BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c24252_g1_i3 len=1704 path=[1407:0-354 1762:355-468 1876:469-503
1911:504-590 1998:591-622 2030:623-794 2202:795-829 1063:830-937
1171:938-980 2397:981-1268 2685:1269-1335 2752:1336-1346
2763:1347-1436 2852:1437-1703]

Length=1704
                                                                      Score     E

ref|XP_002527482.1|  conserved hypothetical protein                     159   2e-37   Ricinus communis
ref|XP_007021012.1|  Leucine-rich repeat containing protein             116   1e-23   
ref|XP_008245605.1|  PREDICTED: putative disease resistance prote...    111   2e-22   
ref|XP_008245602.1|  PREDICTED: putative disease resistance prote...    110   1e-21   
gb|KDP43573.1|  hypothetical protein JCGZ_16860                         108   3e-21   
ref|XP_008375226.1|  PREDICTED: putative disease resistance prote...    100   6e-20   
ref|XP_002526758.1|  Disease resistance protein RGA2, putative          104   7e-20   Ricinus communis
ref|XP_008346939.1|  PREDICTED: putative disease resistance prote...  99.8    9e-20   
ref|XP_002309702.2|  NBS-LRR resistance protein RGH2                    103   9e-20   Populus trichocarpa [western balsam poplar]
ref|XP_011002334.1|  PREDICTED: putative disease resistance prote...    103   1e-19   
ref|XP_007009925.1|  DHHC-type zinc finger family protein               102   2e-19   
ref|XP_011031366.1|  PREDICTED: LOW QUALITY PROTEIN: putative dis...    102   2e-19   
gb|KDP43576.1|  hypothetical protein JCGZ_16863                         102   3e-19   
ref|XP_007021002.1|  Leucine-rich repeat containing protein             102   4e-19   
ref|XP_008375193.1|  PREDICTED: disease resistance protein RGA2-like    101   6e-19   
ref|XP_009354780.1|  PREDICTED: disease resistance protein RGA2-like    101   6e-19   
ref|XP_011002411.1|  PREDICTED: putative disease resistance prote...    100   9e-19   
gb|KGN45111.1|  hypothetical protein Csa_7G426520                       100   1e-18   
ref|XP_004136126.1|  PREDICTED: putative disease resistance prote...    100   1e-18   
ref|XP_006451769.1|  hypothetical protein CICLE_v10007328mg           98.6    4e-18   
ref|XP_003612759.1|  Nbs-lrr resistance protein                       98.6    5e-18   
ref|XP_003612736.1|  Cc-nbs-lrr resistance protein                    97.8    9e-18   
gb|AHG28989.1|  NBS-LRR protein                                       97.1    9e-18   
gb|AAO37646.1|  NBS-LRR resistance protein RGH2                       97.1    1e-17   Manihot esculenta [manioc]
ref|XP_010112014.1|  hypothetical protein L484_004701                 96.3    1e-17   
gb|AAO37645.1|  NBS-LRR resistance protein RGH1                       97.1    2e-17   Manihot esculenta [manioc]
ref|XP_011031388.1|  PREDICTED: LOW QUALITY PROTEIN: putative dis...  95.9    3e-17   
ref|XP_009368038.1|  PREDICTED: disease resistance protein RGA2-like  95.9    4e-17   
ref|XP_008350664.1|  PREDICTED: putative disease resistance prote...  95.5    5e-17   
gb|KEH38630.1|  NBS-LRR type disease resistance protein               95.1    5e-17   
ref|XP_009354779.1|  PREDICTED: disease resistance protein RGA2-like  95.1    6e-17   
ref|XP_007020994.1|  Leucine-rich repeat containing protein           94.7    9e-17   
ref|XP_009368142.1|  PREDICTED: disease resistance protein RGA2-like  94.4    1e-16   
ref|XP_002309704.2|  NBS-LRR resistance protein RGH2                  94.4    1e-16   Populus trichocarpa [western balsam poplar]
ref|XP_007020992.1|  Leucine-rich repeat containing protein           93.6    1e-16   
ref|XP_008461343.1|  PREDICTED: putative disease resistance prote...  93.2    2e-16   
ref|XP_009354721.1|  PREDICTED: putative disease resistance prote...  93.2    2e-16   
ref|XP_006382175.1|  hypothetical protein POPTR_0006s29070g           93.6    2e-16   
ref|XP_008367078.1|  PREDICTED: putative disease resistance prote...  90.5    4e-16   
ref|XP_008461339.1|  PREDICTED: disease resistance protein RGA2-l...  92.4    4e-16   
ref|XP_008461338.1|  PREDICTED: disease resistance protein RGA2-l...  92.4    4e-16   
ref|XP_008350652.1|  PREDICTED: disease resistance protein RGA2-like  92.4    4e-16   
ref|XP_007021003.1|  Leucine-rich repeat containing protein           92.4    5e-16   
gb|AET01334.2|  NB-ARC domain disease resistance protein              91.7    7e-16   
ref|XP_008346971.1|  PREDICTED: disease resistance protein RGA2-like  91.7    7e-16   
ref|XP_010097657.1|  Putative disease resistance protein RGA4         91.7    8e-16   
ref|XP_003626858.1|  Nbs-lrr resistance protein                       91.3    9e-16   
ref|XP_006382153.1|  hypothetical protein POPTR_0006s28900g           90.5    2e-15   
ref|XP_011002412.1|  PREDICTED: putative disease resistance prote...  89.0    2e-15   
ref|XP_008341432.1|  PREDICTED: putative disease resistance prote...  86.7    2e-15   
ref|XP_010097660.1|  Putative disease resistance protein RGA4         89.7    3e-15   
gb|KDP43489.1|  hypothetical protein JCGZ_16776                       89.7    3e-15   
ref|XP_008245639.1|  PREDICTED: putative disease resistance prote...  87.8    6e-15   
ref|XP_007021013.1|  Leucine-rich repeat containing protein           88.2    9e-15   
gb|KHF99762.1|  Putative disease resistance RGA3                      86.7    1e-14   
gb|KDP42480.1|  hypothetical protein JCGZ_00277                       87.4    1e-14   
ref|XP_003626845.1|  NBS resistance protein                           87.4    1e-14   
ref|XP_011031339.1|  PREDICTED: putative disease resistance prote...  87.4    1e-14   
ref|XP_007021016.1|  Leucine-rich repeat containing protein           87.4    1e-14   
ref|XP_006572949.1|  PREDICTED: putative disease resistance prote...  87.4    2e-14   
ref|XP_007021014.1|  Leucine-rich repeat containing protein, puta...  86.3    3e-14   
ref|XP_006382155.1|  hypothetical protein POPTR_0006s28910g           83.2    4e-14   
ref|XP_008461342.1|  PREDICTED: disease resistance protein RGA2-l...  85.5    5e-14   
ref|XP_003635897.1|  Cc-nbs-lrr resistance protein                    85.5    6e-14   
ref|XP_011002332.1|  PREDICTED: putative disease resistance prote...  84.7    1e-13   
ref|XP_003626884.1|  Cc-nbs-lrr resistance protein                    84.3    1e-13   
gb|KHN40424.1|  Putative disease resistance protein RGA4              84.7    1e-13   
ref|XP_010097418.1|  hypothetical protein L484_009642                 83.6    1e-13   
ref|XP_008368959.1|  PREDICTED: disease resistance protein RGA2-like  84.3    1e-13   
gb|KDP37632.1|  hypothetical protein JCGZ_07831                       83.2    1e-13   
ref|XP_003612713.1|  NBS-containing resistance-like protein           83.6    2e-13   
ref|XP_003621452.1|  Nbs-lrr resistance protein                       83.6    2e-13   
gb|AET01380.2|  disease resistance protein (TIR-NBS-LRR class), p...  83.6    3e-13   
ref|XP_006382147.1|  hypothetical protein POPTR_0006s28850g           83.2    3e-13   
ref|XP_003626903.1|  NBS resistance protein                           83.2    3e-13   
ref|XP_008363331.1|  PREDICTED: putative disease resistance prote...  82.8    4e-13   
gb|KGN45100.1|  hypothetical protein Csa_7G425920                     82.4    5e-13   
ref|XP_004136128.1|  PREDICTED: putative disease resistance prote...  82.4    6e-13   
gb|KHG28036.1|  Putative disease resistance RGA1                      79.0    6e-13   
ref|XP_008355462.1|  PREDICTED: putative disease resistance prote...  80.9    8e-13   
ref|XP_004245923.1|  PREDICTED: putative disease resistance prote...  81.6    8e-13   
ref|XP_011031341.1|  PREDICTED: putative disease resistance prote...  81.6    8e-13   
ref|XP_008389184.1|  PREDICTED: disease resistance protein RGA2-l...  81.6    9e-13   
ref|XP_008389186.1|  PREDICTED: disease resistance protein RGA2-l...  81.6    9e-13   
ref|XP_008375181.1|  PREDICTED: putative disease resistance prote...  81.3    1e-12   
gb|KEH25217.1|  NBS-LRR disease resistance protein                    80.9    1e-12   
ref|XP_003612767.1|  Cc-nbs-lrr resistance protein                    80.9    2e-12   
ref|XP_003638275.1|  Cc-nbs-lrr resistance protein                    78.6    2e-12   
gb|KDP37636.1|  hypothetical protein JCGZ_07835                       80.5    2e-12   
gb|KEH40164.1|  disease resistance protein RGA4                       80.5    2e-12   
ref|XP_003612744.1|  hypothetical protein MTR_5g028420                80.5    2e-12   
gb|KEH19079.1|  disease resistance protein (TIR-NBS-LRR class), p...  80.5    3e-12   
gb|KEH19080.1|  disease resistance protein (TIR-NBS-LRR class), p...  80.5    3e-12   
sp|Q7XA39.1|RGA4_SOLBU  RecName: Full=Putative disease resistance...  79.7    4e-12   Solanum bulbocastanum [ornamental nightshade]
gb|AAP45174.1|  Putative disease resistance protein RGA4, identical   79.7    4e-12   Solanum bulbocastanum [ornamental nightshade]
gb|KHG19991.1|  Putative disease resistance RGA3                      79.7    4e-12   
ref|XP_008368960.1|  PREDICTED: putative disease resistance prote...  79.7    4e-12   
gb|KEH18640.1|  NBS-LRR type disease resistance protein               79.3    4e-12   
gb|AAR29072.1|  blight resistance protein RGA4                        79.3    5e-12   Solanum bulbocastanum [ornamental nightshade]
ref|XP_006573928.1|  PREDICTED: putative disease resistance prote...  79.3    5e-12   
gb|KHN40429.1|  Putative disease resistance protein RGA4              79.0    5e-12   
ref|XP_009368061.1|  PREDICTED: disease resistance protein RGA2-like  79.3    5e-12   
ref|XP_006364463.1|  PREDICTED: putative disease resistance prote...  79.3    5e-12   
gb|KDP40558.1|  hypothetical protein JCGZ_24557                       78.6    6e-12   
gb|AAP45188.2|  Disease resistance protein RGA2, putative             79.0    6e-12   Solanum bulbocastanum [ornamental nightshade]
gb|KHG19082.1|  Putative disease resistance RGA4                      78.2    8e-12   
ref|XP_003589381.1|  Resistance protein                               78.6    8e-12   
ref|XP_003626846.1|  Nbs-lrr resistance protein                       78.2    1e-11   
ref|XP_009338800.1|  PREDICTED: putative disease resistance prote...  77.4    1e-11   
gb|ACY74346.1|  blight resistance protein RGA2                        78.2    1e-11   Capsicum annuum
ref|XP_011089014.1|  PREDICTED: putative disease resistance prote...  78.2    1e-11   
ref|XP_003623515.1|  NBS resistance protein                           77.8    1e-11   
gb|AAR29071.1|  blight resistance protein RGA3                        77.8    1e-11   Solanum bulbocastanum [ornamental nightshade]
gb|AES95690.2|  LRR and NB-ARC domain disease resistance protein,...  77.8    1e-11   
ref|XP_006352941.1|  PREDICTED: putative disease resistance prote...  77.8    1e-11   
ref|XP_003612732.1|  Cc-nbs-lrr resistance protein                    77.8    2e-11   
ref|XP_003615650.1|  NBS-LRR resistance protein                       77.8    2e-11   
gb|AES98608.2|  NB-ARC domain disease resistance protein              77.4    2e-11   
ref|XP_006366885.1|  PREDICTED: putative disease resistance prote...  77.4    2e-11   
ref|XP_010097431.1|  Putative disease resistance protein RGA3         76.6    3e-11   
ref|XP_010026803.1|  PREDICTED: disease resistance protein RGA2-like  76.6    3e-11   
ref|XP_008354960.1|  PREDICTED: putative disease resistance prote...  76.3    4e-11   
ref|XP_008465543.1|  PREDICTED: putative disease resistance prote...  75.1    4e-11   
ref|XP_010671992.1|  PREDICTED: disease resistance protein RGA2-like  76.3    4e-11   
gb|ACI25289.1|  late blight resistance protein Rpi-pta1               76.3    4e-11   Solanum stoloniferum
gb|ACI25288.1|  late blight resistance protein Rpi-sto1               76.3    4e-11   Solanum stoloniferum
sp|Q7XBQ9.1|RGA2_SOLBU  RecName: Full=Disease resistance protein ...  76.3    4e-11   Solanum bulbocastanum [ornamental nightshade]
ref|XP_006586822.1|  PREDICTED: putative disease resistance prote...  76.3    5e-11   
ref|XP_010659415.1|  PREDICTED: putative disease resistance prote...  75.9    5e-11   
gb|KEH26310.1|  NBS-LRR type disease resistance protein               75.9    6e-11   
ref|XP_010659434.1|  PREDICTED: putative disease resistance prote...  75.5    6e-11   
ref|XP_010659433.1|  PREDICTED: putative disease resistance prote...  75.9    6e-11   
ref|XP_007158237.1|  hypothetical protein PHAVU_002G135600g           75.9    6e-11   
sp|Q7XA42.2|RGA1_SOLBU  RecName: Full=Putative disease resistance...  75.9    6e-11   Solanum bulbocastanum [ornamental nightshade]
ref|XP_006352943.1|  PREDICTED: disease resistance protein RGA2-like  75.5    7e-11   
ref|XP_008384979.1|  PREDICTED: disease resistance protein RGA2-like  75.1    9e-11   
ref|XP_003615681.1|  NBS-LRR resistance protein                       75.1    1e-10   
ref|XP_008354961.1|  PREDICTED: putative disease resistance prote...  74.7    1e-10   
ref|XP_010672031.1|  PREDICTED: disease resistance protein RGA2-like  74.7    1e-10   
ref|XP_004169506.1|  PREDICTED: putative disease resistance prote...  74.3    1e-10   
ref|XP_003626855.1|  Cc-nbs-lrr resistance protein                    74.3    2e-10   
gb|AET01331.2|  LRR and NB-ARC domain disease resistance protein      73.9    2e-10   
gb|AES96274.2|  disease resistance protein (TIR-NBS-LRR class), p...  72.8    2e-10   
gb|KCW60238.1|  hypothetical protein EUGRSUZ_H02952                   73.9    2e-10   
ref|XP_008461414.1|  PREDICTED: putative disease resistance prote...  73.6    3e-10   
ref|XP_010659380.1|  PREDICTED: disease resistance protein RGA2-l...  73.6    3e-10   
gb|AFU51534.1|  blight resistance protein RGA4                        73.6    3e-10   
ref|XP_008346968.1|  PREDICTED: putative disease resistance prote...  71.2    4e-10   
ref|XP_010922082.1|  PREDICTED: putative disease resistance prote...  73.2    4e-10   
ref|XP_008362780.1|  PREDICTED: disease resistance protein RGA2-like  72.8    4e-10   
ref|XP_010325692.1|  PREDICTED: LOW QUALITY PROTEIN: putative dis...  73.2    4e-10   
ref|XP_008461318.1|  PREDICTED: LOW QUALITY PROTEIN: putative dis...  73.2    4e-10   
gb|KHG16658.1|  Putative disease resistance RGA3                      71.2    7e-10   
ref|XP_003636514.1|  NBS-LRR resistance-like protein 1O               72.0    8e-10   
gb|KHG00979.1|  Putative disease resistance RGA4                      72.0    8e-10   
ref|XP_004489083.1|  PREDICTED: putative disease resistance prote...  71.6    1e-09   
ref|XP_002265970.1|  PREDICTED: putative disease resistance prote...  71.6    1e-09   Vitis vinifera
ref|XP_003615737.1|  NBS-LRR resistance protein                       71.2    1e-09   
gb|KHG11137.1|  Putative disease resistance RGA4                      70.9    2e-09   
gb|KEH40552.1|  NB-ARC domain disease resistance protein              71.2    2e-09   
emb|CBI35059.3|  unnamed protein product                              71.2    2e-09   
gb|AES98695.2|  disease resistance protein RGA4                       71.2    2e-09   
gb|AAP45181.2|  Disease resistant protein rga3, putative              70.9    2e-09   Solanum bulbocastanum [ornamental nightshade]
ref|XP_010670790.1|  PREDICTED: putative disease resistance prote...  70.9    2e-09   
ref|XP_008341719.1|  PREDICTED: putative disease resistance prote...  70.5    2e-09   
ref|XP_008346938.1|  PREDICTED: putative disease resistance RPP13...  70.1    3e-09   
ref|XP_003615749.1|  NBS-LRR resistance protein                       69.7    4e-09   
emb|CAJ44366.1|  putative CC-NBS-LRR resistance protein               69.7    5e-09   Malus domestica [apple tree]
ref|XP_010683936.1|  PREDICTED: putative disease resistance prote...  69.3    6e-09   
ref|XP_003615699.1|  NBS-LRR resistance protein                       69.3    7e-09   
ref|XP_003615700.1|  NBS-LRR resistance protein                       69.3    7e-09   
ref|XP_003613316.1|  Cc-nbs-lrr resistance protein                    68.6    7e-09   
ref|XP_010097435.1|  Putative disease resistance protein RGA1         68.9    8e-09   
ref|XP_010659351.1|  PREDICTED: putative disease resistance prote...  68.9    9e-09   
ref|XP_002519373.1|  leucine-rich repeat containing protein, puta...  68.9    1e-08   Ricinus communis
ref|XP_010026779.1|  PREDICTED: putative disease resistance prote...  68.6    1e-08   
emb|CAN67734.1|  hypothetical protein VITISV_017638                   68.6    1e-08   Vitis vinifera
ref|XP_010677314.1|  PREDICTED: uncharacterized protein LOC104892985  68.6    1e-08   
gb|ABO28718.1|  RB                                                    68.6    1e-08   Solanum verrucosum
gb|KDO49259.1|  hypothetical protein CISIN_1g001955mg                 68.6    1e-08   
ref|XP_007151318.1|  hypothetical protein PHAVU_004G036300g           68.6    1e-08   
gb|KEH25215.1|  disease resistance protein (CC-NBS-LRR class) fam...  68.6    1e-08   
ref|XP_004489884.1|  PREDICTED: putative disease resistance prote...  68.2    1e-08   
ref|XP_003615746.1|  Nbs-lrr resistance protein                       68.2    1e-08   
gb|KHF98275.1|  Putative disease resistance RGA4                      67.0    1e-08   
ref|XP_008777415.1|  PREDICTED: LOW QUALITY PROTEIN: disease resi...  68.2    2e-08   
ref|XP_007148940.1|  hypothetical protein PHAVU_005G027200g           67.8    2e-08   
ref|XP_011013380.1|  PREDICTED: putative disease resistance prote...  68.2    2e-08   
gb|AAR29076.1|  blight resistance protein T118                        67.8    2e-08   Solanum tarijense
gb|ADB43255.1|  blight resistance protein                             67.8    2e-08   Capsicum annuum
gb|AAR29074.1|  blight resistance protein SH10                        67.4    2e-08   Solanum tuberosum [potatoes]
ref|XP_006478603.1|  PREDICTED: putative disease resistance prote...  67.4    2e-08   
gb|KHN46313.1|  Putative disease resistance RPP13-like protein 1      67.0    3e-08   
ref|XP_007045385.1|  LRR and NB-ARC domains-containing disease re...  67.4    3e-08   
ref|XP_006382130.1|  hypothetical protein POPTR_0006s28680g           64.3    3e-08   
gb|ACI16480.1|  NBS-LRR resistance protein                            67.0    3e-08   Solanum bulbocastanum [ornamental nightshade]
emb|CBI21772.3|  unnamed protein product                              67.0    3e-08   
sp|Q7XA40.2|RGA3_SOLBU  RecName: Full=Putative disease resistance...  66.6    4e-08   Solanum bulbocastanum [ornamental nightshade]
ref|XP_003615721.1|  NBS-LRR resistance protein                       66.6    5e-08   
ref|XP_011038426.1|  PREDICTED: putative disease resistance prote...  66.6    5e-08   
gb|ACV53507.1|  blight resistance protein RGA1                        66.6    5e-08   Capsicum annuum
ref|XP_003615728.1|  NBS-LRR resistance protein                       66.6    5e-08   
ref|XP_006442837.1|  hypothetical protein CICLE_v100189572mg          66.2    5e-08   
gb|KDO64057.1|  hypothetical protein CISIN_1g003435mg                 66.2    5e-08   
ref|XP_002529992.1|  ATP binding protein, putative                    66.2    5e-08   Ricinus communis
ref|XP_010683667.1|  PREDICTED: putative disease resistance prote...  66.2    5e-08   
ref|XP_006366683.1|  PREDICTED: putative disease resistance prote...  66.2    6e-08   
gb|AHG28983.1|  NBS-LRR protein                                       66.2    6e-08   
ref|XP_007158232.1|  hypothetical protein PHAVU_002G135100g           66.2    7e-08   
ref|XP_010683671.1|  PREDICTED: putative disease resistance prote...  64.7    7e-08   
gb|ABO28722.1|  RB                                                    65.9    8e-08   Solanum verrucosum
ref|XP_008240993.1|  PREDICTED: disease resistance protein RGA2-like  65.5    8e-08   
ref|XP_004490619.1|  PREDICTED: putative disease resistance prote...  65.9    9e-08   
ref|XP_004157298.1|  PREDICTED: putative disease resistance prote...  65.5    9e-08   
emb|CBI21737.3|  unnamed protein product                              65.1    1e-07   
ref|XP_009365072.1|  PREDICTED: disease resistance protein RGA2-like  62.4    1e-07   
ref|XP_010102916.1|  Putative disease resistance protein RGA4         65.5    1e-07   
ref|XP_008231364.1|  PREDICTED: putative disease resistance prote...  65.5    1e-07   
gb|KGN66116.1|  hypothetical protein Csa_1G572370                     65.1    1e-07   
gb|KCW60240.1|  hypothetical protein EUGRSUZ_H02956                   65.1    1e-07   
ref|XP_006586821.1|  PREDICTED: putative disease resistance prote...  63.2    1e-07   
ref|XP_006383307.1|  hypothetical protein POPTR_0005s14320g           65.1    1e-07   
ref|XP_008222898.1|  PREDICTED: putative disease resistance prote...  65.1    1e-07   
emb|CBI24932.3|  unnamed protein product                              64.3    1e-07   
ref|XP_007030144.1|  Leucine-rich repeat containing protein isofo...  64.7    2e-07   
ref|XP_010644917.1|  PREDICTED: putative disease resistance prote...  64.7    2e-07   
ref|XP_003615790.1|  Nbs-lrr resistance protein                       64.7    2e-07   
dbj|BAG49729.1|  disease resistance protein                           64.7    2e-07   Capsicum chinense [bonnet pepper]
ref|XP_010659529.1|  PREDICTED: putative disease resistance prote...  64.3    2e-07   
ref|XP_010670884.1|  PREDICTED: putative disease resistance prote...  63.2    2e-07   
gb|AAS49213.1|  disease resistance protein                            64.3    3e-07   Glycine max [soybeans]
ref|XP_007133656.1|  hypothetical protein PHAVU_011G198000g           64.3    3e-07   
emb|CDP11107.1|  unnamed protein product                              63.9    3e-07   
ref|XP_006345413.1|  PREDICTED: putative disease resistance prote...  63.5    4e-07   
ref|XP_010088204.1|  hypothetical protein L484_012484                 62.4    4e-07   
ref|XP_007162224.1|  hypothetical protein PHAVU_001G134400g           63.5    4e-07   
ref|XP_010918021.1|  PREDICTED: putative disease resistance prote...  63.5    4e-07   
ref|XP_003615706.1|  NBS-LRR resistance protein                       63.5    4e-07   
ref|XP_010088685.1|  Putative disease resistance protein RGA3         63.5    4e-07   
ref|XP_008375185.1|  PREDICTED: putative disease resistance prote...  63.2    4e-07   
ref|XP_007162223.1|  hypothetical protein PHAVU_001G134400g           63.2    4e-07   
ref|XP_007203607.1|  hypothetical protein PRUPE_ppb024266mg           63.2    4e-07   
ref|XP_009365073.1|  PREDICTED: putative disease resistance prote...  63.2    5e-07   
gb|AES98664.2|  disease resistance protein RGA4                       63.2    5e-07   
ref|XP_007133584.1|  hypothetical protein PHAVU_011G191400g           63.2    5e-07   
emb|CAJ44364.1|  putative CC-NBS-LRR resistance protein               63.2    5e-07   Malus domestica [apple tree]
gb|AES88483.2|  LRR and NB-ARC domain disease resistance protein      63.2    5e-07   
ref|XP_007021001.1|  Leucine-rich repeat containing-like protein      62.4    6e-07   
ref|XP_006382128.1|  hypothetical protein POPTR_0006s28660g           62.8    7e-07   
ref|XP_004169508.1|  PREDICTED: putative disease resistance prote...  62.4    8e-07   
ref|XP_008803720.1|  PREDICTED: putative disease resistance prote...  62.8    8e-07   
ref|XP_003606286.1|  NBS resistance protein                           62.8    8e-07   
gb|KGN45102.1|  hypothetical protein Csa_7G425940                     62.4    8e-07   
ref|XP_009354774.1|  PREDICTED: disease resistance protein RGA2-like  62.4    8e-07   
ref|XP_006371429.1|  hypothetical protein POPTR_0019s10300g           62.4    9e-07   
gb|KHG15117.1|  Putative disease resistance RGA4                      61.2    9e-07   
ref|XP_010904851.1|  PREDICTED: putative disease resistance prote...  62.0    1e-06   
ref|XP_003615648.1|  NBS-LRR resistance protein                       62.4    1e-06   
ref|XP_007162225.1|  hypothetical protein PHAVU_001G134500g           62.0    1e-06   
gb|KEH25299.1|  disease resistance protein (NBS-LRR class) family...  61.2    1e-06   
gb|AES98606.2|  disease resistance protein RGA3                       62.0    1e-06   
ref|XP_004136127.1|  PREDICTED: putative disease resistance prote...  62.0    1e-06   
ref|XP_007162212.1|  hypothetical protein PHAVU_001G133400g           61.6    1e-06   
gb|EYU17619.1|  hypothetical protein MIMGU_mgv1a020513mg              61.6    1e-06   
ref|XP_009598856.1|  PREDICTED: putative disease resistance prote...  61.6    1e-06   
ref|XP_010671893.1|  PREDICTED: putative disease resistance prote...  61.6    1e-06   
gb|AAR19098.1|  NBS-LRR type disease resistance protein Hom-F         61.6    2e-06   Glycine max [soybeans]
ref|XP_008450703.1|  PREDICTED: putative disease resistance prote...  61.6    2e-06   
ref|XP_007133612.1|  hypothetical protein PHAVU_011G194000g           61.6    2e-06   
ref|XP_003619356.1|  NBS-LRR resistance protein                       61.6    2e-06   
ref|XP_002527841.1|  conserved hypothetical protein                   60.1    2e-06   Ricinus communis
gb|AAR29075.1|  blight resistance protein SH20                        61.6    2e-06   Solanum tuberosum [potatoes]
ref|XP_003598558.1|  NBS-containing resistance-like protein           61.2    2e-06   
gb|AES68809.2|  NBS-LRR type disease resistance protein               61.2    2e-06   
ref|XP_007150947.1|  hypothetical protein PHAVU_004G008100g           61.2    2e-06   
ref|XP_003626885.1|  Cc-nbs-lrr resistance protein                    61.2    2e-06   
gb|AET01361.2|  NB-ARC domain disease resistance protein              61.2    2e-06   
emb|CDP20919.1|  unnamed protein product                              61.2    2e-06   
gb|KCW84401.1|  hypothetical protein EUGRSUZ_B01256                   61.2    2e-06   
ref|XP_003606009.1|  NBS-containing resistance-like protein           60.8    2e-06   
gb|KEH26195.1|  NBS-LRR type disease resistance protein               61.2    2e-06   
ref|XP_011097211.1|  PREDICTED: putative disease resistance prote...  61.2    2e-06   
gb|KEH16617.1|  disease resistance protein                            61.2    2e-06   
ref|XP_003621740.1|  Cc-nbs-lrr resistance protein                    60.5    2e-06   
ref|XP_003637363.1|  Nbs-lrr resistance protein                       60.8    2e-06   
ref|XP_006594336.1|  PREDICTED: putative disease resistance prote...  60.8    3e-06   
ref|XP_003626880.1|  Cc-nbs-lrr resistance protein                    60.8    3e-06   
ref|XP_010066297.1|  PREDICTED: putative disease resistance prote...  60.8    3e-06   
gb|AAR19099.1|  NBS-LRR type disease resistance protein Hom-B         60.8    3e-06   
ref|XP_006388568.1|  hypothetical protein POPTR_0154s00230g           60.8    3e-06   
ref|XP_006372598.1|  hypothetical protein POPTR_0017s03100g           60.8    3e-06   
gb|KHN04676.1|  Putative disease resistance protein RGA3              60.8    3e-06   
ref|XP_006371428.1|  hypothetical protein POPTR_0019s10290g           60.8    3e-06   
ref|XP_007162214.1|  hypothetical protein PHAVU_001G133600g           60.5    3e-06   
ref|XP_003541555.2|  PREDICTED: putative disease resistance prote...  60.8    3e-06   
ref|XP_006603646.1|  PREDICTED: NBS-LRR disease resistance protei...  60.5    3e-06   
ref|XP_010026805.1|  PREDICTED: putative disease resistance prote...  60.5    3e-06   
ref|XP_010279527.1|  PREDICTED: putative disease resistance prote...  60.5    3e-06   
ref|XP_008461336.1|  PREDICTED: disease resistance protein RGA2-like  60.5    3e-06   
ref|XP_007133473.1|  hypothetical protein PHAVU_011G181500g           60.5    4e-06   
ref|XP_003619299.1|  NBS-LRR resistance protein                       60.5    4e-06   
ref|XP_002277987.2|  PREDICTED: putative disease resistance prote...  60.5    4e-06   
gb|KHN20833.1|  Putative disease resistance RPP13-like protein 1      60.5    4e-06   
ref|XP_010313609.1|  PREDICTED: putative disease resistance RPP13...  60.5    4e-06   
ref|XP_007203751.1|  hypothetical protein PRUPE_ppa016507mg           57.0    4e-06   
ref|XP_010269784.1|  PREDICTED: disease resistance protein RGA2-like  60.5    4e-06   
gb|AAP45164.2|  Disease resistance protein RGA2, putative             60.1    4e-06   
emb|CDP14721.1|  unnamed protein product                              60.1    4e-06   
ref|XP_007162222.1|  hypothetical protein PHAVU_001G134300g           60.1    4e-06   
ref|XP_009354793.1|  PREDICTED: disease resistance protein RGA2-like  60.1    5e-06   
ref|XP_007204163.1|  hypothetical protein PRUPE_ppa017615mg           60.1    5e-06   
gb|KDP32984.1|  hypothetical protein JCGZ_13015                       58.9    5e-06   
ref|XP_011015122.1|  PREDICTED: putative disease resistance prote...  60.1    5e-06   
ref|XP_010644952.1|  PREDICTED: putative disease resistance prote...  60.1    5e-06   
ref|XP_011047693.1|  PREDICTED: putative disease resistance prote...  58.2    6e-06   
ref|XP_007163950.1|  hypothetical protein PHAVU_L003300g              59.7    6e-06   
ref|XP_007202992.1|  hypothetical protein PRUPE_ppa019012mg           59.7    6e-06   
ref|XP_006604350.1|  PREDICTED: disease resistance protein RGA2-l...  59.7    6e-06   
ref|XP_011016471.1|  PREDICTED: putative disease resistance prote...  59.7    6e-06   
ref|XP_010917819.1|  PREDICTED: putative disease resistance prote...  59.7    7e-06   
ref|XP_009611876.1|  PREDICTED: disease resistance protein RGA2-like  59.3    7e-06   
gb|KHG15016.1|  Putative disease resistance RGA3                      59.7    7e-06   
ref|XP_009801207.1|  PREDICTED: putative disease resistance prote...  59.7    7e-06   
ref|XP_007162218.1|  hypothetical protein PHAVU_001G134000g           59.3    7e-06   
emb|CDP21362.1|  unnamed protein product                              59.7    7e-06   
ref|XP_010023996.1|  PREDICTED: putative disease resistance prote...  59.3    7e-06   
gb|ACZ74653.1|  CNL-B28                                               59.3    8e-06   
emb|CDP20772.1|  unnamed protein product                              59.3    8e-06   
gb|KDO39012.1|  hypothetical protein CISIN_1g044935mg                 59.3    8e-06   
ref|XP_002309757.2|  hypothetical protein POPTR_0007s01210g           59.3    8e-06   
ref|XP_004514999.1|  PREDICTED: putative disease resistance prote...  59.3    8e-06   
gb|KHN14949.1|  Putative disease resistance protein RGA4              59.3    8e-06   
ref|XP_007163949.1|  hypothetical protein PHAVU_L003200g              59.3    8e-06   
ref|XP_006382159.1|  hypothetical protein POPTR_0006s28940g           56.2    8e-06   
gb|EYU23335.1|  hypothetical protein MIMGU_mgv1a018297mg              59.3    9e-06   
ref|XP_010026807.1|  PREDICTED: putative disease resistance prote...  59.3    9e-06   
ref|XP_007203026.1|  hypothetical protein PRUPE_ppa018734mg           58.9    9e-06   
ref|XP_008240999.1|  PREDICTED: putative disease resistance prote...  58.9    1e-05   
ref|XP_006372429.1|  hypothetical protein POPTR_0017s015602g          55.8    1e-05   
ref|XP_009598875.1|  PREDICTED: putative disease resistance prote...  58.9    1e-05   
ref|XP_008360028.1|  PREDICTED: putative disease resistance prote...  55.1    1e-05   
ref|XP_009598883.1|  PREDICTED: putative disease resistance prote...  58.9    1e-05   
ref|XP_010692389.1|  PREDICTED: putative disease resistance prote...  58.9    1e-05   
ref|XP_008776817.1|  PREDICTED: putative disease resistance prote...  58.9    1e-05   
ref|XP_006594354.1|  PREDICTED: putative disease resistance RPP13...  58.9    1e-05   
gb|KHN37726.1|  Putative disease resistance RPP13-like protein 1      58.5    1e-05   
ref|XP_006604349.1|  PREDICTED: disease resistance protein RGA2-l...  58.5    1e-05   
ref|XP_006343286.1|  PREDICTED: putative disease resistance prote...  58.5    1e-05   
ref|XP_006578494.1|  PREDICTED: putative disease resistance prote...  58.5    1e-05   
gb|EYU41308.1|  hypothetical protein MIMGU_mgv1a000452mg              58.5    1e-05   
gb|KHN14961.1|  Putative disease resistance protein RGA1              58.5    1e-05   
ref|XP_008240990.1|  PREDICTED: putative disease resistance prote...  58.5    1e-05   
ref|XP_006355884.1|  PREDICTED: putative disease resistance prote...  58.5    1e-05   
ref|XP_007133934.1|  hypothetical protein PHAVU_010G004600g           58.5    1e-05   
ref|XP_010097447.1|  Putative disease resistance protein RGA4         58.5    2e-05   
ref|XP_004149444.1|  PREDICTED: disease resistance protein RGA2-like  58.2    2e-05   
ref|XP_006382158.1|  hypothetical protein POPTR_0006s28930g           58.2    2e-05   
emb|CDP13084.1|  unnamed protein product                              55.8    2e-05   
ref|XP_006598092.1|  PREDICTED: putative disease resistance RPP13...  58.5    2e-05   
gb|ACE86396.1|  rp3-like disease resistance protein                   58.2    2e-05   
gb|AFK35311.1|  unknown                                               55.1    2e-05   
gb|KHN14937.1|  Putative disease resistance protein RGA1              56.6    2e-05   
ref|XP_008788594.1|  PREDICTED: putative disease resistance prote...  58.2    2e-05   
ref|XP_006372435.1|  hypothetical protein POPTR_0017s01610g           58.2    2e-05   
ref|XP_010646016.1|  PREDICTED: disease resistance protein RGA2-like  55.8    2e-05   
ref|XP_006576500.1|  PREDICTED: putative disease resistance prote...  56.2    2e-05   
gb|KHN31999.1|  Putative disease resistance RPP13-like protein 1      58.2    2e-05   
gb|KHN22970.1|  Disease resistance protein RGA2                       57.4    2e-05   
gb|KDO59542.1|  hypothetical protein CISIN_1g039822mg                 58.2    2e-05   
emb|CDP21809.1|  unnamed protein product                              58.2    2e-05   
emb|CAN65111.1|  hypothetical protein VITISV_030255                   58.2    2e-05   
ref|XP_010094550.1|  Disease resistance protein RGA2                  58.2    2e-05   
gb|EYU41078.1|  hypothetical protein MIMGU_mgv1a023547mg              58.2    2e-05   
ref|XP_006576493.1|  PREDICTED: disease resistance protein RGA2-like  58.2    2e-05   
ref|XP_004298083.1|  PREDICTED: putative disease resistance prote...  58.2    2e-05   
ref|XP_008392255.1|  PREDICTED: disease resistance protein RGA2-like  58.2    2e-05   
ref|XP_009349330.1|  PREDICTED: putative disease resistance prote...  57.4    2e-05   
ref|XP_007202881.1|  hypothetical protein PRUPE_ppa015789mg           57.0    2e-05   
ref|XP_006598091.1|  PREDICTED: putative disease resistance RPP13...  58.2    2e-05   
ref|XP_010650368.1|  PREDICTED: disease resistance protein RGA2-like  55.8    2e-05   
gb|AES96229.2|  NB-ARC domain disease resistance protein              57.8    2e-05   
ref|XP_007207994.1|  hypothetical protein PRUPE_ppa015043mg           57.8    2e-05   
ref|XP_006576824.1|  PREDICTED: putative disease resistance prote...  57.8    2e-05   
gb|KHN46316.1|  Putative disease resistance RPP13-like protein 1      58.2    2e-05   
ref|XP_003613271.1|  NBS-LRR resistance protein                       57.8    2e-05   
ref|XP_006598093.1|  PREDICTED: putative disease resistance RPP13...  57.8    2e-05   
gb|EYU23273.1|  hypothetical protein MIMGU_mgv1a000607mg              57.8    2e-05   
ref|XP_008780356.1|  PREDICTED: putative disease resistance prote...  54.7    2e-05   
gb|AAN03742.1|AF456247_1  NBS-LRR-like protein                        57.8    2e-05   
emb|CDP15919.1|  unnamed protein product                              57.8    2e-05   
gb|AET01333.2|  NBS-LRR type disease resistance protein               57.8    2e-05   
ref|XP_006340276.1|  PREDICTED: putative disease resistance RPP13...  57.8    3e-05   
emb|CAN67818.1|  hypothetical protein VITISV_007674                   57.8    3e-05   
emb|CDP08014.1|  unnamed protein product                              57.8    3e-05   
ref|XP_008799125.1|  PREDICTED: putative disease resistance prote...  57.8    3e-05   
emb|CDP13830.1|  unnamed protein product                              57.8    3e-05   
ref|XP_010027948.1|  PREDICTED: putative disease resistance prote...  57.8    3e-05   
ref|XP_008375287.1|  PREDICTED: disease resistance protein RGA2-like  56.6    3e-05   
ref|XP_006604341.1|  PREDICTED: disease resistance protein RGA2-like  57.4    3e-05   
gb|KDP26047.1|  hypothetical protein JCGZ_21080                       57.4    3e-05   
emb|CDP21009.1|  unnamed protein product                              57.8    3e-05   
ref|XP_007028725.1|  Leucine-rich repeat containing protein, puta...  57.4    3e-05   
gb|AFW78494.1|  hypothetical protein ZEAMMB73_351117                  57.0    3e-05   
gb|KGN47681.1|  hypothetical protein Csa_6G375730                     57.4    3e-05   
ref|XP_004967803.1|  PREDICTED: putative disease resistance prote...  57.4    3e-05   
gb|EYU23290.1|  hypothetical protein MIMGU_mgv1a000712mg              57.4    3e-05   
ref|XP_004152880.1|  PREDICTED: putative disease resistance prote...  57.4    3e-05   
ref|XP_008375222.1|  PREDICTED: disease resistance protein RGA2-like  57.0    3e-05   
emb|CDP15916.1|  unnamed protein product                              57.4    3e-05   
ref|XP_008240895.1|  PREDICTED: disease resistance protein RGA2-like  57.4    3e-05   
gb|KCW58335.1|  hypothetical protein EUGRSUZ_H01018                   57.4    3e-05   
emb|CDP17982.1|  unnamed protein product                              57.4    3e-05   
gb|KEH15144.1|  NBS-LRR resistance protein                            53.9    3e-05   
emb|CAN73260.1|  hypothetical protein VITISV_003723                   57.4    3e-05   
gb|AAR29073.1|  blight resistance protein B149                        57.4    3e-05   
gb|ACJ22810.1|  NBS-LRR type putative disease resistance protein ...  57.4    3e-05   
ref|XP_008231367.1|  PREDICTED: putative disease resistance prote...  56.6    3e-05   
gb|KHN37696.1|  Putative disease resistance RPP13-like protein 1      57.4    4e-05   
gb|KGN61251.1|  hypothetical protein Csa_2G074130                     57.4    4e-05   
ref|XP_010045867.1|  PREDICTED: putative disease resistance prote...  57.4    4e-05   
ref|XP_006604334.1|  PREDICTED: putative disease resistance prote...  57.0    4e-05   
gb|AAL01986.1|AF408704_1  I2C-5                                       57.4    4e-05   
gb|KHN07375.1|  Putative disease resistance protein RGA1              57.0    4e-05   
ref|XP_007033143.1|  Cc-nbs-lrr resistance protein, putative          57.4    4e-05   
ref|XP_008375271.1|  PREDICTED: putative disease resistance prote...  56.2    4e-05   
ref|XP_010026094.1|  PREDICTED: putative disease resistance RPP13...  57.0    4e-05   
gb|KDP32508.1|  hypothetical protein JCGZ_14711                       55.5    4e-05   
ref|XP_003626857.1|  NBS-LRR resistance-like protein 1O               57.0    4e-05   
ref|XP_002455391.1|  hypothetical protein SORBIDRAFT_03g010030        57.0    4e-05   
ref|XP_006604363.1|  PREDICTED: putative disease resistance prote...  57.0    4e-05   
emb|CAN79473.1|  hypothetical protein VITISV_023355                   57.0    4e-05   
gb|KDP26046.1|  hypothetical protein JCGZ_21079                       53.9    4e-05   
ref|XP_006598349.1|  PREDICTED: putative disease resistance prote...  57.0    4e-05   
ref|XP_007151416.1|  hypothetical protein PHAVU_004G0443000g          55.8    4e-05   
ref|XP_008795428.1|  PREDICTED: putative disease resistance prote...  56.2    4e-05   
ref|XP_010690548.1|  PREDICTED: putative disease resistance prote...  57.0    4e-05   
ref|XP_009374146.1|  PREDICTED: putative disease resistance prote...  56.6    4e-05   
ref|XP_008777414.1|  PREDICTED: putative disease resistance prote...  57.0    5e-05   
ref|XP_007151029.1|  hypothetical protein PHAVU_004G012900g           57.0    5e-05   
ref|XP_008650683.1|  PREDICTED: putative disease resistance prote...  57.0    5e-05   
gb|KHN07374.1|  Putative disease resistance protein RGA1              56.6    5e-05   
gb|ACJ22809.1|  NBS-LRR type putative disease resistance protein ...  57.0    5e-05   
gb|AAD27815.1|AF118127_1  disease resistance protein I2               57.0    5e-05   
ref|XP_003619334.1|  Cc-nbs-lrr resistance protein                    56.2    5e-05   
gb|KCW60236.1|  hypothetical protein EUGRSUZ_H02950                   56.6    5e-05   
ref|XP_007033713.1|  LRR and NB-ARC domains-containing disease re...  56.6    5e-05   
ref|XP_003625120.1|  NBS-LRR disease resistance protein               56.6    5e-05   
ref|XP_011038430.1|  PREDICTED: putative disease resistance prote...  55.8    5e-05   
ref|XP_004306232.1|  PREDICTED: putative disease resistance prote...  56.6    5e-05   
gb|EAY98528.1|  hypothetical protein OsI_20440                        56.6    6e-05   
gb|KHN35303.1|  Putative disease resistance RPP13-like protein 1      56.6    6e-05   
ref|XP_002321815.2|  putative disease resistance gene NBS-LRR fam...  56.6    6e-05   
emb|CDP13838.1|  unnamed protein product                              56.6    6e-05   
ref|XP_003625117.1|  hypothetical protein MTR_7g091140                56.6    6e-05   
ref|XP_006388710.1|  hypothetical protein POPTR_0115s002601g          56.2    6e-05   
emb|CDP21274.1|  unnamed protein product                              56.2    7e-05   
ref|XP_008451145.1|  PREDICTED: putative disease resistance prote...  56.2    7e-05   
ref|XP_008383886.1|  PREDICTED: disease resistance protein RGA2-like  55.1    7e-05   
ref|XP_003595147.1|  Leucine-rich repeat-containing protein           56.2    7e-05   
gb|AES81335.2|  LRR and NB-ARC domain disease resistance protein      56.2    7e-05   
ref|XP_002309705.1|  hypothetical protein POPTR_0006s28700g           56.2    7e-05   
gb|AES65398.2|  NBS-LRR type disease resistance protein               56.2    7e-05   
ref|XP_007217378.1|  hypothetical protein PRUPE_ppa023118mg           56.2    7e-05   
ref|XP_009355523.1|  PREDICTED: disease resistance protein RGA2-like  56.2    7e-05   
ref|XP_008392254.1|  PREDICTED: putative disease resistance prote...  56.2    7e-05   
ref|XP_008241001.1|  PREDICTED: putative disease resistance prote...  56.2    8e-05   
emb|CAN69089.1|  hypothetical protein VITISV_009157                   56.2    8e-05   
gb|AAB63275.1|  resistance complex protein I2C-2                      56.2    8e-05   
emb|CBI24956.3|  unnamed protein product                              55.8    8e-05   
ref|XP_010905012.1|  PREDICTED: putative disease resistance prote...  56.2    8e-05   
ref|XP_002323784.2|  hypothetical protein POPTR_0017s02580g           56.2    8e-05   
emb|CBI23835.3|  unnamed protein product                              55.8    8e-05   
emb|CDP13082.1|  unnamed protein product                              55.8    9e-05   
ref|XP_004135792.1|  PREDICTED: putative disease resistance prote...  55.5    9e-05   
ref|XP_007204655.1|  hypothetical protein PRUPE_ppa001501mg           55.8    9e-05   
gb|AES65401.2|  LRR and NB-ARC domain disease resistance protein      55.8    9e-05   
ref|XP_010905013.1|  PREDICTED: putative disease resistance prote...  55.8    1e-04   
gb|KHN11536.1|  Putative disease resistance protein RGA4              55.8    1e-04   
ref|XP_007033676.1|  Cc-nbs-lrr resistance protein, putative          55.8    1e-04   
ref|XP_003634282.2|  PREDICTED: putative disease resistance prote...  55.5    1e-04   
ref|XP_008245195.1|  PREDICTED: putative disease resistance RPP13...  55.8    1e-04   
ref|XP_008348188.1|  PREDICTED: putative disease resistance prote...  55.1    1e-04   
gb|KDO39128.1|  hypothetical protein CISIN_1g011151mg                 55.5    1e-04   
ref|XP_009374154.1|  PREDICTED: putative disease resistance prote...  55.8    1e-04   
ref|XP_008791231.1|  PREDICTED: putative disease resistance prote...  55.1    1e-04   
ref|XP_002272632.1|  PREDICTED: putative disease resistance RPP13...  55.8    1e-04   
ref|XP_007219097.1|  hypothetical protein PRUPE_ppa015274mg           55.8    1e-04   
emb|CDP17141.1|  unnamed protein product                              55.8    1e-04   
ref|XP_007133938.1|  hypothetical protein PHAVU_010G004900g           55.5    1e-04   
ref|XP_008241007.1|  PREDICTED: putative disease resistance prote...  55.5    1e-04   
ref|NP_001235657.1|  disease resistance protein                       55.5    1e-04   
ref|XP_003595150.1|  Leucine-rich repeat-containing protein           55.5    1e-04   
ref|XP_006377109.1|  hypothetical protein POPTR_0012s15110g           55.5    1e-04   
ref|XP_002449391.1|  hypothetical protein SORBIDRAFT_05g009140        55.5    1e-04   
ref|XP_010231224.1|  PREDICTED: putative disease resistance prote...  55.5    1e-04   
ref|XP_010917813.1|  PREDICTED: putative disease resistance prote...  55.5    1e-04   
ref|XP_008779962.1|  PREDICTED: LOW QUALITY PROTEIN: putative dis...  55.5    1e-04   
ref|XP_007163909.1|  hypothetical protein PHAVU_L0063000g             55.5    1e-04   
ref|XP_011038301.1|  PREDICTED: putative disease resistance prote...  55.5    1e-04   
ref|XP_006356903.1|  PREDICTED: putative disease resistance prote...  55.5    1e-04   



>ref|XP_002527482.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF34880.1| conserved hypothetical protein [Ricinus communis]
Length=1782

 Score =   159 bits (403),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 105/302 (35%), Positives = 160/302 (53%), Gaps = 52/302 (17%)
 Frame = -2

Query  1235  SFMAGKIKSINNRLDGIIENYKKIRLEEQNPKQQPMLTLLPPEDIGSVLSWKFASAYMTT  1056
             S ++GK+   N  LD +          +Q  K +   T L  E   S LS   ++  + T
Sbjct  863   SSVSGKLNFENANLDSL----------QQTMKMKVRPTQLGGERFTSQLS---STTKLVT  909

Query  1055  IYIKNCPPGKQLPQFHLLPSLGELYFESIM-VDYIDTTDYEDDNSPSRSELFFPSLKKLW  879
             I++K+C   + LP    + SL ELYF+++  ++YID      +N  +    FF SLKKLW
Sbjct  910   IWLKDCKGCQHLPPLDQIHSLRELYFDNLTDLEYIDMVG---NNGLTGGGPFFQSLKKLW  966

Query  878   IWNCPNLKGWWKKNDE---AIEEELLPPFPCISVVDIKQSPNVTWMPLFPTVSEKLYIVT  708
              WNC  LKGW +K D+       E LP FPC+S+++IK+ PN+TWMPLFPT+ E+LY V 
Sbjct  967   FWNCNKLKGWRRKVDDDATTTTVEQLPWFPCLSLLEIKECPNLTWMPLFPTLDERLYYVN  1026

Query  707   GSIIPLEHT--KKVCSS-------------FKYLKKLWVSEVADLEYMEIE---------  600
                 PL+ T   KV S+              + ++++W+SE++DLEY++ +         
Sbjct  1027  AGSQPLQQTMKMKVMSTQREDLNFLKNTYPLENIQEIWISEISDLEYIDNDVESCINRQG  1086

Query  599   ----LFPSLEYLWVYDCRNLRDWGKKGDHEDAPKALAKLA----PSVIEFEVKNCPKLKL  444
                 +FPSL+ LW+++C  L+ W KK D  D  +A+  L     P +   E+K CP L  
Sbjct  1087  GGSTIFPSLKKLWIHNCPILKGWWKKRDENDYKRAVQTLELPHFPCLSILEIKECPHLNC  1146

Query  443   LP  438
             +P
Sbjct  1147  MP  1148


 Score =   133 bits (335),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 90/257 (35%), Positives = 130/257 (51%), Gaps = 29/257 (11%)
 Frame = -2

Query  1010  HLLPSLGELYFESIM-VDYIDTTDYEDDNSPSRSELFFPSLKKLWIWNCPNLKGWWKKND  834
             + L  L EL+  ++  + YID  + +D+         FP LKKLWI NCPNLKGWWK  D
Sbjct  1190  YALSKLKELWISNVADLQYID--NGKDNFLSKGGSTVFPFLKKLWIDNCPNLKGWWKTRD  1247

Query  833   EAIEEEL--LPPFPCISVVDIKQSPNVTWMPLFPTVSEKLYIVTGSIIPLEHTKKVCSSF  660
                   +  LP F C+S+++IK  P+++WMPLFP+V E+LY V   I PL  T K+ + F
Sbjct  1248  GDTTAFIAELPQFACLSLLEIKHCPHLSWMPLFPSVDERLYYVKSGIEPLLQTIKIKTVF  1307

Query  659   KY----------LKKLWVSEVADLEYMEIE-------------LFPSLEYLWVYDCRNLR  549
             ++          LK+LW+SE+ DLEY++ E             + P L+ LW+  C NL+
Sbjct  1308  QHEGPQPQLFTNLKELWLSELQDLEYIDYEVDGYLNKGQRGSRVCPFLKKLWIGYCPNLK  1367

Query  548   DWGKKGDHEDAPKALAKLAPSVIEFEVKNCPKLKLLPQGMRLLSSSTKFSISGCPLLKQK  369
              W +K D +    A     P +   E+K+CP    +P     L     +  SG   L Q 
Sbjct  1368  GWWRKRDGDTTTLAELPQFPCLSVLEIKHCPIFSCMPL-FPCLDERLYYVKSGVEPLVQT  1426

Query  368   YKSKSGQNWPEVANITT  318
              K K+  N  E   + T
Sbjct  1427  LKIKTSSNQLEGVQLFT  1443


 Score =   125 bits (315),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 84/245 (34%), Positives = 125/245 (51%), Gaps = 30/245 (12%)
 Frame = -2

Query  1025  QLPQFHLLPSLGELYFESIM-VDYIDTTDYEDDNSPSRSELFFPSLKKLWIWNCPNLKGW  849
             QL       +L E++   +  ++YID+  Y   +   R     PSLKKLWI  CPNLKGW
Sbjct  1561  QLEGAQAFTNLEEMWLSELEDLEYIDSEGYGSASGGQRGFTVCPSLKKLWIDYCPNLKGW  1620

Query  848   WKKNDEAIEEEL---LPPFPCISVVDIKQSPNVTWMPLFPTVSEKLYIVTGSIIPLEHTK  678
             WK  D          LP FP +S+++IK  P + WMPLFP + +KL +   +  PL+ T 
Sbjct  1621  WKMRDNGGTTSTATELPHFPSLSLLEIKHCPTLAWMPLFPYLDDKLLLEDANTEPLQQTM  1680

Query  677   KVCSSFKYLKKLWVSEVADLEYMEIELFPSLEYLWVYDCRNLRDWGKKGDHEDAPKALAK  498
             ++ ++++    L V  ++ L+ ++I                    G   D E  PK   +
Sbjct  1681  EM-TAWRSSSSL-VQPLSKLKILQI--------------------GAIEDLESLPKQWLQ  1718

Query  497   LAPSVIEFEVKNCPKLKLLPQGMRLLSSSTKFSISGCPLLKQKYKSKSGQNWPEVA---N  327
                S+ E  +K C +L  LPQ M  L+S  K SISGCPLL ++ ++ +G +WP +A   N
Sbjct  1719  NLTSLQELYIKGCSRLTSLPQEMLHLTSLQKLSISGCPLLSERCRN-NGVDWPNIAHIPN  1777

Query  326   ITTDW  312
             I TDW
Sbjct  1778  IETDW  1782


 Score =   123 bits (309),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 81/223 (36%), Positives = 119/223 (53%), Gaps = 35/223 (16%)
 Frame = -2

Query  1004  LPSLGELYFESIM-VDYIDTTDYEDDNSPSRSELFFPSLKKLWIWNCPNLKGWWKKNDE-  831
             L ++ E++   I  ++YID       N        FPSLKKLWI NCP LKGWWKK DE 
Sbjct  1057  LENIQEIWISEISDLEYIDNDVESCINRQGGGSTIFPSLKKLWIHNCPILKGWWKKRDEN  1116

Query  830   ----AIEEELLPPFPCISVVDIKQSPNVTWMPLFPTVSEKLYIVTGSIIPLEHTKKV---  672
                 A++   LP FPC+S+++IK+ P++  MPLFP + ++LY V     PL+ T ++   
Sbjct  1117  DYKRAVQTLELPHFPCLSILEIKECPHLNCMPLFPFLDQRLYYVNVGKEPLKQTTEMKMK  1176

Query  671   --------CSSFKY----LKKLWVSEVADLEYME-----------IELFPSLEYLWVYDC  561
                      +S  Y    LK+LW+S VADL+Y++             +FP L+ LW+ +C
Sbjct  1177  LDQYGDMRFASTGYALSKLKELWISNVADLQYIDNGKDNFLSKGGSTVFPFLKKLWIDNC  1236

Query  560   RNLRDWGKKGDHEDAPKALAKLA--PSVIEFEVKNCPKLKLLP  438
              NL+ W K  D  D    +A+L     +   E+K+CP L  +P
Sbjct  1237  PNLKGWWKTRDG-DTTAFIAELPQFACLSLLEIKHCPHLSWMP  1278


 Score =   123 bits (309),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 78/223 (35%), Positives = 113/223 (51%), Gaps = 27/223 (12%)
 Frame = -2

Query  1025  QLPQFHLLPSLGELYFESIM-VDYIDTTDYEDDNSPSRSELFFPSLKKLWIWNCPNLKGW  849
             QL    L   L EL+   +  ++YID+      +   R     PSLKKLWI  CPNLKGW
Sbjct  1435  QLEGVQLFTKLKELWLSELEDLEYIDSDGNNCLSGGQRGSTVCPSLKKLWINYCPNLKGW  1494

Query  848   WKKNDEAIEEEL--LPPFPCISVVDIKQSPNVTWMPLFPTVSEKLYIVTGSIIPLEHTKK  675
             W  + +        LP FPC+S+++IK  P ++ MPLFP++  +LY V   I PL  T K
Sbjct  1495  WNVDADTTTTTTTKLPQFPCLSLLEIKHCPKLSCMPLFPSLDGRLYYVKSGIEPLLQTMK  1554

Query  674   V---------CSSFKYLKKLWVSEVADLEYMEIELF-------------PSLEYLWVYDC  561
                         +F  L+++W+SE+ DLEY++ E +             PSL+ LW+  C
Sbjct  1555  SKTISIQLEGAQAFTNLEEMWLSELEDLEYIDSEGYGSASGGQRGFTVCPSLKKLWIDYC  1614

Query  560   RNLRDWGKKGDHEDAPKALAKLA--PSVIEFEVKNCPKLKLLP  438
              NL+ W K  D+        +L   PS+   E+K+CP L  +P
Sbjct  1615  PNLKGWWKMRDNGGTTSTATELPHFPSLSLLEIKHCPTLAWMP  1657


 Score =   101 bits (252),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 71/269 (26%), Positives = 122/269 (45%), Gaps = 53/269 (20%)
 Frame = -2

Query  1088  SWKFASAYMTTIYIKNCPPGKQLPQFHLLPSLGELYFESIM-VDYIDTTDYEDDNSPSRS  912
              W  +   +  ++I NC   + LP    +PSL EL+   +  ++YID+ +  +D S    
Sbjct  746   GWLSSLKNLVQLWIVNCKKCQSLPSLDQIPSLRELWISELYDLEYIDSEE-NNDLSEGGE  804

Query  911   ELFFPSLKKLWIWNCPNLKGWWKKNDEAIEEELLPPFPC-ISVVDIKQSPNVTWMPLFPT  735
              ++F SLKKLWIW CPNLKG+ K+  ++            +S+++I+   ++TWMPL  +
Sbjct  805   SMYFSSLKKLWIWKCPNLKGFRKRRSDSDGAATSTTIESGLSLLEIRNCASLTWMPLISS  864

Query  734   VSEKLYIVTGSIIPLEHTKKV-----------------------------CSSFKY----  654
             VS KL     ++  L+ T K+                             C   ++    
Sbjct  865   VSGKLNFENANLDSLQQTMKMKVRPTQLGGERFTSQLSSTTKLVTIWLKDCKGCQHLPPL  924

Query  653   -----LKKLWVSEVADLEYMEI----------ELFPSLEYLWVYDCRNLRDWGKKGDHED  519
                  L++L+   + DLEY+++            F SL+ LW ++C  L+ W +K D + 
Sbjct  925   DQIHSLRELYFDNLTDLEYIDMVGNNGLTGGGPFFQSLKKLWFWNCNKLKGWRRKVDDDA  984

Query  518   APKALAKLA--PSVIEFEVKNCPKLKLLP  438
                 + +L   P +   E+K CP L  +P
Sbjct  985   TTTTVEQLPWFPCLSLLEIKECPNLTWMP  1013


 Score = 73.6 bits (179),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 55/162 (34%), Positives = 82/162 (51%), Gaps = 6/162 (4%)
 Frame = -2

Query  1565  STAISVAKLILAKIAPFAQDQIKLLWGLNEELTKLGDLVSHIGAVLLDAEGEKH-NKKTE  1389
             S    +A  I+ ++   A  +I L WG+N+E+ KL   VS I AVLLDAE ++  N + +
Sbjct  4     SILFDIAGEIILQLGSRAIQEIGLWWGVNDEIEKLKGTVSRIQAVLLDAEEKQAWNNQVK  63

Query  1388  NLLEMLKNIMDEANRLMDYFSPRAKNHR---PNQEDGCCSYFVSHPNPFVWVSDSFMAGK  1218
             + L  LK ++ EA+ L+D FS  A   +    N+       F S  N F +     MA K
Sbjct  64    DWLGKLKEVVFEADDLLDDFSTEALRRQVMDGNRMTKEVRVFFSRSNQFAYGLK--MAHK  121

Query  1217  IKSINNRLDGIIENYKKIRLEEQNPKQQPMLTLLPPEDIGSV  1092
             IK +  RLDGI  +   + LEE   ++  M T L  +   S+
Sbjct  122   IKDLRERLDGIYADKDNLSLEEGLVEKDAMSTRLRDQTNSSI  163



>ref|XP_007021012.1| Leucine-rich repeat containing protein [Theobroma cacao]
 gb|EOY12537.1| Leucine-rich repeat containing protein [Theobroma cacao]
Length=1073

 Score =   116 bits (290),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 94/290 (32%), Positives = 138/290 (48%), Gaps = 55/290 (19%)
 Frame = -2

Query  1043  NCPPGKQLPQFHLLPSLGELYFESIMVDYIDTTDYEDDN--------SPSRSELFFPSLK  888
             NC   + LP  H L SL  L  E + V      D ++DN        +P  S  FFPSLK
Sbjct  781   NC---QHLPPLHHLSSLQCLILEYLKVLEHVADDGKEDNHSFPVPCSTPRTS--FFPSLK  835

Query  887   KLWIWNCPNLKGWWK-KNDEAIEEELLPPFPCISVVDIKQSPNVTWMPLFPTVSEKLYIV  711
              L I  CP L+GWW+ KN+       LP FPC+S ++I+   N+T MPLFP + + L + 
Sbjct  836   ILKIRGCPKLQGWWRTKNENQGSTAELPCFPCLSKLEIEDCQNLTSMPLFPFLDDDLTLK  895

Query  710   TGSIIPLEHTKKV-----------------CSSFKY---------LKKLWVSEVADLEYM  609
               S+ PL+ T K+                 C S+ Y         LK+L +  +  LE +
Sbjct  896   GTSVRPLQQTLKMKMTKASMTSEASSSRSTCHSYSYSSTALPLSNLKRLTLDSINGLEGL  955

Query  608   EIELFPSLEYL----WVYDCR------NLRDWGKKGDHEDAP--KALAKLAP---SVIEF  474
               E   +L  L    + YDC+      N     ++   E  P  + L    P   S+I  
Sbjct  956   SEEFLQNLTSLVYLQFKYDCQLLPQKMNSLTSLQELHIEYCPDLRVLPDWIPNLTSLITL  1015

Query  473   EVKNCPKLKLLPQGMRLLSSSTKFSISGCPLLKQKYKSKSGQNWPEVANI  324
              +  CP+L+ LP+GM  L+S  + SI GCP L ++ K ++G +WP +A+I
Sbjct  1016  TIWYCPELQYLPEGMHRLASLQRLSIRGCPQLSKRCKKETGIHWPHIAHI  1065


 Score = 55.5 bits (132),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 41/131 (31%), Positives = 66/131 (50%), Gaps = 4/131 (3%)
 Frame = -2

Query  1538  ILAKIAPFAQDQIKLLWGLNEELTKLGDLVSHIGAVLLDA-EGEKHNKKTENLLEMLKNI  1362
             IL+K+   A  ++  ++GLN +L KL + +S I AVL DA E ++ N   +N +  L+++
Sbjct  13    ILSKLVWLAGQELGFIFGLNTDLEKLQETLSTINAVLRDAEEKQESNHAVDNWIIRLQDV  72

Query  1361  MDEANRLMDYFSPRAKNHRPNQEDGCCSYFVSHPNPFVWVSDSFMAGKIKSINNRLDGII  1182
             + +A  L+D F   A   R  +  G    F S  NP V+     M  + K I  RLD + 
Sbjct  73    VFDAEDLLDEFD-YAILRRKVRPRGQVYKFFSSSNPLVFRLK--MGHRFKEIRERLDAVA  129

Query  1181  ENYKKIRLEEQ  1149
              +  K  L  +
Sbjct  130   ADIFKFNLSRR  140



>ref|XP_008245605.1| PREDICTED: putative disease resistance protein RGA3, partial 
[Prunus mume]
Length=620

 Score =   111 bits (278),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 80/276 (29%), Positives = 136/276 (49%), Gaps = 41/276 (15%)
 Frame = -2

Query  1088  SWKFASAYMTTIYIKNCPPGKQLPQFHLLPSLGELYFESIM-VDYIDTTDYEDD------  930
             SW  +   +  + + +C   + LP    LP L  L    +  +++I   D   D      
Sbjct  366   SWFHSLTNIVNLGLYDCDRCQHLPPLDHLPFLKSLVLLGLRNLEHISAEDKVKDFAGDEM  425

Query  929   ---NSPSRSELFFPSLKKLWIWNCPNLKGWWKKNDEAIEEELLPPFPCISVVDIKQSPNV  759
                ++ S S  FFPSL+ L + +CPNLKGWW+    +        FPC+S ++I+  PN+
Sbjct  426   MMMSAASPSTTFFPSLESLRLTDCPNLKGWWRNETASASS-----FPCLSSLEIENCPNL  480

Query  758   TWMPLFPTVSE-KLYIVTGSIIPLEHTKKVCSSFKYLKKLWVSEVADLEYMEIELFPSL-  585
             T MPL+P +    L+  + +++P        S  KYL+   + +V D+EY+  E   +L 
Sbjct  481   TSMPLYPNLDRLDLWRSSWNVLP-------SSKLKYLE---IRDVEDIEYVPEEGIGNLT  530

Query  584   --EYLWVYDCRNLRDWGKKGDHEDAPKALAKLAPSVIEFEVKNCPKLKLLPQGMRLLSSS  411
               + L +  C NL     +G        +  L  S+    +  CP L  LP+G+R L+S 
Sbjct  531   LLQELSIDRCPNLVSLPDQG--------MGSLI-SLQRLHISKCPNLASLPEGLRCLASL  581

Query  410   TKFSISGCPLLKQKYKSKSGQNWPEVAN---ITTDW  312
              + +I  CP+LKQ+ + ++G++W ++A+   I  DW
Sbjct  582   KRLTIVDCPILKQRCQKETGEDWSKIAHIPEIDIDW  617



>ref|XP_008245602.1| PREDICTED: putative disease resistance protein RGA1 [Prunus mume]
Length=1010

 Score =   110 bits (274),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 77/270 (29%), Positives = 128/270 (47%), Gaps = 58/270 (21%)
 Frame = -2

Query  1088  SWKFASAYMTTIYIKNCPPGKQLPQFHLLPSLGELYFESIM-VDYIDTTDYEDD------  930
             SW  +   +  + + +C   + LP    LP L  L    +  +++I   D   D      
Sbjct  777   SWFHSLTNIVNLGLYDCDRCQHLPPLDHLPFLKSLTLSELRNLEHISAKDKVKDFAGDEM  836

Query  929   ---NSPSRSELFFPSLKKLWIWNCPNLKGWWKKNDEAIEEELLPPFPCISVVDIKQSPNV  759
                ++ S S  FFPSL+ L+++ CPNLKGWW+    +        FPC+S ++I   PN+
Sbjct  837   MMMSAASPSTTFFPSLESLYLFECPNLKGWWRNETASASA---SSFPCLSTLEICDCPNL  893

Query  758   TWMPLFPTVSEKLYIVTGSIIPLEHT--KKVCSSF---KYLKKLWVSEVADLEYMEIELF  594
             T MPL+P +           + LE++  K + SSF     LK L+++ V D+EY+  E  
Sbjct  894   TSMPLYPNLHS---------LELENSSWKVLPSSFVPSSKLKFLYITAVEDIEYVLEEGI  944

Query  593   PSLEYLWVYDCRNLRDWGKKGDHEDAPKALAKLAPSVIEFEVKNCPKLKLLPQGMRLLSS  414
              +L+ L                                   + NCPKL  LP+G+R L+S
Sbjct  945   GNLKSLQF-------------------------------LSILNCPKLASLPEGLRCLAS  973

Query  413   STKFSISGCPLLKQKYKSKSGQNWPEVANI  324
               + +I  CP+LKQ+ + ++G++W ++A+I
Sbjct  974   LKRLTIVDCPILKQRCQKETGEDWSKIAHI  1003



>gb|KDP43573.1| hypothetical protein JCGZ_16860 [Jatropha curcas]
Length=1151

 Score =   108 bits (270),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 89/311 (29%), Positives = 137/311 (44%), Gaps = 54/311 (17%)
 Frame = -2

Query  1193  DGIIENYKKIRLEEQNPKQQPMLTLLPPEDIGSVL--SWKFASAYMTTIYIKNCPPGKQL  1020
             D +  +Y +  L+   P Q   L      D G V   +W  +   +  I+I++C   + L
Sbjct  744   DCVHVDYDEKSLQSLQPHQN--LKKFKVCDYGGVRFPNWLSSLTNLVDIWIQDCGRCELL  801

Query  1019  PQFHLLPSLGELYFESI-MVDYIDTTDYEDDNSPSRSEL--FFPSLKKLWIWNCPNLKGW  849
             PQ H + SL  L  +    + YID       N   R E   FF SLK+L++ +CPNL+GW
Sbjct  802   PQLHHIQSLKYLRIQGFPNLKYIDHEGDHFLNGEGRREESNFFLSLKELYLLDCPNLEGW  861

Query  848   WKKN---DEAIEE-ELLPPFPCISVVDIKQSPNVTWMPLFPTVSEKLYIVTGSIIPLEHT  681
             WKK    D A++    L  FP +  ++I+  P +T MP+FP + EKL +   S+ P + T
Sbjct  862   WKKMGNLDPAMKNIAGLSHFPSLCKLEIRDCPKLTCMPIFPKLDEKLLLENASLEPFQQT  921

Query  680   KKVC------------SSFKYLKKLWVSEVADLEYMEIELFPSLEYLWVYDCRNLRDWGK  537
              K+              S   LK LW+  + DLE +                        
Sbjct  922   IKMVMGAAASTSSTPGHSLFMLKVLWIVSIEDLETL------------------------  957

Query  536   KGDHEDAPKALAKLAPSVIEFEVKNCPKLKLLPQGMRLLSSSTKFSISGCPLLKQKYKSK  357
                    PK L +   S+ E  + +CP+L  LP  M  L S  +  I  C  LK++Y S 
Sbjct  958   -------PKELLQKLTSLQELHLMDCPRLASLPLEMYSLISLRELDIINCAKLKERYGSS  1010

Query  356   SGQNWPEVANI  324
                +W ++++I
Sbjct  1011  KCSDWQKISHI  1021



>ref|XP_008375226.1| PREDICTED: putative disease resistance protein RGA1 [Malus domestica]
Length=283

 Score =   100 bits (249),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 84/278 (30%), Positives = 140/278 (50%), Gaps = 49/278 (18%)
 Frame = -2

Query  1082  KFASAYMTTIYIKN-----CPPGKQLPQFHLLPSLGELYFESIMVD-YIDTTDYEDDNSP  921
             +FAS + + I I N     C   + LP    LPSL +L  E +    YI  ++ E  NS 
Sbjct  22    RFASWFSSLINIVNLELQSCNICQHLPPLDHLPSLKKLELEGLEKLEYILLSEKESSNSM  81

Query  920   SRSEL---FFPSLKKLWIWNCPNLKGWWKKNDE-------AIEEELLPPFPCISVVDIKQ  771
             S   +   FFPSL++L+I +CP LKGWW+ +         + E   LP FP +S + I+ 
Sbjct  82    SDEMMRISFFPSLEELYIADCPVLKGWWRAHTHNTASSSSSTEILSLPSFPSLSALTIRN  141

Query  770   SPNVTWMPLFPTVSEKLYIVTGSIIPLEHTKKVCSSFKYLKKLWVSEVADLEY---MEIE  600
              PN+T MPL+P V   L  + GS            S+K ++ L+V   +D+ +   +++ 
Sbjct  142   CPNLTSMPLYPNVERIL--LKGS------------SWKVVESLFVRGASDIPHDVGVDVS  187

Query  599   LFPS------LEYLWVYDCRNLRDWGKKGDHEDAPKALAKLAPSVIEFEVKNCPKLKLLP  438
                S      L ++W+   + + D G        P+ ++ L  S+ +  +K+C  L  LP
Sbjct  188   AASSSPHLSKLTFMWL---QEIEDLGS------LPEEISNLT-SLQKLTIKDCSNLASLP  237

Query  437   QGMRLLSSSTKFSISGCPLLKQKYKSKSGQNWPEVANI  324
             +G+R L       I  CP+L ++ K ++G++WP++A+I
Sbjct  238   EGIRGLPCLNTLVIEKCPMLSERCKKETGEDWPKIAHI  275



>ref|XP_002526758.1| Disease resistance protein RGA2, putative [Ricinus communis]
 gb|EEF35612.1| Disease resistance protein RGA2, putative [Ricinus communis]
Length=1100

 Score =   104 bits (259),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 87/314 (28%), Positives = 139/314 (44%), Gaps = 64/314 (20%)
 Frame = -2

Query  1088  SWKFASAYMTTIYIKNCPPGKQLPQFHLLPSLGELYFESIM-VDYIDTTDYEDDNSPSRS  912
             SW  +   +  + I NC   + LP     PSL  L  + +  + YI++     D + S  
Sbjct  774   SWVASLTSLVELRIDNCINCQNLPPLDQFPSLKHLTLDKLNDLKYIES-GITYDRAESGP  832

Query  911   ELFFPSLKKLWIWNCPNLKGWWKKNDEAIEEELLPPFPCISVVDIKQSPNVTWMPLFPTV  732
              LFFPSL+KLW+ NCPNLKGW + +  A E   L  F C++  +IK  PN+T MPL PTV
Sbjct  833   ALFFPSLEKLWLRNCPNLKGWCRTDTSAPE---LFQFHCLAYFEIKSCPNLTSMPLIPTV  889

Query  731   SEKLYIVTGSIIPLEH-----------------TKKVCSSFKYLKKLWVSEVADLEYMEI  603
              E++     SI  ++                  +  +  S   LK+L + ++ DL+++  
Sbjct  890   -ERMVFQNTSIKSMKDMLKLKLLLPQSASSSCSSSSLSPSLVQLKELSIQKIEDLDFLPD  948

Query  602   EL---FPSLEYLWVYDCRNLRDWGKKGDHEDAPKA-------------------------  507
             EL     SL+ L + DC  +        H  + +                          
Sbjct  949   ELLQNLTSLQQLDIIDCPRITTLSHDMQHLTSLEVLIIRACKELDLSSEQWQCLRSLRKL  1008

Query  506   ----LAKL---------APSVIEFEVKNCPKLKLLPQGMRLLSSSTKFSISGCPLLKQKY  366
                 LAKL           ++ + E+ +CP L  LP+ +  L++     I+ CPLL QK 
Sbjct  1009  RIVNLAKLVSLHQGLQHVTTLQQLEICSCPILGTLPEWISGLTTLRHLEINECPLLSQKC  1068

Query  365   KSKSGQNWPEVANI  324
              +  G++W ++A+I
Sbjct  1069  SNNKGEDWSKIAHI  1082



>ref|XP_008346939.1| PREDICTED: putative disease resistance protein RGA4 [Malus domestica]
 ref|XP_008356742.1| PREDICTED: putative disease resistance protein RGA4 [Malus domestica]
Length=281

 Score = 99.8 bits (247),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 79/268 (29%), Positives = 137/268 (51%), Gaps = 31/268 (12%)
 Frame = -2

Query  1082  KFASAYMTTIYIKN-----CPPGKQLPQFHLLPSLGELYFESI-MVDYIDTTDYEDDNSP  921
             +FAS + + I I N     C   + LP    LPSL +L   S+  ++YI  ++ E  NS 
Sbjct  22    RFASWFSSLINIVNLTFWNCNRCQHLPPLDHLPSLKKLELISLEKLEYILLSEKESINSM  81

Query  920   SRSEL---FFPSLKKLWIWNCPNLKGWWKKN-----DEAIEEELLPPFPCISVVDIKQSP  765
             S   +   FFPSL+ L + NCP LKGWW+ +       + E   LP F  +S + I + P
Sbjct  82    SDEMMRISFFPSLETLEVRNCPVLKGWWRAHARNTASSSTENLSLPSFASLSTLCIYECP  141

Query  764   NVTWMPLFPTVSEKLYIVTGSIIPLEHTKKVCSSFKYLKKLWVSEVADLEY-MEIELFPS  588
             N+T MPL+P V +   ++TG+            S+K +  L+V   +D+ + + +++  S
Sbjct  142   NLTSMPLYPNVVK--MVLTGN------------SWKVVDSLFVRGASDITHDVGVDVSAS  187

Query  587   LEYLWVYDCRNLRDWGKKGDHEDAPKALAKLAPSVIEFEVKNCPKLKLLPQGMRLLSSST  408
                  +    +L   G + D    P+ ++ L  S+ +  ++ CP L  +P+G+R L    
Sbjct  188   SSSPHLSKLTHLTLHGFE-DLASLPEEISNLT-SLQKLTIRVCPNLASIPEGIRGLPCLN  245

Query  407   KFSISGCPLLKQKYKSKSGQNWPEVANI  324
                I  CP+L ++ K ++G++W ++A+I
Sbjct  246   TLVIEKCPMLSERCKKETGEDWLKIAHI  273



>ref|XP_002309702.2| NBS-LRR resistance protein RGH2 [Populus trichocarpa]
 gb|EEE93225.2| NBS-LRR resistance protein RGH2 [Populus trichocarpa]
Length=1052

 Score =   103 bits (258),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 83/269 (31%), Positives = 127/269 (47%), Gaps = 62/269 (23%)
 Frame = -2

Query  1088  SWKFASAYMTTIYIKNCPPGKQLPQFHLLPSLGELYFESIM-VDYIDTTDYEDDNSPSRS  912
             SW    + +  I ++ C   K +P    +PSL EL  E +  ++YID+         +  
Sbjct  754   SWVLELSNLLRIRVERCRRLKHIPPLDGIPSLEELSIEGLDDLEYIDSEGVGGKGVST--  811

Query  911   ELFFPSLKKLWIWNCPNLKGWWKK----------NDEAIEEEL-LPPFPCISVVDIKQSP  765
               FFPSLK+L +W+C  LKGWWK+          ++  IEE L +  FP +S + I+  P
Sbjct  812   --FFPSLKRLEMWDCGGLKGWWKRWSRDEMNDDRDESTIEEGLRMLCFPRLSSLKIRYCP  869

Query  764   NVTWMPLFPTVSEKLYIVTGSIIPLEHTKKVC-----SSF----KYLKKLWVSEVADLEY  612
             N+T MPLFPT+ E LY+   S +PL+ T K+      SSF      LK+L++  + D+E 
Sbjct  870   NLTSMPLFPTLDEDLYLWGTSSMPLQQTMKMTSPVSSSSFIRPLSKLKRLYIGSIDDME-  928

Query  611   MEIELFPSLEYLWVYDCRNLRDWGKKGDHEDAPKALAKLAPSVIEFEVKNCPKLKLLP--  438
                    S+  +W+ +  +L+                       +  +  CP+LK LP  
Sbjct  929   -------SVPEVWLQNLSSLQ-----------------------QLSIYECPRLKSLPLP  958

Query  437   -QGMRLLSSSTKFSISGCPLLKQKYKSKS  354
              QGM  L    K  I+ C  LK   +S+S
Sbjct  959   DQGMHSLQ---KLHIADCRELKSLSESES  984


 Score = 61.2 bits (147),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 44/152 (29%), Positives = 77/152 (51%), Gaps = 10/152 (7%)
 Frame = -2

Query  1553  SVAKLILAKIAPFAQDQIKLLWGLNEELTKLGDLVSHIGAVLLDAE--GEKHNKKTENLL  1380
             ++A+ I+  +      ++ L WGL ++L KL D V+ I AV+ DAE   +K N + E+ L
Sbjct  8     NIAEEIIKTLGSLTAREVALWWGLKDQLRKLNDTVTSIKAVIQDAEEQAQKQNHQIEDWL  67

Query  1379  EMLKNIMDEANRLMDYFSPRA--KNHRPNQE-DGCCSYFVSHPNPFVWVSDSFMAGKIKS  1209
               L+  + +A  L+D FS +A  K   P +        F S  N FV+     M  ++K+
Sbjct  68    MKLREAVYDAEDLLDDFSTQALRKTLMPGKRVSREVRLFFSRSNQFVY--GLRMGHRVKA  125

Query  1208  INNRLDGIIENYKKIRLEEQNPKQQPMLTLLP  1113
             +  RLD I  + ++ +     P+Q+   ++ P
Sbjct  126   LRERLDDIETDSERFKF---VPRQEEGASMTP  154



>ref|XP_011002334.1| PREDICTED: putative disease resistance protein RGA4 [Populus 
euphratica]
Length=1294

 Score =   103 bits (257),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 77/257 (30%), Positives = 124/257 (48%), Gaps = 33/257 (13%)
 Frame = -2

Query  1088  SWKFASAYMTTIYIKNCPPGKQLPQFHLLPSLGELYFESIM-VDYIDTTDYEDDNSPSRS  912
             SW    + +  I+++NC   + +P    +PSL +LYF S+  ++YID+         +  
Sbjct  1012  SWLSHLSNLVRIHLENCRRLEHIPPLDGIPSLEDLYFGSMNDLEYIDSEGVGGKGVST--  1069

Query  911   ELFFPSLKKLWIWNCPNLKGWWKK--NDEAIEEELLPPFPCISVVDIKQSPNVTWMPLFP  738
               FFPSLK L I+ C  LKGWWK+   D+  ++ +   FP +S + I+  PN+T MPLFP
Sbjct  1070  --FFPSLKTLVIYGCFRLKGWWKRWSRDKMNDDRIF--FPRLSSLKIRWCPNLTSMPLFP  1125

Query  737   TVSEKLYIVTGSIIPLEHTKKVCSSF----KYLKKLWVSEVADLEYMEIELFPSLEYLWV  570
             T+ E L +   S +PL+ T K+ S+           ++  ++ L+ ++I           
Sbjct  1126  TLDEGLSLTKTSSMPLQQTMKMKSAVSSSSSSSSSSFIRPLSKLKELDI-----------  1174

Query  569   YDCRNLRDWGKKGDHEDAPKALAKLAPSVIEFEVKNCPKLKLLPQGMRLLSSSTKFSISG  390
                      G   D E  P+   +   S+ +  +  CP+LK LP   + + S  K  ISG
Sbjct  1175  ---------GSIDDMESLPEVGLQNLSSLQQLSISECPRLKSLPLPDQGMPSLQKLYISG  1225

Query  389   CPLLKQKYKSKSGQNWP  339
             C  LK   +S+S    P
Sbjct  1226  CRELKSLSQSQSQGRIP  1242


 Score =   102 bits (253),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 77/238 (32%), Positives = 113/238 (47%), Gaps = 38/238 (16%)
 Frame = -2

Query  1085  WKFASAYMTTIYIKNCPPGKQLPQFHLLPSLGELYFESIMVDYIDTTDYEDD--NSPSRS  912
             W    + +  I+I  CP  K +P    +PSL EL     ++ Y+   +Y D   N     
Sbjct  764   WLSLQSNLVRIHIICCPRLKHIPPLDKIPSLREL-----LIMYLTNLEYMDSEGNGGRGV  818

Query  911   ELFFPSLKKLWIWNCPNLKGWWKKNDEAIEEELLPPFPCISVVDIKQSPNVTWMPLFPTV  732
                FPSLKKL I NCPNLKGWWKK+ + +   ++  FPC+  + I   PN+T MPLFPT+
Sbjct  819   SKIFPSLKKLSISNCPNLKGWWKKSRDKL---IMLRFPCLCSLSIVDCPNLTSMPLFPTL  875

Query  731   SEKLYIVTGSIIPLEHTKKVCSSFKYLKKLWVSEVADLEYMEIELFPSLEYLWVYDCRNL  552
             S  L ++  S +PL+ T ++ S+                         L+ L++Y   N+
Sbjct  876   S-ILILLRASSMPLQQTMEMTSAVSSSSSF------------TRPLSKLKNLYIYFIDNM  922

Query  551   RDWGKKGDHEDAPKALAKLAPSVIEFEVKNCPKLKLLP---QGMRLLSSSTKFSISGC  387
                      E  P+A  +   S+ +  ++ C KLK LP   QGM  L    K +IS C
Sbjct  923   ---------ESLPEAGLQNLCSLQQLSIRGCSKLKSLPLPDQGMHSLQ---KLNISDC  968


 Score = 56.6 bits (135),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 42/149 (28%), Positives = 72/149 (48%), Gaps = 7/149 (5%)
 Frame = -2

Query  1553  SVAKLILAKIAPFAQDQIKLLWGLNEELTKLGDLVSHIGAVLLDAE--GEKHNKKTENLL  1380
             ++A+ I+  +      ++ L WGL ++L KL D V+ I AV+ DAE   +K N + E  L
Sbjct  8     NIAEEIIKTLGTLTAQEVALWWGLKDQLRKLNDTVTSIKAVIQDAEEQAQKQNHQIEVWL  67

Query  1379  EMLKNIMDEANRLMDYFSPRA--KNHRPNQE-DGCCSYFVSHPNPFVWVSDSFMAGKIKS  1209
             + L+  + +A  L+D FS +   K   P +          S  N FV+     M   +K+
Sbjct  68    KKLREAVYDAEDLLDDFSTQVVRKQLMPGKRVSREVRLLFSRSNQFVY--GLRMGHTVKA  125

Query  1208  INNRLDGIIENYKKIRLEEQNPKQQPMLT  1122
             +  RLD I  + K    E ++ ++  + T
Sbjct  126   LRERLDNIETDSKIFHFEVRDEERASLTT  154



>ref|XP_007009925.1| DHHC-type zinc finger family protein [Theobroma cacao]
 gb|EOY18735.1| DHHC-type zinc finger family protein [Theobroma cacao]
Length=662

 Score =   102 bits (254),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 88/323 (27%), Positives = 138/323 (43%), Gaps = 76/323 (24%)
 Frame = -2

Query  1049  IKNCPPGKQLPQFHLLPSLGELYFESIMVDYIDTTDYEDDNSPSRSELFFPSLKKLWIWN  870
             ++N PP   LP    L   G    E +    IDT           +  FFPSLK L I  
Sbjct  147   LRNLPPMDDLPSLKDLDLDGLDALEHVSDIEIDTLT---------ATTFFPSLKFLKISR  197

Query  869   CPNLKGWWKK----------NDEAIEEELLPPFPCISVVDIKQSPNVTWMPLFPTVSEK-  723
             CPNLKGWW++          + +A   ELLP FPC S + I   PN+T +PLFPT++++ 
Sbjct  198   CPNLKGWWRRRKEDDEDDEESTKASTTELLPHFPCFSTLTIWGCPNLTSLPLFPTLNDEL  257

Query  722   -LYIVTGSI------------------------IPLEHTKKV------------------  672
              L I +G +                        +PL + K +                  
Sbjct  258   SLRITSGRLLQQTTMMRTKGKITSAATTSSSTTLPLSNLKSLRLSGMENVESVLKEFLQN  317

Query  671   --CSSFKYLKKLWVSEVADLEYMEIELFPSLEYLWVYDCRNLRDWGKKGDHEDAPKALAK  498
               C+S + L+     E+  L+  E+  F SL+ L +Y+CRNL            P  +  
Sbjct  318   CCCTSLESLEIECCPELTSLQ-TEVHAFTSLQKLMIYECRNLM---------ALPNWIPN  367

Query  497   LAPSVIEFEVKNCPKLKLLPQGMRLLSSSTKFSISGCPLLKQKYKSKSGQNWPEVANITT  318
             L  S+ E  +++C KL+ LP+GM  L++     I  C  L ++ K   G +W E+++ + 
Sbjct  368   LT-SLQELAIESCDKLQSLPEGMSRLTNLRLLRIYDCSHLSERCKRDIGADWAEISHSSA  426

Query  317   DW*LVNQYAYMPRLEFM*FPVSI  249
              +     + ++  L    F V +
Sbjct  427   GFLNATIFTFLASLCLFSFSVGV  449



>ref|XP_011031366.1| PREDICTED: LOW QUALITY PROTEIN: putative disease resistance protein 
RGA3 [Populus euphratica]
Length=1086

 Score =   102 bits (255),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 80/263 (30%), Positives = 124/263 (47%), Gaps = 42/263 (16%)
 Frame = -2

Query  1088  SWKFASAYMTTIYIKNCPPGKQLPQFHLLPSLGELYFESIM-VDYIDTTDYEDDNSPSRS  912
             SW    +Y+  I +  C   + +P  H +PSL EL  E +  ++YID+   E D     S
Sbjct  777   SWVSNLSYLVRIGLDGCSRLQHIPPLHGIPSLEELSIEGLGDLEYIDS---EGDGGRGAS  833

Query  911   ELFFPSLKKLWIWNCPNLKGWWKK------NDEA----IEEELL----PPFPCISVVDIK  774
               FFPSL+KL I  C  LKGWWK+      ND++    IEE L+      FP +S + I 
Sbjct  834   T-FFPSLRKLRISYCDRLKGWWKRWSRDEMNDDSDESTIEEGLIMLFFHVFPRLSSLFIY  892

Query  773   QSPNVTWMPLFPTVSEKLYIVTGSIIPLEHTKKVCSSFKYLKKL---WVSEVADLEYMEI  603
             + P++T MPLFP + E L +   S +PL+ T K+ S   Y       ++  ++ L+ + +
Sbjct  893   RCPDLTSMPLFPALDEDLRLTYSSSVPLQQTMKMTSPVPYSSSSSSSFIRPLSKLKSLSV  952

Query  602   ELFPSLEYLWVYDCRNLRDWGKKGDHEDAPKALAKLAPSVIEFEVKNCPKLKLLPQGMRL  423
                  +E L     RNL                     S+++ ++  CP+LK LP     
Sbjct  953   GFIDDMESLPEVGLRNL--------------------SSLLQLQIYECPRLKSLPLPDEG  992

Query  422   LSSSTKFSISGCPLLKQKYKSKS  354
             + S  +  +S C  LK   +S+S
Sbjct  993   MHSLQRLRVSSCGELKSLSQSES  1015


 Score = 60.8 bits (146),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 44/153 (29%), Positives = 73/153 (48%), Gaps = 7/153 (5%)
 Frame = -2

Query  1553  SVAKLILAKIAPFAQDQIKLLWGLNEELTKLGDLVSHIGAVLLDAEGEKHN--KKTENLL  1380
             ++A+ I+ K+ P A  +I L WG+ ++L+KL   V+ I  VL DAE +      + E+ L
Sbjct  8     NIAEEIVKKLGPLATQEIALWWGVKDQLSKLKSTVTRIRGVLHDAEEQVQKPPAQLEDWL  67

Query  1379  EMLKNIMDEANRLMDYFSPRAKNHR---PNQEDGCCSYFVSHPNPFVWVSDSFMAGKIKS  1209
               L+  + +A  L+D FS   +  R    N+       F S  N  V+     M  K+K 
Sbjct  68    GKLQEAVYDAEDLLDDFSTEVQRKRLMSRNKISREVRTFFSGSNQLVYGWQ--MGHKVKE  125

Query  1208  INNRLDGIIENYKKIRLEEQNPKQQPMLTLLPP  1110
             +  RLD I+   +K   E +  ++ P   +  P
Sbjct  126   LRQRLDEIVSESEKFHFEVRYEEKAPSTMIREP  158



>gb|KDP43576.1| hypothetical protein JCGZ_16863 [Jatropha curcas]
Length=1087

 Score =   102 bits (254),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 92/334 (28%), Positives = 142/334 (43%), Gaps = 69/334 (21%)
 Frame = -2

Query  1088  SWKFASAYMTTIYIKNCPPGKQLPQFHLLPSLGEL-YFESIMVDYIDTTDYEDDNSPSRS  912
             +W  +   +  I I+     + LP F+  P L  L  F+   ++Y++ T  E +N    S
Sbjct  775   NWLSSLTNLVNISIEESRRCQYLPPFYKFPFLKRLRIFDLANLEYVEKT--EGENFIVGS  832

Query  911   ELFFPSLKKLWIWNCPNLKGWWKKNDEAIEEELLPPFPCISVVDIKQSPNVTWMPLFPTV  732
               FFPSLK+L +  CPNLKGWWK  +    +  L  FPC+S + I   P +TWMP FP +
Sbjct  833   STFFPSLKELHLLGCPNLKGWWKNGN---HDNDLAYFPCLSSLSIYSCPKLTWMPPFPFL  889

Query  731   SEKLYIVTGSIIPLEHTKK-------------VCSSFKYLKKLWVSEVADLE--------  615
              E+L +   S   LE T K             +      LKKL + +V DLE        
Sbjct  890   DEELDLNIVSAEILEQTLKMKVPMTSSSTSSSLVHPLSKLKKLMIMDVEDLESLPEEWLQ  949

Query  614   -----------------YMEIELFPSLEYLWVYDCRNLRDWGKKGDHEDAPKALAKLAPS  486
                              ++ +    SL+ L + +C +L     +G H            S
Sbjct  950   NLTSLEELSICGVPILAHLGLSCLVSLKELILRECLSLTSL--QGMH---------FLTS  998

Query  485   VIEFEVKNCPKLKLLPQGMRLLSSSTKFSISGCPLLKQKYKSKSGQNWPEVANITTDW*L  306
             +   ++  CP L  +PQ M  LSS     I  CP L  K  ++   +WP++ +I      
Sbjct  999   LQYLQLWTCPSLTTIPQEMYQLSSLQTLIIGDCPHLSAKCGNQHRDDWPKIVHIPN----  1054

Query  305   VNQYAYMPRLEFM*FPVSIYCAVYVIDDELSIPV  204
                     R++F+   +      YV+DD L+I +
Sbjct  1055  -------IRIDFLAIQLE---GCYVLDDLLAIQL  1078


 Score = 58.5 bits (140),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 43/127 (34%), Positives = 69/127 (54%), Gaps = 7/127 (6%)
 Frame = -2

Query  1526  IAPFAQDQIKLLWGLNEELTKLGDLVSHIGAVLLDA-EGEKHNKKTENLLEMLKNIMDEA  1350
             + P  Q +I L WG+ +EL KL + VS I A+L+DA E +  N++  + L  LK+++ +A
Sbjct  18    VTPVVQ-EIGLYWGVKDELVKLRNTVSGIQALLIDADEKQALNEQVRDWLGKLKDVVYDA  76

Query  1349  NRLMDYFSPRAKNHR---PNQEDGCCSYFVSHPNPFVWVSDSFMAGKIKSINNRLDGIIE  1179
             + L+D FS  A   +    N+     S F S  N   +     M  KIK+I  RLD I +
Sbjct  77    DDLLDDFSTEALQQQVMAGNKVTKEVSRFFSSSNQLTYGLK--MGYKIKAIRERLDAIAK  134

Query  1178  NYKKIRL  1158
             + + ++L
Sbjct  135   DSQNLQL  141



>ref|XP_007021002.1| Leucine-rich repeat containing protein [Theobroma cacao]
 gb|EOY12527.1| Leucine-rich repeat containing protein [Theobroma cacao]
Length=1272

 Score =   102 bits (253),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 79/232 (34%), Positives = 112/232 (48%), Gaps = 52/232 (22%)
 Frame = -2

Query  926   SPSRSELFFPSLKKLWIWNCPNLKGWWK---KNDEAIEEELLPPFPCISVVDIKQSPNVT  756
             S SR E FFPSLKKL I +CPNLKGWWK   +N  +I E  LP FPC+S +DI + PN+ 
Sbjct  832   STSR-EPFFPSLKKLLIHDCPNLKGWWKTKNENQRSIAE--LPCFPCLSELDILRCPNLA  888

Query  755   WMPLFPTVSEKLYIVTGSIIPLEHTKKV-------------------CSSF-------KY  654
              MPLFP++   L +   SI PLE T ++                   C S+        +
Sbjct  889   SMPLFPSLDRDLTLFDASIRPLEQTLQMKMTEASMTLEEASSSSGSACHSYSSTTLPLSH  948

Query  653   LKKLWVSEVADLEYMEIEL---FPSLEYLWVYDC--------------RNLRDWGKKGDH  525
             LK L ++++ DLE +  E      SL  LW+ DC               +L+    K  H
Sbjct  949   LKSLMLTDIKDLEVLLEEFLQNLTSLTSLWLSDCPILESLLPQKMSCLTSLQVLCVKNCH  1008

Query  524   --EDAPKALAKLAPSVIEFEVKNCPKLKLLPQGMRLLSSSTKFSISGCPLLK  375
                  P  +  L  S+   E+  C +L+ +P+G   L+S  K S+  CP ++
Sbjct  1009  NLRAFPDWILNLT-SLKTLEIWGCIELQYMPEGTHQLTSLNKLSVGNCPNMR  1059


 Score = 61.6 bits (148),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 69/252 (27%), Positives = 114/252 (45%), Gaps = 42/252 (17%)
 Frame = -2

Query  1064  MTTIYIKNCPPGKQLPQFHL-LPSLGEL-YFESIMVDYIDTTDYEDDNSPSRSELFFPSL  891
             +  + + NCP  + LP + L L SL  L  +E + + Y+         +P  S     SL
Sbjct  1047  LNKLSVGNCPNMRALPDWILNLTSLKTLEIWECLELKYMPK------GTPRLS-----SL  1095

Query  890   KKLWIWNCPNLKGW--WKKNDEAIEEELLPPFPCISVVDIKQSPNVTWMPLFPTVSEKLY  717
             ++L++ +C NL+    W  N  ++++        + + +  QSP +       T  E+L 
Sbjct  1096  EELYV-DCHNLRALPDWILNLTSLKD--------LYICECLQSPYLQEGMQSLTSLERLI  1146

Query  716   IVTGSIIPLEHTKKVCSSFKYLKKLWVSEVADLEY-MEIELFPSLEYLWVYDCRNLRDWG  540
             +         H   + SS   LK L +    +L +     LF +LE L V +C NL    
Sbjct  1147  V--------HHCPNLSSSTYSLKALLIRGCLNLSFWRSRRLFSTLEELNVQNCPNL----  1194

Query  539   KKGDHEDAPKALAKLAPSVIEFEVKNCPKLKLLPQGMRLLSSSTKFSISGCPLLKQKYKS  360
                  ED    +AK+  S+   ++  CP+L+ LPQ M  L+S    SIS CP L ++ + 
Sbjct  1195  -----EDLLNRIAKMITSLKTLKICKCPELQDLPQRMDGLTSLQVLSISECPRLSERCEK  1249

Query  359   KSGQNWPEVANI  324
              +G  WP +A I
Sbjct  1250  DTGVLWPRIARI  1261



>ref|XP_008375193.1| PREDICTED: disease resistance protein RGA2-like [Malus domestica]
Length=781

 Score =   101 bits (251),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 84/309 (27%), Positives = 144/309 (47%), Gaps = 46/309 (15%)
 Frame = -2

Query  1175  YKKIRLEEQNPKQQPMLTLLPPEDIGSVLSW-----KFASAYMTTIYIKN-----CPPGK  1026
             Y+ ++  ++    + M  L P  ++  +  W     +FAS + + I I N     C   +
Sbjct  486   YEDVKGVDEEDIIKSMEVLQPHSNLKQLSVWYYGGVRFASWFSSLINIVNLTFWNCNRCQ  545

Query  1025  QLPQFHLLPSLGELYFESI-MVDYIDTTDYEDDNSPSRSEL---FFPSLKKLWIWNCPNL  858
              LP    LPSL +L   S+  ++YI  ++ E  NS S   +   FFPSL+ L + NCP L
Sbjct  546   HLPPLDHLPSLKKLELISLEKLEYILLSEKESINSMSDEMMRISFFPSLETLEVRNCPVL  605

Query  857   KGWWKKN-----DEAIEEELLPPFPCISVVDIKQSPNVTWMPLFPTVSEKLYIVTGSIIP  693
             KGWW+ +       + E   LP F  +S + I + PN+T MPL+P V +   ++TG+   
Sbjct  606   KGWWRAHARNTASSSTENLSLPSFASLSTLCIYECPNLTSMPLYPNVVK--MVLTGN---  660

Query  692   LEHTKKVCSSFKYLKKLWVSEVADLEY------MEIELFPSLEYLWVYDCRNLRDWGKKG  531
                      S+K +  L+V   +D+ +            P L  L         D     
Sbjct  661   ---------SWKVVDSLFVRGASDITHDVGVDVSASSSSPHLSKLTHLTLHGFEDLA---  708

Query  530   DHEDAPKALAKLAPSVIEFEVKNCPKLKLLPQGMRLLSSSTKFSISGCPLLKQKYKSKSG  351
                  P+ ++ L  S+ +  ++ CP L  +P+G+R L       I  CP+L ++ K ++G
Sbjct  709   ---SLPEEISNLT-SLQKLTIRVCPNLASIPEGIRGLPCLNTLVIEKCPMLSERCKKETG  764

Query  350   QNWPEVANI  324
             ++W ++A+I
Sbjct  765   EDWLKIAHI  773



>ref|XP_009354780.1| PREDICTED: disease resistance protein RGA2-like [Pyrus x bretschneideri]
Length=1027

 Score =   101 bits (251),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 86/297 (29%), Positives = 136/297 (46%), Gaps = 48/297 (16%)
 Frame = -2

Query  1136  QPMLTLLPPEDIGSVLSW-----KFASAYMTTIYIKNC-----PPGKQLPQFHLLPSLGE  987
             + M  L P  ++  +  W     +FAS + + I I N         ++LP    LPSL  
Sbjct  749   KSMEVLQPHSNLKQLQVWYYGGVRFASWFSSLINIVNLELWFFKRCQRLPPLAHLPSLKS  808

Query  986   LYFESIM-VDYIDTTDYEDDNSPSRSELFFPSLKKLWIWNCPNLKGWWKKN-------DE  831
             L    +  ++YI   D  D+        FFPSL+KL I +CP LKGWW+ +         
Sbjct  809   LTMVGLQKLEYISENDMSDEMMRIS---FFPSLEKLSIQDCPVLKGWWRAHTHNSDDSSS  865

Query  830   AIEEELLPPFPCISVVDIKQSPNVTWMPLFPTVSEKLYIVTGSIIPLEHTKKVCSSFKYL  651
             + E   LP FP +S V I + PN+T MPL+P V EK+           H +K  SS+K +
Sbjct  866   STENLSLPSFPRLSTVSIDECPNLTSMPLYPNV-EKI-----------HLEK--SSWKVV  911

Query  650   KKLWVSEVADLEY------MEIELFPSLEYLWVYDCRNLRDWGKKGDHEDAPKALAKLAP  489
               L+V   +D+ +            P L  L       + D          P+ ++ L  
Sbjct  912   DSLFVRGASDITHDVGVDVSASSSSPHLSKLTHLSLHAIEDLA------SLPEEISNLT-  964

Query  488   SVIEFEVKNCPKLKLLPQGMRLLSSSTKFSISGCPLLKQKYKSKSGQNWPEVANITT  318
             S+ E  + NC  L  LP+G+R L    +  I  CP+L ++ K ++G++W ++ +I +
Sbjct  965   SLQELAISNCSNLSSLPEGIRGLPCLNRLKIWRCPMLSERCKKETGEDWFKIGHIQS  1021


 Score = 60.8 bits (146),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 43/137 (31%), Positives = 71/137 (52%), Gaps = 7/137 (5%)
 Frame = -2

Query  1553  SVAKLILAKIAPFAQDQIKLLWGLNEELTKLGDLVSHIGAVLLDAEGEKHNKKTENLLEM  1374
             ++A+ I+ ++   A  +I L+WG+ +EL KL D V+   AVLLDAE ++ N + +  L+ 
Sbjct  8     NIAEGIIGRLGSLAFQEIGLIWGVQDELRKLRDTVAGFQAVLLDAEQKQANNEVKQWLQS  67

Query  1373  LKNIMDEANRLMDYFSPRAKNHR--PNQEDGC--CSYFVSHPNPFVWVSDSFMAGKIKSI  1206
             +++ + EA+  +D F+  A+  +  P           F S  N  V+     M  KIK I
Sbjct  68    VEDAVYEADDQLDEFNAEAQRRQMVPGNTKLLKKVRLFFSRSNQLVFGLK--MGHKIKDI  125

Query  1205  NNRLDGIIENYKKIRLE  1155
             N RL   + N +   LE
Sbjct  126   NKRLSE-VANRRTFHLE  141



>ref|XP_011002411.1| PREDICTED: putative disease resistance protein RGA1 [Populus 
euphratica]
Length=921

 Score =   100 bits (249),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 74/235 (31%), Positives = 112/235 (48%), Gaps = 32/235 (14%)
 Frame = -2

Query  1085  WKFASAYMTTIYIKNCPPGKQLPQFHLLPSLGELYFESIMVDYIDTTDYEDD--NSPSRS  912
             W    + +  I+I  CP  K +P    +PSL EL     ++ Y+   +Y D   N     
Sbjct  402   WLSLQSNLVRIHIICCPRLKHIPPLDKIPSLREL-----LIMYLTNLEYMDSEGNGGRGV  456

Query  911   ELFFPSLKKLWIWNCPNLKGWWKKNDEAIEEELLPPFPCISVVDIKQSPNVTWMPLFPTV  732
                FPSLKKL I NCPNLKGWWKK+ + +   ++  FPC+  + I   PN+T MPLFPT+
Sbjct  457   SKIFPSLKKLSISNCPNLKGWWKKSRDKL---IMLRFPCLCSLSIVDCPNLTSMPLFPTL  513

Query  731   SEKLYIVTGSIIPLEHTKKVCSSFKYLKKLWVSEVADLEYMEIELFPSLEYLWVYDCRNL  552
             S  L ++  S +PL+ T ++ S+                         L+ L++Y   N+
Sbjct  514   S-ILILLRASSMPLQQTMEMTSAVSSSSSF------------TRPLSKLKNLYIYFIDNM  560

Query  551   RDWGKKGDHEDAPKALAKLAPSVIEFEVKNCPKLKLLPQGMRLLSSSTKFSISGC  387
                      E  P+A  +   S+ +  ++ C KLK LP   + + S  K +IS C
Sbjct  561   ---------ESLPEAGLQNLCSLQQLSIRGCSKLKSLPLPDQGMHSLQKLNISDC  606


 Score = 93.2 bits (230),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 74/257 (29%), Positives = 121/257 (47%), Gaps = 33/257 (13%)
 Frame = -2

Query  1088  SWKFASAYMTTIYIKNCPPGKQLPQFHLLPSLGELYFESIM-VDYIDTTDYEDDNSPSRS  912
             SW    + +  I+++N    + +P    +PSL +LYF S+  ++YID+         +  
Sbjct  639   SWLSHLSNLVRIHLENGRRLEHIPPLDGIPSLADLYFGSMNDLEYIDSEGVGGKGVAT--  696

Query  911   ELFFPSLKKLWIWNCPNLKGWWKK--NDEAIEEELLPPFPCISVVDIKQSPNVTWMPLFP  738
                FPSLK L I+    LKGWWK+   D+  ++ +   FP +S + I+  PN+T MPLFP
Sbjct  697   --LFPSLKTLVIYGWFRLKGWWKRWSRDKMNDDRIF--FPRLSSLKIRWCPNLTSMPLFP  752

Query  737   TVSEKLYIVTGSIIPLEHTKKVCSSF----KYLKKLWVSEVADLEYMEIELFPSLEYLWV  570
             T+ E L +   S +PL+ T K+ S+           ++  ++ L+ ++I           
Sbjct  753   TLDEGLSLTKTSSMPLQQTMKMKSAVSSSSSSSSSSFIRPLSKLKELDI-----------  801

Query  569   YDCRNLRDWGKKGDHEDAPKALAKLAPSVIEFEVKNCPKLKLLPQGMRLLSSSTKFSISG  390
                      G   D E  P+   +   S+ +  +  CP+LK LP   + + S  K  ISG
Sbjct  802   ---------GSIDDMESLPEVGLQNLSSLQQLSISECPRLKSLPLPDQGMPSLQKLYISG  852

Query  389   CPLLKQKYKSKSGQNWP  339
             C  LK   +S+S    P
Sbjct  853   CRELKSLSQSQSQGRIP  869



>gb|KGN45111.1| hypothetical protein Csa_7G426520 [Cucumis sativus]
Length=690

 Score =   100 bits (248),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 84/280 (30%), Positives = 135/280 (48%), Gaps = 39/280 (14%)
 Frame = -2

Query  1100  GSVLSWKFASAY-MTTIYIKNCPPGKQLPQFHLLPSLGELYFESIM-VDYIDTTDYEDDN  927
             G++ +W F S   +T I I+NCP  + LPQF+ L  L  L+   +  +++ID +D     
Sbjct  396   GALPNWVFNSLMKLTEIEIENCPRVQHLPQFNQLQDLRALHLVGLRSLEFIDKSD-----  450

Query  926   SPSRSELFFPSLKKLWIWNCPNLKGWWKKNDEAI-------EEELLPP-FPCISVVDIKQ  771
              P  S +FFPSLK L + + PNL+GWW+  +  +       + + LPP FP ++ + I  
Sbjct  451   -PYSSSVFFPSLKFLRLEDMPNLEGWWELGESKVVARETSGKAKWLPPTFPQVNFLRIYG  509

Query  770   SPNVTWMPLFPTVSEKLYIVTGSIIPLEHTKKVCSSFKY--------LKKLWVSEVADLE  615
              P ++ MP   ++   + I+    + +  T    SSF +        LK LW     DL 
Sbjct  510   CPKLSSMPKLASIGADV-ILHDIGVQMVSTIGPVSSFMFLSMHGMTNLKYLWEEFQQDLV  568

Query  614   YMEIELFP---SLEYLWVYDCRNLRDWGKKGDHEDAPKALAKLAPSVIEFEVKNCPKLKL  444
                        SL YL +  C  L            P+ +  L  S+    +K CPKLK 
Sbjct  569   SSSTSTMSSPISLRYLTISGCPYLM---------SLPEWIGVLT-SLETLHIKECPKLKS  618

Query  443   LPQGMRLLSSSTKFSISGCPLLKQKYKSKSGQNWPEVANI  324
             LP+GM+ L S  +  I  CP L+ + K + G++WP ++++
Sbjct  619   LPEGMQQLKSLKELHIEDCPELEDRCK-QGGEDWPNISHV  657



>ref|XP_004136126.1| PREDICTED: putative disease resistance protein RGA4-like [Cucumis 
sativus]
Length=1073

 Score =   100 bits (248),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 84/280 (30%), Positives = 135/280 (48%), Gaps = 39/280 (14%)
 Frame = -2

Query  1100  GSVLSWKFASAY-MTTIYIKNCPPGKQLPQFHLLPSLGELYFESIM-VDYIDTTDYEDDN  927
             G++ +W F S   +T I I+NCP  + LPQF+ L  L  L+   +  +++ID +D     
Sbjct  779   GALPNWVFNSLMKLTEIEIENCPRVQHLPQFNQLQDLRALHLVGLRSLEFIDKSD-----  833

Query  926   SPSRSELFFPSLKKLWIWNCPNLKGWWKKNDEAI-------EEELLPP-FPCISVVDIKQ  771
              P  S +FFPSLK L + + PNL+GWW+  +  +       + + LPP FP ++ + I  
Sbjct  834   -PYSSSVFFPSLKFLRLEDMPNLEGWWELGESKVVARETSGKAKWLPPTFPQVNFLRIYG  892

Query  770   SPNVTWMPLFPTVSEKLYIVTGSIIPLEHTKKVCSSFKY--------LKKLWVSEVADLE  615
              P ++ MP   ++   + I+    + +  T    SSF +        LK LW     DL 
Sbjct  893   CPKLSSMPKLASIGADV-ILHDIGVQMVSTIGPVSSFMFLSMHGMTNLKYLWEEFQQDLV  951

Query  614   YMEIELFP---SLEYLWVYDCRNLRDWGKKGDHEDAPKALAKLAPSVIEFEVKNCPKLKL  444
                        SL YL +  C  L            P+ +  L  S+    +K CPKLK 
Sbjct  952   SSSTSTMSSPISLRYLTISGCPYLM---------SLPEWIGVLT-SLETLHIKECPKLKS  1001

Query  443   LPQGMRLLSSSTKFSISGCPLLKQKYKSKSGQNWPEVANI  324
             LP+GM+ L S  +  I  CP L+ + K + G++WP ++++
Sbjct  1002  LPEGMQQLKSLKELHIEDCPELEDRCK-QGGEDWPNISHV  1040



>ref|XP_006451769.1| hypothetical protein CICLE_v10007328mg [Citrus clementina]
 ref|XP_006464819.1| PREDICTED: putative disease resistance protein RGA3-like [Citrus 
sinensis]
 gb|ESR65009.1| hypothetical protein CICLE_v10007328mg [Citrus clementina]
Length=1024

 Score = 98.6 bits (244),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 77/264 (29%), Positives = 130/264 (49%), Gaps = 31/264 (12%)
 Frame = -2

Query  1088  SWKFASAYMTTIYIKNCPPGKQLPQFHLLPSLGEL-YFESIMVDYIDTTDYEDDNSPSRS  912
             SW  +   +T I I  C   + +P+   LPSL  L  F+   ++YI ++          S
Sbjct  766   SWLSSVTNLTMIDISICIKCQYIPELDQLPSLKRLRLFKLSALEYISSS-------SPPS  818

Query  911   ELFFPSLKKLWIWNCPNLKGWWKKNDEAIEEELLPPFPCISVVDIKQSPNVTWMPLFPTV  732
                FPSL++L I+ CP LKGWW+ +    +    P FP +S + I   P + +MPL+P++
Sbjct  819   TTIFPSLEELRIFACPELKGWWRTDGSTTQTAEPPLFPSLSKLTIDGCPKLVFMPLYPSL  878

Query  731   SEKLYIVTGSIIPLEHTKKVCSS-----FKYLKKLWVSEVADLEYMEIEL---FPSLEYL  576
              E+L + + S  PL+ T    ++     F  LK L +  + DLE    E+   FPS++ +
Sbjct  879   -EELSLCSTSSHPLQQTMMRTTNTAEPPFSKLKSLTIESIDDLETWPEEMMPNFPSIQNI  937

Query  575   WVYDCRNLRDWGKKGDHEDAPKALAKLAPSVIEFEVKNCPKLKLLPQGMRLLSSSTKFSI  396
              +  C  L            P+ L K A ++    + +CP + +LP+G++L S      I
Sbjct  938   SIELCPKLISL---------PQRLNK-ATTLKTVGIYDCPNMAILPEGLQLQS----LEI  983

Query  395   SGCPLLKQKYKSKSGQNWPEVANI  324
               CP L ++  +    +WP++A+I
Sbjct  984   IQCPQLSERCGNNMAVDWPKIAHI  1007



>ref|XP_003612759.1| Nbs-lrr resistance protein [Medicago truncatula]
 gb|AES95717.1| disease resistance protein (CC-NBS-LRR class) family protein 
[Medicago truncatula]
Length=1082

 Score = 98.6 bits (244),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 78/269 (29%), Positives = 136/269 (51%), Gaps = 33/269 (12%)
 Frame = -2

Query  1100  GSVLSWKFAS-AYMTTIYIKNCPPGKQLPQFHLLPSLGELYFESIMVDYIDTTDYEDDNS  924
             G  LS  F+S A +  + + +C     LP  H LP+L   + E + +D ++    + ++S
Sbjct  741   GKTLSNWFSSIACLVKLSLYDCTSCIFLPHLHELPNLR--FLELLRLDKLEYIADQSNDS  798

Query  923   PSRSE------LFFPSLKKLWIWNCPNLKGWWKKNDEAIEEELLPPFPCISVVDIKQSPN  762
                ++      + FPSL++L I +CPNLK WW+K+     E+ LP F C+S +++   P 
Sbjct  799   DRHNDKLQAAAVHFPSLEELTISDCPNLKRWWRKDKM---EKDLPFFACLSKLNVNYCPE  855

Query  761   VTWMPLFPTVSEKLYIVTGSIIPL----EHTKKVCSSFKYLKKLWVSEVADLEY---MEI  603
             +T MPLFP + E+L +V  S+ PL     H  + C  F  LK + ++ + D      + I
Sbjct  856   LTCMPLFPGLDEELILVGSSVKPLLDSINHGHRKCYPFSKLKSMKIANIEDSRSPAKIWI  915

Query  602   ELFPSLEYLWVYDCRNLRDWGKKGDHEDAPKAL-----AKLAPSVIEFE---------VK  465
             E F SLE L + + ++L+   +  D+ ++ ++L      +L  S  E+E         ++
Sbjct  916   EYFNSLEKLDIKEWKHLKSLPEGFDNLNSLQSLNIENCQELDLSSTEWEGLKNLRSLTIR  975

Query  464   NCPKLKLLPQGMRLLSSSTKFSISGCPLL  378
               PKL+ LP  +  ++S     +  CP L
Sbjct  976   EIPKLETLPSSIYKVTSLQDLQLHNCPQL  1004



>ref|XP_003612736.1| Cc-nbs-lrr resistance protein [Medicago truncatula]
 gb|AES95694.1| NBS-LRR resistance protein [Medicago truncatula]
Length=1090

 Score = 97.8 bits (242),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 90/336 (27%), Positives = 135/336 (40%), Gaps = 85/336 (25%)
 Frame = -2

Query  1100  GSVLS-WKFASAYMTTIYIKNCPPGKQLPQFHLLPSLGELYFESIMVDYIDTTDYEDDNS  924
             G +LS W  +  ++    + +CP  K LP    LP L  L    +     D+  +  +N+
Sbjct  747   GHMLSNWLASLQFLGKFTLNDCPNCKFLPPMDQLPHLKVLQLRRL-----DSLKFIAENN  801

Query  923   PSRSELFFPSLKKLWIWNCPNLKGWWKKNDEAIEEELLPPFPCISVVDIKQSPNVTWMPL  744
              + +  FFPSLK+L I +CPNLK WW+K+   I E   P F CIS ++I+  P +  MPL
Sbjct  802   HTNTPKFFPSLKELAISDCPNLKSWWEKD---IRENDRPSFSCISKLNIQYCPQLASMPL  858

Query  743   FPTVSEKLYIVTGSIIPLEHTKKVC--------SSFKYLKKLWVSEVADLEYMEIEL---  597
             +P + ++L +V  S+I ++ T K          S  K   KL    V  +++   E    
Sbjct  859   YPGLDDELVVVESSVISMKDTMKYAAPEIKTSNSQLKPFSKLKSMVVERIDHSPPERWLK  918

Query  596   -FPSLEYLWVYDCRNLR-----------------------DWGKKGDHEDAPKALAKLAP  489
              F SLE L + DC NL                        D  K  +  +  K L  L  
Sbjct  919   NFISLEELHIRDCFNLASLPQGFKSLSSLQTLTIERCQELDLDKHPNEWEGLKNLRSLTL  978

Query  488   SVI-----------------EFEVKNCPKLKLLPQ------------------------G  432
               I                 +  + +C  L  LP+                        G
Sbjct  979   RSIPKLKSLPWGVENVNTLKDLRIYDCHGLTFLPESIGNLTSLEKLVLSECRKLDSLPKG  1038

Query  431   MRLLSSSTKFSISGCPLLKQKYKSKSGQNWPEVANI  324
             M  L S     I  CPLL  + +  +G +WP++ANI
Sbjct  1039  MEKLESLNTLIIMDCPLLLPRCQPDTGDDWPQIANI  1074



>gb|AHG28989.1| NBS-LRR protein [Cicer arietinum]
Length=647

 Score = 97.1 bits (240),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 65/205 (32%), Positives = 107/205 (52%), Gaps = 31/205 (15%)
 Frame = -2

Query  908  LFFPSLKKLWIWNCPNLKGWWKKNDEA-IEEEL-LPPFPCISVVDIKQSPNVTWMPLFPT  735
            LFFPSL+KL ++ C NL+GW +  + A +   L LPPFPC+S +DI + P +T MP +P 
Sbjct  458  LFFPSLEKLVLFGCKNLRGWQRLGNSADVANHLSLPPFPCLSYLDIWECPKLTCMPTYPY  517

Query  734  VSEKLYIVTGSIIPLEHTKKVCSSFKYLK-------KLWVSEVADLEYMEI-ELFPSLEY  579
                       +I L H + + +  K L+        LW  E       ++     SL+ 
Sbjct  518  -----------LIELRHLQHLSAELKKLRICQVDKVDLWRDEDNTSTLCQVPHGLRSLQK  566

Query  578  LWVYDCRNLRDWGKKGDHEDAPKALAKLAPSVIEFEVKNCPKLKLLPQGMRLLSSSTKFS  399
            + +  C NL+ +         P+ +  L  S+   ++ +C  L+ LP+G+R L++     
Sbjct  567  ISIEFCDNLKAF---------PEQILDLQ-SLRHIKILHCDDLESLPEGLRCLANLQTLH  616

Query  398  ISGCPLLKQKYKSKSGQNWPEVANI  324
            IS C LL+++ +SK G++WP VA+I
Sbjct  617  ISHCRLLRKRCQSKIGEDWPNVAHI  641



>gb|AAO37646.1| NBS-LRR resistance protein RGH2 [Manihot esculenta]
Length=1024

 Score = 97.1 bits (240),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 75/255 (29%), Positives = 122/255 (48%), Gaps = 31/255 (12%)
 Frame = -2

Query  1088  SWKFASAYMTTIYIKNCPPGKQLPQFHLLPSLGELYFESIMVDYIDTTDYEDDNSPSRSE  909
             SW  +   +  ++I NC   + L     +PSL   Y +   VD ++  + E    P+   
Sbjct  757   SWFSSLTNLVYLFIWNCKRYQHLQPMDQIPSLQ--YLQIWGVDDLEYMEIE--GQPTS--  810

Query  908   LFFPSLKKLWIWNCPNLKGWWKKNDEAIEEELLPPFPCISVVDIKQSPNVTWMPLFPTVS  729
              FFPSLK L +  CP LKGW KK D++   ELL  FPC+S    ++ PN+T +P FP++ 
Sbjct  811   -FFPSLKTLDLHGCPKLKGWQKKRDDSTALELLQ-FPCLSYFLCEECPNLTSIPQFPSLD  868

Query  728   EKLYIVTGSIIPLEHTKKVCSSFKYLKKLWVSEVADLEYMEIELFPSLEYLWVYDCRNLR  549
             + L+++  S       + V   F        S +  L  ++I        LW+ D + L 
Sbjct  869   DSLHLLHAS------PQLVHQIFTPSISSSSSIIPPLSKLKI--------LWIRDIKELE  914

Query  548   DWGKKGDHEDAPKALAKLAPSVIEFEVKNCPKLKLLPQGMRLLSSSTKFSISGCPLLKQK  369
                        P  L  L   +    ++ CP +K LPQ MR L+S  + +I+ CP LK++
Sbjct  915   SL--------PPDGLRNLT-CLQRLTIQICPAIKCLPQEMRSLTSLRELNINDCPQLKER  965

Query  368   YKSKSGQNWPEVANI  324
               ++ G +W  +++I
Sbjct  966   CGNRKGADWAFISHI  980


 Score = 60.5 bits (145),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 50/138 (36%), Positives = 70/138 (51%), Gaps = 11/138 (8%)
 Frame = -2

Query  1583  MVDPVVSTAISVAKLILAKIAPFAQDQIKLLWGLNEELTKLGDLVSHIGAVLLDA-EGEK  1407
             M D V+S  +     I+ K+   A  +I L WG+  EL KL   VS I  VLLDA E +K
Sbjct  1     MADGVLSNVVGD---IITKLGSRALHEIGLWWGVKGELKKLEATVSSIRNVLLDAEEQQK  57

Query  1406  HNKKTENLLEMLKNIMDEANRLMDYFSPRAKNHR---PNQEDGCCSYFVSHPNPFVWVSD  1236
              N++ +  LE L+ I+ +A+ L+D F+  A   R    N+     S F S  N  V+   
Sbjct  58    LNRQVKGWLERLEEIVYDADDLVDDFATEALRRRVMTGNRMTKEVSLFFSSSNQLVY---  114

Query  1235  SF-MAGKIKSINNRLDGI  1185
              F M  K+K+I  RL  I
Sbjct  115   GFKMGRKVKAIRERLADI  132



>ref|XP_010112014.1| hypothetical protein L484_004701 [Morus notabilis]
 gb|EXC32359.1| hypothetical protein L484_004701 [Morus notabilis]
Length=600

 Score = 96.3 bits (238),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 86/343 (25%), Positives = 148/343 (43%), Gaps = 94/343 (27%)
 Frame = -2

Query  1088  SWKFASAYMTTIYIKNCPPGKQLPQFHLLPSLGELYFESI-MVDYIDTTDYEDDNSPSRS  912
             SW  +   M  + +++C   + L   +  P L +L    +  ++YI+    E+++    S
Sbjct  258   SWLSSLTNMVNLTLQSCEKCQHLVPLNQFPRLEKLELNFLPCLEYING---EEEDLLLSS  314

Query  911   ELFFPSLKKLWIWNCPNLKGWWKKNDEAIEEELLPPFP-CISVVDIKQSPNVTWMPLFPT  735
              +  PSL++L + + PNLKGWW+   E +  ELLP FP C+S ++I+  P ++ MPL+P 
Sbjct  315   TIVLPSLRELRLRDLPNLKGWWR---EVVSGELLPCFPPCLSTLEIRNCPQLSCMPLYPH  371

Query  734   VSEKLYIVTGSIIPLEHT-----KKVCS--------------------------------  666
             +  +L ++   + PLE T      + CS                                
Sbjct  372   LEGRLDLINTRLKPLEQTVLVLESRKCSTSTTGTEIPTTPSSSFSSLSKLTSLTISEIGE  431

Query  665   ----------SFKYLKKLWVSEVADLEYME--IELFPSLEYLWVYDCRN------LRDWG  540
                       S   LKKL + E + L+ +   I+   SLE L + +C        L++ G
Sbjct  432   DLQCLPEWFKSLTCLKKLEIQECSKLKDLSPGIQHLTSLEDLEIRNCEELEVMIPLKNNG  491

Query  539   KK------GDHEDA--PKALAKLAP-----------------------SVIEFEVKNCPK  453
             +       G H+ A  P  L  L                         S+    + NCPK
Sbjct  492   RLRYLRLIGSHKLASLPGGLQHLTSLRRLLISDWESLETIPEWIGNLNSLESLHLLNCPK  551

Query  452   LKLLPQGMRLLSSSTKFSISGCPLLKQKYKSKSGQNWPEVANI  324
             L+ LP+G+R L+      I  CP+L ++ + + G++WP++A+I
Sbjct  552   LRALPEGIRSLTCLKTLWIWDCPMLLKRCQRQIGEDWPKIAHI  594


 Score = 58.9 bits (141),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 91/396 (23%), Positives = 161/396 (41%), Gaps = 62/396 (16%)
 Frame = -2

Query  1550  VAKLILAKIAPFAQDQIKLLWGLNEELTKLGDLVSHIGAVLLDAEGEKHNK-KTENLLEM  1374
             +A  IL  +      +I L WG+N++L +L + +S I +VLLDAE ++ N  +  N L  
Sbjct  9     IAGKILEGLGSADVKEIALFWGVNDDLDQLNETISTIKSVLLDAEEKQINSHQVRNWLRR  68

Query  1373  LKNIMDEANRLMDYFSPRAKNHRPNQEDGCCSYFVSHPNPFVWVSDSFMAGKIKSINNRL  1194
             L  ++D+A+ LMD F+  A   R        S  V H       S              L
Sbjct  69    LGGVVDDADNLMDEFNTEALRQRVMPAG---SETVKHTLRLNGCSG-------------L  112

Query  1193  DGIIENYKK-IRLEEQNPKQQPMLTLLPPEDIGSVLSWKFASAYMTT----IYIKNCPPG  1029
               +  + KK + L      +   LT + P  +  + + +  S Y+ +    + + N   G
Sbjct  113   RELPRDMKKLVNLRHLEIDRCSGLTHM-PRGLSQLTNLQTLSTYILSESNDVVMIN---G  168

Query  1028  KQLPQFHLLPSL-GELYFESIMVDYIDTTDYEDDNSPSRSELFFPSLKKLWIWNCPNLKG  852
              +L +   L +L GEL   ++  +     DYE  N   +  L + +LK            
Sbjct  169   GELKELVCLNNLKGELEILNLGHENDTARDYESANLKEKQYLRYLALK------------  216

Query  851   WWKKNDEAIEE--------ELLPPFPCISVVDIKQSPNVTWMPLFPTVSEKLYIVTGSII  696
              W  +DE  E         + L P   +  + +     V       +++  + +   S  
Sbjct  217   -WISDDEGTEAPVGYEKSLDALQPHLNLQELALWNYGGVKISSWLSSLTNMVNLTLQSCE  275

Query  695   PLEHTKKVCSSFKYLKKLWVSEVADLEYMEIE----------LFPSLEYLWVYDCRNLRD  546
               +H   + + F  L+KL ++ +  LEY+  E          + PSL  L + D  NL+ 
Sbjct  276   KCQHLVPL-NQFPRLEKLELNFLPCLEYINGEEEDLLLSSTIVLPSLRELRLRDLPNLKG  334

Query  545   WGKKGDHEDAPKALAKLAPSVIEFEVKNCPKLKLLP  438
             W ++     + + L    P +   E++NCP+L  +P
Sbjct  335   WWRE---VVSGELLPCFPPCLSTLEIRNCPQLSCMP  367



>gb|AAO37645.1| NBS-LRR resistance protein RGH1 [Manihot esculenta]
Length=1035

 Score = 97.1 bits (240),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 75/264 (28%), Positives = 120/264 (45%), Gaps = 48/264 (18%)
 Frame = -2

Query  1088  SWKFASAYMTTIYIKNCPPGKQLPQFHLLPSLGELYFESIMVDYIDTTDYEDDNSPSRSE  909
             SW  +   +  + I NC   + LP    +PSL   Y E + +D ++  + E    P+   
Sbjct  757   SWFSSLTNLVYLCIWNCKRYQHLPPMDQIPSLQ--YLEILGLDDLEYMEIE--GQPTS--  810

Query  908   LFFPSLKKLWIWNCPNLKGWWKKN-DEAIEEELLPPFPCISVVDIKQSPNVTWMPLFPTV  732
              FFPSLK L ++NCP LKGW KK  D++   ELL  FPC+S    +  PN+  +P FP++
Sbjct  811   -FFPSLKSLGLYNCPKLKGWQKKKEDDSTALELLQ-FPCLSYFVCEDCPNLNSIPQFPSL  868

Query  731   SEKLYIVTGS--------IIPLEHTKKVCSSFKYLKKLWVSEVADLEYMEIELFPSLEYL  576
              + L+++  S           +  +  +      LK LW+ ++ +LE +           
Sbjct  869   DDSLHLLHASPQLVHQIFTPSISSSSSIIPPLSKLKNLWIRDIKELESLP----------  918

Query  575   WVYDCRNLRDWGKKGDHEDAPKALAKLAPSVIEFEVKNCPKLKLLPQGMRLLSSSTKFSI  396
                               D  + L  L    IE     CP +K LPQ MR L+S  +  I
Sbjct  919   -----------------PDGLRNLTCLQRLTIEI----CPAIKCLPQEMRSLTSLRELDI  957

Query  395   SGCPLLKQKYKSKSGQNWPEVANI  324
               CP LK++  ++ G +W  +++I
Sbjct  958   DDCPQLKERCGNRKGADWAFISHI  981


 Score = 62.0 bits (149),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 53/155 (34%), Positives = 79/155 (51%), Gaps = 12/155 (8%)
 Frame = -2

Query  1583  MVDPVVSTAISVAKLILAKIAPFAQDQIKLLWGLNEELTKLGDLVSHIGAVLLDA-EGEK  1407
             M D V+S  +     I+ K+   A  +I L WG+  EL KL   VS I  VLLDA E +K
Sbjct  1     MADGVLSNVVGD---IITKLGSRALHEIGLWWGVKGELKKLEATVSSIRNVLLDAEEQQK  57

Query  1406  HNKKTENLLEMLKNIMDEANRLMDYFSPRAKNHR---PNQEDGCCSYFVSHPNPFVWVSD  1236
              N++ +  LE L+ ++ +A+ L+D F+  A   R    N+     S F S  N  V+   
Sbjct  58    LNRQVKGWLERLEEVVYDADDLVDDFATEALRRRVMTGNRMTKEVSLFFSSSNKLVY---  114

Query  1235  SF-MAGKIKSINNRLDGIIENYKKIRLEEQNPKQQ  1134
              F M  K+K+I  RL   IE  +K  LE +  +++
Sbjct  115   GFKMGHKVKAIRERL-ADIEADRKFNLEVRTDQER  148



>ref|XP_011031388.1| PREDICTED: LOW QUALITY PROTEIN: putative disease resistance protein 
RGA3 [Populus euphratica]
Length=1009

 Score = 95.9 bits (237),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 73/207 (35%), Positives = 108/207 (52%), Gaps = 31/207 (15%)
 Frame = -2

Query  1088  SWKFASAYMTTIYIKNCPPGKQLPQFHLLPSLGELYFESIM-VDYIDTTDYEDDNSPSRS  912
             SW    +Y+  I +++C   + +P  H +PSL EL  E +  ++YID+   E D     S
Sbjct  701   SWVSNLSYLVRIGLEDCRRLQHIPPLHGIPSLEELSIEGLGDLEYIDS---EGDGGRGAS  757

Query  911   ELFFPSLKKLWIWNCPNLKGWWKK------NDEA----IEEELLPPF-PCISVVDIKQSP  765
               FFPSL+KL I  C  LKGWWK+      ND++    IEE L+  F P +S + I   P
Sbjct  758   T-FFPSLRKLRISYCDRLKGWWKRWSRDEMNDDSDESTIEEGLIMLFFPRLSSLSIVDCP  816

Query  764   NVTWMPLFPTVSEKLYIVTGSIIPLEHTKKVCSS------------FKYLKKLWVSEVAD  621
             N+T MPLFPT+ E L++   S +PL+ T K+ S                LK L +  + D
Sbjct  817   NLTSMPLFPTLDEFLHLQNTSSMPLQQTMKMTSPVSPSSSSSFILPLSKLKNLLLDSIND  876

Query  620   LEYM-EIEL--FPSLEYLWVYDCRNLR  549
             +E + E+ L    SL+ L ++ C  L+
Sbjct  877   MESLPEVGLRNLSSLQKLLIWGCGRLK  903


 Score = 59.3 bits (142),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 41/149 (28%), Positives = 74/149 (50%), Gaps = 7/149 (5%)
 Frame = -2

Query  1553  SVAKLILAKIAPFAQDQIKLLWGLNEELTKLGDLVSHIGAVLLDAE--GEKHNKKTENLL  1380
             ++A+ I+  +      ++ L WG+ ++L KL D V+ I AV+ DAE   +K N++ ++ L
Sbjct  8     NIAEEIIKTLGSLIAQEVALWWGIKDQLRKLNDTVTRIKAVIQDAEEQAQKQNRQIQDWL  67

Query  1379  EMLKNIMDEANRLMDYFSPRA--KNHRPNQE-DGCCSYFVSHPNPFVWVSDSFMAGKIKS  1209
               L+    +A  L+D FS +   K   P +        F S  N FV+     M  ++K+
Sbjct  68    MKLREAAYDAEDLLDDFSTQVLRKQLMPGKRVSREVRLFFSRSNQFVY--GLRMGHRVKA  125

Query  1208  INNRLDGIIENYKKIRLEEQNPKQQPMLT  1122
             +  RLD I  + K    E ++ ++  + T
Sbjct  126   LRERLDNIETDSKIFHFEVRDEERASLTT  154



>ref|XP_009368038.1| PREDICTED: disease resistance protein RGA2-like [Pyrus x bretschneideri]
 ref|XP_009368039.1| PREDICTED: disease resistance protein RGA2-like [Pyrus x bretschneideri]
 ref|XP_009368040.1| PREDICTED: disease resistance protein RGA2-like [Pyrus x bretschneideri]
 ref|XP_009368041.1| PREDICTED: disease resistance protein RGA2-like [Pyrus x bretschneideri]
 ref|XP_009368042.1| PREDICTED: disease resistance protein RGA2-like [Pyrus x bretschneideri]
Length=1219

 Score = 95.9 bits (237),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 85/267 (32%), Positives = 125/267 (47%), Gaps = 46/267 (17%)
 Frame = -2

Query  1082  KFASAYMTTIYIKN-----CPPGKQLPQFHLLPSLGELYFESIM-VDYIDTTDYEDDNSP  921
             +FAS + + I I N     C   + LP  H LPSL  L+  ++  ++YI  T+ E  NS 
Sbjct  771   RFASWFSSLINIVNLQLWDCKRCQHLPPLHHLPSLKSLHLLNLKKLEYI--TEKESSNSM  828

Query  920   SRSEL---FFPSLKKLWIWNCPNLKGWWKKN-----DEAIEEELLPPFPCISVVDIKQSP  765
             S   +   FFPSL+ L I  CP LKGWW+ +       + E   L  FPC+S + I   P
Sbjct  829   SDEMMRISFFPSLETLKIVYCPVLKGWWRAHTHNSASSSTENLSLTSFPCLSTLRILCCP  888

Query  764   NVTWMPLFPTVS------------EKLYIVTGSIIPLEHTKKVCSS-----FKYLKKLWV  636
             ++T MPL+P V             + L++   S I  +    V +S        L +L +
Sbjct  889   DLTSMPLYPNVESIELESTSWKVVDSLFVRGASDITHDVGVDVSASSSSPHLSKLTRLTL  948

Query  635   SEVADLEYMEIEL---FPSLEYLWVYDCRNLRDWGKKGDHEDAPKALAKLAPSVIEFEVK  465
             S + DLE++  E      SL+ L + DC NL            P+ +A L  S+    ++
Sbjct  949   SGIEDLEFIPSEGMGNLTSLQVLAIDDCPNL---------AALPEGIANLT-SLQSLWIE  998

Query  464   NCPKLKLLPQGMRLLSSSTKFSISGCP  384
             NCP L  LP+G+  L+S     I  CP
Sbjct  999   NCPNLAALPEGIANLTSLQSLWIENCP  1025


 Score = 61.6 bits (148),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 71/287 (25%), Positives = 127/287 (44%), Gaps = 46/287 (16%)
 Frame = -2

Query  1127  LTLLPPEDIGSVLSWKFASAYMTTIYIKNCPPGKQLPQ-FHLLPSLGELYFESIMVDYID  951
             L  +P E +G++ S       +  + I +CP    LP+    L SL  L+ E        
Sbjct  954   LEFIPSEGMGNLTS-------LQVLAIDDCPNLAALPEGIANLTSLQSLWIE--------  998

Query  950   TTDYEDDNSPSRSEL-----FFPSLKKLWIWNCPNLKGWWK-----KNDEAIEEELLPPF  801
                    N P+ + L        SL+ LWI NCPNL    +      + +++  E+ P  
Sbjct  999   -------NCPNLAALPEGIANLTSLQSLWIENCPNLAALPEGIANLTSLQSLGIEVCPNL  1051

Query  800   PC----ISVVDIKQSPNVTWMPLFPTVSEKLYIVTGSIIPLEHTKKVCSSFKYLKKLWVS  633
                   I+ +   QS  + + P    + E +  +T S+  L    +VC +   L +  ++
Sbjct  1052  AALPEGIANLTSLQSLRIEYCPNLAALPEGIANLT-SLQSL--GIEVCPNLAALPE-GIA  1107

Query  632   EVADLEYMEIELFPSLEYL--WVYDCRNLRDWGKKG--DHEDAPKALAKLAPSVIEFEVK  465
              +  L+ + I  FP+L  L  W+ +  +L+    K   +    P+ +  L  S+   ++ 
Sbjct  1108  NLTSLQSLSIGNFPNLAALPEWIANLTSLQSLSIKNFPNVAALPEEIRNLT-SLQCLKIT  1166

Query  464   NCPKLKLLPQGMRLLSSSTKFSISGCPLLKQKYKSKSGQNWPEVANI  324
             +C  L  LP+G+R         IS CP+L Q+YK ++G++W ++A I
Sbjct  1167  HCSNLASLPEGIRGFPCLNTLFISDCPMLLQRYKKETGEDWDKIARI  1213


 Score = 54.3 bits (129),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 41/137 (30%), Positives = 72/137 (53%), Gaps = 10/137 (7%)
 Frame = -2

Query  1583  MVDPVVSTAISVAKLILAKIAPFAQDQIKLLWGLNEELTKLGDLVSHIGAVLLDAEGEKH  1404
             M + V+S   +VA  I+ ++   A  +I L+WG+ +E  KL + V+   AVLLDAE ++ 
Sbjct  1     MAERVLS---NVAGGIIERLGSLAFKEIGLIWGVKDEFRKLKETVAGFQAVLLDAEQKQA  57

Query  1403  NKKTENLLEMLKNIMDEANRLMDYFSPRAKNHR--PNQEDGC--CSYFVSHPNPFVWVSD  1236
             N++T+  L+ +++ + EA+ ++D F+  A+  +  P           F S  N    +  
Sbjct  58    NEETKLWLQSVEDAVYEADDVLDEFNTEAQRRQIVPGNTKVLKKVLLFFSSSNQLFGLK-  116

Query  1235  SFMAGKIKSINNRLDGI  1185
               M  K+K IN RL  +
Sbjct  117   --MGHKMKDINKRLSEV  131



>ref|XP_008350664.1| PREDICTED: putative disease resistance protein RGA1 [Malus domestica]
Length=1051

 Score = 95.5 bits (236),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 52/150 (35%), Positives = 84/150 (56%), Gaps = 16/150 (11%)
 Frame = -2

Query  1088  SWKFASAYMTTIYIKNCPPGKQLPQFHLLPSLGELYFESIMVDYIDTTDYEDDNSPSRSE  909
              W  +   +  + +++C   + LP F  LP L     + + +D +D  +Y  D S S S 
Sbjct  759   GWLSSLXNIVNLSLRDCRTCQYLPPFDHLPRL-----KVLRLDGLDALEYISDASSSASR  813

Query  908   L-FFPSLKKLWIWNCPNLKGWWKK----------NDEAIEEELLPPFPCISVVDIKQSPN  762
             + FFPSLKK+++WNCPNLKGWWK+          N+    ++    FPC+S++ +   PN
Sbjct  814   IPFFPSLKKIYLWNCPNLKGWWKQSALIGSPMTENEHQHIQQSSLSFPCLSLLYVWNCPN  873

Query  761   VTWMPLFPTVSEKLYIVTGSIIPLEHTKKV  672
             +T MPL+P + E+L++   S+ PLE T  +
Sbjct  874   LTSMPLYPHLEEELFLDNTSLKPLEETMMI  903



>gb|KEH38630.1| NBS-LRR type disease resistance protein [Medicago truncatula]
Length=1091

 Score = 95.1 bits (235),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 73/254 (29%), Positives = 118/254 (46%), Gaps = 59/254 (23%)
 Frame = -2

Query  914   SELFFPSLKKLWIWNCPNLKGWWKKNDEAIEEELLPPFPCISVVDIKQSPNVTWMPLFPT  735
             S +FFPSL+KL ++ C NLKGW +  +       LPPFPC+S ++I   P +T MP +P 
Sbjct  831   SHVFFPSLEKLILFGCKNLKGWKRLGNNVENHHPLPPFPCLSYLEIWDCPKLTCMPTYPY  890

Query  734   VSEKLYIVTGSIIPLEHTKKV---CSSFK---YLKKLWVSEVADLE--------------  615
             ++E L +++ ++ P+  T  V    SSF     LK L+++E+ DLE              
Sbjct  891   LTE-LKLISCNVKPMIETCSVQLQSSSFNPLFGLKHLYLTEI-DLEAMPEQWMKNLKSLE  948

Query  614   ------YMEIE--------LFPSLEYLWVYDCRNL---RDWGKKGDHEDAPKALAKLAPS  486
                   ++ IE        L   L+ L +     L   RD G        P  L  L   
Sbjct  949   RLSLSGFLVIEPMIRHLQHLSAGLQELRICQVDKLDLWRDEGNANSECQVPHGLRSLQKI  1008

Query  485   VIEF--------------------EVKNCPKLKLLPQGMRLLSSSTKFSISGCPLLKQKY  366
              +EF                    ++ +C  L+ LP+G+R L++     I  CPL++++ 
Sbjct  1009  SVEFCDNLKAFPEQILDIQSLRHIKILHCDDLESLPEGLRCLTNLQTLHIIHCPLIRKRC  1068

Query  365   KSKSGQNWPEVANI  324
             + K G++WP +A+I
Sbjct  1069  QIKVGEDWPNIAHI  1082



>ref|XP_009354779.1| PREDICTED: disease resistance protein RGA2-like [Pyrus x bretschneideri]
Length=1042

 Score = 95.1 bits (235),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 79/277 (29%), Positives = 126/277 (45%), Gaps = 45/277 (16%)
 Frame = -2

Query  1082  KFASAYMTTIYIKN-----CPPGKQLPQFHLLPSLGELYFESI-MVDYIDTTDYEDDNSP  921
             +FAS + + I I N     C   + LP    LPSL  LY   +  ++YI  ++ E  NS 
Sbjct  785   RFASWFSSLINIVNLTMWDCKRCQHLPPLDHLPSLKYLYLRELEKLEYI--SEKESSNSM  842

Query  920   SRSEL---FFPSLKKLWIWNCPNLKGWWKKNDE-------AIEEELLPPFPCISVVDIKQ  771
             S   +   FFPSL+ L + NCP LKGWW+ +         + E   LP F  +S + I  
Sbjct  843   SDEMMRISFFPSLETLDLCNCPVLKGWWRAHTHNSASSSSSTENLSLPSFTRLSTLYIIN  902

Query  770   SPNVTWMPLFPTVSEKLYIVTGSIIPLEHTKKVCSSFKYLKKLWVSEVADLEY------M  609
              PN++ +PL+P V              +  K   SS+K +  L+V   +D+ +       
Sbjct  903   CPNLSSLPLYPNV--------------KRIKLTRSSWKVVDSLFVRGASDITHDVGVDVS  948

Query  608   EIELFPSLEYLWVYDCRNLRDWGKKGDHEDAPKALAKLAPSVIEFEVKNCPKLKLLPQGM  429
                  P L  L       + D          P+ +  L  S+ E  + NC  L  LP+G+
Sbjct  949   ASSSSPHLSKLTHLTLNGIEDLAS------LPEEINNLT-SLQELAISNCSNLSSLPEGI  1001

Query  428   RLLSSSTKFSISGCPLLKQKYKSKSGQNWPEVANITT  318
             R L    +  I  CP+L ++ K ++G++W ++A+I +
Sbjct  1002  RGLPCLNRLEIRWCPMLSERCKKETGEDWFKIAHIQS  1038


 Score = 53.5 bits (127),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 39/127 (31%), Positives = 68/127 (54%), Gaps = 6/127 (5%)
 Frame = -2

Query  1553  SVAKLILAKIAPFAQDQIKLLWGLNEELTKLGDLVSHIGAVLLDAEGEKHNKKTENL-LE  1377
             ++A+ I+ ++   A  +I  +WG+ +EL KL + V     VLLDAE ++ N     L L+
Sbjct  8     NIAERIIVRLGNCAFQKIGSIWGVQDELNKLKETVDGFQDVLLDAEQKQANNNEVKLWLQ  67

Query  1376  MLKNIMDEANRLMDYFSP---RAKNHRPNQEDGCCSYFVSHPNPFVWVSDSFMAGKIKSI  1206
              +++ + EA+ ++D F+    R +  R N +      F S  N  V+  +  M+ KIK+I
Sbjct  68    SVEDAVYEADDVLDEFNTEVQRRQVMRDNTKLSKVRLFFSSSNQLVFGLE--MSHKIKNI  125

Query  1205  NNRLDGI  1185
             N RL  +
Sbjct  126   NKRLSEV  132



>ref|XP_007020994.1| Leucine-rich repeat containing protein [Theobroma cacao]
 gb|EOY12519.1| Leucine-rich repeat containing protein [Theobroma cacao]
Length=1251

 Score = 94.7 bits (234),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 81/259 (31%), Positives = 125/259 (48%), Gaps = 57/259 (22%)
 Frame = -2

Query  1028  KQLPQFHLLPSLGELYFESIMVDYIDTTDYEDDNSP----SRSELFFPSLKKLWIWNCPN  861
             ++LP    LPSL     ES+ ++ +D  ++  D+ P    +  + FFPSL+KL I  CPN
Sbjct  807   EELPPLDHLPSL-----ESLTLEKLDALEHVADSFPLPCSTPRKPFFPSLEKLKIRRCPN  861

Query  860   LKGWWKKNDE---AIEEELLPPFPCISVVDIKQSPNVTWMPLFPTVSEKLYIVTGSIIPL  690
             LKGWW+  +E   +I E  LP FPC+S + I++ PN+T MPLFP++ + L +   S+ PL
Sbjct  862   LKGWWRTKNENQGSIAE--LPCFPCLSELYIEKCPNLTSMPLFPSLDQDLTLEGTSMRPL  919

Query  689   EHTKKV------------------------CSSFKY-------LKKLWVSEVADLEYMEI  603
             + T K+                        C S+         LK+L + ++ DLE +  
Sbjct  920   QQTLKMKVTEASMTSEASSSSSSSSSLGSTCHSYSSTTLPLSNLKRLTLIDIKDLEALPE  979

Query  602   EL---FPSLEYLWVYDCRNLRDWGKKGDHEDAPKALAKLAPSVIEFEVKNCPKLKLLPQG  432
             E      SL  L + DC               P+ ++ L  S+ E  ++NCP L++LP  
Sbjct  980   EFSQNLTSLARLILSDCPKCESL--------LPQKVSCLT-SLQELGIENCPNLRVLPDW  1030

Query  431   MRLLSSSTKFSISGCPLLK  375
             +  L+S     I  C  LK
Sbjct  1031  ILNLTSLRTLHIEKCLELK  1049


 Score = 56.2 bits (134),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 40/131 (31%), Positives = 71/131 (54%), Gaps = 4/131 (3%)
 Frame = -2

Query  1538  ILAKIAPFAQDQIKLLWGLNEELTKLGDLVSHIGAVLLDA-EGEKHNKKTENLLEMLKNI  1362
             IL+K+   A  ++ L++GL ++L KL + +S I AVLLDA E ++ ++  +N +  L+++
Sbjct  13    ILSKLVWLAGQELGLIFGLKKDLEKLQETLSTIKAVLLDADEKQESDRALKNWILRLEDV  72

Query  1361  MDEANRLMDYFSPRAKNHRPNQEDGCCSYFVSHPNPFVWVSDSFMAGKIKSINNRLDGII  1182
             + +A+ L+D F       +   + G  S F S  NP  +     M  +IK I  RL+ + 
Sbjct  73    VYDADDLLDEFDYEILRQKV-LDRGQVSKFFSSSNPLAFGLK--MRHRIKEIRERLNAVA  129

Query  1181  ENYKKIRLEEQ  1149
              +  K  L E+
Sbjct  130   ADKSKFNLRER  140



>ref|XP_009368142.1| PREDICTED: disease resistance protein RGA2-like [Pyrus x bretschneideri]
Length=1033

 Score = 94.4 bits (233),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 81/271 (30%), Positives = 126/271 (46%), Gaps = 41/271 (15%)
 Frame = -2

Query  1082  KFASAYMTTIYIKN-----CPPGKQLPQFHLLPSLGELYFESIM-VDYIDTTDYEDDNSP  921
             +FAS + +   I N     C   + LP     PSL  L    +  ++YI   +  +  S 
Sbjct  770   RFASWFSSLTNIVNLALYWCERCQHLPPLDHFPSLKFLELRELKKLEYISENESSNSMSD  829

Query  920   SRSEL-FFPSLKKLWIWNCPNLKGWWKKN-----DEAIEEELLPPFPCISVVDIKQSPNV  759
                 + FFPSL+KL I +CP LKGWW+ +       + +   LP FP +S + I + PN+
Sbjct  830   EMMRISFFPSLEKLSIEDCPVLKGWWRPHTHNSASSSTKNLSLPSFPRLSTLSIDECPNL  889

Query  758   TWMPLFPTVSE------------KLYIVTGSIIPLEHTKKVCSS-----FKYLKKLWVSE  630
             T MPL+P V E             L++   S IP +    V +S     F  L  L +  
Sbjct  890   TSMPLYPNVVEIELYRSSWKVVDSLFVRGASDIPHDVGVDVSASSSSPHFSKLTHLTLGG  949

Query  629   VADLEYM--EIELFPSLEYLWVYDCRNLRDWGKKGDHEDAPKALAKLAPSVIEFEVKNCP  456
             + DL  +  EI    SL+ L + +C NL            P+ ++ L  S+   E+++C 
Sbjct  950   IEDLASLPEEISNLTSLQELVIAECSNL---------TSLPEEISNLT-SLQRLEIRHCS  999

Query  455   KLKLLPQGMRLLSSSTKFSISGCPLLKQKYK  363
              L  LP+G+R +    +  ISGCP+L ++ K
Sbjct  1000  NLASLPEGIRGVPCLNRLKISGCPMLSKRCK  1030


 Score = 58.5 bits (140),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 41/137 (30%), Positives = 72/137 (53%), Gaps = 7/137 (5%)
 Frame = -2

Query  1553  SVAKLILAKIAPFAQDQIKLLWGLNEELTKLGDLVSHIGAVLLDAEGEKHNKKTENLLEM  1374
             +VA  I+ ++   A  +I L+WG+ +E  KL + V+   AVLLDAE ++ N + +  L+ 
Sbjct  8     NVAGGIIERLGSLAFQEIGLIWGVQDEFQKLKETVARFQAVLLDAEQKQANSEVKLWLQS  67

Query  1373  LKNIMDEANRLMDYFSPRAKNHRPNQEDG----CCSYFVSHPNPFVWVSDSFMAGKIKSI  1206
             +++ + EA+ ++D F+ + +  +   E+       S F S  N  ++     M  KIK I
Sbjct  68    VEDAVYEADDVLDEFNTKNQRRKMMPENTKLLKKVSLFFSSSNQLIFGLK--MGHKIKDI  125

Query  1205  NNRLDGIIENYKKIRLE  1155
             N RL   + N +   LE
Sbjct  126   NKRLSE-VANRRTFHLE  141



>ref|XP_002309704.2| NBS-LRR resistance protein RGH2 [Populus trichocarpa]
 gb|EEE93227.2| NBS-LRR resistance protein RGH2 [Populus trichocarpa]
Length=1076

 Score = 94.4 bits (233),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 70/203 (34%), Positives = 105/203 (52%), Gaps = 26/203 (13%)
 Frame = -2

Query  1088  SWKFASAYMTTIYIKNCPPGKQLPQFHLLPSLGELYFESIMVDYIDTTDYEDDNSPSRSE  909
             SW    + +  I+++ C     +P  H +PSL EL    + +D ++  D E       S 
Sbjct  776   SWVSNLSNLVRIHLERCRRLTHIPPLHGIPSLEELNI--VGLDDLEYIDSEGVGGIGGST  833

Query  908   LFFPSLKKLWIWNCPNLKGWWKK----------NDEAIEEELLPPF-PCISVVDIKQSPN  762
              FFPSLK L I +C  LKGWWK+          ++  IEE L+  F PC+S + I   PN
Sbjct  834   -FFPSLKTLVIKHCRRLKGWWKRWSRDEMNDDRDESTIEEGLIMLFFPCLSSLSIVVCPN  892

Query  761   VTWMPLFPTVSEKLYIVTGSIIPLEHTKKVC-----SSFKY----LKKLWVSEVADLEYM  609
             +T MPLFPT+ E L ++  S +PL+ T K+      SSF      LK L++  + D+E +
Sbjct  893   LTSMPLFPTLDEDLNLINTSSMPLQQTMKMTSPVSSSSFTRPLSKLKILFMYSIYDMESL  952

Query  608   -EIEL--FPSLEYLWVYDCRNLR  549
              E+ L    SL+ L + +C  L+
Sbjct  953   PEVGLQNLSSLQSLSICECSRLK  975


 Score = 63.9 bits (154),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 51/187 (27%), Positives = 86/187 (46%), Gaps = 20/187 (11%)
 Frame = -2

Query  1553  SVAKLILAKIAPFAQDQIKLLWGLNEELTKLGDLVSHIGAVLLDAE--GEKHNKKTENLL  1380
             ++A+ I+  +      ++ L WGL ++L KL D V+ I AV+ DAE   +K N + E+ L
Sbjct  8     TIAEEIIKTLGSLTAQEVALWWGLKDQLRKLNDTVTRIKAVIQDAEEQAQKQNYQIEDWL  67

Query  1379  EMLKNIMDEANRLMDYFSPRA--KNHRPNQE-DGCCSYFVSHPNPFVWVSDSFMAGKIKS  1209
               L+  + +A  L+D FS +   K   P +        F S  N FV+     M  ++K+
Sbjct  68    MKLQEAVYDAEDLLDDFSTQVLRKQLMPGKRVSREVRLFFSRSNQFVY--GLRMGHRVKA  125

Query  1208  INNRLDGIIENYKKIRLE-------------EQNPKQQPMLTLLPPEDIGSVLSWKFASA  1068
             +  RLD I  + KK + +             EQ    +P +T+    D  +V S+   S 
Sbjct  126   LRERLDDIGTDSKKFKFDVRGEERASSTTVREQTTSSEPEITVGRVRDKEAVKSFLMNSN  185

Query  1067  YMTTIYI  1047
             Y   + +
Sbjct  186   YEHNVSV  192



>ref|XP_007020992.1| Leucine-rich repeat containing protein [Theobroma cacao]
 gb|EOY12517.1| Leucine-rich repeat containing protein [Theobroma cacao]
Length=726

 Score = 93.6 bits (231),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 73/188 (39%), Positives = 102/188 (54%), Gaps = 14/188 (7%)
 Frame = -2

Query  926  SPSRSELFFPSLKKLWIWNCPNLKGWWKKNDE---AIEEELLPPFPCISVVDIKQSPNVT  756
            S SR E FFP LKKLWIW CPNLKGWWK  +E   +I E L   FP +S + I + PN+T
Sbjct  254  STSR-EPFFP-LKKLWIWCCPNLKGWWKTENENQGSIAELLC--FPFLSDISINECPNLT  309

Query  755  WMPLFPTVSEKLYIVTGSIIPLEHTKKVCSSFKYLKKLWVSEVADLEYMEIELFPSLEYL  576
            +MPLFP++ + L +   +I PLE T K+    K  +    SE A         + S   L
Sbjct  310  FMPLFPSLDQDLTLSDTTIRPLEQTLKM----KMTEASMTSEEASSSGSTCHSYSS-TTL  364

Query  575  WVYDCRNLRDWGKKGDHEDAPKALAKLAPSVIEFEVKNCPKLK-LLPQGMRLLSSSTKFS  399
             + + + L  + K  D E  P+   +   S+   E+K+CPKL+ LL Q M  L+S  +  
Sbjct  365  PLSNLKRLTLF-KIKDLEALPEEFLQNLASLTFLELKDCPKLESLLSQKMSCLTSLQELW  423

Query  398  ISGCPLLK  375
            +  CP L+
Sbjct  424  VENCPNLR  431



>ref|XP_008461343.1| PREDICTED: putative disease resistance protein RGA4 isoform X4 
[Cucumis melo]
Length=622

 Score = 93.2 bits (230),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 76/268 (28%), Positives = 121/268 (45%), Gaps = 23/268 (9%)
 Frame = -2

Query  1085  WKF-ASAYMTTIYIKNCPPGKQLPQFHLLPSLGELYFESIM-VDYIDTTDYEDDNSPSRS  912
             W F     +T I I +C   + LPQFH L +L  L    +  + +ID  D     +P  S
Sbjct  342   WMFNCHLKLTEIEIVSCHRLQHLPQFHHLQTLKTLCLRDLRSLKFIDKFD-----NPFSS  396

Query  911   ELFFPSLKKLWIWNCPNLKGWWKKNDEAIEEE------LLPPFPCISVVDIKQSPNVTWM  750
              +FFPSLK L + N  NL+GWW+ +     E       L P FP + ++DI Q P +  M
Sbjct  397   SMFFPSLKSLCLANMANLEGWWELSRAVAGETSENIQWLPPTFPELEILDIYQCPKLNSM  456

Query  749   PLFPTVSEKLYIVTGSIIPLEHTKKVCSSFKYLKKLWVSEVADLEYMEIELFPSLEYLWV  570
             P  P+ S K Y+    +        +      L+ L + E+ +L  +  +   ++ +  V
Sbjct  457   PKLPS-STKAYVSLCDVGVQLVISTIGPVLLCLRTLRLEEIKNLNCLPFQ--QNINHSLV  513

Query  569   YDCRNLRDWGKKGDHEDAPKALAKLA------PSVIEFEVKNCPKLKLLPQGMRLLSSST  408
                        K    D    L  L        S+    +  CPKLK LP+GM+ L S  
Sbjct  514   ISSTTTSPIPLKYLQMDKCLDLVTLPEWIYIFTSLETLSISKCPKLKSLPKGMQRLESLK  573

Query  407   KFSISGCPLLKQKYKSKSGQNWPEVANI  324
             +  I  CP L+++ K + G++WP ++++
Sbjct  574   RLCIEDCPRLEERCK-EGGEDWPNISHV  600



>ref|XP_009354721.1| PREDICTED: putative disease resistance protein RGA4 [Pyrus x 
bretschneideri]
Length=1056

 Score = 93.2 bits (230),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 80/287 (28%), Positives = 130/287 (45%), Gaps = 44/287 (15%)
 Frame = -2

Query  1088  SWKFASAYMTTIYIKNCPPGKQLPQFHLLPSLGELYFES-IMVDYIDTTDYEDDNSPSRS  912
             SW  +   +  + + NC   + LP    LPSL  L     I ++Y+  +D E  NS S  
Sbjct  776   SWLSSLINIVNLTLANCYRCQHLPPLDHLPSLKFLQLSRLIQLEYV--SDNERGNSMSDE  833

Query  911   EL---FFPSLKKLWIWNCPNLKGWWKKNDEAIEEEL--------LPPFPCISVVDIKQSP  765
              +   FFPSL+KLW+  CP LKGWW+++                LP FPC+S + I+  P
Sbjct  834   MMRVSFFPSLEKLWVEYCPVLKGWWREHSHNSAASSSKQNLSFPLPSFPCLSGLTIRHCP  893

Query  764   NVTWMPLFPTVSE-KLYIVTGSIIP---------LEHTKKV-------CSSFKYLKKLWV  636
              +  MPL+P V +  LY  +  ++P         + H   V             L  + +
Sbjct  894   MINSMPLYPNVDKIDLYRTSSKVLPSLFVRGASDITHDVGVDVSASSSSPPLSKLTYMSL  953

Query  635   SEVADLEYMEIEL---FPSLEYLWVYDCRNLRDWGKKGDHEDAPKALAKLAPSVIEFEVK  465
               + DLE +  E      SL  L + +C  L            P+ ++ L  S+ + ++ 
Sbjct  954   YGIEDLECITSEGMGNLTSLRLLSIENCPYL---------ASIPEEISNLT-SLQKLQIG  1003

Query  464   NCPKLKLLPQGMRLLSSSTKFSISGCPLLKQKYKSKSGQNWPEVANI  324
              CP L  LP+G+R L   +   I  C +L  + K ++G++W ++A+I
Sbjct  1004  YCPNLASLPEGIRRLPYLSTLKIWECLMLWFRCKKETGEDWHKIAHI  1050



>ref|XP_006382175.1| hypothetical protein POPTR_0006s29070g, partial [Populus trichocarpa]
 gb|ERP59972.1| hypothetical protein POPTR_0006s29070g, partial [Populus trichocarpa]
Length=1204

 Score = 93.6 bits (231),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 80/242 (33%), Positives = 120/242 (50%), Gaps = 50/242 (21%)
 Frame = -2

Query  1025  QLPQFHLLPSLGELYFESIMVDYIDTTDYEDDNSPSRSELFFPSLKKLWIWNCPNLKGWW  846
              +P    +PSL E+    + ++ ++  D E D     S  FFPSLKKL I+NCPNLKGWW
Sbjct  790   HIPPLDKIPSLREMLI--MHLNNLEYMDSEGDGGRGVSG-FFPSLKKLSIYNCPNLKGWW  846

Query  845   KK--------NDEAIEEELLPPFPCISVVDIKQSPNVTWMPLFPTVSEKLYIVTGSIIPL  690
             KK        NDE+++E L   FPC+S + I   PN+T +P F T+S  L+++  S IPL
Sbjct  847   KKSRDEKSDDNDESLKEMLC--FPCLSSLSIVDCPNLTSIPFFQTLS-ILFLLRASSIPL  903

Query  689   EHTKKVCSSFKY---------LKKLWVSEVADLEYM-EIEL--FPSLEYLWVYDCRNLR-  549
             + T ++ S             LKKL++  + D+E + E+ L    SL+ L +  C  L+ 
Sbjct  904   QQTMEMTSPVSSSSSSRPLSKLKKLYIYFIDDMESLPEVGLQNLSSLQQLSIRGCSRLKS  963

Query  548   ----DWGKKGDHEDAPKALAKLAPSVIEFEVKNCPKLKLLPQG----MRLLSSSTKFSIS  393
                 D G                PS+ +  + +C KL+ L Q     +  L+S  +  IS
Sbjct  964   LPLPDQG---------------MPSLQKLNIISCKKLEYLSQSGSQRIPYLTSLQELEIS  1008

Query  392   GC  387
              C
Sbjct  1009  YC  1010


 Score = 89.0 bits (219),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 57/182 (31%), Positives = 94/182 (52%), Gaps = 16/182 (9%)
 Frame = -2

Query  1088  SWKFASAYMTTIYIKNCPPGKQLPQFHLLPSLGELYFESIMVDYIDTTDYEDDNSPSRS-  912
             SW    + +  +++++C   + LP  H +PSL EL      + Y+D+ +Y D        
Sbjct  1026  SWLSHLSNLVRVHLRHCRRLEHLPPLHGIPSLEELS-----IAYMDSLEYIDSERVGGKG  1080

Query  911   -ELFFPSLKKLWIWNCPNLKGWWKKNDE---------AIEEELLPPFPCISVVDIKQSPN  762
               +FFPSL+KL I++C  LKGW KK+ +         A E  ++  FP +S + I   P 
Sbjct  1081  VSMFFPSLRKLRIFSCGRLKGWRKKSRDEMDDDSDESAKEGLIMLCFPRLSSLSIVDCPK  1140

Query  761   VTWMPLFPTVSEKLYIVTGSIIPLEHTKKVCSSFKYLKKLWVSEVADLEYMEIELFPSLE  582
             +T MPLFPT+ E LY+   S +PL+ T ++ S         +  ++ L+ +EI +   +E
Sbjct  1141  LTSMPLFPTLDEDLYLWRTSSMPLQQTMEMTSPVSSSSSSSIRPLSKLKNLEIYIIDDME  1200

Query  581   YL  576
              L
Sbjct  1201  SL  1202


 Score = 60.1 bits (144),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 42/150 (28%), Positives = 74/150 (49%), Gaps = 7/150 (5%)
 Frame = -2

Query  1553  SVAKLILAKIAPFAQDQIKLLWGLNEELTKLGDLVSHIGAVLLDAE--GEKHNKKTENLL  1380
             ++A+ I+  +      ++ L WGL ++L KL D V+ I AV+ DAE   +K N + E  L
Sbjct  8     NIAEEIIKTLGSLTAQEVALWWGLKDQLRKLKDTVTRIKAVIQDAEEQAQKQNHQIEVWL  67

Query  1379  EMLKNIMDEANRLMDYFSP---RAKNHRPNQEDGCCSYFVSHPNPFVWVSDSFMAGKIKS  1209
             + L+  + +A  L+D FS    R +     +       F S  N FV+     M  ++K+
Sbjct  68    KKLREAVYDAEDLLDDFSTQVLRKQLMSGKRVSTEVRLFFSRSNQFVY--GLRMGHRVKA  125

Query  1208  INNRLDGIIENYKKIRLEEQNPKQQPMLTL  1119
             +  RLD I  + KK   + +  ++  + T+
Sbjct  126   LRERLDDIEIDSKKFNFDVRGEERASLTTV  155



>ref|XP_008367078.1| PREDICTED: putative disease resistance protein RGA4 [Malus domestica]
Length=403

 Score = 90.5 bits (223),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 82/290 (28%), Positives = 134/290 (46%), Gaps = 47/290 (16%)
 Frame = -2

Query  1082  KFASAYMTTIYIKN-----CPPGKQLPQFHLLPSLGELYFESIM-VDYI-DTTDYEDDNS  924
             +FAS + + I I N     C   + LP    LPSL  L    +  ++YI D       + 
Sbjct  118   RFASWFSSLINIINLRSHYCERCQNLPXLDHLPSLKYLELSHLKKLEYIADNASSNSMSD  177

Query  923   PSRSELFFPSLKKLWIWNCPNLKGWWKKNDE------AIEEEL---LPPFPCISVVDIKQ  771
                   FFP+L+KL +++CP LKGWW+ +        +  E L   LP FPC+S + I+ 
Sbjct  178   EMMMMSFFPALEKLSMYSCPVLKGWWRXHTHNSASSSSSTENLFFPLPSFPCLSTLIIQN  237

Query  770   SPNVTWMPLFPTVSE-KLYIVTGSII---------PLEHTKKV----CSSFKYLKKLWVS  633
               N++ M L P V   +LY  +  ++          + H   V     SS  +L KL   
Sbjct  238   CRNLSSMSLCPNVDRIRLYRTSLKVLHSLFVRGASDITHDVGVDVSXTSSSPHLSKLTYL  297

Query  632   EVADLEYMEIEL------FPSLEYLWVYDCRNLRDWGKKGDHEDAPKALAKLAPSVIEFE  471
              +  +E +E           SL+ L +  C NL            P+ ++ L  S+ + E
Sbjct  298   SLXGIENLECLTSEGXGSLTSLQLLSITFCPNL---------ASLPEEISNLT-SLQQLE  347

Query  470   VKNCPKLKLLPQGMRLLSSSTKFSISGCPLLKQKYKSKSGQNWPE-VANI  324
             + +C  L  LP+G+R LS   K  +  CP+L ++ + + G++WP+ +A+I
Sbjct  348   IDHCSNLASLPEGIRGLSCLNKLQVWRCPILSERCEKEKGEDWPKNIAHI  397



>ref|XP_008461339.1| PREDICTED: disease resistance protein RGA2-like isoform X2 [Cucumis 
melo]
Length=1061

 Score = 92.4 bits (228),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 78/271 (29%), Positives = 126/271 (46%), Gaps = 44/271 (16%)
 Frame = -2

Query  1064  MTTIYIKNCPPGKQLPQFHLLPSLGELYFESIM-VDYIDTTDYEDDNSPSRSELFFPSLK  888
             +T I I +C   + LPQFH L +L  L    +  + +ID  D     +P  S +FFPSLK
Sbjct  796   LTEIEIVSCHRLQHLPQFHHLQTLKTLCLRDLRSLKFIDKFD-----NPFSSSMFFPSLK  850

Query  887   KLWIWNCPNLKGWWKKNDEAIEE-----ELLPP-FPCISVVDIKQSPNVTWMPLFPTVSE  726
              L + N  NL+GWW+ +     E     + LPP FP + ++DI Q P +  MP  P+ S 
Sbjct  851   SLCLANMANLEGWWELSRAVAGETSENIQWLPPTFPELEILDIYQCPKLNSMPKLPS-ST  909

Query  725   KLYIVTGSIIPLEHTKKVCSSFKYLKKLWVSEVADLEYMEIE------LFPS--------  588
             K Y+    +        +      L+ L + E+ +L  +  +      L  S        
Sbjct  910   KAYVSLCDVGVQLVISTIGPVLLCLRTLRLEEIKNLNCLPFQQNINHSLVISSTTTSPIP  969

Query  587   LEYLWVYDCRNLR---DWGKKGDHEDAPKALAKLAPSVIEFEVKNCPKLKLLPQGMRLLS  417
             L+YL +  C +L    +W               +  S+    +  CPKLK LP+GM+ L 
Sbjct  970   LKYLQMDKCLDLVTLPEW-------------IYIFTSLETLSISKCPKLKSLPKGMQRLE  1016

Query  416   SSTKFSISGCPLLKQKYKSKSGQNWPEVANI  324
             S  +  I  CP L+++ K + G++WP ++++
Sbjct  1017  SLKRLCIEDCPRLEERCK-EGGEDWPNISHV  1046



>ref|XP_008461338.1| PREDICTED: disease resistance protein RGA2-like isoform X1 [Cucumis 
melo]
Length=1068

 Score = 92.4 bits (228),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 78/271 (29%), Positives = 126/271 (46%), Gaps = 44/271 (16%)
 Frame = -2

Query  1064  MTTIYIKNCPPGKQLPQFHLLPSLGELYFESIM-VDYIDTTDYEDDNSPSRSELFFPSLK  888
             +T I I +C   + LPQFH L +L  L    +  + +ID  D     +P  S +FFPSLK
Sbjct  796   LTEIEIVSCHRLQHLPQFHHLQTLKTLCLRDLRSLKFIDKFD-----NPFSSSMFFPSLK  850

Query  887   KLWIWNCPNLKGWWKKNDEAIEE-----ELLPP-FPCISVVDIKQSPNVTWMPLFPTVSE  726
              L + N  NL+GWW+ +     E     + LPP FP + ++DI Q P +  MP  P+ S 
Sbjct  851   SLCLANMANLEGWWELSRAVAGETSENIQWLPPTFPELEILDIYQCPKLNSMPKLPS-ST  909

Query  725   KLYIVTGSIIPLEHTKKVCSSFKYLKKLWVSEVADLEYMEIE------LFPS--------  588
             K Y+    +        +      L+ L + E+ +L  +  +      L  S        
Sbjct  910   KAYVSLCDVGVQLVISTIGPVLLCLRTLRLEEIKNLNCLPFQQNINHSLVISSTTTSPIP  969

Query  587   LEYLWVYDCRNLR---DWGKKGDHEDAPKALAKLAPSVIEFEVKNCPKLKLLPQGMRLLS  417
             L+YL +  C +L    +W               +  S+    +  CPKLK LP+GM+ L 
Sbjct  970   LKYLQMDKCLDLVTLPEW-------------IYIFTSLETLSISKCPKLKSLPKGMQRLE  1016

Query  416   SSTKFSISGCPLLKQKYKSKSGQNWPEVANI  324
             S  +  I  CP L+++ K + G++WP ++++
Sbjct  1017  SLKRLCIEDCPRLEERCK-EGGEDWPNISHV  1046



>ref|XP_008350652.1| PREDICTED: disease resistance protein RGA2-like [Malus domestica]
Length=1040

 Score = 92.4 bits (228),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 51/150 (34%), Positives = 82/150 (55%), Gaps = 16/150 (11%)
 Frame = -2

Query  1088  SWKFASAYMTTIYIKNCPPGKQLPQFHLLPSLGELYFESIMVDYIDTTDYEDDNSPSRSE  909
              W  +   +  + + +C   + LP F  LP L     + + +D +D  +Y  D S S S 
Sbjct  746   GWLSSLXNIVXLSLXDCXTCQYLPPFDHLPRL-----KVLRLDGLDALEYISDASSSASR  800

Query  908   L-FFPSLKKLWIWNCPNLKGWWKK----------NDEAIEEELLPPFPCISVVDIKQSPN  762
             + FFPSLKK+++WNCPNLKGWWK+          N+    ++    FPC+S++ +   PN
Sbjct  801   IPFFPSLKKIYLWNCPNLKGWWKQSALIGSPMTENEHQHIQQSSLSFPCLSLLYVWNCPN  860

Query  761   VTWMPLFPTVSEKLYIVTGSIIPLEHTKKV  672
             +T MPL+P +  +L++   S+ PLE T  +
Sbjct  861   LTSMPLYPHLEXELFLXNTSLKPLEETMMI  890



>ref|XP_007021003.1| Leucine-rich repeat containing protein [Theobroma cacao]
 gb|EOY12528.1| Leucine-rich repeat containing protein [Theobroma cacao]
Length=1271

 Score = 92.4 bits (228),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 76/229 (33%), Positives = 107/229 (47%), Gaps = 49/229 (21%)
 Frame = -2

Query  962   DYIDTTDYEDDN-----SPSRSELFFPSLKKLWIWNCPNLKGWWKKNDE---AIEEELLP  807
             D +D  +Y  D+     S SR E FF SLKKL I+NCPNLKGWWK  +E   +I E  LP
Sbjct  814   DQLDALEYVADSFSLPCSTSR-EPFFLSLKKLSIYNCPNLKGWWKTKNENQGSIAE--LP  870

Query  806   PFPCISVVDIKQSPNVTWMPLFPTVSEKLYIVTGSIIPLEHTKKV---------------  672
              FPC+  + ++ S N+T MPLFP++ + L +   SI P + T K+               
Sbjct  871   CFPCLFRLKVQNSGNLTSMPLFPSLDQDLTLEGTSIRPFQQTLKMKMTEASMRSEEASSS  930

Query  671   ----CSSFKY-------LKKLWVSEVADLEYMEIEL---FPSLEYLWVYDCRNLRDWGKK  534
                 C S+         LK L + ++ DLE +  E      SL ++ + DC  L      
Sbjct  931   SGSTCHSYSSTALPLSNLKHLTLFKIKDLEALPEEFLQNLASLTFVRLKDCPKL------  984

Query  533   GDHEDAPKALAKLAPSVIEFEVKNCPKLKLLPQGMRLLSSSTKFSISGC  387
                E  P        S+ +  V+NCP L+ LP  +  L+S     I  C
Sbjct  985   ---ESLPSQKMSCLTSLQDLLVENCPNLRALPDWILNLTSLETLQIWNC  1030



>gb|AET01334.2| NB-ARC domain disease resistance protein [Medicago truncatula]
Length=898

 Score = 91.7 bits (226),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 77/307 (25%), Positives = 128/307 (42%), Gaps = 63/307 (21%)
 Frame = -2

Query  1100  GSVLSWKFAS-AYMTTIYIKNCPPGKQLPQFHLLPSLGELYFESIMVDYIDTTDYEDDNS  924
             G + S + +S   +  I++  C   + LP    LP     +  S+ +  I+  +Y     
Sbjct  601   GVIFSERLSSLTNIIEIHLGYCQGFRYLPPLERLP-----FLRSLQLHCINNLEYIYYEE  655

Query  923   PSRSELFFPSLKKLWIWNCPNLKGWWKKNDE-----AIEEELLPPFPCISVVDIKQSPNV  759
             P   E FFPSL+ L +W C  L+GW +  D+     +    LLP F C+S + I+    +
Sbjct  656   PILLESFFPSLESLKLWECHELRGWQRMGDDFDDINSSHHLLLPQFHCLSKLAIRGCQML  715

Query  758   TWMPLFPTVSEKLYIVTGSIIPLEHTKKVC-----------------------SSFKYLK  648
             T MP FP + ++L +    +  LE T  +                        S  K L 
Sbjct  716   THMPTFPNIKKRLSLTECCVEILEATLNIAMSQYSIGFPPLSMLKSIEIGEFSSDVKKLP  775

Query  647   KLWVSEVADLEYMEIEL-------------------FPSLEYLWVYDCRNLRDWGKKGDH  525
             K W+  +  LE +E                       PSL+ +  Y+C +L+        
Sbjct  776   KNWLQNLTSLENLEFFFLSSQQFEVIETWFKDDFIYLPSLKRINFYNCFHLKAL------  829

Query  524   EDAPKALAKLAPSVIEFEVKNCPKLKLLPQGMRLLSSSTKFSISGCPLLKQKYKSKSGQN  345
                P  +  L+ S+   E+ NC  L LLPQGM  L++        CPLL ++ ++++   
Sbjct  830   ---PDWICNLS-SLHHIEMINCRDLALLPQGMPRLTNLCTLEFIKCPLLVEECQTETSAI  885

Query  344   WPEVANI  324
             W ++A+I
Sbjct  886   WSKIAHI  892



>ref|XP_008346971.1| PREDICTED: disease resistance protein RGA2-like [Malus domestica]
Length=912

 Score = 91.7 bits (226),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 76/270 (28%), Positives = 120/270 (44%), Gaps = 36/270 (13%)
 Frame = -2

Query  1088  SWKFASAYMTTIYIKNCPPGKQLPQFHLLPSLGELYFESIMVD-YIDTTDYEDDNSPSRS  912
             SW  +   +  + + NC   + LP    LPSL +L  E +    YI   +     S    
Sbjct  658   SWFSSLVNIVNLKLSNCKRCQHLPPLDHLPSLKKLELEGLEKLEYISEKESSHSMSDEMI  717

Query  911   EL-FFPSLKKLWIWNCPNLKGWWKKNDE-------AIEEELLPPFPCISVVDIKQSPNVT  756
              + FFPSL  L I +CP LKGWW+ +         + E   LP FP +S +DI   PN+T
Sbjct  718   RISFFPSLGDLSIQDCPVLKGWWRAHTHNSASSSSSTENLSLPSFPSLSTLDIFYCPNLT  777

Query  755   WMPLFPTVSEKLYIVTGSIIPLEHTKKVCSSFKYLKKLWVSEVADLEY------MEIELF  594
              +PL P V              E  +   SS+K +  L+V   +D+ +            
Sbjct  778   SIPLCPNV--------------ETIQLYKSSWKVVDSLFVRGASDITHDVGVDVSASSSS  823

Query  593   PSLEYLWVYDCRNLRDWGKKGDHEDAPKALAKLAPSVIEFEVKNCPKLKLLPQGMRLLSS  414
             P L  L   +   + D          P+ ++ L  S+    +  C  L  LP+G+R L  
Sbjct  824   PHLSKLTRLELTGIEDLA------SLPEEISNLT-SLQLINIDECSNLTSLPEGIRGLPC  876

Query  413   STKFSISGCPLLKQKYKSKSGQNWPEVANI  324
                 +I GCP+L ++ K ++G++WP++A+I
Sbjct  877   LNTLNICGCPMLSERCKKETGEDWPKIAHI  906



>ref|XP_010097657.1| Putative disease resistance protein RGA4 [Morus notabilis]
 gb|EXB70612.1| Putative disease resistance protein RGA4 [Morus notabilis]
Length=1080

 Score = 91.7 bits (226),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 79/257 (31%), Positives = 122/257 (47%), Gaps = 54/257 (21%)
 Frame = -2

Query  971   IMVDYIDTTDYEDDNSPSRS-----ELFFPSLKKLWIWNCPNLKGWWKKNDEA-------  828
             I ++YI  +D E +N  S S       FFPSL  L I  C NLKGWW+++  A       
Sbjct  831   IALEYI--SDMESNNQLSTSLSTPTTPFFPSLTILKIRFCLNLKGWWRRSTIAGDNSGAL  888

Query  827   -IEEELLPP-------FPCISVVDIKQSPNVTWMPLFPTVSEKLYIVTGSIIPLEHTKKV  672
              +     PP       FPC+  ++I+  P++T MPLFP + + L ++  S  PL+ T  +
Sbjct  889   GLTTATTPPLHQNQPVFPCLHDLEIRNCPHLTSMPLFPDL-KSLELMDTSFRPLQQTMMM  947

Query  671   CSS-------------------FKYLKKLWVSEVADLEYM--EIELFPSLEYLWVYDCRN  555
               +                      LK L +S++ D+E +   I    SL+ L + +C N
Sbjct  948   TDASMIASPSTIMSTPPDSSSSLSKLKNLLISQIKDVESLPEGIGNLTSLQSLDIVECPN  1007

Query  554   LRDWGKKGDHEDAPKALAKLAPSVIEFEVKNCPKLKLLPQGMRLLSSSTKFSISGCPLLK  375
             L            P+ +  L   +   +V  CPKL+ LP+GM LL+S     I  CP L 
Sbjct  1008  L---------TSLPEVIGNLCL-LQSLKVWECPKLESLPEGMCLLTSLKLLKIDKCPTLS  1057

Query  374   QKYKSKSGQNWPEVANI  324
             Q+ K + G++WP++A+I
Sbjct  1058  QRCKREIGEDWPKIAHI  1074



>ref|XP_003626858.1| Nbs-lrr resistance protein [Medicago truncatula]
Length=894

 Score = 91.3 bits (225),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 77/307 (25%), Positives = 128/307 (42%), Gaps = 63/307 (21%)
 Frame = -2

Query  1100  GSVLSWKFAS-AYMTTIYIKNCPPGKQLPQFHLLPSLGELYFESIMVDYIDTTDYEDDNS  924
             G + S + +S   +  I++  C   + LP    LP     +  S+ +  I+  +Y     
Sbjct  597   GVIFSERLSSLTNIIEIHLGYCQGFRYLPPLERLP-----FLRSLQLHCINNLEYIYYEE  651

Query  923   PSRSELFFPSLKKLWIWNCPNLKGWWKKNDE-----AIEEELLPPFPCISVVDIKQSPNV  759
             P   E FFPSL+ L +W C  L+GW +  D+     +    LLP F C+S + I+    +
Sbjct  652   PILLESFFPSLESLKLWECHELRGWQRMGDDFDDINSSHHLLLPQFHCLSKLAIRGCQML  711

Query  758   TWMPLFPTVSEKLYIVTGSIIPLEHTKKVC-----------------------SSFKYLK  648
             T MP FP + ++L +    +  LE T  +                        S  K L 
Sbjct  712   THMPTFPNIKKRLSLTECCVEILEATLNIAMSQYSIGFPPLSMLKSIEIGEFSSDVKKLP  771

Query  647   KLWVSEVADLEYMEIEL-------------------FPSLEYLWVYDCRNLRDWGKKGDH  525
             K W+  +  LE +E                       PSL+ +  Y+C +L+        
Sbjct  772   KNWLQNLTSLENLEFFFLSSQQFEVIETWFKDDFIYLPSLKRINFYNCFHLK--------  823

Query  524   EDAPKALAKLAPSVIEFEVKNCPKLKLLPQGMRLLSSSTKFSISGCPLLKQKYKSKSGQN  345
                P  +  L+ S+   E+ NC  L LLPQGM  L++        CPLL ++ ++++   
Sbjct  824   -ALPDWICNLS-SLHHIEMINCRDLALLPQGMPRLTNLCTLEFIKCPLLVEECQTETSAI  881

Query  344   WPEVANI  324
             W ++A+I
Sbjct  882   WSKIAHI  888



>ref|XP_006382153.1| hypothetical protein POPTR_0006s28900g [Populus trichocarpa]
 gb|ERP59950.1| hypothetical protein POPTR_0006s28900g [Populus trichocarpa]
Length=1047

 Score = 90.5 bits (223),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 75/249 (30%), Positives = 111/249 (45%), Gaps = 35/249 (14%)
 Frame = -2

Query  1088  SWKFASAYMTTIYIKNCPPGKQLPQFHLLPSLGELYFESI-MVDYIDTTDYEDDNSPSRS  912
             SW    + +  ++++NC   K +P    +PSL EL   ++  ++YID+         +  
Sbjct  760   SWLSDLSNLVRVHLRNCRRLKHIPPLDGIPSLEELSITNMDSLEYIDSERVGGKGVST--  817

Query  911   ELFFPSLKKLWIWNCPNLKGWWKKNDEAIEEELLPPFPCISVVDIKQSPNVTWMPLFPTV  732
               FF SLK+L I++CP LKGWWKK         +  FP +S + I    N+T MPLFPT+
Sbjct  818   --FFQSLKELRIFDCPRLKGWWKKKGLR-----MLCFPRLSSLTIYDCSNLTSMPLFPTL  870

Query  731   SEKLYIVTGSIIPLEHTKKVCSSFKYLKKLWVSEVADLEYMEIELFPSLEYLWVYDCRNL  552
              E L +   S +PL+ T K+ S                    I     L+ L++Y     
Sbjct  871   DEDLQLAFSSSMPLQQTMKMTSPVSSSSSSSF----------IRPLSKLKRLYMYSI---  917

Query  551   RDWGKKGDHEDAPKALAKLAPSVIEFEVKNCPKLKLLP---QGMRLLSSSTKFSISGCPL  381
                    D E  P+   K   S+    +  C +LK LP   QGM  L    K  I+ C  
Sbjct  918   ------DDMESLPEVGLKNLSSLQSLSIWGCSRLKSLPLPDQGMHSLQ---KLDIADCRE  968

Query  380   LKQKYKSKS  354
             LK   +S+S
Sbjct  969   LKSLSESES  977


 Score = 60.8 bits (146),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 43/152 (28%), Positives = 75/152 (49%), Gaps = 9/152 (6%)
 Frame = -2

Query  1553  SVAKLILAKIAPFAQDQIKLLWGLNEELTKLGDLVSHIGAVLLDAE----GEKHNKKTEN  1386
             ++A+ I+  +   A  ++ L WGL ++L KL   V+ I AV+ DAE     +K N + E+
Sbjct  8     NIAEEIIKTLGSLAAQEVALWWGLKDQLRKLNGTVTRIKAVVQDAEEQAQKQKQNHQIED  67

Query  1385  LLEMLKNIMDEANRLMDYFSP---RAKNHRPNQEDGCCSYFVSHPNPFVWVSDSFMAGKI  1215
              LE L+  + +A  L+D FS    R +     +       F S  N FV+     M  ++
Sbjct  68    WLEKLREAVYDAEDLLDDFSTQVLRKQLMSGKRVSTEVRLFFSRSNQFVY--GLRMGHRV  125

Query  1214  KSINNRLDGIIENYKKIRLEEQNPKQQPMLTL  1119
             K++  RLD I  + KK   + +  ++  + T+
Sbjct  126   KALRERLDDIEIDSKKFNFDVRGEERASLTTV  157



>ref|XP_011002412.1| PREDICTED: putative disease resistance protein RGA4 [Populus 
euphratica]
Length=494

 Score = 89.0 bits (219),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 57/152 (38%), Positives = 83/152 (55%), Gaps = 14/152 (9%)
 Frame = -2

Query  1088  SWKFASAYMTTIYIKNCPPGKQLPQFHLLPSLGELYFESIMVDYIDTTDYEDDNSPSRSE  909
             SW    + +  I +++C   K +P    + SL EL    + +D ++  D E D     S 
Sbjct  322   SWVSNISNLARICLESCKRLKHIPPLDGILSLEELSI--VGLDDLEYIDSEGDRGRGAST  379

Query  908   LFFPSLKKLWIWNCPNLKGWWKK---------NDEAIEEE--LLPPFPCISVVDIKQSPN  762
              FFPSLK L I+ C  LKGWWK+         +DE+  EE  ++  FPC+S + I + PN
Sbjct  380   -FFPSLKTLVIYGCFRLKGWWKRWSRDEMNDDSDESTIEEGLIMLCFPCLSSLFISECPN  438

Query  761   VTWMPLFPTVSEKLYIVTGSIIPLEHTKKVCS  666
             +T MPLFPT+ E LY+   S +PL+ T K+ S
Sbjct  439   LTSMPLFPTLDEGLYLRRTSSMPLQQTMKMTS  470



>ref|XP_008341432.1| PREDICTED: putative disease resistance protein RGA1 [Malus domestica]
Length=281

 Score = 86.7 bits (213),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 72/267 (27%), Positives = 126/267 (47%), Gaps = 28/267 (10%)
 Frame = -2

Query  1088  SWKFASAYMTTIYIKNCPPGKQLPQFHLLPSLGELYFESI-MVDYIDTTDYEDDNSPSRS  912
             +W  +   +  + + +C   + LP    LP L +L    +  ++YI  ++ E  NS    
Sbjct  25    NWFSSLINIVNLGLADCQRCQHLPPLDHLPFLKKLDLHGLERLEYILLSEKESSNSMIDE  84

Query  911   EL---FFPSLKKLWIWNCPNLKGWWKKNDE-------AIEEELLPPFPCISVVDIKQSPN  762
              +   FFPSL+ L I +CP LKGWW+ +         + E   LP FP +S + IK  PN
Sbjct  85    MMRISFFPSLEYLRINSCPVLKGWWRAHTHNSASSSSSTENLSLPSFPSLSTLTIKDCPN  144

Query  761   VTWMPLFPTVSEKLYIVTGSIIPLEHTKKVCSSFKYLKKLWVSEVADLEY-MEIELFPSL  585
             +T MPL+P                E  +   SS+K +  L+V   +D+ + + +++  S 
Sbjct  145   LTSMPLYPNA--------------ERIELWRSSWKIVDSLFVRGASDITHDVGVDVSSSS  190

Query  584   EYLWVYDCRNLRDWGKKGDHEDAPKALAKLAPSVIEFEVKNCPKLKLLPQGMRLLSSSTK  405
                      +L   G   D    P+ +  L  S+   ++ +C  L  LP+G+R L     
Sbjct  191   SSHRPSKLIHL-SLGGIEDLASLPEEICNLN-SLQHLKISDCSNLASLPEGIRGLPCLNT  248

Query  404   FSISGCPLLKQKYKSKSGQNWPEVANI  324
              +I  CP+L ++ K ++G++W ++A+I
Sbjct  249   LTIWCCPVLSERCKKETGEDWFKIAHI  275



>ref|XP_010097660.1| Putative disease resistance protein RGA4 [Morus notabilis]
 gb|EXB70615.1| Putative disease resistance protein RGA4 [Morus notabilis]
Length=1079

 Score = 89.7 bits (221),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 78/256 (30%), Positives = 121/256 (47%), Gaps = 53/256 (21%)
 Frame = -2

Query  971   IMVDYIDTTDYEDDNSPSRS-----ELFFPSLKKLWIWNCPNLKGWWKKNDEA-------  828
             I ++YI  +D E +N  S S       FFPSL  L I  C NLKGWW+++  A       
Sbjct  831   IALEYI--SDMESNNQLSTSLSTPRTPFFPSLTILKIRFCLNLKGWWRRSTIAGDNSGAL  888

Query  827   -IEEELLPP-------FPCISVVDIKQSPNVTWMPLFPTVSEKLYIVTGSIIPLEHTKKV  672
              +     PP       FPC+  ++I+  P++T MPLFP + + L ++  S  PL+ T  +
Sbjct  889   GLTTATTPPLHQNQPVFPCLHDLEIRNCPHLTSMPLFPDL-KSLELMDTSFRPLQQTMMM  947

Query  671   C------------------SSFKYLKKLWVSEVADLEYM--EIELFPSLEYLWVYDCRNL  552
                                SS   LK L +S++ D+E +   I    SL+ L + +C  L
Sbjct  948   TDASMIASPSTITSTPPDSSSLSKLKNLLISQIKDVESLPEGIGNLTSLQSLDIVECPKL  1007

Query  551   RDWGKKGDHEDAPKALAKLAPSVIEFEVKNCPKLKLLPQGMRLLSSSTKFSISGCPLLKQ  372
                         P+ +  L   +   +V  CPKL+ LP+G+ LL+S     I  CP L Q
Sbjct  1008  ---------TSLPEVIGNLCL-LQSLKVWECPKLESLPEGLCLLTSLKLLKIDKCPTLSQ  1057

Query  371   KYKSKSGQNWPEVANI  324
             +   + G++WP++A+I
Sbjct  1058  RCMREIGEDWPKIAHI  1073



>gb|KDP43489.1| hypothetical protein JCGZ_16776 [Jatropha curcas]
Length=1068

 Score = 89.7 bits (221),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 78/291 (27%), Positives = 133/291 (46%), Gaps = 45/291 (15%)
 Frame = -2

Query  1088  SWKFASAYMTTIYIKNCPPGKQLPQFHLLPSLGEL-YFESIMVDYIDTTDYEDDNSPSRS  912
             SW  +   +  + + +C   + LP F   PSL  L  F+   ++YI++    ++      
Sbjct  776   SWLSSLTNLVELRLNSCKNIQCLPPFDQFPSLKRLKVFKLTNLEYIESGISCNNGG----  831

Query  911   ELFFPSLKKLWIWNCPNLKGWWKKNDEA---------IEEELLPPFPCISVVDIKQSPNV  759
                FPSLK L I  CPNLKGW +   +               LP F C+S + I   PN+
Sbjct  832   ---FPSLKLLDISECPNLKGWRRCEKDTRGTISSSSLTSTSELPKFHCLSNLSIGVCPNL  888

Query  758   TWMPLFPTVSEKLYIVTGSIIPLEH--------TKKVCSS--FKYLKKLWVSEVADLEYM  609
             T +P FP++ E LY    ++ PL+          +   SS     LK+L + E+ D  ++
Sbjct  889   TSLPPFPSI-ENLYFRGKTMKPLDQLLESTISGAESTSSSPPLSQLKQLTIQEINDGAFL  947

Query  608   EIEL---FPSLEYLWVYDCRNLRDWGKKGDHE-------------DAPKALAKLAPSVIE  477
               +L     SL  L++  C  + +   +G                  PK L  L+ ++  
Sbjct  948   PGKLQQKLTSLSKLYIVSCPRILEMECQGLRSLNFLCIRNIDELVSLPKWLQYLS-TLRS  1006

Query  476   FEVKNCPKLKLLPQGMRLLSSSTKFSISGCPLLKQKYKSKSGQNWPEVANI  324
              ++K+CPKL  LP+ M  L+S  + +I  CP L ++ +    ++WP++++I
Sbjct  1007  LKIKDCPKLMSLPEWMSNLTSLRRLTIENCPQLSERCRRNKVEDWPKISHI  1057


 Score = 59.3 bits (142),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 51/144 (35%), Positives = 77/144 (53%), Gaps = 9/144 (6%)
 Frame = -2

Query  1538  ILAKIAPFAQDQIKLLWGLNEELTKLGDLVSHIGAVLLDAEGEKHNK--KTENLLEMLKN  1365
             I+ K++     +I L WG+ +EL +L   VS I  VLLDAE EK++K  + E  L  LK 
Sbjct  13    IITKLSSTVLREIGLWWGVKDELQELKRTVSMIQPVLLDAE-EKYSKSRQVEVWLGTLKE  71

Query  1364  IMDEANRLMDYFSPRA---KNHRPNQEDGCCSYFVSHPNPFVWVSDSFMAGKIKSINNRL  1194
              + +A  L+D FS  A   K    ++     + F S  N F +  D  MA  IKSI  RL
Sbjct  72    AVYDAEDLLDIFSTEALKQKTMTGSKIGKEVTLFFSSSNQFAYGLD--MAHTIKSIRERL  129

Query  1193  DGIIENYKKIRLEEQNPKQQPMLT  1122
             D I +N ++  LE++  ++  ++T
Sbjct  130   DEIAKN-RQFHLEQRPVEKLAIIT  152



>ref|XP_008245639.1| PREDICTED: putative disease resistance protein RGA4 [Prunus mume]
Length=501

 Score = 87.8 bits (216),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 75/249 (30%), Positives = 114/249 (46%), Gaps = 31/249 (12%)
 Frame = -2

Query  1088  SWKFASAYMTTIYIKNCPPGKQLPQFHLLPSLGELYFESIM-VDYIDTTDYEDD------  930
             SW  +   +  + +  C   + LP    LP L  L    +  +++I   D   D      
Sbjct  143   SWFHSLTNIVNLILIGCDRCQHLPPLDHLPFLKSLELCWLRNLEHISAEDKVKDFAGDEM  202

Query  929   ---NSPSRSELFFPSLKKLWIWNCPNLKGWWKKNDEAIEEELLPPFPCISVVDIKQSPNV  759
                ++ S S  FFPSL+ L + +CPNLKGWW+    +        FPC+S + I+  PN+
Sbjct  203   MMMSAASPSTTFFPSLESLRLIHCPNLKGWWRNETASASAS---SFPCLSTLSIRSCPNL  259

Query  758   TWMPLFPTVSEKLYIVTGS--IIPLEHTKKVCSSFKYLKKLWVSEVADLEYMEIELFPSL  585
             T MPL+P + +KL +   S   +P   +  V S  K LK L +  V D+E   I     L
Sbjct  260   TSMPLYPHL-DKLMLERSSWKFLP---SSFVLSKLK-LKSLRIWSVEDIEE-RIANLTLL  313

Query  584   EYLWVYDCRNLRDWGKKGDHEDAPKALAKLAPSVIEFEVKNCPKLKLLPQGMRLLSSSTK  405
             +   +Y+C NL            P+ +  L   +   E+ +CPKL  LP+G+  L+    
Sbjct  314   QEFIIYNCPNL---------VSLPEGIGNLT-LLQHLEISDCPKLASLPEGIGNLTLLQH  363

Query  404   FSISGCPLL  378
               IS CP L
Sbjct  364   LEISDCPKL  372


 Score = 53.5 bits (127),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 66/283 (23%), Positives = 120/283 (42%), Gaps = 70/283 (25%)
 Frame = -2

Query  1076  ASAY--MTTIYIKNCPPGKQLPQF-HL------------LPS---LGELYFESIMVDYID  951
             AS++  ++T+ I++CP    +P + HL            LPS   L +L  +S+ +  ++
Sbjct  242   ASSFPCLSTLSIRSCPNLTSMPLYPHLDKLMLERSSWKFLPSSFVLSKLKLKSLRIWSVE  301

Query  950   TTDYEDDNSPSRSELFFPSLKKLWIWNCPNLKGWWKKNDEAIEEELLPPFPCISVVDIKQ  771
               +    N           L++  I+NCPNL               LP    I  + + Q
Sbjct  302   DIEERIAN--------LTLLQEFIIYNCPNLVS-------------LPEG--IGNLTLLQ  338

Query  770   SPNVTWMPLFPTVSEKLYIVTGSIIPLEHTK-KVCSSFKYLKKLWVSEVADLEYMEIELF  594
                ++  P   ++ E +    G++  L+H +   C     L +  +  +  L  + I  F
Sbjct  339   HLEISDCPKLASLPEGI----GNLTLLQHLEISDCPKLASLPE-GIGNLKSLSNLRIRCF  393

Query  593   P-------------SLEYLWVYDCRNLRDWGKKGDHEDAPKALAKLAPSVIEFEVKNCPK  453
             P             SL+ L ++DC  L            P+ +  L  S+    + +CP 
Sbjct  394   PNLASLPEGLRCLISLQDLKIFDCPKL---------ASLPEGMGNLK-SLKSLWISDCPN  443

Query  452   LKLLPQGMRLLSSSTKFSISGCPLLKQKYKSKSGQNWPEVANI  324
             L  LP+G+R LSS    +I  CP+L Q+ +  +G++W ++A+I
Sbjct  444   LASLPEGLRCLSSLKSLNIWKCPMLAQRCQKGTGEDWSKIAHI  486



>ref|XP_007021013.1| Leucine-rich repeat containing protein [Theobroma cacao]
 gb|EOY12538.1| Leucine-rich repeat containing protein [Theobroma cacao]
Length=1456

 Score = 88.2 bits (217),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 76/267 (28%), Positives = 120/267 (45%), Gaps = 67/267 (25%)
 Frame = -2

Query  1028  KQLPQFHLLPSLGELYFESIMVDYIDTTDYEDDNSP----SRSELFFPSLKKLWIWNCPN  861
             + L    LL  L  L +  ++++ ++  +Y  D+ P    +  + FFPSLKKL I  C N
Sbjct  845   RALEHLPLLDHLSSLKY--LVLEELNALEYVVDSFPLPCSTSRKPFFPSLKKLKIEFCDN  902

Query  860   LKGWWK-KNDEAIEEELLPPFPCISVVDIKQSPNVTWMPLFPTVSEKLYIVTGSIIPLEH  684
             LKGWW+ KN+       LP FPC+S +DI + PN+T MPLFP++ + L +   S+ PL+ 
Sbjct  903   LKGWWRTKNENQGSTAQLPCFPCLSKIDISKCPNLTSMPLFPSLDQDLTLWGTSVRPLQQ  962

Query  683   TKKV-------------------CSSF-------KYLKKLWVSEVADLEYMEIEL-----  597
             T K+                   C S+         LK L + ++ DLE +  E      
Sbjct  963   TLKMKMTEASMTSEEASSSSGSTCHSYFSTTLPLSNLKHLSLIDIKDLEVLSEEFLLAYC  1022

Query  596   -------------FPSLEYLWVYDCRNLRDWGKKGDHEDAPKALAKLAPSVIEFE---VK  465
                            SL+ LWV +  NL              AL+    ++   E   ++
Sbjct  1023  PKLESRQLQKMSCLTSLQELWVKNYPNLM-------------ALSNWILNLTSLETLRIR  1069

Query  464   NCPKLKLLPQGMRLLSSSTKFSISGCP  384
              C +L+ +P+G   L+S  + S+  CP
Sbjct  1070  GCLELQYMPEGTPQLTSLEELSVQNCP  1096



>gb|KHF99762.1| Putative disease resistance RGA3 [Gossypium arboreum]
Length=477

 Score = 86.7 bits (213),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 77/270 (29%), Positives = 121/270 (45%), Gaps = 45/270 (17%)
 Frame = -2

Query  1088  SWKFASAYMTTIYIKNCPPGKQLPQFHLLPSLGELYFESIMVDYIDTTDYEDDNSPSRS-  912
             SW  +   +  I I +    + LP F   P L EL     ++  +   +Y +DN P  S 
Sbjct  112   SWLSSLTNLVLISINSSSKFQHLPSFAQFPCLQEL-----VISNLTELEYMEDNGPHGSQ  166

Query  911   ---ELFFPSLKKLWIWNCPNLKGWWKK---------NDEAIEEELLPPFPCISVVDIKQS  768
                E FFPSL  L + NCPNLK WW+K          D  +       FPC+S + I+  
Sbjct  167   GKVESFFPSLTYLELNNCPNLKSWWRKRPVYDDSNEGDTKVVGASTMAFPCLSYLCIEDC  226

Query  767   PNVTWMPLFPTVSEKLYIVTGSIIPLEHTKKVCSS------------FKYLKKLWVSEVA  624
             P +T MPL+P++ ++L +V  S  PL+ T ++  +               LK   V  + 
Sbjct  227   P-LTSMPLYPSLDKELNLVNTSSRPLKQTLEMNITSMSPSTSTPSLPLSKLKSFHVENIE  285

Query  623   DLEYME----IELFPSLEYLWVYDCRNLRDWGKKGDHEDAPKALAKLAPSVIEFEVKNCP  456
             +L+  +    ++ F SL+ L + DC+ L     +G   +A K L+ L       E+ N P
Sbjct  286   ELDAHKLDEYLQHFTSLKTLTIRDCKEL---DLEGMQWEALKNLSHL-------EIDNIP  335

Query  455   KLKLLPQGMRLLSSSTKFSISGCPLLKQKY  366
             +L  LP G++ L       I  C  L+  +
Sbjct  336   QLVSLPLGLQHLFQLKTLEIKNCNGLRSLF  365



>gb|KDP42480.1| hypothetical protein JCGZ_00277 [Jatropha curcas]
Length=1017

 Score = 87.4 bits (215),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 79/261 (30%), Positives = 119/261 (46%), Gaps = 42/261 (16%)
 Frame = -2

Query  1181  ENYKKIRLEEQNPKQQPMLTLLPPEDIGSVL--SWKFASAYMTTIYIKNCPPGKQLPQFH  1008
             ++ K+I LEE  P Q   L  L     G V   SW    + +  + I  C   ++ P   
Sbjct  753   DDNKEISLEELWPHQN--LKWLIVSGCGKVKFPSWISNLSNLVELQINGCKHCQRFPPLD  810

Query  1007  LLPSLGELYFESIMVDYIDTTDYEDDNSPSRSELFFPSLKKLWIWNCPNLKGWWKKNDEA  828
               P L  L  +    ++ D    E     S S LFFPSL+KLW+ NCPNLKGWW+     
Sbjct  811   QFPFLKRLSIK----NFTDLEYIESGIEMSGSALFFPSLEKLWLENCPNLKGWWRFP---  863

Query  827   IEEELLPPFPCISVVDIKQSPNVTWMPLFPTVSEKLYIVTGSIIPLEHTKK---------  675
                  L  F C+S + I    N+T MPL P+V E L + + SI  L+   K         
Sbjct  864   -----LLKFHCLSYLGIVSCTNLTSMPLIPSV-ESLLLKSTSIKSLDDILKMKIQSRSSS  917

Query  674   ---VCSSFKYLKKLWVSEVADLEYMEIEL---FPSLEYLWVYDCRNLRDWGKKGDHEDAP  513
                +  +   LK L + +V DL++++ EL   F SL+ L ++DC  +            P
Sbjct  918   PSSITPALSQLKTLTLEKVEDLKFLDEELMQNFTSLQQLEIFDCPTI---------TTVP  968

Query  512   KALAKLAPSVIEFEVKNCPKL  450
             +A+ K   S+    +++C +L
Sbjct  969   RAI-KYLTSLKNLMIRDCEEL  988


 Score = 58.5 bits (140),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 54/156 (35%), Positives = 76/156 (49%), Gaps = 9/156 (6%)
 Frame = -2

Query  1583  MVDPVVSTAISVAKLILAKIAPFAQDQIKLLWGLNEELTKLGDLVSHIGAVLLDAEGE-K  1407
             M D  +S    V  +I   ++P A  + KL WG+ +EL KL   VS + AVLLDAE +  
Sbjct  1     MADAYLSNV--VGGVISNLVSP-ALREAKLWWGVKDELDKLKKTVSTVQAVLLDAEEQYS  57

Query  1406  HNKKTENLLEMLKNIMDEANRLMDYFSPR---AKNHRPNQEDGCCSYFVSHPNPFVWVSD  1236
              + + +  ++ LK    +A+ L+D FS R    K    N+       F S  N F  +  
Sbjct  58    QSHQVKVWIDSLKEAFYDADDLLDEFSIRELEKKVMTGNKLVKEVRLFFSSSNQF--IHS  115

Query  1235  SFMAGKIKSINNRLDGIIENYKKIRLEEQNPKQQPM  1128
               MA KIK I   LDGI EN K     E++ K+  M
Sbjct  116   IKMAHKIKEIRCELDGIAENRKFYLNHERSEKRDVM  151



>ref|XP_003626845.1| NBS resistance protein [Medicago truncatula]
 gb|AET01321.1| NB-ARC domain disease resistance protein [Medicago truncatula]
Length=901

 Score = 87.4 bits (215),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 74/273 (27%), Positives = 120/273 (44%), Gaps = 31/273 (11%)
 Frame = -2

Query  1088  SWKFASAYMTTIYIKNCPPGKQLPQFHLLPSLGELYFESIMVDYIDTTDYEDDNSPSRSE  909
             +W  +   +  I +  C   + LP    LP L  LY     + ++    Y     P  SE
Sbjct  633   NWLSSLTNIVEISLTCCEGLEFLPPLERLPFLKSLY-----ISFLRVLKYIHYEEPILSE  687

Query  908   LFFPSLKKLWIWNCPNLKGWWKKND----EAIEEELLPPFPCISVVDIKQSPNVTWMPLF  741
             +FFPSL+ L + +C  L GW +  D            PPFP +S + I+    +T MP F
Sbjct  688   IFFPSLESLRLEDCSYLMGWCRTGDGIDSSQSHHRSFPPFPLLSQLSIEGCQRLTCMPTF  747

Query  740   PTVSEKLYIVTGSIIPLEHTKKVCSSFKYL-----KKLWVSEVADLEYMEIELFPSLEY-  579
             P         + S  PL   K +C     L      + W+  +  L++++IELF S +  
Sbjct  748   PN--------SLSFPPLSMLKSLCIGGHKLAVYNISENWMQNLPSLQHLQIELFSSQQVH  799

Query  578   ---LWVYDCRNLRDWGKKGDHE--DAPKALAKLAPSVIEFE---VKNCPKLKLLPQGMRL  423
                +W  +  N     +K   +  D  KAL     S+   +   ++  P L  +P+GM  
Sbjct  800   EIAIWFNNNFNCLPSLQKITLQYCDDLKALPDWMCSISSLQHVTIRYSPHLASVPEGMPR  859

Query  422   LSSSTKFSISGCPLLKQKYKSKSGQNWPEVANI  324
             L+      I GCPLL ++ ++++   WP+VA+I
Sbjct  860   LAKLKTLEIIGCPLLVKECEAQTNATWPKVAHI  892



>ref|XP_011031339.1| PREDICTED: putative disease resistance protein RGA3 isoform X1 
[Populus euphratica]
Length=1072

 Score = 87.4 bits (215),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 72/252 (29%), Positives = 120/252 (48%), Gaps = 30/252 (12%)
 Frame = -2

Query  1088  SWKFASAYMTTIYIKNCPPGKQLPQFHLLPSLGELYFESIMVDYIDTTDYEDDNSPSRSE  909
             SW    + +  I +++C   K +P    + SL EL    + +D ++  D E D     S 
Sbjct  776   SWVSNISNLARICLESCKRLKHIPPLDGILSLEELSI--VGLDDLEYIDSEGDRGRGAST  833

Query  908   LFFPSLKKLWIWNCPNLKGWWKK------NDEAIEEEL-LPPFPCISVVDIKQSPNVTWM  750
              FFPSLK L I+ C  LKGWWK+      N ++ E  + +  FP +S + +   PN+T M
Sbjct  834   -FFPSLKTLVIYGCFRLKGWWKRWSRDEMNADSDESTIKMLCFPRLSSLCVSDCPNLTSM  892

Query  749   PLFPTVSEKLYIVTGSIIPLEHTKKVCSSFKYLKKLWVSEVADLEYMEIELFPSLEYLWV  570
             PLFPT+ E L +   S +PL+ T  + S        ++  ++ L+ +E         ++ 
Sbjct  893   PLFPTLDEGLDLRRTSSMPLQQTMNMKSPVSSSSSSFIRPLSKLKNLE---------MYS  943

Query  569   YDCRNLRDWGKKGDHEDAPKALAKLAPSVIEFEVKNCPKLKLLPQGMRLLSSSTKFSISG  390
              D           D E  P+   +   S+++  +  CP+LK LP  ++ + S  K  I+ 
Sbjct  944   ID-----------DMESVPEVGLQNLSSLLQLSIYECPRLKSLPLPVQGMHSLQKLHIAD  992

Query  389   CPLLKQKYKSKS  354
             C +LK   +S+S
Sbjct  993   CRVLKSLSESES  1004


 Score = 57.0 bits (136),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 45/158 (28%), Positives = 80/158 (51%), Gaps = 8/158 (5%)
 Frame = -2

Query  1553  SVAKLILAKIAPFAQDQIKLLWGLNEELTKLGDLVSHIGAVLLDAE--GEKHNKKTENLL  1380
             S+ + I+ K+   A  ++ L WG+ ++L KL   V+ I AV+ D E   +K N + E+ L
Sbjct  8     SILEEIIKKLGSPAFQEVALWWGVGDQLMKLSGTVTRIKAVIQDVEEQAQKQNHQIEDWL  67

Query  1379  EMLKNIMDEANRLMDYFSPRA--KNHRPNQE-DGCCSYFVSHPNPFVWVSDSFMAGKIKS  1209
               L+  + +A  L+D FS +   K   P +        F S  N FV+     M  ++K 
Sbjct  68    MKLREAVYDAEDLLDDFSTQVLRKQLMPGKRVSREVRLFFSRSNQFVY--GLRMGHRVKI  125

Query  1208  INNRLDGIIENYKKIRLEEQNPKQQPMLTLLPPEDIGS  1095
             +  RLDGI  + KK+  + ++ +++  LT++  +   S
Sbjct  126   LRERLDGIEIDSKKLNFDVRD-EERASLTMVREQTTSS  162



>ref|XP_007021016.1| Leucine-rich repeat containing protein [Theobroma cacao]
 gb|EOY12541.1| Leucine-rich repeat containing protein [Theobroma cacao]
Length=1024

 Score = 87.4 bits (215),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 73/241 (30%), Positives = 111/241 (46%), Gaps = 24/241 (10%)
 Frame = -2

Query  1088  SWKFASAYMTTIYIKNCPPGKQLPQFHLLPSLGELYFESIMVDYIDTTDYEDDNSPSRSE  909
             SW  +   +  + I  C   + LP    L SL  L  +   V    T  +    S  R+ 
Sbjct  774   SWLSSLNNLVELDIDYCWNCQYLPPLDHLSSLKSLILQRFNVLEYMTDSFSLPCSTPRTS  833

Query  908   LFFPSLKKLWIWNCPNLKGWW---KKNDEAIEEELLPPFPCISVVDIKQSPNVTWMPLFP  738
              FFPSLKKL I  CP  KGWW    KN  +  E+  P FPC+S + I+  P +T MP FP
Sbjct  834   -FFPSLKKLEIRECPKFKGWWWTTTKNQGSTAEQ--PCFPCLSKLKIRACPKLTSMPPFP  890

Query  737   TVSEKLYIVTGSIIPLEHTKKVCSSFKYLKKLWVSEVADLEYMEIEL-FPSLEYLWVYDC  561
             ++ + L ++  SI  L+ T K       +K    S  ++     + L   +L+ L + D 
Sbjct  891   SLDQDLTLIGTSIRVLQETLK-------MKPTEASMTSEASLSSVTLPLSNLKSLTLIDI  943

Query  560   RNLRDWGKKGDHEDAPKALAKLAPSVIEFEVKNCPKLK-LLPQGMRLLSSSTKFSISGCP  384
             ++L    +K           +   S+    +K+CP L+ LLPQ M  L++  + S+  CP
Sbjct  944   KDLDALSEK---------FLQNITSLAHLTLKDCPNLESLLPQNMNCLATLQELSVINCP  994

Query  383   L  381
             L
Sbjct  995   L  995



>ref|XP_006572949.1| PREDICTED: putative disease resistance protein RGA3-like [Glycine 
max]
Length=1091

 Score = 87.4 bits (215),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 70/243 (29%), Positives = 111/243 (46%), Gaps = 38/243 (16%)
 Frame = -2

Query  1100  GSVLS-WKFASAYMTTIYIKNCPPGKQLPQFHLLPSLGELYFESIMVDYIDTTDY-EDDN  927
             G++ S W  +   +    + +CP    +P    LP L  L    +     D+ ++   D 
Sbjct  747   GNMFSDWLSSMQCLVKFSLNDCPKCVFIPPLDHLPHLRVLELRRL-----DSLEFISADA  801

Query  926   SPSRSELFFPSLKKLWIWNCPNLKGWWKKNDEAIEEELLPPFPCISVVDIKQSPNVTWMP  747
               S S  FFPSLK+L I +CPNLK WWK       E+  P F CIS + ++  PN+  MP
Sbjct  802   KGSSSSTFFPSLKELTISDCPNLKSWWKTPK---WEDDRPFFNCISKLHVQCCPNLHCMP  858

Query  746   LFPTVSEKLYIVTGSIIPLEHTKKVCSSFKYLKKLWVSEVADLEYMEIELFPSLEYLWVY  567
             L+P + E+L +V  S+  +  T    +S  +L       ++ L+ M IE           
Sbjct  859   LYPFLDEELVLVDSSVKSMRDTVHAKTSKDFLP------LSKLKSMVIERIT--------  904

Query  566   DCRNLRDWGKKGDHEDAPKALAKLAPSVIEFEVKNCPKLKLLPQGMRLLSSSTKFSISGC  387
                           +  PK+  K   S+    +++C +L+ LP+G + LSS  + +I GC
Sbjct  905   --------------QSPPKSWLKNFISLENLLIRDCSELECLPEGFKSLSSLQRLTIEGC  950

Query  386   PLL  378
             P L
Sbjct  951   PKL  953


 Score = 56.2 bits (134),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 66/277 (24%), Positives = 111/277 (40%), Gaps = 65/277 (23%)
 Frame = -2

Query  1007  LLPSLGELYFESI--MVDYIDTTDYEDDNSPSRSELFFPSLKKLWIWNCPNL--------  858
               PSL EL       +  +  T  +EDD        FF  + KL +  CPNL        
Sbjct  809   FFPSLKELTISDCPNLKSWWKTPKWEDDRP------FFNCISKLHVQCCPNLHCMPLYPF  862

Query  857   ------------KGWWKKNDEAIEEELLPPFPCISVV--DIKQSPNVTWMPLFPTVS---  729
                         K           ++ LP     S+V   I QSP  +W+  F ++    
Sbjct  863   LDEELVLVDSSVKSMRDTVHAKTSKDFLPLSKLKSMVIERITQSPPKSWLKNFISLENLL  922

Query  728   --------------------EKLYIVTGSIIPLEHTKKVCSSFKYLKKLWVSEVADLEYM  609
                                 ++L I     + L+ +K      K+LK L + E+  L+ +
Sbjct  923   IRDCSELECLPEGFKSLSSLQRLTIEGCPKLDLDVSKTEWEGLKHLKCLTIREIPKLKSL  982

Query  608   --EIELFPSLEYLWVYDCRNLRDWGKKGDHEDAPKALAKLAPSVIEFEVKNCPKLKLLPQ  435
                +E   SLE L +Y+C  L            P+++AKL  S+ +  +  C  L  LP+
Sbjct  983   PWGVEDVTSLEELELYECPALTFL---------PESMAKLT-SLCKLVISECKNLGSLPK  1032

Query  434   GMRLLSSSTKFSISGCPLLKQKYKSKSGQNWPEVANI  324
             G+ +L S    +I+ CPLL  + + ++G +WP++ ++
Sbjct  1033  GLEMLKSLNTLTITDCPLLLPRCQPETGDDWPQIGHV  1069



>ref|XP_007021014.1| Leucine-rich repeat containing protein, putative [Theobroma cacao]
 gb|EOY12539.1| Leucine-rich repeat containing protein, putative [Theobroma cacao]
Length=1234

 Score = 86.3 bits (212),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 88/321 (27%), Positives = 129/321 (40%), Gaps = 95/321 (30%)
 Frame = -2

Query  1004  LPSLGELY-FESIMVDYIDTTDYEDD---NSPSRSELFFPSLKKLWIWNCPNLKGWWK-K  840
             LP L EL   +SI ++ +   ++  D   + PS     F SL++L I NCP L GWW+ +
Sbjct  904   LPPLDELSSLQSITLEDLPLLEHVADGMGDHPSFPSHCFQSLQQLEIRNCPKLNGWWRTR  963

Query  839   NDEAIEEELLPPFPCISVVDIKQSPNVTWMPLFPTVSEKLYIVTGSIIPLEHTKKV----  672
             N+       LP FPC+S + I   P +T MPLFP+V ++L +   SI PL  T K+    
Sbjct  964   NENQGSTAELPWFPCLSKLKIINCPKLTSMPLFPSVDQELSLEHTSIRPLRQTLKMKITK  1023

Query  671   -------------CSS------FKYLKKLWVSEVADLEYMEIEL----------------  597
                          CS+       K L    V++V DLE +  E                 
Sbjct  1024  SCVTSEASSSGSTCSTAFPLSNLKCLTLAAVNDVNDLEALSEEFLQNLTFLTCLTFKDCD  1083

Query  596   ------------FPSLEYLWVYDCRNLR---DW------------GKKGDHEDAPKALAK  498
                           SL+ LWV +C NLR   DW             K  D +  P+ + +
Sbjct  1084  KLELLLPQKMNCLTSLQELWVENCSNLRALLDWIPRLTSLHTLTISKDSDLQHLPEGMRR  1143

Query  497   LA-----------------------PSVIEFEVKNCPKLKLLPQGMRLLSSSTKFSISGC  387
             L                         S+   ++ +C K + LP GM  L+S    SI  C
Sbjct  1144  LTSLRELWVVECSNLRSFPDWILDLTSLTTLKIWDCRKFQSLPDGMNRLTSLKHLSIKKC  1203

Query  386   PLLKQKYKSKSGQNWPEVANI  324
             P   ++ ++K    WP+ A I
Sbjct  1204  PQFLER-RAKEIGIWPDPACI  1223



>ref|XP_006382155.1| hypothetical protein POPTR_0006s28910g, partial [Populus trichocarpa]
 gb|ERP59952.1| hypothetical protein POPTR_0006s28910g, partial [Populus trichocarpa]
Length=327

 Score = 83.2 bits (204),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 70/209 (33%), Positives = 103/209 (49%), Gaps = 33/209 (16%)
 Frame = -2

Query  1088  SWKFASAYMTTIYIKNCPPGKQLPQFHLLPSLGELYFESIM-VDYIDTTDYEDDNSPSRS  912
             SW    + +  I ++ C   K +P    +PSL EL    +  ++YID+         +  
Sbjct  109   SWVLDLSNLVRIRVQRCRRLKHIPPLDGIPSLEELGIWDLDDLEYIDSEGVGGKGVST--  166

Query  911   ELFFPSLKKLWIWNCPNLKGWWKK------NDEA----IEEEL-LPPFPCISVVDIKQSP  765
               FF SLKKL I  C  LKGW K+      ND++    IEE L +  F  +S + I + P
Sbjct  167   --FFQSLKKLNIMYCGRLKGWRKRWSRDEMNDDSDESTIEEGLRMLCFLRLSSLSIFKCP  224

Query  764   NVTWMPLFPTVSEKLYIVTGSIIPLEHTKKVCS--------------SFKYLKKLWVSEV  627
             N+T MPLFPT+ E LY+V  S +PL+ T K+ S                  LK L +  +
Sbjct  225   NLTSMPLFPTLDEDLYLVNTSSMPLQQTMKMTSPVSSSSSSSSSITRPLSKLKSLDMWSL  284

Query  626   ADLEYM-EIEL--FPSLEYLWVYDCRNLR  549
              D+E + E+ L    SL+ LW++ CR L+
Sbjct  285   DDMESLPEVGLQNLSSLQQLWIWGCRRLK  313



>ref|XP_008461342.1| PREDICTED: disease resistance protein RGA2-like isoform X3 [Cucumis 
melo]
Length=1042

 Score = 85.5 bits (210),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 76/258 (29%), Positives = 116/258 (45%), Gaps = 43/258 (17%)
 Frame = -2

Query  1064  MTTIYIKNCPPGKQLPQFHLLPSLGELYFESIM-VDYIDTTDYEDDNSPSRSELFFPSLK  888
             +T I I +C   + LPQFH L +L  L    +  + +ID  D     +P  S +FFPSLK
Sbjct  796   LTEIEIVSCHRLQHLPQFHHLQTLKTLCLRDLRSLKFIDKFD-----NPFSSSMFFPSLK  850

Query  887   KLWIWNCPNLKGWWKKNDEAIEE-----ELLPP-FPCISVVDIKQSPNVTWMPLFPTVSE  726
              L + N  NL+GWW+ +     E     + LPP FP + ++DI Q P +  MP  P+ S 
Sbjct  851   SLCLANMANLEGWWELSRAVAGETSENIQWLPPTFPELEILDIYQCPKLNSMPKLPS-ST  909

Query  725   KLYIVTGSIIPLEHTKKVCSSFKYLKKLWVSEVADLEYMEIE------LFPS--------  588
             K Y+    +        +      L+ L + E+ +L  +  +      L  S        
Sbjct  910   KAYVSLCDVGVQLVISTIGPVLLCLRTLRLEEIKNLNCLPFQQNINHSLVISSTTTSPIP  969

Query  587   LEYLWVYDCRNLR---DWGKKGDHEDAPKALAKLAPSVIEFEVKNCPKLKLLPQGMRLLS  417
             L+YL +  C +L    +W               +  S+    +  CPKLK LP+GMR L 
Sbjct  970   LKYLQMDKCLDLVTLPEW-------------IYIFTSLETLSISKCPKLKSLPKGMRRLE  1016

Query  416   SSTKFSISGCPLLKQKYK  363
             S  +  I  CP L+++ K
Sbjct  1017  SLKRLCIEDCPRLEERCK  1034



>ref|XP_003635897.1| Cc-nbs-lrr resistance protein [Medicago truncatula]
 gb|KEH25214.1| disease resistance protein (CC-NBS-LRR class) family protein 
[Medicago truncatula]
Length=1026

 Score = 85.5 bits (210),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 81/297 (27%), Positives = 130/297 (44%), Gaps = 53/297 (18%)
 Frame = -2

Query  1115  PPEDIGSVLSWKFASAYMTTIYIKNCPPGKQLPQFHLLPSLGELYFESIMV-DYIDTTDY  939
             P  +  S LS     +Y++     NC   K LP    LP L  L   S+ V +YI   + 
Sbjct  739   PGYEFSSWLSSINHLSYISLFGFDNC---KSLPPLEHLPCLKSLEISSMKVLEYIHLEEV  795

Query  938   EDDNSPSRSELFFPSLKKLWIWNCPNLKGWWK-KNDEAIEEELLPPFPCISVVDIKQSPN  762
                     +  FFPSL++L    C N  GW + K   ++++   PP   +S + I + P 
Sbjct  796   -----FHTAATFFPSLERLKFSGCKNFTGWQRMKRQVSVDKLSHPPLGRLSQLIINKCPE  850

Query  761   VTWMPLFPTVSEKLYIVTGSIIPLEHTKKVC--------SSFKYLK------------KL  642
             +T +P FP V E+L +    + PL+ T  +         S  K LK              
Sbjct  851   LTDLPTFPNV-EELQLCESMVTPLKETLDIASSSSSTPLSKLKSLKIEGKLPEISVLPSR  909

Query  641   WVSEVADLEYMEI-----------ELFPSLEYLWVYDCRNLRDWGKKGDHEDAPKALAKL  495
             W   +  LE++EI           + FPSL+ + VY C          D +  P+ +  L
Sbjct  910   WKQNLTSLEHLEIGDVDNLDIWFEDNFPSLQKVVVYGC----------DLQALPQKMCDL  959

Query  494   APSVIEFEVKNCPKLKLLPQGMRLLSSSTKFSISGCPLLKQKYKSKSGQNWPEVANI  324
             + S+   ++  C KL  LP+ M  L+      I  CPLL ++ +S++G +WP+V ++
Sbjct  960   S-SLQHVKMMGCHKLASLPKEMVNLNKLVTLEIWDCPLLVERCQSETGVDWPQVKHV  1015



>ref|XP_011002332.1| PREDICTED: putative disease resistance protein RGA3 [Populus 
euphratica]
Length=1075

 Score = 84.7 bits (208),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 73/248 (29%), Positives = 114/248 (46%), Gaps = 43/248 (17%)
 Frame = -2

Query  1088  SWKFASAYMTTIYIKNCPPGKQLPQFHLLPSLGELYFESIMVDYIDTTDYEDDNSPSRSE  909
             SW    + +  I +++C   K +P    + SL EL    + +D ++  D E D     S 
Sbjct  776   SWVSNISNLARICLESCKRLKHIPPLDGILSLEELSI--VGLDDLEYIDSEGDRGRGAST  833

Query  908   LFFPSLKKLWIWNCPNLKGWWKK------NDEAIEEEL-LPPFPCISVVDIKQSPNVTWM  750
              FFPSLK L I+ C  LKGWWK+      N ++ E  + +  FP +S + +   PN+T M
Sbjct  834   -FFPSLKTLVIYGCFRLKGWWKRWSRDEMNADSDESTIKMLCFPRLSSLCVSDCPNLTSM  892

Query  749   PLFPTVSEKLYIVTGSIIPLEHTKKV---------------CSSFKYLKKLWVSEVADLE  615
             PLFPT+ E L + + S +PL+ T K+                S  K L   ++ ++  L 
Sbjct  893   PLFPTLDEGLDLRSTSSMPLQQTMKMKSPVSSSSSSSFIRPLSKLKNLAMWFIDDMESLP  952

Query  614   YMEIELFPSLEYLWVYDCRNLRD--WGKKGDHEDAPKALAKLAPSVIEFEVKNCPKLKLL  441
              + +    SL+ LW+  C  L+      +G H            S+ + EV +C +LK L
Sbjct  953   EVGLRNLSSLQQLWISGCGRLKSLPLPDQGMH------------SLQKLEVSSCRELKSL  1000

Query  440   ----PQGM  429
                  QGM
Sbjct  1001  SESESQGM  1008


 Score = 64.3 bits (155),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 54/190 (28%), Positives = 89/190 (47%), Gaps = 26/190 (14%)
 Frame = -2

Query  1553  SVAKLILAKIAPFAQDQIKLLWGLNEELTKLGDLVSHIGAVLLDAE--GEKHNKKTENLL  1380
             + A+ I+  +      +  L WGL ++L KL D V+ I AV+ DAE   +KHN + ++ L
Sbjct  8     NTAEEIIKTLGSLTAQEAALWWGLKDQLRKLNDTVTRIKAVIEDAEEQAQKHNHQIQDWL  67

Query  1379  EMLKNIMDEANRLMDYFSPRAK------NHRPNQEDGCCSYFVSHPNPFVWVSDSFMAGK  1218
               L+  + +A  L+D FS +          R ++E    S F S  N FV+     M  +
Sbjct  68    MKLREAVYDAEDLLDDFSIQVVRKQLMPGKRVSRE---VSLFFSRSNQFVY--GLRMGHR  122

Query  1217  IKSINNRLDGIIENYKK----IRLEE---------QNPKQQPMLTLLPPEDIGSVLSWKF  1077
             +K++  RLDGI  + KK    +R EE         Q    +P +T+    D  +V ++  
Sbjct  123   VKTLRERLDGIEIDSKKFNFDVRDEERASLTMVRDQTTSSEPEITVGRESDKKTVKTFLM  182

Query  1076  ASAYMTTIYI  1047
              S Y   + +
Sbjct  183   NSNYEHNVSV  192



>ref|XP_003626884.1| Cc-nbs-lrr resistance protein [Medicago truncatula]
 gb|AET01360.1| LRR and NB-ARC domain disease resistance protein [Medicago truncatula]
Length=831

 Score = 84.3 bits (207),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 75/270 (28%), Positives = 124/270 (46%), Gaps = 24/270 (9%)
 Frame = -2

Query  1085  WKFASAYMTTIYIKNCPPGKQLPQFHLLPSLGELYFESIMVDYIDTTDYEDDNSPSRSEL  906
             W  +   +  I IK     K LP    LP L  L    +     D  +Y     P   E 
Sbjct  564   WHSSLTNLVEISIKKFYTLKYLPPMERLPFLKRLNLFCL-----DDLEYIYFEEPILPES  618

Query  905   FFPSLKKLWIWNCPNLKGWWKKNDEAIEEE--------LLPPFPC-ISVVDIKQSPNVTW  753
             FFPSLKKL I +C  L+GWW+  D+    E          PPF   +S++ I   P +T 
Sbjct  619   FFPSLKKLIITDCFKLRGWWRLRDDVNNVENSSQFHHLSFPPFSSHLSLLSIFSCPMLTC  678

Query  752   MPLFPTVSEKLYIVTGSIIPLEHTKKVCSS-----FKYLKKLWVSEVADLEYMEIELFPS  588
             +P FP + + L++V+ S+  LE T  +  S     F  L KL    +   E +++++ P 
Sbjct  679   IPTFPNLDKTLHLVSTSVETLEATLNMVGSELAIEFPPLSKLKYLRLGG-EDLDLKILPF  737

Query  587   L--EYLWVYDCRNLRDWGKKGDHEDAPKALAKLAPSVIEFEVKNCPKLKLLPQGMRLLSS  414
                ++ ++   +N  ++    D +  P  +  L+ S+    ++ C  L  LP+GM  LS 
Sbjct  738   FKEDHNFLSSIQNF-EFCNCSDLKVLPDWICNLS-SLQHISIQRCRNLASLPEGMPRLSK  795

Query  413   STKFSISGCPLLKQKYKSKSGQNWPEVANI  324
                  I GCPLL ++  +++   W ++++I
Sbjct  796   LHTLEIFGCPLLVEECVTQTSATWSKISHI  825



>gb|KHN40424.1| Putative disease resistance protein RGA4 [Glycine soja]
Length=1092

 Score = 84.7 bits (208),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 66/246 (27%), Positives = 105/246 (43%), Gaps = 55/246 (22%)
 Frame = -2

Query  1085  WKFASAYMTTIYIKNCPPGKQLPQFHLLPSLGELYFESIMVDYIDTTDY-EDDNSPSRSE  909
             W  +   +    + +CP    +P    LP L  L    +     D+ ++   D   S S 
Sbjct  754   WLSSMQCLVKFSLNDCPKCVFIPPLDHLPHLRVLELRRL-----DSLEFISADAKGSSSF  808

Query  908   LFFPSLKKLWIWNCPNLKGWW----KKNDEAIEEELLPPFPCISVVDIKQSPNVTWMPLF  741
              FFPSLK+L I +CPNLK WW    ++ND        P F CIS + ++  PN+  MPL+
Sbjct  809   TFFPSLKELTISDCPNLKSWWETPKRENDR-------PFFNCISKLHVQCCPNLDCMPLY  861

Query  740   PTVSEKLYIVTGSIIPLEHTKKVCSS-----FKYLKKLWVSEVADLEYMEIELFPSLEYL  576
             P + E+L +V  S+  +  T    +S     F  LK + ++ +                 
Sbjct  862   PFLDEELVLVDSSVKSMRDTVHAKTSKDFIPFSKLKSMLIARIT----------------  905

Query  575   WVYDCRNLRDWGKKGDHEDAPKALAKLAPSVIEFEVKNCPKLKLLPQGMRLLSSSTKFSI  396
                              E  P    K   S+   ++++C +L+ LP+G + LSS  + +I
Sbjct  906   -----------------ETPPPRWLKSFISLENLQIRDCSELECLPEGFKSLSSLQRLTI  948

Query  395   SGCPLL  378
              GCP L
Sbjct  949   EGCPKL  954


 Score = 55.5 bits (132),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 44/168 (26%), Positives = 84/168 (50%), Gaps = 15/168 (9%)
 Frame = -2

Query  812   LPPFPCISVVDIKQSPNVTWMPL-FPTVS--EKLYIVTGSIIPLEHTKKVCSSFKYLKKL  642
             L  F  +  + I+    +  +P  F ++S  ++L I     + L+ +K      K+LK L
Sbjct  913   LKSFISLENLQIRDCSELECLPEGFKSLSSLQRLTIEGCPKLDLDVSKTEWEGLKHLKCL  972

Query  641   WVSEVADLEYM--EIELFPSLEYLWVYDCRNLRDWGKKGDHEDAPKALAKLAPSVIEFEV  468
              + E+  L+ +   +E   SLE L +Y+C  L            P+++AKL  S+ +  +
Sbjct  973   TIREIPKLKSLPWGVEDVTSLEELELYECPALTFL---------PESMAKLT-SLCKLVI  1022

Query  467   KNCPKLKLLPQGMRLLSSSTKFSISGCPLLKQKYKSKSGQNWPEVANI  324
               C  L  LP+G+ +L S    +I+ CPLL  + + ++G +WP++ ++
Sbjct  1023  SECKNLGSLPKGLEMLESLNTLTITDCPLLLPRCQPETGDDWPQIGHV  1070



>ref|XP_010097418.1| hypothetical protein L484_009642 [Morus notabilis]
 gb|EXB68035.1| hypothetical protein L484_009642 [Morus notabilis]
Length=462

 Score = 83.6 bits (205),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 70/249 (28%), Positives = 116/249 (47%), Gaps = 17/249 (7%)
 Frame = -2

Query  1088  SWKFASAYMTTIYIKNCPPGKQLPQFHLLPSLGELYFESI-MVDYIDTTDYEDDNSPSRS  912
             SW  +   +  + + +C   + L   + L  L +L   S+  ++YI+    E+++    S
Sbjct  84    SWLSSLTNLVNLTLVSCEKCQHLVPLNQLHRLKKLELNSLPCLEYING---EEEDLLLSS  140

Query  911   ELFFPSLKKLWIWNCPNLKGWWKKNDEAIEEELLPPF-PCISVVDIKQSPNVTWMPLFPT  735
              +  PSL++LW+ N  NLKGWW+   E +  ELLP F PC+S + ++    ++ MPL+P 
Sbjct  141   TIILPSLRELWLSNLSNLKGWWR---EVVSGELLPCFPPCLSKLIVRDCLQLSCMPLYPH  197

Query  734   VSEKLYIVTGSIIPLEHTKKVCSSFKYLKKLWVSEVADLEYMEIELFPSLEYLWVYDCRN  555
             + ++L +    + PLE T  V  S KY               EI    S  +  +    +
Sbjct  198   LEKRLELRNTRLKPLEQTVLVLESRKY--------STSTTGTEIPTTTSSSFSPLSKLTS  249

Query  554   LRDWGKKGDHEDAPKALAKLAPSVIEFEVKNCPKLKLLPQGMRLLSSSTKFSISGCPLLK  375
             LR WG   D +  P+    L   + E E+  C KLK L  G+  L+S     I  C  L+
Sbjct  250   LRIWGIGEDLQCLPEWFKSLT-CLKELEIVYCSKLKDLSPGIHHLTSLESLVIENCEELE  308

Query  374   QKYKSKSGQ  348
             +     +G+
Sbjct  309   EMMVVNNGR  317



>ref|XP_008368959.1| PREDICTED: disease resistance protein RGA2-like [Malus domestica]
Length=1126

 Score = 84.3 bits (207),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 72/269 (27%), Positives = 119/269 (44%), Gaps = 49/269 (18%)
 Frame = -2

Query  1088  SWKFASAYMTTIYIKNCPPGKQLPQFHLLPSLGELYFESIMVDYIDTTDYEDDNSPSRSE  909
             SW  +   +  + +  C   + LP     PSL     +S+ +D  +  +Y  DN+ S + 
Sbjct  773   SWFSSLINLVDLTLTGCHRCQHLPPLDRFPSL-----KSLSLDGFEKLEYISDNTTSSNS  827

Query  908   L--------FFPSLKKLWIWNCPNLKGWWKKNDE-------AIEEELLPPFPCISVVDIK  774
             +        FFPSL++L +  CP LKGWW+ +         + E   LP FPC+S + I 
Sbjct  828   MSDEMMKISFFPSLEELSLLGCPVLKGWWRAHTHNNASSSSSTENLSLPSFPCLSQLTID  887

Query  773   QSPNVTWMPLFPTVS------------EKLYIVTGSIIPLEHTKKVCSS-----FKYLKK  645
             + PN+T MPL+P V             + L++   S I  +    V +S        L +
Sbjct  888   ECPNLTSMPLYPNVERLDLERSSWKVVDSLFVRGASDITHDVGVDVSASSSSPHLSKLTR  947

Query  644   LWVSEVADLEYMEIELF---PSLEYLWVYDCRNLRDWGKKGDHEDAPKALAKLAPSVIEF  474
             L + ++ DLE +  +     PSL+ L++ DC NL      G        +  LA +  E 
Sbjct  948   LSLIKIEDLECLTSQGMGNVPSLQSLYIADCPNLALLPYHG--------MGNLA-AFREL  998

Query  473   EVKNCPKLKLLPQGMRLLSSSTKFSISGC  387
              + +C  L  + +G+  L+S    +I  C
Sbjct  999   GIGDCSNLTSMSEGIANLTSLQVLTIGNC  1027


 Score = 57.4 bits (137),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 38/124 (31%), Positives = 64/124 (52%), Gaps = 6/124 (5%)
 Frame = -2

Query  1553  SVAKLILAKIAPFAQDQIKLLWGLNEELTKLGDLVSHIGAVLLDAEGEKHNKKTENLLEM  1374
             +VA  I+ ++   A  +I L+WG+ +EL KL ++V+    VLLD E ++ N + +  LE 
Sbjct  8     NVAAQIIGRLGSLAFQEIGLIWGVQDELHKLQEIVAGFQGVLLDVEQKQTNNEVKLWLES  67

Query  1373  LKNIMDEANRLMDYFSPRAKNHR----PNQEDGCCSYFVSHPNPFVWVSDSFMAGKIKSI  1206
             +++ + EA+ L+D F+  A+  +      +       F S  N   +     M  KIK I
Sbjct  68    VEDAVYEADDLLDEFNTEAQQRQMMCGNTKMSRKVRLFFSSSNQLAFRLK--MGHKIKDI  125

Query  1205  NNRL  1194
             N RL
Sbjct  126   NKRL  129



>gb|KDP37632.1| hypothetical protein JCGZ_07831 [Jatropha curcas]
Length=466

 Score = 83.2 bits (204),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 87/309 (28%), Positives = 129/309 (42%), Gaps = 68/309 (22%)
 Frame = -2

Query  1169  KIRLEEQNPKQQPMLTLLPPEDIGSVL--SWKFASAYMTTIYIKNCPPGKQLPQFHLLPS  996
             +I LEE  P +   L  L     G V   SW      +  + I NC   K LP     PS
Sbjct  117   EISLEELQPHRN--LKWLVISGCGKVKFPSWISTLGCLVDLQINNCTNCKCLPPLDHFPS  174

Query  995   LGELYFESIM-VDYIDTTDYEDDNSPSRSELFFPSLKKLWIWNCPNLKGWWKKNDEAIEE  819
             L  L  +++  ++YI     E+ N  S S     ++++LW+ NCPNLKGW +        
Sbjct  175   LKRLSIQNLTELEYI-----ENGNRMSGS-----TMEELWLINCPNLKGWRRPQ------  218

Query  818   ELLPPFPCISVVDIKQSPNVTWMPLFPTVSEKLYIVTGSIIPLEHTKKV-CSSFKY----  654
               L  F C++ +DI   PN+T MPL P+V + L +   S+  LE T K+  S  +Y    
Sbjct  219   --LLQFHCLTYLDIMSCPNLTSMPLIPSV-KSLVLRNTSMRSLEDTLKMKISVLQYRSSC  275

Query  653   ----------------LKKLWVSEVADLEYMEIEL---FPSLEYLWVYDCRNLRDWGKKG  531
                             LK L + E+  LE++  EL     SL  L + DC  +       
Sbjct  276   PSSSSSSSSTSPIPSQLKSLCIHEIEGLEFLAEELMQNLTSLRQLHIADCPTITTLPCAI  335

Query  530   DHEDAPKALAKLAPSVIEF--------------------EVKNCPKLKLLPQGMRLLSSS  411
              H  + KAL       ++F                    + KN  KL  LP+G++ +++ 
Sbjct  336   QHLTSLKALLICGCEKLDFLADKNKNDMQWQGLRSLKRVQFKNMAKLVSLPKGLQHVTTL  395

Query  410   TKFSISGCP  384
              K  I  CP
Sbjct  396   RKLGIESCP  404



>ref|XP_003612713.1| NBS-containing resistance-like protein [Medicago truncatula]
 gb|AES95671.1| NBS-LRR resistance protein [Medicago truncatula]
Length=1245

 Score = 83.6 bits (205),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 67/242 (28%), Positives = 117/242 (48%), Gaps = 32/242 (13%)
 Frame = -2

Query  1100  GSVLS-WKFASAYMTTIYIKNCPPGKQLPQFHLLPSLGELYF---ESIMVDYIDTTDYED  933
             G  LS W  +   +    + +CP  K LP    LP+L  L+    ES+      +++ + 
Sbjct  897   GRTLSKWLDSLQCLVKFTLSDCPKCKFLPPIDHLPNLKALHLRRLESLEFIAEKSSEPKV  956

Query  932   DNSPSRSELFFPSLKKLWIWNCPNLKGWWKKNDEAIEEELLPPFPCISVVDIKQSPNVTW  753
             D+S S+ E FFP+LK+L I +CP L+ WW+ ND+ +++   P FPCIS ++I+  P +  
Sbjct  957   DSSSSKQE-FFPALKELTISDCPKLESWWE-NDKTLKKNR-PSFPCISKLNIRCCPKLAC  1013

Query  752   MPLFPTVSEKLYIVTGSIIPLEHTKKVCSSFKYLKKLWVSEVADLEYMEIELFPSLEYLW  573
             +PL   + E+L +V  ++  +   ++  +  +   +  +S + +L++M IE         
Sbjct  1014  VPLCTNLDEELVLVDSNVRSM---RETKTETETTVEASLSPLLNLKFMVIERI-------  1063

Query  572   VYDCRNLRDWGKKGDHEDAPKALAKLAPSVIEFEVKNCPKLKLLPQGMRLLSSSTKFSIS  393
                             E  P+   +   S+ E  +++CP LK LPQG + L S     I 
Sbjct  1064  ---------------EESPPQNWLEGFTSLKELHIRDCPNLKSLPQGFKTLCSLQSLCIE  1108

Query  392   GC  387
              C
Sbjct  1109  RC  1110



>ref|XP_003621452.1| Nbs-lrr resistance protein [Medicago truncatula]
 gb|AES77670.1| NBS-LRR type disease resistance protein [Medicago truncatula]
Length=971

 Score = 83.6 bits (205),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 77/313 (25%), Positives = 132/313 (42%), Gaps = 72/313 (23%)
 Frame = -2

Query  1100  GSVLS-WKFASAYMTTIYIKNCPPGKQLPQFHLLPSLGELYFESIMVDYIDTTDYEDDNS  924
             G++ S W  +   +  I + +C   K LP    L     L+ +S+ +  +   +Y   + 
Sbjct  667   GAIFSNWISSLENIVEITLYDCKGLKYLPPMECL-----LFLKSLTIRSLHELEYIYYDE  721

Query  923   PSRSELFFPSLKKLWIWNCPNLKGWWKKNDEAIEEE-------LLPPF-PCISVVDIKQS  768
             P   E FFP LK L+IW C  L+GWWK +D+  ++         +PPF P +S + I + 
Sbjct  722   PCSPETFFPCLKSLFIWKCNKLRGWWKMSDDVNDDNSSHSQNLSIPPFPPSLSNLIIIKC  781

Query  767   PNVTWMPLFPTVSEKLYIVTGSIIPLEHTKKVCSS--------FKYLKKL----------  642
               +T MP FP +++ L   + ++  LE T  + +S        F  LK L          
Sbjct  782   RMLTRMPSFPYLNKILEFYSSNMETLEATLNMVNSKCSIEFPPFSMLKDLTIGKVYLDVK  841

Query  641   -----WVSEVADLEYM-------------------EIELFPSLEYLWVYDCRNLR---DW  543
                  WV  ++ LE++                   EI   PSL+ +  + C +L    DW
Sbjct  842   KLPENWVRNLSSLEHLSFMKLPNQTFQEIGIWFKEEISYLPSLQKIKFWHCSDLMALPDW  901

Query  542   GKKGDHEDAPKALAKLAPSVIEFEVKNCPKLKLLPQGMRLLSSSTKFSISGCPLLKQKYK  363
                               S+    + +C  L  LP+GM  L+      I  CPLL ++ +
Sbjct  902   IFN-------------ISSLQHITIADCINLDSLPEGMPRLAKLQTLEIIRCPLLIEECE  948

Query  362   SKSGQNWPEVANI  324
             +++   W ++++I
Sbjct  949   TQTSATWHKISHI  961



>gb|AET01380.2| disease resistance protein (TIR-NBS-LRR class), putative [Medicago 
truncatula]
Length=2049

 Score = 83.6 bits (205),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 79/309 (26%), Positives = 133/309 (43%), Gaps = 63/309 (20%)
 Frame = -2

Query  1100  GSVLS-WKFASAYMTTIYIKNCPPGKQLPQFHLLPSLGELYFESIMVDYIDTTDYEDDNS  924
             G VLS W  +   +  I +  C   + LP    LP L  L+     ++ ++   YE D +
Sbjct  1721  GMVLSNWISSLTNIVEISLFLCGSLQYLPPLEHLPFLKSLHIS--FLEELEYIYYEQDFA  1778

Query  923   PSRSELFFPSLKKLWIWNCPNLKGWWKKNDE----AIEEEL-LPPFPCISVVDIKQSPNV  759
              +    FFPSL+ L +  C  LKGWW+  D+    +  + L LPPFP +S + I     +
Sbjct  1779  SA----FFPSLECLSLQFCYMLKGWWRMGDDFNNTSCSQNLSLPPFPRLSQLSIIGCLML  1834

Query  758   TWMPLFPTVSEKLYIVTGSI--------IPLE--------------HTKKVCSSFKYLKK  645
             T  P FP +   L +   S+        I LE              H   V  + K + +
Sbjct  1835  TSTPTFPNLENGLELFDSSVETLVATLNIALECLNDIPPLSMLKSLHIDGVSLNVKRIPE  1894

Query  644   LWVSEVADLEYMEIELF-------------------PSLEYLWVYDCRNLRDWGKKGDHE  522
              W+  +  L+ ++I  F                   PSL+ +  ++C +L         E
Sbjct  1895  NWMQNLTSLQLLQINWFSRQAFQEIETWFKDDLKCLPSLQTIAFHNCEDL---------E  1945

Query  521   DAPKALAKLAPSVIEFEVKNCPKLKLLPQGMRLLSSSTKFSISGCPLLKQKYKSKSGQNW  342
               P  +  L+ S+    V +C  L  LP+GM  L++     I GCP+L ++ ++++G+ W
Sbjct  1946  ALPDWICNLS-SLQHLRVYDCINLASLPEGMPRLTNLQTIEIIGCPILVEECQTQTGETW  2004

Query  341   PEVANITTD  315
             P++    +D
Sbjct  2005  PKIGFAFSD  2013



>ref|XP_006382147.1| hypothetical protein POPTR_0006s28850g [Populus trichocarpa]
 gb|ERP59944.1| hypothetical protein POPTR_0006s28850g [Populus trichocarpa]
Length=1066

 Score = 83.2 bits (204),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 93/323 (29%), Positives = 145/323 (45%), Gaps = 48/323 (15%)
 Frame = -2

Query  1193  DGIIENYKKIRLEEQNPKQQPMLTLLPPEDIGSVL--SWKFASAYMTTIYIKNCPPGKQL  1020
             D  I+ Y K+ L+ + P     L  L  E  G +   SW    + +  I++  C   K +
Sbjct  743   DSDIDLYDKM-LQSRQPNSS--LQELRVEGYGGMRFPSWVSNLSNLVRIFVDRCRRLKHI  799

Query  1019  PQFHLLPSLGELYFESIMVDYIDTTDYEDDNSPSRSELFFPSLKKLWIWNCPNLKGWWKK  840
             P    +PSL EL  E +  D ++  D E       S +FFPSLK+L I++C  LKGWWK+
Sbjct  800   PSLDGIPSLEELRIEGL--DDLEYIDSEGVGGKGAS-MFFPSLKRLDIFDCGRLKGWWKR  856

Query  839   ------NDEA----IEEELLPPFPCISVVDIKQSPNVTWMPLFPTVSEKLYIVTGSIIPL  690
                   ND++    IE   +  FP +S + I   PN+T MP F    ++   +T  +   
Sbjct  857   WSRDEMNDDSDESTIEGLRMLCFPRLSSLGISYCPNLTSMP-FSMPLQQTMKMTSPVSSS  915

Query  689   EHTKKVCSSFKYLKKLWVSEVADLEYM-EIEL--FPSLEYLWVYDCRNLRD--WGKKGDH  525
               +         LK L++  + D+E + E+ L    SL+ LW++ C  L+      +G H
Sbjct  916   SSSSSFTRPLSKLKSLYMHSIDDMESLPEVGLQNLSSLQQLWIWGCGRLKSLPLPDQGMH  975

Query  524   EDAPKALAKLAPSVIEFEVKNCPKLKLL----PQGMRLLSSSTKF-SISGCP-LLKQKYK  363
                         S+ + EV  C +LK L     QGM     S +F  I GC   L+ + +
Sbjct  976   ------------SLQKLEVILCRELKSLSESESQGMIPYLPSLQFLRIDGCSEELRGRTR  1023

Query  362   S---KSGQNWP---EVANITTDW  312
                 +S + WP    + +I  DW
Sbjct  1024  GWGKESEEEWPIIKHIPDIVIDW  1046


 Score = 57.0 bits (136),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 42/138 (30%), Positives = 67/138 (49%), Gaps = 7/138 (5%)
 Frame = -2

Query  1553  SVAKLILAKIAPFAQDQIKLLWGLNEELTKLGDLVSHIGAVLLDAEGEKHN--KKTENLL  1380
             ++A+ I+ K+ P A  +I L WG+ ++L+KL   V+ I  VL DAE +      + E+ L
Sbjct  8     NIAEEIVKKLGPLATQEIALWWGVKDQLSKLMSTVTRIKGVLHDAEEQVQKPPAQLEDWL  67

Query  1379  EMLKNIMDEANRLMDYFSPRAKNHR---PNQEDGCCSYFVSHPNPFVWVSDSFMAGKIKS  1209
               L+  + +A  L+D FS   +  R    N+       F S  N  V+     M  K+K 
Sbjct  68    GKLQEAVYDAEDLLDDFSTEVQRKRLMSRNKIPREVRTFFSGSNQLVYGWQ--MGHKVKE  125

Query  1208  INNRLDGIIENYKKIRLE  1155
             +  RLD I+   +K   E
Sbjct  126   LRQRLDEIVSESEKFHFE  143



>ref|XP_003626903.1| NBS resistance protein [Medicago truncatula]
Length=950

 Score = 83.2 bits (204),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 79/309 (26%), Positives = 133/309 (43%), Gaps = 63/309 (20%)
 Frame = -2

Query  1100  GSVLS-WKFASAYMTTIYIKNCPPGKQLPQFHLLPSLGELYFESIMVDYIDTTDYEDDNS  924
             G VLS W  +   +  I +  C   + LP    LP L  L+     ++ ++   YE D +
Sbjct  620   GMVLSNWISSLTNIVEISLFLCGSLQYLPPLEHLPFLKSLHIS--FLEELEYIYYEQDFA  677

Query  923   PSRSELFFPSLKKLWIWNCPNLKGWWKKNDE----AIEEEL-LPPFPCISVVDIKQSPNV  759
              +    FFPSL+ L +  C  LKGWW+  D+    +  + L LPPFP +S + I     +
Sbjct  678   SA----FFPSLECLSLQFCYMLKGWWRMGDDFNNTSCSQNLSLPPFPRLSQLSIIGCLML  733

Query  758   TWMPLFPTVSEKLYIVTGSI--------IPLE--------------HTKKVCSSFKYLKK  645
             T  P FP +   L +   S+        I LE              H   V  + K + +
Sbjct  734   TSTPTFPNLENGLELFDSSVETLVATLNIALECLNDIPPLSMLKSLHIDGVSLNVKRIPE  793

Query  644   LWVSEVADLEYMEIELF-------------------PSLEYLWVYDCRNLRDWGKKGDHE  522
              W+  +  L+ ++I  F                   PSL+ +  ++C +L         E
Sbjct  794   NWMQNLTSLQLLQINWFSRQAFQEIETWFKDDLKCLPSLQTIAFHNCEDL---------E  844

Query  521   DAPKALAKLAPSVIEFEVKNCPKLKLLPQGMRLLSSSTKFSISGCPLLKQKYKSKSGQNW  342
               P  +  L+ S+    V +C  L  LP+GM  L++     I GCP+L ++ ++++G+ W
Sbjct  845   ALPDWICNLS-SLQHLRVYDCINLASLPEGMPRLTNLQTIEIIGCPILVEECQTQTGETW  903

Query  341   PEVANITTD  315
             P++    +D
Sbjct  904   PKIGFAFSD  912



>ref|XP_008363331.1| PREDICTED: putative disease resistance protein RGA3 [Malus domestica]
Length=991

 Score = 82.8 bits (203),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 49/151 (32%), Positives = 77/151 (51%), Gaps = 18/151 (12%)
 Frame = -2

Query  1088  SWKFASAYMTTIYIKNCPPGKQLPQFHLLPSLGELYFESIMVDYIDTTDYEDDNSPSRSE  909
              W  +   +  + + +C   + LP F  LP L  L    +     +  +Y  D S S S 
Sbjct  784   GWLSSLXNIVXLXLXDCXTCQXLPPFDHLPRLKVLXLXGL-----BALEYISDASSSASR  838

Query  908   L-FFPSLKKLWIWNCPNLKGWWKKN-----------DEAIEEELLPPFPCISVVDIKQSP  765
             + FFPSLK ++  NCPNLKGWWK++            + I++  L  FPC+S++ +   P
Sbjct  839   IXFFPSLKXIYJXNCPNLKGWWKQSALIGSPMTEXEXQHIQQSSL-SFPCLSLLXVWXCP  897

Query  764   NVTWMPLFPTVSEKLYIVTGSIIPLEHTKKV  672
             N+T MPL+P +  +L +   S+ PLE T  +
Sbjct  898   NLTSMPLYPHLEXELXLXNTSLKPLEETMMI  928


 Score = 54.3 bits (129),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 42/138 (30%), Positives = 72/138 (52%), Gaps = 6/138 (4%)
 Frame = -2

Query  1553  SVAKLILAKIAPFAQDQIKLLWGLNEELTKLGDLVSHIGAVLLDAEGEKHNKKTENLLEM  1374
             ++A+ I+  +   A  +  LL+G+ +EL KL   V+ I  VLLDAE +K N +    L+ 
Sbjct  8     NIAEGIIGXLQNHAIQEXGLLYGVKDELKKLEKTVTKIKNVLLDAEEKKANHEVTEWLKS  67

Query  1373  LKNIMDEANRLMDYFSPRAKNHR---PNQEDGCCSYFVSHPNPFVWVSDSFMAGKIKSIN  1203
             L++++ +A+ L+D F   A+  +    N+       F S  N  V+     M  KIK I 
Sbjct  68    LEDVVYDADDLLDEFYTEARWRQMVIGNKIXKQVRLFFSSSNQLVFRLK--MGHKIKEIR  125

Query  1202  NRLDGIIENYKKIRLEEQ  1149
               L+ +IE  ++  L+E+
Sbjct  126   ETLN-VIETDRRFHLDER  142



>gb|KGN45100.1| hypothetical protein Csa_7G425920 [Cucumis sativus]
Length=805

 Score = 82.4 bits (202),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 71/244 (29%), Positives = 112/244 (46%), Gaps = 26/244 (11%)
 Frame = -2

Query  1064  MTTIYIKNCPPGKQLPQFHLLPSLGELYFESIMVDYIDTTDYEDDNSPSRSELFFPSLKK  885
             +  I +++C   + LPQF   P L  L  E++      + +Y D+N+   S  FFPSL+K
Sbjct  392   LVNIELQSCEKLQHLPQFDQFPFLKHLLLENL-----PSIEYIDNNNSLSSSTFFPSLEK  446

Query  884   LWIWNCPNLKGWWKKNDEAIEEELLPPFPCI----SVVDIKQSPNVTWMPLFP-------  738
             L I   PNLKGWWK             FP I    S +DI   P +  +P  P       
Sbjct  447   LTIMTMPNLKGWWKGETPPESARYSALFPTILHHLSRLDISNCPQLASIPQHPPLRSLAL  506

Query  737   -TVSEKLYIVTGSIIPLEHTKKVCSSFKYLKKLWVSEVA--DLEYMEIELFPS---LEYL  576
               VS +L+ +   +I +  T    SS   L KL +  +   DLE++  ELF S   LE  
Sbjct  507   NDVSVQLFDM---VIKMATTPAADSS-SALSKLSILHIQNIDLEFLPEELFGSTTDLEIF  562

Query  575   WVYDCRNLRDWGKKGDHEDAPKALAKLAPSVIEFEVKNCPKLKLLPQGMRLLSSSTKFSI  396
              V +C+NL+        ED    L K   ++    + + P+L+ L + ++ +++  +  +
Sbjct  563   TVVNCKNLQMSSSHLVDEDNDGVLGKKLGNLHSLGIFDMPQLEYLWKELKYMTTLERLDL  622

Query  395   SGCP  384
               CP
Sbjct  623   YNCP  626



>ref|XP_004136128.1| PREDICTED: putative disease resistance protein RGA4-like [Cucumis 
sativus]
Length=1480

 Score = 82.4 bits (202),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 71/244 (29%), Positives = 112/244 (46%), Gaps = 26/244 (11%)
 Frame = -2

Query  1064  MTTIYIKNCPPGKQLPQFHLLPSLGELYFESIMVDYIDTTDYEDDNSPSRSELFFPSLKK  885
             +  I +++C   + LPQF   P L  L  E++      + +Y D+N+   S  FFPSL+K
Sbjct  778   LVNIELQSCEKLQHLPQFDQFPFLKHLLLENL-----PSIEYIDNNNSLSSSTFFPSLEK  832

Query  884   LWIWNCPNLKGWWKKNDEAIEEELLPPFPCI----SVVDIKQSPNVTWMPLFP-------  738
             L I   PNLKGWWK             FP I    S +DI   P +  +P  P       
Sbjct  833   LTIMTMPNLKGWWKGETPPESARYSALFPTILHHLSRLDISNCPQLASIPQHPPLRSLAL  892

Query  737   -TVSEKLYIVTGSIIPLEHTKKVCSSFKYLKKLWVSEVA--DLEYMEIELFPS---LEYL  576
               VS +L+ +   +I +  T    SS   L KL +  +   DLE++  ELF S   LE  
Sbjct  893   NDVSVQLFDM---VIKMATTPAADSS-SALSKLSILHIQNIDLEFLPEELFGSTTDLEIF  948

Query  575   WVYDCRNLRDWGKKGDHEDAPKALAKLAPSVIEFEVKNCPKLKLLPQGMRLLSSSTKFSI  396
              V +C+NL+        ED    L K   ++    + + P+L+ L + ++ +++  +  +
Sbjct  949   TVVNCKNLQMSSSHLVDEDNDGVLGKKLGNLHSLGIFDMPQLEYLWKELKYMTTLERLDL  1008

Query  395   SGCP  384
               CP
Sbjct  1009  YNCP  1012


 Score = 54.3 bits (129),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 39/141 (28%), Positives = 72/141 (51%), Gaps = 7/141 (5%)
 Frame = -2

Query  1565  STAISVAKLILAKIAPFAQDQIKLLWGLNEELTKLGDLVSHIGAVLLDAEGEKH-NKKTE  1389
             S   +VA  ++ K+   A  ++  LWG+N+EL KL +++S I AVLLDAE ++  +   +
Sbjct  4     SILFNVAANVITKLGSSALRELGSLWGVNDELGKLQNILSAIKAVLLDAEEQQSVSHAVK  63

Query  1388  NLLEMLKNIMDEANRLMDYFSPRAKNHRPNQEDGCCS----YFVSHPNPFVWVSDSFMAG  1221
             + +  L+++  + + L+D FS      +   +D   +     F S  N   +     M+ 
Sbjct  64    DWISKLRDVFYDVDDLIDEFSYETLRRQVLTKDRTITKQVCIFFSKSNQVSFGHK--MSQ  121

Query  1220  KIKSINNRLDGIIENYKKIRL  1158
             KIK +  +LD I  +  ++ L
Sbjct  122   KIKQVREKLDAIANDKTQLHL  142


 Score = 53.9 bits (128),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 57/247 (23%), Positives = 103/247 (42%), Gaps = 25/247 (10%)
 Frame = -2

Query  1064  MTTIYIKNCPPGKQLPQFHLLPSLGELYFESIMVDYIDTTDYEDDNSP-SRSELFFPSLK  888
             + +I + +C   + LPQF   P L  LY + +        +Y DD+SP S S  FFPSL+
Sbjct  1239  LVSIKLCHCEKLEHLPQFDQFPYLKNLYLKDL-----SNIEYIDDSSPVSSSTTFFPSLE  1293

Query  887   KLWIWNCPNLKGWWKKN-----DEAIEEELLPPFPCISVVDIKQSPNVTWMPLFPTVSEK  723
             KL I   P LKGW +              L      +S + I   P + ++P  P +   
Sbjct  1294  KLRIKKMPKLKGWRRGEIASNYSAQYTASLATALHQLSELWILDCPQLAFIPQHPLL-RS  1352

Query  722   LYIVTGSIIPLEHTKKVCSSFK----YLKKLWVSEVADLEYMEIELFP--------SLEY  579
             L I    +   +   ++ ++          L      +++ ++I+  P         LE 
Sbjct  1353  LRIRGVGLQVFDRVVRMATNLAADSSSSSTLSKLSSLEIDNIDIKFLPEVLNCNMKDLES  1412

Query  578   LWVYDCRNLRDWGKKGDHEDAPKALA-KLAPSVIEFEVKNCPKLKLLPQGMRLLSSSTKF  402
             L + +C++L        +E+  + L  K   S+      + PKL+ LP+G+  +++    
Sbjct  1413  LTIRNCKHLLMSSSHLVYEEDGRLLYWKELSSLRRLSFWDIPKLEYLPKGLEYMTAIKTL  1472

Query  401   SISGCPL  381
              +  C +
Sbjct  1473  RLINCEI  1479



>gb|KHG28036.1| Putative disease resistance RGA1 [Gossypium arboreum]
Length=256

 Score = 79.0 bits (193),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 68/251 (27%), Positives = 111/251 (44%), Gaps = 51/251 (20%)
 Frame = -2

Query  935  DDNSPSRSE----LFFPSLKKLWIWNCPNLKGWWKKND----------EAIEEELLPPFP  798
            DDNSP  S+     FFPSLK L +W+CPN+K WW+               +       FP
Sbjct  2    DDNSPKGSQGEAQSFFPSLKVLCLWDCPNMKSWWRTTKPIDDDSDEDDTTVMGTSTMAFP  61

Query  797  CISVVDIKQSPNVTWMPLFPTVSEKLYIVTGSIIPLEHTKKV------------CSSFKY  654
            C+S + I   P  T MPL+P++ + L +V  S  PL+ T K+                  
Sbjct  62   CLSSLTISNCP-FTSMPLYPSLIDDLRLVGTSSRPLKQTMKMNITSSTPSSSTSSLPLSK  120

Query  653  LKKLWVSEVADLEYME----IELFPSLEYLWVYDCRNLRDWGKKGDHEDAPKALAKL---  495
            LK L +  +  L+       ++   SL+ L +++C+ +     +G   +A K L+ L   
Sbjct  121  LKSLTLDNIEGLDTHTLDECLQHLTSLKDLEIWNCKEV---DLEGMQWEALKNLSGLEIL  177

Query  494  -APSVIE-------------FEVKNCPKLKLLPQGMRLLSSSTKFSISGCPLLKQKYKSK  357
              P ++                + + P L  LP  MR L+S     I+  P L+++ +  
Sbjct  178  NIPKLVSLPRGLQHLTNLRVLRLTDLPNLTSLPDEMRCLTSLEYLQITEVPWLEERCRED  237

Query  356  SGQNWPEVANI  324
            SG +W ++A+I
Sbjct  238  SGADWHKIAHI  248



>ref|XP_008355462.1| PREDICTED: putative disease resistance protein RGA3 [Malus domestica]
 ref|XP_008355463.1| PREDICTED: putative disease resistance protein RGA3 [Malus domestica]
Length=435

 Score = 80.9 bits (198),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 81/315 (26%), Positives = 132/315 (42%), Gaps = 65/315 (21%)
 Frame = -2

Query  1088  SWKFASAYMTTIYIKNCPPGKQLPQFHLLPSLGELYFESI-MVDYIDTTDYEDDNSPSRS  912
             SW  +   +  + +  C   + LP     PSL  L  E    ++YI  T   +    S S
Sbjct  121   SWFSSLINLVHLTLWGCHRCQHLPPLDHFPSLKFLKLEEFEKLEYISDTSSSN----SMS  176

Query  911   ELFFPSLKKLWIWNCPNLKGWWKKNDE-------AIEEELLPPFPCISVVDIKQSPNVTW  753
             +    SL+ LW+ NCP LKGWW+ +         + E   LP FP +S + I   PN+T 
Sbjct  177   DEMMTSLECLWVVNCPVLKGWWRAHTHNNASSSSSTENLSLPSFPGLSTLWISNCPNLTC  236

Query  752   MPLFPTVS------------EKLYIVTGSIIPLEHTKKV--------CSSFKYLKKLWVS  633
             MPL+P V             + L++   S I  +    V         S   +L    + 
Sbjct  237   MPLYPNVERIDLNGCSSKVVDSLFVRGASDITHDVGVDVSASSSSPHLSKLTHLSLFGIE  296

Query  632   EVADLEYME---IELFPSLEYLWVYDCRNLRDWGKK--GDHED-----------------  519
             ++A L+ ++   I+ FP L  L  +   NL    K   GD+ D                 
Sbjct  297   DLAVLQSLQSPCIKDFPHLALLPYHGMGNLTSLQKLTIGDYSDLTLPPDVVINLPSLQSL  356

Query  518   ----------APKALAKLAPSVIEFEVKNCPKLKLLPQGMRLLSSSTKFSISGCPLLKQK  369
                        P+ ++ L  S+    +++CP L  LP+G+  L +  +  I GC +L ++
Sbjct  357   TILSFPNLVSLPEEISNLT-SLQHLAIESCPNLASLPEGICRLPNLNRLQIWGCNMLSER  415

Query  368   YKSKSGQNWPEVANI  324
              K + G +WP++A+I
Sbjct  416   CKKEIGDDWPKIAHI  430



>ref|XP_004245923.1| PREDICTED: putative disease resistance protein RGA4 [Solanum 
lycopersicum]
Length=988

 Score = 81.6 bits (200),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 78/268 (29%), Positives = 122/268 (46%), Gaps = 37/268 (14%)
 Frame = -2

Query  1064  MTTIYIKNCPPGKQLPQFHLLPSLGELYFE--SIMVDYIDTTDYEDDNSPSRSELFFPSL  891
             + +I IK+C     LP F  LP L  L  +  S+ V+Y++  D     S  R    FPSL
Sbjct  731   VISIRIKSCKNCLCLPPFGELPCLESLELQNGSVEVEYVEEDDVHSRFSTRRR---FPSL  787

Query  890   KKLWIWNCPNLKGWWKKNDEAIEEELLPPFPCISVVDIKQSPNVTWMPLFPTVSE-KLYI  714
             KKL IW   NLKG  K+  E         FP +  + I   P    + +FPT+S  K   
Sbjct  788   KKLRIWFFRNLKGLVKEEGE-------EKFPMLEEMAILHCP----LFVFPTLSSVKKLE  836

Query  713   VTGSIIPLEHTKKVCSSFKYLKKLWVSEVADLEYMEIELFPSL---EYLWVYDCRNLRDW  543
             V G+I          S+   L  L +        +  E+F SL   EYL  +D +NL++ 
Sbjct  837   VHGNIKA--RGLSSISNLSTLTSLRIGANYGSTSLPEEMFTSLTYLEYLSFFDFKNLKEL  894

Query  542   GKKGDHEDAPKALA---------------KLAPSVIEFEVKNCPKLKLLPQGMRLLSSST  408
                    +A K L                +   S+ +  VK C  LK LP+G++ L++ T
Sbjct  895   PTSLTSLNALKRLQIESCDSLESFPEQGLEGLTSLTQLFVKYCKMLKRLPEGLQHLTALT  954

Query  407   KFSISGCPLLKQKYKSKSGQNWPEVANI  324
                ++GCP ++++   + G++W ++A+I
Sbjct  955   DLGVTGCPEVEKRCDKEIGEDWHKIAHI  982



>ref|XP_011031341.1| PREDICTED: putative disease resistance protein RGA4 isoform X2 
[Populus euphratica]
Length=918

 Score = 81.6 bits (200),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 52/132 (39%), Positives = 74/132 (56%), Gaps = 14/132 (11%)
 Frame = -2

Query  1088  SWKFASAYMTTIYIKNCPPGKQLPQFHLLPSLGELYFESIMVDYIDTTDYEDDNSPSRSE  909
             SW    + +  I+++ C   K +P  H +P L EL  E +  D ++  D E D     S 
Sbjct  777   SWVSNLSNLVRIHLERCRRLKDIPPLHGIPYLEELSIERL--DDLEYIDSEGDGGKGVS-  833

Query  908   LFFPSLKKLWIWNCPNLKGWWKK------NDEA----IEEELLP-PFPCISVVDIKQSPN  762
             +FFPSLK L I++CP LKGWWK+      ND++    IEE L+   FP +S + I +  N
Sbjct  834   MFFPSLKTLNIFDCPRLKGWWKRRSRDEINDDSDESTIEEGLIVLCFPRLSSLFISECAN  893

Query  761   VTWMPLFPTVSE  726
             +T MPLFPT+ E
Sbjct  894   LTSMPLFPTLDE  905


 Score = 57.0 bits (136),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 45/158 (28%), Positives = 80/158 (51%), Gaps = 8/158 (5%)
 Frame = -2

Query  1553  SVAKLILAKIAPFAQDQIKLLWGLNEELTKLGDLVSHIGAVLLDAE--GEKHNKKTENLL  1380
             S+ + I+ K+   A  ++ L WG+ ++L KL   V+ I AV+ D E   +K N + E+ L
Sbjct  8     SILEEIIKKLGSPAFQEVALWWGVGDQLMKLSGTVTRIKAVIQDVEEQAQKQNHQIEDWL  67

Query  1379  EMLKNIMDEANRLMDYFSPRA--KNHRPNQE-DGCCSYFVSHPNPFVWVSDSFMAGKIKS  1209
               L+  + +A  L+D FS +   K   P +        F S  N FV+     M  ++K 
Sbjct  68    MKLREAVYDAEDLLDDFSTQVLRKQLMPGKRVSREVRLFFSRSNQFVY--GLRMGHRVKI  125

Query  1208  INNRLDGIIENYKKIRLEEQNPKQQPMLTLLPPEDIGS  1095
             +  RLDGI  + KK+  + ++ +++  LT++  +   S
Sbjct  126   LRERLDGIEIDSKKLNFDVRD-EERASLTMVREQTTSS  162



>ref|XP_008389184.1| PREDICTED: disease resistance protein RGA2-like isoform X1 [Malus 
domestica]
 ref|XP_008389185.1| PREDICTED: disease resistance protein RGA2-like isoform X1 [Malus 
domestica]
Length=1125

 Score = 81.6 bits (200),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 77/330 (23%), Positives = 128/330 (39%), Gaps = 92/330 (28%)
 Frame = -2

Query  1043  NCPPGKQLPQFHLLPSLGELYFESIMVDYIDTTDYEDDNSPSRSELFFPSLKKLWIWNCP  864
              C   + LP     PSL   Y + I  + ++    +  +  S S+    SL+ LW+ +CP
Sbjct  790   GCHRCQHLPPLDHFPSLK--YLDLIGFEKLEYISDDTSSGNSMSDEMMTSLEGLWVESCP  847

Query  863   NLKGWWKKNDE-------AIEEELLPPFPCISVVDIKQSPNVTWMPLFPTVS--------  729
              LKGWW+ +         + E   LP FP +S + I   PN+T MPL+P V         
Sbjct  848   VLKGWWRAHTHNNASSSSSTENLSLPSFPGLSTLWISNCPNLTCMPLYPNVERIDLNGCS  907

Query  728   ----EKLYIVTGSIIPLEHTKKVCSS-----FKYLKKLWVSEVADLE-------------  615
                 + L++   S I  +    V +S     F  L  L +S + DLE             
Sbjct  908   SKVVDSLFVRGASDITHDVGVDVSASSSSPHFFKLTHLSLSNIEDLECVTSLGMGNVPSL  967

Query  614   ---------------YMEIELFPSLEYLWVYDCRNLRDW---------------GKKGDH  525
                            Y  +    S   L V +C NL                  G   + 
Sbjct  968   QSLDIKDCPNLALLPYHGMGNLASFRELTVTNCSNLTSMLEGIANLTSLQKLAIGXXSBL  1027

Query  524   EDAPKALAKL----APSVIEF-------------------EVKNCPKLKLLPQGMRLLSS  414
                P+ +  L    + +++ F                   E+++CP L  LP+G+R L +
Sbjct  1028  TLXPEVVVNLPSLQSLTIVSFPNLVSLPEEISNLTLLQNLEIQSCPNLASLPEGIRRLPN  1087

Query  413   STKFSISGCPLLKQKYKSKSGQNWPEVANI  324
                  I  CP+L ++ + ++G++WP++A+I
Sbjct  1088  LNTLGIWRCPVLSERCEKETGEDWPKIAHI  1117


 Score = 55.5 bits (132),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 38/124 (31%), Positives = 65/124 (52%), Gaps = 6/124 (5%)
 Frame = -2

Query  1553  SVAKLILAKIAPFAQDQIKLLWGLNEELTKLGDLVSHIGAVLLDAEGEKHNKKTENLLEM  1374
             +VA  I+ ++   A  +I L+WG+ +EL KL ++V+   AVLLDAE ++   + +  LE 
Sbjct  8     NVAARIIGRLGSLAFQEIGLIWGVQDELHKLLEIVAGFQAVLLDAEKKQTINEVKVWLES  67

Query  1373  LKNIMDEANRLMDYFSPRAKNHR----PNQEDGCCSYFVSHPNPFVWVSDSFMAGKIKSI  1206
             +++ + EA+ L+D F+  A+  +      +       F S  N   +     M  KIK +
Sbjct  68    VEDAVYEADDLLDEFNTEAQQRQMMCGNTKMSKKVRLFFSSSNQLAFRLK--MGHKIKDL  125

Query  1205  NNRL  1194
             N RL
Sbjct  126   NKRL  129



>ref|XP_008389186.1| PREDICTED: disease resistance protein RGA2-like isoform X2 [Malus 
domestica]
 ref|XP_008389187.1| PREDICTED: disease resistance protein RGA2-like isoform X2 [Malus 
domestica]
Length=1123

 Score = 81.6 bits (200),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 77/330 (23%), Positives = 128/330 (39%), Gaps = 92/330 (28%)
 Frame = -2

Query  1043  NCPPGKQLPQFHLLPSLGELYFESIMVDYIDTTDYEDDNSPSRSELFFPSLKKLWIWNCP  864
              C   + LP     PSL   Y + I  + ++    +  +  S S+    SL+ LW+ +CP
Sbjct  790   GCHRCQHLPPLDHFPSLK--YLDLIGFEKLEYISDDTSSGNSMSDEMMTSLEGLWVESCP  847

Query  863   NLKGWWKKNDE-------AIEEELLPPFPCISVVDIKQSPNVTWMPLFPTVS--------  729
              LKGWW+ +         + E   LP FP +S + I   PN+T MPL+P V         
Sbjct  848   VLKGWWRAHTHNNASSSSSTENLSLPSFPGLSTLWISNCPNLTCMPLYPNVERIDLNGCS  907

Query  728   ----EKLYIVTGSIIPLEHTKKVCSS-----FKYLKKLWVSEVADLE-------------  615
                 + L++   S I  +    V +S     F  L  L +S + DLE             
Sbjct  908   SKVVDSLFVRGASDITHDVGVDVSASSSSPHFFKLTHLSLSNIEDLECVTSLGMGNVPSL  967

Query  614   ---------------YMEIELFPSLEYLWVYDCRNLRDW---------------GKKGDH  525
                            Y  +    S   L V +C NL                  G   + 
Sbjct  968   QSLDIKDCPNLALLPYHGMGNLASFRELTVTNCSNLTSMLEGIANLTSLQKLAIGXXSBL  1027

Query  524   EDAPKALAKL----APSVIEF-------------------EVKNCPKLKLLPQGMRLLSS  414
                P+ +  L    + +++ F                   E+++CP L  LP+G+R L +
Sbjct  1028  TLXPEVVVNLPSLQSLTIVSFPNLVSLPEEISNLTLLQNLEIQSCPNLASLPEGIRRLPN  1087

Query  413   STKFSISGCPLLKQKYKSKSGQNWPEVANI  324
                  I  CP+L ++ + ++G++WP++A+I
Sbjct  1088  LNTLGIWRCPVLSERCEKETGEDWPKIAHI  1117


 Score = 55.5 bits (132),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 38/124 (31%), Positives = 65/124 (52%), Gaps = 6/124 (5%)
 Frame = -2

Query  1553  SVAKLILAKIAPFAQDQIKLLWGLNEELTKLGDLVSHIGAVLLDAEGEKHNKKTENLLEM  1374
             +VA  I+ ++   A  +I L+WG+ +EL KL ++V+   AVLLDAE ++   + +  LE 
Sbjct  8     NVAARIIGRLGSLAFQEIGLIWGVQDELHKLLEIVAGFQAVLLDAEKKQTINEVKVWLES  67

Query  1373  LKNIMDEANRLMDYFSPRAKNHR----PNQEDGCCSYFVSHPNPFVWVSDSFMAGKIKSI  1206
             +++ + EA+ L+D F+  A+  +      +       F S  N   +     M  KIK +
Sbjct  68    VEDAVYEADDLLDEFNTEAQQRQMMCGNTKMSKKVRLFFSSSNQLAFRLK--MGHKIKDL  125

Query  1205  NNRL  1194
             N RL
Sbjct  126   NKRL  129



>ref|XP_008375181.1| PREDICTED: putative disease resistance protein RGA3 [Malus domestica]
Length=936

 Score = 81.3 bits (199),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 75/267 (28%), Positives = 116/267 (43%), Gaps = 43/267 (16%)
 Frame = -2

Query  1106  DIGSVLSWKFASAYMTTIYIKN-----CPPGKQLPQFHLLPSLGELYFESIM-VDYIDTT  945
             D G V   +FAS + + I I +     C   + LP    LPSL  L    +  ++YI   
Sbjct  653   DYGGV---RFASWFSSLINIVHLTLVSCERCQHLPPLDNLPSLKILVLSRLKKLEYISAN  709

Query  944   DYEDDNSPSRSEL-FFPSLKKLWIWNCPNLKGWWKKNDEAIEEELLPPFPCISVVDIKQS  768
             +  +  S     + FFPSL+ L + +CP LKGWW+    A   +    FPC+S + I   
Sbjct  710   ESSNSKSDEMMRMSFFPSLEYLCLESCPVLKGWWR----AHTHDSASSFPCLSELTIMSC  765

Query  767   PNVTWMPLFPTVSEKLYIVTGS-IIP--------LEHTKKV-------CSSFKYLKKLWV  636
             PN+T MPL+P V   L   T S ++P        + H   +             L  L +
Sbjct  766   PNLTSMPLYPNVVAILLDQTSSKVVPSLVRGASDITHDVGIDVSVSSSSPHLSKLTHLTL  825

Query  635   SEVADLEYMEIELFP---SLEYLWVYDCRNLRDWGKKGDHEDAPKALAKLAPSVIEFEVK  465
               + DLE +  E      SL+   +  C NL            P+ +A L  ++    ++
Sbjct  826   YRIEDLECISSEGMGNLISLQSFSIQHCPNLASL---------PEGIASLT-ALQSLTIE  875

Query  464   NCPKLKLLPQGMRLLSSSTKFSISGCP  384
             +CP L  LP+G+  L++    +I  CP
Sbjct  876   DCPNLAALPEGIVGLTALQSLTIEDCP  902



>gb|KEH25217.1| NBS-LRR disease resistance protein [Medicago truncatula]
Length=1050

 Score = 80.9 bits (198),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 73/297 (25%), Positives = 133/297 (45%), Gaps = 53/297 (18%)
 Frame = -2

Query  1115  PPEDIGSVLSWKFASAYMTTIYIKNCPPGKQLPQFHLLPSLGELYFESIMVDYIDTTDYE  936
             P +   + LS  +  ++++     NC   K LP    LP     + +S+ +  +   +Y 
Sbjct  763   PGDKFSNWLSDIYCLSHISLFGFDNC---KSLPPLEHLP-----FLKSLEISSMKVLEYI  814

Query  935   DDNSPSRSEL-FFPSLKKLWIWNCPNLKGWWKKNDE-AIEEELLPPFPCISVVDIKQSPN  762
                    +E+ FFPSL++L    C N KGW +   + ++++    PF  +S + I + P 
Sbjct  815   HHKELFHTEVTFFPSLERLKFSGCKNFKGWKRTEGQVSVDKHSQRPFVRLSQLIINKCPK  874

Query  761   VTWMPLFPTVSEKLYIVTGSIIPLEHTKKV--------CSSFKYLK------------KL  642
             +T +P FP V E+L +    + PL+ T  +         S  K LK              
Sbjct  875   LTDLPTFPNV-EELQLCESMVKPLKETLDIASSSSSAPLSKLKSLKIEGKLPDICVLPSR  933

Query  641   WVSEVADLEYMEI-----------ELFPSLEYLWVYDCRNLRDWGKKGDHEDAPKALAKL  495
             W   +  LE++EI           + FPSL+ + +Y C          D +  P  +  +
Sbjct  934   WKQNLTSLEHLEIGDVDNLDIWFEDNFPSLKKVVIYGC----------DLKALPSKMCDM  983

Query  494   APSVIEFEVKNCPKLKLLPQGMRLLSSSTKFSISGCPLLKQKYKSKSGQNWPEVANI  324
               S+   ++  C KL  LP+ M  L++     I  CPLL ++ +S++G +WP+++++
Sbjct  984   L-SLQHIKMMGCHKLASLPKEMVNLTNLVTLEIWDCPLLVERCQSETGVDWPQISHV  1039



>ref|XP_003612767.1| Cc-nbs-lrr resistance protein [Medicago truncatula]
 gb|AES95725.1| CC-NBS-LRR resistance protein, putative [Medicago truncatula]
Length=1078

 Score = 80.9 bits (198),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 68/244 (28%), Positives = 110/244 (45%), Gaps = 26/244 (11%)
 Frame = -2

Query  1100  GSVLSWKFASAY-MTTIYIKNCPPGKQLPQFHLLPSLGELYFESIMVDYIDTTDYEDDNS  924
             G  LS  F S + +    + +CP  + LP    LP L  L    +        + +  N 
Sbjct  732   GHTLSDWFGSLHCLVKFTLNDCPKCEFLPPMDELPHLKVLQLRRLDSLKFIAKNNQVGNF  791

Query  923   PSRSE--LFFPSLKKLWIWNCPNLKGWWKKNDEAIEEELLPPFPCISVVDIKQSPNVTWM  750
             PS +   LFFPSLK+L I +CPNL  WW   +  I +   P F CIS ++++  P +  M
Sbjct  792   PSFTTPILFFPSLKELTISDCPNLNSWW---ETEIWDNDRPSFSCISKLNVQYCPKLACM  848

Query  749   PLFPTVSEKLYIVTGSIIPLEHTKKVCSSFKYLKKLWVSEVADLEYMEIELFPSLEYLWV  570
             PL+P + ++L +V  ++  +  T     S         +E  +    + + F  L+ + +
Sbjct  849   PLYPNLDDELVLVESNVRSMRDTMHYADS---------TESTENSNSQSQPFSKLKSMVI  899

Query  569   YDCRNLRDWGKKGDHEDAPKALAKLAPSVIEFEVKNCPKLKLLPQGMRLLSSSTKFSISG  390
                       ++ D +  PK   K   S+ E  +++C  LK LP+G R LSS    +I  
Sbjct  900   ----------ERID-QSPPKRWLKNFISLKELHIRDCFHLKSLPEGFRSLSSLETLTIER  948

Query  389   CPLL  378
             C  L
Sbjct  949   CQQL  952



>ref|XP_003638275.1| Cc-nbs-lrr resistance protein, partial [Medicago truncatula]
Length=340

 Score = 78.6 bits (192),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 70/284 (25%), Positives = 120/284 (42%), Gaps = 61/284 (21%)
 Frame = -2

Query  1040  CPPGKQLPQFHLLPSLGELYFESIMVDYIDTTDYEDDNSPSRSELFFPSLKKLWIWNCPN  861
             C   + LP    LP L  L+     ++ ++   YE D + +    FFPSL+ L +  C  
Sbjct  64    CGSLQYLPPLERLPFLKSLHIS--FLEELEYIYYEQDFTSA----FFPSLESLSLQFCYK  117

Query  860   LKGWWKKNDE---AIEEELLPPFPCISVVDIKQSPNVTWMPLFPTVSEKL---------Y  717
             LKGWW+  D+     +   LPPFP +  + I     +T+MP FP +   L          
Sbjct  118   LKGWWRIGDDFNNCSQNLSLPPFPRLCQLSIIGCLMLTFMPTFPNLENGLELYNSRAETL  177

Query  716   IVTGSIIPLE--------------HTKKVCSSFKYLKKLWVSEVADLEYMEIELF-----  594
             I T +   +E              H   V    K +  +W+  +  L+ ++I  F     
Sbjct  178   IATLNTAAVERMNDFPPLSMLKSLHIDGVRLDVKSIPNVWMKNLTSLQLLQINWFSRQAF  237

Query  593   --------------PSLEYLWVYDCRNLRDWGKKGDHEDAPKALAKLAPSVIEFEVKNCP  456
                           PSL+ +  ++C +L         E  P  +  L+ S+    V +C 
Sbjct  238   QQIETWFKDDLKYLPSLQTIAFHNCEDL---------EALPDWICNLS-SLQHLRVYDCI  287

Query  455   KLKLLPQGMRLLSSSTKFSISGCPLLKQKYKSKSGQNWPEVANI  324
              L  LP+GM  L++     I GCP+L ++ ++++G+ W + A++
Sbjct  288   NLASLPEGMLNLTNLQTLEIIGCPILVEECQTQTGETWDKTAHV  331



>gb|KDP37636.1| hypothetical protein JCGZ_07835 [Jatropha curcas]
Length=1106

 Score = 80.5 bits (197),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 85/309 (28%), Positives = 127/309 (41%), Gaps = 68/309 (22%)
 Frame = -2

Query  1169  KIRLEEQNPKQQPMLTLLPPEDIGSVL--SWKFASAYMTTIYIKNCPPGKQLPQFHLLPS  996
             +I LEE  P +   L  L     G V    W      +  + I NC   K  P     PS
Sbjct  757   EISLEELQPHRN--LKWLVISGCGKVKFPGWISTLCCLVDLQINNCTNCKCFPPLDHFPS  814

Query  995   LGELYFESIM-VDYIDTTDYEDDNSPSRSELFFPSLKKLWIWNCPNLKGWWKKNDEAIEE  819
             L  L  +++  ++YI     E+ N  S S     ++++LW+ NCPNLKGW +        
Sbjct  815   LKRLSIQNLTELEYI-----ENGNRMSGS-----TMEELWLINCPNLKGWRRPQ------  858

Query  818   ELLPPFPCISVVDIKQSPNVTWMPLFPTVSEKLYIVTGSIIPLEHTKKV-CSSFKY----  654
               L  F C++ +DI   PN+T MPL P+V + L +   S+  LE T K+  S  +Y    
Sbjct  859   --LLQFHCLTYLDIMSCPNLTSMPLIPSV-KSLVLRNTSMRSLEDTLKMKISVLQYRSSC  915

Query  653   ----------------LKKLWVSEVADLEYMEIEL---FPSLEYLWVYDCRNLRDWGKKG  531
                             LK L + E+  LE++  EL     SL  L + DC  +       
Sbjct  916   PSSSSSSSSTSPILSQLKSLCIREIEGLEFLAEELMQNLTSLRQLHIADCPTITTLPCAI  975

Query  530   DHEDAPKALAKLAPSVIEF--------------------EVKNCPKLKLLPQGMRLLSSS  411
              H  + KAL       ++F                    + KN  KL  LP+G++ +++ 
Sbjct  976   QHLTSLKALLICGCEKLDFLADKNENGMQWQCLRSLKRVQFKNMAKLVSLPKGLQHVTTL  1035

Query  410   TKFSISGCP  384
              K  I  CP
Sbjct  1036  RKLGIESCP  1044



>gb|KEH40164.1| disease resistance protein RGA4 [Medicago truncatula]
Length=1009

 Score = 80.5 bits (197),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 69/278 (25%), Positives = 121/278 (44%), Gaps = 46/278 (17%)
 Frame = -2

Query  1088  SWKFASAYMTTIYIKNCPPGKQLPQFHLLPSLGELYFESIMVDYIDTTDYEDDNSPSRSE  909
             SW    + + T+ + +C   ++      LP L +L    + V Y+D  ++ +        
Sbjct  749   SWIRTLSNLVTLEVGSCNHCERFSSLGKLPYLKKLILFGVSVKYLDDNEFHNGMEVR---  805

Query  908   LFFPSLKKLWIWNCPNLKGWWK-KNDEAIEEELLPPFPCISVVDIKQSPNVTWMPLFPTV  732
               FPSL+ L +   PNL+G  K + DE         FPC+S+++I   P +  +P  P+V
Sbjct  806   -IFPSLETLLLRGMPNLEGLLKVERDET--------FPCLSILEIDNCPKLE-LPCLPSV  855

Query  731   SE---------------------KLYIVTGSIIPLEHTKKVCSSFKYLKKLWVSEVADLE  615
              +                      L +  G  I     K+   +F  L+ L V    +L+
Sbjct  856   RDLYVDECNNKMLKSISSFYGLTTLTLYRGEGIT-SFPKEFFRNFTSLQTLSVGNFQNLK  914

Query  614   YMEIELFP-SLEYLWVYDCRNLRDWGKKGDHEDAPKALAKLAPSVIEFEVKNCPKLKLLP  438
              +  E F  +LE+L +  C  L         E  P+ +     S+    +  C +LK LP
Sbjct  915   ELPNERFNLALEHLQISCCCEL---------EYLPEKIWGGLQSLQSMRISYCERLKCLP  965

Query  437   QGMRLLSSSTKFSISGCPLLKQKYKSKSGQNWPEVANI  324
              G+R L++    +I GCP L ++ K  +G++W ++A+I
Sbjct  966   DGIRHLTALDSLTIVGCPTLTERCKEGTGEDWDKIAHI  1003



>ref|XP_003612744.1| hypothetical protein MTR_5g028420 [Medicago truncatula]
 gb|AES95702.1| LRR and NB-ARC domain disease resistance protein, putative [Medicago 
truncatula]
Length=1097

 Score = 80.5 bits (197),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 70/255 (27%), Positives = 106/255 (42%), Gaps = 40/255 (16%)
 Frame = -2

Query  1088  SWKFASAYMTTIYIKNCPPGKQLPQFHLLPSLGELYFESIMVDYIDTTDYEDDNSPSRSE  909
             +W  +   +    + +CP  + LP    LP L  L    +        + +  NSPS + 
Sbjct  754   NWLHSIQCLVKFTLNDCPKCEFLPPMDQLPHLKVLQIRRLDSLKFIAENNQVGNSPSSTT  813

Query  908   --LFFPSLKKLWIWNCPNLKGWWKK----NDEAIEEELLPPFPCISVVDIKQSPNVTWMP  747
               LFFPSLK+L I +CPNLK WW+     ND        P F CIS ++I+  P +  MP
Sbjct  814   PILFFPSLKELTISDCPNLKSWWENEIWGNDR-------PYFSCISKLNIQCCPKLACMP  866

Query  746   LFPTVSEKLYIVTGSIIPLEHTKKVCSSFKYLKKLWVSEVADLEYMEIELFPSLEYLWVY  567
             L+P + ++L +V  ++  +  T       +   K      + L+ M IE           
Sbjct  867   LYPGLDDELVLVESNVRSMRDTMHHADGSETTTK--SKPFSKLKSMVIERI---------  915

Query  566   DCRNLRDWGKKGDHEDAPKALAKLAPSVIEFEVKNCPKLKLLPQGMRLLSSSTKFSISGC  387
                           +  P+   K   S+ E  +++C  LK LPQG + LSS    +I  C
Sbjct  916   -------------EQTPPERWLKNFVSLEELHIRDCVILKSLPQGFKSLSSLISLTIERC  962

Query  386   PLLKQKYKSKSGQNW  342
               L       SG  W
Sbjct  963   EELDLDI---SGTEW  974


 Score = 53.1 bits (126),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 65/254 (26%), Positives = 105/254 (41%), Gaps = 30/254 (12%)
 Frame = -2

Query  1064  MTTIYIKNCPPGKQLPQFHLLPSLGE--LYFESIMVDYIDTTDYEDDNSPSRSELFFPSL  891
             ++ + I+ CP    +P   L P L +  +  ES +    DT  + D +  +     F  L
Sbjct  851   ISKLNIQCCPKLACMP---LYPGLDDELVLVESNVRSMRDTMHHADGSETTTKSKPFSKL  907

Query  890   KKLWIWNCPNLK-GWWKKNDEAIEEELLPPFPCISVVDIKQSPNVTWMPLFPTVSE--KL  720
             K + I          W KN  ++EE  L    C+ +  + Q         F ++S    L
Sbjct  908   KSMVIERIEQTPPERWLKNFVSLEE--LHIRDCVILKSLPQG--------FKSLSSLISL  957

Query  719   YIVTGSIIPLEHTKKVCSSFKYLKKLWVSEVADLEYM--EIELFPSLEYLWVYDCRNLRD  546
              I     + L+ +       + L+ L +  +  L+ +  EIE   SL  L +YDC  L D
Sbjct  958   TIERCEELDLDISGTEWKGLRKLRSLTLRSIPKLKSLPREIENLNSLHDLRLYDCHGLTD  1017

Query  545   WGKKGDHEDAPKALAKLAPSVIEFEVKNCPKLKLLPQGMRLLSSSTKFSISGCPLLKQKY  366
                     ++   L  L   VI      C  L  LP+GM +L S     I  CPLL  + 
Sbjct  1018  LT------ESIGNLTSLGKLVIS----ECRNLDYLPKGMEMLQSLNTLIIMDCPLLLPRC  1067

Query  365   KSKSGQNWPEVANI  324
             +  +G +WP++A+I
Sbjct  1068  QPDTGDDWPQIAHI  1081



>gb|KEH19079.1| disease resistance protein (TIR-NBS-LRR class), putative [Medicago 
truncatula]
Length=1965

 Score = 80.5 bits (197),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 70/284 (25%), Positives = 120/284 (42%), Gaps = 61/284 (21%)
 Frame = -2

Query  1040  CPPGKQLPQFHLLPSLGELYFESIMVDYIDTTDYEDDNSPSRSELFFPSLKKLWIWNCPN  861
             C   + LP    LP L  L+     ++ ++   YE D + +    FFPSL+ L +  C  
Sbjct  1689  CGSLQYLPPLERLPFLKSLHIS--FLEELEYIYYEQDFTSA----FFPSLESLSLQFCYK  1742

Query  860   LKGWWKKNDE---AIEEELLPPFPCISVVDIKQSPNVTWMPLFPTVSEKL---------Y  717
             LKGWW+  D+     +   LPPFP +  + I     +T+MP FP +   L          
Sbjct  1743  LKGWWRIGDDFNNCSQNLSLPPFPRLCQLSIIGCLMLTFMPTFPNLENGLELYNSRAETL  1802

Query  716   IVTGSIIPLE--------------HTKKVCSSFKYLKKLWVSEVADLEYMEIELF-----  594
             I T +   +E              H   V    K +  +W+  +  L+ ++I  F     
Sbjct  1803  IATLNTAAVERMNDFPPLSMLKSLHIDGVRLDVKSIPNVWMKNLTSLQLLQINWFSRQAF  1862

Query  593   --------------PSLEYLWVYDCRNLRDWGKKGDHEDAPKALAKLAPSVIEFEVKNCP  456
                           PSL+ +  ++C +L         E  P  +  L+ S+    V +C 
Sbjct  1863  QQIETWFKDDLKYLPSLQTIAFHNCEDL---------EALPDWICNLS-SLQHLRVYDCI  1912

Query  455   KLKLLPQGMRLLSSSTKFSISGCPLLKQKYKSKSGQNWPEVANI  324
              L  LP+GM  L++     I GCP+L ++ ++++G+ W + A++
Sbjct  1913  NLASLPEGMLNLTNLQTLEIIGCPILVEECQTQTGETWDKTAHV  1956



>gb|KEH19080.1| disease resistance protein (TIR-NBS-LRR class), putative [Medicago 
truncatula]
Length=1744

 Score = 80.5 bits (197),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 70/284 (25%), Positives = 120/284 (42%), Gaps = 61/284 (21%)
 Frame = -2

Query  1040  CPPGKQLPQFHLLPSLGELYFESIMVDYIDTTDYEDDNSPSRSELFFPSLKKLWIWNCPN  861
             C   + LP    LP L  L+     ++ ++   YE D + +    FFPSL+ L +  C  
Sbjct  1468  CGSLQYLPPLERLPFLKSLHIS--FLEELEYIYYEQDFTSA----FFPSLESLSLQFCYK  1521

Query  860   LKGWWKKNDE---AIEEELLPPFPCISVVDIKQSPNVTWMPLFPTVSEKL---------Y  717
             LKGWW+  D+     +   LPPFP +  + I     +T+MP FP +   L          
Sbjct  1522  LKGWWRIGDDFNNCSQNLSLPPFPRLCQLSIIGCLMLTFMPTFPNLENGLELYNSRAETL  1581

Query  716   IVTGSIIPLE--------------HTKKVCSSFKYLKKLWVSEVADLEYMEIELF-----  594
             I T +   +E              H   V    K +  +W+  +  L+ ++I  F     
Sbjct  1582  IATLNTAAVERMNDFPPLSMLKSLHIDGVRLDVKSIPNVWMKNLTSLQLLQINWFSRQAF  1641

Query  593   --------------PSLEYLWVYDCRNLRDWGKKGDHEDAPKALAKLAPSVIEFEVKNCP  456
                           PSL+ +  ++C +L         E  P  +  L+ S+    V +C 
Sbjct  1642  QQIETWFKDDLKYLPSLQTIAFHNCEDL---------EALPDWICNLS-SLQHLRVYDCI  1691

Query  455   KLKLLPQGMRLLSSSTKFSISGCPLLKQKYKSKSGQNWPEVANI  324
              L  LP+GM  L++     I GCP+L ++ ++++G+ W + A++
Sbjct  1692  NLASLPEGMLNLTNLQTLEIIGCPILVEECQTQTGETWDKTAHV  1735



>sp|Q7XA39.1|RGA4_SOLBU RecName: Full=Putative disease resistance protein RGA4; AltName: 
Full=RGA4-blb [Solanum bulbocastanum]
 gb|AAP45166.1| Putative disease resistance protein RGA4, identical [Solanum 
bulbocastanum]
Length=988

 Score = 79.7 bits (195),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 78/270 (29%), Positives = 125/270 (46%), Gaps = 41/270 (15%)
 Frame = -2

Query  1064  MTTIYIKNCPPGKQLPQFHLLPSLGELYFE--SIMVDYIDTTDYEDDNSPSRSELFFPSL  891
             + ++ IK+C     LP F  LP L  L  +  S  V+Y++  D     S  RS   FPSL
Sbjct  731   VISVRIKSCKNCLCLPPFGELPCLENLELQNGSAEVEYVEEDDVHSRFSTRRS---FPSL  787

Query  890   KKLWIWNCPNLKGWWKKNDEAIEEELLPPFPCISVVDIKQSPNVTWMPLFPTVSE-KLYI  714
             KKL IW   +LKG  K+  E         FP +  + I   P    + +FPT+S  K   
Sbjct  788   KKLRIWFFRSLKGLMKEEGE-------EKFPMLEEMAILYCP----LFVFPTLSSVKKLE  836

Query  713   VTGSIIPLEHTKKVCS--SFKYLKKLWVSEVADLEYMEIELFPSL---EYLWVYDCRNLR  549
             V G+     +T+ + S  +   L  L +        +  E+F SL   E+L  +D +NL+
Sbjct  837   VHGNT----NTRGLSSISNLSTLTSLRIGANYRATSLPEEMFTSLTNLEFLSFFDFKNLK  892

Query  548   DWGKKGDHEDAPKALA---------------KLAPSVIEFEVKNCPKLKLLPQGMRLLSS  414
             D        +A K L                +   S+ +  VK C  LK LP+G++ L++
Sbjct  893   DLPTSLTSLNALKRLQIESCDSLESFPEQGLEGLTSLTQLFVKYCKMLKCLPEGLQHLTA  952

Query  413   STKFSISGCPLLKQKYKSKSGQNWPEVANI  324
              T   +SGCP ++++   + G++W ++A+I
Sbjct  953   LTNLGVSGCPEVEKRCDKEIGEDWHKIAHI  982



>gb|AAP45174.1| Putative disease resistance protein RGA4, identical [Solanum 
bulbocastanum]
Length=988

 Score = 79.7 bits (195),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 78/270 (29%), Positives = 125/270 (46%), Gaps = 41/270 (15%)
 Frame = -2

Query  1064  MTTIYIKNCPPGKQLPQFHLLPSLGELYFE--SIMVDYIDTTDYEDDNSPSRSELFFPSL  891
             + ++ IK+C     LP F  LP L  L  +  S  V+Y++  D     S  RS   FPSL
Sbjct  731   VISVRIKSCKNCLCLPPFGELPCLENLELQNGSAEVEYVEEDDVHSRFSTRRS---FPSL  787

Query  890   KKLWIWNCPNLKGWWKKNDEAIEEELLPPFPCISVVDIKQSPNVTWMPLFPTVSE-KLYI  714
             KKL IW   +LKG  K+  E         FP +  + I   P    + +FPT+S  K   
Sbjct  788   KKLRIWFFRSLKGLMKEEGE-------EKFPMLEEMAILYCP----LFVFPTLSSVKKLE  836

Query  713   VTGSIIPLEHTKKVCS--SFKYLKKLWVSEVADLEYMEIELFPSL---EYLWVYDCRNLR  549
             V G+     +T+ + S  +   L  L +        +  E+F SL   E+L  +D +NL+
Sbjct  837   VHGNT----NTRGLSSISNLSTLTSLRIGANYRATSLPEEMFTSLTNLEFLSFFDFKNLK  892

Query  548   DWGKKGDHEDAPKALA---------------KLAPSVIEFEVKNCPKLKLLPQGMRLLSS  414
             D        +A K L                +   S+ +  VK C  LK LP+G++ L++
Sbjct  893   DLPTSLTSLNALKRLQIESCDSLESFPEQGLEGLTSLTQLFVKYCKMLKCLPEGLQHLTA  952

Query  413   STKFSISGCPLLKQKYKSKSGQNWPEVANI  324
              T   +SGCP ++++   + G++W ++A+I
Sbjct  953   LTNLGVSGCPEVEKRCDKEIGEDWHKIAHI  982



>gb|KHG19991.1| Putative disease resistance RGA3 [Gossypium arboreum]
Length=1139

 Score = 79.7 bits (195),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 70/245 (29%), Positives = 111/245 (45%), Gaps = 40/245 (16%)
 Frame = -2

Query  1028  KQLPQFHLLPSLGELYFESIMVDYIDTTDYEDDNSPSRS----ELFFPSLKKLWIWNCPN  861
             K LP F   P L +L    ++ D  +  +Y DDNSP  S    E FFPSLK L + +CPN
Sbjct  832   KHLPSFAQFPCLQDL----VICDLTEL-EYMDDNSPKGSQGELESFFPSLKYLCLRDCPN  886

Query  860   LKGWW----------KKNDEAIEEELLPPFPCISVVDIKQSPNVTWMPLFPTVSEKLYIV  711
             +K WW          K+ D  +       FPC+S + I+  P +T MPL+P++ + L +V
Sbjct  887   MKSWWRTTKAIGDDSKEYDATVMGTSTMAFPCLSCLKIENCP-LTSMPLYPSLDDWLKLV  945

Query  710   TGSIIPLEHTKKVCSSFKY------------LKKLWVSEVADLE-YMEIELFPSLEYLWV  570
               S+ PL+ T K+  + K             LK   V  +  L+ +M  E    L  +  
Sbjct  946   NTSLRPLKQTTKMNMNAKTPSTSTSSLPLSKLKSFHVDNIEGLDTHMLDECLQHLTGIKS  1005

Query  569   YDCRNLRDWGKKGDHEDAPKALAKLAPSVIEFEVKNCPKLKLLPQGMRLLSSSTKFSISG  390
                R+ ++   +G   +  K +++L        +   P+L  LP+G++ L       I  
Sbjct  1006  LTIRDCKELDLEGMQWEPLKNVSRLM-------IDKIPQLVSLPRGLQHLVQLKTLEIHN  1058

Query  389   CPLLK  375
             C  L+
Sbjct  1059  CSGLR  1063



>ref|XP_008368960.1| PREDICTED: putative disease resistance protein RGA3 [Malus domestica]
Length=1087

 Score = 79.7 bits (195),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 82/315 (26%), Positives = 132/315 (42%), Gaps = 65/315 (21%)
 Frame = -2

Query  1088  SWKFASAYMTTIYIKNCPPGKQLPQFHLLPSLGELYFESI-MVDYIDTTDYEDDNSPSRS  912
             SW  +   +  + +  C   + LP     PSL  L  E    ++YI  T      S S S
Sbjct  773   SWFSSLINLVHLTLWGCHRCQHLPPLDHFPSLKFLKLEEFEKLEYISDTSS----SNSMS  828

Query  911   ELFFPSLKKLWIWNCPNLKGWWKKNDE-------AIEEELLPPFPCISVVDIKQSPNVTW  753
             +    SL+ LW+ NCP LKGWW+ +         + E   LP FP +S + I   PN+T 
Sbjct  829   DEMMTSLECLWVVNCPVLKGWWRAHTHNNASSSSSTENLSLPSFPGLSTLWISNCPNLTC  888

Query  752   MPLFPTVS------------EKLYIVTGSIIPLEHTKKV--------CSSFKYLKKLWVS  633
             MPL+P V             + L++   S I  +    V         S   +L    + 
Sbjct  889   MPLYPNVERIDLNGCSSKVVDSLFVRGASDITHDVGVDVSASSSSPHLSKLTHLSLFGIE  948

Query  632   EVADLEYME---IELFPSLEYLWVYDCRNLRDWGKK--GDHED-----------------  519
             ++A L+ ++   I+ FP L  L  +   NL    K   GD+ D                 
Sbjct  949   DLAVLQSLQSPCIKDFPHLALLPYHGMGNLTSLQKLTIGDYSDLTLPPDVVINLPSLQSL  1008

Query  518   ----------APKALAKLAPSVIEFEVKNCPKLKLLPQGMRLLSSSTKFSISGCPLLKQK  369
                        P+ ++ L  S+    +++CP L  LP+G+  L +  +  I GC +L ++
Sbjct  1009  TILSFPNLVSLPEEISNLT-SLQHLAIESCPNLASLPEGICRLPNLNRLQIWGCNMLSER  1067

Query  368   YKSKSGQNWPEVANI  324
              K + G +WP++A+I
Sbjct  1068  CKKEIGDDWPKIAHI  1082


 Score = 55.5 bits (132),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 37/113 (33%), Positives = 59/113 (52%), Gaps = 6/113 (5%)
 Frame = -2

Query  1520  PFAQDQIKLLWGLNEELTKLGDLVSHIGAVLLDAEGEKHNKKTENLLEMLKNIMDEANRL  1341
             PFA  +I L+WG+ +EL KL ++V+    VLLD E ++ N + +  LE +++ + EA+ L
Sbjct  20    PFAFQEIGLIWGVQDELHKLQEIVAGFQGVLLDVEQKQTNNEVKLWLESVEDAVYEADDL  79

Query  1340  MDYFSPRAKNHR----PNQEDGCCSYFVSHPNPFVWVSDSFMAGKIKSINNRL  1194
             +D F+  A+  +      +       F S  N   +     M  KIK IN RL
Sbjct  80    LDEFNTEAQQRQMMCGNTKMSRKVRLFFSSSNQLAFRLK--MGHKIKDINKRL  130



>gb|KEH18640.1| NBS-LRR type disease resistance protein [Medicago truncatula]
Length=997

 Score = 79.3 bits (194),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 78/300 (26%), Positives = 126/300 (42%), Gaps = 52/300 (17%)
 Frame = -2

Query  1100  GSVLS-WKFASAYMTTIYIKNCPPGKQLPQFHLLPSLGELYFESIMVDYIDTTDYEDDNS  924
             GS+ S W      +  I +  C   + LP    LP     + +S+ + Y+D  +Y     
Sbjct  668   GSMFSKWLSPLTNIIEISLDCCRGLQYLPPLERLP-----FLKSLELCYLDELEYIYYEE  722

Query  923   PSRSELFFPSLKKLWIWNCPNLKGWWKKNDE-----AIEEELLPPFPCISVVDIKQSPNV  759
             P   E FFPSL+ L    C  L+GW +  D+     +    LLP FP +S+++I     +
Sbjct  723   PILHESFFPSLESLKFMGCNILRGWRRMGDDFSDINSSRHLLLPQFPRLSILEIGGCWML  782

Query  758   TWMPLFPTVSEKLYIVTGSIIPLEHT-----------------------KKVCSSFKYLK  648
             T MP+FP +  +L +   ++  LE T                        +V S  K L 
Sbjct  783   TSMPIFPEIKTRLSLTECNVQILEATLNIAMSQYSTGFPPLSMLKSMEIGEVSSDVKKLP  842

Query  647   KLWVSEVADLEYMEIELFPSLEY----LWVYDCRNL-----RDWGKKGDHEDA-PKALAK  498
             K W+  +  LE ++     S ++    +W  D  N          K   H +  P  +  
Sbjct  843   KDWLQNLTSLENLDFYFVSSEQFQVIEMWFKDGLNCLPSLQTITFKSCSHLNTLPYWVCN  902

Query  497   LAPSVIEFEVKNCPKLKLLPQGMRLLSSSTKFSISGCPLLKQKYKSKSGQNWPEVANITT  318
             L+ S+   ++ NC  L LLP+GM  L++     I GCPLL +++       W E +  T+
Sbjct  903   LS-SLQHIKMINCGNLALLPEGMSRLTNLRTLEIIGCPLLGEEF-------WTETSATTS  954



>gb|AAR29072.1| blight resistance protein RGA4 [Solanum bulbocastanum]
Length=1040

 Score = 79.3 bits (194),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 78/270 (29%), Positives = 125/270 (46%), Gaps = 41/270 (15%)
 Frame = -2

Query  1064  MTTIYIKNCPPGKQLPQFHLLPSLGELYFE--SIMVDYIDTTDYEDDNSPSRSELFFPSL  891
             + ++ IK+C     LP F  LP L  L  +  S  V+Y++  D     S  RS   FPSL
Sbjct  783   VISVRIKSCKNCLCLPPFGELPCLENLELQNGSAEVEYVEEDDVHSRFSTRRS---FPSL  839

Query  890   KKLWIWNCPNLKGWWKKNDEAIEEELLPPFPCISVVDIKQSPNVTWMPLFPTVSE-KLYI  714
             KKL IW   +LKG  K+  E         FP +  + I   P    + +FPT+S  K   
Sbjct  840   KKLRIWFFRSLKGLMKEEGE-------EKFPMLEEMAILYCP----LFVFPTLSSVKKLE  888

Query  713   VTGSIIPLEHTKKVCS--SFKYLKKLWVSEVADLEYMEIELFPSL---EYLWVYDCRNLR  549
             V G+     +T+ + S  +   L  L +        +  E+F SL   E+L  +D +NL+
Sbjct  889   VHGNT----NTRGLSSISNLSTLTSLRIGANYRATSLPEEMFTSLTNLEFLSFFDFKNLK  944

Query  548   DWGKKGDHEDAPKALA---------------KLAPSVIEFEVKNCPKLKLLPQGMRLLSS  414
             D        +A K L                +   S+ +  VK C  LK LP+G++ L++
Sbjct  945   DLPTSLTSLNALKRLQIESCDSLESFPEQGLEGLTSLTQLFVKYCKMLKCLPEGLQHLTA  1004

Query  413   STKFSISGCPLLKQKYKSKSGQNWPEVANI  324
              T   +SGCP ++++   + G++W ++A+I
Sbjct  1005  LTNLGVSGCPEVEKRCDKEIGEDWHKIAHI  1034



>ref|XP_006573928.1| PREDICTED: putative disease resistance protein RGA4-like [Glycine 
max]
Length=1082

 Score = 79.3 bits (194),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 59/188 (31%), Positives = 83/188 (44%), Gaps = 36/188 (19%)
 Frame = -2

Query  932  DNSPSRSELFFPSLKKLWIWNCPNLKGWWKKNDEAIEEELLPPFPCISVVDIKQSPNVTW  753
            D   S S  FFPSLK+L I +CPNLK WW   +    E+  P F CIS + ++  PN+  
Sbjct  783  DAEGSSSSTFFPSLKELTISDCPNLKSWW---ETPKREDDRPFFNCISKLHVQCCPNLHC  839

Query  752  MPLFPTVSEKLYIVTGSIIPLE---HTKKVCSSFKYLKKLWVSEVADLEYMEIELFPSLE  582
            MPL+P + E+L +V  S+  +    H K     F  L KL    +A +            
Sbjct  840  MPLYPFLDEELVLVDSSVRSMRDTVHAKTSSEDFIPLSKLKSMLIARIT-----------  888

Query  581  YLWVYDCRNLRDWGKKGDHEDAPKALAKLAPSVIEFEVKNCPKLKLLPQGMRLLSSSTKF  402
                               E  P    K   S+   ++++C KLK LP+G + LSS    
Sbjct  889  -------------------ETPPPRWLKSFISLENLQIRDCHKLKCLPEGFKSLSSLQSL  929

Query  401  SISGCPLL  378
            +I  CP L
Sbjct  930  TIERCPEL  937



>gb|KHN40429.1| Putative disease resistance protein RGA4 [Glycine soja]
Length=756

 Score = 79.0 bits (193),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 59/188 (31%), Positives = 83/188 (44%), Gaps = 36/188 (19%)
 Frame = -2

Query  932  DNSPSRSELFFPSLKKLWIWNCPNLKGWWKKNDEAIEEELLPPFPCISVVDIKQSPNVTW  753
            D   S S  FFPSLK+L I +CPNLK WW   +    E+  P F CIS + ++  PN+  
Sbjct  457  DAEGSSSSTFFPSLKELTISDCPNLKSWW---ETPKREDDRPFFNCISKLHVQCCPNLHC  513

Query  752  MPLFPTVSEKLYIVTGSIIPLE---HTKKVCSSFKYLKKLWVSEVADLEYMEIELFPSLE  582
            MPL+P + E+L +V  S+  +    H K     F  L KL    +A +            
Sbjct  514  MPLYPFLDEELVLVDSSVRSMRDTVHAKTSSEDFIPLSKLKSMLIARIT-----------  562

Query  581  YLWVYDCRNLRDWGKKGDHEDAPKALAKLAPSVIEFEVKNCPKLKLLPQGMRLLSSSTKF  402
                               E  P    K   S+   ++++C KLK LP+G + LSS    
Sbjct  563  -------------------ETPPPRWLKSFISLENLQIRDCHKLKCLPEGFKSLSSLQSL  603

Query  401  SISGCPLL  378
            +I  CP L
Sbjct  604  TIERCPEL  611



>ref|XP_009368061.1| PREDICTED: disease resistance protein RGA2-like [Pyrus x bretschneideri]
Length=1131

 Score = 79.3 bits (194),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 74/264 (28%), Positives = 116/264 (44%), Gaps = 42/264 (16%)
 Frame = -2

Query  1088  SWKFASAYMTTIYIKNCPPGKQLPQFHLLPSLGELYFESIMVDYIDTTDYEDDNSPSRSE  909
             SW  +   +  + ++ C   ++LP    LPSL  L    +  D ++     + ++    E
Sbjct  774   SWFSSLINIVNLSLEYCSRCQRLPPLDHLPSLKSLAL--VGFDKLEYISENESSNSMSDE  831

Query  908   L----FFPSLKKLWIWNCPNLKGWWKKN-------DEAIEEELLPPFPCISVVDIKQSPN  762
             +    FFPSLK+LWI  CP LKGWW+ +         + E   LP FP +S + I+  PN
Sbjct  832   MMRISFFPSLKELWILACPILKGWWRAHTHNSDDSSSSTENLSLPSFPRLSTLIIRDCPN  891

Query  761   VTWMPLFPT------------VSEKLYIVTGSIIPLEHTKKVCSSFKY-----LKKLWVS  633
             +T +PL P             V + L +   S I  +    V +S        L  L +S
Sbjct  892   LTSLPLCPNAERIDLERSSWKVVDSLIVRGASDITHDVGVDVSASSSSPPLSKLTHLTLS  951

Query  632   EVADLEYM--EIELFPSLEYLWVYDCRNLRDWGKKGDHEDAPKALAKLAPSVIEFEVKNC  459
             E+ DL  +  EI    SL+ L +  C NL            P+ ++ L  S+   E+  C
Sbjct  952   EIEDLASLPEEISNLTSLQELAIRYCDNL---------ASLPEEISNLT-SLQHLEIIYC  1001

Query  458   PKLKLLPQGMRLLSSSTKFSISGC  387
               L ++P+G+  L+S     IS C
Sbjct  1002  SNLAVMPEGINNLTSLQHLQISNC  1025


 Score = 60.8 bits (146),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 42/137 (31%), Positives = 76/137 (55%), Gaps = 7/137 (5%)
 Frame = -2

Query  1553  SVAKLILAKIAPFAQDQIKLLWGLNEELTKLGDLVSHIGAVLLDAEGEKHNKKTENLLEM  1374
             +VA+ I+ ++   A  +I L+WG+ +E  KL + V+   AVLLDAE ++ N + +  L+ 
Sbjct  8     NVAEGIIERLGSLAFQEIGLIWGVQDEFQKLKETVARFQAVLLDAEQKQANNEVKLWLQS  67

Query  1373  LKNIMDEANRLMDYFSPRAKNHRPNQEDGCCS----YFVSHPNPFVWVSDSFMAGKIKSI  1206
             +++ + EA+ ++D F+ + +  +   E+   S     F S+ N  V+  +  M  KIK I
Sbjct  68    VEDAVYEADDVLDEFNTKNQRRKMLPENTKLSKKVGLFFSNSNQLVFGLN--MGHKIKDI  125

Query  1205  NNRLDGIIENYKKIRLE  1155
             N RL   + N + + LE
Sbjct  126   NKRLSE-VANRRPLHLE  141



>ref|XP_006364463.1| PREDICTED: putative disease resistance protein RGA1-like [Solanum 
tuberosum]
Length=995

 Score = 79.3 bits (194),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 72/267 (27%), Positives = 127/267 (48%), Gaps = 33/267 (12%)
 Frame = -2

Query  1064  MTTIYIKNCPPGKQLPQFHLLPSLGELYFE--SIMVDYIDTTDYEDDNSPSRSELFFPSL  891
             + +I I+ C     LP F  LP L  L     S  V+Y++  D  D +S S + + FPSL
Sbjct  734   VVSIVIEGCENCSCLPPFGELPCLESLVLHKGSAEVEYVEE-DNIDVHSGSPTRIRFPSL  792

Query  890   KKLWIWNCPNLKGWWKKNDEAIEEELLPPFPCISVVDIKQSPNVTWMPLFPTVSEKLYIV  711
             +KL +    NLKG  KK  E         FP +  V+I+Q P V  +P   +V +KL I 
Sbjct  793   RKLTVAKFRNLKGLLKKEGE-------EQFPVLEEVEIEQCP-VFVIPTLSSV-KKLEIA  843

Query  710   TGSIIPLEHTKKVCSSFKYLKKLWVSEVADLEYMEIELF---PSLEYLWVYDCRNLRDWG  540
               +        +  S+ + L  L++S+  +   +  E+F    +L+ L + + +NL+   
Sbjct  844   READAT---GFRSISNLRDLTSLYISDNEEATSLPEEMFKNLANLKDLTISEFKNLKKLP  900

Query  539   KK---------------GDHEDAPKALAKLAPSVIEFEVKNCPKLKLLPQGMRLLSSSTK  405
                              G  E  P+   +   S+ E  ++ C  LK LP+G++ L++ T 
Sbjct  901   TSLATLNALKSLKIECCGALESLPEEGLEGLTSLTELSLQYCEMLKCLPEGLQYLTALTS  960

Query  404   FSISGCPLLKQKYKSKSGQNWPEVANI  324
              ++ GCP ++++ +   G++W ++A+I
Sbjct  961   LTVEGCPEVEKRCEKGIGEDWHKIAHI  987



>gb|KDP40558.1| hypothetical protein JCGZ_24557 [Jatropha curcas]
Length=666

 Score = 78.6 bits (192),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 66/272 (24%), Positives = 122/272 (45%), Gaps = 50/272 (18%)
 Frame = -2

Query  1088  SWKFASAYMTTIYIKNCPPGKQLPQFHLLPSLGELYFESIM-VDYIDTTDYEDDNSPSRS  912
             SW  +   +  I I+NCP  ++LP    LPSL  L+   +  ++YI+  + E  +S +  
Sbjct  331   SWLSSLKNIVRITIRNCPKCRKLPPLEHLPSLRFLHLHKLAALEYIEYDNNEMFSSSASK  390

Query  911   ELFFPSLKKLWIWNCPNLKGWWKK----------------NDEAIEEELLPPFPCISVVD  780
               FFPSL++LW++  PN KGW  +                N++++E      FPC++ + 
Sbjct  391   TAFFPSLQELWLYKLPNFKGWQLREFIDENNGTSAAFTADNNQSLEH----LFPCLNQLT  446

Query  779   IKQSPNVTWMPLFPTVSEKLYIVTGSIIPLEHTKKVCSSFKYLKKLWVSEVADLEYMEIE  600
             I++   +T MP FP + + L+++  S++         +   +   L+     ++ ++E +
Sbjct  447   IERCSKLTSMPFFPYL-DSLHLINSSVL----VTAASTFSSFSFSLFPFSTINILFIEKD  501

Query  599   LFPSLEYLWVYDCRNLRDWGKKGDHEDAPKALAKLAPSVIEFEVKNCPKLKLLPQGMRLL  420
                  EYL                 E  P+   +   S+   ++KNCP+L  L  G+  L
Sbjct  502   -----EYL-----------------ECLPEEGLQNLTSLKTLKLKNCPRLAFLSPGINYL  539

Query  419   SSSTKFSISGCPLLKQKYKSKSGQNWPEVANI  324
             +  T   IS C  +   +   +G  W  + N+
Sbjct  540   TRLTSLEISECSRIDLFH--DNGIQWQGLRNL  569



>gb|AAP45188.2| Disease resistance protein RGA2, putative [Solanum bulbocastanum]
Length=940

 Score = 79.0 bits (193),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 76/260 (29%), Positives = 121/260 (47%), Gaps = 47/260 (18%)
 Frame = -2

Query  1064  MTTIYIKNCPPGKQLPQFHLLPSLG--ELYFESIMVDYIDTTDYEDDNSPSRSELFFPSL  891
             + +I I N      LP F  LP L   EL++ S  V+Y++  D  D +S   + + FPSL
Sbjct  708   IVSILISNFRNCSCLPPFGDLPCLESLELHWGSADVEYVEEVDI-DVHSGFPTRIRFPSL  766

Query  890   KKLWIWNCPNLKGWWKKNDEAIEEELLPPFPCISVVDIKQSPNVTWMPLFPTVSEKLYIV  711
             +KL IW+  +LKG  KK  E         FP +  + I + P       F T+S  L  +
Sbjct  767   RKLDIWDFGSLKGLLKKEGE-------EQFPVLEEMIIHECP-------FLTLSSNLRAL  812

Query  710   TGSIIPLEHTKKVCSSF--KYLKKLWVSEVADLEYMEIELFPSLEYLWVYDCRNLRDWGK  537
             T   I      KV +SF  +  K L                 +L+YL +  C NL++   
Sbjct  813   TSLRICY---NKVATSFPEEMFKNL----------------ANLKYLTISRCNNLKELPT  853

Query  536   KGDHEDAPKALA---------KLAPSVIEFEVKNCPKLKLLPQGMRLLSSSTKFSISGCP  384
                  +A K+LA         +   S+ E  V++C  LK LP+G++ L++ T   I GCP
Sbjct  854   SLASLNALKSLALESLPEEGLEGLSSLTELFVEHCNMLKCLPEGLQHLTTLTSLKIRGCP  913

Query  383   LLKQKYKSKSGQNWPEVANI  324
              L ++ +   G++W ++++I
Sbjct  914   QLIKRCEKGIGEDWHKISHI  933



>gb|KHG19082.1| Putative disease resistance RGA4 [Gossypium arboreum]
Length=721

 Score = 78.2 bits (191),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 87/290 (30%), Positives = 121/290 (42%), Gaps = 58/290 (20%)
 Frame = -2

Query  1088  SWKFASAYMTTIYIKNCPPGKQLPQFHLLPSLGELYFESIMVDYIDTTDYEDDNSPSRS-  912
             SW      +  IYI      K LP    LP L +L             +Y DDNSP  S 
Sbjct  394   SWLSLLTNLVHIYIWGPNKFKYLPSVAQLPCLQDLTIRDCY-----ELEYMDDNSPKGSQ  448

Query  911   ---ELFFPSLKKLWIWNCPNLKGWWK----------KNDEAIEEELLPPFPCISVVDIKQ  771
                E FFPSLK L + NC N+K WW+          ++D  +       FPC+S + IK 
Sbjct  449   GEPESFFPSLKCLDLENCRNMKSWWRTTKPIDNDSNEDDPTVMGTSTMAFPCLSTLWIKN  508

Query  770   SPNVTWMPLFPTVSEKLYIVTGSIIPLEHTKKV--------CSS----FKYLKKLWVSEV  627
              P +T MPL+P V + L +V  S  P + T K+        CS+       LK   V  +
Sbjct  509   CP-LTSMPLYPLVDDDLRLVNSSSRPFKQTIKMKMNAKTPSCSTSSLPLSKLKSFHVKNM  567

Query  626   ADL------EYMEIELFPSLEYLWV-YDCRNLRDWGKK----GDH--------EDAPKAL  504
              D+      EYM  +   SLE L +  DC+ +     K     DH        E+ PK  
Sbjct  568   EDMDTPMLDEYM--QHLTSLETLTIDGDCKEMELSAPKFQIFQDHTSLRSLSLENIPKCW  625

Query  503   A-----KLAPSVIEFEVKNCPKLKLLPQGMRLLSSSTKFSISGCPLLKQK  369
                   +   ++ E  + + P L  LP  MR L++     I G P LK++
Sbjct  626   QLPEWIQHLTNLQELRLLHLPNLTSLPDEMRCLTNLQWLDIIGVPQLKER  675



>ref|XP_003589381.1| Resistance protein [Medicago truncatula]
 gb|AES59632.1| disease resistance protein RGA4 [Medicago truncatula]
Length=1011

 Score = 78.6 bits (192),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 69/274 (25%), Positives = 123/274 (45%), Gaps = 36/274 (13%)
 Frame = -2

Query  1088  SWKFASAYMTTIYIKNCPPGKQLPQFHLLPSLGELYFESIMVDYIDTTDYEDDNSPSRSE  909
             SW      + T+ IK C   ++      LPSL  L    + V Y+D  ++ +        
Sbjct  751   SWIRTLGNLVTLEIKGCMHCERFSSLGKLPSLKTLQITLVSVKYLDDDEFHNGLEVR---  807

Query  908   LFFPSLKKLWIWNCPNLKGWWKKNDEAIEEELLPPFPCISVVDIKQSPNVTWMPLFPTVS  729
               FPSL+ L I + PNL+G  K   + +       FPC+S+++I   P +  +P  P+V 
Sbjct  808   -IFPSLEVLIIDDLPNLEGLLKVEKKEM-------FPCLSILNINNCPKLE-LPCLPSVK  858

Query  728   E-KLYIVTGSIIPLEHTKKVCSSFKYLKKLWVSEVADLEYMEIELFPSL---EYLWVYDC  561
             + ++   T  ++      K  SS   L  L +     +     E+F +L   + L +   
Sbjct  859   DLRVRKCTNELL------KSISSLYCLTTLTLDGGEGITSFPKEMFGNLTCLQSLTLLGY  912

Query  560   RNLRDWGKK--------------GDHEDAPKALAKLAPSVIEFEVKNCPKLKLLPQGMRL  423
             RNL++   +               + E  P+ +     S+    +  C KLK LP G+R 
Sbjct  913   RNLKELPNEPFNLVLEHLNIAFCDELEYLPEKIWGGLQSLQSMRIYCCKKLKCLPDGIRH  972

Query  422   LSSSTKFSISGCPLLKQKYKSKSGQNWPEVANIT  321
             L++    +I+GCP+L +  K  +G++W ++A+I+
Sbjct  973   LTALDLLNIAGCPILTELCKKGTGEDWNKIAHIS  1006



>ref|XP_003626846.1| Nbs-lrr resistance protein [Medicago truncatula]
 gb|AET01322.1| NB-ARC domain disease resistance protein [Medicago truncatula]
Length=936

 Score = 78.2 bits (191),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 77/316 (24%), Positives = 141/316 (45%), Gaps = 44/316 (14%)
 Frame = -2

Query  1169  KIRLEEQNPKQQPMLTLLPPEDIGSVLSWKFASAYMTTIYIKNCPPGKQLPQFHLLPSLG  990
             K+R+ E +P +  ML       I +   W  +   +  I +  C   + LP    LP   
Sbjct  623   KLRVHEISPWEFQMLRY---NGIINHSKWLSSLTNIVEISLTFCGSLQFLPPLEHLP---  676

Query  989   ELYFESIMVDYIDTTDYEDDNSPSRSELFFPSLKKLWIWNCPNLKGWWKKNDEAIEEEL-  813
               + +S+ + Y+   +      P   E FFPSL+ L +  C  L+GW++  D+    +  
Sbjct  677   --FLKSLHIGYLGMLECIHYEKPLFPEKFFPSLESLKLEYCLELRGWYRIGDDINSTQSR  734

Query  812   ---LPPFPCISVVDIKQSPNVTWMPLFPTVSEKLYIVTGSII---------------PLE  687
                LPPFP +S + I+    +T MP F  + ++L ++ G+ +               PL 
Sbjct  735   HLSLPPFPLLSQLSIEGCRKLTCMPAFTKLDKRL-MLNGTHVEALNATLNNQSVSFPPLS  793

Query  686   HTKKVCSSFKYL-----KKLWVSEVADLEYMEIELFPSLEY----LWVYDCRNLRDWGKK  534
               K +C     L      + W+  +  L++++IE F S +     +W  +  N     +K
Sbjct  794   MLKSLCIGGHKLPVYNISENWMHNLLSLQHLQIEHFSSQQVHEIAIWFNEDFNCLPSLQK  853

Query  533   ------GDHEDAPKALAKLAPSVIEFEVKNCPKLKLLPQGMRLLSSSTKFSISGCPLLKQ  372
                    D E  P  +  ++ S+ +  ++  P L  +P+GM  L+      I  CPLL +
Sbjct  854   ITLQYCDDLETLPDWMCSIS-SLQQVTIRCFPHLVSVPEGMPRLTKLQTLEIIECPLLVK  912

Query  371   KYKSKSGQNWPEVANI  324
             + +++S +NWP++A+I
Sbjct  913   ECEAESSENWPKIAHI  928



>ref|XP_009338800.1| PREDICTED: putative disease resistance protein RGA1 [Pyrus x 
bretschneideri]
Length=440

 Score = 77.4 bits (189),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 60/207 (29%), Positives = 100/207 (48%), Gaps = 33/207 (16%)
 Frame = -2

Query  905  FFPSLKKLWIWNCPNLKGWWKKNDE-------AIEEELLPPFPCISVVDIKQSPNVTWMP  747
            FFPSL++L I  CP LKGWW+ +         + E    P FP +S + I+  PN+T MP
Sbjct  249  FFPSLEELRILGCPVLKGWWRAHTHNSASSSSSTENMSFPSFPSLSQLIIRGCPNLTSMP  308

Query  746  LFPTVSEKLYIVTGSIIPLEHTKKVCSSFKYLKKLWVSEVADLEY-----MEIELFPSLE  582
            L+P V              +  + V SS+K +  L+V   +D+ +     +     P L 
Sbjct  309  LYPNV--------------DGIELVRSSWKVVDSLFVRGASDITHDIGVVVSASSSPPLS  354

Query  581  YLWVYDCRNLRDWGKKGDHEDAPKALAKLAPSVIEFEVKNCPKLKLLPQGMRLLSSSTKF  402
             L      +L  WG + D    P+ ++ L  S+ E  +  C  L  LP+G+R L      
Sbjct  355  KL-----TSLTLWGIE-DLAFLPEEISNLT-SLHELIITQCYNLASLPEGIRGLPCLNTL  407

Query  401  SISGCPLLKQKYKSKSGQNWPEVANIT  321
             I+ C +L ++ K ++G++  ++A+I+
Sbjct  408  EINWCHMLSERCKKETGEDLRKIAHIS  434



>gb|ACY74346.1| blight resistance protein RGA2 [Capsicum annuum]
Length=957

 Score = 78.2 bits (191),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 79/261 (30%), Positives = 120/261 (46%), Gaps = 48/261 (18%)
 Frame = -2

Query  1064  MTTIYIKNCPPGKQLPQFHLLPSLG--ELYFESIMVDYIDTTDYEDDNSPSRSELFFPSL  891
             + +I I NC     LP F  LP L   EL F    V+Y +  D     SP+R   +FPSL
Sbjct  723   VISISICNCKNCSCLPPFGELPCLESLELTFGCDEVEYFEEDDVHS-GSPTRR--WFPSL  779

Query  890   KKLWIWNCPNLKGWWKKNDEAIEEELLPPFPCISVVDIKQSPNVTWMPLFPTVSEKLYIV  711
             +KL I    NLKG  KK  E         FP +  ++I   P    M +FPT+S      
Sbjct  780   RKLHIKGFRNLKGLMKKEGE-------EQFPMLEEMNISSCP----MFVFPTLS------  822

Query  710   TGSIIPLEHTKKV-CSSFKYLKKLWVSEVADLEYM---EIELFPS--------LEYLWVY  567
               S+  LE   KV   S   +  L  S +  LE++   E   FP         L+YL +Y
Sbjct  823   --SVKKLEIRGKVDAESLSSISNL--STLTSLEFLGNHEATSFPDEMFNGLAYLKYLQIY  878

Query  566   DCRNLRDWGKKGDHEDAPKALAKLAPSVIEFEVKNCPKLKLLPQGMRLLSSSTKFSISGC  387
             D + L +          P +LA L  ++    ++NC  L+ LP+ ++ L++ T  ++ G 
Sbjct  879   DLKKLNEL---------PTSLASL-NALKSLVIRNCSALESLPKALQNLTALTTLTVIGS  928

Query  386   PLLKQKYKSKSGQNWPEVANI  324
             P +K +     G++W ++A+I
Sbjct  929   PKVKDRCVKGIGEDWRKIAHI  949



>ref|XP_011089014.1| PREDICTED: putative disease resistance protein RGA1 [Sesamum 
indicum]
Length=1141

 Score = 78.2 bits (191),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 78/286 (27%), Positives = 122/286 (43%), Gaps = 47/286 (16%)
 Frame = -2

Query  1064  MTTIYIKNCPPGKQLPQFHLLPSLGELYFESIMVDYIDTTDYEDDNSPSRSELFFPSLKK  885
             +  + I++CP  +QLP F  L  L  L   ++      + ++ DDN    S +FFPSL++
Sbjct  781   LVELTIRDCPNCQQLPPFDQLQGLKILRLSNL-----SSVEHIDDNESEESTMFFPSLQE  835

Query  884   LWIWNCPNLKGWWKKNDEAIEEE------LLPPFPCISVVDIKQSPNVTWMPL-------  744
             L + N PNLK WW +N             + P FPC+S   I+   N+  +PL       
Sbjct  836   LHLNNLPNLKDWWARNVSGAAARGSTLSMVKPSFPCLSKTTIEFCTNLASLPLQMHVEEL  895

Query  743   -FPTVSEKLYI--VTGSIIPLEHTKKVCSSFKYLKKLWVSEVADLEYM---EIELFPSLE  582
              F   SEKL    +T +   L        S   LK L++  V D++Y+    ++   SLE
Sbjct  896   SFHRASEKLLRQQLTATAESLSAASSSSLSHSKLKSLYILGVKDMDYLPEEGLQQLASLE  955

Query  581   YLWVYDCRNLR---DWGKKGDHEDAPKALAKLAPSVIEFEVKNCPKLKLLPQGMRLLSSS  411
             YL +  C  L    D G +G              S+    ++ C  L  L  G++ L++ 
Sbjct  956   YLDISWCSRLLCLPDEGLRG------------LKSLQFLRIRRCSMLNSLSSGIQHLTAL  1003

Query  410   TKFSISGCPLLKQKYKSKSGQNWPEVANITTDW*LVNQYAYMPRLE  273
                 IS C  L     S   Q    + +++ D        Y+P+LE
Sbjct  1004  QTLRISDCKELVFSENSMHFQGLSSLTSLSLD--------YLPKLE  1041



>ref|XP_003623515.1| NBS resistance protein [Medicago truncatula]
 gb|AES79733.1| NBS-LRR type disease resistance protein [Medicago truncatula]
Length=1007

 Score = 77.8 bits (190),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 73/282 (26%), Positives = 133/282 (47%), Gaps = 47/282 (17%)
 Frame = -2

Query  1097  SVLSWKFASAYMTTIYIKNCPPGKQLPQFHLLPSLGELYFESIM-VDYIDTTDYEDDNSP  921
             S+ SW    + + ++ + +C    +LP    LPSL +L   S++ + Y+D     DD S 
Sbjct  743   SLPSWVSILSNLVSLELGDCKKFVRLPLLGKLPSLEKLELSSMVNLKYLD-----DDESQ  797

Query  920   SRSEL-FFPSLKKLWIWNCPNLKGWWKKNDEAIEEELLPPFPCISVVDIKQSP-------  765
                E+  FPSLK L ++  PN++G  K     +       FPC+S + I   P       
Sbjct  798   DGMEVRVFPSLKVLHLYELPNIEGLLKVERGKV-------FPCLSRLTIYYCPKLGLPCL  850

Query  764   ------NVTW--------MPLFPTVSEKLYIVTGSIIPLEHTKKVCSSFKYLKKLWVSEV  627
                   NV+         +P F  ++E L +  G  I     + +  +   L+ L+V   
Sbjct  851   PSLKSLNVSGCNNELLRSIPTFRGLTE-LTLYNGEGIT-SFPEGMFKNLTSLQSLFVDNF  908

Query  626   ADLEYMEIELF-PSLEYLWVYDCRNLRDWGKKGDHEDAPKALAKLAPSVIEFEVKNCPKL  450
              +L+ +  E F P+L +L++Y+C  +         E  P+ + +   S+   E+ +C  +
Sbjct  909   PNLKELPNEPFNPALTHLYIYNCNEI---------ESLPEKMWEGLQSLRTLEIWDCKGM  959

Query  449   KLLPQGMRLLSSSTKFSISGCPLLKQKYKSKSGQNWPEVANI  324
             + LP+G+R L+S     I  CP L+++ K  +G++W ++A+I
Sbjct  960   RCLPEGIRHLTSLEFLRIWSCPTLEERCKEGTGEDWDKIAHI  1001



>gb|AAR29071.1| blight resistance protein RGA3 [Solanum bulbocastanum]
Length=979

 Score = 77.8 bits (190),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 80/270 (30%), Positives = 127/270 (47%), Gaps = 48/270 (18%)
 Frame = -2

Query  1064  MTTIYIKNCPPGKQLPQFHLLPSLG--ELYFESIMVDYIDTTDYEDDNSPSRSELFFPSL  891
             + +I I+ C     LP F  LP L   EL+  S  V+Y+     ED+  P R    FPSL
Sbjct  728   VVSIRIRGCENCSCLPPFGELPCLESLELHTGSADVEYV-----EDNVHPGR----FPSL  778

Query  890   KKLWIWNCPNLKGWWKKNDEAIEEELLPPFPCISVVDIKQSPNVTWMPLF--PTVSEKLY  717
             +KL IW+  NLKG  KK  E         FP +      +     W P+F  PT+S    
Sbjct  779   RKLVIWDFSNLKGLLKKEGE-------KQFPVL------EEMTFYWCPMFVIPTLSS---  822

Query  716   IVTGSIIPLEHTK-KVCSSFKYLKKLWVSEVADLEYMEIELFPSL---EYLWVYDCRNLR  549
             + T  +I  + T  +  S+ + L  L +S   +   +  E+F SL   +YL +   RNL+
Sbjct  823   VKTLKVIATDATVLRSISNLRALTSLDISNNVEATSLPEEMFKSLANLKYLNISFFRNLK  882

Query  548   DWGKKGDHEDAPKAL---------------AKLAPSVIEFEVKNCPKLKLLPQGMRLLSS  414
             +        +A K+L                K   S+ E  V NC  LK LP+G++ L++
Sbjct  883   ELPTSLASLNALKSLKFEFCNALESLPEEGVKGLTSLTELSVSNCMMLKCLPEGLQHLTA  942

Query  413   STKFSISGCPLLKQKYKSKSGQNWPEVANI  324
              T  +I+ CP++ ++ +   G++W ++A+I
Sbjct  943   LTTLTITQCPIVFKRCERGIGEDWHKIAHI  972



>gb|AES95690.2| LRR and NB-ARC domain disease resistance protein, putative [Medicago 
truncatula]
Length=1129

 Score = 77.8 bits (190),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 63/254 (25%), Positives = 106/254 (42%), Gaps = 29/254 (11%)
 Frame = -2

Query  1100  GSVLS-WKFASAYMTTIYIKNCPPGKQLPQFHLLPSLGELYFESIMVDYIDTTDYEDDNS  924
             G  LS W  +   +    + +CP  + LP    LP L  L    +     D+  +   N+
Sbjct  775   GHTLSNWLASLQCLVKFTLNDCPKCEFLPPMDELPHLKVLQLRRL-----DSLKFIAKNN  829

Query  923   PSRSELFFPSLKKLWIWNCPNLKGWWKKNDEAIEEELLPPFPCISVVDIKQSPNVTWMPL  744
              + + +FFPSLK+L I +C  LKGWW+ +   I +   P F CIS ++I+  P +  M L
Sbjct  830   QADTPIFFPSLKELTISDCLKLKGWWEND---IWDNDRPSFSCISKLNIQYCPQLACMLL  886

Query  743   FPTVSEKLYIVTGSIIPLEHTKKVCSSFKYLKKLWVSEVADLEYMEIELFPSLEYLWVYD  564
             +P + ++L +V  ++  +  T                    + Y +              
Sbjct  887   YPGLDDELVLVESNVRSMRDT--------------------MHYADSTESTETSSSQSQP  926

Query  563   CRNLRDWGKKGDHEDAPKALAKLAPSVIEFEVKNCPKLKLLPQGMRLLSSSTKFSISGCP  384
                L+    +   +  P++  K   S+ E  +++C  L+ LPQG + LSS    SI  C 
Sbjct  927   FSKLKSMVIERIDQSPPESWLKNFISLEELHIRDCFILESLPQGFKFLSSLISLSIERCE  986

Query  383   LLKQKYKSKSGQNW  342
              L       +G  W
Sbjct  987   QLVLDIDKSAGTEW  1000



>ref|XP_006352941.1| PREDICTED: putative disease resistance protein RGA4-like [Solanum 
tuberosum]
Length=988

 Score = 77.8 bits (190),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 76/268 (28%), Positives = 120/268 (45%), Gaps = 37/268 (14%)
 Frame = -2

Query  1064  MTTIYIKNCPPGKQLPQFHLLPSLGELYFE--SIMVDYIDTTDYEDDNSPSRSELFFPSL  891
             + +I IK+C     LP F  LP L  L  +  S  V+Y++  D     S  R    FPSL
Sbjct  731   VISIRIKSCKNCLCLPPFGELPCLESLELQNGSAEVEYVEEDDVHSRFSTRRR---FPSL  787

Query  890   KKLWIWNCPNLKGWWKKNDEAIEEELLPPFPCISVVDIKQSPNVTWMPLFPTVSE-KLYI  714
             KKL IW   NLKG  K+  E         FP +  + I   P    + +FP +S  K   
Sbjct  788   KKLRIWFFRNLKGLVKQEGEN-------KFPMLEEMAILHCP----LFVFPILSSVKKLE  836

Query  713   VTGSIIPLEHTKKVCSSFKYLKKLWVSEVADLEYMEIELFPSL---EYLWVYDCRNLRDW  543
             V G+           S+   L  L +        +  E+F SL   EYL  +D +NL++ 
Sbjct  837   VHGNTKA--RGLSSISNLSTLTSLRIGANYRATSLPEEMFTSLTNLEYLSFFDFKNLKEL  894

Query  542   GKKGDHEDAPKALA---------------KLAPSVIEFEVKNCPKLKLLPQGMRLLSSST  408
                    +A K L                +   S+ +  VK C  L+ LP+G++ L++ T
Sbjct  895   PTSLTSLNALKRLQIESCDSLESLPEQGLEGLTSLTQLFVKYCKMLECLPEGLQHLTALT  954

Query  407   KFSISGCPLLKQKYKSKSGQNWPEVANI  324
              F ++GCP ++++   + G++W ++A+I
Sbjct  955   NFGVTGCPEVEKRCDKEIGEDWHKIAHI  982



>ref|XP_003612732.1| Cc-nbs-lrr resistance protein [Medicago truncatula]
Length=1178

 Score = 77.8 bits (190),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 63/254 (25%), Positives = 106/254 (42%), Gaps = 29/254 (11%)
 Frame = -2

Query  1100  GSVLS-WKFASAYMTTIYIKNCPPGKQLPQFHLLPSLGELYFESIMVDYIDTTDYEDDNS  924
             G  LS W  +   +    + +CP  + LP    LP L  L    +     D+  +   N+
Sbjct  775   GHTLSNWLASLQCLVKFTLNDCPKCEFLPPMDELPHLKVLQLRRL-----DSLKFIAKNN  829

Query  923   PSRSELFFPSLKKLWIWNCPNLKGWWKKNDEAIEEELLPPFPCISVVDIKQSPNVTWMPL  744
              + + +FFPSLK+L I +C  LKGWW+ +   I +   P F CIS ++I+  P +  M L
Sbjct  830   QADTPIFFPSLKELTISDCLKLKGWWEND---IWDNDRPSFSCISKLNIQYCPQLACMLL  886

Query  743   FPTVSEKLYIVTGSIIPLEHTKKVCSSFKYLKKLWVSEVADLEYMEIELFPSLEYLWVYD  564
             +P + ++L +V  ++  +  T                    + Y +              
Sbjct  887   YPGLDDELVLVESNVRSMRDT--------------------MHYADSTESTETSSSQSQP  926

Query  563   CRNLRDWGKKGDHEDAPKALAKLAPSVIEFEVKNCPKLKLLPQGMRLLSSSTKFSISGCP  384
                L+    +   +  P++  K   S+ E  +++C  L+ LPQG + LSS    SI  C 
Sbjct  927   FSKLKSMVIERIDQSPPESWLKNFISLEELHIRDCFILESLPQGFKFLSSLISLSIERCE  986

Query  383   LLKQKYKSKSGQNW  342
              L       +G  W
Sbjct  987   QLVLDIDKSAGTEW  1000



>ref|XP_003615650.1| NBS-LRR resistance protein [Medicago truncatula]
Length=1169

 Score = 77.8 bits (190),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 71/260 (27%), Positives = 126/260 (48%), Gaps = 32/260 (12%)
 Frame = -2

Query  1088  SWKFASAYMTTIYIKNCPPGKQLPQFHLLPSLGELYFESIMVDYIDTTDY-EDDNSPSRS  912
             SW    + + ++ +++C    +LP    LPSL +L      + Y+D   Y +DD S    
Sbjct  747   SWIIILSNLISLKLEDCNKIVRLPLLGKLPSLKKLE-----LSYMDNLKYLDDDESQDGM  801

Query  911   EL-FFPSLKKLWIWNCPNLKGWWKKNDEAIEEELLPPFPCISVVDIKQSPNVTWMPLFPT  735
             E+  FPSL++L ++  PN++G  K        E    FPC+S +DI + P +  +P  P+
Sbjct  802   EVRIFPSLEELVLYKLPNIEGLLKV-------ERGEMFPCLSSLDIWKCPKIG-LPCLPS  853

Query  734   VSEKLYIVTGSIIPLEHTKKVCSSFKYLKKLWVSEVADLEYMEIELF---PSLEYLWVYD  564
             + +    +       E  + + S+F  L +L +S+   +      +F    SL  L+VY 
Sbjct  854   LKD----LVADPCNNELLRSI-STFCGLTQLALSDGEGITSFPEGMFKNLTSLLSLFVYC  908

Query  563   CRNLRDWGKKGDHEDAPKALAKLAPSVIEFEVKNCPKLKLLPQGMRLLSSSTKFSISGCP  384
                L         E  P+   +   S+    + NC  L+ LP+G+R L+S    +I GCP
Sbjct  909   FSQL---------ESLPEQNWEGLQSLRILRIWNCEGLRCLPEGIRHLTSLELLAIEGCP  959

Query  383   LLKQKYKSKSGQNWPEVANI  324
              L+++ K  +G++W ++A+I
Sbjct  960   TLEERCKEGTGEDWDKIAHI  979



>gb|AES98608.2| NB-ARC domain disease resistance protein [Medicago truncatula]
Length=1115

 Score = 77.4 bits (189),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 71/260 (27%), Positives = 126/260 (48%), Gaps = 32/260 (12%)
 Frame = -2

Query  1088  SWKFASAYMTTIYIKNCPPGKQLPQFHLLPSLGELYFESIMVDYIDTTDY-EDDNSPSRS  912
             SW    + + ++ +++C    +LP    LPSL +L      + Y+D   Y +DD S    
Sbjct  747   SWIIILSNLISLKLEDCNKIVRLPLLGKLPSLKKLE-----LSYMDNLKYLDDDESQDGM  801

Query  911   EL-FFPSLKKLWIWNCPNLKGWWKKNDEAIEEELLPPFPCISVVDIKQSPNVTWMPLFPT  735
             E+  FPSL++L ++  PN++G  K        E    FPC+S +DI + P +  +P  P+
Sbjct  802   EVRIFPSLEELVLYKLPNIEGLLKV-------ERGEMFPCLSSLDIWKCPKIG-LPCLPS  853

Query  734   VSEKLYIVTGSIIPLEHTKKVCSSFKYLKKLWVSEVADLEYMEIELF---PSLEYLWVYD  564
             + +    +       E  + + S+F  L +L +S+   +      +F    SL  L+VY 
Sbjct  854   LKD----LVADPCNNELLRSI-STFCGLTQLALSDGEGITSFPEGMFKNLTSLLSLFVYC  908

Query  563   CRNLRDWGKKGDHEDAPKALAKLAPSVIEFEVKNCPKLKLLPQGMRLLSSSTKFSISGCP  384
                L         E  P+   +   S+    + NC  L+ LP+G+R L+S    +I GCP
Sbjct  909   FSQL---------ESLPEQNWEGLQSLRILRIWNCEGLRCLPEGIRHLTSLELLAIEGCP  959

Query  383   LLKQKYKSKSGQNWPEVANI  324
              L+++ K  +G++W ++A+I
Sbjct  960   TLEERCKEGTGEDWDKIAHI  979



>ref|XP_006366885.1| PREDICTED: putative disease resistance protein RGA1-like [Solanum 
tuberosum]
Length=983

 Score = 77.4 bits (189),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 78/281 (28%), Positives = 123/281 (44%), Gaps = 64/281 (23%)
 Frame = -2

Query  1064  MTTIYIKNCPPGKQLPQFHLLPSLG--ELYFESIMVDYIDTTDYEDDNSPSR--SELFFP  897
             + +I I  C     LP F  LP L   ELY  S  V+Y+     E+DN  SR  +   FP
Sbjct  729   VISIEIYGCENCSHLPPFGELPCLESLELYDGSWEVEYV-----EEDNIHSRFPTRRRFP  783

Query  896   SLKKLWIWNCPNLKGWWKKNDEAIEEELLPPFPCISVVDIKQSPNVTWMPLFPTVSEKLY  717
             SL+KL I +  NLKG  KK  E         FP +  + I   P   +  L  +V E   
Sbjct  784   SLRKLCICHFRNLKGLLKKETE-------EQFPMLQEMKIIHCPIFVFSAL-SSVKE---  832

Query  716   IVTGSIIPLEHTKKVCS--SFKYLKKLWVSE--------------VADLEYMEIELF---  594
                   + +E    +CS  +   L  L +S               + DL+ ++I  F   
Sbjct  833   ------LEIEGDTALCSISNLSTLTSLNISSNDEVTSLPEEMFRSLVDLKCLKISFFKNL  886

Query  593   ----------PSLEYLWVYDCRNLRDWGKKGDHEDAPKALAKLAPSVIEFEVKNCPKLKL  444
                        +L++L +  C  L         E  P+   +   S+ E  V+ C  +K 
Sbjct  887   KELPTSLVSLTALKHLEILGCDAL---------ESLPEEGLEGLTSLTELSVEYCEMIKC  937

Query  443   LPQGMRLLSSSTKFSISGCPLLKQKYKSKSGQNWPEVANIT  321
             LP+G++ L+S T  +++GCP L++ Y+ + G++W ++A IT
Sbjct  938   LPEGLQHLTSLTSLTVTGCPELEKLYEKRIGEDWHKIARIT  978



>ref|XP_010097431.1| Putative disease resistance protein RGA3 [Morus notabilis]
 gb|EXB68161.1| Putative disease resistance protein RGA3 [Morus notabilis]
Length=1065

 Score = 76.6 bits (187),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 64/234 (27%), Positives = 114/234 (49%), Gaps = 35/234 (15%)
 Frame = -2

Query  1064  MTTIYIKNCPPGKQLPQFHLLPSLGELYFESIMVDYIDTTDYEDDNSPSRSELFFPSLKK  885
             +  + ++ C   K LP F  L  L     + +++D I   +Y +D S +    +FP+L++
Sbjct  809   LVKLLLRKCWGCKYLPPFGQLVKL-----KVLILDEISNLEYIEDESKT----YFPALQE  859

Query  884   LWIWNCPNLKGWWKKNDEAI-EEELLPPFPCISVVDIKQSPNVTWMPLFPTVSEKLYIVT  708
             L +   P L+GW K    ++  ++ LP FPC+S + I+  P +  MPLFPT+ E L + +
Sbjct  860   LSLTEMPKLRGWRKTESVSLGNQKYLPSFPCLSKLVIENCPQLDSMPLFPTLEEGLVLES  919

Query  707   GSIIPLEHTKK--VCSSFKYLKKLWVSEVADLEYMEIELFPSLEYLWVYDCRNLRDWGKK  534
               + PL  TKK  + SS      L +S++ +L    I+ F               D  K 
Sbjct  920   TCLSPLHLTKKPELASSSTTSPPLALSKLKNLSIASIDKF---------------DGSKA  964

Query  533   GDHE-DAPKALAKLAPSVIEFEVKNCPKLKLLPQGMRLLSSSTKFSISGCPLLK  375
             G+   D+ K+L  L       ++ + P+L  LP+G++ +++  +  +  C L K
Sbjct  965   GEIAWDSLKSLQTL-------KLNSLPELTTLPEGLQQVTTLQELHVGHCGLKK  1011



>ref|XP_010026803.1| PREDICTED: disease resistance protein RGA2-like [Eucalyptus grandis]
Length=1039

 Score = 76.6 bits (187),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 92/371 (25%), Positives = 153/371 (41%), Gaps = 100/371 (27%)
 Frame = -2

Query  1151  QNPKQQPMLTLLPPEDI--GSVLSWKFASAYMTTIYIKNCPPGKQLPQFHLLPSLGELYF  978
             +N +  P LT L  +     S  SW  +   +  + +  C   K LP    L SL +L+ 
Sbjct  664   ENLRPHPNLTNLTIDSCMSRSAPSWLSSIKNLVELTLDECKEWKYLPPLGELSSLKKLFL  723

Query  977   ESI-MVDYIDTTDYEDDNSPSRSELFFPSLKKLWIWNCPNLKGWWKK--------NDEAI  825
             +++  ++++      + ++  R   FFPSL+KL ++NC NLKGWW +        + +  
Sbjct  724   KNLYALEFVQEIICVEQSNFVRP--FFPSLEKLELFNCENLKGWWGRTQLLGAYQDHQGY  781

Query  824   EEELLPPFPCISVVDIKQSPNVTWMPLFPTVSEKLYIVTGSIIPLEH---------TKKV  672
                 L  FP +  V+I   P +  MPLFP + E L ++  S+   E          ++ V
Sbjct  782   NSHSL--FPKLLHVEISYCPQLNSMPLFPRI-ETLVLIGCSMKWWEQQEMAVLNYFSEAV  838

Query  671   CSSF---KYLKKLWVSEVADLEYMEIE-LFP---SLEYLWVYDCRNLR------------  549
              S+F     L+ L+     DLE+  +E LFP   +L+ + +Y C  LR            
Sbjct  839   VSTFIPLSKLESLYFYYGVDLEHSMLETLFPFLKNLKSMTIYSCSKLRSLSCGMQYLSSL  898

Query  548   -----------DWGKKGD------------HEDAPKALAKLAP---------SVIEFEVK  465
                        D     D            H+     L+KL           S+   E+K
Sbjct  899   LDLVIHSCEELDLSSHDDEQGTQWRSLVNLHDLIISRLSKLVALPEGIQHVTSLESLEIK  958

Query  464   NCPKLKLLPQ------------------------GMRLLSSSTKFSISGCPLLKQKYKSK  357
              C  L  LP+                        GMR L+S  K SI+ CP+L+++ + +
Sbjct  959   ECQNLTSLPEWIGNFSSLQKLEIISCPSLTCLPIGMRRLTSLKKLSIAECPILEERCQRE  1018

Query  356   SGQNWPEVANI  324
             SG +W ++A++
Sbjct  1019  SGADWEKIAHL  1029



>ref|XP_008354960.1| PREDICTED: putative disease resistance protein RGA1, partial 
[Malus domestica]
Length=658

 Score = 76.3 bits (186),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 44/134 (33%), Positives = 73/134 (54%), Gaps = 9/134 (7%)
 Frame = -2

Query  1088  SWKFASAYMTTIYIKNCPPGKQLPQFHLLPSLGELYFESIMVDYIDTTDYEDDNSPSRSE  909
              W  +   +  + +++C   + LP F  LP L     + + +D +D  +Y  D S S S 
Sbjct  519   GWLSSLTNIVNLRLEDCQTCQYLPPFDHLPRL-----KVLSLDGLDALEYISDASSSASR  573

Query  908   L-FFPSLKKLWIWNCPNLKGWWKKN---DEAIEEELLPPFPCISVVDIKQSPNVTWMPLF  741
             + FFPSLKK+++WNCPNLKGWWK++      + E         S++ +   PN+T MPL+
Sbjct  574   ISFFPSLKKIYLWNCPNLKGWWKQSALIGSPMTENEHQHIQQSSLLYVWNCPNLTSMPLY  633

Query  740   PTVSEKLYIVTGSI  699
             P + ++L +   S+
Sbjct  634   PHLEDELSLRNTSL  647



>ref|XP_008465543.1| PREDICTED: putative disease resistance protein RGA4 [Cucumis 
melo]
Length=369

 Score = 75.1 bits (183),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 65/265 (25%), Positives = 126/265 (48%), Gaps = 33/265 (12%)
 Frame = -2

Query  1091  LSWKFASAYMTTIYIKNCPPGKQLPQFHLLPSLGELYFESI-MVDYIDTTDYEDDNSPSR  915
             +S KF    + T+ + +C   + LP+F   P+L  L  E +  ++YI      ++N    
Sbjct  119   VSSKFLGC-LVTVRLYHCERLRHLPRFDQFPNLKRLSLEVLPNIEYIIV----NNNDSVS  173

Query  914   SELFFPSLKKLWIWNCPNLKGWWKKNDEAIEEELLPPFPCISVVDIKQSPNVTWMPLFPT  735
             S   FPS+K+L I N P L  W K    A    ++  FPC+S + I     +  +  +  
Sbjct  174   SSTNFPSMKELEISNMPKLVSWCKGTTLAKSPIII--FPCLSSLTINGRCPLHMLKFWHA  231

Query  734   VSEKLYIVTGS-----IIPLEHTKKVCSSFKYLKKLWVSEVADLEYME---IELFPSLEY  579
              + K   ++ S     ++PL+       +++ L  L +  +++LEY+         SL +
Sbjct  232   PNLKSLKISDSEDELNVVPLK-------NYENLTSLCLFNLSELEYLPECWQHCMTSLRF  284

Query  578   LWVYDCRNLRDWGKKGDHEDAPKALAKLAPSVIEFEVKNCPKLKLLPQGMRLLSSSTKFS  399
             L +  C+NL+   +  D+            S+   ++ +C  L LLP+G++ + +  +  
Sbjct  285   LCLGRCKNLKSLPEWIDN----------FTSLDRLDIFSCENLTLLPEGIQHIRNLQRLR  334

Query  398   ISGCPLLKQKYKSKSGQNWPEVANI  324
             I  CP+L+++ K   G++W ++A+I
Sbjct  335   IECCPVLEERCKENIGEDWHKIAHI  359



>ref|XP_010671992.1| PREDICTED: disease resistance protein RGA2-like [Beta vulgaris 
subsp. vulgaris]
Length=1032

 Score = 76.3 bits (186),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 67/267 (25%), Positives = 125/267 (47%), Gaps = 34/267 (13%)
 Frame = -2

Query  1097  SVLSWKFASAYMTTIYIKNCPPGKQLPQFHLLPSLGELYFESI-MVDYIDTTDYEDDNSP  921
             +V +W  +   +  I ++ C   +++P    LP+L  L   S+  ++Y++T +    N+ 
Sbjct  780   AVDNWSVSLFRLVDISLQGCSNLQEMPILSKLPNLKTLALHSMDKLEYMETNNNNTSNAD  839

Query  920   SRSELFFPSLKKLWIWNCPNLKGWWKKNDEAIEEELLP-PFPCISVVDIKQSPNVTWMPL  744
             + +  FFPSL  L ++    LKGWWK++   +++      FP +  + I +  N+T  P 
Sbjct  840   TTT--FFPSLLTLGLYGMEKLKGWWKEDQPGVDDHRQSFGFPLLCQLTIGRCSNLTTFPA  897

Query  743   FPTVSEKLYIVTGSIIPLEHTKKVCSSF----KYLKKLWVSEVADLEYMEIELFPSLEYL  576
              P++ +         + L   K + SSF    + LK  ++S +  L    I+   SL+ L
Sbjct  898   CPSLQD---------LELYDNKMLWSSFPQNLRILKFKYLSNMTSLPE-GIQYLSSLQSL  947

Query  575   WVYDCRNLRDWGKKGDHEDAPKALAK---LAPSVIEFEVKNCPKLKLLPQGMRLLSSSTK  405
              ++ C             D  KAL +      S+    +  C  LK LP+ MR L++  +
Sbjct  948   ELFRC-------------DRIKALPEWISCLSSLQSLSIYRCLALKTLPEAMRNLTTLQR  994

Query  404   FSISGCPLLKQKYKSKSGQNWPEVANI  324
               I  C  L+++ K  +G+++P+V  I
Sbjct  995   LYIGRCRDLEERCKKPNGEDYPKVQYI  1021



>gb|ACI25289.1| late blight resistance protein Rpi-pta1 [Solanum stoloniferum]
Length=970

 Score = 76.3 bits (186),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 76/259 (29%), Positives = 121/259 (47%), Gaps = 39/259 (15%)
 Frame = -2

Query  1064  MTTIYIKNCPPGKQLPQFHLLPSLG--ELYFESIMVDYIDTTDYEDDNSPSRSELFFPSL  891
             + +I I N      LP F  LP L   EL++ S  V+Y++  D  D +S   + + FPSL
Sbjct  732   IVSILISNFRNCSCLPPFGDLPCLESLELHWGSADVEYVEEVDI-DVHSGFPTRIRFPSL  790

Query  890   KKLWIWNCPNLKGWWKKNDEAIEEELLPPFPCISVVDIKQSPNVTWMPLFPTVSEKLYIV  711
             +KL IW+  +LKG  KK  E         FP +  + I + P       F T+S  L  +
Sbjct  791   RKLDIWDFGSLKGLLKKEGE-------EQFPVLEELIIHECP-------FLTLSSNLRAL  836

Query  710   TGSIIPLEHTKKVCSSF--------KYLKKLWVSEVADLEYMEIEL--FPSLEYLWVYDC  561
             T   I      KV +SF          LK L +S   +L+ +   L    +L+ L +  C
Sbjct  837   TSLRICY---NKVATSFPEEMFKNLANLKYLTISRCNNLKELPTSLASLNALKSLKIQLC  893

Query  560   RNLRDWGKKGDHEDAPKALAKLAPSVIEFEVKNCPKLKLLPQGMRLLSSSTKFSISGCPL  381
               L         E  P+   +   S+ E  V++C  LK LP+G++ L++ T   I GCP 
Sbjct  894   CAL---------ESLPEEGLEGLSSLTELFVEHCNMLKCLPEGLQHLTTLTSLKIRGCPQ  944

Query  380   LKQKYKSKSGQNWPEVANI  324
             L ++ +   G++W ++++I
Sbjct  945   LIKRCEKGIGEDWHKISHI  963



>gb|ACI25288.1| late blight resistance protein Rpi-sto1 [Solanum stoloniferum]
Length=970

 Score = 76.3 bits (186),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 76/259 (29%), Positives = 121/259 (47%), Gaps = 39/259 (15%)
 Frame = -2

Query  1064  MTTIYIKNCPPGKQLPQFHLLPSLG--ELYFESIMVDYIDTTDYEDDNSPSRSELFFPSL  891
             + +I I N      LP F  LP L   EL++ S  V+Y++  D  D +S   + + FPSL
Sbjct  732   IVSILISNFRNCSCLPPFGDLPCLESLELHWGSADVEYVEEVDI-DVHSGFPTRIRFPSL  790

Query  890   KKLWIWNCPNLKGWWKKNDEAIEEELLPPFPCISVVDIKQSPNVTWMPLFPTVSEKLYIV  711
             +KL IW+  +LKG  KK  E         FP +  + I + P       F T+S  L  +
Sbjct  791   RKLDIWDFGSLKGLLKKEGE-------EQFPVLEEMIIHECP-------FLTLSSNLRAL  836

Query  710   TGSIIPLEHTKKVCSSF--------KYLKKLWVSEVADLEYMEIEL--FPSLEYLWVYDC  561
             T   I      KV +SF          LK L +S   +L+ +   L    +L+ L +  C
Sbjct  837   TSLRICY---NKVATSFPEEMFKNLANLKYLTISRCNNLKELPTSLASLNALKSLKIQLC  893

Query  560   RNLRDWGKKGDHEDAPKALAKLAPSVIEFEVKNCPKLKLLPQGMRLLSSSTKFSISGCPL  381
               L         E  P+   +   S+ E  V++C  LK LP+G++ L++ T   I GCP 
Sbjct  894   CAL---------ESLPEEGLEGLSSLTELFVEHCNMLKCLPEGLQHLTTLTSLKIRGCPQ  944

Query  380   LKQKYKSKSGQNWPEVANI  324
             L ++ +   G++W ++++I
Sbjct  945   LIKRCEKGIGEDWHKISHI  963



>sp|Q7XBQ9.1|RGA2_SOLBU RecName: Full=Disease resistance protein RGA2; AltName: Full=Blight 
resistance protein RPI; AltName: Full=RGA2-blb [Solanum 
bulbocastanum]
 gb|AAP86601.1| putative disease resistant protein RGA2 [Solanum bulbocastanum]
 gb|AAR29069.1| blight resistance protein RPI [Solanum bulbocastanum]
Length=970

 Score = 76.3 bits (186),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 76/259 (29%), Positives = 121/259 (47%), Gaps = 39/259 (15%)
 Frame = -2

Query  1064  MTTIYIKNCPPGKQLPQFHLLPSLG--ELYFESIMVDYIDTTDYEDDNSPSRSELFFPSL  891
             + +I I N      LP F  LP L   EL++ S  V+Y++  D  D +S   + + FPSL
Sbjct  732   IVSILISNFRNCSCLPPFGDLPCLESLELHWGSADVEYVEEVDI-DVHSGFPTRIRFPSL  790

Query  890   KKLWIWNCPNLKGWWKKNDEAIEEELLPPFPCISVVDIKQSPNVTWMPLFPTVSEKLYIV  711
             +KL IW+  +LKG  KK  E         FP +  + I + P       F T+S  L  +
Sbjct  791   RKLDIWDFGSLKGLLKKEGE-------EQFPVLEEMIIHECP-------FLTLSSNLRAL  836

Query  710   TGSIIPLEHTKKVCSSF--------KYLKKLWVSEVADLEYMEIEL--FPSLEYLWVYDC  561
             T   I      KV +SF          LK L +S   +L+ +   L    +L+ L +  C
Sbjct  837   TSLRICY---NKVATSFPEEMFKNLANLKYLTISRCNNLKELPTSLASLNALKSLKIQLC  893

Query  560   RNLRDWGKKGDHEDAPKALAKLAPSVIEFEVKNCPKLKLLPQGMRLLSSSTKFSISGCPL  381
               L         E  P+   +   S+ E  V++C  LK LP+G++ L++ T   I GCP 
Sbjct  894   CAL---------ESLPEEGLEGLSSLTELFVEHCNMLKCLPEGLQHLTTLTSLKIRGCPQ  944

Query  380   LKQKYKSKSGQNWPEVANI  324
             L ++ +   G++W ++++I
Sbjct  945   LIKRCEKGIGEDWHKISHI  963



>ref|XP_006586822.1| PREDICTED: putative disease resistance protein RGA3-like isoform 
X1 [Glycine max]
 ref|XP_006586823.1| PREDICTED: putative disease resistance protein RGA3-like isoform 
X2 [Glycine max]
Length=1007

 Score = 76.3 bits (186),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 67/256 (26%), Positives = 115/256 (45%), Gaps = 33/256 (13%)
 Frame = -2

Query  1079  FASAYMTTIYIKNCPPGKQLPQFHLLPSLGEL-YFESIMVDYIDTTDYEDDNSPSRSELF  903
              +S  +  + +K+C    QLP  + LPSL  L     I V+Y+    Y+        E+ 
Sbjct  768   ISSLSLKYLNLKDCKNCLQLPPLYKLPSLNTLRILNMIHVEYLYEESYD-------GEVV  820

Query  902   FPSLKKLWIWNCPNLKGWWKKNDEAIEEELLPPFPCISVVDIKQSPNVTWMPLFPTVSEK  723
             F +L++L +   PNLK   +++ E +       FPC S ++I + P      +       
Sbjct  821   FRALEELTLRRLPNLKRLSREDRENM-------FPCFSRLEIDECPKFFGEEVLLQGLRS  873

Query  722   LYIVTGSIIPLEHTKKVCSSFKYLKKLWVSEVADLEYME-IELFPSLEYLWVYDCRNLRD  546
             L +             V S FK L KLW+S  A +E ++ ++   SL+ L +     L  
Sbjct  874   LSVFNCGKF------NVSSGFKCLHKLWLSNCAAVEDLQALQDMTSLQELRLTGLPKL--  925

Query  545   WGKKGDHEDAPKALAKLAPSVIEFEVKNCPKLKLLPQGMRLLSSSTKFSISGC-PLLKQK  369
                    E  P     + P +  F +  C KL  LP  +RL +S  + +I GC P L+++
Sbjct  926   -------ESLPDCFGDI-PLLHTFSIFYCSKLTYLPMSLRLTTSLQQLTIFGCHPELEKR  977

Query  368   YKSKSGQNWPEVANIT  321
                ++G++WP + +I+
Sbjct  978   CDKETGEDWPNIVHIS  993



>ref|XP_010659415.1| PREDICTED: putative disease resistance protein RGA3 isoform X1 
[Vitis vinifera]
 ref|XP_010659416.1| PREDICTED: putative disease resistance protein RGA3 isoform X1 
[Vitis vinifera]
 ref|XP_010659417.1| PREDICTED: putative disease resistance protein RGA3 isoform X1 
[Vitis vinifera]
 ref|XP_010659418.1| PREDICTED: putative disease resistance protein RGA3 isoform X1 
[Vitis vinifera]
 ref|XP_010659419.1| PREDICTED: putative disease resistance protein RGA3 isoform X1 
[Vitis vinifera]
 ref|XP_010659420.1| PREDICTED: putative disease resistance protein RGA3 isoform X1 
[Vitis vinifera]
 ref|XP_010659421.1| PREDICTED: putative disease resistance protein RGA3 isoform X1 
[Vitis vinifera]
 ref|XP_010659422.1| PREDICTED: putative disease resistance protein RGA3 isoform X1 
[Vitis vinifera]
 ref|XP_010659423.1| PREDICTED: putative disease resistance protein RGA3 isoform X1 
[Vitis vinifera]
 ref|XP_010659424.1| PREDICTED: putative disease resistance protein RGA3 isoform X1 
[Vitis vinifera]
 ref|XP_010659425.1| PREDICTED: putative disease resistance protein RGA3 isoform X1 
[Vitis vinifera]
 ref|XP_010659426.1| PREDICTED: putative disease resistance protein RGA3 isoform X1 
[Vitis vinifera]
 ref|XP_010659428.1| PREDICTED: putative disease resistance protein RGA3 isoform X1 
[Vitis vinifera]
 ref|XP_010659429.1| PREDICTED: putative disease resistance protein RGA3 isoform X1 
[Vitis vinifera]
 ref|XP_010659430.1| PREDICTED: putative disease resistance protein RGA3 isoform X1 
[Vitis vinifera]
 ref|XP_010659431.1| PREDICTED: putative disease resistance protein RGA3 isoform X1 
[Vitis vinifera]
 ref|XP_010659432.1| PREDICTED: putative disease resistance protein RGA3 isoform X1 
[Vitis vinifera]
 emb|CAN62651.1| hypothetical protein VITISV_003942 [Vitis vinifera]
Length=1129

 Score = 75.9 bits (185),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 89/337 (26%), Positives = 137/337 (41%), Gaps = 104/337 (31%)
 Frame = -2

Query  1064  MTTIYIKNCPPGKQLPQFHLLPSLGELYFESIMVDYIDTTDYEDDNSPSRSELFFPSLKK  885
             +  I I +C   + LP F  LPSL  L    IM   ID   Y  D  PS +  FFPSLK 
Sbjct  800   LVKIEISSCNRSQVLPPFGQLPSLKYL---DIM--QIDDVGYMRD-YPSSATPFFPSLKT  853

Query  884   LWIWNCPNLKGWWKKNDEAIEEELLPPFPCISV-----------------------VDIK  774
             L ++  P+L+GW +++   I  E  P FPC+S+                       ++I+
Sbjct  854   LQLYWLPSLEGWGRRD---ISVEQAPSFPCLSILKISHCSSLRSLSLPSSPSCISQLEIR  910

Query  773   QSPNVTWM--PLFPTVSEKLYIVTGSIIPLEHTKKVCSSFKYLKKLWVSEVADLEYM---  609
               P VT++  P FP + E     T + + L+    + S    LK L++SE+ DL  +   
Sbjct  911   DCPGVTFLQVPSFPCLKELWLDNTSTELCLQ----LISVSSSLKSLYISEIDDLISLPEG  966

Query  608   --------------------EIELFPSLEYLWVYDCR--NLRD-----------------  546
                                  I+    LE L + +CR  NL D                 
Sbjct  967   LRHLTSLKSLIIDNCDSLPQGIQYLTVLESLDIINCREVNLSDDDGLQFQGLRSLRHLYL  1026

Query  545   -WGKK----------------------GDHEDAPKALAKLAPSVIEFEVKNCPKLKLLPQ  435
              W +K                       D    P  +A L  S+ +  ++ CPKL  LP+
Sbjct  1027  GWIRKWVSLPKGLQHVSTLETLELNRLYDLATLPNWIASLT-SLTKLSLEECPKLTSLPE  1085

Query  434   GMRLLSSSTKFSISGCPLLKQKYKSKSGQNWPEVANI  324
              MR L++     IS C  L ++ K ++G++WP +++I
Sbjct  1086  EMRSLNNLHTLKISYCRNLVKRCKKEAGEDWPRISHI  1122



>gb|KEH26310.1| NBS-LRR type disease resistance protein [Medicago truncatula]
Length=964

 Score = 75.9 bits (185),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 76/332 (23%), Positives = 139/332 (42%), Gaps = 70/332 (21%)
 Frame = -2

Query  1166  IRLEEQNPKQQPMLTLLPPEDIGSVLSWKFASAYMTTIYIKNCPPGKQLPQFHLLPSLGE  987
             +  +++ P     L++  P+ + S+ +W      +  + + NC   + LP    LP    
Sbjct  646   VTFKDKTPSGFRKLSIQQPKGL-SLSNWLSPVTNIIELCLYNCQDLRYLPPLERLP----  700

Query  986   LYFESIMVDYIDTTDYEDDNSPSRSELFFPSLKKLWIWNCPNLKGWWKKNDE-----AIE  822
              + +S+ + +++  +Y     P   E FFPSL+ L  + C  LKGW +  D+     +  
Sbjct  701   -FLKSLDLRWLNQLEYIYYEEPILHESFFPSLEILNFFECWKLKGWRRMGDDLNDINSSH  759

Query  821   EELLPPFPCISVVDIKQSPNVTWMPLFPTVSEKLYIVTGSIIPLEHTKKVCS--------  666
                LP FPC+S + I +   +T+MP FP + +KL + + S   LE T  +          
Sbjct  760   HLFLPHFPCLSKLVIVRCKMLTFMPTFPNIKKKLELWSCSAEILEATLNIAESQYSIGFP  819

Query  665   ------SFKYLKKL---------WVSEVADLEYMEIE-------------------LFPS  588
                   SF  ++ +         W+  +  LE ++++                     PS
Sbjct  820   PLSILKSFHIIETIMGMENVPKDWLKNLTSLENLDLDSLSSQQFEVIEMWFKDDLICLPS  879

Query  587   LEYLWVYDCR--NLRDWGKKGDHEDAPKALAKLAPSVIEFEVKNCPKLKLLPQGMRLLSS  414
             L+ + +  CR   L DW            +  ++ S+    V  C  L  LP+GM  L++
Sbjct  880   LQKIQIRTCRLKALPDW------------ICNIS-SLQHLAVYGCESLVDLPEGMPRLTN  926

Query  413   STKFSISGCPL--LKQKYKSKSGQNWPEVANI  324
                  I GCP+     ++  K+G  W ++A+I
Sbjct  927   LHTLEIIGCPISYYYDEFLRKTGATWSKIAHI  958



>ref|XP_010659434.1| PREDICTED: putative disease resistance protein RGA4 isoform X3 
[Vitis vinifera]
Length=782

 Score = 75.5 bits (184),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 90/337 (27%), Positives = 138/337 (41%), Gaps = 104/337 (31%)
 Frame = -2

Query  1064  MTTIYIKNCPPGKQLPQFHLLPSLGELYFESIMVDYIDTTDYEDDNSPSRSELFFPSLKK  885
             +  I I +C   + LP F  LPSL  L    IM   ID   Y  D  PS +  FFPSLK 
Sbjct  453   LVKIEISSCNRSQVLPPFGQLPSLKYL---DIM--QIDDVGYMRD-YPSSATPFFPSLKT  506

Query  884   LWIWNCPNLKGWWKKNDEAIEEELLPPFPCISV-----------------------VDIK  774
             L ++  P+L+GW +++   I  E  P FPC+S+                       ++I+
Sbjct  507   LQLYWLPSLEGWGRRD---ISVEQAPSFPCLSILKISHCSSLRSLSLPSSPSCISQLEIR  563

Query  773   QSPNVTWM--PLFPTVSEKLYIVTGSIIPLEHTKKVCSSFKYLKKLWVSEVADLEYM---  609
               P VT++  P FP + E L++   S    E   ++ S    LK L++SE+ DL  +   
Sbjct  564   DCPGVTFLQVPSFPCLKE-LWLDNTST---ELCLQLISVSSSLKSLYISEIDDLISLPEG  619

Query  608   --------------------EIELFPSLEYLWVYDCR--NLRD-----------------  546
                                  I+    LE L + +CR  NL D                 
Sbjct  620   LRHLTSLKSLIIDNCDSLPQGIQYLTVLESLDIINCREVNLSDDDGLQFQGLRSLRHLYL  679

Query  545   -WGKK----------------------GDHEDAPKALAKLAPSVIEFEVKNCPKLKLLPQ  435
              W +K                       D    P  +A L  S+ +  ++ CPKL  LP+
Sbjct  680   GWIRKWVSLPKGLQHVSTLETLELNRLYDLATLPNWIASLT-SLTKLSLEECPKLTSLPE  738

Query  434   GMRLLSSSTKFSISGCPLLKQKYKSKSGQNWPEVANI  324
              MR L++     IS C  L ++ K ++G++WP +++I
Sbjct  739   EMRSLNNLHTLKISYCRNLVKRCKKEAGEDWPRISHI  775



>ref|XP_010659433.1| PREDICTED: putative disease resistance protein RGA3 isoform X2 
[Vitis vinifera]
Length=927

 Score = 75.9 bits (185),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 90/337 (27%), Positives = 138/337 (41%), Gaps = 104/337 (31%)
 Frame = -2

Query  1064  MTTIYIKNCPPGKQLPQFHLLPSLGELYFESIMVDYIDTTDYEDDNSPSRSELFFPSLKK  885
             +  I I +C   + LP F  LPSL  L    IM   ID   Y  D  PS +  FFPSLK 
Sbjct  598   LVKIEISSCNRSQVLPPFGQLPSLKYL---DIM--QIDDVGYMRD-YPSSATPFFPSLKT  651

Query  884   LWIWNCPNLKGWWKKNDEAIEEELLPPFPCISV-----------------------VDIK  774
             L ++  P+L+GW +++   I  E  P FPC+S+                       ++I+
Sbjct  652   LQLYWLPSLEGWGRRD---ISVEQAPSFPCLSILKISHCSSLRSLSLPSSPSCISQLEIR  708

Query  773   QSPNVTWM--PLFPTVSEKLYIVTGSIIPLEHTKKVCSSFKYLKKLWVSEVADLEYM---  609
               P VT++  P FP + E L++   S    E   ++ S    LK L++SE+ DL  +   
Sbjct  709   DCPGVTFLQVPSFPCLKE-LWLDNTST---ELCLQLISVSSSLKSLYISEIDDLISLPEG  764

Query  608   --------------------EIELFPSLEYLWVYDCR--NLRD-----------------  546
                                  I+    LE L + +CR  NL D                 
Sbjct  765   LRHLTSLKSLIIDNCDSLPQGIQYLTVLESLDIINCREVNLSDDDGLQFQGLRSLRHLYL  824

Query  545   -WGKK----------------------GDHEDAPKALAKLAPSVIEFEVKNCPKLKLLPQ  435
              W +K                       D    P  +A L  S+ +  ++ CPKL  LP+
Sbjct  825   GWIRKWVSLPKGLQHVSTLETLELNRLYDLATLPNWIASLT-SLTKLSLEECPKLTSLPE  883

Query  434   GMRLLSSSTKFSISGCPLLKQKYKSKSGQNWPEVANI  324
              MR L++     IS C  L ++ K ++G++WP +++I
Sbjct  884   EMRSLNNLHTLKISYCRNLVKRCKKEAGEDWPRISHI  920



>ref|XP_007158237.1| hypothetical protein PHAVU_002G135600g [Phaseolus vulgaris]
 gb|ESW30231.1| hypothetical protein PHAVU_002G135600g [Phaseolus vulgaris]
Length=1136

 Score = 75.9 bits (185),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 79/292 (27%), Positives = 119/292 (41%), Gaps = 74/292 (25%)
 Frame = -2

Query  953   DTTDYEDDNSPSRSELFFPSLKKLWIWNCPNLKGWWKKNDEAIEEELLPPFPCISVVDIK  774
             D T  + + S S S  FFPSLK+L I +CP L+ WW   + A  E+  P F  IS +D++
Sbjct  802   DQTSADTEASSSSSTQFFPSLKELTISDCPKLQSWW---ETAKWEDNRPFFTRISKLDVQ  858

Query  773   QSPNVTWMPLFPTVSEKLYIVTGSIIPLEHT--KKVCSSFKYLKKLWVSEVADLEYMEIE  600
               P +  MPL+P + E+L +V  S+  +  T   +    F  L KL  + +A +     E
Sbjct  859   CCPELHCMPLYPYLGEELVLVDSSVKSMRDTVHARTSEDFLPLSKLKTTIIARITQSPPE  918

Query  599   L----FPSLEYLWVYDC------------------------------RNLRDW-GKKGDH  525
                  F SLE L + DC                              R+  +W G K   
Sbjct  919   RWLKNFISLETLKIRDCSKLVSLPQGFKSLSSLQSLTIERCAELDLDRSKSEWEGLKHLR  978

Query  524   EDAPKALAKLAP---------SVIEFEVKNCPKLKLLPQGMRLLSSSTK-----------  405
                 K + KL           S+ E ++  CP L  LP+ +  L+S TK           
Sbjct  979   VLTIKEIPKLKSLPWGVEDVISLEELQLHECPALTNLPETISNLTSLTKLVIFKCENLDS  1038

Query  404   -------------FSISGCPLLKQKYKSKSGQNWPEVANITTDW*LVNQYAY  288
                           SI+ C LL  + + ++G +WP++ +I  D  L   Y Y
Sbjct  1039  LPKGIEKIKSLYTLSITDCSLLTPRCQPETGDDWPQIGHI-KDIILKKSYQY  1089



>sp|Q7XA42.2|RGA1_SOLBU RecName: Full=Putative disease resistance protein RGA1; AltName: 
Full=RGA3-blb [Solanum bulbocastanum]
 gb|AAP45163.2| Disease resistance protein RGA1, putative [Solanum bulbocastanum]
Length=979

 Score = 75.9 bits (185),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 79/270 (29%), Positives = 127/270 (47%), Gaps = 48/270 (18%)
 Frame = -2

Query  1064  MTTIYIKNCPPGKQLPQFHLLPSLG--ELYFESIMVDYIDTTDYEDDNSPSRSELFFPSL  891
             + +I I+ C     LP F  LP L   EL+  S  V+Y+     ED+  P R    FPSL
Sbjct  728   VVSIRIRGCENCSCLPPFGELPCLESLELHTGSADVEYV-----EDNVHPGR----FPSL  778

Query  890   KKLWIWNCPNLKGWWKKNDEAIEEELLPPFPCISVVDIKQSPNVTWMPLF--PTVSEKLY  717
             +KL IW+  NLKG  K   E         FP +      +     W P+F  PT+S    
Sbjct  779   RKLVIWDFSNLKGLLKMEGE-------KQFPVL------EEMTFYWCPMFVIPTLSS---  822

Query  716   IVTGSIIPLEHTK-KVCSSFKYLKKLWVSEVADLEYMEIELFPSL---EYLWVYDCRNLR  549
             + T  +I  + T  +  S+ + L  L +S+  +   +  E+F SL   +YL +   RNL+
Sbjct  823   VKTLKVIVTDATVLRSISNLRALTSLDISDNVEATSLPEEMFKSLANLKYLKISFFRNLK  882

Query  548   DWGKKGDHEDAPKAL---------------AKLAPSVIEFEVKNCPKLKLLPQGMRLLSS  414
             +        +A K+L                K   S+ E  V NC  LK LP+G++ L++
Sbjct  883   ELPTSLASLNALKSLKFEFCDALESLPEEGVKGLTSLTELSVSNCMMLKCLPEGLQHLTA  942

Query  413   STKFSISGCPLLKQKYKSKSGQNWPEVANI  324
              T  +I+ CP++ ++ +   G++W ++A+I
Sbjct  943   LTTLTITQCPIVFKRCERGIGEDWHKIAHI  972



>ref|XP_006352943.1| PREDICTED: disease resistance protein RGA2-like [Solanum tuberosum]
Length=990

 Score = 75.5 bits (184),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 78/274 (28%), Positives = 129/274 (47%), Gaps = 46/274 (17%)
 Frame = -2

Query  1064  MTTIYIKNCPPGKQLPQFHLLPSLGELYFE--SIMVDYIDTTDYEDDNS-PSRSELFFPS  894
             + +I IK+C     LP F  LP L  L     S  ++Y++  D + D+  P+R  + FPS
Sbjct  729   IVSIVIKDCRNCLCLPPFGDLPCLESLKLSWGSADMEYVEEVDIDVDSGFPTR--IRFPS  786

Query  893   LKKLWIWNCPNLKGWWKKNDEAIEEELLPPFPCISVVDIKQSPNVTWMPLFPTVS-----  729
             L+KL IW   NLKG  KK  E         FP +  + I   P    M + PT+S     
Sbjct  787   LRKLAIWGFGNLKGLLKKEGE-------EQFPVLEEMTINGCP----MFVIPTLSSVKTL  835

Query  728   -----EKLYIVTGSIIPLEHTKKVCSSFKY----LKKLWVSEVADLEYMEIELFPSLEYL  576
                  +   IV  SI  L     +     Y    L +     +A+L+Y+ I  F +L+ L
Sbjct  836   KVLGDKSEAIVLRSIYKLTTLTSLYIINNYEATSLPEEMFKSLANLKYLNISFFKNLKGL  895

Query  575   -----WVYDCRNLR-DWGKKGDHEDAPKALAKLA----PSVIEFEVKNCPKLKLLPQGMR  426
                   +   ++LR  W       DA ++LA+       S+ E  V++C  LK LP+G++
Sbjct  896   PTSLASLNALKHLRIQWC------DALESLAEEGLDGLTSLTELFVEHCEMLKCLPEGLQ  949

Query  425   LLSSSTKFSISGCPLLKQKYKSKSGQNWPEVANI  324
              L++     I+ CP+++++ +   G++W ++A+I
Sbjct  950   HLTALKNLIITHCPIVEKRCEKGIGEDWHKIAHI  983



>ref|XP_008384979.1| PREDICTED: disease resistance protein RGA2-like [Malus domestica]
Length=1123

 Score = 75.1 bits (183),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 77/277 (28%), Positives = 119/277 (43%), Gaps = 42/277 (15%)
 Frame = -2

Query  1127  LTLLPPEDIGSV--LSWKFASAYMTTIYIKNCPPGKQLPQFHLLPSLGELYFESI-MVDY  957
             L +L   D G V   SW  +   +  + +  C   + LP     PSL  L  E    ++Y
Sbjct  757   LKMLSVSDYGGVRFASWFSSLINLVDLTLTGCHRCQHLPPLDHFPSLKSLQLEGFEKLEY  816

Query  956   IDTTDYEDDNSPSRSELFFPSLKKLWIWNCPNLKGWWKKNDE-------AIEEELLPPFP  798
             I     +  +S S S+    SL+ L + +CP LKGWW+ +         + E   LP FP
Sbjct  817   ISD---DTSSSNSMSDEMMTSLEFLCLSDCPVLKGWWRAHTHNNASSSSSTENLSLPSFP  873

Query  797   CISVVDIKQSPNVTWMPLFPTVS------------EKLYIVTGSIIPLEHTKKVCSS---  663
             C+S + I   PN+T MPL+P V             + L+    S I  +    V +S   
Sbjct  874   CLSTLQIWDCPNLTSMPLYPNVEGIDLNGCSWKVVDSLFGRGASDITHDVGVDVSASSSS  933

Query  662   --FKYLKKLWVSEVADLEYMEIELF---PSLEYLWVYDCRNLRDWGKKGDHEDAPKALAK  498
                  L +L + ++ DLE +  +     PSL+ L++ DC NL      G        +  
Sbjct  934   PHLSKLTRLSLIKIEDLECLTSQGMGNIPSLQSLYIRDCPNLALLPYHG--------MGN  985

Query  497   LAPSVIEFEVKNCPKLKLLPQGMRLLSSSTKFSISGC  387
             LA S  E  V+N   L  + +G+  L+S  + +I  C
Sbjct  986   LA-SFRELTVRNRSNLTSMLRGIANLTSLQELAIGDC  1021


 Score = 55.5 bits (132),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 39/124 (31%), Positives = 66/124 (53%), Gaps = 6/124 (5%)
 Frame = -2

Query  1553  SVAKLILAKIAPFAQDQIKLLWGLNEELTKLGDLVSHIGAVLLDAEGEKHNKKTENLLEM  1374
             +VA  I+  +   A  +I L+WG+ +EL KL ++V+    VLLDAE ++ N + +  L+ 
Sbjct  8     NVAARIIGGLGSLAFQEIGLIWGVQDELHKLKEIVAGFQGVLLDAEQKQTNNEVKLWLKS  67

Query  1373  LKNIMDEANRLMDYFSPRAKNHRPNQEDGCCS----YFVSHPNPFVWVSDSFMAGKIKSI  1206
             +++ + EA+ L+D F+  A   +   ++   S     F S  N   +     M+ KIK I
Sbjct  68    VEDAVYEADDLLDEFNTEALQRQMMCDNTKMSKKVRLFFSSSNQLAFRLK--MSHKIKDI  125

Query  1205  NNRL  1194
             N RL
Sbjct  126   NKRL  129



>ref|XP_003615681.1| NBS-LRR resistance protein [Medicago truncatula]
 gb|AES98639.1| disease resistance protein RGA4 [Medicago truncatula]
Length=1016

 Score = 75.1 bits (183),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 67/274 (24%), Positives = 132/274 (48%), Gaps = 37/274 (14%)
 Frame = -2

Query  1088  SWKFASAYMTTIYIKNCPPGKQLPQFHLLPSLGELYFESIMVDYIDTTDY-EDDNSPSRS  912
             SW    + + ++ +K C    +L    +LPSL     +++ + Y+D   Y +DD S    
Sbjct  756   SWIIILSNLVSLKLKRCKKVVRLQLLGILPSL-----KNLELSYMDNLKYLDDDESEDGM  810

Query  911   EL-FFPSLKKLWIWNCPNLKGWWKKNDEAIEEELLPPFPCISVVDIKQSPNVTWMPLFPT  735
             E+  FPSL++L ++  PN++G  K     +       FPC+S +DI +   +  +P  P+
Sbjct  811   EVRVFPSLEELVLYQLPNIEGLLKVERGEM-------FPCLSKLDISECRKLG-LPCLPS  862

Query  734   VSEKLYIVTGSIIPLEHTKKVCSSFKYLKKLWVSEVADLEYMEIELF---PSLEYLWVYD  564
             +      +T S    E  + + S+F+ L +L+V+    +      +F    SL+ L +Y+
Sbjct  863   LKS----LTVSECNNELLRSI-STFRGLTQLFVNGGEGITSFPEGMFKNLTSLQSLRIYN  917

Query  563   CRNLRDWGKK--------------GDHEDAPKALAKLAPSVIEFEVKNCPKLKLLPQGMR  426
                L++   +               + E  P+   +   S+    + +C  L+ LP+G+R
Sbjct  918   FPKLKELPNETFNPALTLLCICYCNELESLPEQNWEGLQSLRTLHIYSCEGLRCLPEGIR  977

Query  425   LLSSSTKFSISGCPLLKQKYKSKSGQNWPEVANI  324
              L+S    +I GC  LK++ K ++G++W ++++I
Sbjct  978   HLTSLELLTIIGCRTLKERCKKRTGEDWDKISHI  1011



>ref|XP_008354961.1| PREDICTED: putative disease resistance protein RGA4 [Malus domestica]
Length=1133

 Score = 74.7 bits (182),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 50/151 (33%), Positives = 80/151 (53%), Gaps = 18/151 (12%)
 Frame = -2

Query  1088  SWKFASAYMTTIYIKNCPPGKQLPQFHLLPSLGELYFESI-MVDYIDTTDYEDDNSPSRS  912
              W  +   +  + +K+C   + LP F  LP L  L  + +  ++YI      + +S    
Sbjct  770   GWLSSLTNIVNLSLKHCKTCQYLPPFDHLPCLKVLRLDGLNALEYIS-----EASSSPSR  824

Query  911   ELFFPSLKKLWIWNCPNLKGWWKKN-----------DEAIEEELLPPFPCISVVDIKQSP  765
               FFPSLK +++WNCPNLKGWWK++            + I++  L  FPC+S++D+   P
Sbjct  825   SPFFPSLKAIYLWNCPNLKGWWKQSALIGSPMTEYEHQHIQQSSL-SFPCLSLLDVLDCP  883

Query  764   NVTWMPLFPTVSEKLYIVTGSIIPLEHTKKV  672
             N+T MPL+P +   L +   S+ PLE T  +
Sbjct  884   NLTSMPLYPHLEXXLXLXNTSLKPLEETMMI  914



>ref|XP_010672031.1| PREDICTED: disease resistance protein RGA2-like [Beta vulgaris 
subsp. vulgaris]
Length=1032

 Score = 74.7 bits (182),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 70/264 (27%), Positives = 125/264 (47%), Gaps = 33/264 (13%)
 Frame = -2

Query  1088  SWKFASAYMTTIYIKNCPPGKQLPQFHLLPSLGELYFESI-MVDYIDTTDYEDDNSPSRS  912
             +W  +   +  I ++ C   +++P    LP+L  L   S+  ++Y++T +   D S + +
Sbjct  782   NWAVSLFRLVDISLQGCSNLQEMPILSKLPNLIALALHSMDKLEYMETNN-NTDTSNADT  840

Query  911   ELFFPSLKKLWIWNCPNLKGWWKKNDEAIEEELLP-PFPCISVVDIKQSPNVTWMPLFPT  735
               FFPSL  L ++    LKGWWK++   +++      FP +  + I + PN+T  P  P+
Sbjct  841   TTFFPSLLTLGLYGMQKLKGWWKEDQPGVDDHRQSFGFPFLRQLTIGRCPNLTTFPACPS  900

Query  734   VSEKLYIVTGSIIPLEHTKKVCSSF----KYLKKLWVSEVADLEYMEIELFPSLEYLWVY  567
             + E         + L   K + SSF    + LK  ++S +  L   EI+   SL  L ++
Sbjct  901   LEE---------LELYDNKMLWSSFPQNLRILKFKYLSNMTSLPE-EIQSLSSLRSLELF  950

Query  566   DCRNLRDWGKKGDHEDAPKALAK---LAPSVIEFEVKNCPKLKLLPQGMRLLSSSTKFSI  396
              C             D  KAL +      S+    +  C  LK LP+ MR L++  +  I
Sbjct  951   RC-------------DRIKALPEWISCLSSLQSLSIYRCLALKSLPEAMRNLTTLQRLYI  997

Query  395   SGCPLLKQKYKSKSGQNWPEVANI  324
               C  L+++ K  +G+++P+V +I
Sbjct  998   GRCRDLEERCKKPNGEDYPKVQHI  1021



>ref|XP_004169506.1| PREDICTED: putative disease resistance protein RGA4-like, partial 
[Cucumis sativus]
Length=686

 Score = 74.3 bits (181),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 66/206 (32%), Positives = 93/206 (45%), Gaps = 26/206 (13%)
 Frame = -2

Query  1064  MTTIYIKNCPPGKQLPQFHLLPSLGELYFESIMVDYIDTTDYEDDNSPSRSELFFPSLKK  885
             +  I +++C   + LPQF   P L  L  E++      + +Y D+N+   S  FFPSL+K
Sbjct  482   LVNIELQSCEKLQHLPQFDQFPFLKHLLLENL-----PSIEYIDNNNSLSSSTFFPSLEK  536

Query  884   LWIWNCPNLKGWWKKNDEAIEEELLPPFPCI----SVVDIKQSPNVTWMPLFP-------  738
             L I   PNLKGWWK             FP I    S +DI   P +  +P  P       
Sbjct  537   LTIMTMPNLKGWWKGETPPESARYSALFPTILHHLSRLDISNCPQLASIPQHPPLRSLAL  596

Query  737   -TVSEKLYIVTGSIIPLEHTKKVCSSFKYLKKLWVSEVA--DLEYMEIELFPS---LEYL  576
               VS +L+ +   +I +  T    SS   L KL +  +   DLE++  ELF S   LE  
Sbjct  597   NDVSVQLFDM---VIKMATTPAADSS-SALSKLSILHIQNIDLEFLPEELFGSTTDLEIF  652

Query  575   WVYDCRNLRDWGKKGDHEDAPKALAK  498
              V +C+NL+        ED    L K
Sbjct  653   TVVNCKNLQMSSSHLVDEDNDGVLGK  678



>ref|XP_003626855.1| Cc-nbs-lrr resistance protein [Medicago truncatula]
Length=886

 Score = 74.3 bits (181),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 74/284 (26%), Positives = 120/284 (42%), Gaps = 46/284 (16%)
 Frame = -2

Query  1055  IYIKNCPPGKQLPQFHLLPSLGELYFESIMVDYIDTTDYEDDNSPSRSELFFPSLKKLWI  876
             I +  C   + LP    LP     + +S+ + ++   +Y     P   E FFPSL++L +
Sbjct  598   ISLNYCQGFQHLPPLERLP-----FLKSLELRHLYELEYIYYEEPILHESFFPSLERLEL  652

Query  875   WNCPNLKGWWKKNDE-----AIEEELLPPF--PCISVVDIKQSPNVTWMPLFPTVSEKLY  717
               C  L GW +  D+     +    LLP F  PC+S +DI     + +MP FPT+ ++L 
Sbjct  653   LVCGKLMGWRRIEDDLSDINSSHHRLLPQFQFPCLSKLDINGCDMLAFMPTFPTIKKRLK  712

Query  716   IVTGSIIPLEHTKKVCSS-----------FKYL------------KKLWVSEVADLEYME  606
             + + S   LE T  +  S            K+L             K W   +  LE +E
Sbjct  713   LRSCSAEILEATLNIAESPYSSGFPPLSMLKFLIITDTIMGMEKAPKDWFKNLISLENLE  772

Query  605   I-----ELFPSLEYLWVYDCRNLRDWGKK-----GDHEDAPKALAKLAPSVIEFEVKNCP  456
                   + F  +E  W  D  N     KK      D    P  +  ++ S+   EV  C 
Sbjct  773   FYFLSSQKFQVIEMWWFKDDLNCLPSLKKITFFHCDLNALPYWICNIS-SLQHIEVCGCR  831

Query  455   KLKLLPQGMRLLSSSTKFSISGCPLLKQKYKSKSGQNWPEVANI  324
              L+ LP+ M  L++     I  CP L Q+ ++++   W ++A+I
Sbjct  832   DLEDLPEAMPRLTNLHTLEIIECPFLAQQCETETSATWSKIAHI  875



>gb|AET01331.2| LRR and NB-ARC domain disease resistance protein [Medicago truncatula]
Length=840

 Score = 73.9 bits (180),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 74/284 (26%), Positives = 120/284 (42%), Gaps = 46/284 (16%)
 Frame = -2

Query  1055  IYIKNCPPGKQLPQFHLLPSLGELYFESIMVDYIDTTDYEDDNSPSRSELFFPSLKKLWI  876
             I +  C   + LP    LP     + +S+ + ++   +Y     P   E FFPSL++L +
Sbjct  552   ISLNYCQGFQHLPPLERLP-----FLKSLELRHLYELEYIYYEEPILHESFFPSLERLEL  606

Query  875   WNCPNLKGWWKKNDE-----AIEEELLPPF--PCISVVDIKQSPNVTWMPLFPTVSEKLY  717
               C  L GW +  D+     +    LLP F  PC+S +DI     + +MP FPT+ ++L 
Sbjct  607   LVCGKLMGWRRIEDDLSDINSSHHRLLPQFQFPCLSKLDINGCDMLAFMPTFPTIKKRLK  666

Query  716   IVTGSIIPLEHTKKVCSS-----------FKYL------------KKLWVSEVADLEYME  606
             + + S   LE T  +  S            K+L             K W   +  LE +E
Sbjct  667   LRSCSAEILEATLNIAESPYSSGFPPLSMLKFLIITDTIMGMEKAPKDWFKNLISLENLE  726

Query  605   I-----ELFPSLEYLWVYDCRNLRDWGKK-----GDHEDAPKALAKLAPSVIEFEVKNCP  456
                   + F  +E  W  D  N     KK      D    P  +  ++ S+   EV  C 
Sbjct  727   FYFLSSQKFQVIEMWWFKDDLNCLPSLKKITFFHCDLNALPYWICNIS-SLQHIEVCGCR  785

Query  455   KLKLLPQGMRLLSSSTKFSISGCPLLKQKYKSKSGQNWPEVANI  324
              L+ LP+ M  L++     I  CP L Q+ ++++   W ++A+I
Sbjct  786   DLEDLPEAMPRLTNLHTLEIIECPFLAQQCETETSATWSKIAHI  829



>gb|AES96274.2| disease resistance protein (TIR-NBS-LRR class), putative [Medicago 
truncatula]
Length=366

 Score = 72.8 bits (177),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 65/270 (24%), Positives = 123/270 (46%), Gaps = 44/270 (16%)
 Frame = -2

Query  1064  MTTIYIKNCPPGKQLPQFHLLPSLGELYFESI-MVDYIDTTDYEDDNSPSRSELFFPSLK  888
             +  +YIK+C     LPQ   LP L EL+  ++  + Y+D   Y+       +EL   SL+
Sbjct  106   LHCVYIKDCQSCLHLPQLGKLPYLKELFISNVSRIIYLDEESYDGGAEGGFTELEHLSLE  165

Query  887   KLWIWNCPNLKGWWKKNDEAIEEELLPPFPCISVVDIKQSPNVTWMPLFPTVSEKLYIVT  708
             KL     PNL    +++ E +       FP +S + + + PN+  +P  P+++   YI  
Sbjct  166   KL-----PNLIRISREDRENL-------FPHLSALVVIECPNLLGLPCLPSLN---YIC-  209

Query  707   GSIIPLEHTKKVCSSFKYLKKLWVSEVADLEYMEIELFP--------SLEYLWVYDCRNL  552
                I  +  + + SS    K   +  +   +  E+  FP        SL+ L ++ C  +
Sbjct  210   ---IQGKCNQDLLSSIH--KHGGLESLCFYDNKELTCFPDGMLRNLISLKLLMIWSCSEI  264

Query  551   RDWGKKGDHEDAPKALA-------KLAPSVI-------EFEVKNCPKLKLLPQGMRLLSS  414
                 +   H  + ++L        KL P+ +       +  + NCPKL  LP  ++ L+ 
Sbjct  265   EVLDEALQHVTSLESLILSDLQNLKLLPASLGNLGFLHKLIISNCPKLTCLPMSIQSLTG  324

Query  413   STKFSISGCPLLKQKYKSKSGQNWPEVANI  324
                  I  C  L+++ + ++G++WP++A++
Sbjct  325   LESLGIYSCSELEKRCEKETGEDWPKIAHV  354



>gb|KCW60238.1| hypothetical protein EUGRSUZ_H02952 [Eucalyptus grandis]
Length=792

 Score = 73.9 bits (180),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 92/371 (25%), Positives = 154/371 (42%), Gaps = 101/371 (27%)
 Frame = -2

Query  1151  QNPKQQPMLTLLPPEDI--GSVLSWKFASAYMTTIYIKNCPPGKQLPQFHLLPSLGELYF  978
             +N +  P+LT L  +     S+ SW  +   +  + +  C   K L     L SL +L+ 
Sbjct  418   ENLRLDPILTNLTIDSCMSRSMPSWLSSIKNLVELTLNECREWKYLLPLGELSSLKKLFL  477

Query  977   ESIMVDYIDTTDY-EDDNSPSRSEL---FFPSLKKLWIWNCPNLKGWWKKND--EAIEE-  819
             +++     D  ++ ++   P +S     FFPSL+KL ++NC NLKGWW +     A ++ 
Sbjct  478   KNL-----DALEFVQEIICPEQSNFVRPFFPSLEKLELFNCENLKGWWGRTQLLGAYQDH  532

Query  818   ---ELLPPFPCISVVDIKQSPNVTWMPLFPTVSEKLYIVTGSIIPLEH--------TKKV  672
                ++   FP +  V+I   P +  MP FP + E L ++  SI   E         ++ V
Sbjct  533   QGYKIHSLFPQLLYVEISYCPQLNSMPHFPRI-ETLVLIGCSIKWWEQEMAVLNYLSEAV  591

Query  671   CSSF---KYLKKLWVSEVADLEYMEIE-LFP---SLEYLWVYDCRNLR------------  549
              S+F     L+ L+     DLE+  +E LFP   +L+ + +Y C  LR            
Sbjct  592   VSTFIPLSKLESLYFYYGMDLEHSMLETLFPFLKNLKSMTLYSCSKLRSLSCGMQYLSSL  651

Query  548   -----------DWGKKGDHEDA----------------PKALA-----KLAPSVIEFEVK  465
                        D     D +                  PK +A     +   S+   E+K
Sbjct  652   LDLVIHYCEELDLSSHDDEQGTQWRSLVNLRDLIISQLPKLVASPEGIQHVTSLESLEIK  711

Query  464   NCPKL------------------------KLLPQGMRLLSSSTKFSISGCPLLKQKYKSK  357
              C  L                          LP GMR L+S  K SI+ CP+L+++ + +
Sbjct  712   ECQNLISLPEWIGNFSSLRKLEIISCPSLTCLPNGMRRLTSLKKLSIAECPILEERCRRE  771

Query  356   SGQNWPEVANI  324
             SG +W ++A++
Sbjct  772   SGADWEKIAHL  782



>ref|XP_008461414.1| PREDICTED: putative disease resistance protein RGA1 [Cucumis 
melo]
Length=714

 Score = 73.6 bits (179),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 65/271 (24%), Positives = 116/271 (43%), Gaps = 46/271 (17%)
 Frame = -2

Query  1064  MTTIYIKNCPPGKQLPQFHLLPSLGELYFESI-MVDYIDTTDYEDDNSPSRSELFFPSLK  888
             + TI + +C   + LP+F   P+L  L    +  V+YI      ++N    S   FPSL 
Sbjct  416   LVTIRLHDCERLRHLPRFDQFPNLKRLELCDLPNVEYIIV----NNNDSVSSSTIFPSLN  471

Query  887   KLWIWNCPNLKGWWKKNDEAIEEELLPPF-PCISVVDIK--------QSPNVTWMPLFPT  735
             +L I   P L  W K         ++ P+  C+ +   +         +PN+  + +F +
Sbjct  472   ELEISKMPKLVSWCKGTTSTKSPTIIFPYLSCLRIYGRRPLHMLKFWHAPNLKTLLIFDS  531

Query  734   VSEKLYIVTGSIIPLEHTKKVCSSFKYLKKLWVSEVADLEYME---IELFPSLEYLWVYD  564
               E       +++PL+       +++ L  L +  ++ LEY          SL++L++  
Sbjct  532   EDEL------NVVPLK-------TYENLTSLSLRNLSKLEYFPECWQHCMTSLQFLYLSY  578

Query  563   CRNLRDWGK---------------KGDHEDAPKALAKLAPSVIEFEVKNCPKLKLLPQGM  429
             C NL+   +                G     P+ +  L    I   + NC KL LLP+G+
Sbjct  579   CENLKSLAEWFGNLTSLTQLHIISCGKLTMLPEGIGNLTSLTI-LVIFNCEKLALLPEGI  637

Query  428   RLLSSSTKFSISGCPLLKQKYKSKSGQNWPE  336
             + L +    +I  CP+LK++ K   G++WP 
Sbjct  638   QHLHNLQNLTIDDCPILKERCKKGKGEDWPR  668



>ref|XP_010659380.1| PREDICTED: disease resistance protein RGA2-like isoform X1 [Vitis 
vinifera]
 ref|XP_010659381.1| PREDICTED: disease resistance protein RGA2-like isoform X2 [Vitis 
vinifera]
 ref|XP_010659382.1| PREDICTED: disease resistance protein RGA2-like isoform X1 [Vitis 
vinifera]
 ref|XP_010659383.1| PREDICTED: disease resistance protein RGA2-like isoform X1 [Vitis 
vinifera]
 ref|XP_010659384.1| PREDICTED: disease resistance protein RGA2-like isoform X1 [Vitis 
vinifera]
 ref|XP_010659385.1| PREDICTED: disease resistance protein RGA2-like isoform X1 [Vitis 
vinifera]
 ref|XP_010659386.1| PREDICTED: disease resistance protein RGA2-like isoform X1 [Vitis 
vinifera]
 ref|XP_010659387.1| PREDICTED: disease resistance protein RGA2-like isoform X1 [Vitis 
vinifera]
 ref|XP_010659388.1| PREDICTED: disease resistance protein RGA2-like isoform X1 [Vitis 
vinifera]
 ref|XP_010659389.1| PREDICTED: disease resistance protein RGA2-like isoform X1 [Vitis 
vinifera]
 ref|XP_010659390.1| PREDICTED: disease resistance protein RGA2-like isoform X1 [Vitis 
vinifera]
Length=1005

 Score = 73.6 bits (179),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 65/250 (26%), Positives = 113/250 (45%), Gaps = 47/250 (19%)
 Frame = -2

Query  1064  MTTIYIKNCPPGKQLPQFHLLPSLGELYFESIM-VDYIDTTDYEDDNSPSRSELFFPSLK  888
             +  I +  C   + LP F  LPSL  L+   +  V+Y+   DY     PS ++ FFP LK
Sbjct  791   LVRIQLWRCMGSQVLPPFGQLPSLQYLHLAQLYDVEYM--MDY-----PSPAKPFFPRLK  843

Query  887   KLWIWNCPNLKGWWKKNDEAIEEELLPPFPCISVVDIKQSPNVTWMPLFPTVSEKLYIVT  708
              L +   PNL+GW +++   +  E  P +P +  ++++             +S +L +  
Sbjct  844   TLRLSYLPNLEGWGRRD---VAAEQAPSYPHLENLELE------------NISMELCL--  886

Query  707   GSIIPLEHTKKVCSSFKYLKKLWVSEVADL--EYMEIELFPSLEYLWVYDCRNLRDWGKK  534
                    H   V SS K L+   + E+  L  E   +    +L+    Y    L DW   
Sbjct  887   -------HLISVSSSLKSLRICGIEELISLPKELQHVSTLQTLKIEHCYGLATLPDW---  936

Query  533   GDHEDAPKALAKLAPSVIEFEVKNCPKLKLLPQGMRLLSSSTKFSISGCPLLKQKYKSKS  354
                      + +L  S+ +  +  CPKL  LP+ MR L    +  I  CP L ++ + ++
Sbjct  937   ---------IGRLT-SLTQLTIIACPKLTSLPEEMRSLRHLRQLRIFSCPDLWERCQRET  986

Query  353   GQNWPEVANI  324
             G++WP++++I
Sbjct  987   GEDWPKISHI  996



>gb|AFU51534.1| blight resistance protein RGA4 [Capsicum annuum]
Length=988

 Score = 73.6 bits (179),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 68/266 (26%), Positives = 119/266 (45%), Gaps = 33/266 (12%)
 Frame = -2

Query  1064  MTTIYIKNCPPGKQLPQFHLLPSLG--ELYFESIMVDYIDTTDYEDDNSPSRSELFFPSL  891
             + +I IK C     LP F  LP L   EL + S+ V++++  D     +  R    FPSL
Sbjct  731   VVSIKIKICKNCLCLPPFGELPCLESLELQYGSVEVEFVEEDDVHSRFNTRRR---FPSL  787

Query  890   KKLWIWNCPNLKGWWKKNDE---------AIEEELLPPFPCISVV---DIKQSPNVTWMP  747
             K+L IW   NL+G  K+  E         AI    +  FP +S V   ++    N T + 
Sbjct  788   KRLRIWFFCNLRGLMKEEGEEKFPMLEDMAILHCPMFIFPTLSSVKKLEVHGDTNATGLS  847

Query  746   LFPTVSEKLYIVTGSIIPLEHTKKVCSSFKYLKKLWVSEVADLEYM-----EIELFPSLE  582
                 +S    +  G+    E T      FK L  L    + +  Y+      +    +L+
Sbjct  848   SISNLSTLTSLRIGA--NYEATSLPEEMFKSLTNLEYLSIFEFNYLTELPTSLASLSALK  905

Query  581   YLWVYDCRNLRDWGKKGDHEDAPKALAKLAPSVIEFEVKNCPKLKLLPQGMRLLSSSTKF  402
              + + +C  L         E  P+   +   S+ +   K C  LK LP+G++ L++ TK 
Sbjct  906   RIQIENCDAL---------ESLPEQGLECLTSLTQLFAKYCRMLKSLPEGLQHLTALTKL  956

Query  401   SISGCPLLKQKYKSKSGQNWPEVANI  324
              ++GCP ++++   + G++W ++++I
Sbjct  957   GVTGCPEVEKRCDKELGEDWHKISHI  982



>ref|XP_008346968.1| PREDICTED: putative disease resistance protein RGA1 [Malus domestica]
Length=312

 Score = 71.2 bits (173),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 53/140 (38%), Positives = 71/140 (51%), Gaps = 20/140 (14%)
 Frame = -2

Query  1082  KFASAYMTTIYIKN-----CPPGKQLPQFHLLPSLGELYFESIM-VDYIDTTDYEDDNSP  921
             +FAS + + I I N     C   + LP     P L  L  E +  ++YI  +D E  NS 
Sbjct  118   RFASWFSSLINIVNLTLASCERCQHLPPLDHFPFLKSLKLERLTKLEYI--SDNESSNSM  175

Query  920   SRSEL---FFPSLKKLWIWNCPNLKGWWKKN-----DEAIEEEL---LPPFPCISVVDIK  774
             S   +   FFPSL+KL I NCP L GWW+ +       +  E L   LP FPC+S + I 
Sbjct  176   SDEMVRTSFFPSLEKLRIENCPVLNGWWRAHTHNCASSSSTENLPFPLPSFPCLSTLSIF  235

Query  773   QSPNVTWMPLFPTVSEKLYI  714
               PN+T MPL+  V   LY+
Sbjct  236   YCPNLTSMPLYSNV-HTLYL  254



>ref|XP_010922082.1| PREDICTED: putative disease resistance protein RGA1 [Elaeis guineensis]
Length=1140

 Score = 73.2 bits (178),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 88/302 (29%), Positives = 136/302 (45%), Gaps = 56/302 (19%)
 Frame = -2

Query  1133  PMLTLLPPEDIGSVLSWKF-----ASAYMTTIYIKNCPPGKQLPQFHLLPSLGELYFESI  969
             P L+ L  ED+  +  W +     +   +T++ + +CP  ++LP   L P+L  L     
Sbjct  834   PSLSELLLEDMLKLKEWSYPEDDESFPCLTSLEVVDCPELRKLPC--LPPTLTRLRISET  891

Query  968   MVDYIDTTDYEDDNSPSRSELFFPSLKKLWIWNCPNL----KGWWKKNDEAIEE------  819
              +  +     E  +S SRS    PSL  L I  CPNL    +G + +    ++E      
Sbjct  892   GLRNLP----EVQSSNSRS---LPSLSTLHIHECPNLGSLQQGLFAQQLRDLQELKITNC  944

Query  818   ---ELLP-----PFPCISVVDIKQSPNVT------WMPLFPTVSEKLYIVTGS--IIPLE  687
                ELLP     P   +  + I   P +       W  L P + E L I++ S  I PL 
Sbjct  945   EKLELLPVQGFRPLIALKSLHIYNCPRLAPQGKEGW-ELLPRLLEDLQIISCSKLITPLL  1003

Query  686   HTKKVCSSFKYLKKLWVSEVADL-EYMEIELFPSLEYLWVYDCRNLRDWGKKGDHEDAPK  510
                K   S  +LK   ++E  DL  + E  L  SL++L + DC NL         +  P 
Sbjct  1004  AELKNLPSLTHLK---IAECTDLYNFPEDGLPVSLKFLRILDCENL---------QYLPS  1051

Query  509   ALAKLAPSVIEFEVKNCPKLKLLPQGMRLLSSSTKFSISGCPLLKQKYKSKSGQNWPEVA  330
              L +L  S+    V NCP++  LP    L S+  +  I GCPLLK++ +   G +WP++A
Sbjct  1052  QLQELI-SLTVLVVSNCPQIPCLPV-HDLPSALQELYIEGCPLLKERCQENGGHDWPKIA  1109

Query  329   NI  324
             +I
Sbjct  1110  HI  1111



>ref|XP_008362780.1| PREDICTED: disease resistance protein RGA2-like [Malus domestica]
Length=718

 Score = 72.8 bits (177),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 49/132 (37%), Positives = 70/132 (53%), Gaps = 17/132 (13%)
 Frame = -2

Query  1082  KFASAYMTTIYI-----KNCPPGKQLPQFHLLPSLGELYFESI-MVDYIDTTDYEDDNSP  921
             +FAS + + I I      NC   + LP    LPSL +L   S+  ++YI  ++ E  NS 
Sbjct  559   RFASWFSSLINIVNLKLSNCKRCQHLPPLDHLPSLKKLELRSLEKLEYI--SEKESSNSM  616

Query  920   SRSEL---FFPSLKKLWIWNCPNLKGWWKKN------DEAIEEELLPPFPCISVVDIKQS  768
             S   +   FFPSL+ L+I  CP LKGWW+ +        + E   LP FP +S +  +  
Sbjct  617   SDEMMRISFFPSLENLFISQCPVLKGWWRAHTHNTASSSSTENXSLPSFPRLSRLIXRNX  676

Query  767   PNVTWMPLFPTV  732
             PN+T MPL+P V
Sbjct  677   PNLTSMPLYPNV  688



>ref|XP_010325692.1| PREDICTED: LOW QUALITY PROTEIN: putative disease resistance protein 
RGA3 [Solanum lycopersicum]
Length=1946

 Score = 73.2 bits (178),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 77/278 (28%), Positives = 121/278 (44%), Gaps = 63/278 (23%)
 Frame = -2

Query  1064  MTTIYIKNCPPGKQLPQFHLLPSLG--ELYFESIMVDYIDTTDYEDDNSPSRSELFFPSL  891
             + +I I+ C     LP F  LP L   EL   S  ++Y+     ED   P+R    FPSL
Sbjct  727   VVSIAIRGCENCSCLPPFGDLPCLESLELGDGSAELEYV-----EDSGFPTRRR--FPSL  779

Query  890   KKLWIWNCPNLKGWWKKNDEAIEEELLPPFPCISVVDIKQSPNVTWMPLF--PTVSEKLY  717
             +KL I N  NLKG  K   EA EE+    FP +      +   ++W P+   PT+S    
Sbjct  780   RKLIIVNFDNLKGLLK---EAGEEQ----FPVL------EEMTISWCPVLVIPTLSSVKK  826

Query  716   IVTGSIIPLEHTKKVCSSFKYLKKLWVSE--------------VADLEYMEIEL------  597
             +V    +      +   + + L  L +S               +A+L+Y+EI        
Sbjct  827   LVVNRNMSDAIGLRSIYNLRALTSLNISHNLTATSLPEEMFKSLANLKYLEISFIFNLKE  886

Query  596   -------FPSLEYLWVYDCRNLRDWGKKGDHEDAPKALAKLAPSVIEFEVKNCPKLKLLP  438
                      +L++L +  C  L         E  P+   K   S+ E  + NC +LK LP
Sbjct  887   LPNSLASLNALKHLKIEYCDAL---------ESLPEEGVKGLTSLTELSITNCKRLKCLP  937

Query  437   QGMRLLSSSTKFSISGCPLLKQKYKSKSGQNWPEVANI  324
             +G++ L   T  S+  CP L ++ +   GQ+W ++A+I
Sbjct  938   EGLQHL---TNLSVRECPTLAKRCEKGIGQDWYKIAHI  972


 Score = 61.6 bits (148),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 75/254 (30%), Positives = 121/254 (48%), Gaps = 41/254 (16%)
 Frame = -2

Query  1064  MTTIYIKNCPPGKQLPQFHLLPSLG--ELYFESIMVDYIDTTDYEDDNSPSRSELFFPSL  891
             + +I I+ C     LP F  LP L   EL+  S  V+Y+     ED   P+R    FPSL
Sbjct  1720  VVSIAIRGCENCSCLPPFGDLPCLESLELWSGSAEVEYV-----EDSGFPTRRR--FPSL  1772

Query  890   KKLWIWNCPNLKGWWKKNDEAIEEELLPPFPCISVVDIKQSPNVTWMPLFPTVSEKLYIV  711
             +KL I +  NLKG             L  FP +  + I+  P V  +P   +V  K  +V
Sbjct  1773  RKLTIDDFDNLKG-------------LLQFPVLEELTIRCCP-VFVIPTLSSV--KKLVV  1816

Query  710   TGSIIPLEHTKKVCSSFKYLKKLWVSEVADLEYMEIELFPS---LEYLWVYDCRNLRDWG  540
              G        + +  + + L  L +S  +    +  E+F S   L+YL +    NL++  
Sbjct  1817  YGDKSDATVLRSI-YNLRALTSLTISLNSIATSLPEEMFKSLAILKYLEISFFDNLKEL-  1874

Query  539   KKGDHEDAPKALAKLAPSVIEFEVKNCPKLKLLP-QGMRLLSSSTKFSISGCPLLKQKYK  363
                     P +LA L  ++   E+  CPKL+ LP +G++ L+S T+ SI+ C +LK+  +
Sbjct  1875  --------PNSLASLN-ALKHLEISCCPKLESLPEEGVKGLTSLTQLSITYCEMLKRLPE  1925

Query  362   S-KSGQNWPEVANI  324
               +  Q+W ++A+I
Sbjct  1926  GLQQLQDWYKIAHI  1939



>ref|XP_008461318.1| PREDICTED: LOW QUALITY PROTEIN: putative disease resistance protein 
RGA3 [Cucumis melo]
Length=1067

 Score = 73.2 bits (178),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 69/261 (26%), Positives = 126/261 (48%), Gaps = 33/261 (13%)
 Frame = -2

Query  1064  MTTIYIKNCPPGKQLPQFHLLPSLGELYFESIM-VDYIDTTDYEDDNSPSRSELFFPSLK  888
             +T I I NC   + LP    L +L  L  +++  ++YID       +S S S +FFPSLK
Sbjct  804   LTQIEIVNCHRLQYLPSIEHLHALSNLRLQNLRSLEYIDFD-----SSNSSSSVFFPSLK  858

Query  887   KLWIWNCPNLKGWWKKNDEAIEEELLPPFPCISVVDIKQSPNVTWMPLFPTVSEKLYIVT  708
              +W+ + PNL GW + +   + ++L P FP +  ++I   P +  +P  P++   +++  
Sbjct  859   FIWLQDLPNLVGWGRDDAYTLSDQLAPTFPQLCFLEIFDCPKLISIPKLPSIRAYVHLCH  918

Query  707   GSIIPLEHTKKVCSSFKYLKKLWVSEVADLE-------------YMEIELFPSLEYLWVY  567
                +PL   K+V      L +L + ++  +E             Y +I + P L +L + 
Sbjct  919   VG-VPL--VKRVGLVLWRLGQLKLEQILGMELLPEEFYKYYVTFYEDISMSPGLRWLEII  975

Query  566   DCRNLRDWGKKGDHEDAPKALAKLAPSVIEFEVKNCPKLKLLPQGMRLLSSSTKFSISGC  387
              C NL            P  + ++  S+    + +CP LK LP  +  L    +  I  C
Sbjct  976   KCPNL---------TSLPTWINRII-SLETLRIISCPNLKSLPAEIGELQYLLELQIKDC  1025

Query  386   PLLKQKYKSKSGQNWPEVANI  324
             P L+++ K + G++WP++++I
Sbjct  1026  PELEERCK-QGGEDWPKISSI  1045


 Score = 55.8 bits (133),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 41/133 (31%), Positives = 68/133 (51%), Gaps = 8/133 (6%)
 Frame = -2

Query  1553  SVAKLILAKIAPFAQDQIKLLWGLNEELTKLGDLVSHIGAVLLDAEG-EKHNKKTENLLE  1377
             ++A  ILAK++    ++   LWGL +++ KL   VS I A L+DA+    H +   + LE
Sbjct  8     NLAARILAKLSSLLSEEFGTLWGLKDDVNKLTCTVSIIRATLVDADTWITHLESVVDWLE  67

Query  1376  MLKNIMDEANRLMDYFSPRAKNHR---PNQEDGCCSYFVSHPNPFVWVSDSFMAGKIKSI  1206
              ++ ++ +A  ++D FS  A   R     +       F S+ N  V+  +  MA ++K I
Sbjct  68    QMEAVLKDAEDVLDEFSAEAIRRRVMTRGRNAKQVRIFFSNSNQLVF--NFRMARQVKKI  125

Query  1205  NNRLDGI--IENY  1173
               RLD I  + NY
Sbjct  126   RERLDAIGHLRNY  138



>gb|KHG16658.1| Putative disease resistance RGA3 [Gossypium arboreum]
Length=369

 Score = 71.2 bits (173),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 66/206 (32%), Positives = 90/206 (44%), Gaps = 36/206 (17%)
 Frame = -2

Query  1088  SWKFASAYMTTIYIKNCPPGKQLPQFHLLPSLGELYFESIMVDYIDTTDYEDDNSPSRS-  912
             SW      +  IYI      K LP    LP L +L             +Y DDNSP  S 
Sbjct  113   SWLSLLTNLVHIYIWGPNKFKYLPSVAQLPCLQDLTIRDCY-----ELEYMDDNSPKGSQ  167

Query  911   ---ELFFPSLKKLWIWNCPNLKGWWK----------KNDEAIEEELLPPFPCISVVDIKQ  771
                E FFPSLK L + NC N+K WW+          ++D  +       FPC+S + IK 
Sbjct  168   GEPESFFPSLKCLDLENCRNMKSWWRTTKPIDNDSNEDDPTVMGTSTMAFPCLSTLWIKN  227

Query  770   SPNVTWMPLFPTVSEKLYIVTGSIIPLEHTKKV--------CSSFKY-LKKLWVSEVADL  618
              P +T MPL+P V + L +V  S  P + T K+        CS+    L KL    V ++
Sbjct  228   CP-LTSMPLYPLVDDDLRLVNSSSRPFKQTIKMKMNAKTPSCSTSSLPLSKLKSFHVKNM  286

Query  617   EYME-------IELFPSLEYLWVYDC  561
             E M+       ++   SLE L +  C
Sbjct  287   EDMDTPMLDEYMQHLTSLETLTIDGC  312



>ref|XP_003636514.1| NBS-LRR resistance-like protein 1O [Medicago truncatula]
 gb|KEH18061.1| NBS-LRR type disease resistance protein [Medicago truncatula]
Length=969

 Score = 72.0 bits (175),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 80/295 (27%), Positives = 118/295 (40%), Gaps = 46/295 (16%)
 Frame = -2

Query  1088  SWKFASAYMTTIYIKNCPPGKQLPQFHLLPSLGELYFESIM-VDYIDTTDYEDDNSPSRS  912
             +W      +  IY+  C   + L     LP L  L    ++ ++YI    YED   P   
Sbjct  673   NWTSPLTNINEIYLDGCLNLRYLSPLEHLPFLKSLELRYLLQLEYIY---YED---PILH  726

Query  911   ELFFPSLKKLWIWNCPNLKGWWKKNDE-----AIEEELLPPFPCISVVDIKQSPNVTWMP  747
             E FFPSL+ L +  C  LKGW +  D+     +    LLP FP +S + I     +T+MP
Sbjct  727   ESFFPSLEILQLIACSKLKGWRRMRDDLNDINSSHHLLLPHFPSLSKLTIWSCERLTFMP  786

Query  746   LFPTVSEKLYIVTGSIIPLEHTKKVCSS-----------FKYLK------------KLWV  636
              FP + ++L +   +   +E T  +  S            K LK            K W 
Sbjct  787   TFPNIKKRLELGLVNAEIMEATLNIAESQYSIGFPPLSMLKSLKINATIMGIEKAPKDWF  846

Query  635   SEVADLEYMEIELFPSLEY----LWVYDCRN----LRDWGKKGDHEDAPKALAKL---AP  489
               +  LE +      S       +W  D  N    LR    +G   D  KAL        
Sbjct  847   KNLTSLENLHFYFLMSKNLQVIEMWFKDNLNCLPSLRTINFEGIVGDVVKALPDWICNIS  906

Query  488   SVIEFEVKNCPKLKLLPQGMRLLSSSTKFSISGCPLLKQKYKSKSGQNWPEVANI  324
             S+   +VK C  L  LP GM  L+      I GCPLL  + + ++     ++A+I
Sbjct  907   SLQHLKVKECRDLVDLPDGMPRLTKLHTLEIIGCPLLIDECQREASVTCSKIAHI  961



>gb|KHG00979.1| Putative disease resistance RGA4 [Gossypium arboreum]
Length=950

 Score = 72.0 bits (175),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 60/200 (30%), Positives = 93/200 (47%), Gaps = 40/200 (20%)
 Frame = -2

Query  1028  KQLPQFHLLPSLGELYFESIMVDYIDTTD--YEDDNSPSRS----ELFFPSLKKLWIWNC  867
             K LP F  LP L +L       + ++ T+  Y DDNSP  S    E FF SLK L + +C
Sbjct  672   KHLPFFAQLPRLQQL-------EIVNCTELEYMDDNSPKGSQGEPESFFRSLKHLKVESC  724

Query  866   PNLKGWWK----------KNDEAIEEELLPPFPCISVVDIKQSPNVTWMPLFPTVSEKLY  717
             PN+K WW+          ++D  +       FP +S ++IK  P +T MPL+P++  +L 
Sbjct  725   PNMKSWWRTTKPIDDDSNEDDTTVMGTSTVAFPSLSPLEIKDCP-LTSMPLYPSLDGRLE  783

Query  716   IVTGSIIPLEHTKKV------------CSSFKYLKKLWVSEVADLEYME----IELFPSL  585
             +V  S+ PL+ T K+                  LK   V  +  L+       ++    L
Sbjct  784   LVNTSLRPLKQTMKMNMNAKTPSSSTSSLPLSKLKFFLVDNIEGLDTHTLDECLQHLTGL  843

Query  584   EYLWVYDCRNLRDWGKKGDH  525
             E L + DC+N+   G + +H
Sbjct  844   EGLEIRDCKNVDFEGMQWEH  863



>ref|XP_004489083.1| PREDICTED: putative disease resistance protein RGA1-like [Cicer 
arietinum]
Length=684

 Score = 71.6 bits (174),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 43/106 (41%), Positives = 68/106 (64%), Gaps = 8/106 (8%)
 Frame = -2

Query  908  LFFPSLKKLWIWNCPNLKGWWKKNDEA-IEEEL-LPPFPCISVVDIKQSPNVTWMPLFPT  735
            LFFPSL+KL ++ C NL+GW +  + A +   L LPPFPC+S +DI + P +T MP +P 
Sbjct  548  LFFPSLEKLVLFGCKNLRGWQRLGNSADVANHLSLPPFPCLSYLDIWECPKLTCMPTYPY  607

Query  734  VSEKLYIVTGSIIPLEHTKKVCSS----FKYLKKLWVSEVADLEYM  609
            + E L +++ +++P+  T  V SS       LK L+++E+ D+E M
Sbjct  608  LIE-LRLISCNVMPMIETCSVRSSSFNPLFGLKHLYLTEI-DVESM  651



>ref|XP_002265970.1| PREDICTED: putative disease resistance protein RGA3 [Vitis vinifera]
Length=1211

 Score = 71.6 bits (174),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 64/212 (30%), Positives = 94/212 (44%), Gaps = 35/212 (17%)
 Frame = -2

Query  1064  MTTIYIKNCPPGKQLPQFHLLPSLGELYFESIM-VDYIDTTDYEDDNSPSRSELFFPSLK  888
             +  I I+ C   + LP F  LPSL  L  + +  V YI+        S S ++ FFPSLK
Sbjct  783   LARIEIRRCDRCQDLPPFGQLPSLELLKLQDLTAVVYIN-------ESSSATDPFFPSLK  835

Query  887   KLWIWNCPNLKGWWKKNDEAIEEELL--PPFPCISVVDIKQSPNVTWMPLFPTVSEKLYI  714
             +L ++  PNLKGWW+++    EE++L  P FPC+S   I    N+T + L P+       
Sbjct  836   RLELYELPNLKGWWRRD--GTEEQVLSVPSFPCLSEFLIMGCHNLTSLQLPPS-------  886

Query  713   VTGSIIPLEHTKK----VCSSFKYLKKLWVSEVADLEYMEIELFPSLEYLWVYDCRNLRD  546
                S + LEH       +   F  L KL +S+  +L    +   P L  L + +C NL  
Sbjct  887   PCFSQLELEHCMNLKTLILPPFPCLSKLDISDCPELRSFLLPSSPCLSKLDISECLNLTS  946

Query  545   WGKKGDHEDAPKALAKLAPSVIEFEVKNCPKL  450
                               P + E  +  CP L
Sbjct  947   LELHS------------CPRLSELHICGCPNL  966



>ref|XP_003615737.1| NBS-LRR resistance protein [Medicago truncatula]
Length=1125

 Score = 71.2 bits (173),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 76/283 (27%), Positives = 131/283 (46%), Gaps = 30/283 (11%)
 Frame = -2

Query  1160  LEEQNPKQQPMLTLLPPEDIGSVLSWKFASAYMTTIYIKNCPPGKQLPQFHLLPSLGELY  981
             LEE  P        +   D  S+ SW    + + ++ + +C    +LP F  LPSL +L 
Sbjct  719   LEELQPHSNLKCLDINCYDGLSLPSWIIILSNLISLKLGDCNKIVRLPLFGKLPSLKKLR  778

Query  980   FESIM-VDYIDTTDYEDDNSPSRSELFFPSLKKLWIWNCPNLKGWWKKNDEAIEEELLPP  804
                +  + Y+D  D  +D    R+   FPSL+ L +   PN++G  K     +       
Sbjct  779   VYGMNNLKYLDD-DESEDGMEVRA---FPSLEVLELHGLPNIEGLLKVERGEM-------  827

Query  803   FPCISVVDIKQSPNVTWMPLFPTVSEKLYIVTGSIIPLEHTKKVCSSFKYLKKLWVSEVA  624
             FPC+S +DI + P +  +P  P++ +    V G    L  +    S+F+ L +L ++   
Sbjct  828   FPCLSSLDIWKCPKLG-LPCLPSLKD--LGVDGRNNELLRS---ISTFRGLTQLTLNSGE  881

Query  623   DLEYMEIELF---PSLEYLWVYDCRNLRDWGKKGDHEDAPKALAKLAPSVIEFEVKNCPK  453
              +  +  E+F    SL+ L+V     L         E  P+   +   S+    +  C  
Sbjct  882   GITSLPEEMFKNLTSLQSLFVTFLPQL---------ESLPEQNWEGLQSLRALLIWGCRG  932

Query  452   LKLLPQGMRLLSSSTKFSISGCPLLKQKYKSKSGQNWPEVANI  324
             L+ LP+G+R L+S    SI  CP LK++ K  +G++W ++A+I
Sbjct  933   LRCLPEGIRHLTSLELLSIIDCPTLKERCKEGTGEDWDKIAHI  975



>gb|KHG11137.1| Putative disease resistance RGA4 [Gossypium arboreum]
Length=661

 Score = 70.9 bits (172),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 47/133 (35%), Positives = 68/133 (51%), Gaps = 20/133 (15%)
 Frame = -2

Query  1028  KQLPQFHLLPSLGELYFESIMVDYIDTTDYEDDNSPSRSE----LFFPSLKKLWIWNCPN  861
             K+LP F  LPSL     + + +      +Y DDN+P  S+    LFFPSLK L +  CPN
Sbjct  306   KRLPSFAQLPSL-----KGLKISNCTKLEYMDDNNPKGSQGEPQLFFPSLKHLTLLYCPN  360

Query  860   LKGWW----------KKNDEAIEEELLPPFPCISVVDIKQSPNVTWMPLFPTVSEKLYIV  711
             +K WW          K++D  +       FPC+S + I   P +T MPL+P++   L + 
Sbjct  361   MKSWWRMTKPMDDDSKEDDTTVMGTSTVAFPCLSSLAILNCP-LTSMPLYPSLDGCLQLG  419

Query  710   TGSIIPLEHTKKV  672
               S  PL+ T K+
Sbjct  420   NTSSKPLKQTMKM  432



>gb|KEH40552.1| NB-ARC domain disease resistance protein [Medicago truncatula]
Length=968

 Score = 71.2 bits (173),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 74/285 (26%), Positives = 122/285 (43%), Gaps = 45/285 (16%)
 Frame = -2

Query  1064  MTTIYIKNCPPGKQLPQFHLLPSLGELYFESIMVDYIDTTDYEDDNSPSRSELFFPSLKK  885
             +  I + +C   + LP +  LP L  L    I ++ ++   YED   P   + FFPSL+ 
Sbjct  630   LIEISLNSCSGCRYLPPWERLPYLKSLQL--IWLEELECIYYED---PILPDSFFPSLES  684

Query  884   LWIWNCPNLKGWWKKNDE-----AIEEELLPPFPCISVVDIKQSPNVTWMPLFPTVSEKL  720
             L    C  L+GW +  D+     +    LLP FPC+S++ I     +T+MP FP + + L
Sbjct  685   LQFSRCYKLRGWRRMGDDLNDINSSHHLLLPHFPCLSILTISGCYMLTYMPTFPNI-KIL  743

Query  719   YIVTGSIIPLEHTKKVCSS--------FKYLKKLWVSE-VADLEYMEIELFPSLEYLWVY  567
              +   S   LE T  +  S           LK L ++E +  +E    + F +L  L   
Sbjct  744   VLRRSSAEILEATLNIAESQYSIGFPPLSMLKSLKINETIMGMEKAPKDWFKNLTSLEDL  803

Query  566   DCRNLRDWGKK------------------------GDHEDAPKALAKLAPSVIEFEVKNC  459
             D  NL   G +                         D ++ P  +  ++ S+    V +C
Sbjct  804   DFDNLSSQGFQVIEMWFKNDPNCLRSLQKITFTWCSDLKELPDWICNIS-SLQHLTVYHC  862

Query  458   PKLKLLPQGMRLLSSSTKFSISGCPLLKQKYKSKSGQNWPEVANI  324
               L LLP+ M  L++     I  CPLL ++   ++    P++A+I
Sbjct  863   RYLALLPKEMPRLTNLKTLEIIECPLLIEECLRETSATGPKIAHI  907



>emb|CBI35059.3| unnamed protein product [Vitis vinifera]
Length=1204

 Score = 71.2 bits (173),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 64/212 (30%), Positives = 94/212 (44%), Gaps = 35/212 (17%)
 Frame = -2

Query  1064  MTTIYIKNCPPGKQLPQFHLLPSLGELYFESIM-VDYIDTTDYEDDNSPSRSELFFPSLK  888
             +  I I+ C   + LP F  LPSL  L  + +  V YI+        S S ++ FFPSLK
Sbjct  584   LARIEIRRCDRCQDLPPFGQLPSLELLKLQDLTAVVYIN-------ESSSATDPFFPSLK  636

Query  887   KLWIWNCPNLKGWWKKNDEAIEEELL--PPFPCISVVDIKQSPNVTWMPLFPTVSEKLYI  714
             +L ++  PNLKGWW++  +  EE++L  P FPC+S   I    N+T + L P+       
Sbjct  637   RLELYELPNLKGWWRR--DGTEEQVLSVPSFPCLSEFLIMGCHNLTSLQLPPS-------  687

Query  713   VTGSIIPLEHTKK----VCSSFKYLKKLWVSEVADLEYMEIELFPSLEYLWVYDCRNLRD  546
                S + LEH       +   F  L KL +S+  +L    +   P L  L + +C NL  
Sbjct  688   PCFSQLELEHCMNLKTLILPPFPCLSKLDISDCPELRSFLLPSSPCLSKLDISECLNLTS  747

Query  545   WGKKGDHEDAPKALAKLAPSVIEFEVKNCPKL  450
                               P + E  +  CP L
Sbjct  748   LELHS------------CPRLSELHICGCPNL  767



>gb|AES98695.2| disease resistance protein RGA4 [Medicago truncatula]
Length=1337

 Score = 71.2 bits (173),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 76/283 (27%), Positives = 131/283 (46%), Gaps = 30/283 (11%)
 Frame = -2

Query  1160  LEEQNPKQQPMLTLLPPEDIGSVLSWKFASAYMTTIYIKNCPPGKQLPQFHLLPSLGELY  981
             LEE  P        +   D  S+ SW    + + ++ + +C    +LP F  LPSL +L 
Sbjct  719   LEELQPHSNLKCLDINCYDGLSLPSWIIILSNLISLKLGDCNKIVRLPLFGKLPSLKKLR  778

Query  980   FESIM-VDYIDTTDYEDDNSPSRSELFFPSLKKLWIWNCPNLKGWWKKNDEAIEEELLPP  804
                +  + Y+D  D  +D    R+   FPSL+ L +   PN++G  K     +       
Sbjct  779   VYGMNNLKYLDD-DESEDGMEVRA---FPSLEVLELHGLPNIEGLLKVERGEM-------  827

Query  803   FPCISVVDIKQSPNVTWMPLFPTVSEKLYIVTGSIIPLEHTKKVCSSFKYLKKLWVSEVA  624
             FPC+S +DI + P +  +P  P++ +    V G    L  +    S+F+ L +L ++   
Sbjct  828   FPCLSSLDIWKCPKLG-LPCLPSLKD--LGVDGRNNELLRS---ISTFRGLTQLTLNSGE  881

Query  623   DLEYMEIELF---PSLEYLWVYDCRNLRDWGKKGDHEDAPKALAKLAPSVIEFEVKNCPK  453
              +  +  E+F    SL+ L+V     L         E  P+   +   S+    +  C  
Sbjct  882   GITSLPEEMFKNLTSLQSLFVTFLPQL---------ESLPEQNWEGLQSLRALLIWGCRG  932

Query  452   LKLLPQGMRLLSSSTKFSISGCPLLKQKYKSKSGQNWPEVANI  324
             L+ LP+G+R L+S    SI  CP LK++ K  +G++W ++A+I
Sbjct  933   LRCLPEGIRHLTSLELLSIIDCPTLKERCKEGTGEDWDKIAHI  975



>gb|AAP45181.2| Disease resistant protein rga3, putative [Solanum bulbocastanum]
Length=953

 Score = 70.9 bits (172),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 77/273 (28%), Positives = 120/273 (44%), Gaps = 51/273 (19%)
 Frame = -2

Query  1064  MTTIYIKNCPPGKQLPQFHLLPSLGELYFE--SIMVDYIDTTDYEDDNSPSRSELFFPSL  891
             + +I I  C     LP F  LP L  L  +  S+ V+++     ED   P+R    FPSL
Sbjct  699   VVSILISGCENCSCLPPFGELPCLESLELQDGSVEVEFV-----EDSGFPTRRR--FPSL  751

Query  890   KKLWIWNCPNLKGWWKKNDEAIEEELLPPFPCISVVDIKQSPNVTWMPLFPTVSE-----  726
             +KL I    NLKG  +   E         FP +  + I   P    M +FPT+S      
Sbjct  752   RKLHIGGFCNLKGLQRMEGE-------EQFPVLEEMKISDCP----MFVFPTLSSVKKLE  800

Query  725   --------------KLYIVTGSIIPLEHT-----KKVCSSFKYLKKLWVSEVADLEYMEI  603
                            L  +T   I   HT     +++  S + LK L VS + +L+    
Sbjct  801   IWGEADARGLSSISNLSTLTSLKIFSNHTVTSLLEEMFKSLENLKYLSVSYLENLK----  856

Query  602   ELFPSLEYLWVYDCRNLRDWGKKGDHEDAPKALAKLAPSVIEFEVKNCPKLKLLPQGMRL  423
             EL  SL  L    C ++R        E  P+   +   S+ E  V++C  LK LP+G++ 
Sbjct  857   ELPTSLASLNNLKCLDIRYCYAL---ESLPEEGLEGLSSLTELFVEHCNMLKCLPEGLQH  913

Query  422   LSSSTKFSISGCPLLKQKYKSKSGQNWPEVANI  324
             L++ T   I GCP L ++ +   G++W ++++I
Sbjct  914   LTTLTSLKIRGCPQLIKRCEKGIGEDWHKISHI  946



>ref|XP_010670790.1| PREDICTED: putative disease resistance protein RGA1 [Beta vulgaris 
subsp. vulgaris]
Length=1153

 Score = 70.9 bits (172),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 67/240 (28%), Positives = 112/240 (47%), Gaps = 30/240 (13%)
 Frame = -2

Query  1064  MTTIYIKNCPPGKQLPQFHLLPSLGEL---YFESIMVDYIDTTDYEDDNSPSRSELFFPS  894
             + +I I  C   K LP F  LP L  L   Y  S+   YI T+   + N  S S  +FPS
Sbjct  784   LVSIEIVGCERCKHLPPFSRLPHLRSLELWYLGSL--QYIGTSG--NINEASSSTPYFPS  839

Query  893   LKKLWIWNCPNLKGWWKKNDEAIEEELLPPFPCISVVDIKQSPNVTWMPLFPTV-SEKLY  717
             L++L ++  P LKGW    +   E +  P FPC+S + I   P +  +P+ P + S    
Sbjct  840   LERLVLFQLPELKGWSMIENNVDEPK--PFFPCLSKLFIGYCPKLMSIPMVPRLESLGAN  897

Query  716   IVTGSIIPL-----EHTKKVCS--SFKYLKKLWVSEVADLEYMEIELFPSLEYLWVYDCR  558
              +  +++ L     +    +CS  +   L++L +  + +L+ + I LF SLE L ++ C+
Sbjct  898   NIHKNLLELLLSVDDSQTAMCSLPTPSMLRELHIRSINELDILSINLF-SLESLSIHICQ  956

Query  557   NLRDWGKKGDHEDAPKALAKLAPSVIEFEVKNCPKLKLLPQGMRLLSSSTKFSISGCPLL  378
             +L             + + K   S+   E+ NC +LK +   +  L+   +  IS C  L
Sbjct  957   HL------------IRLIVKAPSSLRHLEIHNCLRLKYISNALHNLAVLEELKISYCEQL  1004



>ref|XP_008341719.1| PREDICTED: putative disease resistance protein RGA3, partial 
[Malus domestica]
Length=982

 Score = 70.5 bits (171),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 59/198 (30%), Positives = 90/198 (45%), Gaps = 39/198 (20%)
 Frame = -2

Query  1136  QPMLTLLPPEDIGSVLSW-----KFASAYMTTIYIKN-----CPPGKQLPQFHLLPSLGE  987
             + M  L P  ++  +  W     +FAS +   + I N     C   + LP    LP L +
Sbjct  748   KSMEVLQPHSNLKQLTVWYYRGVRFASWFSCLLNIVNLGLYGCKRCQHLPPLDHLPFLKK  807

Query  986   L------YFESIMVDYIDTTDYEDDNSPSRSELFFPSLKKLWIWNCPNLKGWWKKNDE--  831
             L        E I++   ++++   D     S  FFPSL++L I+ CP LKGWW+ +    
Sbjct  808   LDLRGLEKLEYILLSENESSNSMSDEMMRIS--FFPSLEELHIYRCPVLKGWWRAHTHNS  865

Query  830   -----AIEEELLPPFPCISVVDIKQSPNVTWMPLFPTVSEKLYIVTGSIIPLEHTKKVCS  666
                  + E   LP FPC+S + I   PN+T MPL+P V E L                CS
Sbjct  866   ASSSSSTENLSLPSFPCLSNLSIIDCPNLTSMPLYPNVVEILL--------------SCS  911

Query  665   SFKYLKKLWVSEVADLEY  612
             S+K +  L+V   +D+ +
Sbjct  912   SWKVVYSLFVRGASDITH  929


 Score = 52.8 bits (125),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 37/125 (30%), Positives = 66/125 (53%), Gaps = 7/125 (6%)
 Frame = -2

Query  1553  SVAKLILAKIAPFAQDQIKLLWGLNEELTKLGDLVSHIGAVLLDAEGEKHNKKTENL-LE  1377
             ++ + I+ ++   A   I  +WG+ +EL KL + V+   A+LLDAE ++ N     L LE
Sbjct  8     NITERIIVRLGSRAFQTIGSIWGVQDELNKLKETVAGFQAILLDAEQKQANNNEVKLWLE  67

Query  1376  MLKNIMDEANRLMDYFSPRAKNHRPNQEDGCCS----YFVSHPNPFVWVSDSFMAGKIKS  1209
              +++ + EA+ ++D F+   +  +  +++   S     F S  N  V+     M+ KIK 
Sbjct  68    SVEDAVYEADDVLDEFNTEVQRRQVMRDNAKLSKEVCIFFSSSNQLVFGLK--MSHKIKD  125

Query  1208  INNRL  1194
             IN RL
Sbjct  126   INERL  130



>ref|XP_008346938.1| PREDICTED: putative disease resistance RPP13-like protein 1 [Malus 
domestica]
Length=601

 Score = 70.1 bits (170),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 38/104 (37%), Positives = 56/104 (54%), Gaps = 6/104 (6%)
 Frame = -2

Query  617  EYMEIELFPSLEYLWVYDCRNLRDWGKKGDHEDAPKALAK------LAPSVIEFEVKNCP  456
            E M I  FPSLE L VY C  L+ W +   H  A  + +         PS+    + +CP
Sbjct  492  EMMRISFFPSLETLEVYICPVLKGWWRAHTHNSASSSSSTENLSLPSFPSLSTLSIMDCP  551

Query  455  KLKLLPQGMRLLSSSTKFSISGCPLLKQKYKSKSGQNWPEVANI  324
             L  LP+G R L       ISGCP+L ++ K ++G++WP++A+I
Sbjct  552  NLTSLPEGTRGLPCLKTLYISGCPMLGERCKKETGEDWPKIAHI  595


 Score = 53.9 bits (128),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 45/83 (54%), Gaps = 10/83 (12%)
 Frame = -2

Query  965  VDYIDTTDYEDDNSPSRSEL---FFPSLKKLWIWNCPNLKGWWKKNDE-------AIEEE  816
            ++YI  ++ E  NS S   +   FFPSL+ L ++ CP LKGWW+ +         + E  
Sbjct  475  LEYILISEKESSNSMSDEMMRISFFPSLETLEVYICPVLKGWWRAHTHNSASSSSSTENL  534

Query  815  LLPPFPCISVVDIKQSPNVTWMP  747
             LP FP +S + I   PN+T +P
Sbjct  535  SLPSFPSLSTLSIMDCPNLTSLP  557



>ref|XP_003615749.1| NBS-LRR resistance protein [Medicago truncatula]
 gb|AES98707.1| disease resistance protein RGA4 [Medicago truncatula]
 gb|KEH28181.1| disease resistance protein RGA4 [Medicago truncatula]
Length=1013

 Score = 69.7 bits (169),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 75/277 (27%), Positives = 117/277 (42%), Gaps = 58/277 (21%)
 Frame = -2

Query  1070  AYMTTIYIKNCPPGKQLPQFHLLPSLGELYFESIMVDYIDTTDYEDDNSPSRSELF--FP  897
             A +   Y KNC    +LP    LPSL +L        Y+D   Y DD   S       FP
Sbjct  761   AVLRLSYCKNCV---RLPSLAKLPSLKKLQLW-----YMDNVQYVDDEESSDGVEVRGFP  812

Query  896   SLKKLWIWNCPNLKGWWKKNDEAIEEELLPPFPCISVVDIKQSPNVTWMPLFPTVSEKLY  717
             SL++L + N PNL+   K     I       FP +S + I   P +  +P   +  E   
Sbjct  813   SLEELLLGNLPNLERLLKVETGEI-------FPRLSKLAIVGCPKLG-LPHLSSFKE--L  862

Query  716   IVTGSIIPLEHTKKVCSSFKYLKKLWVSEVADLEY--------------MEIELFP----  591
             IV G    L  +    SSF  L  L ++   D+ Y              +EI  FP    
Sbjct  863   IVDGCNNELLES---ISSFYGLTTLEINRGEDVTYFPKGMLKNLTCLRTLEISDFPKVKA  919

Query  590   --------SLEYLWVYDCRNLRDWGKKGDHEDAPKALAKLAPSVIEFEVKNCPKLKLLPQ  435
                     +LE+L ++ C  L         +  P+ L +   S+   E+  C +L+ LP+
Sbjct  920   LPSEAFNLALEHLGIHHCCEL---------DSLPEQLFEGLRSLRTMEIAFCERLRCLPE  970

Query  434   GMRLLSSSTKFSISGCPLLKQKYKSKSGQNWPEVANI  324
             G+R L+S    ++ GCP + ++ K + G++W  + +I
Sbjct  971   GIRHLTSLEVLTVYGCPAVAERCKEEIGEDWDMIEHI  1007



>emb|CAJ44366.1| putative CC-NBS-LRR resistance protein [Malus domestica]
Length=955

 Score = 69.7 bits (169),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 38/104 (37%), Positives = 56/104 (54%), Gaps = 6/104 (6%)
 Frame = -2

Query  617  EYMEIELFPSLEYLWVYDCRNLRDWGKKGDHEDAPKALAK------LAPSVIEFEVKNCP  456
            E M I  FPSLE L VY C  L+ W +   H  A  + +         PS+    + +CP
Sbjct  846  EMMRISFFPSLETLEVYICPVLKGWWRAHTHNSASSSSSTENLSLPSFPSLSTLSIMDCP  905

Query  455  KLKLLPQGMRLLSSSTKFSISGCPLLKQKYKSKSGQNWPEVANI  324
             L  LP+G R L       ISGCP+L ++ K ++G++WP++A+I
Sbjct  906  NLTSLPEGTRGLPCLKTLYISGCPMLGERCKKETGEDWPKIAHI  949


 Score = 53.9 bits (128),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 45/83 (54%), Gaps = 10/83 (12%)
 Frame = -2

Query  965  VDYIDTTDYEDDNSPSRSEL---FFPSLKKLWIWNCPNLKGWWKKNDE-------AIEEE  816
            ++YI  ++ E  NS S   +   FFPSL+ L ++ CP LKGWW+ +         + E  
Sbjct  829  LEYILISEKESSNSMSDEMMRISFFPSLETLEVYICPVLKGWWRAHTHNSASSSSSTENL  888

Query  815  LLPPFPCISVVDIKQSPNVTWMP  747
             LP FP +S + I   PN+T +P
Sbjct  889  SLPSFPSLSTLSIMDCPNLTSLP  911



>ref|XP_010683936.1| PREDICTED: putative disease resistance protein RGA4 [Beta vulgaris 
subsp. vulgaris]
Length=951

 Score = 69.3 bits (168),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 71/275 (26%), Positives = 119/275 (43%), Gaps = 49/275 (18%)
 Frame = -2

Query  1097  SVLSWKFASAYMTTIYIKNCPPGKQLPQFHLLPSLGELYFESIMVDYIDTTDYEDDN---  927
             +V  W  + + +  I    C   +++P    LP     Y E++ + Y+D  +Y + N   
Sbjct  645   AVDDWASSLSQLVYINFDGCSNLQEMPVLSRLP-----YLETLHLRYMDKLEYMETNRST  699

Query  926   SPSRSELFFPSLKKLWIWNCPNLKGWWKK--NDEAIEEELLPPFPCISVVDIKQSPNVTW  753
             S + SE  F SL+ L +   P LKGWWK   +   ++++    FPC+S + I + PN+T 
Sbjct  700   SSTESETIFKSLRSLLLCAIPKLKGWWKGEGSRSGVDDQTRLIFPCLSELQILECPNLTS  759

Query  752   MPLFPTV--------SEKLYIVTGSIIPLEHTKKV----CSSFKYLKKLWVS--------  633
               L P++        +E+L I+  +    E+  K+      +  YLK L  +        
Sbjct  760   FLLCPSLEELILENNNERLQIIVKNTGKEEYGVKLRDLEIDNVGYLKSLTTNCLSRLSID  819

Query  632   --------EVADLEYMEIELFP-SLEYLWVYDCRNLRDWGKKGDHEDAPKALAKLAPSVI  480
                     EV D   +  + FP SL Y+     +N+            PK + +   S+ 
Sbjct  820   GSSISEDEEVDDENNILWKSFPQSLCYVKFKSFKNM---------TSLPKVI-QCMTSLQ  869

Query  479   EFEVKNCPKLKLLPQGMRLLSSSTKFSISGCPLLK  375
               ++  C KL+ LP+ +  LSS     I  CP LK
Sbjct  870   TLQLVFCAKLEALPEWISCLSSLQFLFICACPSLK  904



>ref|XP_003615699.1| NBS-LRR resistance protein [Medicago truncatula]
 gb|AES98657.1| NB-ARC domain disease resistance protein [Medicago truncatula]
Length=1186

 Score = 69.3 bits (168),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 69/277 (25%), Positives = 125/277 (45%), Gaps = 44/277 (16%)
 Frame = -2

Query  1088  SWKFASAYMTTIYIKNCPPGKQLPQFHLLPSLGELYFESIM-VDYIDTTDYEDDNSPSRS  912
             SW    + +  + + NC    +LP F  L SL +L   ++  + Y+D  +   D   +R 
Sbjct  754   SWISILSNLVALVLWNCEKCVRLPSFGKLQSLKKLALHNMNDLKYLDDDEESQDGIVAR-  812

Query  911   ELFFPSLKKLWIWNCPNLKGWWKKNDEAIEEELLPPFPCISVVDIKQSPNVTW-------  753
                FPSL+ L +   PNL+G  K        E    FPC+S + I   P +         
Sbjct  813   --IFPSLEVLILEILPNLEGLLKV-------ERGEMFPCLSRLTISFCPKLGLPCLVSLK  863

Query  752   -MPLFPTVSEKLYIVTG----SIIPLEHTKKVCS----SFKYLKKLWVSEVADLEYMEIE  600
              + +    +E L  ++     + + L   K++ S     FK L  L   +V D  + +++
Sbjct  864   NLDVLGCNNELLRSISSFCGLNSLTLAGGKRITSFPDGMFKNLTCLQALDVND--FPKVK  921

Query  599   LFPS------LEYLWVYDCRNLRDWGKKGDHEDAPKALAKLAPSVIEFEVKNCPKLKLLP  438
               P+      +E+L +  C  L         E  PK + +   S+   ++  C +L+ LP
Sbjct  922   ELPNEPFSLVMEHLIISSCDEL---------ESLPKEIWEGLQSLRTLDICRCKELRCLP  972

Query  437   QGMRLLSSSTKFSISGCPLLKQKYKSKSGQNWPEVAN  327
             +G+R L+S    +I GCP L+++ K  +G++W +++N
Sbjct  973   EGIRHLTSLELLTIRGCPTLEERCKEGTGEDWYKISN  1009



>ref|XP_003615700.1| NBS-LRR resistance protein [Medicago truncatula]
 gb|AES98658.1| NB-ARC domain disease resistance protein [Medicago truncatula]
Length=1175

 Score = 69.3 bits (168),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 68/277 (25%), Positives = 125/277 (45%), Gaps = 44/277 (16%)
 Frame = -2

Query  1088  SWKFASAYMTTIYIKNCPPGKQLPQFHLLPSLGELYFESIM-VDYIDTTDYEDDNSPSRS  912
             SW    + +  + + NC    +LP F  L SL +L   ++  + Y+D  +   D   +R 
Sbjct  754   SWISILSNLVALVLWNCEKCVRLPSFGKLQSLKKLALHNMNDLKYLDDDEESQDGIVAR-  812

Query  911   ELFFPSLKKLWIWNCPNLKGWWKKNDEAIEEELLPPFPCISVVDIKQSPNVTW-------  753
                FPSL+ L +   PNL+G  K     +       FPC+S + I   P +         
Sbjct  813   --IFPSLEVLILEILPNLEGLLKVERGEM-------FPCLSRLTISFCPKLGLPCLVSLK  863

Query  752   -MPLFPTVSEKLYIVTG----SIIPLEHTKKVCS----SFKYLKKLWVSEVADLEYMEIE  600
              + +    +E L  ++     + + L   K++ S     FK L  L   +V D  + +++
Sbjct  864   NLDVLGCNNELLRSISSFCGLNSLTLAGGKRITSFPDGMFKNLTCLQALDVND--FPKVK  921

Query  599   LFPS------LEYLWVYDCRNLRDWGKKGDHEDAPKALAKLAPSVIEFEVKNCPKLKLLP  438
               P+      +E+L +  C  L         E  PK + +   S+   ++  C +L+ LP
Sbjct  922   ELPNEPFSLVMEHLIISSCDEL---------ESLPKEIWEGLQSLRTLDICRCKELRCLP  972

Query  437   QGMRLLSSSTKFSISGCPLLKQKYKSKSGQNWPEVAN  327
             +G+R L+S    +I GCP L+++ K  +G++W +++N
Sbjct  973   EGIRHLTSLELLTIRGCPTLEERCKEGTGEDWYKISN  1009



>ref|XP_003613316.1| Cc-nbs-lrr resistance protein [Medicago truncatula]
Length=569

 Score = 68.6 bits (166),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 64/267 (24%), Positives = 120/267 (45%), Gaps = 44/267 (16%)
 Frame = -2

Query  1064  MTTIYIKNCPPGKQLPQFHLLPSLGELYFESI-MVDYIDTTDYEDDNSPSRSELFFPSLK  888
             +  +YIK+C     LPQ   LP L EL+  ++  + Y+D   Y+       +EL   SL+
Sbjct  257   LHCVYIKDCQSCLHLPQLGKLPYLKELFISNVSRIIYLDEESYDGGAEGGFTELEHLSLE  316

Query  887   KLWIWNCPNLKGWWKKNDEAIEEELLPPFPCISVVDIKQSPNVTWMPLFPTVSEKLYIVT  708
             KL     PNL    +++ E +       FP +S + + + PN+  +P  P+++   YI  
Sbjct  317   KL-----PNLIRISREDRENL-------FPHLSALVVIECPNLLGLPCLPSLN---YIC-  360

Query  707   GSIIPLEHTKKVCSSFKYLKKLWVSEVADLEYMEIELFP--------SLEYLWVYDCRNL  552
                I  +  + + SS    K   +  +   +  E+  FP        SL+ L ++ C  +
Sbjct  361   ---IQGKCNQDLLSSIH--KHGGLESLCFYDNKELTCFPDGMLRNLISLKLLMIWSCSEI  415

Query  551   RDWGKKGDHEDAPKALA-------KLAPSVI-------EFEVKNCPKLKLLPQGMRLLSS  414
                 +   H  + ++L        KL P+ +       +  + NCPKL  LP  ++ L+ 
Sbjct  416   EVLDEALQHVTSLESLILSDLQNLKLLPASLGNLGFLHKLIISNCPKLTCLPMSIQSLTG  475

Query  413   STKFSISGCPLLKQKYKSKSGQNWPEV  333
                  I  C  L+++ + ++G++WP++
Sbjct  476   LESLGIYSCSELEKRCEKETGEDWPKI  502



>ref|XP_010097435.1| Putative disease resistance protein RGA1 [Morus notabilis]
 gb|EXB68165.1| Putative disease resistance protein RGA1 [Morus notabilis]
Length=1108

 Score = 68.9 bits (167),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 65/288 (23%), Positives = 121/288 (42%), Gaps = 62/288 (22%)
 Frame = -2

Query  1007  LLPSLGELY-FESIMVDYIDTTDYEDDNSPSRSELFFPSLKKLWIWNCPNLKGWWKKNDE  831
             +LP++ + +  + + +D +   +Y D+   S    FFP L++LW+   P L+GWWK +  
Sbjct  816   VLPAISQCHKLKVLALDEMTDLEYVDNTGVSSQGEFFPDLQELWLTELPKLQGWWKPS--  873

Query  830   AIEEELLPPFPCISVVDIKQSPNVTWMPLFPTVSEKLYIVTGSIIPLEHTKKVCSS----  663
             ++ +E LP FP +S + ++  P +  MPLFPT+ + L + +    P + T K  ++    
Sbjct  874   SVSQEYLPSFPRLSKLVVEDCPKLDSMPLFPTLEDGLVLDSTCWNPFQLTMKHRAAATKN  933

Query  662   ------------FKYLKKLWVSEVAD----------------LEYMEIELFPSLEYL--W  573
                            LKKL +  + +                L+ ++ +  P L  L   
Sbjct  934   KVSSSTSSQSTPLSKLKKLCIVGIPEFDDSKANEVEWHNLKSLQLLKFDSLPGLTTLPEG  993

Query  572   VYDCRNLRDWGKKGDHEDAPKALAKLAPSVIEFEVKNC----------------------  459
             +    N  + GK     + P+   K A ++ E  V  C                      
Sbjct  994   LKPATNQAEGGKPAG-TNQPEG-GKPATNLQELHVWRCGLRELPAWIDKLELLEKLVIRA  1051

Query  458   -PKLKLLPQGMRLLSSSTKFSISGCPLLKQKYKSKSGQNWPEVANITT  318
              P +  LP  +R L       I  CP+L+++ +   G +W ++++I T
Sbjct  1052  CPMMGTLPGEIRGLKYLKTVEIDDCPMLQRRCEEGIGADWDKISHIET  1099



>ref|XP_010659351.1| PREDICTED: putative disease resistance protein RGA3 [Vitis vinifera]
 ref|XP_010659352.1| PREDICTED: putative disease resistance protein RGA3 [Vitis vinifera]
 ref|XP_010659353.1| PREDICTED: putative disease resistance protein RGA3 [Vitis vinifera]
 ref|XP_010659354.1| PREDICTED: putative disease resistance protein RGA3 [Vitis vinifera]
 ref|XP_010659355.1| PREDICTED: putative disease resistance protein RGA3 [Vitis vinifera]
 ref|XP_010659356.1| PREDICTED: putative disease resistance protein RGA3 [Vitis vinifera]
 ref|XP_010659357.1| PREDICTED: putative disease resistance protein RGA3 [Vitis vinifera]
 ref|XP_010659358.1| PREDICTED: putative disease resistance protein RGA3 [Vitis vinifera]
 ref|XP_010659359.1| PREDICTED: putative disease resistance protein RGA3 [Vitis vinifera]
 ref|XP_010659360.1| PREDICTED: putative disease resistance protein RGA3 [Vitis vinifera]
 ref|XP_010659361.1| PREDICTED: putative disease resistance protein RGA3 [Vitis vinifera]
 ref|XP_010659362.1| PREDICTED: putative disease resistance protein RGA3 [Vitis vinifera]
 ref|XP_010659363.1| PREDICTED: putative disease resistance protein RGA3 [Vitis vinifera]
 ref|XP_010659364.1| PREDICTED: putative disease resistance protein RGA3 [Vitis vinifera]
 ref|XP_010659365.1| PREDICTED: putative disease resistance protein RGA3 [Vitis vinifera]
 ref|XP_010659366.1| PREDICTED: putative disease resistance protein RGA3 [Vitis vinifera]
 ref|XP_010659367.1| PREDICTED: putative disease resistance protein RGA3 [Vitis vinifera]
 ref|XP_010659368.1| PREDICTED: putative disease resistance protein RGA3 [Vitis vinifera]
 ref|XP_010659369.1| PREDICTED: putative disease resistance protein RGA3 [Vitis vinifera]
 ref|XP_010659370.1| PREDICTED: putative disease resistance protein RGA3 [Vitis vinifera]
 ref|XP_010659372.1| PREDICTED: putative disease resistance protein RGA3 [Vitis vinifera]
 ref|XP_010659373.1| PREDICTED: putative disease resistance protein RGA3 [Vitis vinifera]
 ref|XP_010659374.1| PREDICTED: putative disease resistance protein RGA3 [Vitis vinifera]
 ref|XP_010659375.1| PREDICTED: putative disease resistance protein RGA3 [Vitis vinifera]
 ref|XP_010659376.1| PREDICTED: putative disease resistance protein RGA3 [Vitis vinifera]
 ref|XP_010659377.1| PREDICTED: putative disease resistance protein RGA3 [Vitis vinifera]
 ref|XP_010659378.1| PREDICTED: putative disease resistance protein RGA3 [Vitis vinifera]
 ref|XP_010659379.1| PREDICTED: putative disease resistance protein RGA3 [Vitis vinifera]
Length=998

 Score = 68.9 bits (167),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 66/252 (26%), Positives = 111/252 (44%), Gaps = 51/252 (20%)
 Frame = -2

Query  1064  MTTIYIKNCPPGKQLPQFHLLPSLGELYFESI-----MVDYIDTTDYEDDNSPSRSELFF  900
             +  I I +C   K LP F  LPSL  L   ++     M+DY           PS ++ FF
Sbjct  785   LVKIQISSCDRSKVLPPFAQLPSLKYLELSNLIAVECMMDY-----------PSSAKPFF  833

Query  899   PSLKKLWIWNCPNLKGWWKKNDEAIEEELLPPFPCISVVDIKQSPNVTWMPLFPTVSEKL  720
             PSLK L + + PNLKGW  ++   +  E  P +P +                     E L
Sbjct  834   PSLKTLQLSDLPNLKGWGMRD---VAAEQAPSYPYL---------------------EDL  869

Query  719   YIVTGSIIPLEHTKKVCSSFKYLKKLWVSEVADLEYMEIELFPSLEYLWVYDCRNLRDWG  540
              +   ++    H   V SS K +    ++++  L    ++   +L+ L +  C +L    
Sbjct  870   RLDNTTVELCLHLISVSSSLKSVSIRRINDLISLPE-GLQHVSTLQTLTIRGCSSL----  924

Query  539   KKGDHEDAPKALAKLAPSVIEFEVKNCPKLKLLPQGMRLLSSSTKFSISGCPLLKQKYKS  360
                     P  + +L  S+ E  ++ CP L  LP+ MR L       I+GCP L ++ + 
Sbjct  925   -----ATLPDWIGRLT-SLSELCIEKCPNLTSLPEEMRSLRHLHTLKINGCPYLYERCQK  978

Query  359   KSGQNWPEVANI  324
             ++G++WP +++I
Sbjct  979   ETGEDWPTISHI  990



>ref|XP_002519373.1| leucine-rich repeat containing protein, putative [Ricinus communis]
 gb|EEF42990.1| leucine-rich repeat containing protein, putative [Ricinus communis]
Length=1208

 Score = 68.9 bits (167),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 59/179 (33%), Positives = 84/179 (47%), Gaps = 26/179 (15%)
 Frame = -2

Query  1151  QNPKQQPMLTLLPPEDIGSV--LSWKFASAYMTTIYIKNCPPGKQLPQFHLLPSLGELYF  978
             QN +    L  L  E  G+V   SW      +  I IKNC   + LP  H L +L  L  
Sbjct  757   QNLQPHSNLKKLHVEGYGAVKFSSWLSLLRGIVKITIKNCHKCQHLPPLHELRTLKFLSL  816

Query  977   ESIM-VDYIDTTDYEDDNSPSRSELFFPSLKKLWIWNCPNLKGWWKKNDEA---------  828
             + +  ++YID    +  + PS S +FFPSLK L + + PNLK WW+    A         
Sbjct  817   QELTNLEYID----DGSSQPSSSLIFFPSLKVLSLVDLPNLKRWWRTKAAAELMSNSEIA  872

Query  827   -------IEEE--LLPPFPCISVVDIKQSPNVTWMPLFPTVSE-KLYIVTGSIIPLEHT  681
                     EE+  LLP FP +S + +    N+T MPL P + E  LY V+  ++  + T
Sbjct  873   SSLLAEHQEEQPMLLPFFPRLSSLKVHHCFNLTSMPLHPYLEELYLYEVSEELLQQQRT  931



>ref|XP_010026779.1| PREDICTED: putative disease resistance protein RGA3 [Eucalyptus 
grandis]
 gb|KCW60170.1| hypothetical protein EUGRSUZ_H02892 [Eucalyptus grandis]
Length=1135

 Score = 68.6 bits (166),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 74/281 (26%), Positives = 118/281 (42%), Gaps = 53/281 (19%)
 Frame = -2

Query  1088  SWKFASAYMTTIYIKNCPPGKQLPQFHLLPSLGELYFESIMVDYIDTT----DYEDDNSP  921
             SW  +   +  + +  C   K L     LPSL +L    + +D ++      D E  N+ 
Sbjct  791   SWLSSIRNLVDLVLWECRGWKYLSPISELPSLKKLTL--VGLDALELVQEIGDLEQSNT-  847

Query  920   SRSELFFPSLKKLWIWNCPNLKGWWKK------NDEAIEEELLPPFPCISVVDIKQSPNV  759
             +RS  FFPSL+ L++  C NLKGWW K      N +  E +    FP +S ++I   P++
Sbjct  848   TRS--FFPSLEGLFLHYCGNLKGWWGKRQLGGANQDHWEYDSQSSFPKLSSLEISYCPHL  905

Query  758   TWMPLFPTVSEKLYIVTGSIIPLEHT----------KKVCSSF---KYLKKLWVSEVADL  618
                PLFP + E L +V  S+  +E              V S+F     LKKL      DL
Sbjct  906   NSEPLFPWI-ENLSLVGVSVKIMEQQLMAFQNCPSEAAVSSTFVPLSKLKKLLFVSGEDL  964

Query  617   EYMEIEL----FPSLEYLWVYDCRNLRDWGKK--------------------GDHEDAPK  510
             E+  +E+      SLE + +Y C  L+   +                       H+D   
Sbjct  965   EHSMLEILLRFLDSLESMSLYYCFKLKSLSRSMQYLSSLQHLDICGCEELDLSSHDDEHG  1024

Query  509   ALAKLAPSVIEFEVKNCPKLKLLPQGMRLLSSSTKFSISGC  387
                +    + +  ++  PKL  LP G++ +++     IS C
Sbjct  1025  TQWRFLTKLRDLRIRQLPKLVALPDGIQHVTTLQFLHISRC  1065



>emb|CAN67734.1| hypothetical protein VITISV_017638 [Vitis vinifera]
Length=1211

 Score = 68.6 bits (166),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 63/212 (30%), Positives = 93/212 (44%), Gaps = 35/212 (17%)
 Frame = -2

Query  1064  MTTIYIKNCPPGKQLPQFHLLPSLGELYFESIM-VDYIDTTDYEDDNSPSRSELFFPSLK  888
             +  I I+ C   + LP F  LPSL  L  + +  V YI+        S S ++ FFPSLK
Sbjct  783   LARIEIRRCDRCQDLPPFGQLPSLELLKLQDLTAVVYIN-------ESSSATDPFFPSLK  835

Query  887   KLWIWNCPNLKGWWKKNDEAIEEELLP--PFPCISVVDIKQSPNVTWMPLFPTVSEKLYI  714
             +L ++  PNLKGWW+++    EE++L    FPC+S   I    N+T + L P+       
Sbjct  836   RLELYELPNLKGWWRRD--GTEEQVLSVHSFPCLSEFLIMGCHNLTSLQLPPS-------  886

Query  713   VTGSIIPLEHTKK----VCSSFKYLKKLWVSEVADLEYMEIELFPSLEYLWVYDCRNLRD  546
                S + LEH       +   F  L KL +S+  +L    +   P L  L + +C NL  
Sbjct  887   PCFSQLELEHCMNLKTLILPPFPCLSKLDISDCPELRSFLLPSSPCLSKLDISECLNLTS  946

Query  545   WGKKGDHEDAPKALAKLAPSVIEFEVKNCPKL  450
                               P + E  +  CP L
Sbjct  947   LELHS------------CPRLSELHICGCPNL  966



>ref|XP_010677314.1| PREDICTED: uncharacterized protein LOC104892985 [Beta vulgaris 
subsp. vulgaris]
Length=2382

 Score = 68.6 bits (166),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 61/249 (24%), Positives = 110/249 (44%), Gaps = 27/249 (11%)
 Frame = -2

Query  1064  MTTIYIKNCPPGKQLPQFHLLPSLGELYFESIM-VDYIDTT----DYEDDNSPSRSEL-F  903
             +  I +  C   +Q+P F  LP L  L    +  V+Y++      D+   +  + +E+ F
Sbjct  801   LVDITLLRCDGCQQVPSFGQLPFLKRLNLACLASVEYMEMESGLYDFPSSSKLTSTEIPF  860

Query  902   FPSLKKLWIWNCPNLKGWWKKNDE------------AIEEELLPPFPCISVVDIKQSPNV  759
             F SLK L +    NLKGWWK+  E            + E  L   F  +S + +++ PN+
Sbjct  861   FRSLKDLTLMGMSNLKGWWKEGGENANSDTKETLHVSTEHLLSMSFSNLSKLSVQECPNL  920

Query  758   TWMPLFPTVSEKLYIVTGSIIPLEHTKKVCSSF--KYLKKLWVSEVADLEYMEIELFPSL  585
              ++P  P + E   +     + +     V SS     LK+L +S V DL  +  E    L
Sbjct  921   VYLPACPNLDELSLVDANETLSVSKMATVSSSRPSSKLKRLTISNVEDLISLPAEFLKHL  980

Query  584   EYLWVYDCRNLRDWGKKGDHEDAPKALAKLAPSVIEFEVKNCPKLKLLPQGMRLLSSSTK  405
               L ++D + L    + G+       +A L+ S+   +  +C  L+ + +G+  L++  +
Sbjct  981   SSLDIWDVK-LVSTDRLGE------VMASLSSSLRCLQFTHCKSLRNISKGLEHLTALEE  1033

Query  404   FSISGCPLL  378
               +  C  L
Sbjct  1034  LVLWDCEQL  1042


 Score = 57.8 bits (138),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 64/232 (28%), Positives = 101/232 (44%), Gaps = 29/232 (13%)
 Frame = -2

Query  1028  KQLPQFHLLPSLGELYFESI-MVDYIDTTDYEDDNS---PSRSELFFPSLKKLWIWNCPN  861
             +++P F  LPSL  L   S+  V Y+++      +S   P+   +FFPSL++L +    +
Sbjct  2025  QKIPSFSQLPSLKRLTLVSLKSVKYMESDPASSTSSLLTPTERLMFFPSLRELILIGMTS  2084

Query  860   LKGWWKKNDEAIEEELLP-PFPCISVVDIKQSPNVTWMPLFPTVSEKLYIVTGSIIPLEH  684
             LK WWK+     E  LL   F  +S +DI   PN+  +PL P V E +   T S + +  
Sbjct  2085  LKAWWKEAYLGGEHPLLSMSFSHLSKLDIGFCPNLVILPLCPNVEELILEGTSSTLSVLE  2144

Query  683   TKKVCSSFKY---------LKKLWVSEVAD-LEYMEIELFPSLEYLWVYDCRNLRDWGKK  534
                  S+            LKKL +  V D L  +  +    L  L+V D R        
Sbjct  2145  MATNTSTTTSPSSSGSGLKLKKLRIDNVEDQLLLLPKQSLHHLASLYVLDPR--------  2196

Query  533   GDHEDAPKALAKLAPSVIE---FEVKNCPKLKLLPQGMRLLSSSTKFSISGC  387
                ED  + L ++  S+I     E   C  L+ + +G+  L+S  +     C
Sbjct  2197  --LEDTLR-LGEICTSLISLRYLEFSFCDSLRCISKGLEHLTSLEELVFRQC  2245



>gb|ABO28718.1| RB [Solanum verrucosum]
Length=960

 Score = 68.6 bits (166),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 71/256 (28%), Positives = 119/256 (46%), Gaps = 50/256 (20%)
 Frame = -2

Query  1064  MTTIYIKNCPPGKQLPQFHLLPSLG--ELYFESIMVDYIDTTDYEDDNSPSRSELFFPSL  891
             + +I I+ C     LP F  LPSL   EL+  S  V+Y+     E++  P R    FPSL
Sbjct  728   VVSITIRGCENCSCLPPFGELPSLESLELHTGSAEVEYV-----EENAHPGR----FPSL  778

Query  890   KKLWIWNCPNLKGWWKKNDEAIEEELLPPFPCISVVDIKQSPNVTWMPLFPTVSE----K  723
             +KL I +  NLKG  KK  E         FP +  + I   P    M + PT+S     K
Sbjct  779   RKLVICDFGNLKGLLKKEGE-------EQFPVLEEMTIHGCP----MFVIPTLSSVKTLK  827

Query  722   LYIVTGSIIPLEHTKKVCSSFKYLKKLWVSEVADLEYMEIELFPSL---EYLWVYDCRNL  552
             + +   +++      +  S+ + L  L +S   +   +  E+F +L   + L + D +NL
Sbjct  828   VDVTDATVL------RSISNLRALTSLDISSNYEATSLPEEMFKNLADLKDLTISDFKNL  881

Query  551   RDW-----------GKKGDHEDAPKAL----AKLAPSVIEFEVKNCPKLKLLPQGMRLLS  417
             ++              + ++ DA ++L     K   S+ E  V NC  LK LP+G++ L+
Sbjct  882   KELPTCLASLNALNSLQIEYCDALESLPEEGVKSLTSLTELSVSNCMTLKCLPEGLQHLT  941

Query  416   SSTKFSISGCPLLKQK  369
             + T   I+ CP++ ++
Sbjct  942   ALTTLIITQCPIVIKR  957



>gb|KDO49259.1| hypothetical protein CISIN_1g001955mg [Citrus sinensis]
Length=991

 Score = 68.6 bits (166),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 69/259 (27%), Positives = 111/259 (43%), Gaps = 54/259 (21%)
 Frame = -2

Query  1088  SWKFASAYMTTIYIKNCPPGKQLPQFHLLPSLGEL-YFESIMVDYIDTTDYEDDNSPSRS  912
             SW  +   +T I I  C   + +P+   LPSL  L  F+   ++YI ++          S
Sbjct  766   SWLSSVTNLTMIDISICIKCQYIPELDQLPSLKRLRLFKLSALEYISSS-------SPPS  818

Query  911   ELFFPSLKKLWIWNCPNLKGWWKKNDEAIEEELLPPFPCISVVDIKQSPNVTWMPLFPTV  732
                FPSL++L I+ CP LKGWW + D +  +   PPF                 PL  T+
Sbjct  819   TTIFPSLEELRIFACPELKGWW-RTDGSTTQTAEPPFS---------------HPLQQTM  862

Query  731   SEKLYIVTGSIIPLEHTKKVCSSFKYLKKLWVSEVADLEYMEIEL---FPSLEYLWVYDC  561
                          +  T      F  LK L +  + DLE    E+   FPS++ + +  C
Sbjct  863   -------------MRTTNTAEPPFSKLKSLTIESIDDLETWPEEMMPNFPSIQNISIELC  909

Query  560   RNLRDWGKKGDHEDAPKALAKLAPSVIEFEVKNCPKLKLLPQGMRLLSSSTKFSISGCPL  381
               L            P+ L K A ++    + +CP + +LP+G++L S      I  CP 
Sbjct  910   PKLISL---------PQRLNK-ATTLKTVGIYDCPNMAILPEGLQLQS----LEIIQCPQ  955

Query  380   LKQKYKSKSGQNWPEVANI  324
             L ++  +    +WP++A+I
Sbjct  956   LSERCGNNMAVDWPKIAHI  974



>ref|XP_007151318.1| hypothetical protein PHAVU_004G036300g [Phaseolus vulgaris]
 ref|XP_007151319.1| hypothetical protein PHAVU_004G036300g [Phaseolus vulgaris]
 gb|ESW23312.1| hypothetical protein PHAVU_004G036300g [Phaseolus vulgaris]
 gb|ESW23313.1| hypothetical protein PHAVU_004G036300g [Phaseolus vulgaris]
Length=1187

 Score = 68.6 bits (166),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 67/227 (30%), Positives = 108/227 (48%), Gaps = 47/227 (21%)
 Frame = -2

Query  905   FFPSLKKLWIWNCPNLKGWWKKNDEAIEEEL----LPPFPCISVVDIKQ--SPNVTWMP-  747
             FFP L  L +  C NL+    K+     +EL     P F    V  +    + N+T++P 
Sbjct  969   FFPKLCSLEMKGCQNLRKISHKDTHNHLKELEIVDCPQFKSFLVEGLSALGAENLTFLPK  1028

Query  746   ----LFPTVSE-------KLYIVTGSIIPLEHTKKVC-SSFKYLKKLWVS-------EVA  624
                 LFP+++        ++ + TG   PL + K VC SS K +  L  +       E  
Sbjct  1029  PMQVLFPSLTMLWIINCPEVEMFTGGGFPL-NVKYVCLSSLKLIASLREALDANTCLETL  1087

Query  623   DLEYMEIELFP-------SLEYLWVYDCRNLRDWGKKGDHEDAPKALAKLAPSVIEFEVK  465
              + ++++E FP       SL YL +Y CRNL+    KG          +   S++ F   
Sbjct  1088  IIRHLDVECFPDEVLLPHSLSYLEIYGCRNLKKMEYKG---------LRHLTSLVLF---  1135

Query  464   NCPKLKLLPQGMRLLSSSTKFSISGCPLLKQKYKSKSGQNWPEVANI  324
             +CP L+ LP+   L  S +  SI GCPLLK++ ++  G++W ++A+I
Sbjct  1136  DCPSLECLPEE-GLPKSISSLSIIGCPLLKKRCQNPDGKDWGKIAHI  1181



>gb|KEH25215.1| disease resistance protein (CC-NBS-LRR class) family protein 
[Medicago truncatula]
Length=988

 Score = 68.6 bits (166),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 69/265 (26%), Positives = 119/265 (45%), Gaps = 27/265 (10%)
 Frame = -2

Query  1115  PPEDIGSVLSWKFASAYMTTIYIKNCPPGKQLPQFHLLPSLGELYFESIMV-DYIDTTDY  939
             P  +  S LS     +Y++     NC   K LP    LP L  L   S+ V +YI   + 
Sbjct  739   PGYEFSSWLSSINHLSYISLFGFDNC---KSLPPLEHLPCLKSLEISSMKVLEYIHLEEV  795

Query  938   EDDNSPSRSELFFPSLKKLWIWNCPNLKGWWKKNDEAIEEELLPPFPCISVVDIKQSPNV  759
                     +  FFPSL++L    C N  GW +   +  E  + P       +DI  S + 
Sbjct  796   -----FHTAATFFPSLERLKFSGCKNFTGWQRMKRQLCESMVTP---LKETLDIASSSSS  847

Query  758   TWMPLFPTVSEKLYIVTGSIIPLEHTKKVCSSFKYLKKLWVSEVADLEYMEIELFPSLEY  579
             T +    ++  +  +   S++P    + + S    L+ L + +V +L+    + FPSL+ 
Sbjct  848   TPLSKLKSLKIEGKLPEISVLPSRWKQNLTS----LEHLEIGDVDNLDIWFEDNFPSLQK  903

Query  578   LWVYDCRNLRDWGKKGDHEDAPKALAKLAPSVIEFEVKNCPKLKLLPQGMRLLSSSTKFS  399
             + VY C          D +  P+ +  L+ S+   ++  C KL  LP+ M  L+      
Sbjct  904   VVVYGC----------DLQALPQKMCDLS-SLQHVKMMGCHKLASLPKEMVNLNKLVTLE  952

Query  398   ISGCPLLKQKYKSKSGQNWPEVANI  324
             I  CPLL ++ +S++G +WP+V ++
Sbjct  953   IWDCPLLVERCQSETGVDWPQVKHV  977



>ref|XP_004489884.1| PREDICTED: putative disease resistance protein RGA3-like [Cicer 
arietinum]
Length=1025

 Score = 68.2 bits (165),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 62/266 (23%), Positives = 117/266 (44%), Gaps = 36/266 (14%)
 Frame = -2

Query  1064  MTTIYIKNCPPGKQLPQFHLLPSLGELYFESI-MVDYIDTTDYEDDNSPSRSELFFPSLK  888
             +  +Y+K+C     LPQ   LP L EL+  ++  + YID   Y          L F SL+
Sbjct  765   LQCLYLKDCHSCLHLPQLAKLPYLKELFISNMSRLIYIDEESYNGGVMGGFIILKFLSLE  824

Query  887   KLWIWNCPNLKGWWKKNDEAIEEELLPPFPCISVVDIKQSPNVTWMPLFPTVSEKLYIVT  708
             KL     PNL    K++ E +       FP +S ++I + PN++ +P  P++        
Sbjct  825   KL-----PNLIRISKEDRENM-------FPHLSALEIIECPNLSGLPYLPSLDYMRIQGK  872

Query  707   GSIIPLEHTKKVCSSFKYLKKLWVSEVADLEYM---EIELFPSLEYLWVYDCRNLRDWGK  537
              +   L    K+      L+ LW  + A+L       +    SL+   +++C  +  + +
Sbjct  873   CNQDLLSSIHKLAC----LESLWFYDNAELTCFPDGMLRNLTSLKTFMIWNCSKIEGFDE  928

Query  536   KGDHEDA---------------PKALAKLAPSVIEFEVKNCPKLKLLPQGMRLLSSSTKF  402
                H  +               P++L  L   + +  + NCPKL  LP  ++ L+     
Sbjct  929   ALQHMTSLESLIVRDLPNLTTLPESLGNLGL-LHDLRISNCPKLTCLPMSIQSLTGLESL  987

Query  401   SISGCPLLKQKYKSKSGQNWPEVANI  324
              I  C  L+++ + ++ ++WP++A++
Sbjct  988   RIYSCSELEKRCEKETSEDWPKIAHV  1013



>ref|XP_003615746.1| Nbs-lrr resistance protein [Medicago truncatula]
 gb|AES98704.1| NB-ARC domain disease resistance protein [Medicago truncatula]
Length=1014

 Score = 68.2 bits (165),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 77/309 (25%), Positives = 136/309 (44%), Gaps = 58/309 (19%)
 Frame = -2

Query  1160  LEEQNPKQQPMLTLLPPEDIGSVLSWKFASAYMTTIYIKNCPPGKQLPQFHLLPSLGELY  981
             LEE  P        +   +  S+ SW    + + ++ ++NC    +LP    LPSL +L 
Sbjct  726   LEELQPHSNLKCLTINYNEGLSLPSWISLLSNLISLELRNCNKIVRLPLLGKLPSLKKLE  785

Query  980   FESIMVDYIDTTDY-EDDNSPSRSE-LFFPSLKKLWIWNCPNLKGWWKKNDEAIEEELLP  807
                  + Y+D   Y +DD S    E + F SL  L +    N++G  K     +      
Sbjct  786   -----LSYMDNLKYLDDDESQDGVEVMVFRSLMDLHLRYLRNIEGLLKVERGEM------  834

Query  806   PFPCISVVDIKQSPNVTWMPLFPTVSEKLYIVTGSIIPLEHTKKVCSSFKYLKKLWVSE-  630
              FPC+S ++I     +  +P  P++ E LY+   +        +  S+F+ L +L + E 
Sbjct  835   -FPCLSYLEISYCHKLG-LPSLPSL-EGLYVDGCN----NELLRSISTFRGLTQLTLMEG  887

Query  629   -------------VADLEYMEIELFPSLEYL----W----------VYDCRNLRDWGKKG  531
                          +  L+Y+E++ FP LE L    W          +  CR LR      
Sbjct  888   EGITSFPEGMFKNLTCLQYLEVDWFPQLESLPEQNWEGLQSLRALHISSCRGLRC-----  942

Query  530   DHEDAPKALAKLAPSVIEFEVKNCPKLKLLPQGMRLLSSSTKFSISGCPLLKQKYKSKSG  351
                  P+ +  L  S+   ++ +C  L+ LP+G+R L+S    +I  CP L+++ K  + 
Sbjct  943   ----LPEGIRHLT-SLRNLQIYSCKGLRCLPEGIRHLTSLEVLTIWECPTLEERCKEGTW  997

Query  350   QNWPEVANI  324
             ++W ++A+I
Sbjct  998   EDWDKIAHI  1006



>gb|KHF98275.1| Putative disease resistance RGA4 [Gossypium arboreum]
Length=382

 Score = 67.0 bits (162),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 50/153 (33%), Positives = 69/153 (45%), Gaps = 20/153 (13%)
 Frame = -2

Query  1088  SWKFASAYMTTIYIKNCPPGKQLPQFHLLPSLGELYFESIMVDYIDTTDYEDDNSPSRS-  912
             SW      +  IYI      K LP    LP L +L             +Y DDNSP  S 
Sbjct  98    SWLSLLTNLVHIYIWGPNKFKYLPSVAQLPCLQDLTIRDCY-----ELEYMDDNSPKGSQ  152

Query  911   ---ELFFPSLKKLWIWNCPNLKGWWK----------KNDEAIEEELLPPFPCISVVDIKQ  771
                E FFPSLK L + NC N+K WW+          ++D  +       FPC+  + I+ 
Sbjct  153   GEPESFFPSLKCLDLENCQNMKSWWRTTKPIDDDSNEDDTTVMGTSTMAFPCLCTLSIQN  212

Query  770   SPNVTWMPLFPTVSEKLYIVTGSIIPLEHTKKV  672
              P +T MPL+P+V + L +   S  P + T K+
Sbjct  213   CP-LTSMPLYPSVDDNLRLENTSSRPFKQTIKM  244



>ref|XP_008777415.1| PREDICTED: LOW QUALITY PROTEIN: disease resistance protein RGA2-like 
[Phoenix dactylifera]
Length=1161

 Score = 68.2 bits (165),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 79/300 (26%), Positives = 127/300 (42%), Gaps = 67/300 (22%)
 Frame = -2

Query  1064  MTTIYIKNCPPGKQLPQFHLLPSLGELYFESI-MVDYIDTTDYEDDNSPSRSELFFPSLK  888
             + T+ + NC     LP    LP L  LY E +  V ++      + N+     + FP L+
Sbjct  865   LDTLRLSNCRRCGVLPLVGKLPQLRNLYLEGLPEVQHMGRVVPGNGNT-----MGFPLLE  919

Query  887   KLWIWNCPNLKGWWKKNDEAIEEEL----------------LPPFPC-ISVVDIKQSPNV  759
              L+I N   L+ W+    E I+ E+                L   PC +   ++     +
Sbjct  920   MLFISNMHKLESWY----EVIQGEMACLKKLVISDCPNIKELSHLPCSLEYFEMGNCQKL  975

Query  758   TWMPLFPTVSEKLYI--VTGSII--------------PLEHTKKV----CSSFKYLKKLW  639
               +P+ P + E L I   TG II               L   K V      + K L++L 
Sbjct  976   LSLPMLPQLHE-LVIKGGTGEIIRWIRQLPLCPRTVSQLSRVKSVPRGYLHNLKILRELK  1034

Query  638   VSEVADLEYMEIELFPSLEYLWVYDCRNLRDWGKKG--------------DHEDAPKALA  501
             +     LE + ++   SLE+L V  CR L  + + G              D +  P  + 
Sbjct  1035  IEGCDKLESLALQDLASLEFLEVSSCRKLSSFAEGGLPATLKEFRLRFCDDLKSLPTRM-  1093

Query  500   KLAPSVIEFEVKNCPKLKLLPQGMRLLSSSTKF-SISGCPLLKQKYKSKSGQNWPEVANI  324
              L PS+   E++N P L  LP     LS S K+ +ISGC LL+Q+ + ++G +WP++ +I
Sbjct  1094  HLLPSLNHMEIRNVPMLTSLP--TEGLSYSLKYLAISGCALLQQRCE-RNGADWPKIQHI  1150



>ref|XP_007148940.1| hypothetical protein PHAVU_005G027200g [Phaseolus vulgaris]
 gb|ESW20934.1| hypothetical protein PHAVU_005G027200g [Phaseolus vulgaris]
Length=913

 Score = 67.8 bits (164),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 45/145 (31%), Positives = 79/145 (54%), Gaps = 8/145 (6%)
 Frame = -2

Query  1550  VAKLILAKIAPFAQDQIKLLWGLNEELTKLGDLVSHIGAVLLDAEGEKHNKKTENLLEML  1371
             +A+++L  +  FAQ++  ++W L +++ ++   VS I AVLLDAE + +N +  N LE L
Sbjct  38    IAQIVLQNLNSFAQEEFGIIWNLKDDVQQMKRTVSAIKAVLLDAEAKTNNLQISNWLEEL  97

Query  1370  KNIMDEANRLMDYFSPRAKNHRPNQED---GCCSYFVSHPNPFVWVSDSFMAG-KIKSIN  1203
             K+++ +A+ L++  S  A   +             F S  N  V+   S+  G K+K+I 
Sbjct  98    KDVLYDADDLLNDMSSEALERKVRGGSILLRRVQIFFSQANQIVY---SYKLGHKMKAIQ  154

Query  1202  NRLDGIIENYKKIRLEEQNPKQQPM  1128
              RLD I +N   ++L E  P + P+
Sbjct  155   KRLDAIAKNKNTLQLTEL-PMETPI  178



>ref|XP_011013380.1| PREDICTED: putative disease resistance protein RGA1 isoform X1 
[Populus euphratica]
Length=1139

 Score = 68.2 bits (165),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 63/255 (25%), Positives = 112/255 (44%), Gaps = 37/255 (15%)
 Frame = -2

Query  1064  MTTIYIKNCPPGKQLP----QFHLLPSLGELYFESIMVDYIDTTDYEDDNSPSRSELFFP  897
             +T++YI+  P  ++LP    Q H L        ES+ +DY+   D E  ++     L   
Sbjct  908   ITSLYIRQIPNVRELPGGFLQNHTL-------LESLKIDYL--PDLESLSNKVLDNL--S  956

Query  896   SLKKLWIWNCPNLKGWWKKNDEAIEEELLPPFPCISVVDIKQSPNVTWMPL--FPTVSEK  723
             +LK L IW C  L        E++ EE L     + V++I+    +  +P+     +S  
Sbjct  957   ALKSLTIWCCDEL--------ESLPEEGLRNLTSLEVLEIRCCGRLNCLPMNGLCGLSSL  1008

Query  722   LYIVTGSIIPLEHTKKVCSSFKYLKKLWVSEVADLEYM--EIELFPSLEYLWVYDCRNLR  549
               +  G                 L+ L +S+  ++  +   I+   SL  L + DC+ L 
Sbjct  1009  RKLFVGYCDKFTSLSDGVQHLTALEDLDLSQCPEVNSLPESIQHLTSLRSLRIRDCKGL-  1067

Query  548   DWGKKGDHEDAPKALAKLAPSVIEFEVKNCPKLKLLPQGMRLLSSSTKFSISGCPLLKQK  369
                        P  +  L P +   E+  CP ++ LP G++ LS+     I  CP LK++
Sbjct  1068  --------ASLPNQIGYLTP-LSRLEIGFCPNVESLPDGVQSLSNLISLIIDNCPKLKKR  1118

Query  368   YKSKSGQNWPEVANI  324
              + + G++WP++A+I
Sbjct  1119  CQKERGEDWPKIAHI  1133



>gb|AAR29076.1| blight resistance protein T118 [Solanum tarijense]
Length=948

 Score = 67.8 bits (164),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 69/244 (28%), Positives = 106/244 (43%), Gaps = 40/244 (16%)
 Frame = -2

Query  1064  MTTIYIKNCPPGKQLPQFHLLPSLGELYFESIMVDYIDTTDYEDDNSPSRSELFFPSLKK  885
             +  I I  C     LP F  LP L  L       +Y++  D + ++S   + + FPSL+K
Sbjct  732   IVLIEISGCKNCSCLPPFGDLPCLESLQLYRGSAEYVEEVDIDVEDSGFPTRIRFPSLRK  791

Query  884   LWIWNCPNLKGWWKKNDEAIEEELLPPFPCISVVDIKQSPNVTWMPLFPTVSEKLYIVTG  705
             L I    NLKG  KK  E  E+     FP +  ++I+  P        PT+S  L  +T 
Sbjct  792   LCICKFDNLKGLVKK--EGGEQ-----FPVLEEMEIRYCP-------IPTLSSNLKALTS  837

Query  704   SIIPLEHTKKVCS-------SFKYLKKLWVSEVADLEYMEIEL-----FPSLEYLWVYDC  561
               + +   K+  S       S   LK L +S   +L+ +   L       SL+  W    
Sbjct  838   --LNISDNKEATSFPEEMFKSLANLKYLNISHFKNLKELPTSLASLNALKSLKIQWCCAL  895

Query  560   RNLRDWGKKGDHEDAPKALAKLAPSVIEFEVKNCPKLKLLPQGMRLLSSSTKFSISGCPL  381
              ++ + G KG              S+ E  VK C  LK LP+G++ L++ T+  I GCP 
Sbjct  896   ESIPEEGVKG------------LTSLTELIVKFCKMLKCLPEGLQHLTALTRVKIWGCPQ  943

Query  380   LKQK  369
             L ++
Sbjct  944   LIKR  947



>gb|ADB43255.1| blight resistance protein [Capsicum annuum]
Length=994

 Score = 67.8 bits (164),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 71/270 (26%), Positives = 124/270 (46%), Gaps = 42/270 (16%)
 Frame = -2

Query  1064  MTTIYIKNCPPGKQLPQFHLLPSLGELYFE--SIMVDYIDTTDYEDDNSPSRSELFFPSL  891
             + +I I +C     L  F  LP L  L  +  S  V+Y++  D        R    FPSL
Sbjct  738   VVSILINSCKNCSCLSPFGELPCLESLELQDGSAEVEYVEDDDVHSGFPLKR----FPSL  793

Query  890   KKLWIWNCPNLKGWWKKNDEAIEEELLPPFPCISVVDIKQSPNVTWMPLFPTVS--EKLY  717
             +KL I    NLKG  +   E         FP +  + I   P    M +FPT+S  +KL 
Sbjct  794   RKLHIGGFCNLKGLQRTERE-------EQFPMLEEMKISDCP----MLVFPTLSSVKKLE  842

Query  716   I----VTGSIIPLEHTKKVCS--------SFKYLKKLWVSEVADLEYMEIELF-------  594
             I        + P+ + + + S        +   L++++ S +A+L+Y+ I  F       
Sbjct  843   IWGEADARGLSPISNLRTLTSLKIFSNHKATSLLEEMFKS-LANLKYLSISYFENLKELP  901

Query  593   PSLEYLWVYDCRNLRDWGKKGDHEDAPKALAKLAPSVIEFEVKNCPKLKLLPQGMRLLSS  414
              SL  L    C ++R        E  P+   +   S++E  V++C  LK LP+ ++ L++
Sbjct  902   TSLTSLNDLKCLDIRYCYAL---ESLPEEGLEGLTSLMELFVEHCNMLKSLPEALQHLTA  958

Query  413   STKFSISGCPLLKQKYKSKSGQNWPEVANI  324
              T   ++GCP + ++ +  +G++W ++A+I
Sbjct  959   LTNLRVTGCPEVAKRCERGTGEDWHKIAHI  988



>gb|AAR29074.1| blight resistance protein SH10, partial [Solanum tuberosum]
Length=948

 Score = 67.4 bits (163),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 68/243 (28%), Positives = 106/243 (44%), Gaps = 41/243 (17%)
 Frame = -2

Query  1064  MTTIYIKNCPPGKQLPQFHLLPSLGELYFE--SIMVDYIDTTDYEDDNSPSRSELFFPSL  891
             + +I I  C     LP F  LP L  L  +  S  V+Y+D+        P+R    FPSL
Sbjct  735   VVSIEISGCKNCSCLPPFGELPCLKRLELQKGSAEVEYVDS------GFPTRRR--FPSL  786

Query  890   KKLWIWNCPNLKGWWKKNDEAIEEELLPPFPCISVVDIKQSPNVTWMPLFPTVSEKLYIV  711
             +KL+I   PNLKG  KK  E         FP +  + I        M ++ T+S     +
Sbjct  787   RKLFIGEFPNLKGLLKKEGE-------EKFPVLERMTI----FYCHMFVYTTLSSNFRAL  835

Query  710   TGSIIPLEHTKKVCS-------SFKYLKKLWVSEVADLEYM--EIELFPSLEYLWVYDCR  558
             T   + + H  +  S       SF  LK L +S   +L+ +   +    +L+ L ++ C 
Sbjct  836   TS--LHISHNNEATSLPEEIFKSFANLKYLKISLFYNLKELPSSLACLNALKTLEIHSCS  893

Query  557   NLRDWGKKGDHEDAPKALAKLAPSVIEFEVKNCPKLKLLPQGMRLLSSSTKFSISGCPLL  378
              L         E  P+   K   S+ E  V +C  LK LP+G++ L++ T   +  CP L
Sbjct  894   AL---------ESLPEEGVKGLTSLTELFVYDCEMLKFLPEGLQHLTALTSLKLRRCPQL  944

Query  377   KQK  369
              ++
Sbjct  945   IKR  947



>ref|XP_006478603.1| PREDICTED: putative disease resistance protein RGA3-like [Citrus 
sinensis]
Length=1051

 Score = 67.4 bits (163),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 78/303 (26%), Positives = 130/303 (43%), Gaps = 58/303 (19%)
 Frame = -2

Query  1151  QNPKQQPMLTLL-PPEDI---------GSVL-SWKFASA-YMTTIYIKNCPPGKQLPQFH  1008
             ++ K Q ++  L PP ++         GSV  SW  +    +  + + +C   ++LP   
Sbjct  699   RDDKAQALIEFLRPPHNLKVLDLKGYRGSVFPSWLNSGVPNLVKVSLVDCTC-QELPPLG  757

Query  1007  LLPSLGELYFESI-MVDYIDTTDYEDDNSPSRSELFFPSLKKLWIWNCPNLKGWWKKNDE  831
              LP+L +LY + +  V  I    Y +D         FPSLK L +++ PNL  W  +  E
Sbjct  758   QLPNLKDLYVKGMSAVQIIGYKFYGNDAIRG-----FPSLKLLQLFDMPNLMEWKGQMTE  812

Query  830   AIEE--ELLPPFPCISVVDIKQSPNVTWMPL----------------------FPTVSEK  723
               +E   +  PFPC+  + ++    +  +P                       FP++S  
Sbjct  813   GTDEFDGMQEPFPCLEKLVVEGCSMLNTLPFIRNLKNLALCNSNDKLVCSLSRFPSLSS-  871

Query  722   LYIVTGSIIPLEHTKKVCSSFKYLKKLWVSEVADLE--YMEIELFPSLEYLWVYDCRNLR  549
               +V  +   L        +   L KL V+E  +LE  ++ ++ F SL +L +  C  L 
Sbjct  872   --LVVDNFPELNCLSDKTGNLNSLVKLTVNECDNLESLFVFMQSFSSLRHLSILHCDKL-  928

Query  548   DWGKKGDHEDAPKALAKLAPSVIEFEVKNCPKLKLLPQGMRLLSSSTKFSISGCPLLKQK  369
                     E  P +L K   S+ + ++  CP+L  +P  M   SS  + SI GCP+LK  
Sbjct  929   --------ESLPMSLEKFC-SLQKLDIVECPRLVHIPDIMGQHSSLLELSIEGCPMLKLS  979

Query  368   YKS  360
              KS
Sbjct  980   LKS  982



>gb|KHN46313.1| Putative disease resistance RPP13-like protein 1 [Glycine soja]
Length=711

 Score = 67.0 bits (162),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 58/218 (27%), Positives = 97/218 (44%), Gaps = 40/218 (18%)
 Frame = -2

Query  905  FFPSLKKLWIWNCPNLK--GWWKKND-------------EAIEEELLPPFPCISVVDIKQ  771
             FP L++L+IW CPNL+    W+ ++             E++ E +    P +  + I  
Sbjct  498  IFPILRRLYIWRCPNLQRISQWQAHNHLQTLDIEECPQLESLPEGMHVLLPSLYQLHIDD  557

Query  770  SPNVTWMP--LFPTVSEKLYIVTGSIIPLEHTKKVCSSFKYLKKLWVSEVADLEYMEIEL  597
             P V   P    P+  + +    GS   +   K        L+ L      D+  +++E 
Sbjct  558  CPKVEMFPEGGLPSNLKNMRFYGGSYKLMSLLKSALGGNHSLEYL------DIGKVDVEC  611

Query  596  FP-------SLEYLWVYDCRNLRDWGKKGDHEDAPKALAKLAPSVIEFEVKNCPKLKLLP  438
            FP       SL  L +Y C +L+    KG        L  L+ S+    + +CP+L+ LP
Sbjct  612  FPDEGVLPHSLVTLGIYKCGDLKRLDYKG--------LCHLS-SLKTLVLYDCPRLQCLP  662

Query  437  QGMRLLSSSTKFSISGCPLLKQKYKSKSGQNWPEVANI  324
            +   L  S +   I  CPLLKQ+ +   G++WP++A+I
Sbjct  663  E-ESLPKSISTLKIHNCPLLKQRCREPEGEDWPKIAHI  699



>ref|XP_007045385.1| LRR and NB-ARC domains-containing disease resistance protein, 
putative [Theobroma cacao]
 gb|EOY01217.1| LRR and NB-ARC domains-containing disease resistance protein, 
putative [Theobroma cacao]
Length=1192

 Score = 67.4 bits (163),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 73/270 (27%), Positives = 113/270 (42%), Gaps = 64/270 (24%)
 Frame = -2

Query  1055  IYIKNCPPGKQLPQFHLLPSLGELYFESIM-VDYIDTTDYEDDN------------SPSR  915
             I +  C     LP F  LP L  L  E +  V+YI+ +  E  +                
Sbjct  801   ITLWRCNRCLHLPLFSHLPKLRVLRLEVVTAVEYIEDSGAESSSLSFGGNRLKGGTEGKE  860

Query  914   SELFFPSLKKLWIWNCPNLKGWWKK-----NDE-----------AIEEELLPPFPCISVV  783
             S  FFP LK+L +++  NLKGWW++     ND              ++E +  FPC+S +
Sbjct  861   STAFFPCLKQLMLFDLRNLKGWWREVTAIANDNLGLAAASSQRPLQQKESMTSFPCLSKL  920

Query  782   DIKQSPNVTWMPLFPT--------VSEKLYIVTGSIIPLEHTKKVCSSFKYLKKLWVSEV  627
              I    N+T+MPL P         VS KL  +  S++    T+++              +
Sbjct  921   TIGICTNLTYMPLHPLLEELELKCVSAKL--LQQSVMIAAETEQI-------------PM  965

Query  626   ADLEYMEIELFPS-LEYLWVYDCRNLRDWGKKGDHEDAPKALAKLAPSVIEFEVKNCPKL  450
             A   ++   L+ S L+ + +    +L  + +KG H            S+    + NCPKL
Sbjct  966   AAAAHLSYPLYLSKLKVMHIDSIMDLVSFPEKGLHH---------LTSLQHLSIANCPKL  1016

Query  449   KLLPQGMRLLSSSTKFSISGCPLLKQKYKS  360
               LP+    L+S   F ISGC +LK   K 
Sbjct  1017  VCLPE--EGLNSLRFFFISGCDMLKSLSKG  1044


 Score = 60.8 bits (146),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 46/148 (31%), Positives = 75/148 (51%), Gaps = 8/148 (5%)
 Frame = -2

Query  1553  SVAKLILAKIAPFAQDQIKLLWGLNEELTKLGDLVSHIGAVLLDAEGEKHNKKTENL--L  1380
             ++A  IL K+      ++ L+WG+ EEL KL + VS I AVLLDAE E+H K  E +  L
Sbjct  15    NIADGILGKLGNLTLQEMGLIWGVKEELEKLKNTVSTIKAVLLDAE-EQHAKSHEVIDWL  73

Query  1379  EMLKNIMDEANRLMDYFSPRAKNHR---PNQEDGCCSYFVSHPNPFVWVSDSFMAGKIKS  1209
               LK+ + +A+ L+D FS      +     +     S+  S  N   +  +  +  +IK+
Sbjct  74    GKLKDAVYDADDLLDDFSTHVLQRQVMMQGKRGKQVSFLFSKANQVAY--NLKIGHQIKA  131

Query  1208  INNRLDGIIENYKKIRLEEQNPKQQPML  1125
             I  RLD I  +  K    +++    P++
Sbjct  132   IRQRLDAIAADKTKYHFTDRSLVSIPVV  159


 Score = 57.4 bits (137),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 57/227 (25%), Positives = 105/227 (46%), Gaps = 25/227 (11%)
 Frame = -2

Query  986   LYFESIMVDYIDTTDYEDDNSPSRSELFFPSLKKLWIWNCPNLKGWWKKNDEAIEEELLP  807
             LY   + V +ID+   +  + P +      SL+ L I NCP L    ++   ++      
Sbjct  975   LYLSKLKVMHIDSI-MDLVSFPEKGLHHLTSLQHLSIANCPKLVCLPEEGLNSLR-----  1028

Query  806   PFPCISVVDIKQSPNVTWMPLFPTVSEKLYIVTGSIIPL-EHTKKVCSSFKYLKKLWVSE  630
              F  IS  D+ +S +  +  L  T  E+L I     + L +  ++     ++L+ L   +
Sbjct  1029  -FFFISGCDMLKSLSKGFRHL--TALEELEIKECRELDLSKDVEENVMELRFLRSLRTLK  1085

Query  629   VADLEYME-----IELFPSLEYLWVYDCRNLRDWGKKGDHEDAPKALAKLAPSVIEFEVK  465
             + D+  +      ++   +L+YL +  C NL+           P+ +  L   +  FE+ 
Sbjct  1086  IGDMPKLNSLPDGLQHVTTLKYLQISSCSNLKSL---------PEWICNLTV-LQRFEIF  1135

Query  464   NCPKLKLLPQGMRLLSSSTKFSISGCPLLKQKYKSKSGQNWPEVANI  324
             +CP+L  L Q +  L++     ISGCPLL    ++K+ +NWP +A+I
Sbjct  1136  DCPQLVSLQQALCSLNALQYLEISGCPLLMDTCQNKTSKNWPRIAHI  1182



>ref|XP_006382130.1| hypothetical protein POPTR_0006s28680g, partial [Populus trichocarpa]
 gb|ERP59927.1| hypothetical protein POPTR_0006s28680g, partial [Populus trichocarpa]
Length=236

 Score = 64.3 bits (155),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 69/129 (53%), Gaps = 12/129 (9%)
 Frame = -2

Query  1136  QPMLTLLPPEDIG----SVLSWKFASAYMTTIYIKNCPPGKQLPQFHLLPSLGELYFESI  969
             QP L L   E +G       SW    + +  I+++NC   + +P    +PSL     E +
Sbjct  111   QPNLNLQELEVVGYRGMRFPSWLSNLSNLVRIHLENCTRPEHIPPLDGIPSL-----EDL  165

Query  968   MVDYIDTTDYEDDNSPSRSELFFPSLKKLWIWNCPNLKGWWKKN-DEAIEEELLPP--FP  798
             ++  +++ +Y D        +FFPSL++L I+ CP LKGWWKK+ DE+  EE L    FP
Sbjct  166   LLTDMESLEYIDSEGVGGRGVFFPSLRELRIFYCPRLKGWWKKSRDESTVEEGLRMLCFP  225

Query  797   CISVVDIKQ  771
              +S + I++
Sbjct  226   RLSSLKIRR  234



>gb|ACI16480.1| NBS-LRR resistance protein [Solanum bulbocastanum]
Length=988

 Score = 67.0 bits (162),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 74/276 (27%), Positives = 123/276 (45%), Gaps = 57/276 (21%)
 Frame = -2

Query  1064  MTTIYIKNCPPGKQLPQFHLLPSLG--ELYFESIMVDYIDTTDYEDDNSPSRSELFFPSL  891
             + +I I +C     LP F  LP L   EL+  S  V+Y+D+        P+R    FPSL
Sbjct  735   VVSIEIISCKNCSCLPPFGELPCLKSLELWRGSAEVEYVDS------GFPTRRR--FPSL  786

Query  890   KKLWIWNCPNLKGWWKKNDEAIEEELLPPFPCISVVDIKQSPNVTWMPLFPTVSE-KLYI  714
             +KL I    NLKG  KK  E          P +  ++IK  P    M + PT+S  K  +
Sbjct  787   RKLNIREFDNLKGLLKKEGE-------EQCPVLEEIEIKCCP----MFVIPTLSSVKKLV  835

Query  713   VTG-----------------SIIPLEHTKKVCS-------SFKYLKKLWVSEVADLEYME  606
             V+G                 + + + + K+  S       S   LK L +S   +L+ + 
Sbjct  836   VSGDKSDAIGFSSISNLMALTSLQIRYNKEDASLPEEMFKSLANLKYLNISFYFNLKELP  895

Query  605   IEL--FPSLEYLWVYDCRNLRDWGKKGDHEDAPKALAKLAPSVIEFEVKNCPKLKLLPQG  432
               L    +L++L ++ C  L         E  P+   K   S+ +  +  C  L+ LP+G
Sbjct  896   TSLASLNALKHLEIHSCYAL---------ESLPEEGVKGLISLTQLSITYCEMLQCLPEG  946

Query  431   MRLLSSSTKFSISGCPLLKQKYKSKSGQNWPEVANI  324
             ++ L++ T  S+  CP L ++ +   G++W ++A+I
Sbjct  947   LQHLTALTNLSVEFCPTLAKRCEKGIGEDWYKIAHI  982



>emb|CBI21772.3| unnamed protein product [Vitis vinifera]
Length=826

 Score = 67.0 bits (162),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 71/281 (25%), Positives = 114/281 (41%), Gaps = 61/281 (22%)
 Frame = -2

Query  1043  NCPPGKQLPQFHLLPSLGELYFESIMVDYIDTTDYEDDNSPSRSELFFPSLKKLWIWNCP  864
             +C   + LP F  LP L  L       +  +  + ED    S  + FFPSL+ L  +  P
Sbjct  560   DCSRCQILPPFSQLPFLKSL-------ELYNMKEVEDMKESSPGKPFFPSLQILKFYKMP  612

Query  863   NLKGWWKKNDEAIEEELLPPFP---------CISVVDIKQSPNVTWMPLFPTVS------  729
              L G W+ +   I  E  P FP         C S+  ++ S N   +  F   S      
Sbjct  613   KLTGLWRMD---ILAEQGPSFPHLSEVYIEKCSSLTSVRLSSNCPNLASFKGASLPCLGK  669

Query  728   -----------------------EKLYI--VTGSIIPLEHTKKVCSSFKYLKKLWVSEVA  624
                                    + LYI  + G I   E   +  S+   L     S ++
Sbjct  670   LALDRIREDVLRQIMSVSASSSLKSLYILKIDGMISLPEELLQHVSTLHTLSLQGCSSLS  729

Query  623   DLEYMEIELFPSLEYLWVYDCRNLRDWGKKGDHEDAPKALAKLAPSVIEFEVKNCPKLKL  444
              L +    L  SL +L + DCR L            P ++  L  S+ + ++   P+L  
Sbjct  730   TLPHWLGNL-TSLTHLQILDCRGL---------ATLPHSIGSLT-SLTDLQIYKSPELAS  778

Query  443   LPQGMRLLSSSTKFSISGCPLLKQKYKSKSGQNWPEVANIT  321
             LP+ MR L +    +IS CP L+++ + ++GQ+WP +A++T
Sbjct  779   LPEEMRSLKNLQTLNISFCPRLEERCRRETGQDWPNIAHVT  819



>sp|Q7XA40.2|RGA3_SOLBU RecName: Full=Putative disease resistance protein RGA3; AltName: 
Full=Blight resistance protein B149; AltName: Full=RGA1-blb 
[Solanum bulbocastanum]
 gb|AAR29070.1| blight resistance protein RGA1 [Solanum bulbocastanum]
 gb|AAP45165.2| Disease resistance protein RGA3, putative [Solanum bulbocastanum]
Length=992

 Score = 66.6 bits (161),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 76/270 (28%), Positives = 119/270 (44%), Gaps = 45/270 (17%)
 Frame = -2

Query  1064  MTTIYIKNCPPGKQLPQFHLLPSLGELYFE--SIMVDYIDTTDYEDDNSPSRSELFFPSL  891
             + +I I  C     LP F  LP L  L  +  S+ V+Y+     ED    +R    FPSL
Sbjct  738   VVSILISGCENCSCLPPFGELPCLESLELQDGSVEVEYV-----EDSGFLTRRR--FPSL  790

Query  890   KKLWIWNCPNLKGWWKKNDEAIEEELLPPFPCISVVDIKQSPNVTWMPLFPTVS--EKLY  717
             +KL I    NLKG  +             FP +  + I   P    M +FPT+S  +KL 
Sbjct  791   RKLHIGGFCNLKGLQRMKGA-------EQFPVLEEMKISDCP----MFVFPTLSSVKKLE  839

Query  716   I----VTGSIIPLEHTKKVCS---------------SFKYLKKLWVSEVADLEYMEIELF  594
             I      G +  + +   + S                FK L+ L    V+ LE ++ EL 
Sbjct  840   IWGEADAGGLSSISNLSTLTSLKIFSNHTVTSLLEEMFKNLENLIYLSVSFLENLK-ELP  898

Query  593   PSLEYLWVYDCRNLRDWGKKGDHEDAPKALAKLAPSVIEFEVKNCPKLKLLPQGMRLLSS  414
              SL  L    C ++R        E  P+   +   S+ E  V++C  LK LP+G++ L++
Sbjct  899   TSLASLNNLKCLDIRYCYAL---ESLPEEGLEGLSSLTELFVEHCNMLKCLPEGLQHLTT  955

Query  413   STKFSISGCPLLKQKYKSKSGQNWPEVANI  324
              T   I GCP L ++ +   G++W ++++I
Sbjct  956   LTSLKIRGCPQLIKRCEKGIGEDWHKISHI  985



>ref|XP_003615721.1| NBS-LRR resistance protein [Medicago truncatula]
 gb|AES98679.1| NB-ARC domain disease resistance protein [Medicago truncatula]
Length=988

 Score = 66.6 bits (161),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 65/245 (27%), Positives = 112/245 (46%), Gaps = 32/245 (13%)
 Frame = -2

Query  1043  NCPPGKQLPQFHLLPSLGEL-YFESIMVDYIDTTDYEDDNSPSRSEL-FFPSLKKLWIWN  870
             NC     L     LPSL  L  +    + Y+D     DD S    E+  FPSL+ L++  
Sbjct  765   NCNKIVLLQLLGKLPSLKNLRVYRMNNLKYLD-----DDESEDGMEVRVFPSLEVLYLQR  819

Query  869   CPNLKGWWKKNDEAIEEELLPPFPCISVVDIKQSPNVTWMPLFPTVSEKLYIVTGSIIPL  690
              PN++G  K        E    FPC+S + I   P +  +P  P++ + LY+   +    
Sbjct  820   LPNIEGLLKV-------ERGEMFPCLSNLTISYCPKIG-LPCLPSLKD-LYVEGCN----  866

Query  689   EHTKKVCSSFKYLKKLWVSEVADLEYMEIELF---PSLEYLWVYDCRNLRDWGKKGDHED  519
                 +  S+F+ L +L + E   +      +F    SL+ L +  C  L         E 
Sbjct  867   NELLRSISTFRGLTQLILYEGEGITSFPEGMFKNLTSLQSLSIISCNEL---------ES  917

Query  518   APKALAKLAPSVIEFEVKNCPKLKLLPQGMRLLSSSTKFSISGCPLLKQKYKSKSGQNWP  339
              P+   +   S+   ++ +C  L+ LP+G+R L+S    +I  CP L+++ K  +G++W 
Sbjct  918   LPEQNWEGLQSLRTLQIYSCEGLRCLPEGIRHLTSLELLTIINCPTLEERCKEGTGEDWD  977

Query  338   EVANI  324
             ++A+I
Sbjct  978   KIAHI  982



>ref|XP_011038426.1| PREDICTED: putative disease resistance protein RGA4 [Populus 
euphratica]
Length=1069

 Score = 66.6 bits (161),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 62/255 (24%), Positives = 112/255 (44%), Gaps = 37/255 (15%)
 Frame = -2

Query  1064  MTTIYIKNCPPGKQLP----QFHLLPSLGELYFESIMVDYIDTTDYEDDNSPSRSELFFP  897
             +T++YI+  P  ++LP    Q H L        ES+ +DY+   D E  ++     L   
Sbjct  838   ITSLYIRQIPNVRELPGGFLQNHTL-------LESLKIDYL--PDLESLSNKVLDNL--S  886

Query  896   SLKKLWIWNCPNLKGWWKKNDEAIEEELLPPFPCISVVDIKQSPNVTWMPL--FPTVSEK  723
             +LK L IW C  L        E++ EE L     + V++I+    +  +P+     +S  
Sbjct  887   ALKSLTIWCCDEL--------ESLPEEGLRNLTSLEVLEIRCCGRLNCLPMNGLCGLSSL  938

Query  722   LYIVTGSIIPLEHTKKVCSSFKYLKKLWVSEVADLEYM--EIELFPSLEYLWVYDCRNLR  549
               +  G                 L+ L +S+  ++  +   I+   SL  L + DC+ L 
Sbjct  939   RKLFVGYCDKFTSLSDGVQHLTALEDLDLSQCPEVNSLPESIQHLTSLRSLRIRDCKGL-  997

Query  548   DWGKKGDHEDAPKALAKLAPSVIEFEVKNCPKLKLLPQGMRLLSSSTKFSISGCPLLKQK  369
                        P  +  L P +   E+  CP ++ LP G++ LS+     I  CP L+++
Sbjct  998   --------ASLPNQIGYLTP-LSRLEIGFCPNVESLPDGVQSLSNLISLIIDNCPKLEKR  1048

Query  368   YKSKSGQNWPEVANI  324
              + + G++WP++A+I
Sbjct  1049  CQKERGEDWPKIAHI  1063



>gb|ACV53507.1| blight resistance protein RGA1 [Capsicum annuum]
Length=957

 Score = 66.6 bits (161),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 74/255 (29%), Positives = 122/255 (48%), Gaps = 39/255 (15%)
 Frame = -2

Query  1070  AYMTTIYIKNC---PPGKQLPQFHLLPSLGELYFESIMVDYIDTTDYEDDNSPSRSELFF  900
             A +T  + KNC   PP  +LP    L SL EL++ S  V+Y+D  D  D   P+R    F
Sbjct  731   ASITISHCKNCSCLPPIGELP---CLESL-ELHYGSAEVEYVDEYDV-DSGFPTRRR--F  783

Query  899   PSLKKLWIWNCPNLKGWWKKNDEAIEEELLPPFPCISVVDIKQSPNVTWMPLFPTVSE-K  723
             PSL+KL I + PN+KG   K    + EE  P         + +        +FPT+S  K
Sbjct  784   PSLRKLVIRDFPNMKGLLIKK---VGEEQCP---------VLEEGYYVLPYVFPTLSSVK  831

Query  722   LYIVTGSIIPLEHTKKVCS--SFKYLKKLWVSEVADLEYMEIELFPSLEYLWVYDCRNLR  549
                + G +        +CS  + + L  L +S   +   +  E+F SL      + +NL 
Sbjct  832   KLRIWGKV----DAAGLCSISNLRTLTDLSISHNNEATSLPEEMFKSL-----VNLKNLH  882

Query  548   DWGKKGDHEDAPKALAKLAPSVIEFEVKNCPKLKLLPQGMRLLSSSTKFSISGCPLLKQK  369
                  G+ ++ P ++A L    +     +C  L+ LP+G++ L   T  ++ G P LK++
Sbjct  883   -INYLGNLKELPTSVASLNALQL-LHTNSCRALESLPEGLQHL---TVLTVHGSPELKKR  937

Query  368   YKSKSGQNWPEVANI  324
             Y+   G++W ++A+I
Sbjct  938   YEKGIGRDWHKIAHI  952



>ref|XP_003615728.1| NBS-LRR resistance protein [Medicago truncatula]
Length=1199

 Score = 66.6 bits (161),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 68/276 (25%), Positives = 128/276 (46%), Gaps = 53/276 (19%)
 Frame = -2

Query  1088  SWKFASAYMTTIYIKNCPPGKQLPQFHLLPSLGELYFESIMVDYIDTTDY-EDDNSPSRS  912
             SW    + + ++ + NC    +L     LPSL +L    +     D   Y +DD S    
Sbjct  755   SWIIILSNLVSLELGNCKKVVRLQLIGKLPSLKKLELSDM-----DNLKYLDDDESQDGV  809

Query  911   EL-FFPSLKKLWIWNCPNLKGWWKKNDEAIEEELLPPFPCISVVDIKQSPNVTWMPLFPT  735
             E+  FPSL++L +   PN++G  K        E    FPC+S + I   P +  +P  P+
Sbjct  810   EVRVFPSLEELHLLCLPNIEGLLKV-------ERGEMFPCLSELRITACPKLG-VPCLPS  861

Query  734   VSEKLYIVTG--------------SIIPLEHTKKVCS-------SFKYLKKLWVSEVADL  618
             + + LY++                + + L++ + + S       +   L+ L V++   L
Sbjct  862   L-KSLYVLGCNNELLRSISTFRGLTELSLDYGRGITSFPEGMFKNLTSLQSLVVNDFPTL  920

Query  617   EYMEIELF-PSLEYLWVYDCRNLRDWGKKGDHEDAPKALAKLAPSVIEFEVKNCPKLKLL  441
             + ++ E F  +L +L + DC N ++W       +  ++L  L        + NC +L+  
Sbjct  921   KELQNEPFNQALTHLRISDC-NEQNW-------EGLQSLQYLY-------ISNCKELRCF  965

Query  440   PQGMRLLSSSTKFSISGCPLLKQKYKSKSGQNWPEV  333
             P+G+R L+S    +I+ CP LK++ K  +G++W ++
Sbjct  966   PEGIRHLTSLEVLTINDCPTLKERCKEGTGEDWDKI  1001



>ref|XP_006442837.1| hypothetical protein CICLE_v100189572mg [Citrus clementina]
 gb|ESR56077.1| hypothetical protein CICLE_v100189572mg [Citrus clementina]
Length=773

 Score = 66.2 bits (160),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 78/303 (26%), Positives = 129/303 (43%), Gaps = 58/303 (19%)
 Frame = -2

Query  1151  QNPKQQPMLTLL-PPEDI---------GSVL-SWKFASA-YMTTIYIKNCPPGKQLPQFH  1008
             ++ K Q ++  L PP ++         GSV  SW  +    +  + + +C   ++LP   
Sbjct  440   RDDKAQALIEFLRPPHNLKVLDLKGYRGSVFPSWLNSGVPNLVKVSLVDCTC-QELPPLG  498

Query  1007  LLPSLGELYFESI-MVDYIDTTDYEDDNSPSRSELFFPSLKKLWIWNCPNLKGWWKKNDE  831
              LP+L +LY + +  V  I    Y +D         FPSLK L +++ PNL  W  +  E
Sbjct  499   QLPNLKDLYVKGMSAVQIIGYKFYGNDAIRG-----FPSLKLLQLFDMPNLMEWKGQMTE  553

Query  830   AIEE--ELLPPFPCISVVDIKQSPNVTWMPL----------------------FPTVSEK  723
               +E   +  PFPC+  + ++    +  +P                       FP++S  
Sbjct  554   GTDEFDGMQEPFPCLEKLVVEGCSMLNTLPFIRNLKNLALCNSNDKLVCSLSRFPSLSS-  612

Query  722   LYIVTGSIIPLEHTKKVCSSFKYLKKLWVSEVADLEYMEI--ELFPSLEYLWVYDCRNLR  549
               +V  +   L        +   L KL V+E  +LE + +  + F SL +L +  C  L 
Sbjct  613   --LVVDNFPELNCLSDKTGNLNSLVKLTVNECDNLESLLVFMQSFSSLRHLSILHCDKL-  669

Query  548   DWGKKGDHEDAPKALAKLAPSVIEFEVKNCPKLKLLPQGMRLLSSSTKFSISGCPLLKQK  369
                     E  P +L K   S+ + ++  CP+L  +P  M   SS  + SI GCP+LK  
Sbjct  670   --------ESLPMSLEKFC-SLQKLDIVECPRLVHIPDIMGQHSSLLELSIEGCPMLKLS  720

Query  368   YKS  360
              KS
Sbjct  721   LKS  723



>gb|KDO64057.1| hypothetical protein CISIN_1g003435mg [Citrus sinensis]
Length=820

 Score = 66.2 bits (160),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 78/303 (26%), Positives = 130/303 (43%), Gaps = 58/303 (19%)
 Frame = -2

Query  1151  QNPKQQPMLTLL-PPEDI---------GSVL-SWKFASA-YMTTIYIKNCPPGKQLPQFH  1008
             ++ K Q ++  L PP ++         GSV  SW  +    +  + + +C   ++LP   
Sbjct  468   RDDKAQALIEFLRPPHNLKVLDLKGYRGSVFPSWLNSGVPNLVKVSLVDCTC-QELPPLG  526

Query  1007  LLPSLGELYFESI-MVDYIDTTDYEDDNSPSRSELFFPSLKKLWIWNCPNLKGWWKKNDE  831
              LP+L +LY + +  V  I    Y +D         FPSLK L +++ PNL  W  +  E
Sbjct  527   QLPNLKDLYVKGMSAVQIIGYKFYGNDAIRG-----FPSLKLLQLFDMPNLMEWKGQMTE  581

Query  830   AIEE--ELLPPFPCISVVDIKQSPNVTWMPL----------------------FPTVSEK  723
               +E   +  PFPC+  + ++    +  +P                       FP++S  
Sbjct  582   GTDEFDGMQEPFPCLEKLVVEGCSMLNTLPFIRNLKNLALCNSNDKLVCSLSRFPSLSS-  640

Query  722   LYIVTGSIIPLEHTKKVCSSFKYLKKLWVSEVADLE--YMEIELFPSLEYLWVYDCRNLR  549
               +V  +   L        +   L KL V+E  +LE  ++ ++ F SL +L +  C  L 
Sbjct  641   --LVVDNFPELNCLSDKTGNLNSLVKLTVNECDNLESLFVFMQSFSSLRHLSILHCDKL-  697

Query  548   DWGKKGDHEDAPKALAKLAPSVIEFEVKNCPKLKLLPQGMRLLSSSTKFSISGCPLLKQK  369
                     E  P +L K   S+ + ++  CP+L  +P  M   SS  + SI GCP+LK  
Sbjct  698   --------ESLPMSLEKFC-SLQKLDIVECPRLVHIPDIMGQHSSLLELSIEGCPMLKLS  748

Query  368   YKS  360
              KS
Sbjct  749   LKS  751



>ref|XP_002529992.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF32397.1| ATP binding protein, putative [Ricinus communis]
Length=978

 Score = 66.2 bits (160),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 65/303 (21%), Positives = 112/303 (37%), Gaps = 86/303 (28%)
 Frame = -2

Query  980  FESIMVDYIDTTDYEDDNSPSRSELFFPSLKKLWIWNCPNLKGWWKK---NDEAIEEELL  810
            +ES+      + D    ++P+++  FFPSL++L ++  PN KGW ++   N+   +   L
Sbjct  672  YESVTNAEYGSNDTTSLSAPTKA--FFPSLQELRLYRLPNFKGWQRREFSNENDAKTATL  729

Query  809  PP---------FPCISVVDIKQSPNVTWMPLFP--------------TVSEKLYIVTGSI  699
            P          FPC+  + I++  N+T MP+FP              T +   +    SI
Sbjct  730  PAGNDQYLRHLFPCLLQLTIERCSNLTLMPVFPHLESLHLINSSVKVTAASVFFTFPSSI  789

Query  698  IPLEHTKKVC---------------SSFKYLKKLWVSEVADLEYME--IELFPSLEYLWV  570
             P    + +C                +   LK L +S    L ++   I     L  L +
Sbjct  790  SPFSRIQFLCIDKSVDLECLPKEGLHNLTSLKTLQISNCPRLMFLSPGINFLTQLSSLEI  849

Query  569  YDCRNLRDWGKKGDHEDAPKALAKLA----------------------------------  492
            Y+C  L  +  KG      + L  L                                   
Sbjct  850  YNCGILNLFDDKGIMWQGFRGLCHLTIDYLPQLFYLPEGLQRVTALQELRILSCYNLVSL  909

Query  491  -------PSVIEFEVKNCPKLKLLPQGMRLLSSSTKFSISGCPLLKQKYKSKSGQNWPEV  333
                    S+ E E+ +C  LK LP+G+  L S  K  I+  P     ++  +G++W ++
Sbjct  910  PEWIKNFSSLQELEISDCSSLKSLPEGIHELVSLKKLKIAEGPNSSDTWQRNTGKDWSKI  969

Query  332  ANI  324
              I
Sbjct  970  FRI  972



>ref|XP_010683667.1| PREDICTED: putative disease resistance protein RGA3 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010683668.1| PREDICTED: putative disease resistance protein RGA3 [Beta vulgaris 
subsp. vulgaris]
Length=1055

 Score = 66.2 bits (160),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 78/299 (26%), Positives = 121/299 (40%), Gaps = 60/299 (20%)
 Frame = -2

Query  1064  MTTIYIKNCPPGKQLPQFHLLPSLGELYFESI-MVDYIDTTDYEDDNSPSRSELFFPSLK  888
             + T+ I+ C    QLPQF  LPSL  L    +  ++YI+   +  D   S S + F +L+
Sbjct  759   LVTVEIQKCESCVQLPQFSQLPSLKSLTLNDLEALEYIEEDGWGGDGE-SCSAIHFVALE  817

Query  887   KLWIWNCPNLKGW-WKKN----------------DEAIEEELLPPFPCISVVDIKQSPNV  759
             KL+I   P LKGW W+                   + +    L  FP +S + I   P  
Sbjct  818   KLYINEMPKLKGWFWRPRVKDYVHPQQADMTSDVHQDLTSHRLLSFPRLSQLYIGDCPQF  877

Query  758   TWMPL--FPTV----SEKLYIVTGSIIPLEHTKKVCS----------SFKYLKKLWVSEV  627
               MPL   P +    +E ++      +   H +   S          +   LKKL + EV
Sbjct  878   VSMPLTLLPRLDEFYAENIHEKAVESLLASHREAPSSSFPSSSSSSPTLSTLKKLHIEEV  937

Query  626   ---------ADLEYMEIELFPSLEYLWVY---------DCRNLRDWGKKGDHEDAPKALA  501
                       D E +EI+    L  L V          D RNL++          P+ + 
Sbjct  938   NIVSFSINSCDSETLEIKDCEKLTSLIVVSPNSPIRQLDLRNLKNL------RALPEEID  991

Query  500   KLAPSVIEFEVKNCPKLKLLPQGMRLLSSSTKFSISGCPLLKQKYKSKSGQNWPEVANI  324
              LA  + +  +  CP+L  LPQ    LSS     +  CP L+ + +   G++WP + +I
Sbjct  992   HLA-QLRDLTICYCPELASLPQSFCGLSSLQSLRVFRCPHLETRCRKPDGEDWPLIQHI  1049



>ref|XP_006366683.1| PREDICTED: putative disease resistance protein RGA3-like [Solanum 
tuberosum]
Length=984

 Score = 66.2 bits (160),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 78/282 (28%), Positives = 128/282 (45%), Gaps = 52/282 (18%)
 Frame = -2

Query  1088  SWKFASAYMTTIYIK-NCPPGKQLPQFHLLPSLG--ELYFESIMVDYIDTTDYEDDNSPS  918
             +W  AS     + I+  C    +LP F  LP L   +LY  S  V+YI+    EDD    
Sbjct  722   NWMNASVLKNVVSIEIECENCWRLPPFGELPCLESLKLYNGSAEVEYIE----EDDG---  774

Query  917   RSELFFPSLKKLWIWNCPNLKGWWK---KNDEAIEEEL---------LPPFPCISVVDI-  777
              S L FP LK+L I   PNLKG  +   K   ++ EE+          P F  +  +D+ 
Sbjct  775   HSILKFPYLKRLAIERFPNLKGLLRSEGKEKFSMLEEMEIWHCPMFVFPAFSSVKKLDVW  834

Query  776   --KQSPNVTWMPLFPTVSEKLYI---VTGSIIPLEHTKKVCS----SFKYLKKLWV--SE  630
                 + +++ +    T++  L I      + +P E  K++ +    S  Y KKL    S 
Sbjct  835   GEIDAASISSISKLTTLTS-LSIDHNFEATTLPEEMFKRLVNLESLSIIYFKKLRELPSS  893

Query  629   VADLEYMEIELFPSLEYLWVYDCRNLRDWGKKGDHEDAPKALAKLAPSVIEFEVKNCPKL  450
             +A L  ++      L+  + Y   +L + G +G              S+    V+NC  L
Sbjct  894   LASLSALK-----CLKIHYCYALESLLEQGMEG------------LTSLTNLYVQNCEML  936

Query  449   KLLPQGMRLLSSSTKFSISGCPLLKQKYKSKSGQNWPEVANI  324
             K LP+G++ L++ T   I GCP L ++ +   G++W ++A+I
Sbjct  937   KCLPEGLQHLTALTSLQIYGCPALTKRCEKGIGEDWHKIAHI  978



>gb|AHG28983.1| NBS-LRR protein [Cicer arietinum]
Length=957

 Score = 66.2 bits (160),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 65/261 (25%), Positives = 123/261 (47%), Gaps = 26/261 (10%)
 Frame = -2

Query  1088  SWKFASAYMTTIYIKNCPPGKQLPQFHLLPSLGELYFESIM-VDYIDTTDYEDDNSPSRS  912
             +W    + +  + +++C    +L     LPSL +L    +  V Y+D    +DD S +  
Sbjct  708   TWINFLSSLVALELRDCKNCVRLSPLGKLPSLKQLELCQMHNVKYMD----DDDESHNGM  763

Query  911   EL-FFPSLKKLWIWNCPNLKGWWKKNDEAIEEELLPPFPCISVVDIKQSPNVTWMPLFPT  735
             E+  FPSL+ L +   PNL+G  K   E +       F C+S + I   P +  +P  P+
Sbjct  764   EVRVFPSLEVLSLKELPNLEGLLKVEREEM-------FHCLSSLTIFNCPKLG-LPCLPS  815

Query  734   VSE-KLYIVTGSIIPLEHTKKVCSSFKYLKKLWV---SEVADLEYMEIELFPSLEYLWVY  567
             V +  +Y     ++      K  S+F  L  L +   +++       +     L+ L V+
Sbjct  816   VKDLSVYGCNNELL------KSISTFYGLTNLDLYGGNQITSFPERMLRNLTCLQTLKVF  869

Query  566   DCRNLRDWGKKGDHEDAPKALAKLAPSVIEFEVKNCPKLKLLPQGMRLLSSSTKFSISGC  387
             D   L++     + E +P+ + +   S+   ++  C  L+ LP+GM+ L+S     I  C
Sbjct  870   DFPKLKEL--PIELEPSPEQICEGLQSLRTMKIIYCEGLRYLPEGMQYLTSLEVLEIREC  927

Query  386   PLLKQKYKSKSGQNWPEVANI  324
             P L+++ K  +G++W ++A+I
Sbjct  928   PTLEERCKEGTGEDWDKIAHI  948



>ref|XP_007158232.1| hypothetical protein PHAVU_002G135100g [Phaseolus vulgaris]
 gb|ESW30226.1| hypothetical protein PHAVU_002G135100g [Phaseolus vulgaris]
Length=1101

 Score = 66.2 bits (160),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 94/367 (26%), Positives = 151/367 (41%), Gaps = 81/367 (22%)
 Frame = -2

Query  1193  DGIIENYKKIRLEEQNPKQQPMLTLLPPEDI-GSVLS-WKFASAYMTTIYIKNCPPGKQL  1020
             +GI +  K+  LE  +P   P L +L      G   S W  +   +    + +C   + L
Sbjct  712   NGIAQKDKET-LECLDPTSNPNLAVLSVVGYYGKTFSDWLSSMKCLVKFSLNDCYNCQYL  770

Query  1019  PQFHLLPSLGELYFESI-MVDYI----DTTDYEDDNSPSRSELFFPSLKKLWIWNCPNLK  855
             P    LP L  L    +  ++++    D T  + + S S S  FFPSLK+L I +CP LK
Sbjct  771   PPLDHLPHLRVLELRRLESLEFVSKNSDQTSADTEASSSSSTPFFPSLKELTISDCPKLK  830

Query  854   GWWKKNDEAIEEELLPPFPCISVVDIKQSPNVTWMPLFPTVSEKLYIVTGSIIPLEHT--  681
              WW   + A  E+  P F  IS +D++  P +  MPL+P + E+L +V  S+  +  T  
Sbjct  831   SWW---ETAKWEDNRPFFTRISKLDVQCCPELHCMPLYPYLGEELVLVDSSVKSMRDTVH  887

Query  680   KKVCSSFKYLKKL---------------WVSEVADLEYMEI-------------ELFPSL  585
              +    F  L KL               W+     LE ++I             +   SL
Sbjct  888   ARTSEDFLPLSKLKTMLIARITQSPPEKWLKNFISLETLQIRDCSKLVSLPQGFKSLSSL  947

Query  584   EYLWVYDC------RNLRDW-GKKGDHEDAPKALAKL---------APSVIEFEVKNCPK  453
             + L +  C      R+  +W G K       K + KL           S+ E ++  CP 
Sbjct  948   QSLTIERCSELDLDRSKSEWEGLKHLRVLTIKEIPKLKSLPWGVEDVTSLKELQLHECPA  1007

Query  452   LKLLPQGMRLLSSSTK------------------------FSISGCPLLKQKYKSKSGQN  345
             L  LP+ +  L+S TK                         +I+ CPLL  + + ++G +
Sbjct  1008  LTNLPETIGNLTSLTKLVICKCENLDSLPKGIEKLKSLDSLTITDCPLLTPRCQPETGDD  1067

Query  344   WPEVANI  324
             WP++ +I
Sbjct  1068  WPQIGHI  1074



>ref|XP_010683671.1| PREDICTED: putative disease resistance protein RGA4 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010683672.1| PREDICTED: putative disease resistance protein RGA4 [Beta vulgaris 
subsp. vulgaris]
Length=343

 Score = 64.7 bits (156),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 85/306 (28%), Positives = 129/306 (42%), Gaps = 72/306 (24%)
 Frame = -2

Query  1064  MTTIYIKNCPPGKQLPQFHLLPSLGELYFESI-MVDYIDTTDYEDDNSPSRSELFFPSLK  888
             + T+YI +C    QLPQF  LP L  L    +  ++YI+  D    ++ S S   F +L+
Sbjct  45    LVTVYILSCKSCVQLPQFSQLPRLKSLTLNDLEALEYIEE-DVWGGDAESCSATHFVALE  103

Query  887   KLWIWNCPNLKGW-WK----------KNDEAIEEEL--------LPPFPCISVVDIKQSP  765
              L IW+ P LKGW W+          + + AI  E+        L  FP +S + I   P
Sbjct  104   TLSIWDMPKLKGWFWRPQVKDWDVQPQQEAAITSEVHQDLTSHRLLSFPRLSQLTIHDCP  163

Query  764   N-VTWMP--LFPTVSEKLYI------VTGSIIP--------------------------L  690
               V  MP  L P + E L++         S++                           +
Sbjct  164   QFVVSMPLTLLPRL-EYLHVENIQEKAVESLLASHREAPSSSFPSSSSSPTLSTLKHLII  222

Query  689   EHTKKVCSSFKY--LKKLWVSEVADLEYMEIELFP--SLEYLWVYDCRNLRDWGKKGDHE  522
             E+   V  S  +  L+ L +S    L  + I + P  S+  L   D +NLR   ++  H 
Sbjct  223   ENVNIVSFSINFGNLQTLKISNCEKLSSL-IVVSPNSSIRKLHFEDLKNLRALPEEIGH-  280

Query  521   DAPKALAKLAPSVIEFEVKNCPKLKLLPQGMRLLSSSTKFSISGCPLLKQKYKSKSGQNW  342
                  L++L    I F     P+L  LPQ +R LSS     I GCP LK + +   G++W
Sbjct  281   -----LSQLRYLTICFS----PELASLPQSLRGLSSLQSLQIWGCPHLKTRCREPYGEDW  331

Query  341   PEVANI  324
             P + +I
Sbjct  332   PLIQHI  337



>gb|ABO28722.1| RB [Solanum verrucosum]
Length=960

 Score = 65.9 bits (159),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 70/256 (27%), Positives = 118/256 (46%), Gaps = 50/256 (20%)
 Frame = -2

Query  1064  MTTIYIKNCPPGKQLPQFHLLPSLG--ELYFESIMVDYIDTTDYEDDNSPSRSELFFPSL  891
             + +I I+ C     LP F  LPSL   EL+  S  V+Y+     E++  P R    FPSL
Sbjct  728   VVSITIRGCENCSCLPPFGELPSLESLELHTGSAEVEYV-----EENAHPGR----FPSL  778

Query  890   KKLWIWNCPNLKGWWKKNDEAIEEELLPPFPCISVVDIKQSPNVTWMPLFPTVSE----K  723
             +KL I +  NLKG  KK  E          P +  + I   P    M + PT+S     K
Sbjct  779   RKLVICDFGNLKGLLKKEGE-------EQVPVLEEMTIHGCP----MFVIPTLSSVKTLK  827

Query  722   LYIVTGSIIPLEHTKKVCSSFKYLKKLWVSEVADLEYMEIELF---PSLEYLWVYDCRNL  552
             + +   +++      +  S+ + L  L +S   +   +  E+F    +L+ L + D +NL
Sbjct  828   VDVTDATVL------RSISNLRALTSLDISSNYEATSLPEEMFKNLANLKDLTISDFKNL  881

Query  551   RDW-----------GKKGDHEDAPKAL----AKLAPSVIEFEVKNCPKLKLLPQGMRLLS  417
             ++              + ++ DA ++L     K   S+ E  V NC  LK LP+G++ L+
Sbjct  882   KELPTCLASLNALNSLQIEYCDALESLPEEGVKSLTSLTELSVSNCMTLKCLPEGLQHLT  941

Query  416   SSTKFSISGCPLLKQK  369
             + T   I+ CP++ ++
Sbjct  942   ALTTLIITQCPIVIKR  957



>ref|XP_008240993.1| PREDICTED: disease resistance protein RGA2-like [Prunus mume]
Length=815

 Score = 65.5 bits (158),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 46/135 (34%), Positives = 72/135 (53%), Gaps = 6/135 (4%)
 Frame = -2

Query  1571  VVSTAISVAKLILAKIAPFAQDQIKLLWGLNEELTKLGDLVSHIGAVLLDA-EGEKHNKK  1395
             +   A  +A  ++ K++  A D+I L+WG+  +L KLG  +S I AVLLDA E + HNK+
Sbjct  1     MADVAFELASKLIEKLSSIAYDEICLVWGVKADLQKLGRTMSAIKAVLLDAEEKQAHNKE  60

Query  1394  TENLLEMLKNIMDEANRLMDYFSPRA-KNHRPNQEDGCCSYFVSHPNPFVWVSDSFMAG-  1221
               + L+ LK++  +A  L+D F  +A +    +       +F S  NP  +      AG 
Sbjct  61    LRSWLQQLKDVFLDAEDLLDEFECQALRKQTYHGTTRKVRHFFSPSNPIAF---RLKAGH  117

Query  1220  KIKSINNRLDGIIEN  1176
             +IK I  RLD +  N
Sbjct  118   EIKGIRERLDELKAN  132



>ref|XP_004490619.1| PREDICTED: putative disease resistance protein RGA4-like isoform 
X1 [Cicer arietinum]
Length=1003

 Score = 65.9 bits (159),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 65/261 (25%), Positives = 123/261 (47%), Gaps = 26/261 (10%)
 Frame = -2

Query  1088  SWKFASAYMTTIYIKNCPPGKQLPQFHLLPSLGELYFESIM-VDYIDTTDYEDDNSPSRS  912
             +W    + +  + +++C    +L     LPSL +L    +  V Y+D    +DD S +  
Sbjct  754   TWINFLSSLVALELRDCKNCVRLSPLGKLPSLKQLELCQMHNVKYMD----DDDESHNGM  809

Query  911   EL-FFPSLKKLWIWNCPNLKGWWKKNDEAIEEELLPPFPCISVVDIKQSPNVTWMPLFPT  735
             E+  FPSL+ L +   PNL+G  K   E +       F C+S + I   P +  +P  P+
Sbjct  810   EVRVFPSLEVLSLKELPNLEGLLKVEREEM-------FHCLSSLTIFNCPKLG-LPCLPS  861

Query  734   VSE-KLYIVTGSIIPLEHTKKVCSSFKYLKKLWV---SEVADLEYMEIELFPSLEYLWVY  567
             V +  +Y     ++      K  S+F  L  L +   +++       +     L+ L V+
Sbjct  862   VKDLSVYGCNNELL------KSISTFYGLTNLDLYGGNQITSFPERMLRNLTCLQTLKVF  915

Query  566   DCRNLRDWGKKGDHEDAPKALAKLAPSVIEFEVKNCPKLKLLPQGMRLLSSSTKFSISGC  387
             D   L++     + E +P+ + +   S+   ++  C  L+ LP+GM+ L+S     I  C
Sbjct  916   DFPKLKEL--PIELEPSPEQICEGLQSLRTMKIIYCEGLRYLPEGMQYLTSLEVLEIREC  973

Query  386   PLLKQKYKSKSGQNWPEVANI  324
             P L+++ K  +G++W ++A+I
Sbjct  974   PTLEERCKEGTGEDWDKIAHI  994



>ref|XP_004157298.1| PREDICTED: putative disease resistance protein RGA4-like [Cucumis 
sativus]
Length=1090

 Score = 65.5 bits (158),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 64/252 (25%), Positives = 113/252 (45%), Gaps = 42/252 (17%)
 Frame = -2

Query  1064  MTTIYIKNCPPGKQLPQFHLLPSLGELYFESIMVDYIDTTDYEDDNSPSRSEL--FFPSL  891
             +  I + NC   +QLP+F   P L  L  +     Y+   ++ D+N    S L  FFPSL
Sbjct  786   LVIIDLFNCNKLQQLPRFDQFPFLKHLKLQ-----YLPNVEFIDNNDSVSSSLTTFFPSL  840

Query  890   KKLWIWNCPNLKGWWKKNDEAIEEELLPPFPCISVVDIKQSPNVTWMPLFPTVSEKLYIV  711
             +KL I+  P LK WWK+    + ++ +P    +  ++I        + +F  V E   + 
Sbjct  841   EKLRIFRLPKLKEWWKR---KLIDQTIPQHRRLESLNISGVS----LQVFELVME---MA  890

Query  710   TGSIIPLEHTKKVCSSFKYLKKLWVSEVADLEYMEI-ELFPSLEY---LWVYDCRNLR--  549
             T +II         ++   L  L + ++ D E+++  +LF ++ +   LW+ +C+N++  
Sbjct  891   TTNIIVGSQDSSSSTTSISLSFLSIEDI-DFEFLQFHDLFSNMTHLKSLWIINCKNIKMS  949

Query  548   ------DWGKKG-----------DHEDAPKALAKLAPSVIEFEVKNCPKLKLLPQGMRLL  420
                    W   G           D E  PK+L +   ++   ++ NCP L  +     L 
Sbjct  950   SSLDAVTWKGLGSLRELMLSSIPDLEYLPKSL-QCVTTLQSLQIYNCPNLVSIESIRHLT  1008

Query  419   SSSTKFSISGCP  384
             +S +   I GCP
Sbjct  1009  TSLSVLEIHGCP  1020


 Score = 56.6 bits (135),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 52/173 (30%), Positives = 78/173 (45%), Gaps = 19/173 (11%)
 Frame = -2

Query  1565  STAISVAKLILAKIAPFAQDQIKLLW-GLNEELTKLGDLVSHIGAVLLDAEGEKH-NKKT  1392
             S   S+A  I  K+   A   + LLW G++EE+ KL D +S I AVL DAE +++ +   
Sbjct  4     SILFSLAANIATKLGSLALQDLGLLWTGIHEEIDKLRDTLSAIQAVLHDAEQKQYKSSAV  63

Query  1391  ENLLEMLKNIMDEANRLMDYFSPRA------KNHRPNQEDGCCSYFVSHPNPFVWVSDSF  1230
             +  +  LK+   + + LMD FS  +        HR N        F S  N   +     
Sbjct  64    KEWVSRLKDAFYDMDDLMDEFSYESFQRQVMTKHRTNNCTKQVCIFFSKSNQIRFRLK--  121

Query  1229  MAGKIKSINNRLDGI---------IENYKKIRLEEQNPKQQPMLTLLPPEDIG  1098
             M  KIK I  +LD I          +N ++IR +E   + +    +L  E IG
Sbjct  122   MVHKIKKIREKLDTIDKDKTQFNLFDNTREIRNDEMTKRSETCSFILEGEVIG  174



>emb|CBI21737.3| unnamed protein product [Vitis vinifera]
Length=766

 Score = 65.1 bits (157),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 65/239 (27%), Positives = 106/239 (44%), Gaps = 41/239 (17%)
 Frame = -2

Query  1064  MTTIYIKNCPPGKQLPQFHLLPSLGELYFESIM-VDYIDTTDYEDDNSPSRSELFFPSLK  888
             +  I + +C   + LP F  LP+L  ++   +  V+Y+  TD      P     FFPSL+
Sbjct  505   LVHIVLFSCERCQILPPFAQLPALKFMWLSGLEEVEYV--TDCSSATPP-----FFPSLQ  557

Query  887   KLWIWNCPNLKGWWKKNDEAIEEELLPPFPCISVVDIKQSPNVTWMPLF--PTVSE----  726
              L + N P LKG  KK   + E+   P FP +S +D+     +T + L   P++SE    
Sbjct  558   MLKLDNLPKLKGLRKKGSSSEED---PSFPLLSKLDVGFCHKLTSLTLHSSPSLSEASLT  614

Query  725   -------KLYIVTGSIIPLEHTKKVCSSFKYLK-------KLWVSEVADLEYMEIELFPS  588
                    K   +  S   LE +   C + + L+       KL+++E  DL+ + +   P 
Sbjct  615   LHHCLNLKSLTLPSSPCLLELSINTCCNLESLELPSSGLSKLYITECNDLKSLNLHSSPD  674

Query  587   LEYLWVYDCRNLRDWGK-------KGDHEDAPKALA---KLAPSVIEFEVKNCPKLKLL  441
             L  L + DC NL    +       + +  D P   +     AP +   E+++CPKL  L
Sbjct  675   LSQLTIRDCNNLTSLAQPPSRYLSQLEIRDCPNLTSFELHSAPELSSLEIRDCPKLTSL  733



>ref|XP_009365072.1| PREDICTED: disease resistance protein RGA2-like [Pyrus x bretschneideri]
Length=226

 Score = 62.4 bits (150),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 42/137 (31%), Positives = 76/137 (55%), Gaps = 7/137 (5%)
 Frame = -2

Query  1553  SVAKLILAKIAPFAQDQIKLLWGLNEELTKLGDLVSHIGAVLLDAEGEKHNKKTENLLEM  1374
             ++A  I+ ++   A  +I  +WG+ +EL KL ++V+ + AVLLDAE ++ N + +  L+ 
Sbjct  8     NIAGGIIGRLGSLAFQKIGFIWGVQDELQKLEEIVTGLQAVLLDAEQQQANNEVKLWLQG  67

Query  1373  LKNIMDEANRLMDYFSPRAKNHR----PNQEDGCCSYFVSHPNPFVWVSDSFMAGKIKSI  1206
             +++ + EA+ ++D F+  A   +      +     S F S  N FV+     M  KIK I
Sbjct  68    VEDAIYEADDVLDEFNTEALRRQMVLGNTKLSKMVSLFFSSSNQFVFGRK--MGRKIKDI  125

Query  1205  NNRLDGIIENYKKIRLE  1155
             N RL  ++E+ +  +LE
Sbjct  126   NERLR-VVESRRPSQLE  141



>ref|XP_010102916.1| Putative disease resistance protein RGA4 [Morus notabilis]
 gb|EXB94434.1| Putative disease resistance protein RGA4 [Morus notabilis]
Length=1131

 Score = 65.5 bits (158),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 62/248 (25%), Positives = 101/248 (41%), Gaps = 39/248 (16%)
 Frame = -2

Query  1064  MTTIYIKNCPPGKQLPQFHLLPSLGELYFESIMVDYIDTTDYEDDN--SPSRSELFFPSL  891
             +  + + NC   +QLP      SL ++    ++    D T  E D+  S S      PSL
Sbjct  786   LVALVLANCSKCQQLPSLDQFHSLKKMELHRLLA-LEDITINEGDSFFSTSSPVSVLPSL  844

Query  890   KKLWIWNCPNLKGWWKKNDEA---IEEELLPPFPCISVVDIKQSPNVTWMPLFPTVSEKL  720
             + L +   P  +GWW+ +  A   +E+ + P FP +S + I   P +T MP +P V  +L
Sbjct  845   ETLKLEVLPKFRGWWRSDMAAENQVEQVVFPSFPRLSHLSIYGCPKLTSMPCYPNVEGEL  904

Query  719   YIVTGSIIPLEHT--------KKVCSSFKYLKKLWVSEV-----ADLEYMEIELFPSLEY  579
              +   S    E T        +K+ ++        V  V     + L  + +E    L+Y
Sbjct  905   TLSDTSGKHFEQTMLMRVPEPQKISTTTTTTTTTEVENVIYHPLSKLTSLTLENVGHLQY  964

Query  578   LWVYDCRNLRDWGKKGDHEDAPKALAKLAPSVIEFEVKNCPKLKLLPQGMRLLSSSTKFS  399
             L                    P    K   S+    ++NCP+LK L  G++ L+S     
Sbjct  965   L--------------------PANQMKSLASLKALRIQNCPELKYLSPGIQNLTSLEYLR  1004

Query  398   ISGCPLLK  375
             I GC  L+
Sbjct  1005  IDGCEELQ  1012



>ref|XP_008231364.1| PREDICTED: putative disease resistance protein RGA3 [Prunus mume]
Length=1077

 Score = 65.5 bits (158),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 31/99 (31%), Positives = 55/99 (56%), Gaps = 7/99 (7%)
 Frame = -2

Query  599  LFPSLEYLWVYDCRNLRDWGKKGDHEDAPKALAKLA-------PSVIEFEVKNCPKLKLL  441
             F SLE L++ DC NL+ W +      +  +   L+       P++    +K+CP L  L
Sbjct  859  FFASLESLYLIDCPNLKGWWRNETASASASSFPCLSTLYIRNCPNLTSLIIKDCPNLASL  918

Query  440  PQGMRLLSSSTKFSISGCPLLKQKYKSKSGQNWPEVANI  324
            P+G R L+S     I  CP+L+Q+ + ++G++W ++A+I
Sbjct  919  PEGFRCLASLKSLIIDSCPILEQRCQKETGEDWSKIAHI  957


 Score = 57.4 bits (137),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 40/130 (31%), Positives = 69/130 (53%), Gaps = 6/130 (5%)
 Frame = -2

Query  1553  SVAKLILAKIAPFAQDQIKLLWGLNEELTKLGDLVSHIGAVLLDAEGEKHNKKTENLLEM  1374
             +VA+ I+ ++      +I LLWG+ ++L KL D V+ + AVLLDAE ++ N + +  L+ 
Sbjct  8     NVAEGIIGRLGSLVFQEIALLWGVKDDLQKLKDKVAQLQAVLLDAEQKQANYQVKVWLQS  67

Query  1373  LKNIMDEANRLMDYFSPRAKNHR----PNQEDGCCSYFVSHPNPFVWVSDSFMAGKIKSI  1206
             +++ + EA+ ++D F   A+  +     N+       F S  N  V+     +  KIK +
Sbjct  68    VEDAVYEADDVLDEFYTEAQWRQMVPGNNKVSKQVRIFFSSSNQLVFGLK--IGHKIKDL  125

Query  1205  NNRLDGIIEN  1176
             N RL  I  N
Sbjct  126   NKRLYEIASN  135


 Score = 55.1 bits (131),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 34/122 (28%), Positives = 55/122 (45%), Gaps = 14/122 (11%)
 Frame = -2

Query  1088  SWKFASAYMTTIYIKNCPPGKQLPQFHLLPSLGEL-YFESIMVDYIDTTDYEDDNSPSRS  912
             SW  +   +  + + +C   + LP    LP L  L  F    +++I   D   D +    
Sbjct  787   SWFHSLTNIINLKLSDCDRCQHLPPLDHLPFLKSLKLFGLRNLEHISAEDTVKDFASDEM  846

Query  911   EL----------FFPSLKKLWIWNCPNLKGWWKKNDEAIEEELLPPFPCISVVDIKQSPN  762
              +          FF SL+ L++ +CPNLKGWW+    +        FPC+S + I+  PN
Sbjct  847   MMMMSVASPLTTFFASLESLYLIDCPNLKGWWRNETASASA---SSFPCLSTLYIRNCPN  903

Query  761   VT  756
             +T
Sbjct  904   LT  905



>gb|KGN66116.1| hypothetical protein Csa_1G572370 [Cucumis sativus]
Length=701

 Score = 65.1 bits (157),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 64/252 (25%), Positives = 113/252 (45%), Gaps = 42/252 (17%)
 Frame = -2

Query  1064  MTTIYIKNCPPGKQLPQFHLLPSLGELYFESIMVDYIDTTDYEDDNSPSRSEL--FFPSL  891
             +  I + NC   +QLP+F   P L  L  +     Y+   ++ D+N    S L  FFPSL
Sbjct  433   LVIIDLFNCNKLQQLPRFDQFPFLKHLKLQ-----YLPNVEFIDNNDSVSSSLTTFFPSL  487

Query  890   KKLWIWNCPNLKGWWKKNDEAIEEELLPPFPCISVVDIKQSPNVTWMPLFPTVSEKLYIV  711
             +KL I+  P LK WWK+    + ++ +P    +  ++I        + +F  V E   + 
Sbjct  488   EKLRIFRLPKLKEWWKR---KLIDQTIPQHRRLESLNISGVS----LQVFELVME---MA  537

Query  710   TGSIIPLEHTKKVCSSFKYLKKLWVSEVADLEYMEI-ELFPSLEY---LWVYDCRNLR--  549
             T +II         ++   L  L + ++ D E+++  +LF ++ +   LW+ +C+N++  
Sbjct  538   TTNIIVGSQDSSSSTTSISLSFLSIEDI-DFEFLQFHDLFSNMTHLKSLWIINCKNIKMS  596

Query  548   ------DWGKKG-----------DHEDAPKALAKLAPSVIEFEVKNCPKLKLLPQGMRLL  420
                    W   G           D E  PK+L +   ++   ++ NCP L  +     L 
Sbjct  597   SSLDAVTWKGLGSLRELMLSSIPDLEYLPKSL-QCVTTLQSLQIYNCPNLVSIESIRHLT  655

Query  419   SSSTKFSISGCP  384
             +S +   I GCP
Sbjct  656   TSLSVLEIHGCP  667



>gb|KCW60240.1| hypothetical protein EUGRSUZ_H02956 [Eucalyptus grandis]
Length=1046

 Score = 65.1 bits (157),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 71/313 (23%), Positives = 128/313 (41%), Gaps = 69/313 (22%)
 Frame = -2

Query  1088  SWKFASAYMTTIYIKNCPPGKQLPQFHLLPSLGELYFESI----MVDYIDTTDYEDDNSP  921
             SW  + A +  + +  C   K LP    LPSL  L   ++     V+ I   +  D + P
Sbjct  734   SWLSSMANLIELDVSVCTEWKYLPSLCELPSLRRLTLSNLYALEFVEEISDLEQSDTSPP  793

Query  920   SRSELFFPSLKKLWIWNCPNLKGWWKK------NDEAIEEELLPPFPCISVVDIKQSPNV  759
                  + PSL+ L ++ C NLKGWW +      + +  +      FP +  + I  + + 
Sbjct  794   -----YLPSLENLNLYYCDNLKGWWGRSQPMELDQDHQQYNSYSSFPKLLSMKIWMAVS-  847

Query  758   TWMPLFPTVSEKLYIVTGSIIPLEHT--KKVCSSFKYLKKLWVSEVADLEYME--IELFP  591
             T++PL      KL  ++   + LEH+  + +    + LK L      +L  +   ++   
Sbjct  848   TFIPL-----SKLERLSFDAVDLEHSMLETLLPFLRNLKTLVFHYCFELRSLSCGMQSLS  902

Query  590   SLEYLWVYDCRNLRDWGKKGDHEDAPKALAKLA-------------PSVIE---------  477
             SL+ L + +C+ L       +H    ++LAKL              P  I+         
Sbjct  903   SLQSLDIRECKELDVSSHDDEHGTQWRSLAKLRHLTFYRLPKLVALPEGIQHITTLESLD  962

Query  476   ----------------------FEVKNCPKLKLLPQGMRLLSSSTKFSISGCPLLKQKYK  363
                                    +V  C KL  LP G+  L+S     I+GCP+L+++ +
Sbjct  963   VSRCENLMSLPEWIGNFSTLQNLDVSYCSKLTCLPDGISRLTSLKTLRIAGCPVLQERCQ  1022

Query  362   SKSGQNWPEVANI  324
              + G +W ++A++
Sbjct  1023  RECGADWEKIAHL  1035



>ref|XP_006586821.1| PREDICTED: putative disease resistance protein RGA4-like [Glycine 
max]
Length=293

 Score = 63.2 bits (152),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 74/292 (25%), Positives = 126/292 (43%), Gaps = 42/292 (14%)
 Frame = -2

Query  1181  ENYKKIRLEEQNPKQQPMLTLLPPEDIGSVLSWKF----ASAYMTTIYIKNCPPGKQLPQ  1014
             EN ++I LE  +P  Q +  L    D+     + F    +S+ +  + +K+C    QL  
Sbjct  23    ENVEEI-LEVLHPDTQQLWRL----DVEGYKGFHFPQWISSSPLKHLMLKDCENCLQLSP  77

Query  1013  FHLLPSLGEL-YFESIMVDYIDTTDYEDDNSPSRSELFFPSLKKLWIWNCPNLKGWWKKN  837
                LPSL  L     I V+Y+    Y+        E+ F +L+ L +   P LK   +++
Sbjct  78    IAKLPSLKTLRILNMIHVEYLYEESYD-------GEVVFRALEDLSLCRLPKLKRLSRED  130

Query  836   DEAIEEELLPPFPCISVVDIKQSPNVTWMPLFPTVSEKLYIVTGSIIPLEHTKKVCSSFK  657
              E +       FPC+S+++I          +F      L ++    I       V + F 
Sbjct  131   GENM-------FPCLSILEIDGCDRFLGEEVFLHRLHSLTLINCGKI------NVSAGFN  177

Query  656   YLKKLWVSEVADLEYMEIELFPSLEYLWVYDCRNLRDWGKKGDHEDAPKALAKLAPSVIE  477
              L+KLW+SE        ++   SL+ L +   RNL         E  P     L P +  
Sbjct  178   CLEKLWISECRVESLQALQDMTSLKELRL---RNLPKL------ETLPDCFGNL-PLLHT  227

Query  476   FEVKNCPKLKLLPQGMRLLSSSTKFSISGC-PLLKQKYKSKSGQNWPEVANI  324
               +  C KL  LP  +   S   + +I GC   L+++Y+ ++G++WP +A+I
Sbjct  228   LSIFFCSKLTCLPMSLS-FSGLHQLTIFGCHSELEKRYEKETGEDWPNIAHI  278



>ref|XP_006383307.1| hypothetical protein POPTR_0005s14320g [Populus trichocarpa]
 gb|ERP61104.1| hypothetical protein POPTR_0005s14320g [Populus trichocarpa]
Length=1005

 Score = 65.1 bits (157),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 64/276 (23%), Positives = 117/276 (42%), Gaps = 46/276 (17%)
 Frame = -2

Query  1064  MTTIYIKNCPPGKQLPQFHLLPSLGELYFESI-MVDYIDTTDYEDDNSPSRSELFFPSLK  888
             +  + +++C   +QLP F  L  L +L  + I  V  ID+    D  +P      FPSL+
Sbjct  736   LVEMELRDCYNCEQLPPFGKLQFLEDLVLQGIDGVKCIDSHVNGDGQNP------FPSLE  789

Query  887   KLWIWNCPNLKGWWKKNDEAIEEELLPPFPCISVVDIKQSPNVTWMPLFPT-VSEKLYIV  711
             +L I++   L+ W     +A        FPC+  + +   P +  +P+ P+ +S  +   
Sbjct  790   RLAIYSMKRLEQW-----DAC------SFPCLRQLHVSSCPLLAEIPIIPSSLSNNVLDN  838

Query  710   TGSIIPLEHT---------KKVCSSFKYLKKLWVSEVADLEYMEIELFPSLEYLWVYDCR  558
               S+  L  T         ++   +   L+ L ++    L  + +    SL  L +  C 
Sbjct  839   LSSLKTLSITACDELESLPEEGLRNLNSLEVLSINGCGRLNSLPMNCLSSLRRLSIKYCD  898

Query  557   NLRDWGKKGDH----ED--------------APKALAKLAPSVIEFEVKNCPKLKLLPQG  432
                   +   H    ED              + + L  L    I  +++ CP L   P G
Sbjct  899   QFASLSEGVRHLTALEDLSLFGCPELNSLPESIQHLTSLRSLSICLKIRGCPNLMSFPDG  958

Query  431   MRLLSSSTKFSISGCPLLKQKYKSKSGQNWPEVANI  324
             ++ LS  +K +I  CP L+++   K G++WP++A+I
Sbjct  959   VQSLSKLSKLTIDECPNLEKRCAKKRGEDWPKIAHI  994



>ref|XP_008222898.1| PREDICTED: putative disease resistance protein RGA3 [Prunus mume]
Length=1259

 Score = 65.1 bits (157),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 83/325 (26%), Positives = 139/325 (43%), Gaps = 58/325 (18%)
 Frame = -2

Query  1232  FMAGKIKSINNRLDGIIENYKKIRLE-----EQNPKQQPMLTLLPPED------IGSVLS  1086
             ++ GK ++  + L G   N + +RLE     E+N   + +L  L P        I S L 
Sbjct  686   YVRGKDEAKESNLAGKT-NIQSLRLEWGNSRERNDDDKEVLDGLEPHPKLESLYISSFLG  744

Query  1085  WKFASAYMTT-------IYIKNCPPGKQLPQFHLLPSLGELYFESIMVDYIDTTDYEDDN  927
              KFAS  M+        I + NC   + +P    LP+L  + F    +D +     E   
Sbjct  745   SKFASWMMSGLPGNLKKIVLSNCRECEVVPTLGHLPNLRHVDF--YFMDKLKCLGDEFYG  802

Query  926   SPSRSELFFPSLKKLWIWNCPNLKGWWKKNDEAIEEELLPPFPCI------SVVDIKQSP  765
                    FFP+LK L   +C  L  W     EA     +  FPC+      S++ +K +P
Sbjct  803   YNQTRPAFFPALKTLRFSSCHALIEW----KEATVMSTVAVFPCLEELSLSSLMQLKNAP  858

Query  764   NVTWMPLFPTVSEKLYI-VTGSIIPLEHTKKVCSSFKYLKKLWVSEVADLEYMEIELF--  594
             +      FP++ +KL+I V  +++P+E+   +CS    L  L++  + +L  + + +   
Sbjct  859   SH-----FPSL-QKLHIHVLDNVMPIEN---ICSQLTTLTSLYMQGIKELTSLPVGMVEK  909

Query  593   -PSLEYLWVYDCRNLRDWGKKGDHE----------DAPKA----LAKLAPSVIEFEVKNC  459
               +L  L +    NLR       H+            P      + +  P + E ++K+C
Sbjct  910   NQNLRSLIIGHFENLRHLPDGLLHKLPLLDELFISSCPNLELIPITEGLPCLRELKIKDC  969

Query  458   PKLKLLPQGMRLLSSSTKFSISGCP  384
              KL  LP G++  +S    SIS CP
Sbjct  970   KKLSSLPSGLKYCTSLQMLSISRCP  994



>emb|CBI24932.3| unnamed protein product [Vitis vinifera]
Length=454

 Score = 64.3 bits (155),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 42/106 (40%), Positives = 59/106 (56%), Gaps = 9/106 (8%)
 Frame = -2

Query  1064  MTTIYIKNCPPGKQLPQFHLLPSLGELYFESIMVDYIDTTDYEDDNSPSRSELFFPSLKK  885
             +  I I +C   + LP F  LPSL  L    IM   ID   Y  D  PS +  FFPSLK 
Sbjct  313   LVKIEISSCNRSQVLPPFGQLPSLKYL---DIM--QIDDVGYMRD-YPSSATPFFPSLKT  366

Query  884   LWIWNCPNLKGWWKKNDEAIEEELLPPFPCISVVDIKQSPNVTWMP  747
             L ++  P+L+GW +++   I  E  P FPC+S++ IK+ P +T +P
Sbjct  367   LQLYWLPSLEGWGRRD---ISVEQAPSFPCLSILKIKECPKLTSLP  409


 Score = 58.2 bits (139),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 38/117 (32%), Positives = 62/117 (53%), Gaps = 12/117 (10%)
 Frame = -2

Query  653  LKKLWVSEVADLEYME------IELFPSLEYLWVYDCRNLRDWGKKG-DHEDAPKALAKL  495
            LK L + ++ D+ YM          FPSL+ L +Y   +L  WG++    E AP      
Sbjct  336  LKYLDIMQIDDVGYMRDYPSSATPFFPSLKTLQLYWLPSLEGWGRRDISVEQAPSF----  391

Query  494  APSVIEFEVKNCPKLKLLPQGMRLLSSSTKFSISGCPLLKQKYKSKSGQNWPEVANI  324
             P +   ++K CPKL  LP+ MR L++     IS C  L ++ K ++G++WP +++I
Sbjct  392  -PCLSILKIKECPKLTSLPEEMRSLNNLHTLKISYCRNLVKRCKKEAGEDWPRISHI  447



>ref|XP_007030144.1| Leucine-rich repeat containing protein isoform 1 [Theobroma cacao]
 gb|EOY10646.1| Leucine-rich repeat containing protein isoform 1 [Theobroma cacao]
Length=855

 Score = 64.7 bits (156),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 43/138 (31%), Positives = 74/138 (54%), Gaps = 2/138 (1%)
 Frame = -2

Query  1565  STAISVAKLILAKIAPFAQDQIKLLWGLNEELTKLGDLVSHIGAVLLDAEGEKHNKKTEN  1386
             S   ++A+ +L KIA  A ++++LL+ +  +L +L D ++HI AVLLDAE ++H  +   
Sbjct  4     SFLFNIAERVLEKIALLAVEEVRLLFNVENDLEELQDTMTHIKAVLLDAERQQHQNEALR  63

Query  1385  L-LEMLKNIMDEANRLMDYFSPRAKNHRPNQEDGCCSYFVSHPNPFVWVS-DSFMAGKIK  1212
             L +  L+++ D+A  ++D     A   R              P+ FV ++  S M  KIK
Sbjct  64    LSIWKLRDLFDDAEDVIDEIECEALRKRVVNYPSTSIKVRCLPSCFVPLAFSSKMGHKIK  123

Query  1211  SINNRLDGIIENYKKIRL  1158
              IN R+D I   + + +L
Sbjct  124   EINKRIDTIATEWDRFKL  141



>ref|XP_010644917.1| PREDICTED: putative disease resistance protein RGA3 [Vitis vinifera]
 ref|XP_010644918.1| PREDICTED: putative disease resistance protein RGA3 [Vitis vinifera]
 ref|XP_010644920.1| PREDICTED: putative disease resistance protein RGA3 [Vitis vinifera]
 ref|XP_010644921.1| PREDICTED: putative disease resistance protein RGA3 [Vitis vinifera]
 ref|XP_010644922.1| PREDICTED: putative disease resistance protein RGA3 [Vitis vinifera]
 ref|XP_003634781.2| PREDICTED: putative disease resistance protein RGA3 [Vitis vinifera]
 ref|XP_010644923.1| PREDICTED: putative disease resistance protein RGA3 [Vitis vinifera]
 ref|XP_010644924.1| PREDICTED: putative disease resistance protein RGA3 [Vitis vinifera]
 ref|XP_010644925.1| PREDICTED: putative disease resistance protein RGA3 [Vitis vinifera]
 ref|XP_010644926.1| PREDICTED: putative disease resistance protein RGA3 [Vitis vinifera]
 ref|XP_010644927.1| PREDICTED: putative disease resistance protein RGA3 [Vitis vinifera]
 ref|XP_010644928.1| PREDICTED: putative disease resistance protein RGA3 [Vitis vinifera]
 ref|XP_010644929.1| PREDICTED: putative disease resistance protein RGA3 [Vitis vinifera]
 ref|XP_010644930.1| PREDICTED: putative disease resistance protein RGA3 [Vitis vinifera]
 ref|XP_010644931.1| PREDICTED: putative disease resistance protein RGA3 [Vitis vinifera]
 ref|XP_010644932.1| PREDICTED: putative disease resistance protein RGA3 [Vitis vinifera]
 ref|XP_010644933.1| PREDICTED: putative disease resistance protein RGA3 [Vitis vinifera]
 ref|XP_010644935.1| PREDICTED: putative disease resistance protein RGA3 [Vitis vinifera]
 ref|XP_010644936.1| PREDICTED: putative disease resistance protein RGA3 [Vitis vinifera]
 ref|XP_010644937.1| PREDICTED: putative disease resistance protein RGA3 [Vitis vinifera]
 ref|XP_010644938.1| PREDICTED: putative disease resistance protein RGA3 [Vitis vinifera]
 ref|XP_010644939.1| PREDICTED: putative disease resistance protein RGA3 [Vitis vinifera]
 ref|XP_010644940.1| PREDICTED: putative disease resistance protein RGA3 [Vitis vinifera]
Length=1045

 Score = 64.7 bits (156),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 65/239 (27%), Positives = 106/239 (44%), Gaps = 41/239 (17%)
 Frame = -2

Query  1064  MTTIYIKNCPPGKQLPQFHLLPSLGELYFESIM-VDYIDTTDYEDDNSPSRSELFFPSLK  888
             +  I + +C   + LP F  LP+L  ++   +  V+Y+  TD      P     FFPSL+
Sbjct  784   LVHIVLFSCERCQILPPFAQLPALKFMWLSGLEEVEYV--TDCSSATPP-----FFPSLQ  836

Query  887   KLWIWNCPNLKGWWKKNDEAIEEELLPPFPCISVVDIKQSPNVTWMPLF--PTVSE----  726
              L + N P LKG  KK   + E+   P FP +S +D+     +T + L   P++SE    
Sbjct  837   MLKLDNLPKLKGLRKKGSSSEED---PSFPLLSKLDVGFCHKLTSLTLHSSPSLSEASLT  893

Query  725   -------KLYIVTGSIIPLEHTKKVCSSFKYLK-------KLWVSEVADLEYMEIELFPS  588
                    K   +  S   LE +   C + + L+       KL+++E  DL+ + +   P 
Sbjct  894   LHHCLNLKSLTLPSSPCLLELSINTCCNLESLELPSSGLSKLYITECNDLKSLNLHSSPD  953

Query  587   LEYLWVYDCRNLRDWGK-------KGDHEDAPKALA---KLAPSVIEFEVKNCPKLKLL  441
             L  L + DC NL    +       + +  D P   +     AP +   E+++CPKL  L
Sbjct  954   LSQLTIRDCNNLTSLAQPPSRYLSQLEIRDCPNLTSFELHSAPELSSLEIRDCPKLTSL  1012



>ref|XP_003615790.1| Nbs-lrr resistance protein [Medicago truncatula]
 gb|AES98748.1| disease resistance protein RGA3 [Medicago truncatula]
Length=992

 Score = 64.7 bits (156),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 66/261 (25%), Positives = 123/261 (47%), Gaps = 34/261 (13%)
 Frame = -2

Query  1088  SWKFASAYMTTIYIKNCPPGKQLPQFHLLPSLGELYFESIM-VDYIDTTDYEDDNSPSRS  912
             SW    + + ++ ++ C    +LP    LPSL +L    +  + Y+D     DD S    
Sbjct  752   SWIIILSNLISLELEICNKIVRLPLLGKLPSLKKLRLYGMNNLKYLD-----DDESEYGM  806

Query  911   EL-FFPSLKKLWIWNCPNLKGWWKKNDEAIEEELLPPFPCISVVDIKQSPNVTWMPLFPT  735
             E+  FPSL++L + + PN++G  K     +       FPC+S +DI   P +  +P  P+
Sbjct  807   EVSVFPSLEELNLKSLPNIEGLLKVERGEM-------FPCLSKLDIWDCPELG-LPCLPS  858

Query  734   V-SEKLYIVTGSIIPLEHTKKVCSSFKYLKKLWVSEVADLEYMEIELF---PSLEYLWVY  567
             + S  L+     ++      +  S+F+ L +L ++    +  +  E+F    SL+ L + 
Sbjct  859   LKSLHLWECNNELL------RSISTFRGLTQLTLNSGEGITSLPEEMFKNLTSLQSLCIN  912

Query  566   DCRNLRDWGKKGDHEDAPKALAKLAPSVIEFEVKNCPKLKLLPQGMRLLSSSTKFSISGC  387
              C  L         E  P+   +   S+   ++  C  L+ LP+G+R L+S     I  C
Sbjct  913   CCNEL---------ESLPEQNWEGLQSLRALQIWGCRGLRCLPEGIRHLTSLELLDIIDC  963

Query  386   PLLKQKYKSKSGQNWPEVANI  324
             P L+++ K  + ++W ++A+I
Sbjct  964   PTLEERCKEGTWEDWDKIAHI  984



>dbj|BAG49729.1| disease resistance protein [Capsicum chinense]
Length=1324

 Score = 64.7 bits (156),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 75/280 (27%), Positives = 122/280 (44%), Gaps = 52/280 (19%)
 Frame = -2

Query  1064  MTTIYIKNCPPGKQLPQF--HLLPSLGELYFESIMVDYIDTTDYEDDNSPSRSELF----  903
             MT++ I NC   K+LP+    LLPSL EL   S      +   + D   P   +L     
Sbjct  1058  MTSLNIHNCAKLKRLPERMQELLPSLKELKPYSCP----EIESFPDGGLPFNLQLLGISN  1113

Query  902   ---FPSLKKLWI--------------WNCPN-LKGWWKKNDEAIEEELLPPFPCISVVDI  777
                 PSL++L+I              W  P+ ++     N + +  +LL     +  +DI
Sbjct  1114  CEKLPSLRELYIYHNGSDEEIVGGENWELPSSIRRLTISNLKTLSSQLLKSLTSLESLDI  1173

Query  776   KQSPNVTWM--PLFPTVSEKLYIVTGS---IIPLEHTKKVCSSFKYLKKLWVSEVADLEY  612
             +  P +  +     P+   +LY+        +P E  + + S    L+ L +S    L+ 
Sbjct  1174  RNLPQIQSLLEQGLPSSLSELYLYDHDELHSLPTEGLRHLTS----LQSLLISNCPQLQS  1229

Query  611   MEIELFPS-LEYLWVYDCRNLRDWGKKGDHEDAPKALAKLAPSVIEFEVKNCPKLKLLPQ  435
             +    FPS L  L + +C NL+   K           +    S+ E  + +CP L+ LP+
Sbjct  1230  LPKSAFPSSLSKLSINNCPNLQSLPK-----------SAFPCSLSELTITHCPNLQSLPE  1278

Query  434   -GMRLLSSSTKFSISGCPLLKQKYKSKSGQNWPEVANITT  318
              GM   SS +  SI  CPLL+   +   G+ WPE+A+I+T
Sbjct  1279  KGMP--SSLSTLSIYNCPLLRPLLEFDKGEYWPEIAHIST  1316



>ref|XP_010659529.1| PREDICTED: putative disease resistance protein RGA3 [Vitis vinifera]
Length=836

 Score = 64.3 bits (155),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 65/248 (26%), Positives = 113/248 (46%), Gaps = 43/248 (17%)
 Frame = -2

Query  1064  MTTIYIKNCPPGKQLPQFHLLPSLGELY-FESIMVDYIDTTDYEDDNSPSRSELFFPSLK  888
             +  I I +C   K LP F  LPSL  L  F+ I V+ +   DY     PS ++ FFPSLK
Sbjct  623   LVKIQITSCNRSKVLPPFAQLPSLKYLVLFDLIAVECM--MDY-----PSSAKPFFPSLK  675

Query  887   KLWIWNCPNLKGWWKKNDEAIEEELLPPFPCISVVDIKQSPNVTWMPLFPTVSEKLYIVT  708
              L +   PNLKGW  ++   +  E  P +P +  + +  +          TV   L++++
Sbjct  676   TLQLSLLPNLKGWGMRD---VAAEQAPSYPYLEDLLLNNT----------TVELCLHLIS  722

Query  707   GSIIPLEHTKKVCSSFKYLKKLWVSEVADLEYMEIELFPSLEYLWVYDCRNLRDWGKKGD  528
              S      + +  +    L +  +  ++ L+ ++IE          Y    L DW     
Sbjct  723   ASSSLKSLSIRCINDLISLPE-GLQHLSTLQTLKIE--------HCYGLATLPDW-----  768

Query  527   HEDAPKALAKLAPSVIEFEVKNCPKLKLLPQGMRLLSSSTKFSISGCPLLKQKYKSKSGQ  348
                    +  L  S+    ++ CP+L+ LP+ MR L       I  CP L ++ + ++G+
Sbjct  769   -------IGSLT-SLSNLSIECCPELRSLPEEMRSLRHLHTLEIYRCPYLYERCQKETGE  820

Query  347   NWPEVANI  324
             +WP++++I
Sbjct  821   DWPKISHI  828



>ref|XP_010670884.1| PREDICTED: putative disease resistance protein RGA1 [Beta vulgaris 
subsp. vulgaris]
Length=376

 Score = 63.2 bits (152),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 64/238 (27%), Positives = 109/238 (46%), Gaps = 31/238 (13%)
 Frame = -2

Query  1055  IYIKNCPPGKQLPQFHLLPSLGELYFESIMVDYIDTTDYEDDNSPSRSELFFPSLKKLWI  876
             I+I +C   + LP F  L SL  L    +  D ++  +     S S +E +FPSLK L +
Sbjct  64    IHISDCHNCQHLPSFGSLSSLESLELRGL--DTLEFIEIGQGISCSSAEGYFPSLKYLIL  121

Query  875   WNCPNLKGWWKKNDEAIE--------EELLPP--FPCISVVDIKQSPNVTWMPLFPTVSE  726
                P+LKGW K  D   +        E+ +P   F C+S + +   PN+  MPL P + E
Sbjct  122   VKLPHLKGWSKVEDHDADCQQEKHGKEQYVPQKIFCCLSEIKVSGCPNLMSMPLVPGL-E  180

Query  725   KLYIVTGSIIPLEHTKKV-----CSSFKYLKKLWVSEVADLEYMEIELFPSLEYLWVYDC  561
              L  V      L+H          S+   LK+L ++   +LE + I +  S++ L + +C
Sbjct  181   TLEAVDIHEKLLKHLMSTQESPASSASSTLKELHINSTHELESLSITI-TSMQVLTITEC  239

Query  560   RNLRDWGKKGDHEDAPKALAKLAPSVIEFEVKNCPKLKLLPQGMRLLSSSTKFSISGC  387
             + L +             LA+ + ++ + ++++C KLK +   +  LS   +  I  C
Sbjct  240   KELTN------------VLAESSHTLRQLKIRSCHKLKDISCALLDLSVLEELEIESC  285



>gb|AAS49213.1| disease resistance protein [Glycine max]
Length=1129

 Score = 64.3 bits (155),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 62/221 (28%), Positives = 99/221 (45%), Gaps = 30/221 (14%)
 Frame = -2

Query  905   FFPSLKKLWIWNCPNLKGWWKKND---------------EAIEEELLPPFPCISVVDIKQ  771
              FP LK+L IW CPNL+   +                  E++ E +    P +  + I  
Sbjct  916   IFPILKELQIWECPNLQRISQGQALNHLETLSMRECPQLESLPEGMHVLLPSLDSLWIDD  975

Query  770   SPNVTWMP--LFPTVSEKLYIVTGSIIPLEHTKKVCSSFKYLKKLWVSEVADLEYM--EI  603
              P V   P    P+  + + +  GS   +   K        L++L +  V D+E +  E 
Sbjct  976   CPKVEMFPEGGLPSNLKSMGLYGGSYKLISLLKSALGGNHSLERLVIGGV-DVECLPDEG  1034

Query  602   ELFPSLEYLWVYDCRNLRDWGKKGDHEDAPKALAKLAPSVIEFEVKNCPKLKLLPQGMRL  423
              L  SL  LW+ +C +L+    KG        L  L+ S+    + +CP+L+ LP+   L
Sbjct  1035  VLPHSLVNLWIRECGDLKRLDYKG--------LCHLS-SLKTLTLWDCPRLQCLPE-EGL  1084

Query  422   LSSSTKFSISGCPLLKQKYKSKSGQNWPEVANITTDW*LVN  300
               S +   I  CPLLKQ+ +   G++WP++A+I   W L N
Sbjct  1085  PKSISTLGILNCPLLKQRCREPEGEDWPKIAHIKRVWLLGN  1125



>ref|XP_007133656.1| hypothetical protein PHAVU_011G198000g [Phaseolus vulgaris]
 gb|ESW05650.1| hypothetical protein PHAVU_011G198000g [Phaseolus vulgaris]
Length=1189

 Score = 64.3 bits (155),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 59/216 (27%), Positives = 102/216 (47%), Gaps = 36/216 (17%)
 Frame = -2

Query  905   FFPSLKKLWIWNCPNLKGWWKKND---------------EAIEEELLPPFPCISVVDIKQ  771
             FFP+L+ L++ NC NL+   + +                E++ E +    PC+  + I+ 
Sbjct  982   FFPTLRSLYLRNCCNLQVILQVHAHTQLQDLTISDCPRFESLPERIHILLPCLEFLSIRD  1041

Query  770   SPNVTWMP--LFPTVSEKLYIVTGS--IIPLEHTKKVCSSFK--YLKKLWVSEVADLEYM  609
              P V        P+  +++Y+   S  I+ L+ +    SS +  ++  L V    D  ++
Sbjct  1042  CPKVDSFSDGYLPSNIKRMYLTNSSKLIVSLKGSFGDNSSLEALFIGNLDVQSFPDEGFL  1101

Query  608   EIELFPSLEYLWVYDCRNLRDWGKKGDHEDAPKALAKLAPSVIEFEVKNCPKLKLLPQGM  429
              I    SL  L +YD +NL     KG        L  L+ S+ E  + NCP+L+ LP   
Sbjct  1102  PI----SLTSLRIYDFQNLEKLDYKG--------LCHLS-SLKELFLVNCPRLQCLPDE-  1147

Query  428   RLLSSSTKFSISG-CPLLKQKYKSKSGQNWPEVANI  324
              L  S +  +ISG CPLL+++ +   GQ+W  +A++
Sbjct  1148  GLPKSISYLTISGNCPLLRERCQQPGGQDWRTIAHV  1183



>emb|CDP11107.1| unnamed protein product [Coffea canephora]
Length=1220

 Score = 63.9 bits (154),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 68/248 (27%), Positives = 106/248 (43%), Gaps = 37/248 (15%)
 Frame = -2

Query  1064  MTTIYIKNCPPGKQLPQFHLLPSLGELYFESIM-VDYIDTTDY---------EDDNSPSR  915
             +T + + NC   + LP    +P L  L    +  V  I  + Y           +  P  
Sbjct  818   LTELRLINCKRLEALPMLGQMPFLQYLELSGLANVTRIGQSFYGANYLALLNRRNGLPQT  877

Query  914   SELFFPSLKKLWIWNCPNLKGWWKKNDEAIEEELLPP---FPCISVVDIKQSPNVTWMPL  744
             +   FP+LK+L +   PNL  W       +E ++ PP   FPC+  + I+  P ++ MP 
Sbjct  878   TITVFPALKRLKLDCMPNLIQW-------MEAQVRPPIEVFPCLEKLTIQYCPRLSTMPC  930

Query  743   -FPTVSE-KLYIVTGSIIPLEHTKKVCSSFKYLKKLWVSEVADLEYMEIELFPS---LEY  579
              FP V E K+  +  +  PL +   +CSS   L +L +  + ++  +   LF S   LE 
Sbjct  931   HFPAVKELKIPFLVHNSTPLAN---ICSSVTTLTELCLYGILEVTCLPNSLFSSNRNLEI  987

Query  578   LWVYDCRNLRDWGKKGDHEDAPKALAKLAPSVIEFEVKNCPKLKLLPQGMRLLSSSTKFS  399
             L +  C NL           AP +      S+ +F +  C +L  LPQ +  LS     S
Sbjct  988   LCISSCPNLT--------HVAP-SFHNFGTSLRQFSINGCNRLSELPQDLNHLSRLESLS  1038

Query  398   ISGCPLLK  375
             I  C  LK
Sbjct  1039  IEECHDLK  1046



>ref|XP_006345413.1| PREDICTED: putative disease resistance protein RGA4-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006345414.1| PREDICTED: putative disease resistance protein RGA4-like isoform 
X2 [Solanum tuberosum]
Length=1162

 Score = 63.5 bits (153),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 79/298 (27%), Positives = 123/298 (41%), Gaps = 58/298 (19%)
 Frame = -2

Query  1193  DGIIENYKKIRLEEQNPKQQPMLTLLPPEDIGSVLSWKFASAY-----MTTIYIKNCPPG  1029
             + + + Y ++ LE   P +   +  +      S   W     +     +T + +KN    
Sbjct  746   EAVNDEYDELLLEGLQPHENLKVLFIERYGGQSFPKWMMVGLHSSLPKLTKLTLKNLKVC  805

Query  1028  KQLPQFHLLPSLGELYFESI-MVDYIDTTDYEDDNSPSR----SELFFPSLKKLWIWNCP  864
             K LP F  LPSL  L  E++ +++YI+ T Y+           S ++FPSLK+L + N P
Sbjct  806   KSLPPFGCLPSLQSLKLENLTLLEYIEHTSYDGSQFGMELQKGSAMYFPSLKELKLCNLP  865

Query  863   NLKGWWKKNDEAIEEELLPPFP---------CISVVDIKQSPNVTWMPLFPTVSEKLYIV  711
              LKGWWKK   A  E     FP          +S + I+    + +MP+ P + E   I 
Sbjct  866   CLKGWWKKEVMAGSES--SSFPNRLLLSSFPSLSKLTIQDCLMLEFMPINPRLEELNLIR  923

Query  710   TGS------IIPLEHTKKV-CSSFKYLKKLWVSEVADLEYMEIELFPSLEYLWVYDCRNL  552
              G+      ++ LE T    CSSF  + K                   L+ L++ D R L
Sbjct  924   VGNKLLQQLMMLLETTLSANCSSFLAVSK-------------------LKSLYILDVREL  964

Query  551   RDWGKKGDHEDAPKALAKLAPSVIEFEVKNCPKLKLLP-QGMRLLSSSTKFSISGCPL  381
                         P+ L  L+  +   E+  CP L  LP +GMR L+      +  C L
Sbjct  965   FLL---------PEGLQNLS-RLDHLEINGCPNLLSLPIEGMRALNMLRFLHVHDCGL  1012



>ref|XP_010088204.1| hypothetical protein L484_012484 [Morus notabilis]
 gb|EXB32756.1| hypothetical protein L484_012484 [Morus notabilis]
Length=356

 Score = 62.4 bits (150),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 45/174 (26%), Positives = 82/174 (47%), Gaps = 10/174 (6%)
 Frame = -2

Query  1088  SWKFASAYMTTIYIKNCPPGKQLPQFHLLPSLGELYFESIM-VDYIDTTDYEDDNSPSRS  912
             SW      +  + ++ C   + LP     PSL  L    +  ++Y+++     + +P+  
Sbjct  168   SWLNPQRNLVKLTLQKCSRCEYLPALDQFPSLKVLVLHEMRNLEYVNS-----EENPA-C  221

Query  911   ELFFPSLKKLWIWNCPNLKGWWKKNDEAIEEELLPPFPCISVVDIKQSPNVTWMPLFPTV  732
             E FF  L+   +   P LKGWW+    + +++  P FP +S + I+  P + +MPLFPT+
Sbjct  222   EPFFSELQ---LEELPRLKGWWRGGAFSYDDDDFPSFPRLSKLSIQDCPELRFMPLFPTL  278

Query  731   SEKLYIVTGSIIPLEHTKKVCSSFKYLKKLWVSEVADLEYMEIELFPSLEYLWV  570
              ++L + T S +  + T K       L  L +  + D    E+  F + + L V
Sbjct  279   KDELVLDTTSWVLFQETMKRRRGALPLMNLSLVNIKDFNKGEVVKFYTRDALRV  332



>ref|XP_007162224.1| hypothetical protein PHAVU_001G134400g [Phaseolus vulgaris]
 gb|ESW34218.1| hypothetical protein PHAVU_001G134400g [Phaseolus vulgaris]
Length=858

 Score = 63.5 bits (153),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 46/142 (32%), Positives = 73/142 (51%), Gaps = 7/142 (5%)
 Frame = -2

Query  1565  STAISVAKLILAKIAPFAQDQIKLLWGLNEELTKLGDLVSHIGAVLLDA-EGEKHNKKTE  1389
             S   S+A+ ++AKIA  A  +   L GL + L  L + +S + AVLLDA + ++HN +  
Sbjct  4     SFLFSIAESLIAKIASHAFQEASRLVGLYDNLRDLIETLSLVKAVLLDAQQKQEHNHQLS  63

Query  1388  NLLEMLKNIMDEANRLMDYFSPRAKNHRPNQEDGC----CSYFVSHPNPFVWVSDSFMAG  1221
               L  LK +  +A  L+D F  +    +  +  G      S+F S  NP ++     MA 
Sbjct  64    QWLTQLKTVFSDAEDLLDEFECQTLRKKVVKAHGSTKDKVSHFFSTSNPLLFRYQ--MAQ  121

Query  1220  KIKSINNRLDGIIENYKKIRLE  1155
             +IK I+NRLD +  +  K  L+
Sbjct  122   QIKDISNRLDKVAADRHKFSLQ  143



>ref|XP_010918021.1| PREDICTED: putative disease resistance protein RGA1 [Elaeis guineensis]
Length=1189

 Score = 63.5 bits (153),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 62/264 (23%), Positives = 108/264 (41%), Gaps = 73/264 (28%)
 Frame = -2

Query  902   FPSLKKLWIWNCPNLKGWWKKNDEAIEEELLPPFPCISVVDIKQSPNVTWMPLFP-----  738
             FPSL+ + +W+ PNL+ W  +   A  +  +  FP ++ ++I   P +   P  P     
Sbjct  873   FPSLEVMNLWDMPNLEAWCAEPTTAGIK--MASFPRLTKLEISSCPKLAVQPCIPCFVEQ  930

Query  737   ---TVSEKLYIVTGSIIPLEHTKK-------VCSS---------FKYLKKLWVSEVADLE  615
                T+S ++ +  GS+  L   K+       V SS            LK+L +S   +L 
Sbjct  931   LEITMSNEMLLSGGSLAGLSQLKRLNIRCCGVSSSSGWWDGLQYLTTLKELRISYCKELT  990

Query  614   YM--EIELFPSLEYLWVYDCRNLRDWGKKGDHEDAP------------------------  513
              +   I   PSL  L++   RNLR    +G  +  P                        
Sbjct  991   CLPEGIMYLPSLHTLYLCWNRNLRSLEGRGRKQQQPTLFFTALRYLYIYGSNALTALQEW  1050

Query  512   ----KALAKLA-----------------PSVIEFEVKNCPKLKLLPQGMRLLSSSTKFSI  396
                  +L KL                   ++ E  + NC +L +LP G++ L++     I
Sbjct  1051  VGGLTSLQKLEILTCPNLAMLPDSLQNLTALQELCIINCNQLAMLPDGLQHLTALQYLKI  1110

Query  395   SGCPLLKQKYKSKSGQNWPEVANI  324
               CP L ++YK ++G++W ++A+I
Sbjct  1111  GDCPQLVRRYKKETGEDWHKIAHI  1134



>ref|XP_003615706.1| NBS-LRR resistance protein [Medicago truncatula]
Length=1327

 Score = 63.5 bits (153),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 62/265 (23%), Positives = 117/265 (44%), Gaps = 46/265 (17%)
 Frame = -2

Query  1088  SWKFASAYMTTIYIKNCPPGKQLPQFHLLPSLGEL-YFESIMVDYIDTTDYEDDNSPSRS  912
             SW    + + ++ ++NC    +LP    LP L +L  FE   + Y+D     DD S    
Sbjct  717   SWIILLSNLISLELRNCNKIVRLPLLGKLPYLKKLELFEMDNLKYLD-----DDESEDGM  771

Query  911   EL-FFPSLKKLWIWNCPNLKGWWKKNDEAIEEELLPPFPCISVVDIKQSPNVTWMPLFPT  735
             E+  FPSL+ L +   PN++G  K     +       FPC+S +DI + P +  +P  P+
Sbjct  772   EVRVFPSLEVLQLSCLPNIEGLLKVERGEM-------FPCLSSLDIWKCPKLG-LPCLPS  823

Query  734   VSEKLYI--VTGSIIPLEHTKKVCSSFKYLKKLWVSE--------VADLEYMEIELFPSL  585
             + + L++      ++    T +  +  K +    ++         +  L+ + +  FP L
Sbjct  824   LKD-LFVWECNNELLRSISTFRGLTQLKLIHGFGITSFPEGMFKNLTSLQSLSVNSFPQL  882

Query  584   EYLWVYDCRNLRDWGKKGDHEDAPKALAKLAPSVIEFEVKNCPKLKLLPQGMRLLSSSTK  405
             E L                    P+   +   S+   ++  C  L+ LP+G+R L+S   
Sbjct  883   ESL--------------------PETNWEGLQSLRFLKIHRCEGLRCLPEGIRHLTSLEV  922

Query  404   FSISGCPLLKQKYKSKSGQNWPEVA  330
              +I  CP L+++ K  +G++W ++ 
Sbjct  923   LNIYKCPTLEERCKEGTGEDWDKIG  947



>ref|XP_010088685.1| Putative disease resistance protein RGA3 [Morus notabilis]
 gb|EXB36856.1| Putative disease resistance protein RGA3 [Morus notabilis]
Length=956

 Score = 63.5 bits (153),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 45/151 (30%), Positives = 71/151 (47%), Gaps = 36/151 (24%)
 Frame = -2

Query  920  SRSELFFPSLKKLWIWNCPNLKGWWKKNDEAIEEE----LLPPFPCISVVDIKQSPNVTW  753
            SR  +  PSLK+L + N PNLKGWW++ D+  E++    +LP FP +  + I   P +T 
Sbjct  747  SRQSMIMPSLKELRLTNLPNLKGWWREMDKGNEDDSDLFMLPCFPQLGSLYICHCPRLTC  806

Query  752  MPLFPTVSEKLYIVTGS-------------------IIPLEHTKKVCSSFKYLKKLWVSE  630
            MPLFP +  +L +   S                   +     T   C+S   ++++ +S+
Sbjct  807  MPLFPFLDWELQLRNTSWKLLLKTIKQKQINPQMDEMSASSSTSTFCASLSKVQRVILSK  866

Query  629  VADLE-------------YMEIELFPSLEYL  576
              DLE             Y++IE FP L+ L
Sbjct  867  NDDLEFFPDYLRNLTSMWYLKIEEFPRLKSL  897



>ref|XP_008375185.1| PREDICTED: putative disease resistance protein RGA3 [Malus domestica]
Length=700

 Score = 63.2 bits (152),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 75/287 (26%), Positives = 120/287 (42%), Gaps = 81/287 (28%)
 Frame = -2

Query  1136  QPMLTLLPPEDIGSVLSW-----KFASAYMTTIYIKN-----CPPGKQLPQFHLLPSLGE  987
             + M  L P  ++  +  W     +FAS + + I I N     C   + LP    LPSL +
Sbjct  472   KSMEVLQPHSNLKQLSVWYYGGVRFASWFSSLINIVNLAFWNCKRCQHLPPLDHLPSLKK  531

Query  986   L---YFESIMVDYIDTTDYEDDNSPSRSEL---FFPSLKKLWIWNCPNLKGWWKKNDEAI  825
             L   Y E +  +YI  ++ E  NS S   +   FFPSL+ L +  CP LKGWW+ +    
Sbjct  532   LQLGYLEKL--EYI--SEKESSNSMSDEMMRISFFPSLETLCLVGCPVLKGWWRAH----  583

Query  824   EEELLPPFPCISVVDIKQSPNVTWMPLFPTVSEKLYIVTGSIIPLEHTKKVCSSFKYLKK  645
                               +PN+T +PL P V              E  +   SS+K +  
Sbjct  584   ------------------TPNLTSIPLCPNV--------------ERIQVCKSSWKVVDS  611

Query  644   LWVSEVADLEYMEIELFPSLEYLWVYDCRNLRDWGKKGDHEDAPKALAKLAPSVIEFEVK  465
             L+    +D+ +                     D G       +   L+KL    +E E++
Sbjct  612   LFFRGASDITH---------------------DVGVDVSASSSSPPLSKLTHLSLE-EIE  649

Query  464   NCPKLKLLPQGMRLLSSSTKFSISGCPLLKQKYKSKSGQNWPEVANI  324
             +   L  LP+ +R L       ISGCP L ++   ++G++WP++A+I
Sbjct  650   D---LASLPEWIRGLPCLNTLQISGCPKLWERCGKETGEDWPKIAHI  693



>ref|XP_007162223.1| hypothetical protein PHAVU_001G134400g [Phaseolus vulgaris]
 gb|ESW34217.1| hypothetical protein PHAVU_001G134400g [Phaseolus vulgaris]
Length=701

 Score = 63.2 bits (152),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 45/138 (33%), Positives = 72/138 (52%), Gaps = 7/138 (5%)
 Frame = -2

Query  1553  SVAKLILAKIAPFAQDQIKLLWGLNEELTKLGDLVSHIGAVLLDA-EGEKHNKKTENLLE  1377
             S+A+ ++AKIA  A  +   L GL + L  L + +S + AVLLDA + ++HN +    L 
Sbjct  8     SIAESLIAKIASHAFQEASRLVGLYDNLRDLIETLSLVKAVLLDAQQKQEHNHQLSQWLT  67

Query  1376  MLKNIMDEANRLMDYFSPRAKNHRPNQEDGC----CSYFVSHPNPFVWVSDSFMAGKIKS  1209
              LK +  +A  L+D F  +    +  +  G      S+F S  NP ++     MA +IK 
Sbjct  68    QLKTVFSDAEDLLDEFECQTLRKKVVKAHGSTKDKVSHFFSTSNPLLFRYQ--MAQQIKD  125

Query  1208  INNRLDGIIENYKKIRLE  1155
             I+NRLD +  +  K  L+
Sbjct  126   ISNRLDKVAADRHKFSLQ  143



>ref|XP_007203607.1| hypothetical protein PRUPE_ppb024266mg [Prunus persica]
 gb|EMJ04806.1| hypothetical protein PRUPE_ppb024266mg [Prunus persica]
Length=645

 Score = 63.2 bits (152),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 46/135 (34%), Positives = 70/135 (52%), Gaps = 6/135 (4%)
 Frame = -2

Query  1571  VVSTAISVAKLILAKIAPFAQDQIKLLWGLNEELTKLGDLVSHIGAVLLDA-EGEKHNKK  1395
             +   A  +A  ++ K++  A D+I L+WG+  +L KLG  +S I AVLLDA E + HNK+
Sbjct  1     MADVAFELASKLIEKLSSIAYDEICLVWGVKADLQKLGRTMSAIKAVLLDAEEKQAHNKE  60

Query  1394  TENLLEMLKNIMDEANRLMDYFSPRA-KNHRPNQEDGCCSYFVSHPNPFVWVSDSFMAG-  1221
               + L  LK++  +A  L+D F  +A +    +        F S  NP  +      AG 
Sbjct  61    LRSWLRQLKDVFLDAEDLLDEFECQALRKQTYHGTTRKVRRFFSPSNPIAF---RLKAGH  117

Query  1220  KIKSINNRLDGIIEN  1176
             +IK I  RLD +  N
Sbjct  118   EIKEIRERLDELKAN  132



>ref|XP_009365073.1| PREDICTED: putative disease resistance protein RGA3 [Pyrus x 
bretschneideri]
Length=850

 Score = 63.2 bits (152),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 65/244 (27%), Positives = 111/244 (45%), Gaps = 26/244 (11%)
 Frame = -2

Query  1082  KFASAYMTTIYIK--NCPPGKQLPQFHLLPSLGELYFESI-MVDYIDTTDYEDDNSPSRS  912
             ++ S+    +Y+K   C   + LP    LPSL  L+   +  ++YI  +D E  NS +RS
Sbjct  491   RWFSSLENVVYLKLSECERCQYLPPLDHLPSLKFLHLYKLEKLEYI--SDNERGNSTNRS  548

Query  911   E---LFFPSLKKLWIWNCPNLKGWWKKNDEAIEEELLPPFPCISVVDIKQSPNVTWMPLF  741
                  FFPSL++L I+ CP LKGWW+ +   +    +P +P +  +D+  + +     LF
Sbjct  549   SDEMSFFPSLEELSIYGCPVLKGWWRAHTHNLTS--MPLYPNVDKIDLIWTSSKVVPSLF  606

Query  740   PTVSEKLYIVTGSIIPLEHTKKVCSSFKYLKKLWVSEVADLEYME---IELFPSLEYLWV  570
                +  +    G  +    +    S    L +L +  + DLE +    I    SL+ L +
Sbjct  607   VRGASDITHDVGVDVSASSSSPHLSK---LTRLSLRGIGDLECITWEWIGNATSLQKLSI  663

Query  569   YDCRNLRDWGKKGDHEDAPKALAKLAPSVIEFEVKNCPKLKLLPQGMRLLSSSTKFSISG  390
             + C  L            P+ ++ L  S+ E  ++ C  L  LP+G+  L+S  +  I  
Sbjct  664   FCCDGLVSL---------PEGISNLT-SLQELRIEYCSGLVSLPEGISNLTSLQELRIEY  713

Query  389   CPLL  378
             C  L
Sbjct  714   CSGL  717



>gb|AES98664.2| disease resistance protein RGA4 [Medicago truncatula]
Length=1234

 Score = 63.2 bits (152),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 62/265 (23%), Positives = 117/265 (44%), Gaps = 46/265 (17%)
 Frame = -2

Query  1088  SWKFASAYMTTIYIKNCPPGKQLPQFHLLPSLGEL-YFESIMVDYIDTTDYEDDNSPSRS  912
             SW    + + ++ ++NC    +LP    LP L +L  FE   + Y+D     DD S    
Sbjct  717   SWIILLSNLISLELRNCNKIVRLPLLGKLPYLKKLELFEMDNLKYLD-----DDESEDGM  771

Query  911   EL-FFPSLKKLWIWNCPNLKGWWKKNDEAIEEELLPPFPCISVVDIKQSPNVTWMPLFPT  735
             E+  FPSL+ L +   PN++G  K     +       FPC+S +DI + P +  +P  P+
Sbjct  772   EVRVFPSLEVLQLSCLPNIEGLLKVERGEM-------FPCLSSLDIWKCPKLG-LPCLPS  823

Query  734   VSEKLYI--VTGSIIPLEHTKKVCSSFKYLKKLWVSE--------VADLEYMEIELFPSL  585
             + + L++      ++    T +  +  K +    ++         +  L+ + +  FP L
Sbjct  824   LKD-LFVWECNNELLRSISTFRGLTQLKLIHGFGITSFPEGMFKNLTSLQSLSVNSFPQL  882

Query  584   EYLWVYDCRNLRDWGKKGDHEDAPKALAKLAPSVIEFEVKNCPKLKLLPQGMRLLSSSTK  405
             E L                    P+   +   S+   ++  C  L+ LP+G+R L+S   
Sbjct  883   ESL--------------------PETNWEGLQSLRFLKIHRCEGLRCLPEGIRHLTSLEV  922

Query  404   FSISGCPLLKQKYKSKSGQNWPEVA  330
              +I  CP L+++ K  +G++W ++ 
Sbjct  923   LNIYKCPTLEERCKEGTGEDWDKIG  947



>ref|XP_007133584.1| hypothetical protein PHAVU_011G191400g [Phaseolus vulgaris]
 gb|ESW05578.1| hypothetical protein PHAVU_011G191400g [Phaseolus vulgaris]
Length=1196

 Score = 63.2 bits (152),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 60/203 (30%), Positives = 98/203 (48%), Gaps = 24/203 (12%)
 Frame = -2

Query  908   LFFPSLKKLWIWNCPNLKGWWKKNDEAIEEELLPPFPCISVVDIKQSPNVTWMP-LFPTV  732
             LF P LK+  I     LK   K+        +    P +  + I+  P V       P+ 
Sbjct  996   LFGPQLKRFCIIGMEKLKSMPKR--------MFALLPSLHYLSIRDCPGVELSEGCLPSN  1047

Query  731   SEKLYIVTGSIIPLEHTKKVCSSFKYLKKLWVSEVADLEYMEIE-LFP-SLEYLWVYDCR  558
              +++ ++  S +     K V  +   LK L++ +  D+E    E L P SL  L + DC 
Sbjct  1048  LKEMRLLNCSKLVASLKKGVWETNTSLKFLYIQK-GDVECFPDEGLLPLSLTDLIIKDCP  1106

Query  557   NLRDWGKKGDHEDAPKALAKLAPSVIEFEVKNCPKLKLLP-QGMRLLSSSTKFSISGCPL  381
             NL+    KG        L  L+ S+ +  ++NCP L+ LP +G+    S ++  I+ CPL
Sbjct  1107  NLKKLDYKG--------LCHLS-SLRKLVLENCPILQCLPDEGLS--ESISQLRITDCPL  1155

Query  380   LKQKYKSKSGQNWPEVANITTDW  312
             LKQ+YK + G++W ++A+I T W
Sbjct  1156  LKQRYKKEEGEDWEKIAHIKTIW  1178



>emb|CAJ44364.1| putative CC-NBS-LRR resistance protein [Malus domestica]
Length=692

 Score = 63.2 bits (152),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 40/124 (32%), Positives = 71/124 (57%), Gaps = 6/124 (5%)
 Frame = -2

Query  1553  SVAKLILAKIAPFAQDQIKLLWGLNEELTKLGDLVSHIGAVLLDAEGEKHNKKTENLLEM  1374
             ++A+ I+ ++   A  +I L+WG+ +EL KL D V+   AVLLDAE ++ N + +  L+ 
Sbjct  8     NIAEGIIGRLGSLAFQEIGLIWGVQDELRKLQDTVAGFQAVLLDAEQKQANNEVKLWLQS  67

Query  1373  LKNIMDEANRLMDYFSPRAKNHRPNQEDGCCS----YFVSHPNPFVWVSDSFMAGKIKSI  1206
             +++ + EA+ ++D F+  A+  +   E+   S    +F S  N  V+     M  K+K+I
Sbjct  68    VEDAIYEADDVLDEFNAEAQQRQMVPENTKLSKKVRHFFSSSNQLVFGLK--MGHKLKNI  125

Query  1205  NNRL  1194
             N RL
Sbjct  126   NKRL  129



>gb|AES88483.2| LRR and NB-ARC domain disease resistance protein [Medicago truncatula]
Length=1045

 Score = 63.2 bits (152),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 72/295 (24%), Positives = 136/295 (46%), Gaps = 54/295 (18%)
 Frame = -2

Query  1088  SWKFASAYMTTIYIKNCPPGKQLPQFHLLPSLGELYFESIM-VDYIDTTDYEDDNSPSRS  912
             SW    + + +  ++NC    QLP    LPSL +L    +  + Y+D    +D++   R 
Sbjct  757   SWIIILSNLVSFELENCNEIVQLPLIGKLPSLKKLTISGMYNLKYLD----DDESRDGRE  812

Query  911   ELFFPSLKKLWIWNCPNLKGWWKKNDEAIEEELLPPFPCISVVDIKQSPNVTWMPLFPTV  732
                FPSL+ L ++   N++G  K     +       FPC+S + I + P +  MP  P++
Sbjct  813   VRVFPSLEVLDLFCLQNIEGLLKVERGEM-------FPCLSKLKISKCPKLG-MPCLPSL  864

Query  731   ---------SEKLYIVTG----SIIPLEHTKKVCSSF--------KYLKKLWVSEVADLE  615
                      +E L  ++     + + L  ++++ +SF          L+ L ++   +L+
Sbjct  865   KSLDVDPCNNELLRSISTFRGLTQLSLLDSEEIITSFPDGMFKNLTSLQSLVLNYFTNLK  924

Query  614   YMEIELF-PSLEYLWVYDCR--------------NLRDWGK---KGDHEDAPKALAKLAP  489
              +  E F P+L++L +  CR              +LR  G    KG  +  P+ +  L  
Sbjct  925   ELPNEPFNPALKHLDISRCRELESLPEQIWEGLQSLRTLGISYCKG-LQCLPEGIQHLT-  982

Query  488   SVIEFEVKNCPKLKLLPQGMRLLSSSTKFSISGCPLLKQKYKSKSGQNWPEVANI  324
              +   ++  C  L+ LP+G++ L+S    +I  CP LK + K  +G++W ++A+I
Sbjct  983   FLRTLKIWGCEGLQCLPEGIQHLTSLELLTIGYCPTLKLRCKEGTGEDWDKIAHI  1037



>ref|XP_007021001.1| Leucine-rich repeat containing-like protein [Theobroma cacao]
 gb|EOY12526.1| Leucine-rich repeat containing-like protein [Theobroma cacao]
Length=442

 Score = 62.4 bits (150),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 60/232 (26%), Positives = 104/232 (45%), Gaps = 40/232 (17%)
 Frame = -2

Query  965  VDYIDTTDYEDDNSPSRSELFFPSLKKLWIWNCPNLKGWWKKNDEAIEEELLPPFPCISV  786
            +D +   + E   +  R +    SL+  W    PN++G  KKN+  ++   L P P +  
Sbjct  225  LDMVRNVELESMEAILREKKRLQSLRLQW---GPNIRGDNKKNELLLDN--LEPHPNLKE  279

Query  785  VDI--KQSPNVTWMPLFPTVSEKLYIVTGSIIPLEHTKKVCSSFKYLKKLWVSEVADLEY  612
            + +   + P+ +  P    + E  + +T      E   K C + + L   WV  +  LE 
Sbjct  280  LTVFGYEGPSFSECPELQYLPEGTHQLTSL---QELCVKNCPNLRALPD-WVLNLTSLET  335

Query  611  MEIE-------------LFPSLEYLWVYDCRNLRDWGKKGDHEDAPKALAKLAPSVIEF-  474
            ++I+                SL+ L V DC NL             KAL    P++    
Sbjct  336  LKIQSCSELHCLPEGTHRLTSLQELHVEDCLNL-------------KALPNWIPNLTSLK  382

Query  473  --EVKNCPKLKLLPQGMRLLSSSTKFSISGCPLLKQKYKSKSGQNWPEVANI  324
              ++  C KL+ LP+G++ L+S    SI+GCP L ++ K ++G +WP +A+I
Sbjct  383  TIDIWGCDKLQYLPEGIQHLTSLRSLSITGCPQLSERCKKETGIHWPHIAHI  434



>ref|XP_006382128.1| hypothetical protein POPTR_0006s28660g [Populus trichocarpa]
 gb|ERP59925.1| hypothetical protein POPTR_0006s28660g [Populus trichocarpa]
Length=834

 Score = 62.8 bits (151),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 51/190 (27%), Positives = 87/190 (46%), Gaps = 26/190 (14%)
 Frame = -2

Query  1553  SVAKLILAKIAPFAQDQIKLLWGLNEELTKLGDLVSHIGAVLLDAE--GEKHNKKTENLL  1380
             ++A+ I+  +      ++ L WGL ++L KL D V+ I AV+ DAE   +K N + E+ L
Sbjct  8     TIAEEIIKTLGSLTAQEVALWWGLKDQLRKLNDTVTRIKAVIQDAEEQAQKQNYQIEDWL  67

Query  1379  EMLKNIMDEANRLMDYFSPRA------KNHRPNQEDGCCSYFVSHPNPFVWVSDSFMAGK  1218
               L+  + +A  L+D FS +          R ++E      F S  N FV+     M  +
Sbjct  68    MKLQEAVYDAEDLLDDFSTQVLRKQLMPGKRVSRE---VRLFFSRSNQFVY--GLRMGHR  122

Query  1217  IKSINNRLDGIIENYKKIRLE-------------EQNPKQQPMLTLLPPEDIGSVLSWKF  1077
             +K++  RLD I  + KK + +             EQ    +P +T+    D  +V S+  
Sbjct  123   VKALRERLDDIGTDSKKFKFDVRGEERASSTTVREQTTSSEPEITVGRVRDKEAVKSFLM  182

Query  1076  ASAYMTTIYI  1047
              S Y   + +
Sbjct  183   NSNYEHNVSV  192



>ref|XP_004169508.1| PREDICTED: putative disease resistance protein RGA4-like [Cucumis 
sativus]
Length=613

 Score = 62.4 bits (150),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 70/255 (27%), Positives = 113/255 (44%), Gaps = 30/255 (12%)
 Frame = -2

Query  1079  FASAYM---TTIYIKNCPPGKQLPQFHLLPSLGELYFESIMVDYIDTTDYEDD-NSPSRS  912
             F+S ++    +I + +C   + LPQF        LY + +++ Y+   +Y D  NS S S
Sbjct  283   FSSNFLGGLVSIELSHCEKLEHLPQFDQF-----LYLKHLLLGYLPNIEYIDSGNSVSSS  337

Query  911   ELFFPSLKKLWIWNCPNLKGWWKKNDE---AIEEEL--LPPFPCISVVDIKQSPNVTWMP  747
               FFPSL+KL I + P LKGWWK        I  +L  L  F C  +  I Q P++  + 
Sbjct  338   TTFFPSLEKLRIESMPKLKGWWKGEISFPTTILHQLSELCIFYCPLLASIPQHPSLESLR  397

Query  746   LFPTVSEKLYIVTGSIIPLEHTKKVCSSFKYLKKLWVSEVADLEYMEIELF---PSLEYL  576
             +     +   +V      L       S+   L  L +  + DLE++ +ELF     LE L
Sbjct  398   ICGVSVQLFQMVIRMATDLSEHSSSSSTLSKLSFLEIGTI-DLEFLPVELFCNMTHLESL  456

Query  575   WVYDCRNLRDWGKKGDHED-----------APKALAKLAPSVIEFEVKNCPKLKLLPQGM  429
              +  C++L+        ED           + + + +L  S+   E+  CP L +L + +
Sbjct  457   IIERCKSLQMSSPHPVDEDNDVLSNCENLVSTEGIGELI-SLSHLEIDRCPNLPILSEDV  515

Query  428   RLLSSSTKFSISGCP  384
               L S +   I  CP
Sbjct  516   GDLISLSHLLIWNCP  530



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4862288125142