLMVLVVVTGLLPNPLIPVDAISICMNIEGWTAMISIG  314

Query  39   FSAAIS  22
            F+AAIS
Sbjct  315  FNAAIS  320



>ref|XP_011083755.1| PREDICTED: protein TRANSPARENT TESTA 12 [Sesamum indicum]
Length=480

 Score =   356 bits (913),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 177/300 (59%), Positives = 217/300 (72%), Gaps = 0/300 (0%)
 Frame = -1

Query  921  RQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHVGNIQLAAVAVEN  742
             Q K  + FI+EF +ESK LW L+ PAIFT   QYS+GA+TQ FAG VG I+LAAV+VEN
Sbjct  15   HQEKGGEGFIKEFGAESKTLWKLSGPAIFTSICQYSLGALTQTFAGQVGEIELAAVSVEN  74

Query  741  NLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNATAIPLTTLYIFST  562
            ++IAG AFG M GMGSALETLCGQA+GA ++ MLGVY+QRSW+IL  TA  L  LYIF+ 
Sbjct  75   SVIAGLAFGAMLGMGSALETLCGQAYGAGQVRMLGVYMQRSWVILLTTACVLLPLYIFAP  134

Query  561  PILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYVMASVSDVALVGH  382
            PIL    ++  IS+A G FA+WMIPQLFAY   FPIQ+FLQSQ K+ VMA +S + LV H
Sbjct  135  PILLFFGESAEISRAAGQFALWMIPQLFAYALNFPIQKFLQSQRKMMVMAWISGIILVLH  194

Query  381  VLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKGFSQRAFQNLTGF  202
             +FSWL +LKL WGL G AV LN +WW + V Q +Y+       AW GFS  AFQ+L GF
Sbjct  195  TVFSWLLILKLGWGLVGAAVTLNLSWWLIIVLQLIYIFYTKSDGAWGGFSWLAFQDLYGF  254

Query  201  VRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGWTLMVGVGFSAAIS  22
             +LSLAS +M CLE WY + +I+IAG+ +N  V VD  SICMNI GW  M+  GF+AAIS
Sbjct  255  AKLSLASSIMLCLEFWYLMVIIVIAGHLENPVVPVDAISICMNIQGWDAMISFGFNAAIS  314



>ref|XP_010461551.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Camelina 
sativa]
Length=485

 Score =   356 bits (913),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 169/306 (55%), Positives = 222/306 (73%), Gaps = 1/306 (0%)
 Frame = -1

Query  936  DAGDIRQIKKV-KEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHVGNIQLA  760
            D  ++   K   K + +EF  ESK+LW LA PAIFT  SQYS+GA+TQ F+G +G ++LA
Sbjct  15   DPPELNGTKPASKVWAKEFGEESKRLWELAGPAIFTAISQYSLGALTQTFSGRLGELELA  74

Query  759  AVAVENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNATAIPLTT  580
            AV+VEN++I+G AFG+M GMGSALETLCGQA+GA ++ M+G+Y+QRSW+IL  TA+ L  
Sbjct  75   AVSVENSVISGLAFGVMLGMGSALETLCGQAYGAGQIRMMGIYMQRSWVILFTTALCLLP  134

Query  579  LYIFSTPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYVMASVSD  400
            +YI++ PIL    + P IS A G FA+WMIPQLFAY   FPIQ+FLQSQ K+ VMA +S 
Sbjct  135  VYIWAPPILSFFGEAPKISNAAGKFALWMIPQLFAYAANFPIQKFLQSQRKVLVMAWISG  194

Query  399  VALVGHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKGFSQRAF  220
            V LV H +FSWL +L  +WGL G A+ LNT+WW + + Q +Y++      AW GFS+ AF
Sbjct  195  VVLVIHAVFSWLLILYFKWGLVGAAITLNTSWWLIVIGQLLYILITKSDGAWTGFSRLAF  254

Query  219  QNLTGFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGWTLMVGVG  40
            Q+L GFV+LSLAS VM CLE WY + L+++ G   N  + VD  SICMNI GWT M+ +G
Sbjct  255  QDLYGFVKLSLASAVMLCLEFWYLMVLVVVTGLLPNPLIPVDAISICMNIEGWTAMISIG  314

Query  39   FSAAIS  22
            F+AAIS
Sbjct  315  FNAAIS  320



>gb|KFK36142.1| hypothetical protein AALP_AA4G082800 [Arabis alpina]
Length=484

 Score =   355 bits (911),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 167/294 (57%), Positives = 218/294 (74%), Gaps = 0/294 (0%)
 Frame = -1

Query  903  KEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHVGNIQLAAVAVENNLIAGF  724
            K + +EF  ES++LW LA PAIFT  SQYS+GA+TQ F+G +G ++LAAV+VEN++I+G 
Sbjct  26   KVWAKEFGEESRRLWQLAGPAIFTAISQYSLGALTQTFSGRLGELELAAVSVENSVISGL  85

Query  723  AFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNATAIPLTTLYIFSTPILKLL  544
            AFG+M GMGSALETLCGQA+GA +L MLG+Y+QRSW+IL  TA+ +  +YI++ PIL   
Sbjct  86   AFGVMLGMGSALETLCGQAYGAGQLRMLGIYMQRSWVILFTTALFILPIYIWAPPILSFF  145

Query  543  HQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYVMASVSDVALVGHVLFSWL  364
             + PHISKA G FA+WMIPQLFAY   FPIQ+FLQSQ K+ VMA +S V LV H  FSWL
Sbjct  146  GEAPHISKAAGKFALWMIPQLFAYAANFPIQKFLQSQRKVLVMAWISGVVLVIHTFFSWL  205

Query  363  FMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKGFSQRAFQNLTGFVRLSLA  184
             ++  +WGL G A+ LNT+WW + + Q +Y++      AW GFS  AF++L GFV+LSLA
Sbjct  206  LIIHFKWGLVGAAITLNTSWWLIVIGQLLYILITKSDGAWSGFSWLAFKDLFGFVKLSLA  265

Query  183  SGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGWTLMVGVGFSAAIS  22
            S VM CLE WY + L+++ G   N  + VD  SICMNI GWT M+ +GF+AAIS
Sbjct  266  SAVMLCLEFWYLMVLVVVTGLLPNPLIPVDAISICMNIEGWTAMISLGFNAAIS  319



>ref|XP_010525623.1| PREDICTED: protein TRANSPARENT TESTA 12 [Tarenaya hassleriana]
Length=481

 Score =   355 bits (910),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 170/290 (59%), Positives = 212/290 (73%), Gaps = 0/290 (0%)
 Frame = -1

Query  891  REFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHVGNIQLAAVAVENNLIAGFAFGI  712
            REF  ES++LW LA PAIFT   QYS+GA+TQ FAGHVG ++LAAV+VEN++IAG AFG+
Sbjct  27   REFGEESRRLWKLAGPAIFTAICQYSLGALTQTFAGHVGELELAAVSVENSVIAGLAFGV  86

Query  711  MYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNATAIPLTTLYIFSTPILKLLHQNP  532
            M GMGSALETLCGQAFGA +L MLGVY+QRSW+IL  TA  L  +YI++ PIL    +  
Sbjct  87   MLGMGSALETLCGQAFGAGQLRMLGVYMQRSWVILFVTACCLLPIYIWAPPILSFFGEAH  146

Query  531  HISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYVMASVSDVALVGHVLFSWLFMLK  352
            HIS+A G FA+WMIPQLFAY   FPIQ+FLQ+Q K+ VM  +S   LV H + SWL +LK
Sbjct  147  HISRAAGKFALWMIPQLFAYAMNFPIQKFLQAQRKVLVMTWISTGVLVIHAVASWLLILK  206

Query  351  LRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKGFSQRAFQNLTGFVRLSLASGVM  172
             +WGL G A+ LNT+WW + + Q +Y+       AW GFS  AF++L GFV+LSLAS +M
Sbjct  207  FKWGLVGAAITLNTSWWLIVIGQLLYIFITTSDGAWSGFSWLAFRDLYGFVKLSLASAIM  266

Query  171  FCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGWTLMVGVGFSAAIS  22
             CLE WY + L++I G   N  V VD  SICMNI GWT M+ +GF+AAIS
Sbjct  267  LCLEFWYLMVLVVITGLLPNPLVPVDAISICMNIQGWTTMISIGFNAAIS  316



>ref|XP_009365621.1| PREDICTED: protein TRANSPARENT TESTA 12 isoform X2 [Pyrus x bretschneideri]
Length=489

 Score =   354 bits (908),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 173/312 (55%), Positives = 227/312 (73%), Gaps = 5/312 (2%)
 Frame = -1

Query  957  SVYSFDADAGDIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHV  778
            S +S   D G+    +K+ EF+++F  ESK+LW +A PAIFT   QYS+GA+TQ FAG V
Sbjct  15   SNHSGHEDGGE----EKI-EFVKQFGIESKRLWKIAGPAIFTALCQYSLGALTQTFAGFV  69

Query  777  GNIQLAAVAVENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNAT  598
            G+++LAAV++EN++IAG AFG+M GMGSALETLCGQA+GA ++ MLGVY+QRSWIIL  T
Sbjct  70   GDLELAAVSIENSVIAGLAFGVMLGMGSALETLCGQAYGAGQIRMLGVYMQRSWIILLVT  129

Query  597  AIPLTTLYIFSTPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYV  418
            A  L  +Y++S PIL+L+ +   IS+A G FAVWM+PQLFAY   FPIQ+FLQ+Q K+ V
Sbjct  130  ACVLVPVYVWSPPILELVGETTEISEAAGKFAVWMLPQLFAYALNFPIQKFLQAQRKVSV  189

Query  417  MASVSDVALVGHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKG  238
            +A +S   LV H +FSWL M+KL WGL G A+ LN +WW + +AQ +Y+       AW G
Sbjct  190  IAWISAAVLVEHAVFSWLLMIKLGWGLTGAAITLNASWWLIIIAQLLYIFITKSDGAWSG  249

Query  237  FSQRAFQNLTGFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGWT  58
            FS  AF +L GFV+LSLAS VM CLE WY + L++I G   N  + VD  SICMNI+GW 
Sbjct  250  FSWLAFSDLWGFVKLSLASAVMLCLEFWYLMVLVVITGRLTNPLIPVDAISICMNINGWD  309

Query  57   LMVGVGFSAAIS  22
             M+ +GF+AAIS
Sbjct  310  AMIAIGFNAAIS  321



>ref|XP_009365620.1| PREDICTED: protein TRANSPARENT TESTA 12 isoform X1 [Pyrus x bretschneideri]
Length=504

 Score =   354 bits (909),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 173/312 (55%), Positives = 227/312 (73%), Gaps = 5/312 (2%)
 Frame = -1

Query  957  SVYSFDADAGDIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHV  778
            S +S   D G+    +K+ EF+++F  ESK+LW +A PAIFT   QYS+GA+TQ FAG V
Sbjct  30   SNHSGHEDGGE----EKI-EFVKQFGIESKRLWKIAGPAIFTALCQYSLGALTQTFAGFV  84

Query  777  GNIQLAAVAVENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNAT  598
            G+++LAAV++EN++IAG AFG+M GMGSALETLCGQA+GA ++ MLGVY+QRSWIIL  T
Sbjct  85   GDLELAAVSIENSVIAGLAFGVMLGMGSALETLCGQAYGAGQIRMLGVYMQRSWIILLVT  144

Query  597  AIPLTTLYIFSTPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYV  418
            A  L  +Y++S PIL+L+ +   IS+A G FAVWM+PQLFAY   FPIQ+FLQ+Q K+ V
Sbjct  145  ACVLVPVYVWSPPILELVGETTEISEAAGKFAVWMLPQLFAYALNFPIQKFLQAQRKVSV  204

Query  417  MASVSDVALVGHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKG  238
            +A +S   LV H +FSWL M+KL WGL G A+ LN +WW + +AQ +Y+       AW G
Sbjct  205  IAWISAAVLVEHAVFSWLLMIKLGWGLTGAAITLNASWWLIIIAQLLYIFITKSDGAWSG  264

Query  237  FSQRAFQNLTGFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGWT  58
            FS  AF +L GFV+LSLAS VM CLE WY + L++I G   N  + VD  SICMNI+GW 
Sbjct  265  FSWLAFSDLWGFVKLSLASAVMLCLEFWYLMVLVVITGRLTNPLIPVDAISICMNINGWD  324

Query  57   LMVGVGFSAAIS  22
             M+ +GF+AAIS
Sbjct  325  AMIAIGFNAAIS  336



>ref|XP_009395378.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Musa acuminata 
subsp. malaccensis]
Length=489

 Score =   354 bits (908),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 169/302 (56%), Positives = 223/302 (74%), Gaps = 0/302 (0%)
 Frame = -1

Query  927  DIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHVGNIQLAAVAV  748
            D+ +IK V++F+   + E KKLWYLA PAIFT  +QYS+GA+TQ+FAGH+  ++L AV+ 
Sbjct  18   DLEEIKSVRQFMEHVWEEKKKLWYLAGPAIFTSLAQYSLGAVTQIFAGHLTTLELDAVST  77

Query  747  ENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNATAIPLTTLYIF  568
            EN +IAG AFGIM GMGSALETLCGQAFGAK+L MLG+Y+QRSW+IL A  I L  +Y+F
Sbjct  78   ENMVIAGLAFGIMLGMGSALETLCGQAFGAKQLHMLGIYMQRSWVILTAMCICLLPIYLF  137

Query  567  STPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYVMASVSDVALV  388
            +T IL L HQ+  I+   G F+++MIPQLFAY   FPIQ+FLQ+QSK+  MA VS VAL+
Sbjct  138  ATHILLLFHQDAEIAVLAGRFSLYMIPQLFAYGLNFPIQKFLQAQSKVMTMAVVSAVALL  197

Query  387  GHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKGFSQRAFQNLT  208
             H+  SWL +++ + GL G A  LN  WW + V QF+YV  G C  AW GFS  AF++L 
Sbjct  198  FHLFLSWLLIVQFKLGLVGAATSLNAAWWVVVVGQFIYVAWGYCPGAWNGFSWGAFRDLG  257

Query  207  GFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGWTLMVGVGFSAA  28
             F RLS+AS +M CLE W+++ LI++AG  +NA+V+V   SIC+N+ GW +MV  GF+AA
Sbjct  258  AFARLSIASAIMMCLEFWFYMFLIVLAGNLRNAQVAVAAISICINLYGWEMMVFFGFNAA  317

Query  27   IS  22
            IS
Sbjct  318  IS  319



>ref|XP_006307362.1| hypothetical protein CARUB_v10008985mg [Capsella rubella]
 gb|EOA40260.1| hypothetical protein CARUB_v10008985mg [Capsella rubella]
Length=485

 Score =   353 bits (905),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 166/294 (56%), Positives = 218/294 (74%), Gaps = 0/294 (0%)
 Frame = -1

Query  903  KEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHVGNIQLAAVAVENNLIAGF  724
            K + +EF  ESK+LW LA PAIFT  SQYS+GA+TQ F+G +G ++LAAV+VEN++I+G 
Sbjct  27   KVWAKEFGEESKRLWELAGPAIFTAISQYSLGALTQTFSGRLGELELAAVSVENSVISGL  86

Query  723  AFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNATAIPLTTLYIFSTPILKLL  544
            AFG+M GMGSALETLCGQA+GA ++ M+G+Y+QRSW+IL  TA+ L  +YI++ PIL   
Sbjct  87   AFGVMLGMGSALETLCGQAYGAGQIRMMGIYMQRSWVILFTTALFLLPVYIWAPPILSFF  146

Query  543  HQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYVMASVSDVALVGHVLFSWL  364
             + P ISKA G FA+WMIPQLFAY   FPIQ+FLQSQ K+ VMA +S   LV H +FSWL
Sbjct  147  GEAPQISKAAGKFALWMIPQLFAYAANFPIQKFLQSQRKVLVMAWISGAVLVIHAVFSWL  206

Query  363  FMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKGFSQRAFQNLTGFVRLSLA  184
            F+L  +WGL G A+ LNT+WW + + Q +Y++      AW GFS  AF++L GFV+LSLA
Sbjct  207  FILYFKWGLVGAAITLNTSWWLIVIGQLLYILITKSDGAWTGFSLLAFRDLYGFVKLSLA  266

Query  183  SGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGWTLMVGVGFSAAIS  22
            S +M CLE WY + L+++ G   N  + VD  SICMNI GWT M+ +GF+AAIS
Sbjct  267  SALMLCLEFWYLMVLVVVTGLLPNPLIPVDAISICMNIEGWTAMISIGFNAAIS  320



>ref|XP_006434915.1| hypothetical protein CICLE_v10000947mg [Citrus clementina]
 gb|ESR48155.1| hypothetical protein CICLE_v10000947mg [Citrus clementina]
Length=477

 Score =   352 bits (904),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 176/323 (54%), Positives = 226/323 (70%), Gaps = 3/323 (1%)
 Frame = -1

Query  987  KNTQIS*NMSSVYSFDA-DAGDIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSI  811
            +NT    +  +  S+D    GD +Q  K   F++EF  ESK+LW LA PAIFT  SQYS+
Sbjct  4    ENTSPLLSNKATESYDIYSDGDDQQ--KQLGFVKEFGYESKRLWKLAGPAIFTSISQYSL  61

Query  810  GAITQVFAGHVGNIQLAAVAVENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVY  631
            GA+TQ FAG VG ++LAA +VEN++IAG AFG+M GMGSALETLCGQAFGA  + MLGVY
Sbjct  62   GALTQTFAGRVGELELAAFSVENSVIAGLAFGVMLGMGSALETLCGQAFGAGSIRMLGVY  121

Query  630  LQRSWIILNATAIPLTTLYIFSTPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQ  451
            +QRSW+IL  T+  L+ LY++S P+L L  +   IS A G FA+WM+PQLFAY   FPIQ
Sbjct  122  MQRSWVILLITSCVLSPLYVWSPPVLMLFGETAEISNAAGKFALWMLPQLFAYALNFPIQ  181

Query  450  RFLQSQSKIYVMASVSDVALVGHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYV  271
            +FLQ+Q K+ VMA +S + LV H LFSWL +LKL WGL G A+ LN +WW + + Q +Y+
Sbjct  182  KFLQAQRKVLVMAWISAIVLVLHALFSWLLILKLGWGLIGAAITLNLSWWLIVILQLLYI  241

Query  270  VSGACGDAWKGFSQRAFQNLTGFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDG  91
                   AW GFS  AF +L  FV+LSLAS VM CLE WY + L++I G   NA ++VD 
Sbjct  242  FITKSDGAWSGFSWLAFADLWAFVKLSLASAVMLCLEFWYLMLLVVITGRLPNALIAVDA  301

Query  90   TSICMNISGWTLMVGVGFSAAIS  22
             S+CMNI GW  M+ +GF+AAIS
Sbjct  302  ISVCMNIQGWDAMIAIGFNAAIS  324



>ref|XP_006393574.1| hypothetical protein EUTSA_v10011435mg [Eutrema salsugineum]
 gb|ESQ30860.1| hypothetical protein EUTSA_v10011435mg [Eutrema salsugineum]
Length=485

 Score =   352 bits (903),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 167/309 (54%), Positives = 225/309 (73%), Gaps = 7/309 (2%)
 Frame = -1

Query  927  DIRQIKKVKE-------FIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHVGNI  769
            D R+  ++ E       + +EF  ES++LW LA PAIFT  SQYS+GA+TQ F+G +G +
Sbjct  11   DPREPPELSETKPASKVWAKEFGEESRRLWELAGPAIFTAISQYSLGALTQTFSGRLGEL  70

Query  768  QLAAVAVENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNATAIP  589
            +LAA++VEN++I+G AFG+M GMGSALETLCGQA+GA ++ MLG+Y+QRSW+IL  TA+ 
Sbjct  71   ELAAISVENSVISGLAFGVMLGMGSALETLCGQAYGAGQIRMLGIYMQRSWVILFTTALC  130

Query  588  LTTLYIFSTPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYVMAS  409
            L  +YI++ PIL    + PHISKA G FA+WMIPQ+FAY   FPIQ+FLQSQ K+ V+A 
Sbjct  131  LLPVYIWAHPILSFFGEAPHISKAAGKFALWMIPQVFAYSANFPIQKFLQSQGKVLVIAW  190

Query  408  VSDVALVGHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKGFSQ  229
            +S V L+ H +FSWL +L  +WGL G A+ LNT+WW + + Q +Y++      AW GFS 
Sbjct  191  ISGVVLIIHTVFSWLLILYFKWGLVGAAITLNTSWWLIIIGQLLYILITKSDGAWSGFSW  250

Query  228  RAFQNLTGFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGWTLMV  49
             AF++L GFV+LSLAS VM CLELWYF+ LI++ G   N  + VD  SICMNI  WT M+
Sbjct  251  LAFRDLYGFVKLSLASAVMLCLELWYFMVLIVVTGLLPNPLIPVDAISICMNIECWTAMI  310

Query  48   GVGFSAAIS  22
             +GF++AIS
Sbjct  311  SIGFNSAIS  319



>ref|XP_006473428.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Citrus sinensis]
Length=493

 Score =   352 bits (904),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 177/324 (55%), Positives = 227/324 (70%), Gaps = 5/324 (2%)
 Frame = -1

Query  987  KNTQ--IS*NMSSVYSFDADAGDIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYS  814
            +NT   +S  ++  Y   +D GD +Q  K   F++EF  ESK+LW LA PAIFT   QYS
Sbjct  4    ENTSPLLSNKVTESYDIYSD-GDDQQ--KQLGFLKEFGYESKRLWKLAGPAIFTCICQYS  60

Query  813  IGAITQVFAGHVGNIQLAAVAVENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGV  634
            +GA+TQ FAG VG ++LAA +VEN++IAG AFG+M GMGSALETLCGQAFGA  + MLGV
Sbjct  61   LGALTQTFAGRVGELELAAFSVENSVIAGLAFGVMLGMGSALETLCGQAFGAGSIRMLGV  120

Query  633  YLQRSWIILNATAIPLTTLYIFSTPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPI  454
            Y+QRSW+IL  T+  L+ LY++S P+L L  +   IS A G FA+WM+PQLFAY   FPI
Sbjct  121  YMQRSWVILLITSCVLSPLYVWSPPVLMLFGETAEISNAAGKFALWMLPQLFAYALNFPI  180

Query  453  QRFLQSQSKIYVMASVSDVALVGHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVY  274
            Q+FLQ+Q K+ VMA +S + LV H LFSWL +LKL WGL G A+ LN +WW + V Q +Y
Sbjct  181  QKFLQAQRKVLVMAWISAIVLVLHALFSWLLILKLGWGLIGAAITLNLSWWLIVVLQLLY  240

Query  273  VVSGACGDAWKGFSQRAFQNLTGFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVD  94
            +       AW GFS  AF +L  FV+LSLAS VM CLE WY + L++I G   NA ++VD
Sbjct  241  IFITKSDGAWSGFSWLAFADLWAFVKLSLASAVMLCLEFWYLMLLVVITGRLPNALIAVD  300

Query  93   GTSICMNISGWTLMVGVGFSAAIS  22
              S+CMNI GW  M+ +GF+AAIS
Sbjct  301  AISVCMNIQGWDAMIAIGFNAAIS  324



>emb|CAN79163.1| hypothetical protein VITISV_019245 [Vitis vinifera]
Length=459

 Score =   351 bits (900),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 169/289 (58%), Positives = 215/289 (74%), Gaps = 0/289 (0%)
 Frame = -1

Query  888  EFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHVGNIQLAAVAVENNLIAGFAFGIM  709
            +F +ESKKLW LA PAIFT   QYS+GA+TQ FAG VG  +LAAV+VEN++IAG AFG+M
Sbjct  5    KFCAESKKLWKLAGPAIFTAICQYSLGALTQTFAGLVGETELAAVSVENSVIAGLAFGVM  64

Query  708  YGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNATAIPLTTLYIFSTPILKLLHQNPH  529
             GMGSALETLCGQA+GA K+ MLG+Y+QRSW+IL  TA  L  +Y+F+ PIL+L+ +   
Sbjct  65   LGMGSALETLCGQAYGAGKIRMLGIYMQRSWVILLTTACCLVPIYVFAPPILELIGETTQ  124

Query  528  ISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYVMASVSDVALVGHVLFSWLFMLKL  349
            IS+A G FA+WMIPQLFAY   FPIQ+FLQ+Q K++VMA +S V LV H + SWL +LKL
Sbjct  125  ISEAAGQFALWMIPQLFAYALNFPIQKFLQAQRKVFVMAWISVVVLVIHAVLSWLLILKL  184

Query  348  RWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKGFSQRAFQNLTGFVRLSLASGVMF  169
             +GL G AV+LN +WW + ++Q +Y+       AW GFS  AF +L GFV+LSLAS VM 
Sbjct  185  GYGLVGAAVMLNLSWWLIVISQLLYIFITTSDGAWSGFSMLAFADLYGFVKLSLASAVML  244

Query  168  CLELWYFVALILIAGYTKNAEVSVDGTSICMNISGWTLMVGVGFSAAIS  22
            CLE WY + L++I G  KN  + VD  SICMNI GW  M+ +GF+AAIS
Sbjct  245  CLEFWYLMILVVITGRLKNPLIPVDAISICMNIQGWDAMIALGFNAAIS  293



>ref|XP_006434916.1| hypothetical protein CICLE_v10000947mg [Citrus clementina]
 gb|ESR48156.1| hypothetical protein CICLE_v10000947mg [Citrus clementina]
Length=493

 Score =   352 bits (902),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 176/323 (54%), Positives = 226/323 (70%), Gaps = 3/323 (1%)
 Frame = -1

Query  987  KNTQIS*NMSSVYSFDA-DAGDIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSI  811
            +NT    +  +  S+D    GD +Q  K   F++EF  ESK+LW LA PAIFT  SQYS+
Sbjct  4    ENTSPLLSNKATESYDIYSDGDDQQ--KQLGFVKEFGYESKRLWKLAGPAIFTSISQYSL  61

Query  810  GAITQVFAGHVGNIQLAAVAVENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVY  631
            GA+TQ FAG VG ++LAA +VEN++IAG AFG+M GMGSALETLCGQAFGA  + MLGVY
Sbjct  62   GALTQTFAGRVGELELAAFSVENSVIAGLAFGVMLGMGSALETLCGQAFGAGSIRMLGVY  121

Query  630  LQRSWIILNATAIPLTTLYIFSTPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQ  451
            +QRSW+IL  T+  L+ LY++S P+L L  +   IS A G FA+WM+PQLFAY   FPIQ
Sbjct  122  MQRSWVILLITSCVLSPLYVWSPPVLMLFGETAEISNAAGKFALWMLPQLFAYALNFPIQ  181

Query  450  RFLQSQSKIYVMASVSDVALVGHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYV  271
            +FLQ+Q K+ VMA +S + LV H LFSWL +LKL WGL G A+ LN +WW + + Q +Y+
Sbjct  182  KFLQAQRKVLVMAWISAIVLVLHALFSWLLILKLGWGLIGAAITLNLSWWLIVILQLLYI  241

Query  270  VSGACGDAWKGFSQRAFQNLTGFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDG  91
                   AW GFS  AF +L  FV+LSLAS VM CLE WY + L++I G   NA ++VD 
Sbjct  242  FITKSDGAWSGFSWLAFADLWAFVKLSLASAVMLCLEFWYLMLLVVITGRLPNALIAVDA  301

Query  90   TSICMNISGWTLMVGVGFSAAIS  22
             S+CMNI GW  M+ +GF+AAIS
Sbjct  302  ISVCMNIQGWDAMIAIGFNAAIS  324



>gb|AHI48500.1| multidrug and toxic extrusion transporter [Vaccinium corymbosum]
Length=489

 Score =   351 bits (901),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 170/307 (55%), Positives = 220/307 (72%), Gaps = 2/307 (1%)
 Frame = -1

Query  942  DADAGDIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHVGNIQL  763
            +   GD++   K     R F +ESK+LW +A PAI T   QYS+GA+TQ FAG VG+++L
Sbjct  18   EGGGGDLQ--GKAVAVARAFGTESKRLWKIAGPAILTAICQYSLGALTQTFAGFVGDLEL  75

Query  762  AAVAVENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNATAIPLT  583
            AAV+VEN+++AG AFG+M GMGSALETLCGQA+GA ++ MLGVY+QRSW+IL  TA  L 
Sbjct  76   AAVSVENSVVAGLAFGVMLGMGSALETLCGQAYGAGQVRMLGVYMQRSWVILLVTACLLV  135

Query  582  TLYIFSTPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYVMASVS  403
             +Y+FS PIL+L  +   IS+A G FA+ M+PQLFAY   FPIQ+FLQ+Q K+ VM  VS
Sbjct  136  PVYVFSPPILELAGETTEISEAAGKFAIKMLPQLFAYALNFPIQKFLQAQRKVLVMTWVS  195

Query  402  DVALVGHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKGFSQRA  223
             + LV HV+FSWL MLKL WGL G A+VLNT+WW + + Q +Y+       AW GFS  A
Sbjct  196  AIVLVIHVVFSWLLMLKLGWGLTGAAIVLNTSWWLIVIGQLLYIFVTTSDGAWSGFSWLA  255

Query  222  FQNLTGFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGWTLMVGV  43
            F +L GFV+LSLAS VM CLE WY + L+++ G   N  + VD  SICMNI+GW  M+ +
Sbjct  256  FADLWGFVKLSLASAVMLCLEFWYLMVLVVVTGRLSNPLIPVDAISICMNITGWDAMIAI  315

Query  42   GFSAAIS  22
            GF+AAIS
Sbjct  316  GFNAAIS  322



>ref|XP_003550359.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform 1 [Glycine 
max]
 gb|KHN12740.1| Protein TRANSPARENT TESTA 12 [Glycine soja]
Length=483

 Score =   350 bits (897),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 172/309 (56%), Positives = 217/309 (70%), Gaps = 0/309 (0%)
 Frame = -1

Query  948  SFDADAGDIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHVGNI  769
            + D    ++ + K     ++ F  ESKKLW +A PAI T   QYS+GA+TQ FAG VG++
Sbjct  8    NIDNSCSNVEEEKTPNTVVKRFGFESKKLWKIAGPAIVTSICQYSLGALTQTFAGLVGDL  67

Query  768  QLAAVAVENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNATAIP  589
             LAAV+VEN++IAG AFG+M GMGSALETLCGQA+GA ++ MLGVY+QRSW+IL  TA+ 
Sbjct  68   DLAAVSVENSVIAGLAFGVMLGMGSALETLCGQAYGAGQIRMLGVYMQRSWVILFITALI  127

Query  588  LTTLYIFSTPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYVMAS  409
            L  LYI+S PIL+L  Q   IS A G FAVWMIPQLFAY   FPI +FLQ+Q K+ VM  
Sbjct  128  LLPLYIWSPPILRLAGQTAEISDAAGKFAVWMIPQLFAYAINFPIVKFLQAQRKVLVMLW  187

Query  408  VSDVALVGHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKGFSQ  229
            +S V LV H  FSWL + KL WGL G AV LNT+WW + +AQ +Y+       AW GF+ 
Sbjct  188  ISVVVLVLHTFFSWLVIFKLGWGLIGAAVTLNTSWWVIVIAQLLYIFITKSDGAWSGFTW  247

Query  228  RAFQNLTGFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGWTLMV  49
             AF +L GFV+LSLAS VM CLE WY + L++I G  +N  + VD  SICMNI+GW  M+
Sbjct  248  LAFSDLFGFVKLSLASAVMLCLEFWYLMILVVITGRLENPLIPVDAISICMNINGWDAMI  307

Query  48   GVGFSAAIS  22
             +GF+AAIS
Sbjct  308  AIGFNAAIS  316



>gb|EYU30643.1| hypothetical protein MIMGU_mgv1a023413mg, partial [Erythranthe 
guttata]
Length=454

 Score =   347 bits (891),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 178/302 (59%), Positives = 223/302 (74%), Gaps = 4/302 (1%)
 Frame = -1

Query  927  DIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHVGNIQLAAVAV  748
            DI  +  V  FIR F  ESKKLW LA PAIFT   QYS+ A+TQ FAGH+G  +LAA +V
Sbjct  11   DIGPVIGVDGFIRAFKLESKKLWSLAGPAIFTSVCQYSLNAVTQTFAGHIGTFELAAFSV  70

Query  747  ENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNATAIPLTTLYIF  568
            EN++I+G  +GIM+GMGSALETLCGQA+GA ++EMLG    RSW++L AT+  LT LY+F
Sbjct  71   ENSVISGLCYGIMWGMGSALETLCGQAYGAGQIEMLG----RSWVVLLATSSLLTLLYVF  126

Query  567  STPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYVMASVSDVALV  388
            + P L LL QN  IS+A   +++WMIPQL+AY   FPI +FLQ+QS++  MA +S  AL 
Sbjct  127  AGPALLLLRQNEDISRAAARYSLWMIPQLYAYALNFPISKFLQAQSRMAAMAWISAAALA  186

Query  387  GHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKGFSQRAFQNLT  208
             HV FSWL M +LRWG+ GGA VLN +WWF+ VAQ VY+ SG CG AW GF   AF+NL 
Sbjct  187  LHVFFSWLLMFRLRWGMAGGAAVLNGSWWFIVVAQLVYIFSGRCGRAWSGFCWGAFENLW  246

Query  207  GFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGWTLMVGVGFSAA  28
            GF RLS+AS VM CLE+WYF ALIL AGY KNAEV+VD  S  +NI+GW +M+ +G +AA
Sbjct  247  GFARLSMASAVMLCLEVWYFTALILFAGYLKNAEVAVDALSTRININGWAVMLALGLNAA  306

Query  27   IS  22
            +S
Sbjct  307  VS  308



>ref|NP_001183424.1| putative MATE efflux family protein [Zea mays]
 gb|ACR36728.1| unknown [Zea mays]
 gb|AFW65686.1| putative MATE efflux family protein [Zea mays]
Length=506

 Score =   349 bits (895),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 170/308 (55%), Positives = 220/308 (71%), Gaps = 1/308 (0%)
 Frame = -1

Query  942  DADA-GDIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHVGNIQ  766
            D D   D+ +I+ V  F+R    E++KLWYLA PAI T  +QYS+G ITQVFAGH+  ++
Sbjct  29   DGDGEKDLEEIRSVGSFLRHAAEENRKLWYLAGPAIITSITQYSLGGITQVFAGHLTTLE  88

Query  765  LAAVAVENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNATAIPL  586
            L A++ ENN+IAG AFGIM GMGSALETLCGQA+GAK+L MLGVY+QRS IILNA A+ +
Sbjct  89   LDAISTENNVIAGLAFGIMLGMGSALETLCGQAYGAKQLHMLGVYMQRSLIILNAMAVLM  148

Query  585  TTLYIFSTPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYVMASV  406
              LY+F+TPIL+  HQ+  I+   G  A++MIPQLFAY F FPIQ+FLQ+QSK+  MA V
Sbjct  149  LPLYLFATPILRFFHQDAEIAALTGRLALYMIPQLFAYAFNFPIQKFLQAQSKVMAMAVV  208

Query  405  SDVALVGHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKGFSQR  226
            S  AL+ HV  SWL +  +  G+ G AV LN +WW + + Q  Y++ G C  AW GF   
Sbjct  209  SVAALLLHVAISWLLVGPMGMGIVGLAVALNASWWLVVLGQLAYILMGYCPGAWNGFDWL  268

Query  225  AFQNLTGFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGWTLMVG  46
            AF +L+GF RLSL S VM CLE W+++ LI+I G  +NA+V+V   SIC N+ GW +MV 
Sbjct  269  AFSDLSGFARLSLGSAVMLCLEFWFYMFLIVIVGNLENAQVAVAAVSICTNLFGWQIMVF  328

Query  45   VGFSAAIS  22
             GF+AAIS
Sbjct  329  FGFNAAIS  336



>ref|XP_010060900.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Eucalyptus 
grandis]
Length=472

 Score =   347 bits (890),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 167/297 (56%), Positives = 217/297 (73%), Gaps = 0/297 (0%)
 Frame = -1

Query  912  KKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHVGNIQLAAVAVENNLI  733
            +K     R F SES KLW +A PAIFT  +QYS+GA+TQ+F G +  I LAAV+V N+++
Sbjct  22   EKRASIFRRFRSESGKLWKIAGPAIFTSITQYSLGALTQIFVGQLSEIDLAAVSVGNSVV  81

Query  732  AGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNATAIPLTTLYIFSTPIL  553
             GFAFG+M GMGSALETLCGQAFGA ++ MLGVY+QRSW+IL  TA  L  +Y+F+ PIL
Sbjct  82   GGFAFGVMLGMGSALETLCGQAFGAGRIRMLGVYMQRSWVILLTTACVLVPVYVFAPPIL  141

Query  552  KLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYVMASVSDVALVGHVLF  373
            +++ +   IS+A G FA+WM+PQLFAY   FPIQ+FLQ+Q K++VMA +S   LV H +F
Sbjct  142  EVIGETAEISEAAGQFALWMLPQLFAYALNFPIQKFLQAQRKVFVMAWISATVLVLHAIF  201

Query  372  SWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKGFSQRAFQNLTGFVRL  193
            SWL +LKL  G+ G A+ L+ +WW + VAQ +Y+       AW GFS  AF +L GFV+L
Sbjct  202  SWLVILKLGGGIVGAAITLDISWWLIIVAQLLYIFITKSDGAWSGFSWLAFADLWGFVKL  261

Query  192  SLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGWTLMVGVGFSAAIS  22
            SLAS VM CLELWYF+ L++IAG   N  + VD  SICMNI+GW +M+ VGF+AAIS
Sbjct  262  SLASAVMLCLELWYFMVLLVIAGRLPNPLIPVDAISICMNINGWDIMIAVGFNAAIS  318



>gb|KCW88053.1| hypothetical protein EUGRSUZ_A00475 [Eucalyptus grandis]
Length=492

 Score =   347 bits (891),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 170/290 (59%), Positives = 213/290 (73%), Gaps = 0/290 (0%)
 Frame = -1

Query  891  REFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHVGNIQLAAVAVENNLIAGFAFGI  712
            +EF  ESK+LW LA PAIFT  SQYS+GA+TQ FAG V  I LAAV+VEN++IAG AFG+
Sbjct  32   KEFGGESKRLWKLAGPAIFTALSQYSLGALTQTFAGQVSEIDLAAVSVENSVIAGLAFGV  91

Query  711  MYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNATAIPLTTLYIFSTPILKLLHQNP  532
            M GMGSALETLCGQA+GA ++ MLGVY+QRSW+IL  TA  L  LY++S PIL+L+ +  
Sbjct  92   MLGMGSALETLCGQAYGAGEIRMLGVYMQRSWVILLTTACILVPLYVWSPPILELIGETT  151

Query  531  HISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYVMASVSDVALVGHVLFSWLFMLK  352
             IS+A G FA+WM+PQLFAY   FPIQ+FLQ+Q K+ VMA +S + LV H + SWLF+LK
Sbjct  152  EISEAAGKFALWMLPQLFAYALNFPIQKFLQAQRKVMVMAWISAIVLVIHAVASWLFILK  211

Query  351  LRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKGFSQRAFQNLTGFVRLSLASGVM  172
            L +GL G A+ LNT+WW + + Q +Y+       AW GFS  AF NL GFV+LSLAS VM
Sbjct  212  LGYGLVGAAITLNTSWWLIIIGQLLYIFITKSDGAWGGFSWLAFSNLWGFVKLSLASAVM  271

Query  171  FCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGWTLMVGVGFSAAIS  22
             CLE WY + L++I G   N  + VD  SICMNI GW  M+ +GF+AAIS
Sbjct  272  LCLEFWYLMILVVITGRLPNPLIPVDAISICMNIQGWDAMIALGFNAAIS  321



>ref|XP_010025046.1| PREDICTED: protein TRANSPARENT TESTA 12 [Eucalyptus grandis]
 gb|KCW88052.1| hypothetical protein EUGRSUZ_A00475 [Eucalyptus grandis]
Length=488

 Score =   347 bits (890),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 170/290 (59%), Positives = 213/290 (73%), Gaps = 0/290 (0%)
 Frame = -1

Query  891  REFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHVGNIQLAAVAVENNLIAGFAFGI  712
            +EF  ESK+LW LA PAIFT  SQYS+GA+TQ FAG V  I LAAV+VEN++IAG AFG+
Sbjct  32   KEFGGESKRLWKLAGPAIFTALSQYSLGALTQTFAGQVSEIDLAAVSVENSVIAGLAFGV  91

Query  711  MYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNATAIPLTTLYIFSTPILKLLHQNP  532
            M GMGSALETLCGQA+GA ++ MLGVY+QRSW+IL  TA  L  LY++S PIL+L+ +  
Sbjct  92   MLGMGSALETLCGQAYGAGEIRMLGVYMQRSWVILLTTACILVPLYVWSPPILELIGETT  151

Query  531  HISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYVMASVSDVALVGHVLFSWLFMLK  352
             IS+A G FA+WM+PQLFAY   FPIQ+FLQ+Q K+ VMA +S + LV H + SWLF+LK
Sbjct  152  EISEAAGKFALWMLPQLFAYALNFPIQKFLQAQRKVMVMAWISAIVLVIHAVASWLFILK  211

Query  351  LRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKGFSQRAFQNLTGFVRLSLASGVM  172
            L +GL G A+ LNT+WW + + Q +Y+       AW GFS  AF NL GFV+LSLAS VM
Sbjct  212  LGYGLVGAAITLNTSWWLIIIGQLLYIFITKSDGAWGGFSWLAFSNLWGFVKLSLASAVM  271

Query  171  FCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGWTLMVGVGFSAAIS  22
             CLE WY + L++I G   N  + VD  SICMNI GW  M+ +GF+AAIS
Sbjct  272  LCLEFWYLMILVVITGRLPNPLIPVDAISICMNIQGWDAMIALGFNAAIS  321



>ref|XP_004291916.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Fragaria vesca 
subsp. vesca]
Length=484

 Score =   347 bits (890),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 166/300 (55%), Positives = 215/300 (72%), Gaps = 0/300 (0%)
 Frame = -1

Query  921  RQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHVGNIQLAAVAVEN  742
             + +K   F  +F  ESKKLW +A PAIFT   QYS+GA+TQ F G VG ++LAAV+VEN
Sbjct  18   HEDEKELGFCPKFKVESKKLWQIAGPAIFTALCQYSLGALTQTFTGFVGELELAAVSVEN  77

Query  741  NLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNATAIPLTTLYIFST  562
            ++IAG AFG+M GMGSALETLCGQA+GA ++ MLGVY+QRSWIIL  T++ L  +Y++S 
Sbjct  78   SVIAGLAFGVMLGMGSALETLCGQAYGAGQIRMLGVYMQRSWIILLTTSLFLVPIYVWSP  137

Query  561  PILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYVMASVSDVALVGH  382
            PIL+ + +   IS+A G FA+WM+PQLFAY   FPIQ+FLQ+Q K++VMA +S   LV H
Sbjct  138  PILEFIGETDEISEAAGKFAIWMLPQLFAYALNFPIQKFLQAQRKVFVMAYISAGVLVFH  197

Query  381  VLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKGFSQRAFQNLTGF  202
              FSWL +LKL WGL G A+ LNT+WW + + Q +Y+       AW GFS  AF +L GF
Sbjct  198  TFFSWLMILKLGWGLTGAAITLNTSWWLIIIGQLMYIFITKSDGAWSGFSMLAFADLYGF  257

Query  201  VRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGWTLMVGVGFSAAIS  22
            V+LSLAS VM CLE WY + L++I G   +  + VD  SICMNI GW  M+ +GF+AAIS
Sbjct  258  VKLSLASAVMLCLEFWYLMVLVVITGRLADPLIPVDAISICMNIQGWDAMIALGFNAAIS  317



>ref|XP_003544433.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Glycine max]
Length=483

 Score =   347 bits (889),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 169/309 (55%), Positives = 217/309 (70%), Gaps = 0/309 (0%)
 Frame = -1

Query  948  SFDADAGDIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHVGNI  769
            + D     + + K +   +++F  ESKKLW +A PAI T   QYS+GA+TQ FAG VG++
Sbjct  8    NIDNSTTYVEEKKTLNSVVKKFGFESKKLWKIAGPAILTSICQYSLGALTQTFAGLVGDL  67

Query  768  QLAAVAVENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNATAIP  589
            +LAAV+VEN+++AG AFG+M GMGSALETLCGQA+GA +  MLGVY+QRSW+IL  TA+ 
Sbjct  68   ELAAVSVENSVVAGLAFGVMLGMGSALETLCGQAYGAGQSTMLGVYMQRSWVILFVTALI  127

Query  588  LTTLYIFSTPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYVMAS  409
            L  LYI+S PIL+L  Q   IS A G FA+WMIPQLFAY   FP+ +FLQ+Q K+ VM  
Sbjct  128  LLPLYIWSPPILRLFGQTAEISDAAGKFALWMIPQLFAYAINFPMVKFLQAQRKVLVMLW  187

Query  408  VSDVALVGHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKGFSQ  229
            +S V LV H  FSW  + KL WGL G A+ LNT+WW + +AQ +Y+       AW GF+ 
Sbjct  188  ISVVVLVLHTFFSWFLIFKLGWGLIGAAITLNTSWWVIVIAQLLYIFITKSDGAWNGFTW  247

Query  228  RAFQNLTGFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGWTLMV  49
             AF +L GFV+LSLAS VM CLE WY + L++I G  KN  V VD  SICMNI+GW  M+
Sbjct  248  LAFSDLFGFVKLSLASAVMLCLEFWYLMILVVITGRLKNPLVPVDAISICMNINGWDAMI  307

Query  48   GVGFSAAIS  22
             +GF+AAIS
Sbjct  308  AIGFNAAIS  316



>ref|XP_004171488.1| PREDICTED: protein TRANSPARENT TESTA 12-like, partial [Cucumis 
sativus]
Length=290

 Score =   340 bits (871),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 165/259 (64%), Positives = 199/259 (77%), Gaps = 0/259 (0%)
 Frame = -1

Query  945  FDADAGDIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHVGNIQ  766
            F  DA DI  I   ++F REF  E KKLWYLAAPA+FT   QYS GAITQ+FAG V  I 
Sbjct  32   FAPDADDIPPINTARDFYREFCIELKKLWYLAAPAVFTSICQYSFGAITQLFAGQVSTIA  91

Query  765  LAAVAVENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNATAIPL  586
            LAAV+VEN++IAGF+FGIM GMGSALETLCGQA+GA +L M+GVYLQRSW+IL  TA+ L
Sbjct  92   LAAVSVENSVIAGFSFGIMLGMGSALETLCGQAYGAGQLGMMGVYLQRSWVILLTTAVVL  151

Query  585  TTLYIFSTPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYVMASV  406
            T +YIFS P+LKL+ Q   IS+A G  ++WMIPQL+AY   FP+ +FLQ+QSK+  M+ +
Sbjct  152  TPIYIFSAPLLKLIGQTAEISEAAGVLSIWMIPQLYAYALNFPVSKFLQAQSKMMAMSVI  211

Query  405  SDVALVGHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKGFSQR  226
            S VALV H  F+WLFMLKL WGL GGA+VLN +WW +  AQ VY++SG+CG AW GFS +
Sbjct  212  SAVALVFHTFFTWLFMLKLGWGLAGGAIVLNASWWVIDFAQIVYILSGSCGRAWSGFSWQ  271

Query  225  AFQNLTGFVRLSLASGVMF  169
            AF NL GFVRLSLAS VM 
Sbjct  272  AFHNLWGFVRLSLASAVML  290



>gb|KHN21009.1| Protein TRANSPARENT TESTA 12 [Glycine soja]
Length=487

 Score =   346 bits (888),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 169/309 (55%), Positives = 217/309 (70%), Gaps = 0/309 (0%)
 Frame = -1

Query  948  SFDADAGDIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHVGNI  769
            + D     + + K +   +++F  ESKKLW +A PAI T   QYS+GA+TQ FAG VG++
Sbjct  8    NIDNSTTYVEEKKTLNSVVKKFGFESKKLWKIAGPAILTSICQYSLGALTQTFAGLVGDL  67

Query  768  QLAAVAVENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNATAIP  589
            +LAAV+VEN+++AG AFG+M GMGSALETLCGQA+GA +  MLGVY+QRSW+IL  TA+ 
Sbjct  68   ELAAVSVENSVVAGLAFGVMLGMGSALETLCGQAYGAGQSTMLGVYMQRSWVILFVTALI  127

Query  588  LTTLYIFSTPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYVMAS  409
            L  LYI+S PIL+L  Q   IS A G FA+WMIPQLFAY   FP+ +FLQ+Q K+ VM  
Sbjct  128  LLPLYIWSPPILRLFGQTAEISDAAGKFALWMIPQLFAYAINFPMVKFLQAQRKVLVMLW  187

Query  408  VSDVALVGHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKGFSQ  229
            +S V LV H  FSW  + KL WGL G A+ LNT+WW + +AQ +Y+       AW GF+ 
Sbjct  188  ISVVVLVLHTFFSWFLIFKLGWGLIGAAITLNTSWWVIVIAQLLYIFITKSDGAWSGFTW  247

Query  228  RAFQNLTGFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGWTLMV  49
             AF +L GFV+LSLAS VM CLE WY + L++I G  KN  V VD  SICMNI+GW  M+
Sbjct  248  LAFSDLFGFVKLSLASAVMLCLEFWYLMILVVITGRLKNPLVPVDAISICMNINGWDAMI  307

Query  48   GVGFSAAIS  22
             +GF+AAIS
Sbjct  308  AIGFNAAIS  316



>ref|XP_010060899.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Eucalyptus 
grandis]
 gb|KCW67796.1| hypothetical protein EUGRSUZ_F01527 [Eucalyptus grandis]
Length=484

 Score =   346 bits (888),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 167/297 (56%), Positives = 217/297 (73%), Gaps = 0/297 (0%)
 Frame = -1

Query  912  KKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHVGNIQLAAVAVENNLI  733
            +K     R F SES KLW +A PAIFT  +QYS+GA+TQ+F G +  I LAAV+V N+++
Sbjct  22   EKRASIFRRFRSESGKLWKIAGPAIFTSITQYSLGALTQIFVGQLSEIDLAAVSVGNSVV  81

Query  732  AGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNATAIPLTTLYIFSTPIL  553
             GFAFG+M GMGSALETLCGQAFGA ++ MLGVY+QRSW+IL  TA  L  +Y+F+ PIL
Sbjct  82   GGFAFGVMLGMGSALETLCGQAFGAGRIRMLGVYMQRSWVILLTTACVLVPVYVFAPPIL  141

Query  552  KLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYVMASVSDVALVGHVLF  373
            +++ +   IS+A G FA+WM+PQLFAY   FPIQ+FLQ+Q K++VMA +S   LV H +F
Sbjct  142  EVIGETAEISEAAGQFALWMLPQLFAYALNFPIQKFLQAQRKVFVMAWISATVLVLHAIF  201

Query  372  SWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKGFSQRAFQNLTGFVRL  193
            SWL +LKL  G+ G A+ L+ +WW + VAQ +Y+       AW GFS  AF +L GFV+L
Sbjct  202  SWLVILKLGGGIVGAAITLDISWWLIIVAQLLYIFITKSDGAWSGFSWLAFADLWGFVKL  261

Query  192  SLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGWTLMVGVGFSAAIS  22
            SLAS VM CLELWYF+ L++IAG   N  + VD  SICMNI+GW +M+ VGF+AAIS
Sbjct  262  SLASAVMLCLELWYFMVLLVIAGRLPNPLIPVDAISICMNINGWDIMIAVGFNAAIS  318



>ref|XP_006416102.1| hypothetical protein EUTSA_v10009930mg [Eutrema salsugineum]
 gb|ESQ34455.1| hypothetical protein EUTSA_v10009930mg [Eutrema salsugineum]
Length=508

 Score =   346 bits (888),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 171/302 (57%), Positives = 218/302 (72%), Gaps = 11/302 (4%)
 Frame = -1

Query  927  DIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHVGNIQLAAVAV  748
            D+  I   ++F+R+F +ESKKLW+LA PAIFT  S   + + T         + LAAV++
Sbjct  27   DMAPITGGRDFLRQFATESKKLWWLAGPAIFT--SFLPVLSCT---------LALAAVSI  75

Query  747  ENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNATAIPLTTLYIF  568
            +N++IAGF+ GIM GMGSAL TLCGQA+GA +LEM+G+YLQRSWIILN+ A+ L   Y+F
Sbjct  76   QNSVIAGFSVGIMLGMGSALATLCGQAYGAGQLEMMGIYLQRSWIILNSCALLLCLFYVF  135

Query  567  STPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYVMASVSDVALV  388
            +TP+L LL Q+P ISKA G F++WMIPQLFAY   F   +FLQ+QSK+  MA ++   L 
Sbjct  136  ATPLLSLLGQSPEISKAAGKFSLWMIPQLFAYAVNFATAKFLQAQSKVIAMAVIAATVLC  195

Query  387  GHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKGFSQRAFQNLT  208
             H + SW  MLKL WG+ GGAV LN +WW +  AQ VY+  G+CG AW G S +AF+NL 
Sbjct  196  QHAVLSWFMMLKLGWGMAGGAVALNVSWWLIDGAQIVYICGGSCGRAWSGLSWKAFKNLR  255

Query  207  GFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGWTLMVGVGFSAA  28
            GF RLSLAS VM CLE+WYF+ALIL AGY KN +VSV   SICMNI GW +MV  GF+AA
Sbjct  256  GFARLSLASAVMVCLEVWYFMALILFAGYLKNPQVSVAALSICMNILGWPIMVAFGFNAA  315

Query  27   IS  22
            +S
Sbjct  316  VS  317



>gb|KDO82260.1| hypothetical protein CISIN_1g0101212mg [Citrus sinensis]
Length=331

 Score =   340 bits (871),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 175/288 (61%), Positives = 215/288 (75%), Gaps = 0/288 (0%)
 Frame = -1

Query  945  FDADAGDIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHVGNIQ  766
            F A   DI  I  V++F REF  E KKLWYLA PAIF    QY +GAITQVF+GH+  + 
Sbjct  43   FTAGTDDIPPINGVRDFSREFLKEGKKLWYLAGPAIFMTICQYPLGAITQVFSGHISTLA  102

Query  765  LAAVAVENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNATAIPL  586
            LAAV+VEN++IAGF+FG M GMGSALETLCGQA+GA +L+M+GVYLQRSWIIL  TA+ L
Sbjct  103  LAAVSVENSVIAGFSFGAMLGMGSALETLCGQAYGAGQLDMMGVYLQRSWIILITTALML  162

Query  585  TTLYIFSTPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYVMASV  406
              +YIF+  IL L+ Q   IS A GTFA WMIPQLFAY   FP+ +FLQ+QSKI V+A +
Sbjct  163  MFMYIFAQQILSLIGQTQEISNAAGTFATWMIPQLFAYALNFPMVKFLQAQSKIMVLAVI  222

Query  405  SDVALVGHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKGFSQR  226
            + VAL+ H + SWL +LKL  GL G AV LN +WWF+ + + +Y+ SGACG  W GFS +
Sbjct  223  AAVALLLHTILSWLLILKLGLGLVGAAVALNASWWFIDITRLLYIFSGACGPTWSGFSWK  282

Query  225  AFQNLTGFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSI  82
            AF +L  FVRLSLAS VM C+E+WYF+ALIL AGY KNA++SV G SI
Sbjct  283  AFHSLWSFVRLSLASAVMLCVEIWYFMALILFAGYLKNAKLSVAGLSI  330



>gb|KDO82261.1| hypothetical protein CISIN_1g0101212mg, partial [Citrus sinensis]
 gb|KDO82262.1| hypothetical protein CISIN_1g0101212mg, partial [Citrus sinensis]
 gb|KDO82263.1| hypothetical protein CISIN_1g0101212mg, partial [Citrus sinensis]
 gb|KDO82264.1| hypothetical protein CISIN_1g0101212mg, partial [Citrus sinensis]
Length=330

 Score =   340 bits (871),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 175/288 (61%), Positives = 215/288 (75%), Gaps = 0/288 (0%)
 Frame = -1

Query  945  FDADAGDIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHVGNIQ  766
            F A   DI  I  V++F REF  E KKLWYLA PAIF    QY +GAITQVF+GH+  + 
Sbjct  43   FTAGTDDIPPINGVRDFSREFLKEGKKLWYLAGPAIFMTICQYPLGAITQVFSGHISTLA  102

Query  765  LAAVAVENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNATAIPL  586
            LAAV+VEN++IAGF+FG M GMGSALETLCGQA+GA +L+M+GVYLQRSWIIL  TA+ L
Sbjct  103  LAAVSVENSVIAGFSFGAMLGMGSALETLCGQAYGAGQLDMMGVYLQRSWIILITTALML  162

Query  585  TTLYIFSTPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYVMASV  406
              +YIF+  IL L+ Q   IS A GTFA WMIPQLFAY   FP+ +FLQ+QSKI V+A +
Sbjct  163  MFMYIFAQQILSLIGQTQEISNAAGTFATWMIPQLFAYALNFPMVKFLQAQSKIMVLAVI  222

Query  405  SDVALVGHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKGFSQR  226
            + VAL+ H + SWL +LKL  GL G AV LN +WWF+ + + +Y+ SGACG  W GFS +
Sbjct  223  AAVALLLHTILSWLLILKLGLGLVGAAVALNASWWFIDITRLLYIFSGACGPTWSGFSWK  282

Query  225  AFQNLTGFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSI  82
            AF +L  FVRLSLAS VM C+E+WYF+ALIL AGY KNA++SV G SI
Sbjct  283  AFHSLWSFVRLSLASAVMLCVEIWYFMALILFAGYLKNAKLSVAGLSI  330



>gb|KCW86662.1| hypothetical protein EUGRSUZ_B03290 [Eucalyptus grandis]
Length=502

 Score =   345 bits (886),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 175/321 (55%), Positives = 219/321 (68%), Gaps = 31/321 (10%)
 Frame = -1

Query  984  NTQIS*NMSSVYSFDADAGDIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGA  805
            N  +S  ++  ++F     DI  IK  ++F+REF  ESKKLW+LA PAIFT   +YSIGA
Sbjct  37   NMPLSTTVNDTFTFTPHTDDIPPIKGPRDFLREFAKESKKLWFLAGPAIFTSICRYSIGA  96

Query  804  ITQVFAGHVGNIQLAAVAVENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQ  625
            ITQVFAG VG ++LAAV+VEN++IAGF+FG+M GMGSALETLCGQA+GA +L+MLG+YLQ
Sbjct  97   ITQVFAGQVGTLELAAVSVENSVIAGFSFGVMLGMGSALETLCGQAYGAGQLDMLGIYLQ  156

Query  624  RSWIILNATAIPLTTLYIFSTPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRF  445
            RSW+ILN TA+ L  LYI +  +L+L+ Q   IS+  G FAVWMIPQ+F Y   FPI +F
Sbjct  157  RSWVILNTTAVALCFLYILAAKLLRLIGQTEAISEEAGMFAVWMIPQVFMYAMNFPIAKF  216

Query  444  LQSQSKIYVMASVSDVALVGHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVS  265
            LQ+QS+I VMA ++ V LV H  FSWL MLKL WGL G AVVLN +W  +  AQ  Y+ S
Sbjct  217  LQAQSRIMVMAVIAGVVLVLHTAFSWLLMLKLGWGLVGAAVVLNASWVVIVAAQLAYIFS  276

Query  264  GACGDAWKGFSQRAFQNLTGFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTS  85
            GA                               LE+WYF+ALIL AGY KNAE+SVD  +
Sbjct  277  GA-------------------------------LEIWYFMALILFAGYLKNAEISVDALA  305

Query  84   ICMNISGWTLMVGVGFSAAIS  22
            ICMNI GWT+M  +G +AAIS
Sbjct  306  ICMNILGWTVMQALGMNAAIS  326



>ref|XP_010243274.1| PREDICTED: protein TRANSPARENT TESTA 12 isoform X2 [Nelumbo nucifera]
Length=504

 Score =   345 bits (886),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 160/294 (54%), Positives = 215/294 (73%), Gaps = 0/294 (0%)
 Frame = -1

Query  903  KEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHVGNIQLAAVAVENNLIAGF  724
            +    + + ESKK+W++AAPAI T  +Q+SIG +T  F GH+G ++LAAV+V  N+I GF
Sbjct  19   ERLANKSWDESKKMWHIAAPAILTAVAQFSIGLVTVAFVGHLGEVELAAVSVVENVIEGF  78

Query  723  AFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNATAIPLTTLYIFSTPILKLL  544
             +GIM GMGSALETLCGQA GA ++ MLG+Y+QRSWII   TA+ LT +Y+F++P+LKLL
Sbjct  79   VYGIMLGMGSALETLCGQAVGAGQMNMLGIYMQRSWIITGVTALILTPVYVFASPMLKLL  138

Query  543  HQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYVMASVSDVALVGHVLFSWL  364
            HQ+  IS+  G +++W+IPQLFAY   FP Q+FLQSQSK++VM  +S   L  H L +W+
Sbjct  139  HQSDDISELAGKYSIWVIPQLFAYALNFPTQKFLQSQSKVWVMTIISGAVLAFHALLNWI  198

Query  363  FMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKGFSQRAFQNLTGFVRLSLA  184
             + KL  GL G A+  N +WW + +AQ VYVVSG   DAW GFS  AF+ L  FV+LSLA
Sbjct  199  LVTKLGHGLAGAAIAGNISWWLVVLAQLVYVVSGYFPDAWTGFSLSAFEKLAAFVKLSLA  258

Query  183  SGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGWTLMVGVGFSAAIS  22
            S +M CLELWY+  +IL+ G  KN E++VD  SICMN+  WTLM+ +GF+AA+S
Sbjct  259  SAIMLCLELWYYTIVILLVGRLKNPEIAVDAISICMNLQQWTLMIALGFNAAVS  312



>ref|XP_006478466.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Citrus sinensis]
Length=318

 Score =   338 bits (868),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 170/311 (55%), Positives = 217/311 (70%), Gaps = 5/311 (2%)
 Frame = -1

Query  987  KNTQ--IS*NMSSVYSFDADAGDIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYS  814
            +NT   +S  ++  Y   +D GD +Q  K   F++EF  ESK+LW LA PAIFT   QYS
Sbjct  4    ENTSPLLSNKVTESYDIYSD-GDDQQ--KQLGFLKEFGYESKRLWKLAGPAIFTCICQYS  60

Query  813  IGAITQVFAGHVGNIQLAAVAVENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGV  634
            +GA+TQ FAG VG ++LAA +VEN++IAG AFG+M GMGSALETLCGQAFGA  + MLGV
Sbjct  61   LGALTQTFAGRVGELELAAFSVENSVIAGLAFGVMLGMGSALETLCGQAFGAGSIRMLGV  120

Query  633  YLQRSWIILNATAIPLTTLYIFSTPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPI  454
            Y+QRSW+IL  T+  L+ LY++S P+L L  +   IS A G FA+WM+PQLFAY   FPI
Sbjct  121  YMQRSWVILLITSCVLSPLYVWSPPVLMLFGETAEISNAAGKFALWMLPQLFAYALNFPI  180

Query  453  QRFLQSQSKIYVMASVSDVALVGHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVY  274
            Q+FLQ+Q K+ VMA +S + LV H LFSWL +LKL WGL G A+ LN +WW + V Q +Y
Sbjct  181  QKFLQAQRKVLVMAWISAIVLVLHALFSWLLILKLGWGLIGAAITLNLSWWLIVVLQLLY  240

Query  273  VVSGACGDAWKGFSQRAFQNLTGFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVD  94
            +       AW GFS  AF +L  FV+LSLAS VM CLE WY + L++I G   NA ++VD
Sbjct  241  IFITKSDGAWSGFSWLAFADLWAFVKLSLASAVMLCLEFWYLMLLVVITGRLPNALIAVD  300

Query  93   GTSICMNISGW  61
              S+CMNI GW
Sbjct  301  AISVCMNIQGW  311



>ref|XP_008779773.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Phoenix dactylifera]
Length=323

 Score =   338 bits (868),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 164/256 (64%), Positives = 201/256 (79%), Gaps = 0/256 (0%)
 Frame = -1

Query  936  DAGDIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHVGNIQLAA  757
            + GDI  I+   +F REF  ESKKLWYLA PAIFT   QYS+GAITQ+FAG VG ++LAA
Sbjct  67   ELGDIGSIRGPGDFWREFVVESKKLWYLAGPAIFTSICQYSLGAITQMFAGQVGTLELAA  126

Query  756  VAVENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNATAIPLTTL  577
            V+VEN++IAGF+FGIM GMGSALETLCGQA+GA +L+MLGVY+QRSW+ILN TA+ L+ L
Sbjct  127  VSVENSVIAGFSFGIMLGMGSALETLCGQAYGAGQLDMLGVYMQRSWVILNTTALLLSLL  186

Query  576  YIFSTPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYVMASVSDV  397
            Y+FS P+L+L+ Q   I+ A GTF+VWMIPQLFAY   FPI +FLQ+QS++  MA VS V
Sbjct  187  YVFSGPVLRLIGQTEEIAGAAGTFSVWMIPQLFAYAMNFPIAKFLQAQSRMMAMAVVSVV  246

Query  396  ALVGHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKGFSQRAFQ  217
            AL+ HVLFSWL +L+L WGL G AVVLN +WW + + Q  Y+  GACG AW GFS +AF 
Sbjct  247  ALLLHVLFSWLLILRLGWGLVGAAVVLNASWWLIVLGQLAYIFGGACGRAWSGFSLKAFA  306

Query  216  NLTGFVRLSLASGVMF  169
            NL GFVRLS+AS VM 
Sbjct  307  NLWGFVRLSIASAVML  322



>gb|KDP46214.1| hypothetical protein JCGZ_10054 [Jatropha curcas]
Length=495

 Score =   345 bits (884),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 158/297 (53%), Positives = 222/297 (75%), Gaps = 0/297 (0%)
 Frame = -1

Query  912  KKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHVGNIQLAAVAVENNLI  733
            +K K+ +++ + ESKK+W +A PA+ T  +Q+SIG +T  F GH+G ++LAAV++  N+I
Sbjct  20   EKRKKIVKKSWDESKKMWEIATPAMLTAVTQFSIGVVTSAFVGHIGEVELAAVSIVQNVI  79

Query  732  AGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNATAIPLTTLYIFSTPIL  553
             GF FG+M GMGSALETLCGQA GA ++ MLG+YLQRSW I   TA+ LT +Y+F++P+L
Sbjct  80   EGFVFGVMLGMGSALETLCGQAVGAGQVNMLGIYLQRSWTITGVTALFLTPVYVFTSPLL  139

Query  552  KLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYVMASVSDVALVGHVLF  373
            +LLHQ+ +ISK  G F++W+IPQL+AY   FPIQ+FLQ+QSK++VM  +S  +L+ HVL 
Sbjct  140  QLLHQDKNISKLAGKFSIWVIPQLYAYAMNFPIQKFLQAQSKVWVMTIISIFSLLFHVLL  199

Query  372  SWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKGFSQRAFQNLTGFVRL  193
            +W+ + K+  GL G A+  N +WW + + Q  YV++G   +AW GFS  AF +L GFV+L
Sbjct  200  NWVLVTKMERGLLGAAIAGNISWWLVVLGQAFYVLAGFFPEAWTGFSLSAFTSLAGFVKL  259

Query  192  SLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGWTLMVGVGFSAAIS  22
            SLAS VM CLELWYF  +IL+ G+ KN E++VD  SICMN+  WTLM+ +GF+AAIS
Sbjct  260  SLASAVMLCLELWYFTIVILMVGWLKNPEIAVDAISICMNLELWTLMIALGFNAAIS  316



>ref|XP_002444617.1| hypothetical protein SORBIDRAFT_07g024790 [Sorghum bicolor]
 gb|EES14112.1| hypothetical protein SORBIDRAFT_07g024790 [Sorghum bicolor]
Length=512

 Score =   344 bits (883),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 171/302 (57%), Positives = 219/302 (73%), Gaps = 0/302 (0%)
 Frame = -1

Query  927  DIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHVGNIQLAAVAV  748
            D+ +I+ V  F+R    E++KLWYLA PAI T  +QYS+GAITQVFAGH+  ++L A++ 
Sbjct  39   DLEEIRSVGSFLRHAAEENRKLWYLAGPAILTSIAQYSLGAITQVFAGHLTTLELDAIST  98

Query  747  ENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNATAIPLTTLYIF  568
            ENN++AG AFGIM GMGSALETLCGQA+GAK+L MLGVYLQRSWIIL A A+ +  LY+F
Sbjct  99   ENNVVAGLAFGIMLGMGSALETLCGQAYGAKQLPMLGVYLQRSWIILTAMAVLMLPLYLF  158

Query  567  STPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYVMASVSDVALV  388
            +TPIL+L HQ+  I+   G  A++MIPQLFAY F FPIQ+FLQ+QSK+  MA+VS  AL 
Sbjct  159  ATPILRLFHQDAEIADLAGRLALYMIPQLFAYAFNFPIQKFLQAQSKVMAMAAVSAAALA  218

Query  387  GHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKGFSQRAFQNLT  208
             HV  SW  +  +R GL G AV LN +WW + + Q  Y++ G C  AW GF   AF +L 
Sbjct  219  FHVALSWFLVGPMRMGLVGLAVALNASWWLVVLGQLAYILMGYCPGAWNGFDCLAFSDLV  278

Query  207  GFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGWTLMVGVGFSAA  28
            GF RLSL S VM CLE W+++ LI+I G  +NA+V+V   SIC N+ GW +MV  GF+AA
Sbjct  279  GFARLSLGSAVMLCLEFWFYMFLIVIVGNLENAQVAVAAVSICTNLFGWQIMVFFGFNAA  338

Query  27   IS  22
            IS
Sbjct  339  IS  340



>ref|XP_008347416.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Malus domestica]
Length=562

 Score =   345 bits (886),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 171/321 (53%), Positives = 227/321 (71%), Gaps = 5/321 (2%)
 Frame = -1

Query  984  NTQIS*NMSSVYSFDADAGDIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGA  805
            N Q +  + S +S   D G+    +KV  F++++  ESKKLW +A PAIFT   QYS+GA
Sbjct  79   NDQNTPLLVSNHSGHEDGGE----EKVG-FVKQYGIESKKLWKIAGPAIFTSLCQYSLGA  133

Query  804  ITQVFAGHVGNIQLAAVAVENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQ  625
            +TQ FAG VG+++LAAV++EN++IAG AFG+M GMGSALETLCGQA+GA ++ MLGVY+Q
Sbjct  134  LTQTFAGFVGDLELAAVSIENSVIAGLAFGVMLGMGSALETLCGQAYGAGQIRMLGVYMQ  193

Query  624  RSWIILNATAIPLTTLYIFSTPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRF  445
            RSWIIL  TA  +  +Y++S PILKL  +   IS+A G FA+ M+PQLFAY   FPIQ+F
Sbjct  194  RSWIILLVTACAMVPIYVWSPPILKLFGETTEISEAAGRFALLMLPQLFAYALNFPIQKF  253

Query  444  LQSQSKIYVMASVSDVALVGHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVS  265
            LQ+Q K+ V+A +S   LV H + SWL M+KL WGL G A+ LN +WW + + Q +Y+  
Sbjct  254  LQAQRKVSVIAWISGAVLVEHAVLSWLLMIKLGWGLTGAAITLNASWWLIIIGQLLYIFI  313

Query  264  GACGDAWKGFSQRAFQNLTGFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTS  85
                 AW GFS  AF +L GF++LSLAS VM CLE WY + L++I G  KN  + VD  S
Sbjct  314  TKSDGAWSGFSWLAFSDLWGFIKLSLASAVMLCLEFWYLMILLVITGRLKNPLIPVDAIS  373

Query  84   ICMNISGWTLMVGVGFSAAIS  22
            ICMNI+GW  M+ +GF+AAIS
Sbjct  374  ICMNINGWDAMIAIGFNAAIS  394



>emb|CDO97089.1| unnamed protein product [Coffea canephora]
Length=514

 Score =   343 bits (881),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 169/324 (52%), Positives = 225/324 (69%), Gaps = 2/324 (1%)
 Frame = -1

Query  987  KNTQIS*NMSSVYSFDADAGDIRQIKKV--KEFIREFYSESKKLWYLAAPAIFTIASQYS  814
            + T  S  M  + S + +  + +Q K+V  K+     ++ESKK+W +AAPAI T  +Q+S
Sbjct  10   EETDSSAAMEPIMSLEIEEKEDKQRKRVGGKKICGRSWNESKKMWEIAAPAILTAVAQFS  69

Query  813  IGAITQVFAGHVGNIQLAAVAVENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGV  634
               +T  F GH+G ++LAAV+V  N+I GF +GIM GMGSALETLCGQA GA + EMLG 
Sbjct  70   FEFVTAAFIGHLGEVELAAVSVVQNVIEGFVYGIMLGMGSALETLCGQAVGAGQFEMLGA  129

Query  633  YLQRSWIILNATAIPLTTLYIFSTPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPI  454
            Y+QRS II   TA+ L+  YIF+ P+LKLLHQ+P IS   G +A+W+IPQLFAY   FPI
Sbjct  130  YMQRSCIITLVTALLLSPFYIFTAPLLKLLHQDPRISHLAGKYALWVIPQLFAYALNFPI  189

Query  453  QRFLQSQSKIYVMASVSDVALVGHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVY  274
            Q+FLQ+QSKI+VM  +S V L  HVL +W+F+  L  GL G AV  N +WW M +AQ +Y
Sbjct  190  QKFLQAQSKIWVMTIISLVMLGIHVLLNWIFVTMLGHGLLGAAVAGNISWWLMVLAQIIY  249

Query  273  VVSGACGDAWKGFSQRAFQNLTGFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVD  94
            VV G   +AW GFS  AF+ L  FV+ SLAS +M CLELWY+  +IL+ G+ KN E++VD
Sbjct  250  VVGGFFPEAWTGFSSLAFKQLASFVKFSLASAIMLCLELWYYTVVILMVGWLKNPEIAVD  309

Query  93   GTSICMNISGWTLMVGVGFSAAIS  22
              SICMN+  WTLM+ +GF+AA+S
Sbjct  310  AVSICMNLQLWTLMIALGFNAAVS  333



>ref|XP_008778454.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Phoenix dactylifera]
Length=296

 Score =   335 bits (860),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 162/262 (62%), Positives = 203/262 (77%), Gaps = 3/262 (1%)
 Frame = -1

Query  945  FDADAGDIRQIKKVK---EFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHVG  775
            F A+ G IR I  +    +F REF  ESKKLWYLA PAIFT   QYS+G ITQ+FAG VG
Sbjct  34   FVAEIGKIRDIGSISGPGDFWREFVVESKKLWYLAGPAIFTSICQYSLGGITQMFAGQVG  93

Query  774  NIQLAAVAVENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNATA  595
             ++LAAV+VEN++IAGF+FG+M GMGSALETLCGQA+GA +L+M+GVY+QRSW+ILN+TA
Sbjct  94   TLELAAVSVENSVIAGFSFGVMLGMGSALETLCGQAYGAGQLDMMGVYMQRSWVILNSTA  153

Query  594  IPLTTLYIFSTPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYVM  415
            + L+ LY+F+ P+L+L+ Q   I+ A GTF+VWMIPQLFAY   FPI +FLQ+QS++  M
Sbjct  154  LLLSLLYVFAGPVLRLIGQTEEIAGAAGTFSVWMIPQLFAYAMNFPIAKFLQAQSRMMAM  213

Query  414  ASVSDVALVGHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKGF  235
            A VS VAL+ H+LFSWL +L+L WGL G AVVLN +WW + + Q  Y+  GACG AW GF
Sbjct  214  AVVSVVALLLHILFSWLLILRLGWGLVGAAVVLNASWWLIVLGQLAYIFGGACGRAWSGF  273

Query  234  SQRAFQNLTGFVRLSLASGVMF  169
            S +AF NL GFVRLSLAS VM 
Sbjct  274  SLKAFANLWGFVRLSLASAVML  295



>ref|XP_010243273.1| PREDICTED: protein TRANSPARENT TESTA 12 isoform X1 [Nelumbo nucifera]
Length=506

 Score =   342 bits (877),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 158/298 (53%), Positives = 218/298 (73%), Gaps = 0/298 (0%)
 Frame = -1

Query  915  IKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHVGNIQLAAVAVENNL  736
            I+  ++   + + ESKK+W++A PAI +  +Q+SIG +T  F GH+G+++LAAV++  N+
Sbjct  17   IQSRRKLGDKSWVESKKMWHIAGPAILSTVAQFSIGFVTVAFVGHLGDMELAAVSIVQNV  76

Query  735  IAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNATAIPLTTLYIFSTPI  556
            I GF +GIM GMGSALETLCGQA GA ++ MLG+Y+QRSWII   TA+ LT +Y+F++P+
Sbjct  77   IEGFVYGIMLGMGSALETLCGQAVGAGQMNMLGIYMQRSWIITGVTALILTPVYVFASPM  136

Query  555  LKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYVMASVSDVALVGHVL  376
            LKLLHQ+  IS+  G +++W+IPQLFAY   FP Q+FLQSQSK++VM  +S   L  H L
Sbjct  137  LKLLHQSDDISELAGKYSIWVIPQLFAYALNFPTQKFLQSQSKVWVMTIISGAVLAFHAL  196

Query  375  FSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKGFSQRAFQNLTGFVR  196
             +W+ + KL  GL G A+  N +WW + +AQ VYVVSG   DAW GFS  AF+ L  FV+
Sbjct  197  LNWILVTKLGHGLAGAAIAGNISWWLVVLAQLVYVVSGYFPDAWTGFSLSAFEKLAAFVK  256

Query  195  LSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGWTLMVGVGFSAAIS  22
            LSLAS +M CLELWY+  +IL+ G  KN E++VD  SICMN+  WTLM+ +GF+AA+S
Sbjct  257  LSLASAIMLCLELWYYTIVILLVGRLKNPEIAVDAISICMNLQQWTLMIALGFNAAVS  314



>ref|XP_009383439.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Musa acuminata 
subsp. malaccensis]
Length=500

 Score =   342 bits (876),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 164/316 (52%), Positives = 224/316 (71%), Gaps = 4/316 (1%)
 Frame = -1

Query  936  DAGDIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHVGNIQLAA  757
            + GD+ +I+ +K+F++++  E+K+LWYLA P+IFT   +YS+GA TQVFAGH+  ++L A
Sbjct  16   ERGDLEEIRSLKQFLKQWVEENKRLWYLAGPSIFTSICRYSLGATTQVFAGHLTTLELDA  75

Query  756  VAVENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNATAIPLTTL  577
            V+ EN +IAG AFGIM GMGSALETLCGQA+GAK+L MLGVY+QRSW+IL  T   L  +
Sbjct  76   VSTENMVIAGLAFGIMMGMGSALETLCGQAYGAKQLHMLGVYMQRSWVILLTTCTCLLPV  135

Query  576  YIFSTPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYVMASVSDV  397
            Y+F+ PIL+L  Q+  I++  G F+++MIPQLFAY   FPI +FLQ+QSK+ VMA V+ +
Sbjct  136  YLFAAPILRLFKQDADIAELAGRFSLYMIPQLFAYGLNFPISKFLQAQSKVMVMAVVAAI  195

Query  396  ALVGHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKGFSQRAFQ  217
            ALV HV  SWL +++ + GL G A  LN  WW + +AQF Y+  G C  AW GFS  AF+
Sbjct  196  ALVFHVCLSWLLIVQFKLGLVGAATSLNIAWWIVVLAQFGYIAMGYCPGAWNGFSWGAFR  255

Query  216  NLTGFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGWTLMVGVGF  37
             L  F  LS+ S +M CLE WY++ +I++ G  +NA+++V   SIC NI+GW  MV  GF
Sbjct  256  GLGSFAWLSIGSAIMLCLEFWYYMIIIVLVGRLENAQIAVAAVSICTNINGWEFMVFFGF  315

Query  36   SAA----ISNNLFRRR  1
            + A    ISN L  RR
Sbjct  316  NVAISVRISNELGARR  331



>ref|XP_008796381.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Phoenix dactylifera]
Length=490

 Score =   340 bits (872),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 157/290 (54%), Positives = 212/290 (73%), Gaps = 0/290 (0%)
 Frame = -1

Query  891  REFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHVGNIQLAAVAVENNLIAGFAFGI  712
             + + E + +WY+A PAI T   Q+S+G++TQ   GH+G ++LAAV ++N +IAG  FG+
Sbjct  30   EDTWRELRLVWYIAGPAILTSVFQFSLGSVTQTLVGHIGTLELAAVGIQNLVIAGIGFGV  89

Query  711  MYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNATAIPLTTLYIFSTPILKLLHQNP  532
            M GMGSALETLCGQA+GA K+ MLG+YLQRSW+IL ATA+ L+  Y+F+TPILKLL Q  
Sbjct  90   MLGMGSALETLCGQAYGAGKMSMLGIYLQRSWVILLATAMLLSMTYVFATPILKLLGQKD  149

Query  531  HISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYVMASVSDVALVGHVLFSWLFMLK  352
             I++  G F++WMIP+LFA+   FPIQ+FLQ+QSK+  MA +S   LV HV+ SWLF++K
Sbjct  150  EIAELAGRFSIWMIPELFAFAVNFPIQKFLQAQSKVMAMAWISAAVLVVHVILSWLFIIK  209

Query  351  LRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKGFSQRAFQNLTGFVRLSLASGVM  172
            L  GL G A+ LN  W+ + V Q VYV+SG+C D+W GFS  AF+ L  F+ LSLAS VM
Sbjct  210  LEMGLVGAAITLNFAWFLLDVGQLVYVLSGSCKDSWTGFSWLAFRELVDFLGLSLASAVM  269

Query  171  FCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGWTLMVGVGFSAAIS  22
             CLE W  + L+++AG  KN E++VD  SICMN+ GW  M+ +GF AA+S
Sbjct  270  LCLEYWTLMVLVILAGLLKNPEIAVDAASICMNVEGWCFMIPLGFVAAVS  319



>ref|XP_002445728.1| hypothetical protein SORBIDRAFT_07g024780 [Sorghum bicolor]
 gb|EES15223.1| hypothetical protein SORBIDRAFT_07g024780 [Sorghum bicolor]
Length=508

 Score =   340 bits (872),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 172/309 (56%), Positives = 219/309 (71%), Gaps = 0/309 (0%)
 Frame = -1

Query  948  SFDADAGDIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHVGNI  769
            SF     D+ +I+ V  F+R   +E++KLWYLA PAIFT  +QYS+GAIT VFAGH+  +
Sbjct  27   SFSKGGEDLEEIRSVGSFLRHAAAENRKLWYLAGPAIFTSIAQYSLGAITLVFAGHLTTL  86

Query  768  QLAAVAVENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNATAIP  589
            +L A + ENN+IAG A GI  GMGSALETLCGQA+GAK+L MLGVYLQRSWIIL A A+ 
Sbjct  87   ELDAFSTENNVIAGLALGITLGMGSALETLCGQAYGAKQLHMLGVYLQRSWIILTAMAVL  146

Query  588  LTTLYIFSTPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYVMAS  409
            +  LY+F+TPIL+L HQ+  I+   G  A++MIPQLFAY F FPIQ+FLQ+QSK+  MA+
Sbjct  147  MLPLYLFATPILRLFHQDAEIADLAGRLALYMIPQLFAYAFNFPIQKFLQAQSKVMAMAA  206

Query  408  VSDVALVGHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKGFSQ  229
            VS  AL  HV  SW  +  +R GL G AV LN +WW + + Q  Y++ G C  AW GF  
Sbjct  207  VSAAALAFHVALSWFLVGPMRMGLVGLAVALNASWWLVVLGQLAYILMGYCPGAWNGFDC  266

Query  228  RAFQNLTGFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGWTLMV  49
             AF +L GF RLSL S VM CLE W+++ LI+I G  +NA+V+V   SIC N+ GW +MV
Sbjct  267  LAFSDLVGFARLSLGSAVMLCLEFWFYMFLIVIVGNLENAQVAVAAVSICTNLFGWQIMV  326

Query  48   GVGFSAAIS  22
              GF+AAIS
Sbjct  327  FFGFNAAIS  335



>ref|XP_010941347.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Elaeis guineensis]
Length=495

 Score =   340 bits (871),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 161/302 (53%), Positives = 215/302 (71%), Gaps = 0/302 (0%)
 Frame = -1

Query  927  DIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHVGNIQLAAVAV  748
            D+ ++K + +F++E   E+K+LWYLA PA FT  +QYS+GA TQVFAG +  ++L AV+ 
Sbjct  27   DLEEMKSLGQFVKEVIKENKRLWYLAGPATFTSLAQYSLGATTQVFAGQLTTLELDAVST  86

Query  747  ENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNATAIPLTTLYIF  568
            EN +IAG AFG+M  MGSALETLCGQ+FGAK+L MLGVY+QRSW+IL AT + L  +Y+F
Sbjct  87   ENMVIAGLAFGLMLSMGSALETLCGQSFGAKQLHMLGVYMQRSWVILIATCLCLLPIYLF  146

Query  567  STPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYVMASVSDVALV  388
            +TP+L+ L+Q+  IS+  GT +++MIPQLFAY   FPIQ+FLQ+QSK+   A VS VAL 
Sbjct  147  ATPLLRFLNQDEKISELAGTLSLYMIPQLFAYGLNFPIQKFLQAQSKVMTTAVVSAVALA  206

Query  387  GHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKGFSQRAFQNLT  208
             H+  SWL ++  + GL G A  LN  WW + + Q  Y+  G C  AW GFS  A ++L 
Sbjct  207  SHIFLSWLLIVHFKLGLVGAAASLNIAWWIVVLGQIAYIAMGYCPGAWTGFSWGALRDLE  266

Query  207  GFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGWTLMVGVGFSAA  28
             F RLS+ S +M CLE W+++ LIL+ G  KNAEV+V   SIC N+ GW LMV  GF+AA
Sbjct  267  AFARLSIDSAIMMCLEFWFYMFLILLVGQLKNAEVAVAAVSICFNLFGWELMVFFGFNAA  326

Query  27   IS  22
            IS
Sbjct  327  IS  328



>ref|XP_010935395.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Elaeis guineensis]
Length=487

 Score =   339 bits (869),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 169/302 (56%), Positives = 221/302 (73%), Gaps = 0/302 (0%)
 Frame = -1

Query  927  DIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHVGNIQLAAVAV  748
            D+ +IK +++F++E   E KKLWYLA PAIFT  +QYS+GA TQVFAG +  ++  AV+ 
Sbjct  19   DLEEIKSLEQFVKEIVKEKKKLWYLAGPAIFTSLAQYSLGATTQVFAGQLPTLEFDAVST  78

Query  747  ENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNATAIPLTTLYIF  568
            EN +IAG AFGIM GMGSALETLCGQAFGAK+L MLGVY+QRSW+IL A  + L  +Y+F
Sbjct  79   ENMVIAGLAFGIMLGMGSALETLCGQAFGAKQLHMLGVYMQRSWVILTAMCVCLLPIYLF  138

Query  567  STPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYVMASVSDVALV  388
            ++P+L+LL+Q+  IS   G F+++MIPQLFAY F FPIQ+FLQ+QSK+  MA VS VA+V
Sbjct  139  ASPLLQLLNQDKKISMLAGKFSLYMIPQLFAYGFNFPIQKFLQAQSKVMTMAIVSAVAMV  198

Query  387  GHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKGFSQRAFQNLT  208
             H+  SWL M+  + GL G A  LN  WW + + QF Y+  G C  AW GFS  AF++L 
Sbjct  199  FHIFLSWLLMVHFKLGLVGAAASLNLAWWIVVLGQFAYIAMGYCPGAWTGFSWGAFRDLG  258

Query  207  GFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGWTLMVGVGFSAA  28
             F ++S+ S +M CLE W+++ LILI G  KNAEV+V   SIC N+ GW LMV +GF+AA
Sbjct  259  AFAKISIGSAIMMCLEYWFYMFLILIVGQLKNAEVAVAAVSICDNLFGWVLMVFLGFNAA  318

Query  27   IS  22
            IS
Sbjct  319  IS  320



>ref|XP_010028564.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Eucalyptus grandis]
 gb|KCW55318.1| hypothetical protein EUGRSUZ_I01242 [Eucalyptus grandis]
Length=514

 Score =   340 bits (871),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 158/290 (54%), Positives = 216/290 (74%), Gaps = 0/290 (0%)
 Frame = -1

Query  891  REFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHVGNIQLAAVAVENNLIAGFAFGI  712
            ++   ESKK W +AAPAI +  +Q+SIG +T  F G+VG+++ AAV++  N++ GF +G+
Sbjct  49   KKCMKESKKTWQIAAPAILSAVAQFSIGVVTSAFVGYVGDVEFAAVSIVQNVLEGFVYGV  108

Query  711  MYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNATAIPLTTLYIFSTPILKLLHQNP  532
            M GMGSALETLCGQA GA KL MLG+Y+QRS II   TA+ LT +YIF +PIL++L Q+ 
Sbjct  109  MLGMGSALETLCGQAVGAGKLHMLGIYMQRSCIITGITALLLTPVYIFVSPILQILRQDK  168

Query  531  HISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYVMASVSDVALVGHVLFSWLFMLK  352
            HIS   G +++W+IPQL+AY   FPIQ+FLQSQSK++VM  +S VAL  H L +W+F+ K
Sbjct  169  HISDLAGKYSMWVIPQLYAYALNFPIQKFLQSQSKVWVMTIISLVALALHCLLNWVFLPK  228

Query  351  LRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKGFSQRAFQNLTGFVRLSLASGVM  172
            L++GL G A+  N +WWF+ VAQ +YVV G   + W GFS  AF++L GFV+LSLAS +M
Sbjct  229  LQYGLLGAAIAGNISWWFLVVAQVIYVVGGFFPETWTGFSMLAFKSLAGFVKLSLASAIM  288

Query  171  FCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGWTLMVGVGFSAAIS  22
             CLELWY+ A+IL+ G  KN E++VD  SICMNI  W LM+ +GF+A++S
Sbjct  289  LCLELWYYTAVILLVGTLKNPEIAVDAISICMNIQMWALMIALGFNASVS  338



>ref|XP_002519100.1| multidrug resistance pump, putative [Ricinus communis]
 gb|EEF43311.1| multidrug resistance pump, putative [Ricinus communis]
Length=496

 Score =   339 bits (869),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 157/302 (52%), Positives = 223/302 (74%), Gaps = 0/302 (0%)
 Frame = -1

Query  927  DIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHVGNIQLAAVAV  748
             + +  + ++ ++  + ESK++W +AAPA+ T  +Q+SIG +T  + GH+G ++LAAV++
Sbjct  19   QVTEPMRKEKMVKRSWDESKRMWEIAAPAMITAVTQFSIGFVTSAYVGHLGEVELAAVSI  78

Query  747  ENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNATAIPLTTLYIF  568
              N+I GF +G+M GMGSALETLCGQA GA +L MLGVY+Q+SWII    A+ L   YIF
Sbjct  79   VQNVIEGFVYGVMLGMGSALETLCGQAVGAGQLNMLGVYMQKSWIITGVAALFLAPFYIF  138

Query  567  STPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYVMASVSDVALV  388
            ++P+L+LLHQ+  IS+  G +++W++PQLFA+   FPIQ+FLQ+QS+++VM  +S +AL 
Sbjct  139  ASPLLQLLHQDKDISELAGKYSIWVLPQLFAFAINFPIQKFLQAQSRVWVMTIISVIALA  198

Query  387  GHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKGFSQRAFQNLT  208
             HVL +WL + KL  GL G A+  N +W  + +AQ VYVVSG   +AW GFS  AF++L 
Sbjct  199  FHVLLNWLLVTKLDHGLLGAAIAGNISWLVIVLAQIVYVVSGFFPEAWTGFSCSAFKSLA  258

Query  207  GFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGWTLMVGVGFSAA  28
            GFV+LSLAS VM CLELWYF A+IL+ G+ KN E++VD  SICMN+  WTLM+ +GF+AA
Sbjct  259  GFVKLSLASAVMLCLELWYFTAVILMVGWLKNPEIAVDAISICMNLQLWTLMIALGFNAA  318

Query  27   IS  22
            IS
Sbjct  319  IS  320



>ref|XP_004974154.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Setaria italica]
Length=508

 Score =   339 bits (869),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 163/302 (54%), Positives = 216/302 (72%), Gaps = 0/302 (0%)
 Frame = -1

Query  927  DIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHVGNIQLAAVAV  748
            D+ +I+ V+ F+R    E+++LW LA PAIFT  +QYS+GAIT VFAGH+  ++L A++ 
Sbjct  37   DLEEIRSVRAFLRHAAEENRRLWSLAGPAIFTSIAQYSMGAITLVFAGHLSTLELDAIST  96

Query  747  ENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNATAIPLTTLYIF  568
            ENN+IAG A G+  GMGSALETLCGQA+GAK+L MLGVYLQRSWIILNA A+ +  LY+F
Sbjct  97   ENNVIAGLALGLTMGMGSALETLCGQAYGAKQLHMLGVYLQRSWIILNALAVLMLPLYLF  156

Query  567  STPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYVMASVSDVALV  388
            + P+L+  HQ+  I+     FA++MIPQLFAY   FPIQ++LQ+Q K+  MA VS VALV
Sbjct  157  AAPVLRFFHQDAEIAALASRFALYMIPQLFAYACNFPIQKYLQAQGKVMAMAVVSAVALV  216

Query  387  GHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKGFSQRAFQNLT  208
             HV  SWL +  +  G+ G AV LN +WWF+ + Q  Y++ G C  AW GF   AF +L 
Sbjct  217  FHVALSWLLVGPMGMGVVGLAVALNASWWFVVLGQLAYILMGYCPGAWNGFDWLAFSDLY  276

Query  207  GFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGWTLMVGVGFSAA  28
            GF RLS+ S VM CLE W+++ LI+I G  +NA+V+V   SIC N+ GW +MV  GF+AA
Sbjct  277  GFARLSVGSAVMTCLEFWFYMFLIVIVGNLENAQVAVAAVSICTNLFGWQIMVFFGFNAA  336

Query  27   IS  22
            IS
Sbjct  337  IS  338



>gb|AAL06936.1| AT5g38030/F16F17_30 [Arabidopsis thaliana]
Length=292

 Score =   330 bits (847),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 163/255 (64%), Positives = 193/255 (76%), Gaps = 0/255 (0%)
 Frame = -1

Query  927  DIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHVGNIQLAAVAV  748
            DI  I  V  F++EF  E KKLWYLA PAIF   +QYS+GA TQVFAGH+  I LAAV+V
Sbjct  28   DIPPITTVGGFVKEFNVEVKKLWYLAGPAIFMSITQYSLGAATQVFAGHISTIALAAVSV  87

Query  747  ENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNATAIPLTTLYIF  568
            EN++IAGF+FG+M GMGSALETLCGQAFGA KL MLGVYLQRSW+ILN TA+ L+ LYIF
Sbjct  88   ENSVIAGFSFGVMLGMGSALETLCGQAFGAGKLSMLGVYLQRSWVILNVTAVILSLLYIF  147

Query  567  STPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYVMASVSDVALV  388
            + PIL  + Q P IS A G F+++MIPQ+FAY   +P  +FLQSQSKI VMA++S VALV
Sbjct  148  AAPILAFIGQTPAISSATGIFSIYMIPQIFAYAVNYPTAKFLQSQSKIMVMAAISAVALV  207

Query  387  GHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKGFSQRAFQNLT  208
             HVL +W  +  L+WG  G AVVLN +WWF+ VAQ VY+ SG CG+AW GFS  AF NL 
Sbjct  208  LHVLLTWFVIEGLQWGTAGLAVVLNASWWFIVVAQLVYIFSGTCGEAWSGFSWEAFHNLW  267

Query  207  GFVRLSLASGVMFCL  163
             FVRLSLAS VM  L
Sbjct  268  SFVRLSLASAVMLWL  282



>ref|XP_010927288.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Elaeis guineensis]
 ref|XP_010927289.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Elaeis guineensis]
Length=493

 Score =   337 bits (863),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 157/290 (54%), Positives = 210/290 (72%), Gaps = 0/290 (0%)
 Frame = -1

Query  891  REFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHVGNIQLAAVAVENNLIAGFAFGI  712
             + + E K LWY+A PAI T   Q+S+G++TQ   GH+G I+LAAV ++N +IAG  FG+
Sbjct  33   EDTWREMKLLWYIAGPAILTSVFQFSLGSVTQTLVGHIGTIELAAVGIQNLVIAGIGFGV  92

Query  711  MYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNATAIPLTTLYIFSTPILKLLHQNP  532
            M GMGSALET+CGQA+GA K+ MLG+YLQRSW+IL +TA+ L+  Y+F+TPILKLL Q+ 
Sbjct  93   MLGMGSALETVCGQAYGAGKMSMLGIYLQRSWVILLSTAMLLSMTYVFATPILKLLGQSD  152

Query  531  HISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYVMASVSDVALVGHVLFSWLFMLK  352
             I++  G F++WMIP+LFA+   FPIQ+FLQ+QSK+  MA +S   LV HV+ SWLF++K
Sbjct  153  EIAELAGRFSIWMIPELFAFAVDFPIQKFLQAQSKVMAMAWISAAVLVIHVILSWLFIIK  212

Query  351  LRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKGFSQRAFQNLTGFVRLSLASGVM  172
            L  GL G A+ LN  W+ + V Q VYV+SG+C D+W GFS  AF  L  F+ LSLAS VM
Sbjct  213  LEMGLVGAAITLNFAWFLLDVGQLVYVLSGSCKDSWTGFSWLAFTELVDFLGLSLASAVM  272

Query  171  FCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGWTLMVGVGFSAAIS  22
             CLE W  + L+L+AG   N E++VD  SICMN+ GW  M+ +GF  A+S
Sbjct  273  LCLEYWTLMVLVLLAGLLPNPEIAVDAASICMNVEGWCFMIPLGFVTAVS  322



>gb|AES59561.2| MATE efflux family protein [Medicago truncatula]
Length=487

 Score =   336 bits (861),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 161/300 (54%), Positives = 211/300 (70%), Gaps = 0/300 (0%)
 Frame = -1

Query  921  RQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHVGNIQLAAVAVEN  742
             + +K  + + +   ESKKLW +A P I T  SQYS+GA T  F GHV  + LAA +VEN
Sbjct  21   HEEEKPLKIVHKIGVESKKLWKIAGPTILTSLSQYSLGAFTSTFVGHVNELDLAAFSVEN  80

Query  741  NLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNATAIPLTTLYIFST  562
            ++IAGFAFG + GMGSALETLCGQAFGA  + M+G+Y+QRSWIIL AT + L   YI++T
Sbjct  81   SVIAGFAFGFLLGMGSALETLCGQAFGAGHIRMMGIYMQRSWIILVATGLLLLPFYIWAT  140

Query  561  PILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYVMASVSDVALVGH  382
            P+LKL+ Q   I++A GTFA+WMIPQ+FAY   FPIQ+FLQ+Q K+ VM  +S   LV H
Sbjct  141  PLLKLVGQTDEIAEAAGTFALWMIPQIFAYALNFPIQKFLQAQRKVLVMLWISLGVLVLH  200

Query  381  VLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKGFSQRAFQNLTGF  202
            V  SWL +LKL WGL G A++LNT+WW + + Q +Y+       AW GFS  AF +L  F
Sbjct  201  VPLSWLLILKLNWGLVGAAIILNTSWWLIVIGQLLYIFITKSDGAWSGFSWLAFADLFNF  260

Query  201  VRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGWTLMVGVGFSAAIS  22
            ++LSLAS VM CLE WY + L++I G+  N  V +D  SICMNI+GW +M+ +GF+ AIS
Sbjct  261  LKLSLASAVMLCLEFWYLMILVVITGHLANPLVPLDAVSICMNINGWDMMIALGFNVAIS  320



>ref|XP_010927461.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Elaeis guineensis]
Length=491

 Score =   336 bits (861),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 158/290 (54%), Positives = 211/290 (73%), Gaps = 0/290 (0%)
 Frame = -1

Query  891  REFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHVGNIQLAAVAVENNLIAGFAFGI  712
             + + E + +WY+A PAI T   Q+S+G++TQ   GHVG ++LAAV +EN +I G  FG+
Sbjct  31   EDTWRELRLVWYIAGPAILTSLFQFSLGSVTQTLIGHVGTLELAAVGIENLVITGIGFGV  90

Query  711  MYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNATAIPLTTLYIFSTPILKLLHQNP  532
            M GMGSALETLCGQA+GA K+ MLG+YLQRSW+IL ATA+ L+  ++F+TPILKLL Q+ 
Sbjct  91   MLGMGSALETLCGQAYGAGKMSMLGIYLQRSWVILLATAVILSMTHVFATPILKLLGQSD  150

Query  531  HISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYVMASVSDVALVGHVLFSWLFMLK  352
             I++  G F++WMIP+LFA+   FPIQ+FLQ+QSK+  MA +S   LV HV+ SWLF++K
Sbjct  151  EIAELAGRFSIWMIPELFAFAVNFPIQKFLQAQSKVMAMAWISAAVLVIHVILSWLFIVK  210

Query  351  LRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKGFSQRAFQNLTGFVRLSLASGVM  172
            L  GL G A+ LN  W+ + V Q VYV+SG+C D+W GFS  AF  L  F+ LSLAS VM
Sbjct  211  LEMGLVGAAITLNFAWFLLDVGQLVYVLSGSCRDSWTGFSWLAFTELVDFLGLSLASAVM  270

Query  171  FCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGWTLMVGVGFSAAIS  22
             CLE W  + L+++AG  KN EV+VD  SICMN+ GW  M+ +GF AA+S
Sbjct  271  LCLEYWTVMVLVILAGLLKNPEVAVDAASICMNVEGWCFMIPLGFVAAVS  320



>ref|XP_006856152.1| hypothetical protein AMTR_s00059p00169820 [Amborella trichopoda]
 gb|ERN17619.1| hypothetical protein AMTR_s00059p00169820 [Amborella trichopoda]
Length=485

 Score =   336 bits (861),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 163/314 (52%), Positives = 221/314 (70%), Gaps = 0/314 (0%)
 Frame = -1

Query  963  MSSVYSFDADAGDIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAG  784
            M  V+  +   G       +K   R+   ESK  WY+A PAI     Q+SI  +T VF G
Sbjct  1    MGEVHVSNPGVGFEGPCVGLKNLGRKSLEESKVTWYIAGPAILATVFQFSISIVTVVFVG  60

Query  783  HVGNIQLAAVAVENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILN  604
             +G+ +LAAV++  N+I GFAFG+M GMGSALETLCGQA GA +  MLG+Y+QRSWII  
Sbjct  61   RLGSTELAAVSIVQNVIEGFAFGVMLGMGSALETLCGQAVGAGQFHMLGIYMQRSWIITC  120

Query  603  ATAIPLTTLYIFSTPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKI  424
             TA+ L+ LY+FS+PILKL HQ+  I++  G +++W+IPQLFAY   FP+Q+FLQSQSK+
Sbjct  121  VTAMVLSPLYVFSSPILKLFHQSDEIAQMSGKYSIWVIPQLFAYAINFPLQKFLQSQSKV  180

Query  423  YVMASVSDVALVGHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAW  244
             V+ ++S V L+ HVL +W+F+ KL +GL G AVV N +WW + +AQ +Y+VSG   ++W
Sbjct  181  MVLTAISGVTLMVHVLLNWVFVTKLNYGLTGAAVVGNISWWIINLAQIIYLVSGFFPESW  240

Query  243  KGFSQRAFQNLTGFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNISG  64
             G S  AF +L  FV+LSLAS +M CLELWYF A+IL+ G   NAE+++D  SICMN+  
Sbjct  241  TGLSWLAFHSLFAFVKLSLASAIMLCLELWYFTAIILLVGGLHNAEIAIDAISICMNLEL  300

Query  63   WTLMVGVGFSAAIS  22
            WTLMV +GF+AA+S
Sbjct  301  WTLMVALGFNAAVS  314



>ref|NP_001062445.1| Os08g0550200 [Oryza sativa Japonica Group]
 dbj|BAD08960.1| putative ripening regulated protein DDTFR18 [Oryza sativa Japonica 
Group]
 dbj|BAF24359.1| Os08g0550200 [Oryza sativa Japonica Group]
 gb|EAZ43576.1| hypothetical protein OsJ_28198 [Oryza sativa Japonica Group]
 dbj|BAG91849.1| unnamed protein product [Oryza sativa Japonica Group]
Length=522

 Score =   336 bits (862),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 165/302 (55%), Positives = 217/302 (72%), Gaps = 0/302 (0%)
 Frame = -1

Query  927  DIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHVGNIQLAAVAV  748
            D+ +I+ V E +R    E+++LWYLA PAIFT  +QYS+GA+TQVFAGH+  ++L AV+ 
Sbjct  50   DLEEIRSVGELMRLAAEENRRLWYLAGPAIFTSLAQYSLGAVTQVFAGHLTTLELDAVST  109

Query  747  ENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNATAIPLTTLYIF  568
            EN +IAG AFGIMYGMGSALETLCGQAFGAK+  MLG+YLQRSW+IL A ++ L  +Y+F
Sbjct  110  ENMVIAGLAFGIMYGMGSALETLCGQAFGAKQHHMLGIYLQRSWVILTAMSVILLPIYLF  169

Query  567  STPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYVMASVSDVALV  388
            +TPIL+  HQ+  I+     F+++MIPQLFAY   FPIQ+FLQ+QSK+  MA+VS   L+
Sbjct  170  ATPILRFFHQDDEIAVLASRFSLYMIPQLFAYALNFPIQKFLQAQSKVMAMAAVSAAVLL  229

Query  387  GHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKGFSQRAFQNLT  208
             HV  +WL ++ LR GL G AV LN +WW + + Q  Y+V G C  AW GF   AF +L 
Sbjct  230  FHVALTWLLLVPLRMGLVGLAVALNVSWWLVVLGQLAYIVMGYCPGAWNGFDWLAFTDLL  289

Query  207  GFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGWTLMVGVGFSAA  28
             F RLSL S +M CLE W+++ LI+I G   NA+V+V   SIC N+ GW +MV  GF+AA
Sbjct  290  SFARLSLGSAIMICLEFWFYMFLIVIVGNLPNAQVAVAAVSICTNLFGWQIMVFFGFNAA  349

Query  27   IS  22
            IS
Sbjct  350  IS  351



>emb|CDO97090.1| unnamed protein product [Coffea canephora]
Length=487

 Score =   334 bits (856),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 159/303 (52%), Positives = 221/303 (73%), Gaps = 3/303 (1%)
 Frame = -1

Query  921  RQIKKV---KEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHVGNIQLAAVA  751
            RQ+ ++   ++   + + E+KK W +A PAI T  +Q+S+  +T  FAGH+G+ +LAAV+
Sbjct  10   RQVTEILHKRKTPEKLWKETKKTWDIALPAIITAVTQFSLELVTSAFAGHLGDAELAAVS  69

Query  750  VENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNATAIPLTTLYI  571
            V  N+I GF +G+M GMGSALETLCGQA GA ++ MLG+YLQRSWII   TA+ LT +Y+
Sbjct  70   VVQNVIDGFVYGVMLGMGSALETLCGQAVGAGQVGMLGIYLQRSWIITIVTALFLTPIYV  129

Query  570  FSTPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYVMASVSDVAL  391
            F++PILKLLHQN  IS   G FA+W+IPQLFAY   FP+Q+F QSQSK+++M  +S  +L
Sbjct  130  FASPILKLLHQNRDISNLAGKFALWVIPQLFAYALNFPVQKFFQSQSKVWMMTMLSIASL  189

Query  390  VGHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKGFSQRAFQNL  211
              HVL +W+ + KL  GL G A+  N TW+ + ++Q +Y +SG   DAW GFS  AF++L
Sbjct  190  ALHVLLNWVLVTKLGHGLLGAAMAGNITWFLLDISQIIYAISGCFPDAWNGFSWLAFKSL  249

Query  210  TGFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGWTLMVGVGFSA  31
            T FV+LSLAS +M CLELWYF A+IL+ G  K+A V++D  SICMN+  WT+M+ VGF+A
Sbjct  250  TNFVKLSLASAIMLCLELWYFTAVILMVGGLKDAAVAIDAISICMNLQLWTMMIAVGFNA  309

Query  30   AIS  22
            ++S
Sbjct  310  SVS  312



>emb|CDP13217.1| unnamed protein product [Coffea canephora]
Length=525

 Score =   334 bits (857),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 168/290 (58%), Positives = 219/290 (76%), Gaps = 0/290 (0%)
 Frame = -1

Query  873  SKKLWYLAAPAIFTIASQYSIGAITQVFAGHVGNIQLAAVAVENNLIAGFAFGIMYGMGS  694
            S+KLWYLA P+IFT   QY IGA+TQ+FAG +G IQLAA+AVEN +IA F +GI+ GMGS
Sbjct  29   SEKLWYLAGPSIFTSICQYGIGALTQIFAGQLGTIQLAAIAVENCVIAAFGYGILMGMGS  88

Query  693  ALETLCGQAFGAKKLEMLGVYLQRSWIILNATAIPLTTLYIFSTPILKLLHQNPHISKAV  514
            ALETLCGQA+GA +  MLG+Y+QRSW+ILN  A+ +  L+IF+TPILKL  QN  I+K  
Sbjct  89   ALETLCGQAYGANRHNMLGIYMQRSWVILNTLALWILPLFIFATPILKLFGQNASIAKEG  148

Query  513  GTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYVMASVSDVALVGHVLFSWLFMLKLRWGLP  334
            G FA+WMIPQ FAY  T P+ +FLQ+QSK+  MA +S +A+  H    WL M+KLR GL 
Sbjct  149  GKFALWMIPQQFAYAITIPLAKFLQAQSKVMEMAVISAIAVCLHAFLGWLVMMKLRLGLL  208

Query  333  GGAVVLNTTWWFMAVAQFVYVVSGACGDAWKGFSQRAFQNLTGFVRLSLASGVMFCLELW  154
            G A++LN +WWF+ + QF+YV+SG CG +W GFS +A +NL+GF +LS++S VM  LE+W
Sbjct  209  GAALMLNASWWFITIGQFLYVMSGNCGRSWSGFSWKALRNLSGFAKLSVSSAVMLSLEVW  268

Query  153  YFVALILIAGYTKNAEVSVDGTSICMNISGWTLMVGVGFSAAISNNLFRR  4
              +AL L AGY  NAE+SVD  SICMNI GW+ MVG+GF+ AIS  + ++
Sbjct  269  CIMALTLAAGYLPNAEISVDALSICMNIIGWSGMVGLGFNVAISVTVSKK  318



>ref|XP_011088336.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Sesamum 
indicum]
Length=512

 Score =   332 bits (852),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 159/287 (55%), Positives = 214/287 (75%), Gaps = 0/287 (0%)
 Frame = -1

Query  882  YSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHVGNIQLAAVAVENNLIAGFAFGIMYG  703
            + ESKK+W +AAPAI T  +Q+SIG +T  F GH+G ++LAAV+V  N++ GF FGIM G
Sbjct  39   WDESKKMWEIAAPAILTAVAQFSIGFVTIAFVGHLGEVELAAVSVVQNVLEGFVFGIMLG  98

Query  702  MGSALETLCGQAFGAKKLEMLGVYLQRSWIILNATAIPLTTLYIFSTPILKLLHQNPHIS  523
            MGSALETLCGQA GA + EMLGVYLQRS+II   TA+ L  LYIF++PIL LL Q+  IS
Sbjct  99   MGSALETLCGQAVGAGQDEMLGVYLQRSFIITTVTALLLLPLYIFTSPILTLLRQDKKIS  158

Query  522  KAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYVMASVSDVALVGHVLFSWLFMLKLRW  343
            +    +A+W+IPQLFAY   FP+Q+FLQ+QS+I+VM ++S V L  HVL +W+ ++KL  
Sbjct  159  ELAAKYALWVIPQLFAYALNFPVQKFLQAQSRIWVMTTISIVVLGFHVLLNWIVVIKLEK  218

Query  342  GLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKGFSQRAFQNLTGFVRLSLASGVMFCL  163
            GL G A+  N +WW + +AQ  YVVSG   ++W GFS  AF++L  FV+LSL+S +M CL
Sbjct  219  GLLGAAIAENVSWWIVVLAQLAYVVSGCFPESWTGFSLLAFKSLASFVKLSLSSALMLCL  278

Query  162  ELWYFVALILIAGYTKNAEVSVDGTSICMNISGWTLMVGVGFSAAIS  22
            ELWY+  +IL+ G+ K+ E++VD  SICMN+  WTLM+ +GF+AAIS
Sbjct  279  ELWYYTIVILMVGWLKHPEIAVDAISICMNLELWTLMITLGFNAAIS  325



>ref|XP_006852302.1| hypothetical protein AMTR_s00049p00190590 [Amborella trichopoda]
 gb|ERN13769.1| hypothetical protein AMTR_s00049p00190590 [Amborella trichopoda]
Length=279

 Score =   324 bits (831),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 155/259 (60%), Positives = 200/259 (77%), Gaps = 0/259 (0%)
 Frame = -1

Query  948  SFDADAGDIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHVGNI  769
            SF    GDI   + + EF REF  ESKKLWYLA PAIFT   QYS+GAITQ FAGH+G +
Sbjct  19   SFVEFEGDIEPTRSLGEFSREFAVESKKLWYLAGPAIFTSICQYSLGAITQAFAGHLGTL  78

Query  768  QLAAVAVENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNATAIP  589
            +LAAV++EN++IAGF+FG++ GMGSALETLCGQA+GA +L+MLG+Y+QRSW+IL  TA+ 
Sbjct  79   ELAAVSMENSVIAGFSFGLLLGMGSALETLCGQAYGAGQLDMLGIYMQRSWVILITTALI  138

Query  588  LTTLYIFSTPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYVMAS  409
            L+  Y+F+TP L L+ Q+  I+ A G F+++MIPQLFAY   FPIQ+FLQ+QS++  MA 
Sbjct  139  LSIFYVFATPFLILIGQDHRIAAAAGLFSLYMIPQLFAYAVYFPIQKFLQAQSRMMSMAV  198

Query  408  VSDVALVGHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKGFSQ  229
            ++ +AL+ H  FSWL M+KL WG+ G AVVLN +WWF+ VAQ VY+  G+CG AW GFS 
Sbjct  199  IASIALLLHTFFSWLVMIKLNWGMVGAAVVLNGSWWFIVVAQLVYIFCGSCGRAWSGFSW  258

Query  228  RAFQNLTGFVRLSLASGVM  172
             AF+NL GFVRLS+ S VM
Sbjct  259  MAFRNLWGFVRLSVESAVM  277



>gb|EPS63161.1| hypothetical protein M569_11626, partial [Genlisea aurea]
Length=453

 Score =   330 bits (847),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 158/290 (54%), Positives = 214/290 (74%), Gaps = 0/290 (0%)
 Frame = -1

Query  891  REFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHVGNIQLAAVAVENNLIAGFAFGI  712
            R+ + ES+ +W +A PAI T  +Q+S+  +T  F GH+G  +LAAV+V  N++ GF +GI
Sbjct  5    RKLWQESRNMWNIAFPAIITSVAQFSVAFVTAAFVGHIGGAELAAVSVVQNVLEGFVYGI  64

Query  711  MYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNATAIPLTTLYIFSTPILKLLHQNP  532
            M G+GSALETLCGQA GA + +MLG+Y+QRS II  ATAI L+ LYIF++PILKLL Q+P
Sbjct  65   MLGLGSALETLCGQAVGAGEYKMLGIYMQRSCIITTATAIALSPLYIFTSPILKLLRQSP  124

Query  531  HISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYVMASVSDVALVGHVLFSWLFMLK  352
             IS   G +A+W+IPQLFAY F FPIQ+FLQ+QSK++V+  VS   L  HVLF+W+ ++K
Sbjct  125  DISDLSGKYALWIIPQLFAYAFNFPIQKFLQAQSKVWVVTFVSVAVLGFHVLFTWIVVVK  184

Query  351  LRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKGFSQRAFQNLTGFVRLSLASGVM  172
            L  GL G A+V N +WW M +AQ VYVV G   ++W GFS  AF+ L GF++LS+ S VM
Sbjct  185  LEKGLLGAAMVENLSWWIMVLAQMVYVVCGFFPESWNGFSMSAFECLKGFIKLSMESAVM  244

Query  171  FCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGWTLMVGVGFSAAIS  22
             CLE+W+   +IL+ G+ KN E++VD  SICMNI  WTLM+ +GF+AA+S
Sbjct  245  LCLEIWFPSVVILMVGWLKNPEIAVDAVSICMNIELWTLMIALGFNAAVS  294



>ref|XP_010250481.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Nelumbo 
nucifera]
Length=484

 Score =   330 bits (847),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 166/292 (57%), Positives = 209/292 (72%), Gaps = 0/292 (0%)
 Frame = -1

Query  897  FIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHVGNIQLAAVAVENNLIAGFAF  718
             +R    ESKKLW +A PAIFT+  QYS+GAITQ F GHVG ++LAA +V N+++AGF +
Sbjct  25   LLRRVSVESKKLWKIAGPAIFTMICQYSLGAITQAFIGHVGTLELAAFSVANSVVAGFGY  84

Query  717  GIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNATAIPLTTLYIFSTPILKLLHQ  538
            G+M GMGSALETLCGQAFGA K  MLG+Y+QRSW+IL  TA+ L  +Y+FS PIL L+ Q
Sbjct  85   GLMLGMGSALETLCGQAFGAGKFTMLGIYMQRSWLILLCTALLLVPIYVFSAPILILMGQ  144

Query  537  NPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYVMASVSDVALVGHVLFSWLFM  358
               I+ A G FA WM+PQLFAY   FPIQ+FLQ+Q K+ VMA V+ + LV HVL SWL +
Sbjct  145  TVEIADAAGRFATWMLPQLFAYALNFPIQKFLQAQRKVMVMACVAAIVLVVHVLISWLVI  204

Query  357  LKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKGFSQRAFQNLTGFVRLSLASG  178
             KL WGL G AV LN +WW     Q +Y+     G AW GFS +AF +L GF++LSLAS 
Sbjct  205  FKLGWGLIGAAVSLNFSWWINIFGQSMYIFISKSGGAWTGFSLQAFADLWGFIKLSLASA  264

Query  177  VMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGWTLMVGVGFSAAIS  22
            VM CL+ WY + +I I G+  N  V VD  SICM+I+GW  M+G+GF+AAIS
Sbjct  265  VMLCLQFWYLMIIITITGHLTNPLVPVDALSICMSINGWDAMIGLGFNAAIS  316



>ref|XP_010250482.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Nelumbo 
nucifera]
Length=482

 Score =   330 bits (846),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 166/292 (57%), Positives = 209/292 (72%), Gaps = 0/292 (0%)
 Frame = -1

Query  897  FIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHVGNIQLAAVAVENNLIAGFAF  718
             +R    ESKKLW +A PAIFT+  QYS+GAITQ F GHVG ++LAA +V N+++AGF +
Sbjct  25   LLRRVSVESKKLWKIAGPAIFTMICQYSLGAITQAFIGHVGTLELAAFSVANSVVAGFGY  84

Query  717  GIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNATAIPLTTLYIFSTPILKLLHQ  538
            G+M GMGSALETLCGQAFGA K  MLG+Y+QRSW+IL  TA+ L  +Y+FS PIL L+ Q
Sbjct  85   GLMLGMGSALETLCGQAFGAGKFTMLGIYMQRSWLILLCTALLLVPIYVFSAPILILMGQ  144

Query  537  NPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYVMASVSDVALVGHVLFSWLFM  358
               I+ A G FA WM+PQLFAY   FPIQ+FLQ+Q K+ VMA V+ + LV HVL SWL +
Sbjct  145  TVEIADAAGRFATWMLPQLFAYALNFPIQKFLQAQRKVMVMACVAAIVLVVHVLISWLVI  204

Query  357  LKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKGFSQRAFQNLTGFVRLSLASG  178
             KL WGL G AV LN +WW     Q +Y+     G AW GFS +AF +L GF++LSLAS 
Sbjct  205  FKLGWGLIGAAVSLNFSWWINIFGQSMYIFISKSGGAWTGFSLQAFADLWGFIKLSLASA  264

Query  177  VMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGWTLMVGVGFSAAIS  22
            VM CL+ WY + +I I G+  N  V VD  SICM+I+GW  M+G+GF+AAIS
Sbjct  265  VMLCLQFWYLMIIITITGHLTNPLVPVDALSICMSINGWDAMIGLGFNAAIS  316



>gb|EYU37755.1| hypothetical protein MIMGU_mgv1a025801mg, partial [Erythranthe 
guttata]
Length=445

 Score =   328 bits (840),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 158/287 (55%), Positives = 212/287 (74%), Gaps = 0/287 (0%)
 Frame = -1

Query  882  YSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHVGNIQLAAVAVENNLIAGFAFGIMYG  703
            + ESKKLW +A PAI TI +Q+SIG +T  F GH+G ++LAAV+V  N++ GF FGIM G
Sbjct  11   WEESKKLWEIALPAILTIVTQFSIGFVTVAFVGHLGEVELAAVSVVQNVLEGFVFGIMLG  70

Query  702  MGSALETLCGQAFGAKKLEMLGVYLQRSWIILNATAIPLTTLYIFSTPILKLLHQNPHIS  523
            MGSALETLCGQA GA + +MLG+Y QRS +I  AT++ L  LYIF+TPIL LL Q+  IS
Sbjct  71   MGSALETLCGQAVGAGQYDMLGIYTQRSCVITLATSLLLLPLYIFTTPILNLLRQDKKIS  130

Query  522  KAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYVMASVSDVALVGHVLFSWLFMLKLRW  343
            +  G +A+W++PQLFAY   FP+Q+FLQ+QSKI+VM S+S   L  HVL +W+ ++K   
Sbjct  131  EMAGKYALWVVPQLFAYALNFPVQKFLQAQSKIWVMTSISIFVLGFHVLLNWILVVKFEK  190

Query  342  GLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKGFSQRAFQNLTGFVRLSLASGVMFCL  163
            GL G A+  N +WW + + Q +YVVSG   ++W GFS  AF++L  FV+LSLAS +M CL
Sbjct  191  GLLGAAIAENISWWLVVIGQIIYVVSGFFPESWTGFSLLAFKSLYSFVKLSLASAIMLCL  250

Query  162  ELWYFVALILIAGYTKNAEVSVDGTSICMNISGWTLMVGVGFSAAIS  22
            ELWY+  +IL+ G+ KN E++VD  SICMN+  WTLM+ +GF+AAIS
Sbjct  251  ELWYYTLVILMVGWLKNPEIAVDAISICMNLELWTLMIALGFNAAIS  297



>emb|CDP07803.1| unnamed protein product [Coffea canephora]
Length=529

 Score =   329 bits (843),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 158/292 (54%), Positives = 207/292 (71%), Gaps = 0/292 (0%)
 Frame = -1

Query  897  FIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHVGNIQLAAVAVENNLIAGFAF  718
            F REFY E KKLW LA P IF     Y +G  TQ+FAGH+G IQLAA++VEN++IA F +
Sbjct  50   FSREFYIELKKLWSLAGPFIFASVCLYGLGCFTQIFAGHLGTIQLAAISVENSVIADFGY  109

Query  717  GIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNATAIPLTTLYIFSTPILKLLHQ  538
             I+ G   AL+TLCGQA+GAK+ +MLG+Y+Q+SW IL +  +   +L+IF+TP+LK L Q
Sbjct  110  SILAGTAGALDTLCGQAYGAKQYDMLGIYMQKSWFILTSATLGNLSLFIFATPVLKFLGQ  169

Query  537  NPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYVMASVSDVALVGHVLFSWLFM  358
               IS   G FA+WMIPQ FAY    P  +FLQ+QSK+  MA ++ VAL  H    W  +
Sbjct  170  TATISTEAGRFALWMIPQQFAYALMIPTTKFLQAQSKVKEMALIAAVALSLHAFLGWFLI  229

Query  357  LKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKGFSQRAFQNLTGFVRLSLASG  178
            LK+ WGLPG A++LN++WWF+AVAQF+Y++SG+CG  W GFS +A  NL+GF++LS+ S 
Sbjct  230  LKIGWGLPGAALMLNSSWWFVAVAQFLYIISGSCGQTWPGFSWKALTNLSGFLKLSVLSA  289

Query  177  VMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGWTLMVGVGFSAAIS  22
            +M CL  W  +A+ L+AGY KNAEVSV   SIC NI G    VG GFSAA+S
Sbjct  290  LMQCLSTWNGMAVTLLAGYLKNAEVSVAALSICFNILGIATTVGTGFSAAVS  341



>ref|XP_008654862.1| PREDICTED: uncharacterized protein LOC100280263 isoform X1 [Zea 
mays]
Length=502

 Score =   328 bits (840),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 152/290 (52%), Positives = 210/290 (72%), Gaps = 0/290 (0%)
 Frame = -1

Query  891  REFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHVGNIQLAAVAVENNLIAGFAFGI  712
            +++  E + LW +A P I T   Q+ +G +T  F GH+G ++LAAV++ N ++ G AFG+
Sbjct  35   KKWSDECRNLWRVAGPVILTGIFQFLLGFVTTAFVGHIGKVELAAVSIVNGVVEGLAFGL  94

Query  711  MYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNATAIPLTTLYIFSTPILKLLHQNP  532
            + GMGSALETLCGQA GA +L+MLGVY+QRSWII  AT++ L  LY+F++P+L++L Q+ 
Sbjct  95   LLGMGSALETLCGQAVGAGQLQMLGVYMQRSWIICLATSLALLPLYVFTSPLLRMLRQSA  154

Query  531  HISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYVMASVSDVALVGHVLFSWLFMLK  352
             IS   G +A W +PQLFAY   FPIQ+F Q+QS+++ M ++S  AL  H L SWL + +
Sbjct  155  DISAVAGRYARWCVPQLFAYAVNFPIQKFYQAQSRVWAMTAISGAALAVHALLSWLVVAR  214

Query  351  LRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKGFSQRAFQNLTGFVRLSLASGVM  172
            L  GL G AVV + +WW + VAQFVY+V G+  DAW GFS++AF +L GFVRLS+AS VM
Sbjct  215  LGRGLAGAAVVGDVSWWLVNVAQFVYLVGGSFPDAWTGFSRKAFDSLGGFVRLSVASAVM  274

Query  171  FCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGWTLMVGVGFSAAIS  22
             CLE+WY+ A++++ G  KN E+ VD  SICMN   WTLMV VGF+AA+S
Sbjct  275  LCLEMWYYTAVLILVGCLKNPEIQVDAISICMNYQLWTLMVAVGFNAAVS  324



>ref|XP_008797000.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Phoenix dactylifera]
Length=472

 Score =   327 bits (837),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 152/293 (52%), Positives = 213/293 (73%), Gaps = 0/293 (0%)
 Frame = -1

Query  900  EFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHVGNIQLAAVAVENNLIAGFA  721
              + + + ESKK+W++  PAI T   Q+SIG +T  F GH+G+++LAAV++  ++I GFA
Sbjct  3    RLVAKSWDESKKMWHIGGPAILTGVLQFSIGFVTVAFVGHLGDVELAAVSIAQSVIEGFA  62

Query  720  FGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNATAIPLTTLYIFSTPILKLLH  541
            FG + GMGSALETLCGQA GA +L MLGVY+QRSW+I   TA+ L+ +Y+F++PILKLL 
Sbjct  63   FGFLLGMGSALETLCGQAVGAGQLHMLGVYMQRSWVITGVTALVLSPVYVFTSPILKLLR  122

Query  540  QNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYVMASVSDVALVGHVLFSWLF  361
            Q+  IS+  G + +W++PQL+AY   FP+Q+F QSQSK++VMA ++ V L  H L +W+F
Sbjct  123  QSNAISEVAGKYTIWILPQLYAYAMNFPLQKFFQSQSKVWVMAVIAGVVLGIHALLNWIF  182

Query  360  MLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKGFSQRAFQNLTGFVRLSLAS  181
            + K+  GL G A+V N +WW + + Q +Y+VSG   +AW GFS  AFQNL  FV+LSLAS
Sbjct  183  ITKMGHGLLGAAIVGNISWWLINLGQMIYLVSGFFPEAWNGFSMLAFQNLAAFVKLSLAS  242

Query  180  GVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGWTLMVGVGFSAAIS  22
             VM CLELWY+ A+I++ G  KN E++V   SICMN   WTLM+ +G +AA+S
Sbjct  243  AVMLCLELWYYTAVIILVGCLKNPEIAVGAISICMNYQLWTLMIALGLNAAVS  295



>ref|NP_001146663.1| uncharacterized protein LOC100280263 [Zea mays]
 gb|ACL54488.1| unknown [Zea mays]
Length=490

 Score =   327 bits (837),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 152/290 (52%), Positives = 210/290 (72%), Gaps = 0/290 (0%)
 Frame = -1

Query  891  REFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHVGNIQLAAVAVENNLIAGFAFGI  712
            +++  E + LW +A P I T   Q+ +G +T  F GH+G ++LAAV++ N ++ G AFG+
Sbjct  14   KKWSDECRNLWRVAGPVILTGIFQFLLGFVTTAFVGHIGKVELAAVSIVNGVVEGLAFGL  73

Query  711  MYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNATAIPLTTLYIFSTPILKLLHQNP  532
            + GMGSALETLCGQA GA +L+MLGVY+QRSWII  AT++ L  LY+F++P+L++L Q+ 
Sbjct  74   LLGMGSALETLCGQAVGAGQLQMLGVYMQRSWIICLATSLALLPLYVFTSPLLRMLRQSA  133

Query  531  HISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYVMASVSDVALVGHVLFSWLFMLK  352
             IS   G +A W +PQLFAY   FPIQ+F Q+QS+++ M ++S  AL  H L SWL + +
Sbjct  134  DISAVAGRYARWCVPQLFAYAVNFPIQKFYQAQSRVWAMTAISGAALAVHALLSWLVVAR  193

Query  351  LRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKGFSQRAFQNLTGFVRLSLASGVM  172
            L  GL G AVV + +WW + VAQFVY+V G+  DAW GFS++AF +L GFVRLS+AS VM
Sbjct  194  LGRGLAGAAVVGDVSWWLVNVAQFVYLVGGSFPDAWTGFSRKAFDSLGGFVRLSVASAVM  253

Query  171  FCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGWTLMVGVGFSAAIS  22
             CLE+WY+ A++++ G  KN E+ VD  SICMN   WTLMV VGF+AA+S
Sbjct  254  LCLEMWYYTAVLILVGCLKNPEIQVDAISICMNYQLWTLMVAVGFNAAVS  303



>ref|XP_009802671.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Nicotiana sylvestris]
Length=500

 Score =   327 bits (838),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 156/309 (50%), Positives = 223/309 (72%), Gaps = 5/309 (2%)
 Frame = -1

Query  948  SFDADAGDIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHVGNI  769
             F AD  D       K+  ++ ++ESKKLW +AAPAI T  SQ+SIG ++  F GH+G++
Sbjct  14   KFQADDCD-----DAKKMSKKSFNESKKLWEIAAPAIITAVSQFSIGFVSVAFVGHLGSL  68

Query  768  QLAAVAVENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNATAIP  589
            +LAA++V  N+I GF +G+M GMGSALETLCGQA GA++ +MLG+YLQRS +I   T++ 
Sbjct  69   ELAAISVVQNVIEGFVYGVMLGMGSALETLCGQAVGAERFDMLGIYLQRSCVITLVTSLF  128

Query  588  LTTLYIFSTPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYVMAS  409
            LT  Y+F++PILKLLHQ+  I++  G +A+W+IPQL+AY   FP+Q+FLQ+QSKI+VM  
Sbjct  129  LTPFYVFTSPILKLLHQDKRIAEIAGKYAIWVIPQLYAYALNFPVQKFLQAQSKIWVMTI  188

Query  408  VSDVALVGHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKGFSQ  229
            ++ V LV H++ +W+ + KL  GL G A+  N +WW + +AQ +YV+SG   ++W GFS 
Sbjct  189  INVVVLVFHIVLNWVLVTKLGHGLLGAAMAGNISWWLVVLAQNIYVISGFFPESWTGFSI  248

Query  228  RAFQNLTGFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGWTLMV  49
             AF++L  FV+LSLAS VM CLELWYF  +IL+ G+ KN E+ VD  S  +++  W LM+
Sbjct  249  LAFKSLWNFVKLSLASAVMLCLELWYFTVVILMVGWLKNPEIKVDAVSTSLDLQLWVLMI  308

Query  48   GVGFSAAIS  22
             +GF+AAIS
Sbjct  309  TLGFNAAIS  317



>ref|XP_009605026.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Nicotiana tomentosiformis]
Length=500

 Score =   327 bits (838),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 156/309 (50%), Positives = 223/309 (72%), Gaps = 5/309 (2%)
 Frame = -1

Query  948  SFDADAGDIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHVGNI  769
             F AD  D       K+  ++ ++ESKKLW +AAPAI T  SQ+SIG ++  F GH+G++
Sbjct  14   KFQADDCD-----DAKKMSKKSFNESKKLWEIAAPAIITAVSQFSIGFVSVAFVGHLGSL  68

Query  768  QLAAVAVENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNATAIP  589
            +LAA++V  N+I GF +G+M GMGSALETLCGQA GA++ +MLG+YLQRS +I   T++ 
Sbjct  69   ELAAISVVQNVIEGFVYGVMLGMGSALETLCGQAVGAERFDMLGIYLQRSCVITLVTSLF  128

Query  588  LTTLYIFSTPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYVMAS  409
            LT  Y+F++PILKLLHQ+  I++  G +A+W+IPQL+AY   FP+Q+FLQ+QSKI+VM  
Sbjct  129  LTPFYVFTSPILKLLHQDKRIAEIAGKYAIWVIPQLYAYALNFPVQKFLQAQSKIWVMTI  188

Query  408  VSDVALVGHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKGFSQ  229
            ++ V LV H++ +W+ + KL  GL G A+  N +WW + +AQ +YV+SG   ++W GFS 
Sbjct  189  INVVVLVFHIVLNWVLVTKLGHGLLGAAMAGNISWWLVVLAQNIYVISGFFPESWTGFSI  248

Query  228  RAFQNLTGFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGWTLMV  49
             AF++L  FV+LSLAS VM CLELWYF  +IL+ G+ KN E+ VD  S  +++  W LM+
Sbjct  249  LAFKSLWNFVKLSLASAVMLCLELWYFTVVILMVGWLKNPEIKVDAVSTSLDLQLWVLMI  308

Query  48   GVGFSAAIS  22
             +GF+AAIS
Sbjct  309  TLGFNAAIS  317



>ref|XP_008808887.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Phoenix dactylifera]
Length=467

 Score =   325 bits (834),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 148/293 (51%), Positives = 215/293 (73%), Gaps = 0/293 (0%)
 Frame = -1

Query  900  EFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHVGNIQLAAVAVENNLIAGFA  721
              + +F+ ESK++W +   AI T   Q+S+G +T  F GH+G+++LAAV++  N+I GFA
Sbjct  3    RLVAKFWDESKRMWQIGGAAILTGVLQFSLGFVTVAFVGHLGDVELAAVSIAQNVIEGFA  62

Query  720  FGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNATAIPLTTLYIFSTPILKLLH  541
            +GI+ GMGSALETLCGQA GA +L +LGVY+QRSW+I   TA+ L+ +Y+F++PILKL+ 
Sbjct  63   YGILLGMGSALETLCGQAVGAGQLHLLGVYMQRSWVISGVTAMVLSPVYVFTSPILKLVR  122

Query  540  QNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYVMASVSDVALVGHVLFSWLF  361
            Q+  IS+  G +A+W IPQL+AY   FP+Q+F QSQSK++VMA +S V L  HVL +W+ 
Sbjct  123  QSKDISEVAGKYAIWTIPQLYAYAMNFPLQKFFQSQSKVWVMALISGVVLGIHVLLNWIL  182

Query  360  MLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKGFSQRAFQNLTGFVRLSLAS  181
            ++K+  GL G A+ +N +WW + + Q +Y+VSG   +AW+GFS  AFQNL  F++LSLAS
Sbjct  183  VIKMGHGLLGAAIAVNISWWLINLGQMIYLVSGFFPEAWQGFSLSAFQNLAAFIKLSLAS  242

Query  180  GVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGWTLMVGVGFSAAIS  22
             +M CLELWY+ A+I++ G  +N +++V   SICMN   W LM+ +GFSAA+S
Sbjct  243  AIMLCLELWYYTAVIILVGCLRNPKIAVGAISICMNYQLWALMIALGFSAAVS  295



>gb|AFW84961.1| putative MATE efflux family protein [Zea mays]
Length=554

 Score =   327 bits (837),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 152/290 (52%), Positives = 210/290 (72%), Gaps = 0/290 (0%)
 Frame = -1

Query  891  REFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHVGNIQLAAVAVENNLIAGFAFGI  712
            +++  E + LW +A P I T   Q+ +G +T  F GH+G ++LAAV++ N ++ G AFG+
Sbjct  78   KKWSDECRNLWRVAGPVILTGIFQFLLGFVTTAFVGHIGKVELAAVSIVNGVVEGLAFGL  137

Query  711  MYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNATAIPLTTLYIFSTPILKLLHQNP  532
            + GMGSALETLCGQA GA +L+MLGVY+QRSWII  AT++ L  LY+F++P+L++L Q+ 
Sbjct  138  LLGMGSALETLCGQAVGAGQLQMLGVYMQRSWIICLATSLALLPLYVFTSPLLRMLRQSA  197

Query  531  HISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYVMASVSDVALVGHVLFSWLFMLK  352
             IS   G +A W +PQLFAY   FPIQ+F Q+QS+++ M ++S  AL  H L SWL + +
Sbjct  198  DISAVAGRYARWCVPQLFAYAVNFPIQKFYQAQSRVWAMTAISGAALAVHALLSWLVVAR  257

Query  351  LRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKGFSQRAFQNLTGFVRLSLASGVM  172
            L  GL G AVV + +WW + VAQFVY+V G+  DAW GFS++AF +L GFVRLS+AS VM
Sbjct  258  LGRGLAGAAVVGDVSWWLVNVAQFVYLVGGSFPDAWTGFSRKAFDSLGGFVRLSVASAVM  317

Query  171  FCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGWTLMVGVGFSAAIS  22
             CLE+WY+ A++++ G  KN E+ VD  SICMN   WTLMV VGF+AA+S
Sbjct  318  LCLEMWYYTAVLILVGCLKNPEIQVDAISICMNYQLWTLMVAVGFNAAVS  367



>ref|XP_007042719.1| MATE efflux family protein [Theobroma cacao]
 gb|EOX98550.1| MATE efflux family protein [Theobroma cacao]
Length=498

 Score =   325 bits (833),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 163/312 (52%), Positives = 210/312 (67%), Gaps = 1/312 (0%)
 Frame = -1

Query  957  SVYSFDADAGDIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHV  778
             V  F  +     Q  K ++ ++  + ESKK+W +A PA+    SQ+SIG +T  FAGH+
Sbjct  12   EVKPFQVERQRGEQAAK-QKIVKRSWKESKKMWAIAGPAVLVSVSQFSIGFVTVAFAGHL  70

Query  777  GNIQLAAVAVENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNAT  598
            G ++LAAV V  N+I GF FGIM GMGSALETLCGQA GA +  MLG+YLQRSWII   T
Sbjct  71   GELELAAVTVTTNVIEGFVFGIMLGMGSALETLCGQAVGAGQHNMLGIYLQRSWIISGVT  130

Query  597  AIPLTTLYIFSTPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYV  418
            A+ L   YI ++PILKLL Q+  IS+  G +   +IPQ FAY   FPIQ+FLQSQSK++V
Sbjct  131  ALCLMPCYILASPILKLLRQDKDISELAGKYCRMVIPQFFAYAMNFPIQKFLQSQSKVWV  190

Query  417  MASVSDVALVGHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKG  238
            M  +S V L  HVL +W  + KL  GL G A+  N +WW    A  +YVVSG   D+W G
Sbjct  191  MTIISVVGLGCHVLLNWALVTKLHLGLLGAAMAGNISWWLQVTAMVIYVVSGFFPDSWNG  250

Query  237  FSQRAFQNLTGFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGWT  58
             S  AF++L GF++LSLAS VM CLELWY+ A+IL+ GY KN  ++VD  SICMN+  WT
Sbjct  251  LSPLAFKSLGGFMKLSLASAVMLCLELWYYTAIILMVGYLKNPTIAVDAISICMNMQLWT  310

Query  57   LMVGVGFSAAIS  22
             MV +GF+AA+S
Sbjct  311  SMVTLGFNAAVS  322



>ref|XP_009793955.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Nicotiana 
sylvestris]
Length=513

 Score =   325 bits (834),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 162/318 (51%), Positives = 227/318 (71%), Gaps = 7/318 (2%)
 Frame = -1

Query  963  MSSVYSFDAD----AGDIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQ  796
            M SV  F+ +    A D    KK  E   + + ES+K+W +AAPA+ T  +Q+SIG +T 
Sbjct  15   MESVGPFEMERKFQADDYDDAKKTGE---KSWVESRKMWKIAAPAVLTAVAQFSIGFVTV  71

Query  795  VFAGHVGNIQLAAVAVENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSW  616
             F GH+G+ +LAAV++  N+I GF +GIM GMGSALETLCGQA GA K +MLG+Y+QRS 
Sbjct  72   AFIGHLGSTELAAVSIVQNVIEGFVYGIMLGMGSALETLCGQAVGAGKYDMLGIYMQRSC  131

Query  615  IILNATAIPLTTLYIFSTPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQS  436
            ++   TA+ LT  YIF++P+LKLLHQN  IS+  G +A+W+IPQL+AY   FP+++FLQ+
Sbjct  132  VLTLVTALLLTPFYIFTSPLLKLLHQNTSISELAGKYAIWVIPQLYAYALNFPVEKFLQA  191

Query  435  QSKIYVMASVSDVALVGHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGAC  256
            Q KI+VM  ++ V L  HV+ +W+ + K   GL G A+  N +WW + +AQFVYV+SG  
Sbjct  192  QGKIWVMTVINLVILALHVVLNWVLVTKCGHGLLGAAIAGNISWWLVVIAQFVYVISGYF  251

Query  255  GDAWKGFSQRAFQNLTGFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICM  76
             +AW GFS  AF++L GF++LSLAS +M CLELWY+  +IL+ G+ KN E++VD  SICM
Sbjct  252  PEAWTGFSTLAFKSLWGFLKLSLASAIMLCLELWYYTVVILMVGWLKNPEIAVDAISICM  311

Query  75   NISGWTLMVGVGFSAAIS  22
            N+  WTLM+ +GF+AA+S
Sbjct  312  NLQLWTLMISLGFNAAVS  329



>gb|KFK44418.1| hypothetical protein AALP_AA1G254300 [Arabis alpina]
Length=472

 Score =   323 bits (828),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 163/302 (54%), Positives = 205/302 (68%), Gaps = 24/302 (8%)
 Frame = -1

Query  927  DIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHVGNIQLAAVAV  748
            D+  I   ++F+ +F +ESKKLW+LA PAIFT   QYS+GA+TQV AGHV  + LAAV +
Sbjct  26   DMPPITGGRDFLMQFVTESKKLWWLAGPAIFTSFCQYSLGAVTQVLAGHVNTLALAAVTI  85

Query  747  ENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNATAIPLTTLYIF  568
            +N++IAGF+ GIM GMGSAL TLCGQA+GA +LEM+G+YLQ                   
Sbjct  86   QNSVIAGFSVGIMLGMGSALATLCGQAYGAGQLEMMGIYLQ-------------------  126

Query  567  STPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYVMASVSDVALV  388
                  LL Q+P ISKA    +++MIPQLFAY   F   +FLQ+QSK+  MA ++   L 
Sbjct  127  -----SLLGQSPEISKAARKCSLFMIPQLFAYAVNFATAKFLQAQSKVIAMAVIAATVLF  181

Query  387  GHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKGFSQRAFQNLT  208
             H + SWL MLKL WG+ GGAVVLN +WW +  AQ VY+  G+CG AW G S +AF+NL 
Sbjct  182  QHAILSWLLMLKLGWGMAGGAVVLNVSWWLIDGAQIVYICGGSCGRAWSGLSWKAFKNLR  241

Query  207  GFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGWTLMVGVGFSAA  28
            GF RLSLAS VM CLE+WYF+ALIL AGY KN +V V   SICMNI  W +MV  GF+AA
Sbjct  242  GFARLSLASAVMVCLEVWYFMALILFAGYLKNPQVFVAALSICMNILAWPIMVAFGFNAA  301

Query  27   IS  22
            +S
Sbjct  302  VS  303



>ref|XP_010941933.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Elaeis guineensis]
Length=472

 Score =   323 bits (828),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 151/293 (52%), Positives = 212/293 (72%), Gaps = 0/293 (0%)
 Frame = -1

Query  900  EFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHVGNIQLAAVAVENNLIAGFA  721
              + + + ESKK+W++  PAI T   Q+S+G +T  F GH+G+++LA V++  ++I  FA
Sbjct  3    RLVAKSWDESKKMWHIGGPAILTGVFQFSVGFVTVAFVGHLGDVELAGVSIALSVIETFA  62

Query  720  FGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNATAIPLTTLYIFSTPILKLLH  541
            FGI+ GMGSALETLCGQA GA +L MLGVY+QRSW+I   TA+ L+ +Y+F++PILKLL 
Sbjct  63   FGILLGMGSALETLCGQAVGAGQLHMLGVYMQRSWVITEVTALVLSPVYVFASPILKLLR  122

Query  540  QNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYVMASVSDVALVGHVLFSWLF  361
            Q+  IS+  G + +W+IPQLFAY   FP+Q+F QSQSK++VMA+++ V L  H L +W+F
Sbjct  123  QSKDISEVAGRYTIWVIPQLFAYAMNFPLQKFFQSQSKVWVMAAINGVVLGIHALLNWIF  182

Query  360  MLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKGFSQRAFQNLTGFVRLSLAS  181
            + K+  GL   A++ N +WW + + Q  Y+VSG   +AWKGFS  AFQNL  FV+LSLAS
Sbjct  183  VTKMGHGLLATAIIGNVSWWLINLGQMAYLVSGFFPEAWKGFSMLAFQNLAAFVKLSLAS  242

Query  180  GVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGWTLMVGVGFSAAIS  22
             VM CLELWY+ A+I++ G  KN +++V   SICMN   WTLMV +G +AA+S
Sbjct  243  AVMLCLELWYYTAVIILVGCLKNPQIAVGAISICMNYQLWTLMVALGLNAAVS  295



>emb|CDY28209.1| BnaA01g06400D [Brassica napus]
Length=248

 Score =   314 bits (804),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 157/248 (63%), Positives = 188/248 (76%), Gaps = 2/248 (1%)
 Frame = -1

Query  825  SQYSIGAITQVFAGHVGNIQLAAVAVENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLE  646
            +Q+S+GAITQVFAGH+  I LAAV++EN++IAGF FGIM G GSALETLCGQAFGA K+ 
Sbjct  2    AQFSLGAITQVFAGHISTIALAAVSIENSVIAGFFFGIMLGTGSALETLCGQAFGAGKIS  61

Query  645  MLGVYLQRSWIILNATAIPLTTLYIFSTPILKLLHQNPHISKAVGTFAVWMIPQLFAYVF  466
            M GVYLQRSW+IL  TA+ L+ LYIF+ PIL  + Q   IS   G F+++MIPQ+FAY  
Sbjct  62   MFGVYLQRSWVILTVTALILSLLYIFAAPILTFICQTAAISAMAGVFSIYMIPQIFAYAI  121

Query  465  TFPIQRFLQSQSKIYVMASVSDVALVGHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVA  286
             FP  +FLQSQSKI VMA++S VALV H L +   M  + WGLPG   VLN +WWF+ VA
Sbjct  122  NFPTAKFLQSQSKIMVMAAISGVALVIHTLLT--CMAIIHWGLPGLDFVLNKSWWFIVVA  179

Query  285  QFVYVVSGACGDAWKGFSQRAFQNLTGFVRLSLASGVMFCLELWYFVALILIAGYTKNAE  106
            QFVY+ SG CG+AW GF+  AF NL GFV+LSLAS VM CLE+WYF+ALIL AG  KNAE
Sbjct  180  QFVYIFSGTCGEAWSGFTWEAFHNLWGFVKLSLASAVMLCLEIWYFMALILFAGNLKNAE  239

Query  105  VSVDGTSI  82
            VSV   SI
Sbjct  240  VSVAALSI  247



>ref|XP_006659668.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Oryza brachyantha]
Length=513

 Score =   323 bits (827),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 162/303 (53%), Positives = 214/303 (71%), Gaps = 1/303 (0%)
 Frame = -1

Query  927  DIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHVGNIQLAAVAV  748
            D+ +I+ V  F+R    E+++LWYLA P IFT  +QYS+GA+TQV AGH+  ++L AV+ 
Sbjct  42   DLEEIRSVGAFMRLAAEENRRLWYLAGPVIFTSLAQYSLGAVTQVLAGHLTTLELDAVST  101

Query  747  ENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNATAIPLTTLYIF  568
            EN +IAG AFGIMYGMGSALETLCGQA+GAK+L MLGVYLQRSW+IL A ++ L  +Y+F
Sbjct  102  ENMVIAGLAFGIMYGMGSALETLCGQAYGAKQLHMLGVYLQRSWVILTAMSVLLLPIYLF  161

Query  567  STPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYVMASVSDVALV  388
            +TPIL+  HQ+  I+   G F+++MIPQLFAY   FPIQ+FLQ+QSK+  MA VS +AL+
Sbjct  162  ATPILRFFHQDDDIALLAGRFSLYMIPQLFAYALNFPIQKFLQAQSKVVAMAVVSALALL  221

Query  387  GHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKGFS-QRAFQNL  211
             HV  SWL ++ L  GL G AV LN +WW + + Q  Y+V G C  AW GF        L
Sbjct  222  FHVALSWLLVVPLGMGLVGLAVALNVSWWLVVLGQLAYIVMGCCPGAWNGFDWLPPPPPL  281

Query  210  TGFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGWTLMVGVGFSA  31
            +   RLS+ S +M CLE W+++ LI+I G   NA+V+V   SIC N+ GW +MV  GF+A
Sbjct  282  SPPPRLSVGSAIMLCLEFWFYMFLIVIVGNLPNAQVAVAAVSICTNLFGWQIMVFFGFNA  341

Query  30   AIS  22
            AIS
Sbjct  342  AIS  344



>ref|XP_010941927.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X8 [Elaeis 
guineensis]
Length=372

 Score =   318 bits (814),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 148/293 (51%), Positives = 212/293 (72%), Gaps = 0/293 (0%)
 Frame = -1

Query  900  EFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHVGNIQLAAVAVENNLIAGFA  721
              + + ++ESKK+W +   AI     Q+SIG +T  FAGH+G ++LAA+++  N+I GFA
Sbjct  3    RLVAKIWNESKKMWQIGGAAILIGVLQFSIGFVTVAFAGHLGVVELAAISIAQNVIEGFA  62

Query  720  FGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNATAIPLTTLYIFSTPILKLLH  541
            +GI+ GMGSALETLCGQA GA +L MLGVY+QRSW+I   TA+ LT +Y F++P+LKL+ 
Sbjct  63   YGILLGMGSALETLCGQAVGAGQLHMLGVYMQRSWVISGVTAMVLTPIYAFTSPMLKLVR  122

Query  540  QNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYVMASVSDVALVGHVLFSWLF  361
            Q+  +S+  G +A W IPQL+AY   FP+Q+F QSQSK++VMA +S V L  H L +W+ 
Sbjct  123  QSKDVSEVAGKYATWTIPQLYAYAMNFPLQKFFQSQSKVWVMAVISGVVLGIHALLNWIL  182

Query  360  MLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKGFSQRAFQNLTGFVRLSLAS  181
            ++K+  GL G A+ ++ +WW + ++Q +Y+VSG   +AW+GFS  AFQNL  FV+LSLAS
Sbjct  183  VIKMGHGLLGAAIAVDVSWWLINLSQMIYLVSGFFPEAWQGFSLLAFQNLAAFVKLSLAS  242

Query  180  GVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGWTLMVGVGFSAAIS  22
             VM CLELWY+ A+I++ G  +N +++V   SICMN   W LM+ +GFSAA+S
Sbjct  243  AVMLCLELWYYTAVIILVGCLQNPKIAVGAISICMNYQLWALMIALGFSAAVS  295



>ref|XP_010941919.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X7 [Elaeis 
guineensis]
Length=389

 Score =   318 bits (815),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 148/293 (51%), Positives = 212/293 (72%), Gaps = 0/293 (0%)
 Frame = -1

Query  900  EFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHVGNIQLAAVAVENNLIAGFA  721
              + + ++ESKK+W +   AI     Q+SIG +T  FAGH+G ++LAA+++  N+I GFA
Sbjct  3    RLVAKIWNESKKMWQIGGAAILIGVLQFSIGFVTVAFAGHLGVVELAAISIAQNVIEGFA  62

Query  720  FGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNATAIPLTTLYIFSTPILKLLH  541
            +GI+ GMGSALETLCGQA GA +L MLGVY+QRSW+I   TA+ LT +Y F++P+LKL+ 
Sbjct  63   YGILLGMGSALETLCGQAVGAGQLHMLGVYMQRSWVISGVTAMVLTPIYAFTSPMLKLVR  122

Query  540  QNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYVMASVSDVALVGHVLFSWLF  361
            Q+  +S+  G +A W IPQL+AY   FP+Q+F QSQSK++VMA +S V L  H L +W+ 
Sbjct  123  QSKDVSEVAGKYATWTIPQLYAYAMNFPLQKFFQSQSKVWVMAVISGVVLGIHALLNWIL  182

Query  360  MLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKGFSQRAFQNLTGFVRLSLAS  181
            ++K+  GL G A+ ++ +WW + ++Q +Y+VSG   +AW+GFS  AFQNL  FV+LSLAS
Sbjct  183  VIKMGHGLLGAAIAVDVSWWLINLSQMIYLVSGFFPEAWQGFSLLAFQNLAAFVKLSLAS  242

Query  180  GVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGWTLMVGVGFSAAIS  22
             VM CLELWY+ A+I++ G  +N +++V   SICMN   W LM+ +GFSAA+S
Sbjct  243  AVMLCLELWYYTAVIILVGCLQNPKIAVGAISICMNYQLWALMIALGFSAAVS  295



>ref|XP_006365501.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Solanum tuberosum]
Length=494

 Score =   322 bits (824),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 159/315 (50%), Positives = 221/315 (70%), Gaps = 5/315 (2%)
 Frame = -1

Query  966  NMSSVYSFDADAGDIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFA  787
            N      F+ D  D       K+  ++  +ESKKLW +AAPAI T  SQ+SIG ++  F 
Sbjct  8    NFEMERRFEGDDCD-----DAKKMSKKSLNESKKLWEIAAPAIITAVSQFSIGFVSIAFV  62

Query  786  GHVGNIQLAAVAVENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIIL  607
            GH+G+++LAA++V  N++ GF FGIM GMGSALETLCGQA GA + +MLGV LQRS +I 
Sbjct  63   GHLGSLELAAISVVQNVVEGFVFGIMLGMGSALETLCGQAVGAGQFDMLGVNLQRSCVIT  122

Query  606  NATAIPLTTLYIFSTPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSK  427
             ATA+ LT  Y+F++ ILKLLHQ+  IS+  G +A+W+IPQL+AY   FP+Q+FLQ+QSK
Sbjct  123  LATALLLTPFYVFTSQILKLLHQDKEISEVAGKYAIWVIPQLYAYALNFPVQKFLQAQSK  182

Query  426  IYVMASVSDVALVGHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDA  247
            I+VM  ++ V LV H++ +W+ + KL  GL G A+  N +WW + +AQ  YV++G   ++
Sbjct  183  IWVMTVINIVILVFHIVLNWVLVTKLGHGLFGAAMAGNVSWWLVVLAQIFYVIAGFFPES  242

Query  246  WKGFSQRAFQNLTGFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNIS  67
            W GFS  AF++L  FV+LSLAS VM CLELWYF  +IL+ G+ KN E++VD  SI + + 
Sbjct  243  WTGFSMLAFKSLWSFVKLSLASAVMLCLELWYFTVVILMVGWLKNPEIAVDAISISLALQ  302

Query  66   GWTLMVGVGFSAAIS  22
             W LM+ +GF+AAIS
Sbjct  303  LWVLMITLGFNAAIS  317



>ref|XP_009399295.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Musa acuminata 
subsp. malaccensis]
Length=466

 Score =   320 bits (821),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 155/300 (52%), Positives = 212/300 (71%), Gaps = 7/300 (2%)
 Frame = -1

Query  921  RQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHVGNIQLAAVAVEN  742
            R + K++E       ESK+ W LA PAI T   Q+SI  +T  F G +G +QL+AV+V  
Sbjct  3    RLLSKIRE-------ESKQTWSLAGPAILTGTFQFSIATVTAAFVGRLGALQLSAVSVAQ  55

Query  741  NLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNATAIPLTTLYIFST  562
             +IAGFA+G M GMGSALETLCGQA GA +  MLG+Y+QRSW+I  ATA+ LT LY+F+T
Sbjct  56   GVIAGFAYGAMLGMGSALETLCGQAVGAGQFHMLGIYMQRSWVISAATAMVLTPLYVFAT  115

Query  561  PILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYVMASVSDVALVGH  382
            PIL+LLHQ+  IS+  G +  W++PQL+AY   FP+Q+F QSQSK++V+  VS   L  H
Sbjct  116  PILRLLHQSKDISEVAGKYCGWIVPQLYAYAVNFPLQKFFQSQSKVWVVTLVSGAVLGVH  175

Query  381  VLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKGFSQRAFQNLTGF  202
             L +W+F+ KL  GL G A+V N +WW + +AQ +Y+++G   ++W+GFS  AFQNL  F
Sbjct  176  ALLNWVFVSKLGHGLLGAAMVENVSWWLINLAQMIYLLAGFFPESWRGFSLSAFQNLGAF  235

Query  201  VRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGWTLMVGVGFSAAIS  22
             +LSLAS +M CLELWY+ A++++ G  KN E++V   SICMN   WTLMV +GF+AA+S
Sbjct  236  GKLSLASAIMLCLELWYYTAVVILVGCLKNPEIAVGAISICMNYEAWTLMVALGFNAAVS  295



>ref|XP_004231422.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Solanum lycopersicum]
Length=497

 Score =   321 bits (823),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 156/308 (51%), Positives = 219/308 (71%), Gaps = 5/308 (2%)
 Frame = -1

Query  945  FDADAGDIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHVGNIQ  766
            F+ D  D       K+  ++  +ESKKLW +AAPAI T  SQ+SIG ++  F GH+G+++
Sbjct  15   FEGDDYD-----DAKKMSKKSLNESKKLWEIAAPAIITAVSQFSIGFVSIAFVGHLGSLE  69

Query  765  LAAVAVENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNATAIPL  586
            LAA++V  N++ GF FGIM GMGSALETLCGQA GA + +MLGV LQRS +I  ATA+ L
Sbjct  70   LAAISVVQNVVEGFVFGIMLGMGSALETLCGQAVGAGQFDMLGVNLQRSCVITIATALLL  129

Query  585  TTLYIFSTPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYVMASV  406
            T  Y+F++ ILKLLHQ+  IS+  G +A+W+IPQL+AY   FP+Q+FLQ+QSKI+VM  +
Sbjct  130  TPFYVFTSQILKLLHQDKEISEVAGKYAIWVIPQLYAYALNFPVQKFLQAQSKIWVMTVI  189

Query  405  SDVALVGHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKGFSQR  226
            + V LV H++ +W+ + K   GL G A+  N +WW + +AQ  YV++G   ++W GFS  
Sbjct  190  NIVILVFHIVLNWVLVTKFEHGLLGAAMAGNVSWWLVVLAQIFYVIAGFFPESWTGFSML  249

Query  225  AFQNLTGFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGWTLMVG  46
            AF++L GF++LSLAS VM CLELWYF  +IL+ G+ KN E++VD  S  + +  W LM+ 
Sbjct  250  AFKSLWGFIKLSLASAVMLCLELWYFTVVILMVGWLKNPEIAVDAISTSLALQLWVLMIT  309

Query  45   VGFSAAIS  22
            +GF+AAIS
Sbjct  310  LGFNAAIS  317



>ref|XP_010270616.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Nelumbo nucifera]
Length=490

 Score =   321 bits (822),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 153/298 (51%), Positives = 213/298 (71%), Gaps = 1/298 (0%)
 Frame = -1

Query  912  KKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHVGNIQLAAVAVENNLI  733
             + K    + + E KKLW LA P+I     Q+S+ AITQ F+GH+G ++LAAVA+ N +I
Sbjct  13   SRSKTISIKIWQEWKKLWLLAGPSILIAVFQFSLFAITQTFSGHLGAVKLAAVAIGNLVI  72

Query  732  AGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNATAIPLTTLYIFSTPIL  553
            +G  +G + GMGSALETLCGQAFGA +L M+G+YLQRSWIIL+ TA+    ++IF+ PIL
Sbjct  73   SGIGYGFLMGMGSALETLCGQAFGAGQLHMMGIYLQRSWIILSVTAVVTCPVFIFAAPIL  132

Query  552  KLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYVMASVSDVALVGHVLF  373
            +LL Q   IS+  G F++W+IPQ FAY + FP+Q+FLQ+QSK+  M  +S + L  HV++
Sbjct  133  RLLGQTAEISQVAGEFSIWIIPQYFAYAWNFPMQKFLQAQSKVMAMTWMSGICLAIHVIW  192

Query  372  SWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKGFSQRAFQNLTGFVRL  193
            SWL ++KL WGL G A+ LN  WW + + Q VY+++G C  AW GFS  AF++L GFV+L
Sbjct  193  SWLCIVKLGWGLVGAAITLNLAWWLLVLMQLVYILAGKCPGAWTGFSWLAFKDLYGFVKL  252

Query  192  SLASGVMFCLELWYFVALILIAGYTK-NAEVSVDGTSICMNISGWTLMVGVGFSAAIS  22
            S+AS +M CLE W+ + LIL+ G+ K NAEV VD  +IC+N+ GW + V +GF AA+S
Sbjct  253  SMASAIMLCLEYWFVMILILLVGHLKTNAEVYVDAMAICLNLDGWIVQVPIGFMAAVS  310



>ref|XP_010941911.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X6 [Elaeis 
guineensis]
Length=398

 Score =   318 bits (814),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 148/293 (51%), Positives = 212/293 (72%), Gaps = 0/293 (0%)
 Frame = -1

Query  900  EFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHVGNIQLAAVAVENNLIAGFA  721
              + + ++ESKK+W +   AI     Q+SIG +T  FAGH+G ++LAA+++  N+I GFA
Sbjct  3    RLVAKIWNESKKMWQIGGAAILIGVLQFSIGFVTVAFAGHLGVVELAAISIAQNVIEGFA  62

Query  720  FGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNATAIPLTTLYIFSTPILKLLH  541
            +GI+ GMGSALETLCGQA GA +L MLGVY+QRSW+I   TA+ LT +Y F++P+LKL+ 
Sbjct  63   YGILLGMGSALETLCGQAVGAGQLHMLGVYMQRSWVISGVTAMVLTPIYAFTSPMLKLVR  122

Query  540  QNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYVMASVSDVALVGHVLFSWLF  361
            Q+  +S+  G +A W IPQL+AY   FP+Q+F QSQSK++VMA +S V L  H L +W+ 
Sbjct  123  QSKDVSEVAGKYATWTIPQLYAYAMNFPLQKFFQSQSKVWVMAVISGVVLGIHALLNWIL  182

Query  360  MLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKGFSQRAFQNLTGFVRLSLAS  181
            ++K+  GL G A+ ++ +WW + ++Q +Y+VSG   +AW+GFS  AFQNL  FV+LSLAS
Sbjct  183  VIKMGHGLLGAAIAVDVSWWLINLSQMIYLVSGFFPEAWQGFSLLAFQNLAAFVKLSLAS  242

Query  180  GVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGWTLMVGVGFSAAIS  22
             VM CLELWY+ A+I++ G  +N +++V   SICMN   W LM+ +GFSAA+S
Sbjct  243  AVMLCLELWYYTAVIILVGCLQNPKIAVGAISICMNYQLWALMIALGFSAAVS  295



>ref|XP_002458553.1| hypothetical protein SORBIDRAFT_03g035610 [Sorghum bicolor]
 gb|EES03673.1| hypothetical protein SORBIDRAFT_03g035610 [Sorghum bicolor]
Length=487

 Score =   320 bits (820),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 151/290 (52%), Positives = 208/290 (72%), Gaps = 0/290 (0%)
 Frame = -1

Query  891  REFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHVGNIQLAAVAVENNLIAGFAFGI  712
            + +  E + LW +A P I T   Q+ +G +T  F GH+G ++LAAV++ N ++ G AFG+
Sbjct  16   KNWSDECRNLWRVAGPVILTGIFQFLLGFVTTAFVGHIGKVELAAVSIVNGVVEGLAFGL  75

Query  711  MYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNATAIPLTTLYIFSTPILKLLHQNP  532
            + GMGSALETLCGQA GA +L+MLGVY+QRSWII  AT++ L  LY+F++PIL+LL Q+ 
Sbjct  76   LLGMGSALETLCGQAVGAGQLQMLGVYMQRSWIICVATSLVLLPLYVFTSPILRLLRQSA  135

Query  531  HISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYVMASVSDVALVGHVLFSWLFMLK  352
             IS   G +A W +PQLFAY   FP+Q+F Q+QS+++VM ++S   L  H L +WL + +
Sbjct  136  DISAVSGRYARWCVPQLFAYAVNFPMQKFYQAQSRVWVMTAISGAVLAVHALLNWLVVSR  195

Query  351  LRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKGFSQRAFQNLTGFVRLSLASGVM  172
            L  GL G AVV + +WW + VAQFVY+V G+   AW GFS++AF +L GFVRLS+AS VM
Sbjct  196  LGRGLVGAAVVGDVSWWLVNVAQFVYLVGGSFPGAWTGFSRKAFASLGGFVRLSIASAVM  255

Query  171  FCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGWTLMVGVGFSAAIS  22
             CLE+WY+ A++++ G  KN E+ VD  SICMN   WTLMV VGF+AA+S
Sbjct  256  LCLEMWYYTAVLILVGCLKNPEIQVDAISICMNYQLWTLMVAVGFNAAVS  305



>ref|XP_006423184.1| hypothetical protein CICLE_v10028264mg [Citrus clementina]
 gb|ESR36424.1| hypothetical protein CICLE_v10028264mg [Citrus clementina]
Length=479

 Score =   320 bits (819),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 153/294 (52%), Positives = 205/294 (70%), Gaps = 0/294 (0%)
 Frame = -1

Query  903  KEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHVGNIQLAAVAVENNLIAGF  724
            K F    ++ESKK+W +A P I    S++SI  +T  F GH+G ++ AAV+V  N+I GF
Sbjct  36   KNFRERSWNESKKIWEIAGPVILASGSEFSITFVTAAFVGHLGEVEFAAVSVVQNVIEGF  95

Query  723  AFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNATAIPLTTLYIFSTPILKLL  544
             +GIM GMGSALETL GQA GA + +MLG+YLQRS+I+  ATA+ L   YIF+TP LKLL
Sbjct  96   VYGIMLGMGSALETLSGQAVGAGRFDMLGIYLQRSFIVTGATALCLMPFYIFATPFLKLL  155

Query  543  HQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYVMASVSDVALVGHVLFSWL  364
             Q+  IS+  G ++ W++PQLFAY    PIQ+FLQSQS+++VM  +S  AL+ HV  +W+
Sbjct  156  SQDKEISELAGKYSKWIVPQLFAYAINSPIQKFLQSQSRVWVMTMISMAALIFHVFLNWI  215

Query  363  FMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKGFSQRAFQNLTGFVRLSLA  184
             + KL +G+ G A+  + + W M V   VYV SG   DAW GFS RAF++L  FV+LSLA
Sbjct  216  LVAKLNYGIVGAAIAGDISLWLMVVGLVVYVTSGCFPDAWTGFSLRAFKSLASFVKLSLA  275

Query  183  SGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGWTLMVGVGFSAAIS  22
            S VM CLELWY+ A+IL+ G+  N E++VD  SICMN+  WTLM+ +GF  AIS
Sbjct  276  SAVMLCLELWYYTAVILMVGWLNNPEIAVDAISICMNLQQWTLMISLGFHTAIS  329



>gb|KDO51435.1| hypothetical protein CISIN_1g010173mg [Citrus sinensis]
Length=516

 Score =   321 bits (822),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 153/294 (52%), Positives = 205/294 (70%), Gaps = 0/294 (0%)
 Frame = -1

Query  903  KEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHVGNIQLAAVAVENNLIAGF  724
            K F    ++ESKK+W +A P I    S++SI  +T  F GH+G ++ AAV+V  N+I GF
Sbjct  36   KNFRERIWNESKKIWEIAGPVILASGSEFSITFVTAAFVGHLGEVEFAAVSVVQNVIEGF  95

Query  723  AFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNATAIPLTTLYIFSTPILKLL  544
             +GIM GMGSALETL GQA GA + +MLG+YLQRS+I+  ATA+ L   YIF+TP LKLL
Sbjct  96   VYGIMLGMGSALETLSGQAVGAGRFDMLGIYLQRSFIVTGATALCLMPFYIFATPFLKLL  155

Query  543  HQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYVMASVSDVALVGHVLFSWL  364
             Q+  IS+  G ++ W++PQLFAY    PIQ+FLQSQS+++VM  +S  AL+ HV  +W+
Sbjct  156  SQDKEISELAGKYSKWIVPQLFAYAINSPIQKFLQSQSRVWVMTMISMAALIFHVFLNWI  215

Query  363  FMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKGFSQRAFQNLTGFVRLSLA  184
             + KL +G+ G A+  + + W M V   VYV SG   DAW GFS RAF++L  FV+LSLA
Sbjct  216  LVAKLNYGIVGAAIAGDISLWLMVVGLVVYVTSGCFPDAWTGFSLRAFKSLASFVKLSLA  275

Query  183  SGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGWTLMVGVGFSAAIS  22
            S VM CLELWY+ A+IL+ G+  N E++VD  SICMN+  WTLM+ +GF  AIS
Sbjct  276  SAVMLCLELWYYTAVILMVGWLNNPEIAVDAISICMNLQQWTLMISLGFHTAIS  329



>ref|XP_004982390.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Setaria italica]
Length=494

 Score =   320 bits (820),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 153/294 (52%), Positives = 213/294 (72%), Gaps = 0/294 (0%)
 Frame = -1

Query  903  KEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHVGNIQLAAVAVENNLIAGF  724
            K  + + + ESK LW++A PAI T   Q+SIG +T  F GH+G+++LAAV V  N+I GF
Sbjct  3    KAVLSKSWQESKLLWHIAFPAILTAVFQFSIGFVTVGFVGHIGSVELAAVTVVENVIEGF  62

Query  723  AFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNATAIPLTTLYIFSTPILKLL  544
            A+G++ GMGSALETLCGQA GA +++MLGVY+QRSW+I  ATA+ LT  Y+F+ PIL+ L
Sbjct  63   AYGVLLGMGSALETLCGQAVGAGQVDMLGVYIQRSWLICGATAVVLTPAYLFTGPILRAL  122

Query  543  HQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYVMASVSDVALVGHVLFSWL  364
             Q   I+   GT+  W++PQLFAY   FP+Q+F QSQS+++V+  +S   L  HV  +++
Sbjct  123  RQPDDIAAVAGTYCRWVVPQLFAYAANFPLQKFFQSQSRVWVVTLISGAGLAAHVALNYV  182

Query  363  FMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKGFSQRAFQNLTGFVRLSLA  184
            F+ +L  GL G A+V N TWW + VAQ  Y+VSG   +AW+GFS  AF+NL  FV+LSLA
Sbjct  183  FVTRLGHGLLGAAIVGNVTWWLIIVAQMGYLVSGCFPEAWRGFSMLAFKNLAAFVKLSLA  242

Query  183  SGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGWTLMVGVGFSAAIS  22
            S VM CLELWY+ A++++ G+ KNA++ +D  SIC+N   WTLMV +GF+AA+S
Sbjct  243  SAVMLCLELWYYTAVLILVGFLKNAQLQIDVMSICINYQLWTLMVALGFNAAVS  296



>gb|KDO51434.1| hypothetical protein CISIN_1g010173mg [Citrus sinensis]
Length=498

 Score =   320 bits (821),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 153/294 (52%), Positives = 205/294 (70%), Gaps = 0/294 (0%)
 Frame = -1

Query  903  KEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHVGNIQLAAVAVENNLIAGF  724
            K F    ++ESKK+W +A P I    S++SI  +T  F GH+G ++ AAV+V  N+I GF
Sbjct  36   KNFRERIWNESKKIWEIAGPVILASGSEFSITFVTAAFVGHLGEVEFAAVSVVQNVIEGF  95

Query  723  AFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNATAIPLTTLYIFSTPILKLL  544
             +GIM GMGSALETL GQA GA + +MLG+YLQRS+I+  ATA+ L   YIF+TP LKLL
Sbjct  96   VYGIMLGMGSALETLSGQAVGAGRFDMLGIYLQRSFIVTGATALCLMPFYIFATPFLKLL  155

Query  543  HQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYVMASVSDVALVGHVLFSWL  364
             Q+  IS+  G ++ W++PQLFAY    PIQ+FLQSQS+++VM  +S  AL+ HV  +W+
Sbjct  156  SQDKEISELAGKYSKWIVPQLFAYAINSPIQKFLQSQSRVWVMTMISMAALIFHVFLNWI  215

Query  363  FMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKGFSQRAFQNLTGFVRLSLA  184
             + KL +G+ G A+  + + W M V   VYV SG   DAW GFS RAF++L  FV+LSLA
Sbjct  216  LVAKLNYGIVGAAIAGDISLWLMVVGLVVYVTSGCFPDAWTGFSLRAFKSLASFVKLSLA  275

Query  183  SGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGWTLMVGVGFSAAIS  22
            S VM CLELWY+ A+IL+ G+  N E++VD  SICMN+  WTLM+ +GF  AIS
Sbjct  276  SAVMLCLELWYYTAVILMVGWLNNPEIAVDAISICMNLQQWTLMISLGFHTAIS  329



>emb|CDP01532.1| unnamed protein product [Coffea canephora]
Length=495

 Score =   320 bits (820),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 158/311 (51%), Positives = 210/311 (68%), Gaps = 9/311 (3%)
 Frame = -1

Query  960  SSVYSFDADAGDIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGH  781
            SS Y  D D  ++R         R  + ESKKLW++  PAIF+  + YS+  ITQ FAGH
Sbjct  28   SSKYEIDDDDQNLR---------RRVFVESKKLWHIVGPAIFSRITTYSMNVITQAFAGH  78

Query  780  VGNIQLAAVAVENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNA  601
            +G+ +LAA+++ NN++ GF FG++ GM SALETLCGQAFGAKK  MLG+Y+QRSWI+L A
Sbjct  79   LGDTELAAISIINNVVVGFDFGLLLGMASALETLCGQAFGAKKYHMLGIYMQRSWIVLFA  138

Query  600  TAIPLTTLYIFSTPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIY  421
              I L  +YIF+TPILKLL Q  ++++  G+ A+WMIP  F++ F FP+QRFLQSQ K  
Sbjct  139  CCILLLPIYIFATPILKLLGQPANVAELSGSVALWMIPLHFSFAFQFPLQRFLQSQLKNS  198

Query  420  VMASVSDVALVGHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWK  241
            V+A VS VAL+ H+  SWLF+   + G+ G  V LN  WW +    F+Y   G C   W 
Sbjct  199  VIAWVSLVALLVHLCTSWLFVYGFQLGVVGTVVTLNFAWWVLVFGLFIYTACGGCPHTWP  258

Query  240  GFSQRAFQNLTGFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGW  61
            GFS  AF  L  F++LS +SGVM CLE WY+  LIL+ G  KNAE++VD  S+CM I+GW
Sbjct  259  GFSMEAFSGLWEFLKLSASSGVMLCLENWYYRILILMTGNLKNAEIAVDALSVCMTINGW  318

Query  60   TLMVGVGFSAA  28
             +M+ +GF AA
Sbjct  319  EMMIPLGFFAA  329



>ref|XP_006827533.1| hypothetical protein AMTR_s00009p00209360, partial [Amborella 
trichopoda]
 gb|ERM94949.1| hypothetical protein AMTR_s00009p00209360, partial [Amborella 
trichopoda]
Length=434

 Score =   318 bits (814),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 158/302 (52%), Positives = 211/302 (70%), Gaps = 1/302 (0%)
 Frame = -1

Query  927  DIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHVGNIQLAAVAV  748
            D   I   ++    F SES+KLW +AAP IF     +++G+ TQ+F GH+GN++LA VA+
Sbjct  15   DYPAITNCRQARALFGSESRKLWTIAAPIIFNTLCFFALGSTTQMFVGHLGNLELAGVAI  74

Query  747  ENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNATAIPLTTLYIF  568
             +++I+ F FG M GMGSA ETLCGQAFGA ++EMLG+YLQRSWIIL  T + L  +Y+F
Sbjct  75   SSSVISTFTFGFMLGMGSAAETLCGQAFGAGQVEMLGIYLQRSWIILLVTGLFLVPVYVF  134

Query  567  STPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYVMASVSDVALV  388
            STPIL LL Q+  IS   G F +W IPQ+FA    FP Q+FLQSQSK      +  +ALV
Sbjct  135  STPILVLLGQDRAISNLAGKFTIWTIPQIFALAINFPTQKFLQSQSKFAAFTWIGFIALV  194

Query  387  GHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKGFSQRAFQNLT  208
             H+L  W+F+    WGLPG AVV+N + WF+++AQ VYVV   C DAW G S  AF+++ 
Sbjct  195  IHILLLWVFVWLFGWGLPGAAVVVNVSAWFISIAQTVYVVYW-CKDAWNGLSWLAFKDMW  253

Query  207  GFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGWTLMVGVGFSAA  28
             FVRLSLAS VM CLE+WY ++L ++ G+ +N E++VD  SICMN++GW  M+ +GF AA
Sbjct  254  AFVRLSLASAVMLCLEVWYMMSLTVLTGHLENPEIAVDSISICMNVNGWEAMIFIGFIAA  313

Query  27   IS  22
            IS
Sbjct  314  IS  315



>ref|XP_010941884.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X3 [Elaeis 
guineensis]
Length=437

 Score =   318 bits (814),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 148/293 (51%), Positives = 212/293 (72%), Gaps = 0/293 (0%)
 Frame = -1

Query  900  EFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHVGNIQLAAVAVENNLIAGFA  721
              + + ++ESKK+W +   AI     Q+SIG +T  FAGH+G ++LAA+++  N+I GFA
Sbjct  3    RLVAKIWNESKKMWQIGGAAILIGVLQFSIGFVTVAFAGHLGVVELAAISIAQNVIEGFA  62

Query  720  FGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNATAIPLTTLYIFSTPILKLLH  541
            +GI+ GMGSALETLCGQA GA +L MLGVY+QRSW+I   TA+ LT +Y F++P+LKL+ 
Sbjct  63   YGILLGMGSALETLCGQAVGAGQLHMLGVYMQRSWVISGVTAMVLTPIYAFTSPMLKLVR  122

Query  540  QNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYVMASVSDVALVGHVLFSWLF  361
            Q+  +S+  G +A W IPQL+AY   FP+Q+F QSQSK++VMA +S V L  H L +W+ 
Sbjct  123  QSKDVSEVAGKYATWTIPQLYAYAMNFPLQKFFQSQSKVWVMAVISGVVLGIHALLNWIL  182

Query  360  MLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKGFSQRAFQNLTGFVRLSLAS  181
            ++K+  GL G A+ ++ +WW + ++Q +Y+VSG   +AW+GFS  AFQNL  FV+LSLAS
Sbjct  183  VIKMGHGLLGAAIAVDVSWWLINLSQMIYLVSGFFPEAWQGFSLLAFQNLAAFVKLSLAS  242

Query  180  GVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGWTLMVGVGFSAAIS  22
             VM CLELWY+ A+I++ G  +N +++V   SICMN   W LM+ +GFSAA+S
Sbjct  243  AVMLCLELWYYTAVIILVGCLQNPKIAVGAISICMNYQLWALMIALGFSAAVS  295



>ref|XP_006423183.1| hypothetical protein CICLE_v10028264mg [Citrus clementina]
 ref|XP_006479341.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Citrus 
sinensis]
 gb|ESR36423.1| hypothetical protein CICLE_v10028264mg [Citrus clementina]
Length=498

 Score =   320 bits (819),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 153/294 (52%), Positives = 205/294 (70%), Gaps = 0/294 (0%)
 Frame = -1

Query  903  KEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHVGNIQLAAVAVENNLIAGF  724
            K F    ++ESKK+W +A P I    S++SI  +T  F GH+G ++ AAV+V  N+I GF
Sbjct  36   KNFRERSWNESKKIWEIAGPVILASGSEFSITFVTAAFVGHLGEVEFAAVSVVQNVIEGF  95

Query  723  AFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNATAIPLTTLYIFSTPILKLL  544
             +GIM GMGSALETL GQA GA + +MLG+YLQRS+I+  ATA+ L   YIF+TP LKLL
Sbjct  96   VYGIMLGMGSALETLSGQAVGAGRFDMLGIYLQRSFIVTGATALCLMPFYIFATPFLKLL  155

Query  543  HQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYVMASVSDVALVGHVLFSWL  364
             Q+  IS+  G ++ W++PQLFAY    PIQ+FLQSQS+++VM  +S  AL+ HV  +W+
Sbjct  156  SQDKEISELAGKYSKWIVPQLFAYAINSPIQKFLQSQSRVWVMTMISMAALIFHVFLNWI  215

Query  363  FMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKGFSQRAFQNLTGFVRLSLA  184
             + KL +G+ G A+  + + W M V   VYV SG   DAW GFS RAF++L  FV+LSLA
Sbjct  216  LVAKLNYGIVGAAIAGDISLWLMVVGLVVYVTSGCFPDAWTGFSLRAFKSLASFVKLSLA  275

Query  183  SGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGWTLMVGVGFSAAIS  22
            S VM CLELWY+ A+IL+ G+  N E++VD  SICMN+  WTLM+ +GF  AIS
Sbjct  276  SAVMLCLELWYYTAVILMVGWLNNPEIAVDAISICMNLQQWTLMISLGFHTAIS  329



>ref|XP_010941865.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Elaeis 
guineensis]
Length=466

 Score =   318 bits (815),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 148/293 (51%), Positives = 212/293 (72%), Gaps = 0/293 (0%)
 Frame = -1

Query  900  EFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHVGNIQLAAVAVENNLIAGFA  721
              + + ++ESKK+W +   AI     Q+SIG +T  FAGH+G ++LAA+++  N+I GFA
Sbjct  3    RLVAKIWNESKKMWQIGGAAILIGVLQFSIGFVTVAFAGHLGVVELAAISIAQNVIEGFA  62

Query  720  FGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNATAIPLTTLYIFSTPILKLLH  541
            +GI+ GMGSALETLCGQA GA +L MLGVY+QRSW+I   TA+ LT +Y F++P+LKL+ 
Sbjct  63   YGILLGMGSALETLCGQAVGAGQLHMLGVYMQRSWVISGVTAMVLTPIYAFTSPMLKLVR  122

Query  540  QNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYVMASVSDVALVGHVLFSWLF  361
            Q+  +S+  G +A W IPQL+AY   FP+Q+F QSQSK++VMA +S V L  H L +W+ 
Sbjct  123  QSKDVSEVAGKYATWTIPQLYAYAMNFPLQKFFQSQSKVWVMAVISGVVLGIHALLNWIL  182

Query  360  MLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKGFSQRAFQNLTGFVRLSLAS  181
            ++K+  GL G A+ ++ +WW + ++Q +Y+VSG   +AW+GFS  AFQNL  FV+LSLAS
Sbjct  183  VIKMGHGLLGAAIAVDVSWWLINLSQMIYLVSGFFPEAWQGFSLLAFQNLAAFVKLSLAS  242

Query  180  GVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGWTLMVGVGFSAAIS  22
             VM CLELWY+ A+I++ G  +N +++V   SICMN   W LM+ +GFSAA+S
Sbjct  243  AVMLCLELWYYTAVIILVGCLQNPKIAVGAISICMNYQLWALMIALGFSAAVS  295



>ref|XP_009626790.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Nicotiana 
tomentosiformis]
Length=493

 Score =   318 bits (816),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 156/309 (50%), Positives = 218/309 (71%), Gaps = 4/309 (1%)
 Frame = -1

Query  948  SFDADAGDIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHVGNI  769
            S + D GDI+  KK+    +++  E+KK+W +A PAI    S +S+  +T  FAG +G++
Sbjct  10   SHETD-GDIQLKKKIA---KKWCVEAKKVWQIAGPAILNAVSLFSLEFVTAAFAGRLGDL  65

Query  768  QLAAVAVENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNATAIP  589
            +LAAV+  +N+IAGF +G+M GM SAL TLCGQA GA +  MLGVYLQRSWII   T++ 
Sbjct  66   ELAAVSEVHNVIAGFVYGVMLGMASALATLCGQAVGAGQFNMLGVYLQRSWIITGFTSLL  125

Query  588  LTTLYIFSTPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYVMAS  409
            LT +++F++PILKLLHQ+  IS   G +A+W+IPQ+FAY   FP+Q+FLQSQSK++ MA 
Sbjct  126  LTPMFVFTSPILKLLHQDKDISHLAGKYAIWIIPQMFAYALNFPMQKFLQSQSKVWFMAI  185

Query  408  VSDVALVGHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKGFSQ  229
             S   L  HVL +W+ ++K  WGL G A+  N +WW + +AQF+Y++SG   +AW GFS 
Sbjct  186  TSMGGLAVHVLLNWILVVKAGWGLFGAAIAGNVSWWLLDIAQFIYIISGYFPEAWTGFSC  245

Query  228  RAFQNLTGFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGWTLMV  49
             AF++LT F++LSLAS +M CLE WYF A+IL+ G  KNA  SVD  SIC+ +  WTL V
Sbjct  246  LAFKSLTNFLKLSLASAIMVCLEFWYFTAVILMVGGFKNATTSVDAISICIGLQLWTLTV  305

Query  48   GVGFSAAIS  22
              GF+++ S
Sbjct  306  AYGFTSSTS  314



>ref|NP_001050703.1| Os03g0626700 [Oryza sativa Japonica Group]
 gb|AAL31693.1|AC092390_14 putative multidrug efflux protein [Oryza sativa Japonica Group]
 gb|AAR01662.1| putative MATE efflux family protein [Oryza sativa Japonica Group]
 gb|ABF97717.1| MATE efflux family protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF12617.1| Os03g0626700 [Oryza sativa Japonica Group]
Length=477

 Score =   317 bits (813),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 152/293 (52%), Positives = 212/293 (72%), Gaps = 0/293 (0%)
 Frame = -1

Query  900  EFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHVGNIQLAAVAVENNLIAGFA  721
            + + + + ESK LW++A PAI T   Q+SIG +T  F GH+G ++LAAV V  N+I GFA
Sbjct  3    KLVSKSWQESKLLWHIAFPAILTAVFQFSIGFVTVGFVGHIGQVELAAVTVVENVIEGFA  62

Query  720  FGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNATAIPLTTLYIFSTPILKLLH  541
            +G++ GMGSALETLCGQA GA ++ MLGVY+QRSWII  ATA+ LT  Y+F+  IL  L 
Sbjct  63   YGVLLGMGSALETLCGQAVGAGQVSMLGVYIQRSWIICGATAVILTPTYVFTAGILIGLR  122

Query  540  QNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYVMASVSDVALVGHVLFSWLF  361
            Q   I+   GT+  W+IPQLFAY   FP+Q+F QSQSK++ M ++S +AL  HV+ +++F
Sbjct  123  QPTDIAAVAGTYTRWVIPQLFAYAANFPLQKFFQSQSKVWAMTAISGIALALHVVLNYIF  182

Query  360  MLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKGFSQRAFQNLTGFVRLSLAS  181
            + +L  GL   A++ N TWW + +AQF+Y+VSG   +AWKGFS  AF+NL  FV+LSLAS
Sbjct  183  LTRLGHGLVAAALIGNVTWWLIILAQFIYLVSGCFPEAWKGFSMLAFKNLAAFVKLSLAS  242

Query  180  GVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGWTLMVGVGFSAAIS  22
             +M CLELWY+ A++++ G  K+A++ VD  S+C+N   WTLMV +GF+AA+S
Sbjct  243  AIMLCLELWYYTAVLILVGLLKDAKLQVDVMSVCINYQLWTLMVALGFNAAVS  295



>ref|XP_008804797.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Phoenix dactylifera]
 ref|XP_008804798.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Phoenix dactylifera]
Length=476

 Score =   317 bits (812),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 153/287 (53%), Positives = 202/287 (70%), Gaps = 0/287 (0%)
 Frame = -1

Query  891  REFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHVGNIQLAAVAVENNLIAGFAFGI  712
            R  + ESKKLW + APAIF+    YS+  ITQ FAGH+G+++LAA+++ N ++ GF FG+
Sbjct  24   RRTWEESKKLWRIVAPAIFSRVVTYSMNVITQAFAGHLGDLELAAMSIANTVVVGFNFGL  83

Query  711  MYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNATAIPLTTLYIFSTPILKLLHQNP  532
            M GM SALETLCGQAFGAKK  MLG+Y+QRSWI+L   A+ L  +Y F+TPIL LL Q P
Sbjct  84   MLGMASALETLCGQAFGAKKYHMLGIYMQRSWIVLFLCAVLLLPMYFFATPILVLLGQPP  143

Query  531  HISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYVMASVSDVALVGHVLFSWLFMLK  352
             ++   G  ++W IP  F++VF FP+QRFLQSQ K  + A +S +A+V H+  SWLF+ K
Sbjct  144  ELAALAGKVSIWFIPLHFSFVFLFPLQRFLQSQLKNAINAYISAIAMVVHIFISWLFVSK  203

Query  351  LRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKGFSQRAFQNLTGFVRLSLASGVM  172
            L++GL G A  LN +WW     QF+YV  G C  +W GFS  AF  L  F++LS ASGVM
Sbjct  204  LQFGLTGTAATLNFSWWVAVACQFLYVSCGGCPHSWHGFSMEAFAGLWEFLKLSAASGVM  263

Query  171  FCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGWTLMVGVGFSA  31
             CLE WY+  LIL+ G  +NAE++VD  SICM+I+GW LM+ +GF A
Sbjct  264  LCLENWYYRILILLTGNLRNAEIAVDALSICMSINGWELMIPLGFFA  310



>ref|XP_006365500.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Solanum tuberosum]
Length=497

 Score =   317 bits (813),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 157/315 (50%), Positives = 219/315 (70%), Gaps = 5/315 (2%)
 Frame = -1

Query  966  NMSSVYSFDADAGDIRQIKKVKEFIREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFA  787
            N      F+ D  D       K+  ++  +ESKKLW +AAPAI T  SQ+SIG ++  F 
Sbjct  8    NFEMERRFEGDDCD-----DAKKMSKKSLNESKKLWEIAAPAIITAVSQFSIGFVSIAFV  62

Query  786  GHVGNIQLAAVAVENNLIAGFAFGIMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIIL  607
            GH+G+++LAA++V  N++ GF FGIM GMGSALETLCGQA GA + +MLGV LQRS +I 
Sbjct  63   GHLGSLELAAISVVQNVVEGFVFGIMLGMGSALETLCGQAVGAGQFDMLGVNLQRSCVIT  122

Query  606  NATAIPLTTLYIFSTPILKLLHQNPHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSK  427
             ATA+ LT  Y+F++ ILKLLHQ+  IS+  G +A+W+IPQL+AY   FP+Q+FLQ+QSK
Sbjct  123  LATALLLTPFYVFTSQILKLLHQDKEISEVAGKYAIWVIPQLYAYALNFPVQKFLQAQSK  182

Query  426  IYVMASVSDVALVGHVLFSWLFMLKLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDA  247
            I+VM  ++ V LV H++ +W+ + KL  GL G A+  N +WW + +AQ  YV++G   ++
Sbjct  183  IWVMTVINIVILVFHIVLNWVLVTKLGHGLFGAAMAGNVSWWLVVLAQIFYVIAGFFPES  242

Query  246  WKGFSQRAFQNLTGFVRLSLASGVMFCLELWYFVALILIAGYTKNAEVSVDGTSICMNIS  67
            W GFS  AF++L  FV+LSLAS VM CLELWYF  + L+ G+ KN E++VD  S  + + 
Sbjct  243  WTGFSMLAFKSLWSFVKLSLASAVMLCLELWYFTVVNLMVGWLKNPEIAVDAISTSLALQ  302

Query  66   GWTLMVGVGFSAAIS  22
             W LM+ +GF+AAIS
Sbjct  303  LWVLMIALGFNAAIS  317



>tpg|DAA50400.1| TPA: putative MATE efflux family protein [Zea mays]
Length=495

 Score =   317 bits (812),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 149/291 (51%), Positives = 210/291 (72%), Gaps = 0/291 (0%)
 Frame = -1

Query  894  IREFYSESKKLWYLAAPAIFTIASQYSIGAITQVFAGHVGNIQLAAVAVENNLIAGFAFG  715
            + + + ESK LW++A PAI T   Q+SIG +T  F GH+G+++LAAV V  N+I GFA+G
Sbjct  17   VSKSWQESKLLWHIAFPAILTAVFQFSIGFVTVGFVGHIGSVELAAVTVVENVIEGFAYG  76

Query  714  IMYGMGSALETLCGQAFGAKKLEMLGVYLQRSWIILNATAIPLTTLYIFSTPILKLLHQN  535
            ++ GMGSALETLCGQA GA ++ MLGVY+QRSWII  ATA+ LT  Y+F+ PIL+ L Q 
Sbjct  77   VLLGMGSALETLCGQAVGAGQVGMLGVYIQRSWIICGATAVLLTPTYLFTAPILRALRQP  136

Query  534  PHISKAVGTFAVWMIPQLFAYVFTFPIQRFLQSQSKIYVMASVSDVALVGHVLFSWLFML  355
              +++  G +  W++PQLFAY   FP+Q+F Q+QS+++V+ ++S  AL  HV  +++F+ 
Sbjct  137  ADVARVAGAYCRWVLPQLFAYAANFPLQKFFQAQSRVWVVTAISGAALALHVALNYVFVA  196

Query  354  KLRWGLPGGAVVLNTTWWFMAVAQFVYVVSGACGDAWKGFSQRAFQNLTGFVRLSLASGV  175
            ++  GLP  A V N TWW +  AQ  Y++SG   DAW+GFS+ AF NL  FV+LSLAS V
Sbjct  197  RMGHGLPAAAAVGNVTWWLVIAAQVAYLLSGRFEDAWRGFSRLAFANLAAFVKLSLASAV  256

Query  174  MFCLELWYFVALILIAGYTKNAEVSVDGTSICMNISGWTLMVGVGFSAAIS  22
            M CLELWY+ A++++ G+ KNA + +D  SIC+N   WTLMV +GF+AA+S
Sbjct  257  MLCLELWYYTAVLILVGFLKNARLQIDVMSICINYQLWTLMVALGFNAAVS  307



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2181636186120