BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c24250_g1_i7 len=2536 path=[2725:0-82 2808:83-561 3287:562-575
3301:576-680 6361:681-681 3407:682-686 @3412@!:687-1071
@4081@!:1072-1731 4741:1732-1869 4879:1870-1947 5932:1948-2020
4957:2021-2535]

Length=2536
                                                                      Score     E

ref|XP_008659030.1|  PREDICTED: histone-lysine N-methyltransferas...    327   1e-96   
gb|AES94654.2|  histone-lysine N-methyltransferase                      283   1e-85   
ref|XP_003611696.1|  Histone-lysine N-methyltransferase CLF             283   2e-85   
ref|XP_002523623.1|  enhancer of zeste, ezh, putative                   283   2e-83   Ricinus communis
ref|XP_010070361.1|  PREDICTED: histone-lysine N-methyltransferas...    295   3e-82   
ref|XP_010070362.1|  PREDICTED: histone-lysine N-methyltransferas...    293   3e-82   
gb|KDO79173.1|  hypothetical protein CISIN_1g0024181mg                  288   4e-82   
gb|KDO79169.1|  hypothetical protein CISIN_1g0024181mg                  290   7e-82   
gb|KDO79170.1|  hypothetical protein CISIN_1g0024181mg                  290   7e-82   
ref|XP_010531249.1|  PREDICTED: histone-lysine N-methyltransferas...    290   8e-82   
ref|XP_010070360.1|  PREDICTED: histone-lysine N-methyltransferas...    294   1e-81   
ref|XP_009630459.1|  PREDICTED: histone-lysine N-methyltransferas...    293   1e-81   
ref|XP_010531248.1|  PREDICTED: histone-lysine N-methyltransferas...    293   1e-81   
dbj|BAC84950.1|  PHCLF1                                                 293   1e-81   Petunia x hybrida [garden petunia]
ref|XP_009788515.1|  PREDICTED: histone-lysine N-methyltransferas...    292   2e-81   
ref|XP_006425927.1|  hypothetical protein CICLE_v10024826mg             292   2e-81   
ref|XP_006494449.1|  PREDICTED: histone-lysine N-methyltransferas...    292   2e-81   
ref|XP_008338375.1|  PREDICTED: histone-lysine N-methyltransferas...    287   2e-81   
ref|XP_011099118.1|  PREDICTED: histone-lysine N-methyltransferas...    291   3e-81   
ref|XP_011099116.1|  PREDICTED: histone-lysine N-methyltransferas...    291   3e-81   
ref|XP_004288020.1|  PREDICTED: LOW QUALITY PROTEIN: histone-lysi...    291   3e-81   
ref|XP_009788514.1|  PREDICTED: histone-lysine N-methyltransferas...    291   3e-81   
ref|XP_010531247.1|  PREDICTED: histone-lysine N-methyltransferas...    292   3e-81   
ref|XP_011099117.1|  PREDICTED: histone-lysine N-methyltransferas...    291   3e-81   
ref|XP_006590653.1|  PREDICTED: histone-lysine N-methyltransferas...    290   4e-81   
ref|XP_006590652.1|  PREDICTED: histone-lysine N-methyltransferas...    290   4e-81   
ref|XP_010317757.1|  PREDICTED: EZ2 protein isoform X1                  291   5e-81   
ref|XP_006573641.1|  PREDICTED: histone-lysine N-methyltransferas...    290   6e-81   
ref|NP_001234765.1|  EZ2 protein                                        291   6e-81   
ref|XP_009367302.1|  PREDICTED: histone-lysine N-methyltransferas...    287   6e-81   
ref|XP_009343281.1|  PREDICTED: histone-lysine N-methyltransferas...    287   7e-81   
ref|XP_007047318.1|  SET domain-containing protein isoform 2            285   1e-80   
ref|XP_008340296.1|  PREDICTED: histone-lysine N-methyltransferas...    290   1e-80   
ref|XP_009343280.1|  PREDICTED: histone-lysine N-methyltransferas...    290   1e-80   
ref|XP_007156782.1|  hypothetical protein PHAVU_002G017200g             289   1e-80   
ref|XP_009367294.1|  PREDICTED: histone-lysine N-methyltransferas...    289   2e-80   
ref|XP_007047317.1|  SET domain-containing protein isoform 1            289   4e-80   
ref|XP_002310129.2|  Polycomb group protein CURLY LEAF                  288   4e-80   Populus trichocarpa [western balsam poplar]
ref|XP_008241485.1|  PREDICTED: histone-lysine N-methyltransferas...    288   5e-80   
ref|XP_010677348.1|  PREDICTED: histone-lysine N-methyltransferas...    288   6e-80   
ref|XP_010677349.1|  PREDICTED: histone-lysine N-methyltransferas...    288   6e-80   
ref|XP_010263482.1|  PREDICTED: histone-lysine N-methyltransferas...    288   6e-80   
ref|XP_007204662.1|  hypothetical protein PRUPE_ppa001213mg             287   8e-80   
ref|XP_008457756.1|  PREDICTED: histone-lysine N-methyltransferas...    288   9e-80   
ref|XP_010263480.1|  PREDICTED: histone-lysine N-methyltransferas...    288   9e-80   
gb|KGN61983.1|  hypothetical protein Csa_2G279200                       288   1e-79   
gb|KDP31958.1|  hypothetical protein JCGZ_12419                         287   1e-79   
ref|XP_004149692.1|  PREDICTED: LOW QUALITY PROTEIN: histone-lysi...    287   1e-79   
ref|XP_010652797.1|  PREDICTED: histone-lysine N-methyltransferas...    287   1e-79   
ref|XP_010263481.1|  PREDICTED: histone-lysine N-methyltransferas...    287   1e-79   
ref|XP_010652795.1|  PREDICTED: histone-lysine N-methyltransferas...    287   1e-79   
ref|XP_010652796.1|  PREDICTED: histone-lysine N-methyltransferas...    287   1e-79   
ref|XP_009621002.1|  PREDICTED: histone-lysine N-methyltransferas...    286   2e-79   
ref|XP_009621000.1|  PREDICTED: histone-lysine N-methyltransferas...    287   2e-79   
ref|XP_011043519.1|  PREDICTED: histone-lysine N-methyltransferas...    286   2e-79   
dbj|BAC84951.1|  PHCLF2                                                 286   3e-79   Petunia x hybrida [garden petunia]
ref|XP_009795142.1|  PREDICTED: histone-lysine N-methyltransferas...    286   3e-79   
ref|XP_010270355.1|  PREDICTED: histone-lysine N-methyltransferas...    286   4e-79   
ref|XP_010270364.1|  PREDICTED: histone-lysine N-methyltransferas...    285   5e-79   
gb|ADD60709.1|  putative polycomb protein EZ1                           285   5e-79   Oryza brachyantha
ref|XP_011008519.1|  PREDICTED: histone-lysine N-methyltransferas...    285   6e-79   
ref|XP_006656878.1|  PREDICTED: histone-lysine N-methyltransferas...    285   6e-79   
ref|XP_011008520.1|  PREDICTED: histone-lysine N-methyltransferas...    285   6e-79   
ref|XP_007047320.1|  SET domain-containing protein isoform 4            286   7e-79   
ref|XP_004511910.1|  PREDICTED: histone-lysine N-methyltransferas...    284   8e-79   
ref|XP_006404821.1|  hypothetical protein EUTSA_v10000037mg             285   8e-79   
ref|NP_179919.1|  histone-lysine N-methyltransferase CLF                284   1e-78   Arabidopsis thaliana [mouse-ear cress]
dbj|BAH36888.1|  Polycomb group protein                                 261   1e-78   
gb|KHN36244.1|  Histone-lysine N-methyltransferase CLF                  283   1e-78   
gb|EPS61713.1|  hypothetical protein M569_13078                         284   1e-78   
ref|XP_006361736.1|  PREDICTED: histone-lysine N-methyltransferas...    283   1e-78   
gb|ADD60685.1|  putative polycomb protein EZ1                           283   2e-78   Oryza australiensis
ref|XP_002307273.2|  Polycomb group protein CURLY LEAF                  284   2e-78   Populus trichocarpa [western balsam poplar]
gb|ADD60698.1|  putative polycomb protein EZ1                           283   2e-78   Oryza officinalis
ref|XP_010259296.1|  PREDICTED: histone-lysine N-methyltransferas...    280   2e-78   
ref|NP_001057379.1|  Os06g0275500                                       283   2e-78   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010429289.1|  PREDICTED: histone-lysine N-methyltransferas...    282   3e-78   
gb|ADD60673.1|  putative polycomb protein EZ1                           283   3e-78   Oryza granulata
ref|XP_010472335.1|  PREDICTED: histone-lysine N-methyltransferas...    283   3e-78   
ref|XP_006361735.1|  PREDICTED: histone-lysine N-methyltransferas...    283   3e-78   
gb|KHN42097.1|  Histone-lysine N-methyltransferase CLF                  282   3e-78   
ref|XP_010932044.1|  PREDICTED: histone-lysine N-methyltransferas...    283   3e-78   
ref|XP_006295423.1|  hypothetical protein CARUB_v10024520mg             283   4e-78   
gb|ADU32891.1|  enhancer of zeste1 protein                              283   4e-78   
gb|AIC33179.1|  enhancer of zeste-like protein                          283   4e-78   
ref|XP_010419281.1|  PREDICTED: histone-lysine N-methyltransferas...    281   4e-78   
ref|XP_010429288.1|  PREDICTED: histone-lysine N-methyltransferas...    282   5e-78   
ref|XP_010259293.1|  PREDICTED: histone-lysine N-methyltransferas...    282   5e-78   
ref|XP_010932045.1|  PREDICTED: histone-lysine N-methyltransferas...    283   5e-78   
ref|XP_008799009.1|  PREDICTED: histone-lysine N-methyltransferas...    283   6e-78   
ref|XP_006850490.1|  hypothetical protein AMTR_s00035p00184080          283   6e-78   
ref|XP_008799008.1|  PREDICTED: histone-lysine N-methyltransferas...    283   6e-78   
ref|XP_002437898.1|  hypothetical protein SORBIDRAFT_10g004560          283   6e-78   Sorghum bicolor [broomcorn]
gb|ACV53437.1|  enhancer of zeste-like protein 1                        282   6e-78   Sorghum bicolor [broomcorn]
ref|XP_006840562.1|  hypothetical protein AMTR_s00045p00224440          282   9e-78   
ref|XP_002878682.1|  hypothetical protein ARALYDRAFT_481208             281   9e-78   
emb|CAA71599.1|  curly leaf                                             281   1e-77   Arabidopsis thaliana [mouse-ear cress]
gb|EEE65516.1|  hypothetical protein OsJ_20958                          283   1e-77   Oryza sativa Japonica Group [Japonica rice]
gb|EEC80388.1|  hypothetical protein OsI_22514                          283   1e-77   Oryza sativa Indica Group [Indian rice]
ref|NP_001105078.1|  histone-lysine N-methyltransferase EZ1             281   2e-77   Zea mays [maize]
ref|XP_008648283.1|  PREDICTED: histone-lysine N-methyltransferas...    281   2e-77   
gb|AAR31181.1|  enhancer of zeste-like 1                                281   2e-77   Zea mays [maize]
gb|ACN26587.1|  unknown                                                 264   2e-77   Zea mays [maize]
ref|XP_004964752.1|  PREDICTED: histone-lysine N-methyltransferas...    281   3e-77   
ref|XP_010938257.1|  PREDICTED: histone-lysine N-methyltransferas...    277   3e-77   
ref|XP_004964751.1|  PREDICTED: histone-lysine N-methyltransferas...    281   4e-77   
ref|XP_010927438.1|  PREDICTED: LOW QUALITY PROTEIN: histone-lysi...    280   4e-77   
ref|XP_009386332.1|  PREDICTED: histone-lysine N-methyltransferas...    280   4e-77   
ref|XP_009386334.1|  PREDICTED: histone-lysine N-methyltransferas...    280   4e-77   
ref|XP_009386333.1|  PREDICTED: histone-lysine N-methyltransferas...    280   5e-77   
ref|XP_009140462.1|  PREDICTED: histone-lysine N-methyltransferas...    280   5e-77   
gb|KFK32747.1|  histone-lysine n-methyltransferase clf                  279   8e-77   
ref|XP_001768188.1|  polycomb group protein                             255   8e-77   
ref|XP_006840446.1|  hypothetical protein AMTR_s00045p00168580          278   9e-77   
emb|CBI36953.3|  unnamed protein product                                265   1e-76   
ref|XP_004984614.1|  PREDICTED: histone-lysine N-methyltransferas...    275   1e-76   
gb|AEZ06400.1|  CLF-like protein                                        278   2e-76   
ref|XP_004984613.1|  PREDICTED: histone-lysine N-methyltransferas...    277   3e-76   
ref|XP_008454290.1|  PREDICTED: histone-lysine N-methyltransferas...    274   3e-76   
ref|XP_010938256.1|  PREDICTED: histone-lysine N-methyltransferas...    277   3e-76   
ref|XP_008776528.1|  PREDICTED: histone-lysine N-methyltransferas...    277   3e-76   
ref|XP_004984612.1|  PREDICTED: histone-lysine N-methyltransferas...    277   4e-76   
ref|XP_008813375.1|  PREDICTED: histone-lysine N-methyltransferas...    277   5e-76   
gb|KDO86989.1|  hypothetical protein CISIN_1g002895mg                   275   5e-76   
gb|KHG06300.1|  Histone-lysine N-methyltransferase CLF                  277   5e-76   
ref|XP_008454287.1|  PREDICTED: histone-lysine N-methyltransferas...    276   5e-76   
gb|KHG06299.1|  Histone-lysine N-methyltransferase CLF                  277   5e-76   
ref|XP_010227998.1|  PREDICTED: histone-lysine N-methyltransferas...    276   6e-76   
ref|XP_009416259.1|  PREDICTED: histone-lysine N-methyltransferas...    277   6e-76   
ref|XP_009416267.1|  PREDICTED: histone-lysine N-methyltransferas...    276   6e-76   
ref|XP_008454286.1|  PREDICTED: histone-lysine N-methyltransferas...    276   7e-76   
ref|XP_008454284.1|  PREDICTED: histone-lysine N-methyltransferas...    276   7e-76   
ref|XP_008454285.1|  PREDICTED: histone-lysine N-methyltransferas...    276   8e-76   
gb|KDO86988.1|  hypothetical protein CISIN_1g002895mg                   275   9e-76   
ref|XP_006444504.1|  hypothetical protein CICLE_v10018849mg             275   9e-76   
ref|XP_004164981.1|  PREDICTED: LOW QUALITY PROTEIN: histone-lysi...    275   1e-75   
gb|KDO86987.1|  hypothetical protein CISIN_1g002895mg                   274   1e-75   
gb|KGN52856.1|  hypothetical protein Csa_4G003700                       275   1e-75   
gb|AFW88591.1|  putative SET-domain containing protein family           268   1e-75   
ref|XP_004152222.1|  PREDICTED: histone-lysine N-methyltransferas...    275   2e-75   
ref|XP_002994616.1|  hypothetical protein SELMODRAFT_138884             274   2e-75   
ref|XP_006492341.1|  PREDICTED: histone-lysine N-methyltransferas...    275   2e-75   
ref|XP_002987466.1|  hypothetical protein SELMODRAFT_446978             274   2e-75   
ref|XP_002980071.1|  hypothetical protein SELMODRAFT_111860             273   2e-75   
ref|XP_008648300.1|  PREDICTED: histone-lysine N-methyltransferas...    271   3e-75   
ref|XP_011082418.1|  PREDICTED: histone-lysine N-methyltransferas...    270   4e-75   
ref|XP_010652245.1|  PREDICTED: histone-lysine N-methyltransferas...    271   5e-75   
ref|XP_011082416.1|  PREDICTED: histone-lysine N-methyltransferas...    271   8e-75   
tpg|DAA45021.1|  TPA: putative SET-domain containing protein family     273   9e-75   
ref|XP_008648292.1|  PREDICTED: histone-lysine N-methyltransferas...    273   9e-75   
ref|NP_001105079.1|  histone-lysine N-methyltransferase EZ3             273   9e-75   Zea mays [maize]
ref|XP_002465374.1|  hypothetical protein SORBIDRAFT_01g037450          273   1e-74   Sorghum bicolor [broomcorn]
gb|AHA56717.1|  EZ2                                                     272   1e-74   
ref|XP_002270605.1|  PREDICTED: histone-lysine N-methyltransferas...    273   2e-74   Vitis vinifera
ref|XP_006349182.1|  PREDICTED: histone-lysine N-methyltransferas...    271   2e-74   
ref|XP_010652244.1|  PREDICTED: histone-lysine N-methyltransferas...    272   2e-74   
ref|XP_010556692.1|  PREDICTED: histone-lysine N-methyltransferas...    272   2e-74   
ref|XP_010556694.1|  PREDICTED: histone-lysine N-methyltransferas...    272   2e-74   
gb|EPS72293.1|  hypothetical protein M569_02463                         259   2e-74   
gb|ABI94364.1|  enhancer of zeste 1                                     271   3e-74   Triticum monococcum [einkorn wheat]
ref|XP_010322207.1|  PREDICTED: EZ1 protein isoform X1                  270   4e-74   
ref|NP_001234760.1|  EZ1 protein                                        270   4e-74   
ref|XP_011042257.1|  PREDICTED: histone-lysine N-methyltransferas...    270   5e-74   
ref|XP_011042258.1|  PREDICTED: histone-lysine N-methyltransferas...    268   6e-74   
ref|XP_007051110.1|  Enhancer of zeste, ezh, putative isoform 1         271   6e-74   
ref|XP_007051111.1|  Enhancer of zeste, ezh, putative isoform 2         270   6e-74   
ref|XP_008659027.1|  PREDICTED: histone-lysine N-methyltransferas...    270   6e-74   
dbj|BAJ84922.1|  predicted protein                                      270   7e-74   
ref|XP_002302766.2|  hypothetical protein POPTR_0002s19670g             270   7e-74   Populus trichocarpa [western balsam poplar]
ref|XP_011042256.1|  PREDICTED: histone-lysine N-methyltransferas...    270   7e-74   
ref|XP_002320296.1|  Polycomb group protein MEDEA                       269   8e-74   Populus trichocarpa [western balsam poplar]
ref|XP_006339876.1|  PREDICTED: histone-lysine N-methyltransferas...    270   8e-74   
ref|XP_009783487.1|  PREDICTED: histone-lysine N-methyltransferas...    266   9e-74   
emb|CDY17381.1|  BnaA10g10150D                                          269   1e-73   
dbj|BAJ99573.1|  predicted protein                                      256   1e-73   
ref|XP_009604958.1|  PREDICTED: histone-lysine N-methyltransferas...    266   1e-73   
ref|XP_011042255.1|  PREDICTED: histone-lysine N-methyltransferas...    270   1e-73   
ref|XP_009111326.1|  PREDICTED: histone-lysine N-methyltransferas...    269   1e-73   
ref|XP_008659029.1|  PREDICTED: histone-lysine N-methyltransferas...    267   1e-73   
ref|XP_009604955.1|  PREDICTED: histone-lysine N-methyltransferas...    269   1e-73   
ref|XP_009604957.1|  PREDICTED: histone-lysine N-methyltransferas...    269   1e-73   
ref|XP_009604956.1|  PREDICTED: histone-lysine N-methyltransferas...    268   1e-73   
ref|XP_010456095.1|  PREDICTED: histone-lysine N-methyltransferas...    269   1e-73   
ref|XP_010456094.1|  PREDICTED: histone-lysine N-methyltransferas...    269   1e-73   
ref|XP_010456093.1|  PREDICTED: histone-lysine N-methyltransferas...    269   1e-73   
emb|CDY07102.1|  BnaCnng01170D                                          269   1e-73   
ref|XP_008659028.1|  PREDICTED: histone-lysine N-methyltransferas...    267   2e-73   
ref|XP_006396399.1|  hypothetical protein EUTSA_v10028423mg             268   2e-73   
ref|XP_009783486.1|  PREDICTED: histone-lysine N-methyltransferas...    268   2e-73   
ref|XP_002874946.1|  swinger                                            268   2e-73   
emb|CDY22021.1|  BnaA09g00500D                                          268   2e-73   
ref|XP_006396400.1|  hypothetical protein EUTSA_v10028423mg             268   2e-73   
ref|XP_009783485.1|  PREDICTED: histone-lysine N-methyltransferas...    268   2e-73   
ref|XP_008659026.1|  PREDICTED: histone-lysine N-methyltransferas...    269   2e-73   
ref|XP_010422654.1|  PREDICTED: histone-lysine N-methyltransferas...    268   2e-73   
gb|EYU46811.1|  hypothetical protein MIMGU_mgv1a002769mg                264   2e-73   
ref|XP_010422656.1|  PREDICTED: histone-lysine N-methyltransferas...    268   2e-73   
ref|NP_001105650.1|  histone-lysine N-methyltransferase EZ2             269   2e-73   Zea mays [maize]
gb|KDO86985.1|  hypothetical protein CISIN_1g002895mg                   268   3e-73   
ref|XP_006651312.1|  PREDICTED: histone-lysine N-methyltransferas...    269   3e-73   
ref|NP_567221.1|  histone-lysine N-methyltransferase EZA1               268   3e-73   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009346619.1|  PREDICTED: histone-lysine N-methyltransferas...    264   3e-73   
ref|XP_010228709.1|  PREDICTED: histone-lysine N-methyltransferas...    266   4e-73   
ref|XP_010429047.1|  PREDICTED: histone-lysine N-methyltransferas...    268   5e-73   
ref|XP_010429044.1|  PREDICTED: histone-lysine N-methyltransferas...    268   5e-73   
ref|XP_010429054.1|  PREDICTED: histone-lysine N-methyltransferas...    267   5e-73   
gb|AAC78694.1|  putative curlyleaf-like 1 homeotic protein              268   5e-73   Arabidopsis thaliana [mouse-ear cress]
emb|CDY38942.1|  BnaA04g13630D                                          268   6e-73   
gb|ABK41491.1|  swinger                                                 267   8e-73   Arabidopsis lyrata subsp. lyrata
ref|XP_007145145.1|  hypothetical protein PHAVU_007G213900g             266   9e-73   
ref|XP_002515279.1|  enhancer of zeste, ezh, putative                   267   9e-73   Ricinus communis
ref|XP_008235145.1|  PREDICTED: histone-lysine N-methyltransferas...    265   9e-73   
ref|XP_009346618.1|  PREDICTED: histone-lysine N-methyltransferas...    266   1e-72   
ref|NP_001289854.1|  histone-lysine N-methyltransferase CLF-like        266   1e-72   
dbj|BAC84952.1|  PHCLF3                                                 266   1e-72   Petunia x hybrida [garden petunia]
ref|XP_006588568.1|  PREDICTED: histone-lysine N-methyltransferas...    265   1e-72   
ref|XP_006588566.1|  PREDICTED: histone-lysine N-methyltransferas...    266   2e-72   
ref|XP_006588563.1|  PREDICTED: histone-lysine N-methyltransferas...    266   2e-72   
ref|XP_006588565.1|  PREDICTED: histone-lysine N-methyltransferas...    266   2e-72   
ref|XP_006588564.1|  PREDICTED: histone-lysine N-methyltransferas...    266   2e-72   
ref|XP_003535927.1|  PREDICTED: histone-lysine N-methyltransferas...    266   2e-72   
ref|XP_003519745.1|  PREDICTED: histone-lysine N-methyltransferas...    266   2e-72   
ref|XP_008235144.1|  PREDICTED: histone-lysine N-methyltransferas...    266   2e-72   
ref|XP_010315972.1|  PREDICTED: histone-lysine N-methyltransferas...    265   2e-72   
ref|XP_010315973.1|  PREDICTED: histone-lysine N-methyltransferas...    265   2e-72   
ref|XP_010315966.1|  PREDICTED: histone-lysine N-methyltransferas...    265   3e-72   
ref|XP_009378727.1|  PREDICTED: histone-lysine N-methyltransferas...    261   7e-72   
gb|EMS47378.1|  Histone-lysine N-methyltransferase EZ1                  263   8e-72   
emb|CDX89569.1|  BnaC04g35880D                                          265   8e-72   
gb|EEC75093.1|  hypothetical protein OsI_11249                          260   9e-72   Oryza sativa Indica Group [Indian rice]
ref|XP_008386718.1|  PREDICTED: histone-lysine N-methyltransferas...    260   1e-71   
gb|AAN01115.1|AF407010_1  SET domain-containing protein                 264   1e-71   Oryza sativa [red rice]
ref|XP_004495901.1|  PREDICTED: histone-lysine N-methyltransferas...    263   1e-71   
ref|XP_009378725.1|  PREDICTED: histone-lysine N-methyltransferas...    263   1e-71   
ref|XP_009378726.1|  PREDICTED: histone-lysine N-methyltransferas...    261   2e-71   
ref|XP_008386717.1|  PREDICTED: histone-lysine N-methyltransferas...    262   2e-71   
ref|NP_001049899.1|  Os03g0307800                                       262   5e-71   Oryza sativa Japonica Group [Japonica rice]
emb|CAD18871.3|  enhancer of zeste protein                              262   7e-71   Oryza sativa Indica Group [Indian rice]
emb|CDP17065.1|  unnamed protein product                                261   9e-71   
gb|KHN30637.1|  Histone-lysine N-methyltransferase EZA1                 261   1e-70   
gb|KHN08633.1|  Histone-lysine N-methyltransferase EZA1                 261   1e-70   
gb|KEH43199.1|  histone-lysine N-methyltransferase                      256   1e-70   
gb|KEH43197.1|  histone-lysine N-methyltransferase                      257   4e-70   
gb|KEH43204.1|  histone-lysine N-methyltransferase                      258   5e-70   
gb|AES61647.2|  histone-lysine N-methyltransferase                      258   5e-70   
ref|XP_003591396.1|  Histone-lysine N-methyltransferase EZA1            258   5e-70   
gb|KEH43196.1|  histone-lysine N-methyltransferase                      258   5e-70   
gb|KEH43202.1|  histone-lysine N-methyltransferase                      258   5e-70   
gb|KEH43200.1|  histone-lysine N-methyltransferase                      256   8e-70   
ref|XP_006590684.1|  PREDICTED: LOW QUALITY PROTEIN: histone-lysi...    234   1e-69   
ref|XP_007156927.1|  hypothetical protein PHAVU_002G029000g             236   1e-69   
gb|KHG24721.1|  Histone-lysine N-methyltransferase EZA1 -like pro...    258   2e-69   
ref|XP_004515047.1|  PREDICTED: histone-lysine N-methyltransferas...    246   3e-69   
ref|XP_004300446.1|  PREDICTED: histone-lysine N-methyltransferas...    256   4e-69   
ref|XP_011041152.1|  PREDICTED: LOW QUALITY PROTEIN: histone-lysi...    256   8e-69   
ref|XP_007199000.1|  hypothetical protein PRUPE_ppa001254mg             254   2e-68   
ref|XP_010679389.1|  PREDICTED: histone-lysine N-methyltransferas...    251   1e-67   
ref|XP_010679391.1|  PREDICTED: histone-lysine N-methyltransferas...    251   1e-67   
ref|XP_010679390.1|  PREDICTED: histone-lysine N-methyltransferas...    251   1e-67   
ref|XP_003520774.2|  PREDICTED: histone-lysine N-methyltransferas...    229   6e-67   
gb|EMS49760.1|  Histone-lysine N-methyltransferase EZ1                  231   3e-66   
gb|AEZ06401.1|  SWN-like protein                                        246   5e-66   
ref|XP_004494933.1|  PREDICTED: histone-lysine N-methyltransferas...    243   1e-65   
gb|KDO79171.1|  hypothetical protein CISIN_1g0024181mg                  241   4e-65   
gb|EMT18431.1|  hypothetical protein F775_02572                         243   6e-65   
ref|XP_006605249.1|  PREDICTED: histone-lysine N-methyltransferas...    224   8e-65   
gb|EMT31844.1|  Histone-lysine N-methyltransferase EZ1                  220   1e-64   
ref|XP_010259294.1|  PREDICTED: histone-lysine N-methyltransferas...    238   3e-63   
ref|XP_003622867.1|  Histone-lysine N-methyltransferase EZ2             226   6e-63   
gb|EYU44418.1|  hypothetical protein MIMGU_mgv1a001364mg                238   7e-63   
gb|AES82191.2|  histone-lysine N-methyltransferase                      221   2e-62   
ref|XP_003625973.1|  MEDEA                                              221   2e-62   
ref|XP_010069836.1|  PREDICTED: histone-lysine N-methyltransferas...    236   5e-62   
gb|AES79083.2|  histone-lysine N-methyltransferase                      232   2e-61   
ref|XP_007163181.1|  hypothetical protein PHAVU_001G213300g             216   2e-61   
gb|KFK44937.1|  hypothetical protein AALP_AA1G322200                    215   2e-59   
gb|ACN86208.1|  MEDEA                                                   219   1e-58   Arabidopsis halleri subsp. halleri
gb|ACN86198.1|  MEDEA                                                   219   3e-58   Arabidopsis lyrata subsp. petraea
emb|CDP02511.1|  unnamed protein product                                224   3e-58   
gb|ACN86200.1|  MEDEA                                                   219   3e-58   
gb|ABS87920.1|  MEDEA                                                   219   3e-58   
gb|ABS32093.1|  MEDEA                                                   219   3e-58   
gb|ACN86199.1|  MEDEA                                                   219   3e-58   
gb|ACN86205.1|  MEDEA                                                   219   3e-58   
gb|ABS32089.1|  MEDEA                                                   219   3e-58   
gb|ABS32082.1|  MEDEA                                                   219   3e-58   
gb|ACN86197.1|  MEDEA                                                   219   3e-58   
gb|ABS32100.1|  MEDEA                                                   219   3e-58   
gb|ABS32103.1|  MEDEA                                                   219   4e-58   
gb|ACN86194.1|  MEDEA                                                   218   4e-58   
gb|ABS87924.1|  MEDEA                                                   218   4e-58   
gb|ABS87922.1|  MEDEA                                                   218   4e-58   
gb|ABS32099.1|  MEDEA                                                   218   4e-58   
gb|ABS87928.1|  MEDEA                                                   218   4e-58   
gb|ACN86206.1|  MEDEA                                                   218   4e-58   
gb|ABS32080.1|  MEDEA                                                   218   4e-58   
gb|ABS32098.1|  MEDEA                                                   218   4e-58   
gb|ABS87927.1|  MEDEA                                                   218   4e-58   
gb|ABS32095.1|  MEDEA                                                   218   4e-58   
gb|ACN86203.1|  MEDEA                                                   218   4e-58   
gb|ABS32054.1|  MEDEA                                                   218   4e-58   
gb|ABS87923.1|  MEDEA                                                   218   4e-58   
gb|ACN86183.1|  MEDEA                                                   218   4e-58   
gb|ACN86195.1|  MEDEA                                                   218   4e-58   
gb|ACN86191.1|  MEDEA                                                   218   4e-58   
gb|ABS87921.1|  MEDEA                                                   218   4e-58   
gb|ABS32068.1|  MEDEA                                                   218   4e-58   
gb|ABS32090.1|  MEDEA                                                   218   4e-58   
gb|ABK41492.1|  medea                                                   218   4e-58   
gb|ABS32075.1|  MEDEA                                                   218   4e-58   
gb|ACN86188.1|  MEDEA                                                   218   4e-58   
gb|ABS32076.1|  MEDEA                                                   218   4e-58   
gb|ACN86202.1|  MEDEA                                                   218   4e-58   
gb|ACN86187.1|  MEDEA                                                   218   4e-58   
gb|ABS32084.1|  MEDEA                                                   218   5e-58   
gb|ABS32094.1|  MEDEA                                                   218   5e-58   
gb|ABS32096.1|  MEDEA                                                   218   5e-58   
gb|ABS32101.1|  MEDEA                                                   218   5e-58   
gb|ABS32086.1|  MEDEA                                                   218   5e-58   
gb|ABS32081.1|  MEDEA                                                   218   5e-58   
gb|ACN86196.1|  MEDEA                                                   218   5e-58   
gb|ABS32073.1|  MEDEA                                                   218   5e-58   
gb|ABS32097.1|  MEDEA                                                   218   5e-58   
gb|ABS32078.1|  MEDEA                                                   218   5e-58   
gb|ABS32079.1|  MEDEA                                                   218   5e-58   
gb|ABS32087.1|  MEDEA                                                   218   5e-58   
gb|ABS32074.1|  MEDEA                                                   218   6e-58   
gb|ABS32077.1|  MEDEA                                                   218   6e-58   
gb|ABS32088.1|  MEDEA                                                   218   6e-58   
ref|XP_006418325.1|  hypothetical protein EUTSA_v10009931mg             211   9e-58   
gb|ACN86180.1|  MEDEA                                                   215   9e-58   
gb|ACN86190.1|  MEDEA                                                   217   1e-57   
gb|ACN86185.1|  MEDEA                                                   217   1e-57   
gb|ACN86192.1|  MEDEA                                                   217   1e-57   
gb|ACN86189.1|  MEDEA                                                   217   1e-57   
gb|ACN86184.1|  MEDEA                                                   217   1e-57   
gb|ABS32063.1|  MEDEA                                                   217   1e-57   
gb|ABS32062.1|  MEDEA                                                   217   1e-57   
gb|ABS32057.1|  MEDEA                                                   217   1e-57   
gb|ABS32055.1|  MEDEA                                                   217   1e-57   
gb|ACN86186.1|  MEDEA                                                   217   1e-57   
gb|ABS87910.1|  MEDEA                                                   217   1e-57   
ref|XP_002889408.1|  hypothetical protein ARALYDRAFT_470218             217   1e-57   
gb|ACN86175.1|  MEDEA                                                   215   1e-57   
gb|ABS87913.1|  MEDEA                                                   216   1e-57   
gb|ACN86176.1|  MEDEA                                                   214   2e-57   
gb|ACN86193.1|  MEDEA                                                   216   2e-57   
ref|NP_563658.1|  histone-lysine N-methyltransferase MEDEA              214   2e-57   
gb|ACN86181.1|  MEDEA                                                   214   2e-57   
gb|ACN86171.1|  MEDEA                                                   214   2e-57   
gb|ACN86177.1|  MEDEA                                                   214   2e-57   
gb|ACN86179.1|  MEDEA                                                   214   2e-57   
gb|ACN86201.1|  MEDEA                                                   215   3e-57   
ref|XP_006306314.1|  hypothetical protein CARUB_v10012183mg             202   4e-55   
ref|XP_003059747.1|  set domain protein                                 189   9e-55   
ref|XP_010457241.1|  PREDICTED: histone-lysine N-methyltransferas...    204   1e-54   
ref|XP_010501285.1|  PREDICTED: LOW QUALITY PROTEIN: histone-lysi...    202   7e-54   
ref|XP_010480318.1|  PREDICTED: histone-lysine N-methyltransferas...    201   1e-53   
gb|KFK42616.1|  medea                                                   196   3e-53   
ref|XP_010109789.1|  hypothetical protein L484_005764                   204   1e-52   
gb|ACN86209.1|  MEDEA                                                   201   1e-51   
ref|XP_006494450.1|  PREDICTED: histone-lysine N-methyltransferas...    202   2e-51   
ref|XP_005647363.1|  enhancer of zeste 2                                179   4e-51   
gb|KCW58325.1|  hypothetical protein EUGRSUZ_H01011                     198   2e-50   
gb|KCW58324.1|  hypothetical protein EUGRSUZ_H01011                     200   2e-50   
ref|XP_007047322.1|  SET domain-containing protein isoform 6            197   7e-50   
ref|XP_007047321.1|  SET domain-containing protein isoform 5            198   8e-50   
gb|KFK30781.1|  swinger                                                 166   3e-49   
gb|KCW59109.1|  hypothetical protein EUGRSUZ_H01730                     187   1e-48   
emb|CDX89960.1|  BnaA10g01220D                                          183   1e-48   
ref|XP_006088763.1|  PREDICTED: histone-lysine N-methyltransferas...    175   2e-48   
ref|XP_009119777.1|  PREDICTED: histone-lysine N-methyltransferas...    182   3e-48   
ref|XP_006088761.1|  PREDICTED: histone-lysine N-methyltransferas...    174   4e-48   
ref|XP_006088766.1|  PREDICTED: histone-lysine N-methyltransferas...    174   4e-48   
ref|XP_005862884.1|  PREDICTED: histone-lysine N-methyltransferas...    174   4e-48   
ref|XP_006777222.1|  PREDICTED: histone-lysine N-methyltransferas...    173   1e-47   
ref|XP_006777225.1|  PREDICTED: histone-lysine N-methyltransferas...    173   2e-47   
ref|XP_006577727.1|  PREDICTED: histone-lysine N-methyltransferas...    187   2e-47   
ref|XP_006777226.1|  PREDICTED: histone-lysine N-methyltransferas...    173   3e-47   
ref|XP_006777220.1|  PREDICTED: histone-lysine N-methyltransferas...    172   3e-47   
ref|XP_006777224.1|  PREDICTED: histone-lysine N-methyltransferas...    172   3e-47   
ref|XP_008922171.1|  PREDICTED: histone-lysine N-methyltransferas...    174   4e-47   
ref|XP_001622422.1|  predicted protein                                  171   6e-47   
gb|KFW81023.1|  Histone-lysine N-methyltransferase EZH1                 173   7e-47   
ref|XP_790741.3|  PREDICTED: histone-lysine N-methyltransferase E...    176   1e-46   
gb|EFB29049.1|  hypothetical protein PANDA_013054                       176   2e-46   
gb|EKC36964.1|  Histone-lysine N-methyltransferase E(z)                 187   2e-46   
ref|XP_004772148.1|  PREDICTED: histone-lysine N-methyltransferas...    174   3e-46   
ref|XP_005011335.1|  PREDICTED: histone-lysine N-methyltransferas...    175   3e-46   
gb|EOB07356.1|  Polycomb protein EZH2                                   175   3e-46   
ref|XP_006777230.1|  PREDICTED: histone-lysine N-methyltransferas...    174   3e-46   
ref|XP_005011330.1|  PREDICTED: histone-lysine N-methyltransferas...    175   4e-46   
ref|XP_001422533.1|  predicted protein                                  168   4e-46   
ref|XP_006777229.1|  PREDICTED: histone-lysine N-methyltransferas...    174   4e-46   
ref|XP_005011328.1|  PREDICTED: histone-lysine N-methyltransferas...    175   4e-46   
ref|XP_005011331.1|  PREDICTED: histone-lysine N-methyltransferas...    175   4e-46   
ref|XP_005011327.1|  PREDICTED: histone-lysine N-methyltransferas...    175   4e-46   
gb|ETE63954.1|  Histone-lysine N-methyltransferase EZH2                 174   7e-46   
ref|XP_001947303.2|  PREDICTED: histone-lysine N-methyltransferas...    185   8e-46   
ref|XP_005394529.1|  PREDICTED: histone-lysine N-methyltransferas...    172   8e-46   
ref|XP_010735411.1|  PREDICTED: histone-lysine N-methyltransferas...    176   9e-46   
emb|CBY32127.1|  unnamed protein product                                169   1e-45   
emb|CBY33596.1|  unnamed protein product                                169   1e-45   
emb|CDY15252.1|  BnaC05g01310D                                          179   2e-45   
ref|XP_008010797.1|  PREDICTED: histone-lysine N-methyltransferas...    170   2e-45   
ref|XP_007102183.1|  PREDICTED: histone-lysine N-methyltransferas...    182   3e-45   
ref|XP_004859889.1|  PREDICTED: histone-lysine N-methyltransferas...    170   4e-45   
ref|XP_007509828.1|  PREDICTED: histone-lysine N-methyltransferas...    168   5e-45   
gb|EMS65861.1|  Histone-lysine N-methyltransferase EZ3                  175   6e-45   
gb|AFK81061.1|  EZH2                                                    172   7e-45   
emb|CBY12204.1|  unnamed protein product                                166   1e-44   
pdb|4MI0|A  Chain A, Human Enhancer Of Zeste (drosophila) Homolog...    171   1e-44   
ref|XP_010171989.1|  PREDICTED: histone-lysine N-methyltransferas...    172   1e-44   
emb|CDY37467.1|  BnaC08g46050D                                          175   1e-44   
ref|XP_001663184.1|  enhancer of zeste, ezh                             181   2e-44   
gb|ABS87935.1|  MEDEA                                                   179   2e-44   
gb|ABS87930.1|  MEDEA                                                   179   2e-44   
ref|XP_001663394.1|  enhancer of zeste, ezh                             181   2e-44   
gb|ABS87929.1|  MEDEA                                                   179   2e-44   
gb|ABS87942.1|  MEDEA                                                   179   2e-44   
ref|XP_009873589.1|  PREDICTED: histone-lysine N-methyltransferas...    172   2e-44   
pdb|4MI5|A  Chain A, Crystal Structure Of The Ezh2 Set Domain           171   2e-44   
gb|ABS87938.1|  MEDEA                                                   179   2e-44   
gb|ABS87931.1|  MEDEA                                                   179   2e-44   
ref|XP_010121553.1|  PREDICTED: histone-lysine N-methyltransferas...    171   2e-44   
gb|ABS87911.1|  MEDEA                                                   179   3e-44   
gb|ABS87912.1|  MEDEA                                                   179   3e-44   
ref|XP_010206893.1|  PREDICTED: histone-lysine N-methyltransferas...    174   3e-44   
ref|XP_005494454.1|  PREDICTED: histone-lysine N-methyltransferas...    174   3e-44   
ref|XP_010767827.1|  PREDICTED: histone-lysine N-methyltransferas...    170   3e-44   
ref|XP_009925093.1|  PREDICTED: histone-lysine N-methyltransferas...    173   3e-44   
ref|XP_001848357.1|  polycomb protein E(z)                              181   4e-44   
gb|ABI34878.1|  enhancer of zeste 2                                     169   4e-44   
gb|EFX90346.1|  hypothetical protein DAPPUDRAFT_300071                  181   4e-44   
ref|XP_007957411.1|  PREDICTED: histone-lysine N-methyltransferas...    175   4e-44   
emb|CDQ85039.1|  unnamed protein product                                170   5e-44   
ref|XP_003222404.1|  PREDICTED: histone-lysine N-methyltransferas...    180   5e-44   
ref|XP_001811652.1|  PREDICTED: histone-lysine N-methyltransferas...    179   6e-44   
gb|KFB43971.1|  AGAP012516-PA-like protein                              180   6e-44   
ref|XP_001984575.1|  GH16544                                            180   6e-44   
ref|XP_002427089.1|  enhancer of zeste, ezh, putative                   179   6e-44   
ref|XP_002069056.1|  GK12358                                            180   7e-44   
ref|XP_007617020.1|  PREDICTED: histone-lysine N-methyltransferas...    170   1e-43   
ref|XP_307419.2|  Anopheles gambiae str. PEST AGAP012516-PA             179   1e-43   
ref|XP_002009050.1|  GI13833                                            179   1e-43   
ref|XP_006505590.1|  PREDICTED: histone-lysine N-methyltransferas...    176   1e-43   
ref|XP_009487411.1|  PREDICTED: histone-lysine N-methyltransferas...    174   1e-43   
ref|XP_010079381.1|  PREDICTED: histone-lysine N-methyltransferas...    169   1e-43   
ref|XP_008294300.1|  PREDICTED: histone-lysine N-methyltransferas...    169   1e-43   
ref|XP_007432054.1|  PREDICTED: histone-lysine N-methyltransferas...    179   1e-43   
ref|XP_006505592.1|  PREDICTED: histone-lysine N-methyltransferas...    176   1e-43   
gb|ABS87933.1|  MEDEA                                                   177   1e-43   
gb|ABS87944.1|  MEDEA                                                   177   1e-43   
ref|XP_004523770.1|  PREDICTED: histone-lysine N-methyltransferas...    178   1e-43   
ref|XP_004523768.1|  PREDICTED: histone-lysine N-methyltransferas...    179   2e-43   
ref|XP_004523769.1|  PREDICTED: histone-lysine N-methyltransferas...    178   2e-43   
ref|XP_002047854.1|  GJ11699                                            178   2e-43   
ref|XP_005184703.1|  PREDICTED: histone-lysine N-methyltransferas...    179   2e-43   
gb|ENN78407.1|  hypothetical protein YQE_05207                          178   2e-43   
gb|ETE65535.1|  Histone-lysine N-methyltransferase EZH1                 178   2e-43   
ref|XP_004523767.1|  PREDICTED: histone-lysine N-methyltransferas...    178   2e-43   
emb|CAA64955.1|  enhancer of zeste                                      178   2e-43   
ref|XP_005184702.1|  PREDICTED: histone-lysine N-methyltransferas...    178   2e-43   
ref|XP_001957822.1|  GF23825                                            178   3e-43   
ref|XP_008695496.1|  PREDICTED: histone-lysine N-methyltransferas...    176   3e-43   
ref|XP_001353780.1|  GA19644                                            177   3e-43   
ref|XP_002026522.1|  GL15590                                            177   3e-43   
ref|XP_005096267.1|  PREDICTED: histone-lysine N-methyltransferas...    177   4e-43   
ref|XP_002030006.1|  GM24804                                            177   4e-43   
ref|XP_002932548.2|  PREDICTED: histone-lysine N-methyltransferas...    177   4e-43   
ref|XP_010735410.1|  PREDICTED: histone-lysine N-methyltransferas...    177   4e-43   
ref|XP_006139944.1|  PREDICTED: histone-lysine N-methyltransferas...    177   4e-43   
ref|XP_002094312.1|  GE20265                                            177   4e-43   
ref|XP_008573326.1|  PREDICTED: histone-lysine N-methyltransferas...    176   4e-43   
ref|XP_010291743.1|  PREDICTED: histone-lysine N-methyltransferas...    175   5e-43   
ref|XP_005429635.1|  PREDICTED: histone-lysine N-methyltransferas...    177   5e-43   
ref|XP_006139945.1|  PREDICTED: histone-lysine N-methyltransferas...    176   5e-43   
ref|XP_001972290.1|  GG13968                                            177   5e-43   
gb|AAC46462.1|  E(z)                                                    177   5e-43   
gb|ERL93287.1|  hypothetical protein D910_10583                         179   5e-43   
ref|NP_524021.2|  enhancer of zeste, isoform A                          177   5e-43   
ref|XP_008573325.1|  PREDICTED: histone-lysine N-methyltransferas...    176   5e-43   
ref|XP_008573324.1|  PREDICTED: histone-lysine N-methyltransferas...    176   5e-43   
ref|XP_008573323.1|  PREDICTED: histone-lysine N-methyltransferas...    176   5e-43   
ref|XP_006139946.1|  PREDICTED: histone-lysine N-methyltransferas...    176   5e-43   
ref|XP_003270929.1|  PREDICTED: histone-lysine N-methyltransferas...    177   5e-43   
ref|XP_007090924.1|  PREDICTED: histone-lysine N-methyltransferas...    177   5e-43   
ref|XP_005087561.1|  PREDICTED: histone-lysine N-methyltransferas...    177   5e-43   
ref|XP_007090926.1|  PREDICTED: histone-lysine N-methyltransferas...    177   5e-43   
ref|XP_004320415.1|  PREDICTED: histone-lysine N-methyltransferas...    177   5e-43   
gb|KFQ81235.1|  Histone-lysine N-methyltransferase EZH2                 175   5e-43   
gb|ELR47934.1|  Histone-lysine N-methyltransferase EZH2                 176   5e-43   
ref|XP_004815167.1|  PREDICTED: histone-lysine N-methyltransferas...    177   5e-43   
ref|XP_004008207.1|  PREDICTED: histone-lysine N-methyltransferas...    176   5e-43   
ref|XP_007652665.1|  PREDICTED: histone-lysine N-methyltransferas...    177   5e-43   
ref|XP_005667822.1|  PREDICTED: enhancer of zeste homolog 2 isofo...    176   5e-43   
ref|NP_001261682.1|  enhancer of zeste, isoform C                       177   5e-43   
ref|XP_004772152.1|  PREDICTED: histone-lysine N-methyltransferas...    177   5e-43   
ref|XP_007090927.1|  PREDICTED: histone-lysine N-methyltransferas...    176   6e-43   
ref|XP_010009036.1|  PREDICTED: histone-lysine N-methyltransferas...    175   6e-43   



>ref|XP_008659030.1| PREDICTED: histone-lysine N-methyltransferase EZ2 isoform X5 
[Zea mays]
Length=623

 Score =   327 bits (837),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 213/511 (42%), Positives = 286/511 (56%), Gaps = 87/511 (17%)
 Frame = +1

Query  691   GDGSADLLAKRQTDAFDLQNSIGTGSGNKICSSQEDGYASSDL----RSSIVLKNAVCpi  858
             G+  +   A+RQ  + DL N IG      + S QE+  A+  L      +   +  V  +
Sbjct  87    GNALSQRAAERQCGS-DLANGIGE---RDVVSVQEENLATGTLALSSSGATAQRTIVRFV  142

Query  859   klpklekippYTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALi-csdsdeeiieeeg  1035
             KLP +EKIPPYTTW FL +NQ+M +DQSV+GRRRIYYD    EALI     +E    EE 
Sbjct  143   KLPLVEKIPPYTTWIFLDKNQRMADDQSVVGRRRIYYDTVGNEALICSDSDEEIPEPEEE  202

Query  1036  enefaesedYILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLIKEGATSKNENTE  1215
             ++ F + ED+++    +  GL   V+++L       PSE++ R + L ++       + +
Sbjct  203   KHFFTKGEDHLIWRATQDHGLNQEVVNVLCQFIGATPSEIEERSEVLFEKNEKHSGSSDK  262

Query  1216  VTINSYLDEDLDAALSSFDNLFCQRCF-------------VFNCQL--------------  1314
             +     LD+ +DA L SFDNLFC+RC              VF C+               
Sbjct  263   IESRLSLDKTMDAVLDSFDNLFCRRCLVFDCRLHGCSQNLVFPCEKQPYSFDPDENKKPC  322

Query  1315  -HGC---SQDL--------------------------IILKQIRVREELCAHYTPCNC*P  1404
              H C    QD+                           + K+    ++    Y+PC C  
Sbjct  323   GHLCYLREQDMAARTRIYRRRGRNRKLKYTWKSAGHPTVRKRTDDGKQCYTQYSPCACQQ  382

Query  1405  HCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKNECATNYCPCYASGRECDPDVCCF  1584
              CGK CPC  K   CEK+CGC  +CK  F+GCHC K++C +  CPC+A+ RECDPDVC  
Sbjct  383   MCGKDCPCADKGTCCEKYCGCSKSCKNKFRGCHCAKSQCRSRQCPCFAASRECDPDVCRN  442

Query  1585  CWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLLGRSDIAGWGAFLKNCVICVSKNE  1764
             CWVSCGDGS+G P  +   ++C NMKLLL  QQ++LLGRSD+AGWGAF+KN    V+KN+
Sbjct  443   CWVSCGDGSLGEPLARGDGYQCGNMKLLLKQQQRILLGRSDVAGWGAFIKN---PVNKND  499

Query  1765  FIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQLVIDAYRRGNKLKFINHSPDPNCF  1944
             ++G YTGELISH EADK GK+YDR N SFLF+LNDQ V+DAYR+G+KLKF NHS +PNC+
Sbjct  500   YLGEYTGELISHKEADKRGKIYDRANSSFLFDLNDQYVLDAYRKGDKLKFANHSSNPNCY  559

Query  1945  AKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
             AKV             ++VAG     DHR G
Sbjct  560   AKV-------------MLVAG-----DHRVG  572


 Score = 58.5 bits (140),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSK  2164
             +++V GDHR+GI+A + + A +EL YDY+Y PD  PAWA+  + S K
Sbjct  562   VMLVAGDHRVGIYAKEHIEASEELFYDYRYGPDQAPAWARRPEGSKK  608



>gb|AES94654.2| histone-lysine N-methyltransferase [Medicago truncatula]
Length=863

 Score =   283 bits (725),  Expect(2) = 1e-85, Method: Compositional matrix adjust.
 Identities = 131/207 (63%), Positives = 162/207 (78%), Gaps = 5/207 (2%)
 Frame = +1

Query  1339  ILKQIRVR-EELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKN  1515
             I K+I  R ++ C  Y PC C   CGK+CPC++    CEK+CGCP +CK  F+GCHC K+
Sbjct  598   IRKRITERKDQPCRQYNPCGCQSACGKECPCLLNGTCCEKYCGCPKSCKNRFRGCHCAKS  657

Query  1516  ECATNYCPCYASGRECDPDVCCFCWV-SCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVL  1692
             +C +  CPC+A+ RECDPDVC  CWV SCGDG++GIP  +  N++C+NMKLLL  QQKVL
Sbjct  658   QCRSRQCPCFAADRECDPDVCRNCWVSSCGDGTLGIPSQRGDNYECRNMKLLLKQQQKVL  717

Query  1693  LGRSDIAGWGAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQ  1872
             LGRSD++GWGAFLKN    V K+E++G YTGELISH EADK GK+YDR+N SFLFNLNDQ
Sbjct  718   LGRSDVSGWGAFLKN---SVGKHEYLGEYTGELISHREADKRGKIYDRENSSFLFNLNDQ  774

Query  1873  LVIDAYRRGNKLKFINHSPDPNCFAKV  1953
              V+DAYR+G+KLKF NHSP PNC+AKV
Sbjct  775   FVLDAYRKGDKLKFANHSPVPNCYAKV  801


 Score = 63.5 bits (153),  Expect(2) = 1e-85, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAK  2143
             +I+V GDHR+GIFA + +NAG+EL YDY+Y+PD  PAWA+
Sbjct  801   VIMVDGDHRVGIFAKERINAGEELFYDYRYEPDRAPAWAR  840


 Score =   174 bits (442),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 130/259 (50%), Positives = 170/259 (66%), Gaps = 31/259 (12%)
 Frame = +1

Query  694   DGSADLLAKRQTDAFDLQNSIGTGSGNKICSSQEDGYASSDLRSSIVL-------KNAVC  852
             D   DLL+KRQ +A D+ N I  G+ +     + +GY   D  S+ VL       KNAV 
Sbjct  90    DRGLDLLSKRQKEAIDMHNGIRAGNDD----GESNGYNGDDHGSTAVLLGSNYAVKNAVR  145

Query  853   piklpklekippYTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALi-csdsdeeiiee  1029
             PIKLP+++++PPYTTW FL RNQ+M EDQSV+GRRRIYYD N GEALI     +E I EE
Sbjct  146   PIKLPEVKRLPPYTTWIFLDRNQRMTEDQSVLGRRRIYYDQNGGEALICSDSEEELIDEE  205

Query  1030  egenefaesedYILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLIKE---GATSK  1200
             E + EF ESED+ILRMTI + GL D+VL++LA  FSRK S++K RY+    E   G  SK
Sbjct  206   EEKREFVESEDFILRMTIREFGLSDVVLEILAQCFSRKTSDIKVRYETFCNEDNSGEDSK  265

Query  1201  N----ENTEVTINSYLDEDLDAALSSFDNLFCQRCFVFNCQLHGCSQDLIILKQIRVREE  1368
             N    +N+++  +S+L++DL+AAL SFDNLFC+RC VF+C+LHGCSQDL+         E
Sbjct  266   NGDAQDNSQID-DSFLEKDLEAALDSFDNLFCRRCRVFDCRLHGCSQDLVFPA------E  318

Query  1369  LCAHYTPCN-----C*PHC  1410
                 +TP N     C P+C
Sbjct  319   RQPSWTPPNTEDVPCGPNC  337



>ref|XP_003611696.1| Histone-lysine N-methyltransferase CLF [Medicago truncatula]
Length=870

 Score =   283 bits (724),  Expect(2) = 2e-85, Method: Compositional matrix adjust.
 Identities = 131/207 (63%), Positives = 162/207 (78%), Gaps = 5/207 (2%)
 Frame = +1

Query  1339  ILKQIRVR-EELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKN  1515
             I K+I  R ++ C  Y PC C   CGK+CPC++    CEK+CGCP +CK  F+GCHC K+
Sbjct  605   IRKRITERKDQPCRQYNPCGCQSACGKECPCLLNGTCCEKYCGCPKSCKNRFRGCHCAKS  664

Query  1516  ECATNYCPCYASGRECDPDVCCFCWV-SCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVL  1692
             +C +  CPC+A+ RECDPDVC  CWV SCGDG++GIP  +  N++C+NMKLLL  QQKVL
Sbjct  665   QCRSRQCPCFAADRECDPDVCRNCWVSSCGDGTLGIPSQRGDNYECRNMKLLLKQQQKVL  724

Query  1693  LGRSDIAGWGAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQ  1872
             LGRSD++GWGAFLKN    V K+E++G YTGELISH EADK GK+YDR+N SFLFNLNDQ
Sbjct  725   LGRSDVSGWGAFLKN---SVGKHEYLGEYTGELISHREADKRGKIYDRENSSFLFNLNDQ  781

Query  1873  LVIDAYRRGNKLKFINHSPDPNCFAKV  1953
              V+DAYR+G+KLKF NHSP PNC+AKV
Sbjct  782   FVLDAYRKGDKLKFANHSPVPNCYAKV  808


 Score = 63.5 bits (153),  Expect(2) = 2e-85, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAK  2143
             +I+V GDHR+GIFA + +NAG+EL YDY+Y+PD  PAWA+
Sbjct  808   VIMVDGDHRVGIFAKERINAGEELFYDYRYEPDRAPAWAR  847


 Score =   174 bits (441),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 130/259 (50%), Positives = 170/259 (66%), Gaps = 31/259 (12%)
 Frame = +1

Query  694   DGSADLLAKRQTDAFDLQNSIGTGSGNKICSSQEDGYASSDLRSSIVL-------KNAVC  852
             D   DLL+KRQ +A D+ N I  G+ +     + +GY   D  S+ VL       KNAV 
Sbjct  90    DRGLDLLSKRQKEAIDMHNGIRAGNDD----GESNGYNGDDHGSTAVLLGSNYAVKNAVR  145

Query  853   piklpklekippYTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALi-csdsdeeiiee  1029
             PIKLP+++++PPYTTW FL RNQ+M EDQSV+GRRRIYYD N GEALI     +E I EE
Sbjct  146   PIKLPEVKRLPPYTTWIFLDRNQRMTEDQSVLGRRRIYYDQNGGEALICSDSEEELIDEE  205

Query  1030  egenefaesedYILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLIKE---GATSK  1200
             E + EF ESED+ILRMTI + GL D+VL++LA  FSRK S++K RY+    E   G  SK
Sbjct  206   EEKREFVESEDFILRMTIREFGLSDVVLEILAQCFSRKTSDIKVRYETFCNEDNSGEDSK  265

Query  1201  N----ENTEVTINSYLDEDLDAALSSFDNLFCQRCFVFNCQLHGCSQDLIILKQIRVREE  1368
             N    +N+++  +S+L++DL+AAL SFDNLFC+RC VF+C+LHGCSQDL+         E
Sbjct  266   NGDAQDNSQID-DSFLEKDLEAALDSFDNLFCRRCRVFDCRLHGCSQDLVFPA------E  318

Query  1369  LCAHYTPCN-----C*PHC  1410
                 +TP N     C P+C
Sbjct  319   RQPSWTPPNTEDVPCGPNC  337



>ref|XP_002523623.1| enhancer of zeste, ezh, putative [Ricinus communis]
 gb|EEF38818.1| enhancer of zeste, ezh, putative [Ricinus communis]
Length=371

 Score =   283 bits (724),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 138/234 (59%), Positives = 171/234 (73%), Gaps = 22/234 (9%)
 Frame = +1

Query  1339  ILKQIRVR-EELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKN  1515
             I K+I  R ++ C  Y PCNC   CGK+C C++    CEK+CGCP  CK  F+GCHC K+
Sbjct  107   IRKRITERKDQPCRQYNPCNCQTACGKQCACLLNGTCCEKYCGCPKTCKNRFRGCHCAKS  166

Query  1516  ECATNYCPCYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLL  1695
             +C +  CPC+A+ RECDPDVC  CWVSCGDGS+G+P  +  N++C+NMKLLL  QQ+VLL
Sbjct  167   QCRSRQCPCFAADRECDPDVCRNCWVSCGDGSLGVPNQRGDNYECRNMKLLLKQQQRVLL  226

Query  1696  GRSDIAGWGAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQL  1875
             GRSD++GWGAFLKN    V K+E++G YTGELISH EADK GK+YDR+N SFLFNLNDQ 
Sbjct  227   GRSDVSGWGAFLKN---SVGKHEYLGEYTGELISHREADKRGKIYDRENSSFLFNLNDQF  283

Query  1876  VIDAYRRGNKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
             V+DAYR+G+KLKF NHSPDPNC+AKV             ++VAG     DHR G
Sbjct  284   VLDAYRKGDKLKFANHSPDPNCYAKV-------------IMVAG-----DHRVG  319


 Score = 65.5 bits (158),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSKK  2167
             +I+V GDHR+GIFA + ++AG+EL YDY+Y+PD  PAWA+  ++S  K
Sbjct  309   VIMVAGDHRVGIFAKERISAGEELFYDYRYEPDRAPAWARKPEASGSK  356



>ref|XP_010070361.1| PREDICTED: histone-lysine N-methyltransferase CLF isoform X2 
[Eucalyptus grandis]
 gb|KCW59067.1| hypothetical protein EUGRSUZ_H01689 [Eucalyptus grandis]
Length=933

 Score =   295 bits (754),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 140/234 (60%), Positives = 173/234 (74%), Gaps = 22/234 (9%)
 Frame = +1

Query  1339  ILKQIRVR-EELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKN  1515
             I K+I  R ++ C  Y PCNC   CGK+C C+V    CEK+CGCP +CK  F+GCHC KN
Sbjct  669   IRKRITERKDQPCRQYNPCNCQTACGKQCSCLVNGTCCEKYCGCPKSCKNRFRGCHCAKN  728

Query  1516  ECATNYCPCYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLL  1695
             +C +  CPC+A+ RECDPDVC  CWVSCGDG++G+P  +  N++C+NMKLLL  QQ+VLL
Sbjct  729   QCRSRQCPCFAADRECDPDVCRNCWVSCGDGTLGVPNQRGDNYECRNMKLLLKQQQRVLL  788

Query  1696  GRSDIAGWGAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQL  1875
             GRSD++GWGAFLKN    VSK+E++G YTGELISH EADK GK+YDR+N SFLFNLNDQ 
Sbjct  789   GRSDVSGWGAFLKN---SVSKHEYLGEYTGELISHREADKRGKIYDRENSSFLFNLNDQF  845

Query  1876  VIDAYRRGNKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
             V+DAYR+G+KLKF NHSPDPNC+AKV             ++VAG     DHR G
Sbjct  846   VLDAYRKGDKLKFANHSPDPNCYAKV-------------IMVAG-----DHRVG  881


 Score =   199 bits (506),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 131/228 (57%), Positives = 166/228 (73%), Gaps = 10/228 (4%)
 Frame = +1

Query  688   VGDGSADLLAKRQTDAFDLQNSIGTGSGNKICSSQ-EDGYASSD--LRSSIVLKNAVCpi  858
             +   S DLL KRQ DA  +QN I   +G++  +   ED +AS+   L SSI +KNAV PI
Sbjct  89    IAGNSVDLLTKRQEDALGMQNGIDANNGDRDSNDYLEDAHASTAVLLGSSIPVKNAVRPI  148

Query  859   klpklekippYTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALi-csdsdeeiieeeg  1035
             KLP+++++PPYTTW FL RNQ+M EDQSV+GRRRIYYD N GEALI     +E I EEE 
Sbjct  149   KLPEVKRLPPYTTWIFLDRNQRMTEDQSVVGRRRIYYDQNGGEALICSDSEEEAIDEEED  208

Query  1036  enefaesedYILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLIKE------GATS  1197
             + EF +SED+ILRMTI+++GL D VL+ LAN  SR PSE+KARY+ LIKE          
Sbjct  209   KREFVDSEDFILRMTIKELGLSDSVLESLANCLSRSPSELKARYEVLIKEEKDVGGSKNG  268

Query  1198  KNENTEVTINSYLDEDLDAALSSFDNLFCQRCFVFNCQLHGCSQDLII  1341
              NE T  T++S+LD+DLDAAL SFDNLFC+RC VF+C+LHGCSQDL++
Sbjct  269   DNEETSQTMSSFLDKDLDAALDSFDNLFCRRCLVFDCRLHGCSQDLVL  316


 Score = 67.0 bits (162),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSKK  2167
             +I+V GDHR+GIFA + +NAG+EL YDY+Y+PD  PAWA+  +++  K
Sbjct  871   VIMVAGDHRVGIFAKERINAGEELFYDYRYEPDRAPAWARKPEAAGSK  918



>ref|XP_010070362.1| PREDICTED: histone-lysine N-methyltransferase CLF isoform X3 
[Eucalyptus grandis]
Length=843

 Score =   293 bits (750),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 140/234 (60%), Positives = 173/234 (74%), Gaps = 22/234 (9%)
 Frame = +1

Query  1339  ILKQIRVR-EELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKN  1515
             I K+I  R ++ C  Y PCNC   CGK+C C+V    CEK+CGCP +CK  F+GCHC KN
Sbjct  579   IRKRITERKDQPCRQYNPCNCQTACGKQCSCLVNGTCCEKYCGCPKSCKNRFRGCHCAKN  638

Query  1516  ECATNYCPCYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLL  1695
             +C +  CPC+A+ RECDPDVC  CWVSCGDG++G+P  +  N++C+NMKLLL  QQ+VLL
Sbjct  639   QCRSRQCPCFAADRECDPDVCRNCWVSCGDGTLGVPNQRGDNYECRNMKLLLKQQQRVLL  698

Query  1696  GRSDIAGWGAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQL  1875
             GRSD++GWGAFLKN    VSK+E++G YTGELISH EADK GK+YDR+N SFLFNLNDQ 
Sbjct  699   GRSDVSGWGAFLKN---SVSKHEYLGEYTGELISHREADKRGKIYDRENSSFLFNLNDQF  755

Query  1876  VIDAYRRGNKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
             V+DAYR+G+KLKF NHSPDPNC+AKV             ++VAG     DHR G
Sbjct  756   VLDAYRKGDKLKFANHSPDPNCYAKV-------------IMVAG-----DHRVG  791


 Score =   155 bits (392),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 93/150 (62%), Positives = 114/150 (76%), Gaps = 7/150 (5%)
 Frame = +1

Query  913   RNQKMPEDQSVIGRRRIYYDMNSGEALi-csdsdeeiieeegenefaesedYILRMTIEK  1089
             RNQ+M EDQSV+GRRRIYYD N GEALI     +E I EEE + EF +SED+ILRMTI++
Sbjct  8     RNQRMTEDQSVVGRRRIYYDQNGGEALICSDSEEEAIDEEEDKREFVDSEDFILRMTIKE  67

Query  1090  VGLYDMVLDLLANHFSRKPSEVKARYKDLIKE------GATSKNENTEVTINSYLDEDLD  1251
             +GL D VL+ LAN  SR PSE+KARY+ LIKE           NE T  T++S+LD+DLD
Sbjct  68    LGLSDSVLESLANCLSRSPSELKARYEVLIKEEKDVGGSKNGDNEETSQTMSSFLDKDLD  127

Query  1252  AALSSFDNLFCQRCFVFNCQLHGCSQDLII  1341
             AAL SFDNLFC+RC VF+C+LHGCSQDL++
Sbjct  128   AALDSFDNLFCRRCLVFDCRLHGCSQDLVL  157


 Score = 66.6 bits (161),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSKK  2167
             +I+V GDHR+GIFA + +NAG+EL YDY+Y+PD  PAWA+  +++  K
Sbjct  781   VIMVAGDHRVGIFAKERINAGEELFYDYRYEPDRAPAWARKPEAAGSK  828



>gb|KDO79173.1| hypothetical protein CISIN_1g0024181mg [Citrus sinensis]
Length=652

 Score =   288 bits (738),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 138/234 (59%), Positives = 172/234 (74%), Gaps = 22/234 (9%)
 Frame = +1

Query  1339  ILKQIRVR-EELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKN  1515
             I K+I  R ++ C  Y PC C   CGK+CPC++    CEK+CGCP +CK  F+GCHC K+
Sbjct  388   IRKRITERKDQPCRQYNPCGCQTACGKQCPCLLNGTCCEKYCGCPKSCKNRFRGCHCAKS  447

Query  1516  ECATNYCPCYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLL  1695
             +C +  CPC+A+ RECDPDVC  CW+SCGDGS+G+P  K  N++C+NMKLLL  QQ+VLL
Sbjct  448   QCRSRQCPCFAADRECDPDVCRNCWISCGDGSLGVPDQKGDNYECRNMKLLLKQQQRVLL  507

Query  1696  GRSDIAGWGAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQL  1875
             GRSD++GWGAFLKN    V K+E++G YTGELISH EADK GK+YDR+N SFLFNLNDQ 
Sbjct  508   GRSDVSGWGAFLKN---SVGKHEYLGEYTGELISHREADKRGKIYDRENSSFLFNLNDQF  564

Query  1876  VIDAYRRGNKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
             V+DAYR+G+KLKF NHSPDPNC+AKV             ++VAG     DHR G
Sbjct  565   VLDAYRKGDKLKFANHSPDPNCYAKV-------------IMVAG-----DHRVG  600


 Score = 65.9 bits (159),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSKK  2167
             +I+V GDHR+GIFA + ++AG+EL YDY+Y+PD  PAWA+  ++S  K
Sbjct  590   VIMVAGDHRVGIFAKERISAGEELFYDYRYEPDRAPAWARKPEASGSK  637



>gb|KDO79169.1| hypothetical protein CISIN_1g0024181mg, partial [Citrus sinensis]
Length=762

 Score =   290 bits (743),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 138/234 (59%), Positives = 172/234 (74%), Gaps = 22/234 (9%)
 Frame = +1

Query  1339  ILKQIRVR-EELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKN  1515
             I K+I  R ++ C  Y PC C   CGK+CPC++    CEK+CGCP +CK  F+GCHC K+
Sbjct  498   IRKRITERKDQPCRQYNPCGCQTACGKQCPCLLNGTCCEKYCGCPKSCKNRFRGCHCAKS  557

Query  1516  ECATNYCPCYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLL  1695
             +C +  CPC+A+ RECDPDVC  CW+SCGDGS+G+P  K  N++C+NMKLLL  QQ+VLL
Sbjct  558   QCRSRQCPCFAADRECDPDVCRNCWISCGDGSLGVPDQKGDNYECRNMKLLLKQQQRVLL  617

Query  1696  GRSDIAGWGAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQL  1875
             GRSD++GWGAFLKN    V K+E++G YTGELISH EADK GK+YDR+N SFLFNLNDQ 
Sbjct  618   GRSDVSGWGAFLKN---SVGKHEYLGEYTGELISHREADKRGKIYDRENSSFLFNLNDQF  674

Query  1876  VIDAYRRGNKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
             V+DAYR+G+KLKF NHSPDPNC+AKV             ++VAG     DHR G
Sbjct  675   VLDAYRKGDKLKFANHSPDPNCYAKV-------------IMVAG-----DHRVG  710


 Score =   155 bits (391),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 110/195 (56%), Positives = 136/195 (70%), Gaps = 12/195 (6%)
 Frame = +1

Query  916   NQKMPEDQSVIGRRRIYYDMNSGEALicsdsdeeiieeegenefaesedYILRMTIEKVG  1095
             NQ+M EDQSV+ RRRIYYD N GEALICSDS+EE+IEEE + +F +SEDYILRMTI++VG
Sbjct  1     NQRMTEDQSVMSRRRIYYDQNGGEALICSDSEEEVIEEEEKKDFVDSEDYILRMTIKEVG  60

Query  1096  LYDMVLDLLANHFSRKPSEVKARYKDLIKEGAT---SKNENTEVTINSYLDEDLDAALSS  1266
             L D  L+ LA  FSR PSEVKARY+ L KE +    S N N E T+N++L +DL+AAL S
Sbjct  61    LSDATLESLAQCFSRSPSEVKARYEILSKEESAVGGSNNGNDEHTMNNFLVKDLEAALDS  120

Query  1267  FDNLFCQRCFVFNCQLHGCSQDLIILKQIRVREELCAHYTPCN--C*PHCGKKCPCVVKS  1440
             FDNLFC+RC VF+C+LHGCSQDL+   +   ++ L  H    N  C PHC +    V+KS
Sbjct  121   FDNLFCRRCLVFDCRLHGCSQDLVFPAE---KQPLWYHLDEGNVPCGPHCYRS---VLKS  174

Query  1441  IYCEKFCGCPLNCKI  1485
                   C  PLN  I
Sbjct  175   ERNATACS-PLNGDI  188


 Score = 65.9 bits (159),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSKK  2167
             +I+V GDHR+GIFA + ++AG+EL YDY+Y+PD  PAWA+  ++S  K
Sbjct  700   VIMVAGDHRVGIFAKERISAGEELFYDYRYEPDRAPAWARKPEASGSK  747



>gb|KDO79170.1| hypothetical protein CISIN_1g0024181mg, partial [Citrus sinensis]
Length=740

 Score =   290 bits (742),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 138/234 (59%), Positives = 172/234 (74%), Gaps = 22/234 (9%)
 Frame = +1

Query  1339  ILKQIRVR-EELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKN  1515
             I K+I  R ++ C  Y PC C   CGK+CPC++    CEK+CGCP +CK  F+GCHC K+
Sbjct  476   IRKRITERKDQPCRQYNPCGCQTACGKQCPCLLNGTCCEKYCGCPKSCKNRFRGCHCAKS  535

Query  1516  ECATNYCPCYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLL  1695
             +C +  CPC+A+ RECDPDVC  CW+SCGDGS+G+P  K  N++C+NMKLLL  QQ+VLL
Sbjct  536   QCRSRQCPCFAADRECDPDVCRNCWISCGDGSLGVPDQKGDNYECRNMKLLLKQQQRVLL  595

Query  1696  GRSDIAGWGAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQL  1875
             GRSD++GWGAFLKN    V K+E++G YTGELISH EADK GK+YDR+N SFLFNLNDQ 
Sbjct  596   GRSDVSGWGAFLKN---SVGKHEYLGEYTGELISHREADKRGKIYDRENSSFLFNLNDQF  652

Query  1876  VIDAYRRGNKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
             V+DAYR+G+KLKF NHSPDPNC+AKV             ++VAG     DHR G
Sbjct  653   VLDAYRKGDKLKFANHSPDPNCYAKV-------------IMVAG-----DHRVG  688


 Score =   119 bits (297),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 97/195 (50%), Positives = 120/195 (62%), Gaps = 34/195 (17%)
 Frame = +1

Query  916   NQKMPEDQSVIGRRRIYYDMNSGEALicsdsdeeiieeegenefaesedYILRMTIEKVG  1095
             NQ+M EDQSV+ RRRIYYD N GEALICSDS+EE+IEEE + +F +SEDYIL        
Sbjct  1     NQRMTEDQSVMSRRRIYYDQNGGEALICSDSEEEVIEEEEKKDFVDSEDYIL--------  52

Query  1096  LYDMVLDLLANHFSRKPSEVKARYKDLIKEGAT---SKNENTEVTINSYLDEDLDAALSS  1266
                           R PSEVKARY+ L KE +    S N N E T+N++L +DL+AAL S
Sbjct  53    --------------RSPSEVKARYEILSKEESAVGGSNNGNDEHTMNNFLVKDLEAALDS  98

Query  1267  FDNLFCQRCFVFNCQLHGCSQDLIILKQIRVREELCAHYTPCN--C*PHCGKKCPCVVKS  1440
             FDNLFC+RC VF+C+LHGCSQDL+   +   ++ L  H    N  C PHC +    V+KS
Sbjct  99    FDNLFCRRCLVFDCRLHGCSQDLVFPAE---KQPLWYHLDEGNVPCGPHCYRS---VLKS  152

Query  1441  IYCEKFCGCPLNCKI  1485
                   C  PLN  I
Sbjct  153   ERNATACS-PLNGDI  166


 Score = 65.9 bits (159),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSKK  2167
             +I+V GDHR+GIFA + ++AG+EL YDY+Y+PD  PAWA+  ++S  K
Sbjct  678   VIMVAGDHRVGIFAKERISAGEELFYDYRYEPDRAPAWARKPEASGSK  725



>ref|XP_010531249.1| PREDICTED: histone-lysine N-methyltransferase CLF isoform X3 
[Tarenaya hassleriana]
Length=765

 Score =   290 bits (743),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 138/234 (59%), Positives = 174/234 (74%), Gaps = 6/234 (3%)
 Frame = +1

Query  1339  ILKQIRVR-EELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKN  1515
             I K+I  R ++ C  Y PCNC   CGK+C C++    CEK+CGCP NCK  F+GCHC K+
Sbjct  496   IRKRITERKDQPCRQYNPCNCQTACGKQCSCLLNGTCCEKYCGCPKNCKNRFRGCHCAKS  555

Query  1516  ECATNYCPCYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLL  1695
             +C +  CPC+A+ RECDPDVC  CWVSCGDG++G+P  +  N++C+NMKLLL  QQKVLL
Sbjct  556   QCRSRQCPCFAADRECDPDVCRNCWVSCGDGTLGVPNQRGDNYECRNMKLLLKQQQKVLL  615

Query  1696  GRSDIAGWGAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQL  1875
             GRSD++GWGAFLKN    VSK+E++G YTGELISH EADK GK+YDR+N SFLFNLNDQ 
Sbjct  616   GRSDVSGWGAFLKN---SVSKHEYLGEYTGELISHREADKRGKIYDRENSSFLFNLNDQF  672

Query  1876  VIDAYRRGNKLKFINHSPDPNCFAKVNCSLSPCLLQCF--QLIVAGGSFSIDHR  2031
             V+DAYR+G+KLKF NHSP+PNC+AKV        +  F  + I+AG     D+R
Sbjct  673   VLDAYRKGDKLKFANHSPEPNCYAKVIMVAGDHRVGIFARERIMAGEELFYDYR  726


 Score = 85.5 bits (210),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 50/118 (42%), Positives = 66/118 (56%), Gaps = 37/118 (31%)
 Frame = +1

Query  1093  GLYDMVLDLLANHFSRKPSEVKARYKDLIKEGATSKNENTEVTINSYLDEDLDAALSSFD  1272
             GL D VL+ LAN  SR PSE+KAR++ L+KE   SKN +++   NS+L++DL+AAL SFD
Sbjct  34    GLLDPVLEELANCLSRSPSEIKARHEVLMKEKQVSKNGDSQAE-NSFLNKDLEAALDSFD  92

Query  1273  NLFCQRCF------------------------------------VFNCQLHGCSQDLI  1338
             NLFC+RC                                     VF+C+LHGCSQDL+
Sbjct  93    NLFCRRCLVSSLVVHSILMFHLVRLLLGVPCTLTFCLLCSMAVQVFDCRLHGCSQDLV  150


 Score = 66.2 bits (160),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSKK  2167
             +I+V GDHR+GIFA + + AG+EL YDY+Y+PD  PAWA+  +SS  K
Sbjct  698   VIMVAGDHRVGIFARERIMAGEELFYDYRYEPDRAPAWARKPESSGSK  745



>ref|XP_010070360.1| PREDICTED: histone-lysine N-methyltransferase CLF isoform X1 
[Eucalyptus grandis]
Length=1002

 Score =   294 bits (753),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 140/234 (60%), Positives = 173/234 (74%), Gaps = 22/234 (9%)
 Frame = +1

Query  1339  ILKQIRVR-EELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKN  1515
             I K+I  R ++ C  Y PCNC   CGK+C C+V    CEK+CGCP +CK  F+GCHC KN
Sbjct  738   IRKRITERKDQPCRQYNPCNCQTACGKQCSCLVNGTCCEKYCGCPKSCKNRFRGCHCAKN  797

Query  1516  ECATNYCPCYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLL  1695
             +C +  CPC+A+ RECDPDVC  CWVSCGDG++G+P  +  N++C+NMKLLL  QQ+VLL
Sbjct  798   QCRSRQCPCFAADRECDPDVCRNCWVSCGDGTLGVPNQRGDNYECRNMKLLLKQQQRVLL  857

Query  1696  GRSDIAGWGAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQL  1875
             GRSD++GWGAFLKN    VSK+E++G YTGELISH EADK GK+YDR+N SFLFNLNDQ 
Sbjct  858   GRSDVSGWGAFLKN---SVSKHEYLGEYTGELISHREADKRGKIYDRENSSFLFNLNDQF  914

Query  1876  VIDAYRRGNKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
             V+DAYR+G+KLKF NHSPDPNC+AKV             ++VAG     DHR G
Sbjct  915   VLDAYRKGDKLKFANHSPDPNCYAKV-------------IMVAG-----DHRVG  950


 Score =   199 bits (505),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 131/228 (57%), Positives = 166/228 (73%), Gaps = 10/228 (4%)
 Frame = +1

Query  688   VGDGSADLLAKRQTDAFDLQNSIGTGSGNKICSSQ-EDGYASSD--LRSSIVLKNAVCpi  858
             +   S DLL KRQ DA  +QN I   +G++  +   ED +AS+   L SSI +KNAV PI
Sbjct  89    IAGNSVDLLTKRQEDALGMQNGIDANNGDRDSNDYLEDAHASTAVLLGSSIPVKNAVRPI  148

Query  859   klpklekippYTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALi-csdsdeeiieeeg  1035
             KLP+++++PPYTTW FL RNQ+M EDQSV+GRRRIYYD N GEALI     +E I EEE 
Sbjct  149   KLPEVKRLPPYTTWIFLDRNQRMTEDQSVVGRRRIYYDQNGGEALICSDSEEEAIDEEED  208

Query  1036  enefaesedYILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLIKE------GATS  1197
             + EF +SED+ILRMTI+++GL D VL+ LAN  SR PSE+KARY+ LIKE          
Sbjct  209   KREFVDSEDFILRMTIKELGLSDSVLESLANCLSRSPSELKARYEVLIKEEKDVGGSKNG  268

Query  1198  KNENTEVTINSYLDEDLDAALSSFDNLFCQRCFVFNCQLHGCSQDLII  1341
              NE T  T++S+LD+DLDAAL SFDNLFC+RC VF+C+LHGCSQDL++
Sbjct  269   DNEETSQTMSSFLDKDLDAALDSFDNLFCRRCLVFDCRLHGCSQDLVL  316


 Score = 67.0 bits (162),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSKK  2167
             +I+V GDHR+GIFA + +NAG+EL YDY+Y+PD  PAWA+  +++  K
Sbjct  940   VIMVAGDHRVGIFAKERINAGEELFYDYRYEPDRAPAWARKPEAAGSK  987



>ref|XP_009630459.1| PREDICTED: histone-lysine N-methyltransferase CLF-like [Nicotiana 
tomentosiformis]
Length=922

 Score =   293 bits (749),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 138/234 (59%), Positives = 173/234 (74%), Gaps = 22/234 (9%)
 Frame = +1

Query  1339  ILKQIRVR-EELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKN  1515
             I K+I  R ++ C  Y PC C   CGK+CPC+V    CEK+CGCP +CK  F+GCHC K+
Sbjct  658   IRKRISERKDQPCRQYNPCGCQGPCGKECPCIVNGTCCEKYCGCPKSCKNRFRGCHCAKS  717

Query  1516  ECATNYCPCYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLL  1695
             +C +  CPC+A+GRECDPDVC  CW+SCGDG++G+PP +  +H+C+NMKLLL  QQKVLL
Sbjct  718   QCRSRQCPCFAAGRECDPDVCRNCWISCGDGTLGVPPQRGDSHECRNMKLLLKQQQKVLL  777

Query  1696  GRSDIAGWGAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQL  1875
             GRSD++GWGAFLKN    V K+E++G YTGELISH EADK GK+YDR+N SFLFNLNDQ 
Sbjct  778   GRSDVSGWGAFLKN---TVGKHEYLGEYTGELISHREADKRGKIYDRENSSFLFNLNDQF  834

Query  1876  VIDAYRRGNKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
             V+DA+R+G+KLKF NHSP PNC+AKV             ++VAG     DHR G
Sbjct  835   VLDAHRKGDKLKFANHSPVPNCYAKV-------------MMVAG-----DHRVG  870


 Score =   206 bits (524),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 138/229 (60%), Positives = 171/229 (75%), Gaps = 6/229 (3%)
 Frame = +1

Query  691   GDGSADLLAKRQTDAFDLQNSIGTGSGNKICSSQED-GYASSD--LRSSIVLKNAVCpik  861
              D + DLL+KRQ DA D+QN I T +G+   +S ED GYA+S   L SSI +KNAV PIK
Sbjct  87    ADRTVDLLSKRQKDAIDMQNGIDTSNGDDDSNSSEDDGYATSAILLGSSIAVKNAVRPIK  146

Query  862   lpklekippYTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALi-csdsdeeiieeege  1038
             LP+ ++IPPYTTW FL RNQ+M EDQSV+GRRRIYYD N GE LI     +E + EEE +
Sbjct  147   LPEEKRIPPYTTWIFLDRNQRMTEDQSVVGRRRIYYDQNGGETLICSDSDEEVLEEEEEK  206

Query  1039  nefaesedYILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLIKE--GATSKNENT  1212
               FAESEDY+LRMTI++VGL D VL+LL    SRKPS+VKARY+DL+K     TSKNE  
Sbjct  207   KVFAESEDYMLRMTIKEVGLSDSVLELLGRCLSRKPSDVKARYEDLVKRDNAGTSKNEYM  266

Query  1213  EVTINSYLDEDLDAALSSFDNLFCQRCFVFNCQLHGCSQDLIILKQIRV  1359
             E +++ YL +DLDAAL SFDNLFC+RC VF+C+LHGCSQDLI   + ++
Sbjct  267   ESSLDLYLAKDLDAALDSFDNLFCRRCLVFDCRLHGCSQDLIFPAEKQI  315


 Score = 63.2 bits (152),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSKK  2167
             +++V GDHR+GIFA + + AG+EL YDY+Y+PD+ PAWA+  ++S  +
Sbjct  860   VMMVAGDHRVGIFANERICAGEELFYDYRYEPDSAPAWARKPEASGTR  907



>ref|XP_010531248.1| PREDICTED: histone-lysine N-methyltransferase CLF isoform X2 
[Tarenaya hassleriana]
Length=919

 Score =   293 bits (749),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 138/234 (59%), Positives = 174/234 (74%), Gaps = 6/234 (3%)
 Frame = +1

Query  1339  ILKQIRVR-EELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKN  1515
             I K+I  R ++ C  Y PCNC   CGK+C C++    CEK+CGCP NCK  F+GCHC K+
Sbjct  650   IRKRITERKDQPCRQYNPCNCQTACGKQCSCLLNGTCCEKYCGCPKNCKNRFRGCHCAKS  709

Query  1516  ECATNYCPCYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLL  1695
             +C +  CPC+A+ RECDPDVC  CWVSCGDG++G+P  +  N++C+NMKLLL  QQKVLL
Sbjct  710   QCRSRQCPCFAADRECDPDVCRNCWVSCGDGTLGVPNQRGDNYECRNMKLLLKQQQKVLL  769

Query  1696  GRSDIAGWGAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQL  1875
             GRSD++GWGAFLKN    VSK+E++G YTGELISH EADK GK+YDR+N SFLFNLNDQ 
Sbjct  770   GRSDVSGWGAFLKN---SVSKHEYLGEYTGELISHREADKRGKIYDRENSSFLFNLNDQF  826

Query  1876  VIDAYRRGNKLKFINHSPDPNCFAKVNCSLSPCLLQCF--QLIVAGGSFSIDHR  2031
             V+DAYR+G+KLKF NHSP+PNC+AKV        +  F  + I+AG     D+R
Sbjct  827   VLDAYRKGDKLKFANHSPEPNCYAKVIMVAGDHRVGIFARERIMAGEELFYDYR  880


 Score =   180 bits (457),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 122/222 (55%), Positives = 161/222 (73%), Gaps = 8/222 (4%)
 Frame = +1

Query  694   DGS---ADLLAKRQTDAFDLQNSIGTGSG-NKICSSQEDGYASSDL--RSSIVLKNAVCp  855
             DGS    DLLAKRQ D   +++ I  G G N   SS  D +A+S     SS+ +K ++ P
Sbjct  84    DGSNDGMDLLAKRQRDTLGIKSGIDAGDGDNNNHSSLGDAHANSTTIQGSSVPVKLSLRP  143

Query  856   iklpklekippYTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALi-csdsdeeiieee  1032
             +K+P+L+++PPYTTW FL RNQ+M EDQSV+GRRRIYYD N GEALI     +E   +E+
Sbjct  144   VKIPELKRLPPYTTWVFLDRNQRMTEDQSVVGRRRIYYDQNGGEALICSDSEEELAEDED  203

Query  1033  genefaesedYILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLIKEGATSKNENT  1212
              + +F ESEDYIL MTIE +GL D VL+ LAN  SR PSE+KAR++ L+KE   SKN ++
Sbjct  204   EKRDFVESEDYILCMTIEHLGLLDPVLEELANCLSRSPSEIKARHEVLMKEKQVSKNGDS  263

Query  1213  EVTINSYLDEDLDAALSSFDNLFCQRCFVFNCQLHGCSQDLI  1338
             +   NS+L++DL+AAL SFDNLFC+RC VF+C+LHGCSQDL+
Sbjct  264   QAE-NSFLNKDLEAALDSFDNLFCRRCLVFDCRLHGCSQDLV  304


 Score = 66.2 bits (160),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSKK  2167
             +I+V GDHR+GIFA + + AG+EL YDY+Y+PD  PAWA+  +SS  K
Sbjct  852   VIMVAGDHRVGIFARERIMAGEELFYDYRYEPDRAPAWARKPESSGSK  899



>dbj|BAC84950.1| PHCLF1 [Petunia x hybrida]
Length=922

 Score =   293 bits (749),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 138/234 (59%), Positives = 174/234 (74%), Gaps = 22/234 (9%)
 Frame = +1

Query  1339  ILKQIRVR-EELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKN  1515
             I K+I  R ++ C  + PC C   CGK+CPC+V +  CEK+CGCP +CK  F+GCHC K+
Sbjct  658   IRKRISERKDQPCRQFNPCGCQGPCGKECPCIVNATCCEKYCGCPKSCKNRFRGCHCAKS  717

Query  1516  ECATNYCPCYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLL  1695
             +C +  CPC+A+GRECDPDVC  CW+SCGDG++GIPP +  +H+C+NMKLLL  QQKVLL
Sbjct  718   QCRSRQCPCFAAGRECDPDVCRNCWISCGDGTLGIPPQRGDSHECKNMKLLLKQQQKVLL  777

Query  1696  GRSDIAGWGAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQL  1875
             GRSD++GWGAFLKN    V K+E++G YTGELISH EADK GK+YDR+N SFLFNLNDQ 
Sbjct  778   GRSDVSGWGAFLKN---SVGKHEYLGEYTGELISHREADKRGKIYDRENSSFLFNLNDQF  834

Query  1876  VIDAYRRGNKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
             V+DA+R+G+KLKF NHSP PNC+AKV             ++VAG     DHR G
Sbjct  835   VLDAHRKGDKLKFANHSPVPNCYAKV-------------MMVAG-----DHRVG  870


 Score =   209 bits (533),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 139/223 (62%), Positives = 168/223 (75%), Gaps = 6/223 (3%)
 Frame = +1

Query  691   GDGSADLLAKRQTDAFDLQNSIGTGSGNKICSSQED-GYASSD--LRSSIVLKNAVCpik  861
              D + DLLAKRQ DA D+QN I T  G+   +S ED GYA+S   L SSI +KNAV PIK
Sbjct  86    ADRTVDLLAKRQKDAIDMQNGIDTSHGDDDSNSSEDDGYATSAILLGSSIAVKNAVRPIK  145

Query  862   lpklekippYTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALi-csdsdeeiieeege  1038
             LP++++IPPYTTW FL RNQ+M EDQSV+GRRRIYYD N GE LI     +E + EEE +
Sbjct  146   LPEVKRIPPYTTWIFLDRNQRMTEDQSVVGRRRIYYDQNGGETLICSDSDEEVLDEEEEK  205

Query  1039  nefaesedYILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLIKE--GATSKNENT  1212
               FAE EDY+LRMTIE+VGL + VLDLL    SRKPS+VKARY+DL+KE    TSKN+  
Sbjct  206   KVFAEPEDYVLRMTIEEVGLSNTVLDLLGKCLSRKPSDVKARYEDLVKEDNAGTSKNQYM  265

Query  1213  EVTINSYLDEDLDAALSSFDNLFCQRCFVFNCQLHGCSQDLII  1341
             E +++ YL +DLDAAL SFDNLFC+RC VF+C+LHGCSQDLI 
Sbjct  266   ESSLDLYLAKDLDAALDSFDNLFCRRCLVFDCRLHGCSQDLIF  308


 Score = 62.8 bits (151),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 24/45 (53%), Positives = 37/45 (82%), Gaps = 0/45 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSS  2158
             +++V GDHR+GIFA + + AG+EL YDY+Y+PD+ PAWA+  ++S
Sbjct  860   VMMVAGDHRVGIFANERICAGEELFYDYRYEPDSAPAWARKPEAS  904



>ref|XP_009788515.1| PREDICTED: histone-lysine N-methyltransferase CLF-like isoform 
X2 [Nicotiana sylvestris]
Length=913

 Score =   292 bits (748),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 137/234 (59%), Positives = 173/234 (74%), Gaps = 22/234 (9%)
 Frame = +1

Query  1339  ILKQIRVR-EELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKN  1515
             I K+I  R ++ C  + PC C   CGK+CPC+V    CEK+CGCP +CK  F+GCHC K+
Sbjct  649   IRKRISERKDQPCRQFNPCGCQGPCGKECPCIVNGTCCEKYCGCPKSCKNRFRGCHCAKS  708

Query  1516  ECATNYCPCYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLL  1695
             +C +  CPC+A+GRECDPDVC  CW+SCGDG++G+PP +  +H+C+NMKLLL  QQKVLL
Sbjct  709   QCRSRQCPCFAAGRECDPDVCRNCWISCGDGTLGVPPQRGDSHECRNMKLLLKQQQKVLL  768

Query  1696  GRSDIAGWGAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQL  1875
             GRSD++GWGAFLKN    V K+E++G YTGELISH EADK GK+YDR+N SFLFNLNDQ 
Sbjct  769   GRSDVSGWGAFLKN---TVGKHEYLGEYTGELISHREADKRGKIYDRENSSFLFNLNDQF  825

Query  1876  VIDAYRRGNKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
             V+DA+R+G+KLKF NHSP PNC+AKV             ++VAG     DHR G
Sbjct  826   VLDAHRKGDKLKFANHSPVPNCYAKV-------------MMVAG-----DHRVG  861


 Score =   209 bits (531),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 139/223 (62%), Positives = 170/223 (76%), Gaps = 6/223 (3%)
 Frame = +1

Query  691   GDGSADLLAKRQTDAFDLQNSIGTGSGNKICSSQED-GYASSD--LRSSIVLKNAVCpik  861
              D + DLL+KRQ DA D+QN I T +G+   +S ED GYA+S   L SSI +KNAV PIK
Sbjct  77    ADRTVDLLSKRQKDAIDMQNGIDTNNGDDDSNSSEDDGYATSAILLGSSIAVKNAVRPIK  136

Query  862   lpklekippYTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALi-csdsdeeiieeege  1038
             LP+ ++IPPYTTW FL RNQ+M EDQSV+GRRRIYYD N GE LI     +E + EEE +
Sbjct  137   LPEEKRIPPYTTWIFLDRNQRMTEDQSVVGRRRIYYDQNGGETLICSDSDEEVLEEEEEK  196

Query  1039  nefaesedYILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLIKE--GATSKNENT  1212
               FAESEDY+LRMTI++VGL D VL+LL    SRKPSEVKARY+DL+K+    +SKNE T
Sbjct  197   KVFAESEDYMLRMTIKEVGLSDSVLELLGQCLSRKPSEVKARYEDLVKKDNAGSSKNEYT  256

Query  1213  EVTINSYLDEDLDAALSSFDNLFCQRCFVFNCQLHGCSQDLII  1341
             E +++ YL +DLDAAL SFDNLFC+RC VF+C+LHGCSQDLI 
Sbjct  257   ESSLDLYLAKDLDAALDSFDNLFCRRCLVFDCRLHGCSQDLIF  299


 Score = 63.2 bits (152),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSKK  2167
             +++V GDHR+GIFA + + AG+EL YDY+Y+PD+ PAWA+  ++S  +
Sbjct  851   VMMVAGDHRVGIFANERICAGEELFYDYRYEPDSAPAWARKPEASGTR  898



>ref|XP_006425927.1| hypothetical protein CICLE_v10024826mg [Citrus clementina]
 gb|ESR39167.1| hypothetical protein CICLE_v10024826mg [Citrus clementina]
Length=925

 Score =   292 bits (748),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 138/234 (59%), Positives = 172/234 (74%), Gaps = 22/234 (9%)
 Frame = +1

Query  1339  ILKQIRVR-EELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKN  1515
             I K+I  R ++ C  Y PC C   CGK+CPC++    CEK+CGCP +CK  F+GCHC K+
Sbjct  661   IRKRITERKDQPCRQYNPCGCQTACGKQCPCLLNGTCCEKYCGCPKSCKNRFRGCHCAKS  720

Query  1516  ECATNYCPCYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLL  1695
             +C +  CPC+A+ RECDPDVC  CW+SCGDGS+G+P  K  N++C+NMKLLL  QQ+VLL
Sbjct  721   QCRSRQCPCFAADRECDPDVCRNCWISCGDGSLGVPDQKGDNYECRNMKLLLKQQQRVLL  780

Query  1696  GRSDIAGWGAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQL  1875
             GRSD++GWGAFLKN    V K+E++G YTGELISH EADK GK+YDR+N SFLFNLNDQ 
Sbjct  781   GRSDVSGWGAFLKN---SVGKHEYLGEYTGELISHREADKRGKIYDRENSSFLFNLNDQF  837

Query  1876  VIDAYRRGNKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
             V+DAYR+G+KLKF NHSPDPNC+AKV             ++VAG     DHR G
Sbjct  838   VLDAYRKGDKLKFANHSPDPNCYAKV-------------IMVAG-----DHRVG  873


 Score =   202 bits (514),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 149/270 (55%), Positives = 185/270 (69%), Gaps = 14/270 (5%)
 Frame = +1

Query  697   GSADLLAKRQTDAFDLQNSIGTGSGNKICS-SQEDGYASSDLR-SSIVLKNAVCpiklpk  870
             GS DLL KRQ +A  +QN I   SG++    SQEDGYAS+ +  SS   KN + PIKL  
Sbjct  89    GSVDLLTKRQREALGVQNGIDVSSGDRDSHISQEDGYASTAVYGSSNPTKNIIRPIKLND  148

Query  871   lekippYTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALicsdsdeeiieeegenefa  1050
              +++PPYTTW FL RNQ+M EDQSV+ RRRIYYD N GEALICSDS+EE+IEEE + +F 
Sbjct  149   NKRLPPYTTWIFLDRNQRMTEDQSVMSRRRIYYDQNGGEALICSDSEEEVIEEEEKKDFV  208

Query  1051  esedYILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLIKEGAT---SKNENTEVT  1221
             +SEDYILRMTI++VGL D  L+ LA  FSR PSEVKARY+ L KE +    S N N E T
Sbjct  209   DSEDYILRMTIKEVGLSDATLESLAQCFSRSPSEVKARYEILSKEESAVGGSNNGNDEHT  268

Query  1222  INSYLDEDLDAALSSFDNLFCQRCFVFNCQLHGCSQDLIILKQIRVREELCAHYTPCN--  1395
             +N++L +DL+AAL SFDNLFC+RC VF+C+LHGCSQDL+   +   ++ L  H    N  
Sbjct  269   MNNFLVKDLEAALDSFDNLFCRRCLVFDCRLHGCSQDLVFPAE---KQPLWYHLDEGNVP  325

Query  1396  C*PHCGKKCPCVVKSIYCEKFCGCPLNCKI  1485
             C PHC +    V+KS      C  PLN  I
Sbjct  326   CGPHCYR---SVLKSERNATACS-PLNGDI  351


 Score = 65.9 bits (159),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSKK  2167
             +I+V GDHR+GIFA + ++AG+EL YDY+Y+PD  PAWA+  ++S  K
Sbjct  863   VIMVAGDHRVGIFAKERISAGEELFYDYRYEPDRAPAWARKPEASGSK  910



>ref|XP_006494449.1| PREDICTED: histone-lysine N-methyltransferase CLF-like isoform 
X1 [Citrus sinensis]
Length=925

 Score =   292 bits (748),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 138/234 (59%), Positives = 172/234 (74%), Gaps = 22/234 (9%)
 Frame = +1

Query  1339  ILKQIRVR-EELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKN  1515
             I K+I  R ++ C  Y PC C   CGK+CPC++    CEK+CGCP +CK  F+GCHC K+
Sbjct  661   IRKRITERKDQPCRQYNPCGCQTACGKQCPCLLNGTCCEKYCGCPKSCKNRFRGCHCAKS  720

Query  1516  ECATNYCPCYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLL  1695
             +C +  CPC+A+ RECDPDVC  CW+SCGDGS+G+P  K  N++C+NMKLLL  QQ+VLL
Sbjct  721   QCRSRQCPCFAADRECDPDVCRNCWISCGDGSLGVPDQKGDNYECRNMKLLLKQQQRVLL  780

Query  1696  GRSDIAGWGAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQL  1875
             GRSD++GWGAFLKN    V K+E++G YTGELISH EADK GK+YDR+N SFLFNLNDQ 
Sbjct  781   GRSDVSGWGAFLKN---SVGKHEYLGEYTGELISHREADKRGKIYDRENSSFLFNLNDQF  837

Query  1876  VIDAYRRGNKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
             V+DAYR+G+KLKF NHSPDPNC+AKV             ++VAG     DHR G
Sbjct  838   VLDAYRKGDKLKFANHSPDPNCYAKV-------------IMVAG-----DHRVG  873


 Score =   203 bits (516),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 149/270 (55%), Positives = 185/270 (69%), Gaps = 14/270 (5%)
 Frame = +1

Query  697   GSADLLAKRQTDAFDLQNSIGTGSGNKICS-SQEDGYASSDLR-SSIVLKNAVCpiklpk  870
             GS DLL KRQ +A  +QN I   SG++    SQEDGYAS+ +  SS   KN + PIKL  
Sbjct  89    GSVDLLTKRQREALGVQNGIDVSSGDRDSHISQEDGYASTAVYGSSNPTKNVIRPIKLND  148

Query  871   lekippYTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALicsdsdeeiieeegenefa  1050
              +++PPYTTW FL RNQ+M EDQSV+ RRRIYYD N GEALICSDS+EE+IEEE + +F 
Sbjct  149   NKRLPPYTTWIFLDRNQRMTEDQSVMSRRRIYYDQNGGEALICSDSEEEVIEEEEKKDFV  208

Query  1051  esedYILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLIKEGAT---SKNENTEVT  1221
             +SEDYILRMTI++VGL D  L+ LA  FSR PSEVKARY+ L KE +    S N N E T
Sbjct  209   DSEDYILRMTIKEVGLSDATLESLAQCFSRSPSEVKARYEILSKEESAVGGSNNGNDEHT  268

Query  1222  INSYLDEDLDAALSSFDNLFCQRCFVFNCQLHGCSQDLIILKQIRVREELCAHYTPCN--  1395
             +N++L +DL+AAL SFDNLFC+RC VF+C+LHGCSQDL+   +   ++ L  H    N  
Sbjct  269   MNNFLVKDLEAALDSFDNLFCRRCLVFDCRLHGCSQDLVFPAE---KQPLWYHLDEGNVP  325

Query  1396  C*PHCGKKCPCVVKSIYCEKFCGCPLNCKI  1485
             C PHC +    V+KS      C  PLN  I
Sbjct  326   CGPHCYR---SVLKSERNATACS-PLNGDI  351


 Score = 65.9 bits (159),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSKK  2167
             +I+V GDHR+GIFA + ++AG+EL YDY+Y+PD  PAWA+  ++S  K
Sbjct  863   VIMVAGDHRVGIFAKERISAGEELFYDYRYEPDRAPAWARKPEASGSK  910



>ref|XP_008338375.1| PREDICTED: histone-lysine N-methyltransferase CLF-like [Malus 
domestica]
Length=694

 Score =   287 bits (735),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 135/234 (58%), Positives = 170/234 (73%), Gaps = 6/234 (3%)
 Frame = +1

Query  1339  ILKQIRVR-EELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKN  1515
             I K+I  R ++ C  Y PC C   CGK+C C+     CEK+CGCP  CK  F+GCHC K+
Sbjct  430   IRKRITERKDQPCRQYNPCTCQTACGKQCSCLQNGTCCEKYCGCPKTCKNRFRGCHCAKS  489

Query  1516  ECATNYCPCYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLL  1695
             +C +  CPC+A+ RECDPDVC  CWVSCGDG++G+P  +  N++C+NMKLLL  QQ+VLL
Sbjct  490   QCRSRQCPCFAADRECDPDVCRNCWVSCGDGTLGVPSQRGDNYECRNMKLLLKQQQRVLL  549

Query  1696  GRSDIAGWGAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQL  1875
             GRSD++GWGAFLKN    V+K+E++G YTGELISH EADK GK+YDR+N SFLFNLNDQ 
Sbjct  550   GRSDVSGWGAFLKN---SVAKHEYLGEYTGELISHREADKRGKIYDRENSSFLFNLNDQF  606

Query  1876  VIDAYRRGNKLKFINHSPDPNCFAKVNCSLSPCLLQCF--QLIVAGGSFSIDHR  2031
             V+DAYR+G+KLKF NHSPDPNC+AKV        +  F  + I AG     D+R
Sbjct  607   VLDAYRKGDKLKFANHSPDPNCYAKVIMVAGDHRVGIFAKERIAAGEELFYDYR  660


 Score = 85.5 bits (210),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 44/77 (57%), Positives = 55/77 (71%), Gaps = 6/77 (8%)
 Frame = +1

Query  1129  HFSRKPSEVKARYKDLIKEGATS---KNENTEVTI---NSYLDEDLDAALSSFDNLFCQR  1290
             +   K SEVKARY  L+KE   S   K+ +TE      NS++D+DLDAAL SFDNLFC+R
Sbjct  14    YVKEKSSEVKARYDTLVKEEEASGGCKSRDTEDISQIGNSFIDKDLDAALDSFDNLFCRR  73

Query  1291  CFVFNCQLHGCSQDLII  1341
             C VF+C+LHGCSQDL+ 
Sbjct  74    CLVFDCRLHGCSQDLVF  90


 Score = 64.7 bits (156),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSKK  2167
             +I+V GDHR+GIFA + + AG+EL YDY+Y+PD  PAWA+  ++S  K
Sbjct  632   VIMVAGDHRVGIFAKERIAAGEELFYDYRYEPDRAPAWARKPEASGSK  679



>ref|XP_011099118.1| PREDICTED: histone-lysine N-methyltransferase CLF isoform X3 
[Sesamum indicum]
Length=882

 Score =   291 bits (745),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 133/226 (59%), Positives = 168/226 (74%), Gaps = 21/226 (9%)
 Frame = +1

Query  1360  REELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKNECATNYCP  1539
             +++ C  Y+PC C   CGK CPC+V    CEK+CGCP +CK  F+GCHC K++C +  CP
Sbjct  626   KDQPCRQYSPCGCQSACGKTCPCLVNGTCCEKYCGCPKSCKNRFRGCHCAKSQCRSRQCP  685

Query  1540  CYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLLGRSDIAGW  1719
             C+A+ RECDPDVC  CW+SCGDG++G+P  +  N++C+NMKLLL  QQ+VLLGRSD++GW
Sbjct  686   CFAADRECDPDVCRNCWISCGDGTLGVPSQRGDNYECRNMKLLLKQQQRVLLGRSDVSGW  745

Query  1720  GAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQLVIDAYRRG  1899
             GAFLKN    V K+E++G YTGELISH EADK GK+YDR+N SFLFNLNDQ V+DAYR+G
Sbjct  746   GAFLKN---SVGKHEYLGEYTGELISHREADKRGKIYDRENSSFLFNLNDQFVLDAYRKG  802

Query  1900  NKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
             +KLKF NHSPDPNC+AKV             ++VAG     DHR G
Sbjct  803   DKLKFANHSPDPNCYAKV-------------IMVAG-----DHRVG  830


 Score =   209 bits (531),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 143/256 (56%), Positives = 176/256 (69%), Gaps = 17/256 (7%)
 Frame = +1

Query  691   GDGSADLLAKRQTDAFDLQNSIGTGSG-NKICSSQEDGYASSD--LRSSIVLKNAVCpik  861
             GDG  DLLAKRQ DA D+ + IGT +G N+  SSQEDGYA S   L SSI +KNAV PIK
Sbjct  82    GDGGVDLLAKRQKDAIDMHSGIGTSNGDNESSSSQEDGYAPSAILLGSSIAVKNAVRPIK  141

Query  862   lpklekippYTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALi-csdsdeeiieeege  1038
             LP+++K+PPYTTW FL RNQ+M EDQSV+GRRRIYYD N GEALI     +E + +EE +
Sbjct  142   LPEVKKLPPYTTWIFLDRNQRMTEDQSVVGRRRIYYDQNGGEALICSDSEEETVDDEEEK  201

Query  1039  nefaesedYILRM---------TIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLIKEGA  1191
              +F ESEDYILR+         TI++VGL D+ LDLLA   SRK  E+K RY+DLIK   
Sbjct  202   KDFVESEDYILRLVHLMQIAETTIKEVGLCDLTLDLLAQCLSRKSCEIKGRYEDLIKNEI  261

Query  1192  T---SKNENTEVTINSYLDEDLDAALSSFDNLFCQRCFVFNCQLHGCSQDLIILKQIRVR  1362
                   N N E  +N Y+D+DLDAAL SFDNLFC+RC VF+C+LHGCSQDL+   + ++ 
Sbjct  262   ALCRVNNGNAESFVNPYIDKDLDAALDSFDNLFCRRCLVFDCRLHGCSQDLVFSAEKQL-  320

Query  1363  EELCAHYTPCNC*PHC  1410
               LC       C P+C
Sbjct  321   PWLCPDVEKEPCGPNC  336


 Score = 66.2 bits (160),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSKK  2167
             +I+V GDHR+GIFA + ++AG+EL YDY+Y+PD  PAWAK  ++S  K
Sbjct  820   VIMVAGDHRVGIFAKERISAGEELFYDYRYEPDRAPAWAKKPEASGAK  867



>ref|XP_011099116.1| PREDICTED: histone-lysine N-methyltransferase CLF isoform X1 
[Sesamum indicum]
Length=912

 Score =   291 bits (746),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 133/226 (59%), Positives = 168/226 (74%), Gaps = 21/226 (9%)
 Frame = +1

Query  1360  REELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKNECATNYCP  1539
             +++ C  Y+PC C   CGK CPC+V    CEK+CGCP +CK  F+GCHC K++C +  CP
Sbjct  656   KDQPCRQYSPCGCQSACGKTCPCLVNGTCCEKYCGCPKSCKNRFRGCHCAKSQCRSRQCP  715

Query  1540  CYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLLGRSDIAGW  1719
             C+A+ RECDPDVC  CW+SCGDG++G+P  +  N++C+NMKLLL  QQ+VLLGRSD++GW
Sbjct  716   CFAADRECDPDVCRNCWISCGDGTLGVPSQRGDNYECRNMKLLLKQQQRVLLGRSDVSGW  775

Query  1720  GAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQLVIDAYRRG  1899
             GAFLKN    V K+E++G YTGELISH EADK GK+YDR+N SFLFNLNDQ V+DAYR+G
Sbjct  776   GAFLKN---SVGKHEYLGEYTGELISHREADKRGKIYDRENSSFLFNLNDQFVLDAYRKG  832

Query  1900  NKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
             +KLKF NHSPDPNC+AKV             ++VAG     DHR G
Sbjct  833   DKLKFANHSPDPNCYAKV-------------IMVAG-----DHRVG  860


 Score =   209 bits (532),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 143/256 (56%), Positives = 176/256 (69%), Gaps = 17/256 (7%)
 Frame = +1

Query  691   GDGSADLLAKRQTDAFDLQNSIGTGSG-NKICSSQEDGYASSD--LRSSIVLKNAVCpik  861
             GDG  DLLAKRQ DA D+ + IGT +G N+  SSQEDGYA S   L SSI +KNAV PIK
Sbjct  82    GDGGVDLLAKRQKDAIDMHSGIGTSNGDNESSSSQEDGYAPSAILLGSSIAVKNAVRPIK  141

Query  862   lpklekippYTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALi-csdsdeeiieeege  1038
             LP+++K+PPYTTW FL RNQ+M EDQSV+GRRRIYYD N GEALI     +E + +EE +
Sbjct  142   LPEVKKLPPYTTWIFLDRNQRMTEDQSVVGRRRIYYDQNGGEALICSDSEEETVDDEEEK  201

Query  1039  nefaesedYILRM---------TIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLIKEGA  1191
              +F ESEDYILR+         TI++VGL D+ LDLLA   SRK  E+K RY+DLIK   
Sbjct  202   KDFVESEDYILRLVHLMQIAETTIKEVGLCDLTLDLLAQCLSRKSCEIKGRYEDLIKNEI  261

Query  1192  T---SKNENTEVTINSYLDEDLDAALSSFDNLFCQRCFVFNCQLHGCSQDLIILKQIRVR  1362
                   N N E  +N Y+D+DLDAAL SFDNLFC+RC VF+C+LHGCSQDL+   + ++ 
Sbjct  262   ALCRVNNGNAESFVNPYIDKDLDAALDSFDNLFCRRCLVFDCRLHGCSQDLVFSAEKQL-  320

Query  1363  EELCAHYTPCNC*PHC  1410
               LC       C P+C
Sbjct  321   PWLCPDVEKEPCGPNC  336


 Score = 66.2 bits (160),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSKK  2167
             +I+V GDHR+GIFA + ++AG+EL YDY+Y+PD  PAWAK  ++S  K
Sbjct  850   VIMVAGDHRVGIFAKERISAGEELFYDYRYEPDRAPAWAKKPEASGAK  897



>ref|XP_004288020.1| PREDICTED: LOW QUALITY PROTEIN: histone-lysine N-methyltransferase 
CLF-like [Fragaria vesca subsp. vesca]
Length=912

 Score =   291 bits (746),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 134/226 (59%), Positives = 168/226 (74%), Gaps = 21/226 (9%)
 Frame = +1

Query  1360  REELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKNECATNYCP  1539
             +++ C  Y PC C   CGK+C C++    CEK+CGCP +CK  F+GCHC K++C +  CP
Sbjct  656   KDQPCRQYNPCTCQTACGKQCSCLLNGTCCEKYCGCPKSCKNRFRGCHCAKSQCRSRQCP  715

Query  1540  CYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLLGRSDIAGW  1719
             C+A+ RECDPDVC  CWVSCGDGS+G+P  +  N++C+NMKLLL  QQ+VLLGRSD++GW
Sbjct  716   CFAADRECDPDVCRNCWVSCGDGSLGVPNQRGDNYECRNMKLLLKQQQRVLLGRSDVSGW  775

Query  1720  GAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQLVIDAYRRG  1899
             GAFLKN    VSK+E++G YTGELISH EADK GK+YDR+N SFLFNLNDQ V+DAYR+G
Sbjct  776   GAFLKN---SVSKHEYLGEYTGELISHREADKRGKIYDRENSSFLFNLNDQFVLDAYRKG  832

Query  1900  NKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
             +KLKF NHSPDPNC+AKV             ++VAG     DHR G
Sbjct  833   DKLKFANHSPDPNCYAKV-------------IMVAG-----DHRVG  860


 Score =   201 bits (511),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 134/223 (60%), Positives = 165/223 (74%), Gaps = 11/223 (5%)
 Frame = +1

Query  700   SADLLAKRQTDAFDLQNSIGTGSGNKICSSQEDGYASSD--LRSSIVLKNAVCpiklpkl  873
             S DLL KRQ DAF LQN   +   N   SSQEDG  S+   L S++ +KNAV PIKLP++
Sbjct  89    SVDLLTKRQQDAFKLQNGDESNGSND--SSQEDGRGSTAVLLESNVAVKNAVRPIKLPEV  146

Query  874   ekippYTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALi-csdsdeeiieeegenefa  1050
             +++PPYTTW FL RNQ+M EDQS++GRRRIYYD N GEALI     +E I EEE + EF 
Sbjct  147   KRLPPYTTWVFLDRNQRMTEDQSILGRRRIYYDQNGGEALICSDSEEEAIDEEEEKREFV  206

Query  1051  esedYILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLIKEGAT---SKN---ENT  1212
             ESEDYILRMTI++ G+ D VL+ LA++FSR P+EVKARY+ LIKE  +   SKN   E+ 
Sbjct  207   ESEDYILRMTIKEAGVSDPVLESLAHYFSRSPTEVKARYEALIKEEESMGISKNTDDEDL  266

Query  1213  EVTINSYLDEDLDAALSSFDNLFCQRCFVFNCQLHGCSQDLII  1341
                 NS+LD+DLDAAL SFDNLFC+RC VF+C+LHGCSQDL+ 
Sbjct  267   SKNDNSFLDKDLDAALDSFDNLFCRRCLVFDCRLHGCSQDLVF  309


 Score = 63.9 bits (154),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSKK  2167
             +I+V GDHR+GIFA + + +G+EL YDY+Y+PD  PAWA+  ++S  K
Sbjct  850   VIMVAGDHRVGIFAKERIASGEELFYDYRYEPDRAPAWARKPEASGSK  897



>ref|XP_009788514.1| PREDICTED: histone-lysine N-methyltransferase CLF-like isoform 
X1 [Nicotiana sylvestris]
Length=923

 Score =   291 bits (746),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 137/234 (59%), Positives = 173/234 (74%), Gaps = 22/234 (9%)
 Frame = +1

Query  1339  ILKQIRVR-EELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKN  1515
             I K+I  R ++ C  + PC C   CGK+CPC+V    CEK+CGCP +CK  F+GCHC K+
Sbjct  659   IRKRISERKDQPCRQFNPCGCQGPCGKECPCIVNGTCCEKYCGCPKSCKNRFRGCHCAKS  718

Query  1516  ECATNYCPCYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLL  1695
             +C +  CPC+A+GRECDPDVC  CW+SCGDG++G+PP +  +H+C+NMKLLL  QQKVLL
Sbjct  719   QCRSRQCPCFAAGRECDPDVCRNCWISCGDGTLGVPPQRGDSHECRNMKLLLKQQQKVLL  778

Query  1696  GRSDIAGWGAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQL  1875
             GRSD++GWGAFLKN    V K+E++G YTGELISH EADK GK+YDR+N SFLFNLNDQ 
Sbjct  779   GRSDVSGWGAFLKN---TVGKHEYLGEYTGELISHREADKRGKIYDRENSSFLFNLNDQF  835

Query  1876  VIDAYRRGNKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
             V+DA+R+G+KLKF NHSP PNC+AKV             ++VAG     DHR G
Sbjct  836   VLDAHRKGDKLKFANHSPVPNCYAKV-------------MMVAG-----DHRVG  871


 Score =   208 bits (530),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 139/223 (62%), Positives = 170/223 (76%), Gaps = 6/223 (3%)
 Frame = +1

Query  691   GDGSADLLAKRQTDAFDLQNSIGTGSGNKICSSQED-GYASSD--LRSSIVLKNAVCpik  861
              D + DLL+KRQ DA D+QN I T +G+   +S ED GYA+S   L SSI +KNAV PIK
Sbjct  87    ADRTVDLLSKRQKDAIDMQNGIDTNNGDDDSNSSEDDGYATSAILLGSSIAVKNAVRPIK  146

Query  862   lpklekippYTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALi-csdsdeeiieeege  1038
             LP+ ++IPPYTTW FL RNQ+M EDQSV+GRRRIYYD N GE LI     +E + EEE +
Sbjct  147   LPEEKRIPPYTTWIFLDRNQRMTEDQSVVGRRRIYYDQNGGETLICSDSDEEVLEEEEEK  206

Query  1039  nefaesedYILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLIKE--GATSKNENT  1212
               FAESEDY+LRMTI++VGL D VL+LL    SRKPSEVKARY+DL+K+    +SKNE T
Sbjct  207   KVFAESEDYMLRMTIKEVGLSDSVLELLGQCLSRKPSEVKARYEDLVKKDNAGSSKNEYT  266

Query  1213  EVTINSYLDEDLDAALSSFDNLFCQRCFVFNCQLHGCSQDLII  1341
             E +++ YL +DLDAAL SFDNLFC+RC VF+C+LHGCSQDLI 
Sbjct  267   ESSLDLYLAKDLDAALDSFDNLFCRRCLVFDCRLHGCSQDLIF  309


 Score = 63.2 bits (152),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSKK  2167
             +++V GDHR+GIFA + + AG+EL YDY+Y+PD+ PAWA+  ++S  +
Sbjct  861   VMMVAGDHRVGIFANERICAGEELFYDYRYEPDSAPAWARKPEASGTR  908



>ref|XP_010531247.1| PREDICTED: histone-lysine N-methyltransferase CLF isoform X1 
[Tarenaya hassleriana]
Length=955

 Score =   292 bits (748),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 138/234 (59%), Positives = 174/234 (74%), Gaps = 6/234 (3%)
 Frame = +1

Query  1339  ILKQIRVR-EELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKN  1515
             I K+I  R ++ C  Y PCNC   CGK+C C++    CEK+CGCP NCK  F+GCHC K+
Sbjct  686   IRKRITERKDQPCRQYNPCNCQTACGKQCSCLLNGTCCEKYCGCPKNCKNRFRGCHCAKS  745

Query  1516  ECATNYCPCYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLL  1695
             +C +  CPC+A+ RECDPDVC  CWVSCGDG++G+P  +  N++C+NMKLLL  QQKVLL
Sbjct  746   QCRSRQCPCFAADRECDPDVCRNCWVSCGDGTLGVPNQRGDNYECRNMKLLLKQQQKVLL  805

Query  1696  GRSDIAGWGAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQL  1875
             GRSD++GWGAFLKN    VSK+E++G YTGELISH EADK GK+YDR+N SFLFNLNDQ 
Sbjct  806   GRSDVSGWGAFLKN---SVSKHEYLGEYTGELISHREADKRGKIYDRENSSFLFNLNDQF  862

Query  1876  VIDAYRRGNKLKFINHSPDPNCFAKVNCSLSPCLLQCF--QLIVAGGSFSIDHR  2031
             V+DAYR+G+KLKF NHSP+PNC+AKV        +  F  + I+AG     D+R
Sbjct  863   VLDAYRKGDKLKFANHSPEPNCYAKVIMVAGDHRVGIFARERIMAGEELFYDYR  916


 Score =   162 bits (410),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 122/258 (47%), Positives = 161/258 (62%), Gaps = 44/258 (17%)
 Frame = +1

Query  694   DGS---ADLLAKRQTDAFDLQNSIGTGSG-NKICSSQEDGYASSDL--RSSIVLKNAVCp  855
             DGS    DLLAKRQ D   +++ I  G G N   SS  D +A+S     SS+ +K ++ P
Sbjct  84    DGSNDGMDLLAKRQRDTLGIKSGIDAGDGDNNNHSSLGDAHANSTTIQGSSVPVKLSLRP  143

Query  856   iklpklekippYTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALi-csdsdeeiieee  1032
             +K+P+L+++PPYTTW FL RNQ+M EDQSV+GRRRIYYD N GEALI     +E   +E+
Sbjct  144   VKIPELKRLPPYTTWVFLDRNQRMTEDQSVVGRRRIYYDQNGGEALICSDSEEELAEDED  203

Query  1033  genefaesedYILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLIKEGATSKNENT  1212
              + +F ESEDYIL MTIE +GL D VL+ LAN  SR PSE+KAR++ L+KE   SKN ++
Sbjct  204   EKRDFVESEDYILCMTIEHLGLLDPVLEELANCLSRSPSEIKARHEVLMKEKQVSKNGDS  263

Query  1213  EVTINSYLDEDLDAALSSFDNLFCQRCF--------------------------------  1296
             +   NS+L++DL+AAL SFDNLFC+RC                                 
Sbjct  264   QAE-NSFLNKDLEAALDSFDNLFCRRCLVSSLVVHSILMFHLVRLLLGVPCTLTFCLLCS  322

Query  1297  ----VFNCQLHGCSQDLI  1338
                 VF+C+LHGCSQDL+
Sbjct  323   MAVQVFDCRLHGCSQDLV  340


 Score = 66.2 bits (160),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSKK  2167
             +I+V GDHR+GIFA + + AG+EL YDY+Y+PD  PAWA+  +SS  K
Sbjct  888   VIMVAGDHRVGIFARERIMAGEELFYDYRYEPDRAPAWARKPESSGSK  935



>ref|XP_011099117.1| PREDICTED: histone-lysine N-methyltransferase CLF isoform X2 
[Sesamum indicum]
Length=903

 Score =   291 bits (745),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 133/226 (59%), Positives = 168/226 (74%), Gaps = 21/226 (9%)
 Frame = +1

Query  1360  REELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKNECATNYCP  1539
             +++ C  Y+PC C   CGK CPC+V    CEK+CGCP +CK  F+GCHC K++C +  CP
Sbjct  647   KDQPCRQYSPCGCQSACGKTCPCLVNGTCCEKYCGCPKSCKNRFRGCHCAKSQCRSRQCP  706

Query  1540  CYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLLGRSDIAGW  1719
             C+A+ RECDPDVC  CW+SCGDG++G+P  +  N++C+NMKLLL  QQ+VLLGRSD++GW
Sbjct  707   CFAADRECDPDVCRNCWISCGDGTLGVPSQRGDNYECRNMKLLLKQQQRVLLGRSDVSGW  766

Query  1720  GAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQLVIDAYRRG  1899
             GAFLKN    V K+E++G YTGELISH EADK GK+YDR+N SFLFNLNDQ V+DAYR+G
Sbjct  767   GAFLKN---SVGKHEYLGEYTGELISHREADKRGKIYDRENSSFLFNLNDQFVLDAYRKG  823

Query  1900  NKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
             +KLKF NHSPDPNC+AKV             ++VAG     DHR G
Sbjct  824   DKLKFANHSPDPNCYAKV-------------IMVAG-----DHRVG  851


 Score =   216 bits (549),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 143/247 (58%), Positives = 175/247 (71%), Gaps = 8/247 (3%)
 Frame = +1

Query  691   GDGSADLLAKRQTDAFDLQNSIGTGSG-NKICSSQEDGYASSD--LRSSIVLKNAVCpik  861
             GDG  DLLAKRQ DA D+ + IGT +G N+  SSQEDGYA S   L SSI +KNAV PIK
Sbjct  82    GDGGVDLLAKRQKDAIDMHSGIGTSNGDNESSSSQEDGYAPSAILLGSSIAVKNAVRPIK  141

Query  862   lpklekippYTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALi-csdsdeeiieeege  1038
             LP+++K+PPYTTW FL RNQ+M EDQSV+GRRRIYYD N GEALI     +E + +EE +
Sbjct  142   LPEVKKLPPYTTWIFLDRNQRMTEDQSVVGRRRIYYDQNGGEALICSDSEEETVDDEEEK  201

Query  1039  nefaesedYILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLIKEGAT---SKNEN  1209
              +F ESEDYILR TI++VGL D+ LDLLA   SRK  E+K RY+DLIK         N N
Sbjct  202   KDFVESEDYILRTTIKEVGLCDLTLDLLAQCLSRKSCEIKGRYEDLIKNEIALCRVNNGN  261

Query  1210  TEVTINSYLDEDLDAALSSFDNLFCQRCFVFNCQLHGCSQDLIILKQIRVREELCAHYTP  1389
              E  +N Y+D+DLDAAL SFDNLFC+RC VF+C+LHGCSQDL+   + ++   LC     
Sbjct  262   AESFVNPYIDKDLDAALDSFDNLFCRRCLVFDCRLHGCSQDLVFSAEKQL-PWLCPDVEK  320

Query  1390  CNC*PHC  1410
               C P+C
Sbjct  321   EPCGPNC  327


 Score = 66.2 bits (160),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSKK  2167
             +I+V GDHR+GIFA + ++AG+EL YDY+Y+PD  PAWAK  ++S  K
Sbjct  841   VIMVAGDHRVGIFAKERISAGEELFYDYRYEPDRAPAWAKKPEASGAK  888



>ref|XP_006590653.1| PREDICTED: histone-lysine N-methyltransferase CLF-like isoform 
X2 [Glycine max]
Length=840

 Score =   290 bits (742),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 138/234 (59%), Positives = 171/234 (73%), Gaps = 22/234 (9%)
 Frame = +1

Query  1339  ILKQIRVR-EELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKN  1515
             I K+I  R ++ C  Y PC C   CGK+CPC+     CEK+CGCP +CK  F+GCHC K+
Sbjct  576   IRKRITERKDQPCRQYNPCGCQTACGKQCPCLQNGTCCEKYCGCPKSCKNRFRGCHCAKS  635

Query  1516  ECATNYCPCYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLL  1695
             +C +  CPC+A+ RECDPDVC  CWVSCGDG++GIP  +  N++C+NMKLLL  QQ+VLL
Sbjct  636   QCRSRQCPCFAADRECDPDVCRNCWVSCGDGTLGIPSQRGDNYECRNMKLLLKQQQRVLL  695

Query  1696  GRSDIAGWGAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQL  1875
             GRSD++GWGAFLKN    V K+E++G YTGELISH EADK GK+YDR+N SFLFNLNDQ 
Sbjct  696   GRSDVSGWGAFLKN---SVGKHEYLGEYTGELISHREADKRGKIYDRENSSFLFNLNDQF  752

Query  1876  VIDAYRRGNKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
             V+DAYR+G+KLKF NHSPDPNC+AKV             ++VAG     DHR G
Sbjct  753   VLDAYRKGDKLKFANHSPDPNCYAKV-------------IMVAG-----DHRVG  788


 Score =   176 bits (447),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 118/224 (53%), Positives = 158/224 (71%), Gaps = 10/224 (4%)
 Frame = +1

Query  700   SADLLAKRQTDAFDLQNSIGTGSGNKICSSQED---GYASSDLRSSIVLKNAVCpiklpk  870
             S DLL KRQ DA D+ N +   +G+   +   D   G  +  L S++ +KNAV PIKLP+
Sbjct  71    SLDLLTKRQKDAIDMHNGVHASNGDVESNGYHDDSHGSTAVLLGSNVAVKNAVRPIKLPE  130

Query  871   lekippYTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALi-csdsdeeiieeegenef  1047
             ++K+PPYTTW FL RNQ+M EDQSV+GRRRIYYD N GEALI     +E + +EE + +F
Sbjct  131   VKKLPPYTTWIFLDRNQRMTEDQSVVGRRRIYYDQNGGEALICSDSEEETMDDEEEKRQF  190

Query  1048  aesedYILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDL-IKEGA-----TSKNEN  1209
              ESEDYILRMT+++ GL D+VL+ LA  FSR  SE+KA+Y+ L I++ A        +E 
Sbjct  191   IESEDYILRMTVKEFGLTDIVLESLAQCFSRNTSEIKAKYETLSIQDNAGGCSKAGDSEE  250

Query  1210  TEVTINSYLDEDLDAALSSFDNLFCQRCFVFNCQLHGCSQDLII  1341
                + NS+L++DL+AAL SFDNLFC+RC VF+C+LHGCSQDL+ 
Sbjct  251   NSQSGNSFLEKDLEAALDSFDNLFCRRCLVFDCRLHGCSQDLVF  294


 Score = 64.7 bits (156),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSKK  2167
             +I+V GDHR+GIFA + + AG+EL YDY+Y+PD  PAWA+  ++S  K
Sbjct  778   VIMVAGDHRVGIFAKERICAGEELFYDYRYEPDRAPAWARKPEASGSK  825



>ref|XP_006590652.1| PREDICTED: histone-lysine N-methyltransferase CLF-like isoform 
X1 [Glycine max]
Length=861

 Score =   290 bits (743),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 138/234 (59%), Positives = 171/234 (73%), Gaps = 22/234 (9%)
 Frame = +1

Query  1339  ILKQIRVR-EELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKN  1515
             I K+I  R ++ C  Y PC C   CGK+CPC+     CEK+CGCP +CK  F+GCHC K+
Sbjct  597   IRKRITERKDQPCRQYNPCGCQTACGKQCPCLQNGTCCEKYCGCPKSCKNRFRGCHCAKS  656

Query  1516  ECATNYCPCYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLL  1695
             +C +  CPC+A+ RECDPDVC  CWVSCGDG++GIP  +  N++C+NMKLLL  QQ+VLL
Sbjct  657   QCRSRQCPCFAADRECDPDVCRNCWVSCGDGTLGIPSQRGDNYECRNMKLLLKQQQRVLL  716

Query  1696  GRSDIAGWGAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQL  1875
             GRSD++GWGAFLKN    V K+E++G YTGELISH EADK GK+YDR+N SFLFNLNDQ 
Sbjct  717   GRSDVSGWGAFLKN---SVGKHEYLGEYTGELISHREADKRGKIYDRENSSFLFNLNDQF  773

Query  1876  VIDAYRRGNKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
             V+DAYR+G+KLKF NHSPDPNC+AKV             ++VAG     DHR G
Sbjct  774   VLDAYRKGDKLKFANHSPDPNCYAKV-------------IMVAG-----DHRVG  809


 Score =   176 bits (447),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 118/224 (53%), Positives = 158/224 (71%), Gaps = 10/224 (4%)
 Frame = +1

Query  700   SADLLAKRQTDAFDLQNSIGTGSGNKICSSQED---GYASSDLRSSIVLKNAVCpiklpk  870
             S DLL KRQ DA D+ N +   +G+   +   D   G  +  L S++ +KNAV PIKLP+
Sbjct  92    SLDLLTKRQKDAIDMHNGVHASNGDVESNGYHDDSHGSTAVLLGSNVAVKNAVRPIKLPE  151

Query  871   lekippYTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALi-csdsdeeiieeegenef  1047
             ++K+PPYTTW FL RNQ+M EDQSV+GRRRIYYD N GEALI     +E + +EE + +F
Sbjct  152   VKKLPPYTTWIFLDRNQRMTEDQSVVGRRRIYYDQNGGEALICSDSEEETMDDEEEKRQF  211

Query  1048  aesedYILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDL-IKEGA-----TSKNEN  1209
              ESEDYILRMT+++ GL D+VL+ LA  FSR  SE+KA+Y+ L I++ A        +E 
Sbjct  212   IESEDYILRMTVKEFGLTDIVLESLAQCFSRNTSEIKAKYETLSIQDNAGGCSKAGDSEE  271

Query  1210  TEVTINSYLDEDLDAALSSFDNLFCQRCFVFNCQLHGCSQDLII  1341
                + NS+L++DL+AAL SFDNLFC+RC VF+C+LHGCSQDL+ 
Sbjct  272   NSQSGNSFLEKDLEAALDSFDNLFCRRCLVFDCRLHGCSQDLVF  315


 Score = 64.7 bits (156),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSKK  2167
             +I+V GDHR+GIFA + + AG+EL YDY+Y+PD  PAWA+  ++S  K
Sbjct  799   VIMVAGDHRVGIFAKERICAGEELFYDYRYEPDRAPAWARKPEASGSK  846



>ref|XP_010317757.1| PREDICTED: EZ2 protein isoform X1 [Solanum lycopersicum]
Length=888

 Score =   291 bits (744),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 137/234 (59%), Positives = 172/234 (74%), Gaps = 22/234 (9%)
 Frame = +1

Query  1339  ILKQIRVR-EELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKN  1515
             I K+I  R ++ C  + PC C   CGK+CPC+V    CEK+CGCP  CK  F+GCHC K+
Sbjct  624   IRKRISERKDQPCRQFNPCGCQGPCGKECPCIVNGTCCEKYCGCPKGCKNRFRGCHCAKS  683

Query  1516  ECATNYCPCYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLL  1695
             +C +  CPC+A+GRECDPDVC  CW+SCGDG++G+PP +  +H+C+NMKLLL  QQKVLL
Sbjct  684   QCRSRQCPCFAAGRECDPDVCRNCWISCGDGTLGVPPQRGDSHECRNMKLLLKQQQKVLL  743

Query  1696  GRSDIAGWGAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQL  1875
             GRSD++GWGAFLKN    V K+E++G YTGELISH EADK GK+YDR+N SFLFNLNDQ 
Sbjct  744   GRSDVSGWGAFLKN---TVGKHEYLGEYTGELISHREADKRGKIYDRENSSFLFNLNDQF  800

Query  1876  VIDAYRRGNKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
             V+DA+R+G+KLKF NHSP PNC+AKV             ++VAG     DHR G
Sbjct  801   VLDAHRKGDKLKFANHSPVPNCYAKV-------------MMVAG-----DHRVG  836


 Score =   206 bits (523),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 139/221 (63%), Positives = 171/221 (77%), Gaps = 6/221 (3%)
 Frame = +1

Query  697   GSADLLAKRQTDAFDLQNSIGTGSGNKICSSQED-GYASSD--LRSSIVLKNAVCpiklp  867
             G  DLL+KRQ DA D+QN I T +G+   +S ED GYA+S   L SSI +KNAV PIKLP
Sbjct  89    GKIDLLSKRQKDALDMQNGIDTSNGDDDSNSSEDDGYATSAILLGSSIAVKNAVRPIKLP  148

Query  868   klekippYTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALi-csdsdeeiieeegene  1044
             ++++IPPYT+W FL RNQ+M EDQSV+GRRRIYYD N GE LI     +E + EEE +  
Sbjct  149   EVKRIPPYTSWIFLDRNQRMTEDQSVVGRRRIYYDQNGGETLICSDSDEEVLEEEEEKKV  208

Query  1045  faesedYILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLIK--EGATSKNENTEV  1218
             FAESEDY+LRMTI++VGL D+VLDLL +  SRKPSEVKARY+ L+K  +  TSKNE TE 
Sbjct  209   FAESEDYMLRMTIKEVGLSDIVLDLLGHCLSRKPSEVKARYEALVKADDVGTSKNEFTES  268

Query  1219  TINSYLDEDLDAALSSFDNLFCQRCFVFNCQLHGCSQDLII  1341
             +++ YL +DLDAAL SFDNLFC+RC VF+C+LHGCSQDLI 
Sbjct  269   SLDLYLAKDLDAALDSFDNLFCRRCLVFDCRLHGCSQDLIF  309


 Score = 62.8 bits (151),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSKK  2167
             +++V GDHR+GIFA + + AG+EL YDY+Y+PD+ PAWA+  ++S  +
Sbjct  826   VMMVAGDHRVGIFANERICAGEELFYDYRYEPDSAPAWARKPEASGTR  873



>ref|XP_006573641.1| PREDICTED: histone-lysine N-methyltransferase CLF-like [Glycine 
max]
Length=861

 Score =   290 bits (742),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 139/234 (59%), Positives = 171/234 (73%), Gaps = 22/234 (9%)
 Frame = +1

Query  1339  ILKQIRVR-EELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKN  1515
             I K+I  R ++ C  Y PC C   CGK+CPC+     CEK+CGCP +CK  F+GCHC K+
Sbjct  597   IRKRITERKDQPCRQYNPCGCQSACGKQCPCLQNGTCCEKYCGCPKSCKNRFRGCHCAKS  656

Query  1516  ECATNYCPCYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLL  1695
             +C +  CPC+A+ RECDPDVC  CWVSCGDG++GIP  +  N++C+NMKLLL  QQ+VLL
Sbjct  657   QCRSRQCPCFAADRECDPDVCRNCWVSCGDGTLGIPSQRGDNYECRNMKLLLKQQQRVLL  716

Query  1696  GRSDIAGWGAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQL  1875
             GRSDI+GWGAFLKN    V K+E++G YTGELISH EADK GK+YDR+N SFLFNLNDQ 
Sbjct  717   GRSDISGWGAFLKN---SVGKHEYLGEYTGELISHREADKRGKIYDRENSSFLFNLNDQF  773

Query  1876  VIDAYRRGNKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
             V+DAYR+G+KLKF NHSPDPNC+AKV             ++VAG     DHR G
Sbjct  774   VLDAYRKGDKLKFANHSPDPNCYAKV-------------IMVAG-----DHRVG  809


 Score =   173 bits (439),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 119/224 (53%), Positives = 156/224 (70%), Gaps = 10/224 (4%)
 Frame = +1

Query  700   SADLLAKRQTDAFDLQNSIGTGSGNKICSSQED---GYASSDLRSSIVLKNAVCpiklpk  870
             S DLL KRQ DA D+ N +   +G+   +   D   G  +  L S++ +KNAV PIKLP+
Sbjct  92    SLDLLTKRQKDAIDMHNGVHASNGDVESNGYHDDNHGSTAVLLGSNVAVKNAVRPIKLPE  151

Query  871   lekippYTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALi-csdsdeeiieeegenef  1047
             ++K+PPYTTW FL RNQ+M EDQSV+GRRRIYYD N GEALI     +E + +EE + EF
Sbjct  152   VKKLPPYTTWIFLDRNQRMTEDQSVVGRRRIYYDQNGGEALICSDSEEETMDDEEEKREF  211

Query  1048  aesedYILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLI---KEGATSK---NEN  1209
              ESEDYILRMT+++ GL D+VL+ LA  FSR  SE+KA+Y+ L      G  SK   +E 
Sbjct  212   IESEDYILRMTVKEFGLTDIVLESLAQCFSRNTSEIKAKYETLSIHDNAGGCSKAGDSEE  271

Query  1210  TEVTINSYLDEDLDAALSSFDNLFCQRCFVFNCQLHGCSQDLII  1341
                + N +L++DL+AAL SFDNLFC+RC VF+C+LHGCSQDL+ 
Sbjct  272   NSQSGNFFLEKDLEAALDSFDNLFCRRCLVFDCRLHGCSQDLVF  315


 Score = 64.7 bits (156),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSKK  2167
             +I+V GDHR+GIFA + + AG+EL YDY+Y+PD  PAWA+  ++S  K
Sbjct  799   VIMVAGDHRVGIFAKERICAGEELFYDYRYEPDRAPAWARKPEASGSK  846



>ref|NP_001234765.1| EZ2 protein [Solanum lycopersicum]
 gb|ABU96078.1| EZ2 [Solanum lycopersicum]
Length=921

 Score =   291 bits (744),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 137/234 (59%), Positives = 172/234 (74%), Gaps = 22/234 (9%)
 Frame = +1

Query  1339  ILKQIRVR-EELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKN  1515
             I K+I  R ++ C  + PC C   CGK+CPC+V    CEK+CGCP  CK  F+GCHC K+
Sbjct  657   IRKRISERKDQPCRQFNPCGCQGPCGKECPCIVNGTCCEKYCGCPKGCKNRFRGCHCAKS  716

Query  1516  ECATNYCPCYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLL  1695
             +C +  CPC+A+GRECDPDVC  CW+SCGDG++G+PP +  +H+C+NMKLLL  QQKVLL
Sbjct  717   QCRSRQCPCFAAGRECDPDVCRNCWISCGDGTLGVPPQRGDSHECRNMKLLLKQQQKVLL  776

Query  1696  GRSDIAGWGAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQL  1875
             GRSD++GWGAFLKN    V K+E++G YTGELISH EADK GK+YDR+N SFLFNLNDQ 
Sbjct  777   GRSDVSGWGAFLKN---TVGKHEYLGEYTGELISHREADKRGKIYDRENSSFLFNLNDQF  833

Query  1876  VIDAYRRGNKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
             V+DA+R+G+KLKF NHSP PNC+AKV             ++VAG     DHR G
Sbjct  834   VLDAHRKGDKLKFANHSPVPNCYAKV-------------MMVAG-----DHRVG  869


 Score =   206 bits (524),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 139/221 (63%), Positives = 171/221 (77%), Gaps = 6/221 (3%)
 Frame = +1

Query  697   GSADLLAKRQTDAFDLQNSIGTGSGNKICSSQED-GYASSD--LRSSIVLKNAVCpiklp  867
             G  DLL+KRQ DA D+QN I T +G+   +S ED GYA+S   L SSI +KNAV PIKLP
Sbjct  89    GKIDLLSKRQKDALDMQNGIDTSNGDDDSNSSEDDGYATSAILLGSSIAVKNAVRPIKLP  148

Query  868   klekippYTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALi-csdsdeeiieeegene  1044
             ++++IPPYT+W FL RNQ+M EDQSV+GRRRIYYD N GE LI     +E + EEE +  
Sbjct  149   EVKRIPPYTSWIFLDRNQRMTEDQSVVGRRRIYYDQNGGETLICSDSDEEVLEEEEEKKV  208

Query  1045  faesedYILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLIK--EGATSKNENTEV  1218
             FAESEDY+LRMTI++VGL D+VLDLL +  SRKPSEVKARY+ L+K  +  TSKNE TE 
Sbjct  209   FAESEDYMLRMTIKEVGLSDIVLDLLGHCLSRKPSEVKARYEALVKADDVGTSKNEFTES  268

Query  1219  TINSYLDEDLDAALSSFDNLFCQRCFVFNCQLHGCSQDLII  1341
             +++ YL +DLDAAL SFDNLFC+RC VF+C+LHGCSQDLI 
Sbjct  269   SLDLYLAKDLDAALDSFDNLFCRRCLVFDCRLHGCSQDLIF  309


 Score = 62.8 bits (151),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSKK  2167
             +++V GDHR+GIFA + + AG+EL YDY+Y+PD+ PAWA+  ++S  +
Sbjct  859   VMMVAGDHRVGIFANERICAGEELFYDYRYEPDSAPAWARKPEASGTR  906



>ref|XP_009367302.1| PREDICTED: histone-lysine N-methyltransferase CLF-like isoform 
X2 [Pyrus x bretschneideri]
Length=750

 Score =   287 bits (735),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 136/234 (58%), Positives = 169/234 (72%), Gaps = 6/234 (3%)
 Frame = +1

Query  1339  ILKQIRVR-EELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKN  1515
             I K+I  R ++ C  Y PC C   CGK+C C+     CEK+CGCP  CK  F+GCHC K+
Sbjct  486   IRKRITERKDQPCRQYNPCTCQTACGKQCSCLQNGTCCEKYCGCPKTCKNRFRGCHCAKS  545

Query  1516  ECATNYCPCYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLL  1695
             +C +  CPC+A+ RECDPDVC  CWVSCGDG++G+P  +  N++C+NMKLLL  QQ+VLL
Sbjct  546   QCRSRQCPCFAADRECDPDVCRNCWVSCGDGTLGVPSQRGDNYECRNMKLLLKQQQRVLL  605

Query  1696  GRSDIAGWGAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQL  1875
             GRSDI+GWGAFLKN    V K+E++G YTGELISH EADK GK+YDR+N SFLFNLNDQ 
Sbjct  606   GRSDISGWGAFLKN---SVPKHEYLGEYTGELISHREADKRGKIYDRENSSFLFNLNDQF  662

Query  1876  VIDAYRRGNKLKFINHSPDPNCFAKVNCSLSPCLLQCF--QLIVAGGSFSIDHR  2031
             V+DAYR+G+KLKF NHSPDPNC+AKV        +  F  + I AG     D+R
Sbjct  663   VLDAYRKGDKLKFANHSPDPNCYAKVIMVAGDHRVGIFAKERIAAGEELFYDYR  716


 Score =   142 bits (359),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 88/146 (60%), Positives = 106/146 (73%), Gaps = 7/146 (5%)
 Frame = +1

Query  925   MPEDQSVIGRRRIYYDMNSGEALi-csdsdeeiieeegenefaesedYILRMTIEKVGLY  1101
             M EDQSV+GRRRIYYD N GEALI     +E + EEE +  F ESED+ILR  I++VG  
Sbjct  1     MTEDQSVVGRRRIYYDQNGGEALICSDSEEEAVDEEEEKRVFVESEDFILRSAIKEVGFS  60

Query  1102  DMVLDLLANHFSRKPSEVKARYKDLIKEGATS---KNENTEVTI---NSYLDEDLDAALS  1263
             D +L+ LA +FSR PSEVKARY  L+KE   S   KN +TE      NS+LD+DLDAAL 
Sbjct  61    DPMLESLAQYFSRSPSEVKARYDTLLKEKEASGGCKNRDTEDISQIGNSFLDKDLDAALD  120

Query  1264  SFDNLFCQRCFVFNCQLHGCSQDLII  1341
             SFDNLFC+RC VF+C+LHGCSQDL+ 
Sbjct  121   SFDNLFCRRCLVFDCRLHGCSQDLVF  146


 Score = 64.7 bits (156),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSKK  2167
             +I+V GDHR+GIFA + + AG+EL YDY+Y+PD  PAWA+  ++S  K
Sbjct  688   VIMVAGDHRVGIFAKERIAAGEELFYDYRYEPDRAPAWARKPEASGSK  735



>ref|XP_009343281.1| PREDICTED: histone-lysine N-methyltransferase CLF-like isoform 
X2 [Pyrus x bretschneideri]
Length=750

 Score =   287 bits (735),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 136/234 (58%), Positives = 169/234 (72%), Gaps = 6/234 (3%)
 Frame = +1

Query  1339  ILKQIRVR-EELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKN  1515
             I K+I  R ++ C  Y PC C   CGK+C C+     CEK+CGCP  CK  F+GCHC K+
Sbjct  486   IRKRITERKDQPCRQYNPCTCQTACGKQCSCLQNGTCCEKYCGCPKTCKNRFRGCHCAKS  545

Query  1516  ECATNYCPCYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLL  1695
             +C +  CPC+A+ RECDPDVC  CWVSCGDG++G+P  +  N++C+NMKLLL  QQ+VLL
Sbjct  546   QCRSRQCPCFAADRECDPDVCRNCWVSCGDGTLGVPSQRGDNYECRNMKLLLKQQQRVLL  605

Query  1696  GRSDIAGWGAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQL  1875
             GRSDI+GWGAFLKN    V K+E++G YTGELISH EADK GK+YDR+N SFLFNLNDQ 
Sbjct  606   GRSDISGWGAFLKN---SVPKHEYLGEYTGELISHREADKRGKIYDRENSSFLFNLNDQF  662

Query  1876  VIDAYRRGNKLKFINHSPDPNCFAKVNCSLSPCLLQCF--QLIVAGGSFSIDHR  2031
             V+DAYR+G+KLKF NHSPDPNC+AKV        +  F  + I AG     D+R
Sbjct  663   VLDAYRKGDKLKFANHSPDPNCYAKVIMVAGDHRVGIFAKERIAAGEELFYDYR  716


 Score =   142 bits (359),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 88/146 (60%), Positives = 106/146 (73%), Gaps = 7/146 (5%)
 Frame = +1

Query  925   MPEDQSVIGRRRIYYDMNSGEALi-csdsdeeiieeegenefaesedYILRMTIEKVGLY  1101
             M EDQSV+GRRRIYYD N GEALI     +E + EEE +  F ESED+ILR  I++VG  
Sbjct  1     MTEDQSVVGRRRIYYDQNGGEALICSDSEEEAVDEEEEKRVFVESEDFILRSAIKEVGFS  60

Query  1102  DMVLDLLANHFSRKPSEVKARYKDLIKEGATS---KNENTEVTI---NSYLDEDLDAALS  1263
             D +L+ LA +FSR PSEVKARY  L+KE   S   KN +TE      NS+LD+DLDAAL 
Sbjct  61    DPMLESLAQYFSRSPSEVKARYDTLLKEKEASGGCKNRDTEDISQIGNSFLDKDLDAALD  120

Query  1264  SFDNLFCQRCFVFNCQLHGCSQDLII  1341
             SFDNLFC+RC VF+C+LHGCSQDL+ 
Sbjct  121   SFDNLFCRRCLVFDCRLHGCSQDLVF  146


 Score = 64.7 bits (156),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSKK  2167
             +I+V GDHR+GIFA + + AG+EL YDY+Y+PD  PAWA+  ++S  K
Sbjct  688   VIMVAGDHRVGIFAKERIAAGEELFYDYRYEPDRAPAWARKPEASGSK  735



>ref|XP_007047318.1| SET domain-containing protein isoform 2 [Theobroma cacao]
 gb|EOX91475.1| SET domain-containing protein isoform 2 [Theobroma cacao]
Length=675

 Score =   285 bits (729),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 138/236 (58%), Positives = 173/236 (73%), Gaps = 24/236 (10%)
 Frame = +1

Query  1339  ILKQIRVR-EELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKN  1515
             I K+I  R ++ C  Y PC+C   CGK+C C++    CEK+CGCP +CK  F+GCHC K+
Sbjct  410   IRKRITERKDQPCRQYNPCSCQTACGKQCSCLLNGTCCEKYCGCPKSCKNRFRGCHCAKS  469

Query  1516  ECATNYCPCYASGRECDPDVCCFCWVSCGD--GSIGIPPDKVSNHKCQNMKLLLGHQQKV  1689
             +C +  CPC+A+ RECDPDVC  CWVSCGD  GS+G+PP +  N++C+NMKLLL  QQ+V
Sbjct  470   QCRSRQCPCFAADRECDPDVCRNCWVSCGDGTGSLGVPPQRGDNYECRNMKLLLKQQQRV  529

Query  1690  LLGRSDIAGWGAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLND  1869
             LLGRSD++GWGAFLKN    V K+E++G YTGELISH EADK GK+YDR+N SFLFNLND
Sbjct  530   LLGRSDVSGWGAFLKN---SVGKHEYLGEYTGELISHREADKRGKIYDRENSSFLFNLND  586

Query  1870  QLVIDAYRRGNKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
             Q V+DAYR+G+KLKF NHSPDPNC+AKV             ++VAG     DHR G
Sbjct  587   QFVLDAYRKGDKLKFANHSPDPNCYAKV-------------IMVAG-----DHRVG  624


 Score = 72.4 bits (176),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 42/55 (76%), Gaps = 1/55 (2%)
 Frame = +1

Query  1180  KEGATSKNENTEV-TINSYLDEDLDAALSSFDNLFCQRCFVFNCQLHGCSQDLII  1341
             K+   SKN + E    NS+L++DL+A L SFDNLFC+RC VF+C+LHGCSQDLI 
Sbjct  5     KDAGASKNADIEAQNWNSFLEKDLEAGLDSFDNLFCRRCLVFDCRLHGCSQDLIF  59


 Score = 67.8 bits (164),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSKK  2167
             +I+V GDHR+GIFA + +NAG+EL YDY+Y+PD  PAWA+  ++S  K
Sbjct  614   VIMVAGDHRVGIFAKERINAGEELFYDYRYEPDRAPAWARKPEASGSK  661



>ref|XP_008340296.1| PREDICTED: histone-lysine N-methyltransferase CLF [Malus domestica]
Length=916

 Score =   290 bits (742),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 136/234 (58%), Positives = 169/234 (72%), Gaps = 6/234 (3%)
 Frame = +1

Query  1339  ILKQIRVR-EELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKN  1515
             I K+I  R ++ C  Y PC C   CGK+C C+     CEK+CGCP  CK  F+GCHC K+
Sbjct  652   IRKRITERKDQPCRQYNPCTCQTACGKQCSCLQNGTCCEKYCGCPKTCKNRFRGCHCAKS  711

Query  1516  ECATNYCPCYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLL  1695
             +C +  CPC+A+ RECDPDVC  CWVSCGDG++G+P  +  N++C+NMKLLL  QQ+VLL
Sbjct  712   QCRSRQCPCFAADRECDPDVCRNCWVSCGDGTLGVPSQRGDNYECRNMKLLLKQQQRVLL  771

Query  1696  GRSDIAGWGAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQL  1875
             GRSDI+GWGAFLKN    V K+E++G YTGELISH EADK GK+YDR+N SFLFNLNDQ 
Sbjct  772   GRSDISGWGAFLKN---SVPKHEYLGEYTGELISHREADKRGKIYDRENSSFLFNLNDQF  828

Query  1876  VIDAYRRGNKLKFINHSPDPNCFAKVNCSLSPCLLQCF--QLIVAGGSFSIDHR  2031
             V+DAYR+G+KLKF NHSPDPNC+AKV        +  F  + I AG     D+R
Sbjct  829   VLDAYRKGDKLKFANHSPDPNCYAKVIMVAGDHRVGIFAKERIAAGEELFYDYR  882


 Score =   194 bits (494),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 130/223 (58%), Positives = 162/223 (73%), Gaps = 10/223 (4%)
 Frame = +1

Query  700   SADLLAKRQTDAFDLQNSIGTGSGNKICSSQEDGYASSD--LRSSIVLKNAVCpiklpkl  873
             S DLL KRQ DAF LQN I   S     SSQEDG+ S+   L S++ +K++V PIKLP++
Sbjct  91    SVDLLTKRQKDAFALQNGIEL-SNESNDSSQEDGHGSTAVLLESNVAVKSSVRPIKLPEV  149

Query  874   ekippYTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALi-csdsdeeiieeegenefa  1050
             +++PPYT W FL RNQ+M EDQSV+GRRRIYYD N GEALI     +E + EEE +  F 
Sbjct  150   KRLPPYTXWIFLDRNQRMTEDQSVVGRRRIYYDQNGGEALICSDSEEEAVDEEEEKRVFV  209

Query  1051  esedYILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLIKEGATS---KNENTEVT  1221
             ESED+ILR  I++VG+ D VL+ LA +FSR PSEVKARY  L+KE   S   KN +TE +
Sbjct  210   ESEDFILRSAIKEVGISDPVLESLAQYFSRSPSEVKARYDTLLKEEEASGGCKNRDTEDS  269

Query  1222  I---NSYLDEDLDAALSSFDNLFCQRCFVFNCQLHGCSQDLII  1341
                 NS+LD+DLDAAL SFDNLFC+RC VF+C+LHGCSQDL+ 
Sbjct  270   SQIGNSFLDKDLDAALDSFDNLFCRRCLVFDCRLHGCSQDLVF  312


 Score = 65.1 bits (157),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSKK  2167
             +I+V GDHR+GIFA + + AG+EL YDY+Y+PD  PAWA+  ++S  K
Sbjct  854   VIMVAGDHRVGIFAKERIAAGEELFYDYRYEPDRAPAWARKPEASGSK  901



>ref|XP_009343280.1| PREDICTED: histone-lysine N-methyltransferase CLF-like isoform 
X1 [Pyrus x bretschneideri]
Length=916

 Score =   290 bits (741),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 136/234 (58%), Positives = 169/234 (72%), Gaps = 6/234 (3%)
 Frame = +1

Query  1339  ILKQIRVR-EELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKN  1515
             I K+I  R ++ C  Y PC C   CGK+C C+     CEK+CGCP  CK  F+GCHC K+
Sbjct  652   IRKRITERKDQPCRQYNPCTCQTACGKQCSCLQNGTCCEKYCGCPKTCKNRFRGCHCAKS  711

Query  1516  ECATNYCPCYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLL  1695
             +C +  CPC+A+ RECDPDVC  CWVSCGDG++G+P  +  N++C+NMKLLL  QQ+VLL
Sbjct  712   QCRSRQCPCFAADRECDPDVCRNCWVSCGDGTLGVPSQRGDNYECRNMKLLLKQQQRVLL  771

Query  1696  GRSDIAGWGAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQL  1875
             GRSDI+GWGAFLKN    V K+E++G YTGELISH EADK GK+YDR+N SFLFNLNDQ 
Sbjct  772   GRSDISGWGAFLKN---SVPKHEYLGEYTGELISHREADKRGKIYDRENSSFLFNLNDQF  828

Query  1876  VIDAYRRGNKLKFINHSPDPNCFAKVNCSLSPCLLQCF--QLIVAGGSFSIDHR  2031
             V+DAYR+G+KLKF NHSPDPNC+AKV        +  F  + I AG     D+R
Sbjct  829   VLDAYRKGDKLKFANHSPDPNCYAKVIMVAGDHRVGIFAKERIAAGEELFYDYR  882


 Score =   197 bits (500),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 130/223 (58%), Positives = 163/223 (73%), Gaps = 10/223 (4%)
 Frame = +1

Query  700   SADLLAKRQTDAFDLQNSIGTGSGNKICSSQEDGYASSD--LRSSIVLKNAVCpiklpkl  873
             S DLL KRQ DAF LQN I   +G+   SSQEDG+ S+   L S++ +K++V PIKLP++
Sbjct  91    SVDLLTKRQKDAFALQNGIELSNGSND-SSQEDGHGSTAVLLESNVAVKSSVRPIKLPEV  149

Query  874   ekippYTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALi-csdsdeeiieeegenefa  1050
             +++PPYTTW FL RNQ+M EDQSV+GRRRIYYD N GEALI     +E + EEE +  F 
Sbjct  150   KRLPPYTTWIFLDRNQRMTEDQSVVGRRRIYYDQNGGEALICSDSEEEAVDEEEEKRVFV  209

Query  1051  esedYILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLIKEGATS---KNENTEVT  1221
             ESED+ILR  I++VG  D +L+ LA +FSR PSEVKARY  L+KE   S   KN +TE  
Sbjct  210   ESEDFILRSAIKEVGFSDPMLESLAQYFSRSPSEVKARYDTLLKEKEASGGCKNRDTEDI  269

Query  1222  I---NSYLDEDLDAALSSFDNLFCQRCFVFNCQLHGCSQDLII  1341
                 NS+LD+DLDAAL SFDNLFC+RC VF+C+LHGCSQDL+ 
Sbjct  270   SQIGNSFLDKDLDAALDSFDNLFCRRCLVFDCRLHGCSQDLVF  312


 Score = 65.1 bits (157),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSKK  2167
             +I+V GDHR+GIFA + + AG+EL YDY+Y+PD  PAWA+  ++S  K
Sbjct  854   VIMVAGDHRVGIFAKERIAAGEELFYDYRYEPDRAPAWARKPEASGSK  901



>ref|XP_007156782.1| hypothetical protein PHAVU_002G017200g [Phaseolus vulgaris]
 gb|ESW28776.1| hypothetical protein PHAVU_002G017200g [Phaseolus vulgaris]
Length=861

 Score =   289 bits (739),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 138/234 (59%), Positives = 171/234 (73%), Gaps = 22/234 (9%)
 Frame = +1

Query  1339  ILKQIRVR-EELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKN  1515
             I K+I  R ++ C  Y PC C   CGK+C C++    CEK+CGCP +CK  F+GCHC K+
Sbjct  597   IRKRITERKDQPCRQYNPCGCQSACGKQCSCLLNGTCCEKYCGCPKSCKNRFRGCHCAKS  656

Query  1516  ECATNYCPCYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLL  1695
             +C +  CPC+A+ RECDPDVC  CWVSCGDGS+GIP  +  N++C+NMKLLL  QQ+VLL
Sbjct  657   QCRSRQCPCFAADRECDPDVCRNCWVSCGDGSLGIPSQRGDNYECRNMKLLLKQQQRVLL  716

Query  1696  GRSDIAGWGAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQL  1875
             GRSD++GWGAFLKN    V K+E++G YTGELISH EADK GK+YDR+N SFLFNLNDQ 
Sbjct  717   GRSDVSGWGAFLKN---SVGKHEYLGEYTGELISHREADKRGKIYDRENSSFLFNLNDQF  773

Query  1876  VIDAYRRGNKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
             V+DAYR+G+KLKF NHSPDPNC+AKV             ++VAG     DHR G
Sbjct  774   VLDAYRKGDKLKFANHSPDPNCYAKV-------------IMVAG-----DHRVG  809


 Score =   175 bits (444),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 122/231 (53%), Positives = 163/231 (71%), Gaps = 13/231 (6%)
 Frame = +1

Query  688   VGDG--SADLLAKRQTDAFDLQNSIGTGSGNKICSS-QEDGYASSD--LRSSIVLKNAVC  852
             VGD   S DLL KRQ DA D+ N +   +G+   +   ED + S+   L S++ +KNAV 
Sbjct  84    VGDSNRSLDLLTKRQKDAIDMHNGVHASNGDVESNGYHEDSHGSTAVLLGSNVAVKNAVR  143

Query  853   piklpklekippYTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALi-csdsdeeiiee  1029
             PIKLP+++K+PPYTTW FL RNQ+M EDQSV+GRRRIYYD N GEALI     +E + +E
Sbjct  144   PIKLPEIKKLPPYTTWIFLDRNQRMTEDQSVVGRRRIYYDQNGGEALICSDSEEEIMEDE  203

Query  1030  egenefaesedYILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLI-----KEGAT  1194
             E + EF ESEDYILRMT+++ GL D V++ LA  FSR  +E+KARY+ L       +G++
Sbjct  204   EEKREFIESEDYILRMTVKEFGLTDNVMESLAQCFSRNTNEIKARYEALSIHQDNADGSS  263

Query  1195  SKNENTE--VTINSYLDEDLDAALSSFDNLFCQRCFVFNCQLHGCSQDLII  1341
                ++ E   T NS+L++DL+AAL SFDNLFC+RC VF+C+LHGCSQDL+ 
Sbjct  264   KAVDSVENSQTGNSFLEKDLEAALDSFDNLFCRRCLVFDCRLHGCSQDLVF  314


 Score = 64.7 bits (156),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSKK  2167
             +I+V GDHR+GIFA + + AG+EL YDY+Y+PD  PAWA+  ++S  K
Sbjct  799   VIMVAGDHRVGIFAKERICAGEELFYDYRYEPDRAPAWARKPEASGSK  846



>ref|XP_009367294.1| PREDICTED: histone-lysine N-methyltransferase CLF-like isoform 
X1 [Pyrus x bretschneideri]
Length=916

 Score =   289 bits (740),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 136/234 (58%), Positives = 169/234 (72%), Gaps = 6/234 (3%)
 Frame = +1

Query  1339  ILKQIRVR-EELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKN  1515
             I K+I  R ++ C  Y PC C   CGK+C C+     CEK+CGCP  CK  F+GCHC K+
Sbjct  652   IRKRITERKDQPCRQYNPCTCQTACGKQCSCLQNGTCCEKYCGCPKTCKNRFRGCHCAKS  711

Query  1516  ECATNYCPCYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLL  1695
             +C +  CPC+A+ RECDPDVC  CWVSCGDG++G+P  +  N++C+NMKLLL  QQ+VLL
Sbjct  712   QCRSRQCPCFAADRECDPDVCRNCWVSCGDGTLGVPSQRGDNYECRNMKLLLKQQQRVLL  771

Query  1696  GRSDIAGWGAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQL  1875
             GRSDI+GWGAFLKN    V K+E++G YTGELISH EADK GK+YDR+N SFLFNLNDQ 
Sbjct  772   GRSDISGWGAFLKN---SVPKHEYLGEYTGELISHREADKRGKIYDRENSSFLFNLNDQF  828

Query  1876  VIDAYRRGNKLKFINHSPDPNCFAKVNCSLSPCLLQCF--QLIVAGGSFSIDHR  2031
             V+DAYR+G+KLKF NHSPDPNC+AKV        +  F  + I AG     D+R
Sbjct  829   VLDAYRKGDKLKFANHSPDPNCYAKVIMVAGDHRVGIFAKERIAAGEELFYDYR  882


 Score =   196 bits (499),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 130/223 (58%), Positives = 163/223 (73%), Gaps = 10/223 (4%)
 Frame = +1

Query  700   SADLLAKRQTDAFDLQNSIGTGSGNKICSSQEDGYASSD--LRSSIVLKNAVCpiklpkl  873
             S DLL KRQ DAF LQN I   +G+   SSQEDG+ S+   L S++ +K++V PIKLP++
Sbjct  91    SVDLLTKRQKDAFALQNGIELSNGSND-SSQEDGHGSTAVLLESNVAVKSSVRPIKLPEV  149

Query  874   ekippYTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALi-csdsdeeiieeegenefa  1050
             +++PPYTTW FL RNQ+M EDQSV+GRRRIYYD N GEALI     +E + EEE +  F 
Sbjct  150   KRLPPYTTWIFLDRNQRMTEDQSVVGRRRIYYDQNGGEALICSDSEEEAVDEEEEKRVFV  209

Query  1051  esedYILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLIKEGATS---KNENTEVT  1221
             ESED+ILR  I++VG  D +L+ LA +FSR PSEVKARY  L+KE   S   KN +TE  
Sbjct  210   ESEDFILRSAIKEVGFSDPMLESLAQYFSRSPSEVKARYDTLLKEKEASGGCKNRDTEDI  269

Query  1222  I---NSYLDEDLDAALSSFDNLFCQRCFVFNCQLHGCSQDLII  1341
                 NS+LD+DLDAAL SFDNLFC+RC VF+C+LHGCSQDL+ 
Sbjct  270   SQIGNSFLDKDLDAALDSFDNLFCRRCLVFDCRLHGCSQDLVF  312


 Score = 65.1 bits (157),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSKK  2167
             +I+V GDHR+GIFA + + AG+EL YDY+Y+PD  PAWA+  ++S  K
Sbjct  854   VIMVAGDHRVGIFAKERIAAGEELFYDYRYEPDRAPAWARKPEASGSK  901



>ref|XP_007047317.1| SET domain-containing protein isoform 1 [Theobroma cacao]
 ref|XP_007047319.1| SET domain-containing protein isoform 1 [Theobroma cacao]
 gb|EOX91474.1| SET domain-containing protein isoform 1 [Theobroma cacao]
 gb|EOX91476.1| SET domain-containing protein isoform 1 [Theobroma cacao]
Length=924

 Score =   289 bits (739),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 138/236 (58%), Positives = 173/236 (73%), Gaps = 24/236 (10%)
 Frame = +1

Query  1339  ILKQIRVR-EELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKN  1515
             I K+I  R ++ C  Y PC+C   CGK+C C++    CEK+CGCP +CK  F+GCHC K+
Sbjct  659   IRKRITERKDQPCRQYNPCSCQTACGKQCSCLLNGTCCEKYCGCPKSCKNRFRGCHCAKS  718

Query  1516  ECATNYCPCYASGRECDPDVCCFCWVSCGD--GSIGIPPDKVSNHKCQNMKLLLGHQQKV  1689
             +C +  CPC+A+ RECDPDVC  CWVSCGD  GS+G+PP +  N++C+NMKLLL  QQ+V
Sbjct  719   QCRSRQCPCFAADRECDPDVCRNCWVSCGDGTGSLGVPPQRGDNYECRNMKLLLKQQQRV  778

Query  1690  LLGRSDIAGWGAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLND  1869
             LLGRSD++GWGAFLKN    V K+E++G YTGELISH EADK GK+YDR+N SFLFNLND
Sbjct  779   LLGRSDVSGWGAFLKN---SVGKHEYLGEYTGELISHREADKRGKIYDRENSSFLFNLND  835

Query  1870  QLVIDAYRRGNKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
             Q V+DAYR+G+KLKF NHSPDPNC+AKV             ++VAG     DHR G
Sbjct  836   QFVLDAYRKGDKLKFANHSPDPNCYAKV-------------IMVAG-----DHRVG  873


 Score =   197 bits (501),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 133/246 (54%), Positives = 169/246 (69%), Gaps = 10/246 (4%)
 Frame = +1

Query  694   DGSADLLAKRQTDAFDLQNSIGTGSGNKICSSQEDGYASSDLRSSIVLKNAVCpiklpkl  873
             D ++DLL KRQ DA  +QN I   +G+K   S ++   +  + SSI +KNAV PIKL ++
Sbjct  88    DSASDLLTKRQKDALGMQNGIDVSNGDKDSHSYQEASTAVLMGSSIPVKNAVRPIKLTEV  147

Query  874   ekippYTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALi-csdsdeeiieeegenefa  1050
             +K+PPYTTW FL RNQ+M EDQSV+GRRRIYYD N GEALI     +E I EEE + +F 
Sbjct  148   KKLPPYTTWIFLDRNQRMTEDQSVVGRRRIYYDQNGGEALICSDSEEEVIEEEEEKRDFV  207

Query  1051  esedYILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLIKE---GATSKNENTEV-  1218
             ESED+ILRMTI++VGL D VL+ LA  FSR P EVKARY+ L+KE      SKN + E  
Sbjct  208   ESEDFILRMTIKEVGLSDPVLESLAQCFSRSPPEVKARYETLMKEEKDAGASKNADIEAQ  267

Query  1219  TINSYLDEDLDAALSSFDNLFCQRCFVFNCQLHGCSQDLIILKQIRVREELCAHYTPCN-  1395
               NS+L++DL+A L SFDNLFC+RC VF+C+LHGCSQDLI       ++   +H    N 
Sbjct  268   NWNSFLEKDLEAGLDSFDNLFCRRCLVFDCRLHGCSQDLIFPAD---KQTPWSHPDEENA  324

Query  1396  -C*PHC  1410
              C PHC
Sbjct  325   PCGPHC  330


 Score = 68.2 bits (165),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSKK  2167
             +I+V GDHR+GIFA + +NAG+EL YDY+Y+PD  PAWA+  ++S  K
Sbjct  863   VIMVAGDHRVGIFAKERINAGEELFYDYRYEPDRAPAWARKPEASGSK  910



>ref|XP_002310129.2| Polycomb group protein CURLY LEAF [Populus trichocarpa]
 gb|EEE90579.2| Polycomb group protein CURLY LEAF [Populus trichocarpa]
Length=892

 Score =   288 bits (737),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 136/234 (58%), Positives = 172/234 (74%), Gaps = 22/234 (9%)
 Frame = +1

Query  1339  ILKQIRVR-EELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKN  1515
             I K+I  R ++ C  Y PC+C   CGK+C C++    CEK+CGCP +CK  F+GCHC K+
Sbjct  628   IRKRITERKDQPCRQYNPCSCQAACGKQCTCLLNGTCCEKYCGCPKSCKNRFRGCHCAKS  687

Query  1516  ECATNYCPCYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLL  1695
             +C +  CPC+A+ RECDPDVC  CWVSCGDG++GIP  +  N++C+NMKLLL  QQ+VLL
Sbjct  688   QCRSRQCPCFAADRECDPDVCRNCWVSCGDGTLGIPSQRGDNYECRNMKLLLKQQQRVLL  747

Query  1696  GRSDIAGWGAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQL  1875
             GRSD++GWGAFLKN    V K+E++G YTGELISH EADK GK+YDR+N SFLFNLNDQ 
Sbjct  748   GRSDVSGWGAFLKN---SVGKHEYLGEYTGELISHREADKRGKIYDRENSSFLFNLNDQF  804

Query  1876  VIDAYRRGNKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
             V+DAYR+G+KLKF NHSP+PNC+AKV             ++VAG     DHR G
Sbjct  805   VLDAYRKGDKLKFANHSPEPNCYAKV-------------IMVAG-----DHRVG  840


 Score =   182 bits (463),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 127/224 (57%), Positives = 160/224 (71%), Gaps = 8/224 (4%)
 Frame = +1

Query  694   DGSADLLAKRQTDAFDLQNSIGTGSGNK-ICSSQEDGYASSD--LRSSIVLKNAVCpikl  864
             D S DL  KRQ DA  +   I + + +K    S+EDG  S+   L SSI +KNAV PIKL
Sbjct  67    DNSVDLFTKRQKDALSMHGGIDSSNVDKDSLGSEEDGNTSTAVLLGSSIPVKNAVRPIKL  126

Query  865   pklekippYTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALi-csdsdeeiieeegen  1041
             P+++++PPYT+W FL RNQ+M EDQSV+GRRRIYYD N GEALI     +E I EEE + 
Sbjct  127   PEVKRLPPYTSWIFLDRNQRMTEDQSVLGRRRIYYDQNGGEALICSDSEEEIIDEEEEKR  186

Query  1042  efaesedYILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLIKEGAT---SKNENT  1212
             +F ESEDYILRMTI++ GL D V++ LA  FSR  SEVK R++ L KE      SKN++ 
Sbjct  187   DFLESEDYILRMTIKEAGLSDPVVESLAQCFSRSSSEVKVRFEVLKKEEKAVEDSKNKDN  246

Query  1213  EV-TINSYLDEDLDAALSSFDNLFCQRCFVFNCQLHGCSQDLII  1341
             E  T+NS+LD+DL+ AL SFDNLFC+RC VF+C+LHGCSQDLI 
Sbjct  247   EAQTLNSFLDKDLEVALDSFDNLFCRRCLVFDCRLHGCSQDLIF  290


 Score = 68.2 bits (165),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSKK  2167
             +I+V GDHR+GIFA + +NAG+EL YDY+Y+PD  PAWA+  ++S  K
Sbjct  830   VIMVAGDHRVGIFAKERINAGEELFYDYRYEPDRAPAWARKPEASGSK  877



>ref|XP_008241485.1| PREDICTED: histone-lysine N-methyltransferase CLF [Prunus mume]
Length=914

 Score =   288 bits (737),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 135/234 (58%), Positives = 169/234 (72%), Gaps = 6/234 (3%)
 Frame = +1

Query  1339  ILKQIRVR-EELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKN  1515
             I K+I  R ++ C  Y PC C   CGK+C C+     CEK+CGCP  CK  F+GCHC K+
Sbjct  650   IRKRITERKDQPCRQYNPCTCQTACGKQCSCLQNGTCCEKYCGCPKTCKNRFRGCHCAKS  709

Query  1516  ECATNYCPCYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLL  1695
             +C +  CPC+A+ RECDPDVC  CWVSCGDGS+G+P  +  N++C+NMKLLL  QQ+VLL
Sbjct  710   QCRSRQCPCFAADRECDPDVCRNCWVSCGDGSLGVPNQRGDNYECRNMKLLLKQQQRVLL  769

Query  1696  GRSDIAGWGAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQL  1875
             GRSD++GWGAFLKN    V K+E++G YTGELISH EADK GK+YDR+N SFLFNLNDQ 
Sbjct  770   GRSDVSGWGAFLKN---SVGKHEYLGEYTGELISHREADKRGKIYDRENSSFLFNLNDQF  826

Query  1876  VIDAYRRGNKLKFINHSPDPNCFAKVNCSLSPCLLQCF--QLIVAGGSFSIDHR  2031
             V+DAYR+G+KLKF NH+PDPNC+AKV        +  F  + I AG     D+R
Sbjct  827   VLDAYRKGDKLKFANHAPDPNCYAKVIMVAGDHRVGIFAKERITAGEELFYDYR  880


 Score =   189 bits (481),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 126/223 (57%), Positives = 156/223 (70%), Gaps = 13/223 (6%)
 Frame = +1

Query  700   SADLLAKRQTDAFDLQNSIGTGSGNKICSSQEDGYASSD--LRSSIVLKNAVCpiklpkl  873
             S DLL KRQ DAF LQN I          SQEDG+ S+   L S++ +K++V PIKLP++
Sbjct  91    SVDLLTKRQKDAFALQNGIDVSKDG----SQEDGHGSTAVLLESNVAVKSSVRPIKLPEV  146

Query  874   ekippYTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALi-csdsdeeiieeegenefa  1050
             +++PPYTTW FL RNQ+M EDQSV+GRRRIYYD N GEALI     +E + EE+ + +F 
Sbjct  147   KRLPPYTTWIFLDRNQRMTEDQSVLGRRRIYYDQNGGEALICSDSEEEAVDEEDEKRDFV  206

Query  1051  esedYILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLIKEGA------TSKNENT  1212
             ESEDYIL M I++VG  D VL+ LA  FSR PSEVKARY  L+KE        T  NE+ 
Sbjct  207   ESEDYILSMAIKEVGFSDPVLESLAQCFSRSPSEVKARYDTLVKEEEAVGGCKTMDNEDI  266

Query  1213  EVTINSYLDEDLDAALSSFDNLFCQRCFVFNCQLHGCSQDLII  1341
                 N +LD+DLDAAL SFDNLFC+RC VF+C+LHGCSQDL+ 
Sbjct  267   SQNGNYFLDKDLDAALDSFDNLFCRRCLVFDCRLHGCSQDLVF  309


 Score = 65.9 bits (159),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSKK  2167
             +I+V GDHR+GIFA + + AG+EL YDY+Y+PD  PAWA+  ++S  K
Sbjct  852   VIMVAGDHRVGIFAKERITAGEELFYDYRYEPDRAPAWARKPEASGSK  899



>ref|XP_010677348.1| PREDICTED: histone-lysine N-methyltransferase CLF isoform X1 
[Beta vulgaris subsp. vulgaris]
Length=914

 Score =   288 bits (737),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 136/234 (58%), Positives = 170/234 (73%), Gaps = 22/234 (9%)
 Frame = +1

Query  1339  ILKQIRVR-EELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKN  1515
             I K+I  R ++ C  Y PC C   CGK+C C++    CEK+CGCP +CK  F+GCHC K+
Sbjct  650   IRKRISERKDQPCRQYNPCGCESACGKQCSCLLNGTCCEKYCGCPKSCKNRFRGCHCAKS  709

Query  1516  ECATNYCPCYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLL  1695
             +C +  CPC+A+ RECDPDVC  CWVSCGDG++G+P  +  N+ C+NMKLLL  QQ+VLL
Sbjct  710   QCRSRQCPCFAADRECDPDVCRNCWVSCGDGTLGVPNQRGDNYGCRNMKLLLKQQQRVLL  769

Query  1696  GRSDIAGWGAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQL  1875
             GRSD++GWGAFLKN    V K+E++G YTGELISH EADK GK+YDR+N SFLFNLNDQ 
Sbjct  770   GRSDVSGWGAFLKN---SVGKHEYLGEYTGELISHREADKRGKIYDRENSSFLFNLNDQF  826

Query  1876  VIDAYRRGNKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
             V+DAYR+G+KLKF NHSPDPNC+AKV             ++VAG     DHR G
Sbjct  827   VLDAYRKGDKLKFANHSPDPNCYAKV-------------IMVAG-----DHRVG  862


 Score =   175 bits (444),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 120/225 (53%), Positives = 156/225 (69%), Gaps = 12/225 (5%)
 Frame = +1

Query  694   DGSADLLAKRQTDAFDLQNSI-GTGSGNKICSSQEDGYASSDLRSSIVLKNAVCpiklpk  870
             + S  LL KRQ DA ++QN I G   G     SQE  +A+  L +SI +KN V  I+LP+
Sbjct  85    EKSTALLVKRQNDAINMQNGIEGGKKGEDGSGSQE--HAAVLLGASIPIKNTVRAIRLPE  142

Query  871   lekippYTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALi-csdsdeeiieeegenef  1047
             ++++PPYTTW FL RNQ+M EDQSV+GRRRIYYD   GEALI     +E I EEE + EF
Sbjct  143   VKRLPPYTTWMFLDRNQRMTEDQSVLGRRRIYYDPTGGEALICSDSEEEVIEEEEDKKEF  202

Query  1048  aesedYILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLIKE-------GATSKNE  1206
               SED+ILR T+++VGL D VLDLL   FS+KP+++KARY+ L +E       G     E
Sbjct  203   VRSEDHILRNTVQQVGLSDAVLDLLGQCFSKKPTDIKARYEALCEEEKAKTGLGNGDTVE  262

Query  1207  NTEVTINSYLDEDLDAALSSFDNLFCQRCFVFNCQLHGCSQDLII  1341
              +E + N Y+D+DL+ AL SFDNLFC+RC+VF+C+LHGCSQDLI 
Sbjct  263   TSEYS-NPYIDKDLEGALDSFDNLFCRRCYVFDCRLHGCSQDLIF  306


 Score = 69.7 bits (169),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/48 (58%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSKK  2167
             +I+V GDHR+GIFA + MNAG+EL YDY+Y+PD  PAWA+  + S  K
Sbjct  852   VIMVAGDHRVGIFAKERMNAGEELFYDYRYEPDRAPAWARKPEESGSK  899



>ref|XP_010677349.1| PREDICTED: histone-lysine N-methyltransferase CLF isoform X2 
[Beta vulgaris subsp. vulgaris]
Length=911

 Score =   288 bits (737),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 136/234 (58%), Positives = 170/234 (73%), Gaps = 22/234 (9%)
 Frame = +1

Query  1339  ILKQIRVR-EELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKN  1515
             I K+I  R ++ C  Y PC C   CGK+C C++    CEK+CGCP +CK  F+GCHC K+
Sbjct  647   IRKRISERKDQPCRQYNPCGCESACGKQCSCLLNGTCCEKYCGCPKSCKNRFRGCHCAKS  706

Query  1516  ECATNYCPCYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLL  1695
             +C +  CPC+A+ RECDPDVC  CWVSCGDG++G+P  +  N+ C+NMKLLL  QQ+VLL
Sbjct  707   QCRSRQCPCFAADRECDPDVCRNCWVSCGDGTLGVPNQRGDNYGCRNMKLLLKQQQRVLL  766

Query  1696  GRSDIAGWGAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQL  1875
             GRSD++GWGAFLKN    V K+E++G YTGELISH EADK GK+YDR+N SFLFNLNDQ 
Sbjct  767   GRSDVSGWGAFLKN---SVGKHEYLGEYTGELISHREADKRGKIYDRENSSFLFNLNDQF  823

Query  1876  VIDAYRRGNKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
             V+DAYR+G+KLKF NHSPDPNC+AKV             ++VAG     DHR G
Sbjct  824   VLDAYRKGDKLKFANHSPDPNCYAKV-------------IMVAG-----DHRVG  859


 Score =   175 bits (443),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 120/225 (53%), Positives = 156/225 (69%), Gaps = 12/225 (5%)
 Frame = +1

Query  694   DGSADLLAKRQTDAFDLQNSI-GTGSGNKICSSQEDGYASSDLRSSIVLKNAVCpiklpk  870
             + S  LL KRQ DA ++QN I G   G     SQE  +A+  L +SI +KN V  I+LP+
Sbjct  82    EKSTALLVKRQNDAINMQNGIEGGKKGEDGSGSQE--HAAVLLGASIPIKNTVRAIRLPE  139

Query  871   lekippYTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALi-csdsdeeiieeegenef  1047
             ++++PPYTTW FL RNQ+M EDQSV+GRRRIYYD   GEALI     +E I EEE + EF
Sbjct  140   VKRLPPYTTWMFLDRNQRMTEDQSVLGRRRIYYDPTGGEALICSDSEEEVIEEEEDKKEF  199

Query  1048  aesedYILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLIKE-------GATSKNE  1206
               SED+ILR T+++VGL D VLDLL   FS+KP+++KARY+ L +E       G     E
Sbjct  200   VRSEDHILRNTVQQVGLSDAVLDLLGQCFSKKPTDIKARYEALCEEEKAKTGLGNGDTVE  259

Query  1207  NTEVTINSYLDEDLDAALSSFDNLFCQRCFVFNCQLHGCSQDLII  1341
              +E + N Y+D+DL+ AL SFDNLFC+RC+VF+C+LHGCSQDLI 
Sbjct  260   TSEYS-NPYIDKDLEGALDSFDNLFCRRCYVFDCRLHGCSQDLIF  303


 Score = 69.7 bits (169),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/48 (58%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSKK  2167
             +I+V GDHR+GIFA + MNAG+EL YDY+Y+PD  PAWA+  + S  K
Sbjct  849   VIMVAGDHRVGIFAKERMNAGEELFYDYRYEPDRAPAWARKPEESGSK  896



>ref|XP_010263482.1| PREDICTED: histone-lysine N-methyltransferase CLF-like isoform 
X3 [Nelumbo nucifera]
Length=930

 Score =   288 bits (737),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 135/234 (58%), Positives = 171/234 (73%), Gaps = 22/234 (9%)
 Frame = +1

Query  1339  ILKQIRVR-EELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKN  1515
             I K+I  R ++ C  + PCNC   CGK+C C++    CEK+CGCP +CK  F+GCHC K+
Sbjct  666   IRKRITERKDQPCRQFNPCNCKSACGKQCACLLNGTCCEKYCGCPKSCKNRFRGCHCAKS  725

Query  1516  ECATNYCPCYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLL  1695
             +C +  CPC+A+ RECDPDVC  CWV CGDG++G+P  +  N++C+NMKLLL  QQ+VLL
Sbjct  726   QCRSRQCPCFAADRECDPDVCRNCWVGCGDGTLGVPSQRGDNYECRNMKLLLKQQQRVLL  785

Query  1696  GRSDIAGWGAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQL  1875
             GRSD++GWGAFLKN    V K+E++G YTGELISH EADK GK+YDR+N SFLFNLNDQ 
Sbjct  786   GRSDVSGWGAFLKN---SVGKHEYLGEYTGELISHREADKRGKIYDRENSSFLFNLNDQF  842

Query  1876  VIDAYRRGNKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
             V+DAYR+G+KLKF NHSPDPNC+AKV             ++VAG     DHR G
Sbjct  843   VLDAYRKGDKLKFANHSPDPNCYAKV-------------IMVAG-----DHRVG  878


 Score =   188 bits (478),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 130/223 (58%), Positives = 161/223 (72%), Gaps = 12/223 (5%)
 Frame = +1

Query  706   DLLAKRQTDAFDLQNSIGTGSGNKICS-SQEDGYASSDL--RSSIVLKNAVCpiklpkle  876
             DLL KRQ DAF + N +   +G K  + SQED YASS +   SS  +KN V PIKLP+++
Sbjct  92    DLLTKRQRDAFGMLNGLDLTNGEKDKNGSQEDSYASSAVLVGSSFGMKNVVRPIKLPEVK  151

Query  877   kippYTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALi-csdsdeeiieeegenefae  1053
             K+PPYTTW FL RNQ+M EDQSV+GRRRIYYD N GEALI     +E + EEE + EF +
Sbjct  152   KLPPYTTWIFLDRNQRMTEDQSVVGRRRIYYDQNGGEALICSDSEEEIVEEEEEKREFVD  211

Query  1054  sedYILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLIK-------EGATSKNENT  1212
             SEDYILRMTI++VGL D VLD LA  FSR P EVKARY+ L+K       E   S ++ T
Sbjct  212   SEDYILRMTIQEVGLSDAVLDSLAQCFSRSPCEVKARYEILMKGEKDAQCEKKGSTDDKT  271

Query  1213  EVTINSYLDEDLDAALSSFDNLFCQRCFVFNCQLHGCSQDLII  1341
             ++  +S+ D+DLDAAL SFDNLFC+RC VF+C+LHGCSQDL+ 
Sbjct  272   QMD-DSFFDKDLDAALDSFDNLFCRRCLVFDCRLHGCSQDLVF  313


 Score = 68.2 bits (165),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSKK  2167
             +I+V GDHR+GIFA + +NAG+EL YDY+Y+PD  PAWAK  +++  K
Sbjct  868   VIMVAGDHRVGIFAKERINAGEELFYDYRYEPDRAPAWAKKPETTGSK  915



>ref|XP_007204662.1| hypothetical protein PRUPE_ppa001213mg [Prunus persica]
 gb|EMJ05861.1| hypothetical protein PRUPE_ppa001213mg [Prunus persica]
Length=880

 Score =   287 bits (734),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 135/234 (58%), Positives = 169/234 (72%), Gaps = 6/234 (3%)
 Frame = +1

Query  1339  ILKQIRVR-EELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKN  1515
             I K+I  R ++ C  Y PC C   CGK+C C+     CEK+CGCP  CK  F+GCHC K+
Sbjct  616   IRKRITERKDQPCRQYNPCTCQTACGKQCSCLQNGTCCEKYCGCPKTCKNRFRGCHCAKS  675

Query  1516  ECATNYCPCYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLL  1695
             +C +  CPC+A+ RECDPDVC  CWVSCGDGS+G+P  +  N++C+NMKLLL  QQ+VLL
Sbjct  676   QCRSRQCPCFAADRECDPDVCRNCWVSCGDGSLGVPNQRGDNYECRNMKLLLKQQQRVLL  735

Query  1696  GRSDIAGWGAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQL  1875
             GRSD++GWGAFLKN    V K+E++G YTGELISH EADK GK+YDR+N SFLFNLNDQ 
Sbjct  736   GRSDVSGWGAFLKN---SVGKHEYLGEYTGELISHREADKRGKIYDRENSSFLFNLNDQF  792

Query  1876  VIDAYRRGNKLKFINHSPDPNCFAKVNCSLSPCLLQCF--QLIVAGGSFSIDHR  2031
             V+DAYR+G+KLKF NH+PDPNC+AKV        +  F  + I AG     D+R
Sbjct  793   VLDAYRKGDKLKFANHAPDPNCYAKVIMVAGDHRVGIFAKERITAGEELFYDYR  846


 Score =   177 bits (449),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 123/223 (55%), Positives = 153/223 (69%), Gaps = 14/223 (6%)
 Frame = +1

Query  700   SADLLAKRQTDAFDLQNSIGTGSGNKICSSQEDGYASSD--LRSSIVLKNAVCpiklpkl  873
             S DLL KRQ DAF LQN I          SQEDG+ S+   L S++ +K++V PIKLP++
Sbjct  56    SVDLLTKRQKDAFALQNGIDVSKD----GSQEDGHGSTAVLLESNVAVKSSVRPIKLPEV  111

Query  874   ekippYTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALi-csdsdeeiieeegenefa  1050
             +++PPYTTW FL RNQ+M EDQSV+GRRRIYYD N GEALI     +E + EE+ + +F 
Sbjct  112   KRLPPYTTWIFLDRNQRMTEDQSVLGRRRIYYDQNGGEALICSDSEEEAVDEEDEKRDFV  171

Query  1051  esedYILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLIKEGA------TSKNENT  1212
             ESEDYIL M I++VG  D VL+ LA  FSR PSEVK RY+    E        T  NE+ 
Sbjct  172   ESEDYILSMAIKEVGFSDPVLESLAQCFSRSPSEVK-RYETPSNEEEAVGGCKTMDNEDI  230

Query  1213  EVTINSYLDEDLDAALSSFDNLFCQRCFVFNCQLHGCSQDLII  1341
                 N +LD+DLDAAL SFDNLFC+RC VF+C+LHGCSQDL+ 
Sbjct  231   SQNGNYFLDKDLDAALDSFDNLFCRRCLVFDCRLHGCSQDLVF  273


 Score = 65.5 bits (158),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSKK  2167
             +I+V GDHR+GIFA + + AG+EL YDY+Y+PD  PAWA+  ++S  K
Sbjct  818   VIMVAGDHRVGIFAKERITAGEELFYDYRYEPDRAPAWARKPEASGSK  865



>ref|XP_008457756.1| PREDICTED: histone-lysine N-methyltransferase CLF [Cucumis melo]
Length=923

 Score =   288 bits (736),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 137/234 (59%), Positives = 171/234 (73%), Gaps = 22/234 (9%)
 Frame = +1

Query  1339  ILKQIRVR-EELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKN  1515
             I K+I  R ++ C  Y PC C   CGK+C C++    CEK+CGCP +CK  F+GCHC K+
Sbjct  659   IRKRITERKDQPCRQYNPCGCQTACGKQCACLLNGTCCEKYCGCPKSCKNRFRGCHCAKS  718

Query  1516  ECATNYCPCYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLL  1695
             +C +  CPC+A+ RECDPDVC  CWVSCGDG++G+P  +  N++C+NMKLLL  QQ+VLL
Sbjct  719   QCRSRQCPCFAADRECDPDVCRNCWVSCGDGTLGVPNQRGDNYECRNMKLLLKQQQRVLL  778

Query  1696  GRSDIAGWGAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQL  1875
             GRSDI+GWGAFLKN    V K+E++G YTGELISH EADK GK+YDR+N SFLFNLNDQ 
Sbjct  779   GRSDISGWGAFLKN---SVGKHEYLGEYTGELISHREADKRGKIYDRENSSFLFNLNDQF  835

Query  1876  VIDAYRRGNKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
             V+DAYR+G+KLKF NHSPDPNC+AKV             ++VAG     DHR G
Sbjct  836   VLDAYRKGDKLKFANHSPDPNCYAKV-------------IMVAG-----DHRVG  871


 Score =   184 bits (468),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 125/225 (56%), Positives = 159/225 (71%), Gaps = 10/225 (4%)
 Frame = +1

Query  694   DGSADLLAKRQTDAFDLQNSIGTGSGNKICSSQEDGYASSD--LRSSIVLKNAVCpiklp  867
             D   DLL KRQ DA D+QN I    G     SQEDG+ASS   L S++ ++NAV PIKLP
Sbjct  88    DKGVDLLTKRQKDALDMQNGIDVSDGEND-RSQEDGHASSAVLLGSNVAVRNAVRPIKLP  146

Query  868   klekippYTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALi-csdsdeeiieeegene  1044
             +++++PPYTTW FL RNQ+M EDQSV+GRRRIYY  + GEALI     +E I +EE + +
Sbjct  147   EVKRLPPYTTWIFLDRNQRMTEDQSVVGRRRIYYGQSGGEALICSDSEEEVIDDEEEKRD  206

Query  1045  faesedYILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLIK-EGATSK-----NE  1206
             F ESEDYILRMT++++G  D+VL+ LAN FSR P E+KARY+ L + E A        NE
Sbjct  207   FVESEDYILRMTMKEIGSSDLVLESLANCFSRSPGEIKARYEVLTQGEKAIGYFNNRINE  266

Query  1207  NTEVTINSYLDEDLDAALSSFDNLFCQRCFVFNCQLHGCSQDLII  1341
                   ++ LD+DLDAAL SFDNLFC+RC VF+C+LHGCSQDL+ 
Sbjct  267   EISHIGSTLLDKDLDAALDSFDNLFCRRCLVFDCRLHGCSQDLVF  311


 Score = 65.9 bits (159),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSKK  2167
             +I+V GDHR+GIFA + ++AG+EL YDY+Y+PD  PAWA+  ++S  K
Sbjct  861   VIMVAGDHRVGIFAKERISAGEELFYDYRYEPDRAPAWARKPEASGSK  908



>ref|XP_010263480.1| PREDICTED: histone-lysine N-methyltransferase CLF-like isoform 
X1 [Nelumbo nucifera]
Length=966

 Score =   288 bits (737),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 135/234 (58%), Positives = 171/234 (73%), Gaps = 22/234 (9%)
 Frame = +1

Query  1339  ILKQIRVR-EELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKN  1515
             I K+I  R ++ C  + PCNC   CGK+C C++    CEK+CGCP +CK  F+GCHC K+
Sbjct  702   IRKRITERKDQPCRQFNPCNCKSACGKQCACLLNGTCCEKYCGCPKSCKNRFRGCHCAKS  761

Query  1516  ECATNYCPCYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLL  1695
             +C +  CPC+A+ RECDPDVC  CWV CGDG++G+P  +  N++C+NMKLLL  QQ+VLL
Sbjct  762   QCRSRQCPCFAADRECDPDVCRNCWVGCGDGTLGVPSQRGDNYECRNMKLLLKQQQRVLL  821

Query  1696  GRSDIAGWGAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQL  1875
             GRSD++GWGAFLKN    V K+E++G YTGELISH EADK GK+YDR+N SFLFNLNDQ 
Sbjct  822   GRSDVSGWGAFLKN---SVGKHEYLGEYTGELISHREADKRGKIYDRENSSFLFNLNDQF  878

Query  1876  VIDAYRRGNKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
             V+DAYR+G+KLKF NHSPDPNC+AKV             ++VAG     DHR G
Sbjct  879   VLDAYRKGDKLKFANHSPDPNCYAKV-------------IMVAG-----DHRVG  914


 Score =   188 bits (478),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 138/267 (52%), Positives = 177/267 (66%), Gaps = 17/267 (6%)
 Frame = +1

Query  706   DLLAKRQTDAFDLQNSIGTGSGNKICS-SQEDGYASSDL--RSSIVLKNAVCpiklpkle  876
             DLL KRQ DAF + N +   +G K  + SQED YASS +   SS  +KN V PIKLP+++
Sbjct  128   DLLTKRQRDAFGMLNGLDLTNGEKDKNGSQEDSYASSAVLVGSSFGMKNVVRPIKLPEVK  187

Query  877   kippYTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALi-csdsdeeiieeegenefae  1053
             K+PPYTTW FL RNQ+M EDQSV+GRRRIYYD N GEALI     +E + EEE + EF +
Sbjct  188   KLPPYTTWIFLDRNQRMTEDQSVVGRRRIYYDQNGGEALICSDSEEEIVEEEEEKREFVD  247

Query  1054  sedYILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLIK-------EGATSKNENT  1212
             SEDYILRMTI++VGL D VLD LA  FSR P EVKARY+ L+K       E   S ++ T
Sbjct  248   SEDYILRMTIQEVGLSDAVLDSLAQCFSRSPCEVKARYEILMKGEKDAQCEKKGSTDDKT  307

Query  1213  EVTINSYLDEDLDAALSSFDNLFCQRCFVFNCQLHGCSQDLIILKQIRVREELCAHYTPC  1392
             ++  +S+ D+DLDAAL SFDNLFC+RC VF+C+LHGCSQDL+   +    ++L  +YT  
Sbjct  308   QMD-DSFFDKDLDAALDSFDNLFCRRCLVFDCRLHGCSQDLVFPAE----KQLPWNYTDE  362

Query  1393  NC*PHCGKKCPCVVKSIYCEKFCGCPL  1473
                P CG  C  + + +        P+
Sbjct  363   ENVP-CGVNCYRLAQKLESNAIRSSPV  388


 Score = 68.2 bits (165),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSKK  2167
             +I+V GDHR+GIFA + +NAG+EL YDY+Y+PD  PAWAK  +++  K
Sbjct  904   VIMVAGDHRVGIFAKERINAGEELFYDYRYEPDRAPAWAKKPETTGSK  951



>gb|KGN61983.1| hypothetical protein Csa_2G279200 [Cucumis sativus]
Length=923

 Score =   288 bits (736),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 137/234 (59%), Positives = 171/234 (73%), Gaps = 22/234 (9%)
 Frame = +1

Query  1339  ILKQIRVR-EELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKN  1515
             I K+I  R ++ C  Y PC C   CGK+C C++    CEK+CGCP +CK  F+GCHC K+
Sbjct  659   IRKRITERKDQPCRQYNPCGCQTACGKQCACLLNGTCCEKYCGCPKSCKNRFRGCHCAKS  718

Query  1516  ECATNYCPCYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLL  1695
             +C +  CPC+A+ RECDPDVC  CWVSCGDG++G+P  +  N++C+NMKLLL  QQ+VLL
Sbjct  719   QCRSRQCPCFAADRECDPDVCRNCWVSCGDGTLGVPNQRGDNYECRNMKLLLKQQQRVLL  778

Query  1696  GRSDIAGWGAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQL  1875
             GRSDI+GWGAFLKN    V K+E++G YTGELISH EADK GK+YDR+N SFLFNLNDQ 
Sbjct  779   GRSDISGWGAFLKN---SVGKHEYLGEYTGELISHREADKRGKIYDRENSSFLFNLNDQF  835

Query  1876  VIDAYRRGNKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
             V+DAYR+G+KLKF NHSPDPNC+AKV             ++VAG     DHR G
Sbjct  836   VLDAYRKGDKLKFANHSPDPNCYAKV-------------IMVAG-----DHRVG  871


 Score =   182 bits (461),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 123/225 (55%), Positives = 159/225 (71%), Gaps = 10/225 (4%)
 Frame = +1

Query  694   DGSADLLAKRQTDAFDLQNSIGTGSGNKICSSQEDGYASSD--LRSSIVLKNAVCpiklp  867
             D   DLL KRQ DA D+QN I    G     SQEDG+ASS   L S++ ++NAV PIKLP
Sbjct  88    DKGVDLLTKRQKDALDMQNGIDVSDGEND-RSQEDGHASSAVLLGSNVAVRNAVRPIKLP  146

Query  868   klekippYTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALi-csdsdeeiieeegene  1044
             +++++PPYTTW FL RNQ+M EDQSV+GRRRIYY  + GEALI     +E I +EE + +
Sbjct  147   EVKRLPPYTTWIFLDRNQRMTEDQSVVGRRRIYYGQSGGEALICSDSEEEVIDDEEEKRD  206

Query  1045  faesedYILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLIK-EGATSK-----NE  1206
             F +SEDYILRMT++++G  D+VL+ LA+ FSR P E+KARY+ L + E A        NE
Sbjct  207   FVDSEDYILRMTMKEIGSSDLVLESLASCFSRSPGEIKARYEVLTQGEKAIGYFNNRINE  266

Query  1207  NTEVTINSYLDEDLDAALSSFDNLFCQRCFVFNCQLHGCSQDLII  1341
                   ++ LD+DLDAAL SFDNLFC+RC VF+C+LHGCSQDL+ 
Sbjct  267   EISHIGSTLLDKDLDAALDSFDNLFCRRCLVFDCRLHGCSQDLVF  311


 Score = 65.9 bits (159),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSKK  2167
             +I+V GDHR+GIFA + ++AG+EL YDY+Y+PD  PAWA+  ++S  K
Sbjct  861   VIMVAGDHRVGIFAKERISAGEELFYDYRYEPDRAPAWARKPEASGSK  908



>gb|KDP31958.1| hypothetical protein JCGZ_12419 [Jatropha curcas]
Length=922

 Score =   287 bits (735),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 136/234 (58%), Positives = 171/234 (73%), Gaps = 22/234 (9%)
 Frame = +1

Query  1339  ILKQIRVR-EELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKN  1515
             I K+I  R ++ C  Y PC C   CGK+C C++    CEK+CGCP +CK  F+GCHC K+
Sbjct  658   IRKRITERKDQPCRQYNPCGCRTACGKQCSCLLNGTCCEKYCGCPKSCKNRFRGCHCAKS  717

Query  1516  ECATNYCPCYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLL  1695
             +C +  CPC+A+ RECDPDVC  CWVSCGDG++G+P  +  N++C+NMKLLL  QQ+VLL
Sbjct  718   QCRSRQCPCFAADRECDPDVCRNCWVSCGDGTLGVPNQRGDNYECRNMKLLLKQQQRVLL  777

Query  1696  GRSDIAGWGAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQL  1875
             GRSD++GWGAFLKN    V K+E++G YTGELISH EADK GK+YDR+N SFLFNLNDQ 
Sbjct  778   GRSDVSGWGAFLKN---SVGKHEYLGEYTGELISHREADKRGKIYDRENSSFLFNLNDQF  834

Query  1876  VIDAYRRGNKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
             V+DAYR+G+KLKF NHSPDPNC+AKV             ++VAG     DHR G
Sbjct  835   VLDAYRKGDKLKFANHSPDPNCYAKV-------------IMVAG-----DHRVG  870


 Score =   196 bits (498),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 136/251 (54%), Positives = 176/251 (70%), Gaps = 11/251 (4%)
 Frame = +1

Query  688   VGDGSADLLAKRQTDAFDLQNSIGTGSGNKICSSQEDGYASSD--LRSSIVLKNAVCpik  861
             + DGS DLL KRQ DA  + + I   +G+K  +SQEDG+AS+   L SSI +K+AV PIK
Sbjct  86    ITDGSIDLLTKRQKDALGMHSGIDMSNGDKD-TSQEDGHASTAVLLGSSIPVKSAVRPIK  144

Query  862   lpklekippYTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALi-csdsdeeiieeege  1038
             LP+++++PPYTTW FL RNQ+M EDQSV+GRRRIYYD N GEALI     +E I +EE +
Sbjct  145   LPEVKRLPPYTTWIFLDRNQRMTEDQSVVGRRRIYYDQNGGEALICSDSEEEIIDDEEEK  204

Query  1039  nefaesedYILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLIK-EGATSKNENTE  1215
              +F +SEDYILR T+++VG  D V++ LA  FSR PSEV+ARY+ L K E A    +N E
Sbjct  205   RDFVDSEDYILRNTVKEVGSSDSVMESLAQCFSRSPSEVEARYEVLTKAETAVEDPKNGE  264

Query  1216  V---TINSYLDEDLDAALSSFDNLFCQRCFVFNCQLHGCSQDLII-LKQIRVREELCAHY  1383
                 T+NS+LD+DL+AAL SFDNLFC+RC VF+C+LHGCSQDL+   ++      L    
Sbjct  265   TDAQTVNSFLDKDLEAALDSFDNLFCRRCLVFDCRLHGCSQDLVFPAEKQHPWNHLDEEN  324

Query  1384  TPCNC*PHCGK  1416
              PC   PHC K
Sbjct  325   VPCG--PHCYK  333


 Score = 65.9 bits (159),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSKK  2167
             +I+V GDHR+GIFA + ++AG+EL YDY+Y+PD  PAWA+  ++S  K
Sbjct  860   VIMVAGDHRVGIFAKERISAGEELFYDYRYEPDRAPAWARKPEASGSK  907



>ref|XP_004149692.1| PREDICTED: LOW QUALITY PROTEIN: histone-lysine N-methyltransferase 
CLF-like [Cucumis sativus]
 ref|XP_004163272.1| PREDICTED: LOW QUALITY PROTEIN: histone-lysine N-methyltransferase 
CLF-like [Cucumis sativus]
Length=927

 Score =   287 bits (735),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 137/234 (59%), Positives = 171/234 (73%), Gaps = 22/234 (9%)
 Frame = +1

Query  1339  ILKQIRVR-EELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKN  1515
             I K+I  R ++ C  Y PC C   CGK+C C++    CEK+CGCP +CK  F+GCHC K+
Sbjct  663   IRKRITERKDQPCRQYNPCGCQTACGKQCACLLNGTCCEKYCGCPKSCKNRFRGCHCAKS  722

Query  1516  ECATNYCPCYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLL  1695
             +C +  CPC+A+ RECDPDVC  CWVSCGDG++G+P  +  N++C+NMKLLL  QQ+VLL
Sbjct  723   QCRSRQCPCFAADRECDPDVCRNCWVSCGDGTLGVPNQRGDNYECRNMKLLLKQQQRVLL  782

Query  1696  GRSDIAGWGAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQL  1875
             GRSDI+GWGAFLKN    V K+E++G YTGELISH EADK GK+YDR+N SFLFNLNDQ 
Sbjct  783   GRSDISGWGAFLKN---SVGKHEYLGEYTGELISHREADKRGKIYDRENSSFLFNLNDQF  839

Query  1876  VIDAYRRGNKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
             V+DAYR+G+KLKF NHSPDPNC+AKV             ++VAG     DHR G
Sbjct  840   VLDAYRKGDKLKFANHSPDPNCYAKV-------------IMVAG-----DHRVG  875


 Score =   182 bits (461),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 123/225 (55%), Positives = 159/225 (71%), Gaps = 10/225 (4%)
 Frame = +1

Query  694   DGSADLLAKRQTDAFDLQNSIGTGSGNKICSSQEDGYASSD--LRSSIVLKNAVCpiklp  867
             D   DLL KRQ DA D+QN I    G     SQEDG+ASS   L S++ ++NAV PIKLP
Sbjct  88    DKGVDLLTKRQKDALDMQNGIDVSDGEND-RSQEDGHASSAVLLGSNVAVRNAVRPIKLP  146

Query  868   klekippYTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALi-csdsdeeiieeegene  1044
             +++++PPYTTW FL RNQ+M EDQSV+GRRRIYY  + GEALI     +E I +EE + +
Sbjct  147   EVKRLPPYTTWIFLDRNQRMTEDQSVVGRRRIYYGQSGGEALICSDSEEEVIDDEEEKRD  206

Query  1045  faesedYILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLIK-EGATSK-----NE  1206
             F +SEDYILRMT++++G  D+VL+ LA+ FSR P E+KARY+ L + E A        NE
Sbjct  207   FVDSEDYILRMTMKEIGSSDLVLESLASCFSRSPGEIKARYEVLTQGEKAIGYFNNRINE  266

Query  1207  NTEVTINSYLDEDLDAALSSFDNLFCQRCFVFNCQLHGCSQDLII  1341
                   ++ LD+DLDAAL SFDNLFC+RC VF+C+LHGCSQDL+ 
Sbjct  267   EISHIGSTLLDKDLDAALDSFDNLFCRRCLVFDCRLHGCSQDLVF  311


 Score = 65.9 bits (159),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSKK  2167
             +I+V GDHR+GIFA + ++AG+EL YDY+Y+PD  PAWA+  ++S  K
Sbjct  865   VIMVAGDHRVGIFAKERISAGEELFYDYRYEPDRAPAWARKPEASGSK  912



>ref|XP_010652797.1| PREDICTED: histone-lysine N-methyltransferase CLF isoform X3 
[Vitis vinifera]
Length=900

 Score =   287 bits (734),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 135/234 (58%), Positives = 171/234 (73%), Gaps = 22/234 (9%)
 Frame = +1

Query  1339  ILKQIRVR-EELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKN  1515
             I K+I  R ++ C  Y PC C   CGK+C C++    CEK+CGCP +CK  F+GCHC K+
Sbjct  636   IRKRISERKDQPCRQYNPCGCQSACGKQCACLLNGTCCEKYCGCPKSCKNRFRGCHCAKS  695

Query  1516  ECATNYCPCYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLL  1695
             +C +  CPC+A+ RECDPDVC  CW+SCGDG++G+P  +  N++C+NMKLLL  QQ+VLL
Sbjct  696   QCRSRQCPCFAADRECDPDVCRNCWISCGDGTLGVPSQRGDNYECRNMKLLLKQQQRVLL  755

Query  1696  GRSDIAGWGAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQL  1875
             GRSD++GWGAFLKN    V K+E++G YTGELISH EADK GK+YDR+N SFLFNLNDQ 
Sbjct  756   GRSDVSGWGAFLKN---SVGKHEYLGEYTGELISHREADKRGKIYDRENSSFLFNLNDQF  812

Query  1876  VIDAYRRGNKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
             V+DAYR+G+KLKF NHSPDPNC+AKV             ++VAG     DHR G
Sbjct  813   VLDAYRKGDKLKFANHSPDPNCYAKV-------------IMVAG-----DHRVG  848


 Score =   198 bits (503),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 134/225 (60%), Positives = 162/225 (72%), Gaps = 10/225 (4%)
 Frame = +1

Query  694   DGSADLLAKRQTDAFDLQNSIGTGSGNKICS-SQEDGYASSD--LRSSIVLKNAVCpikl  864
             D S DLL KRQ DA D+QN     +G+K    SQEDG+ SS   L SSI +KNAV PIKL
Sbjct  58    DKSVDLLTKRQRDALDMQNGNDANNGDKASHCSQEDGHVSSAVLLGSSIAVKNAVRPIKL  117

Query  865   pklekippYTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALi-csdsdeeiieeegen  1041
              +++++PPYTTW FL RNQ+M EDQSV+GRRRIYYD   GEALI     +E I EEE + 
Sbjct  118   TEVKRLPPYTTWIFLDRNQRMTEDQSVVGRRRIYYDQTGGEALICSDSEEEAIEEEEEKK  177

Query  1042  efaesedYILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLIKEGAT---SKN---  1203
             EFA+ EDYILRMTI++ GL D VL+ L  + SRKP EVKARY+ L K   +   SKN   
Sbjct  178   EFADFEDYILRMTIKETGLSDPVLEALGRYLSRKPCEVKARYEILNKGEKSVVGSKNGVI  237

Query  1204  ENTEVTINSYLDEDLDAALSSFDNLFCQRCFVFNCQLHGCSQDLI  1338
             E+   T+ SYLD+DLDAAL SFDNLFC+RC VF+C+LHGCSQDL+
Sbjct  238   EDISQTLTSYLDKDLDAALDSFDNLFCRRCLVFDCRLHGCSQDLV  282


 Score = 64.7 bits (156),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSKK  2167
             +I+V GDHR+GIFA + ++AG+EL YDY+Y+PD  PAWA+  ++S  K
Sbjct  838   VIMVAGDHRVGIFAKERISAGEELFYDYRYEPDRAPAWARKPEASGVK  885



>ref|XP_010263481.1| PREDICTED: histone-lysine N-methyltransferase CLF-like isoform 
X2 [Nelumbo nucifera]
Length=940

 Score =   287 bits (735),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 135/234 (58%), Positives = 171/234 (73%), Gaps = 22/234 (9%)
 Frame = +1

Query  1339  ILKQIRVR-EELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKN  1515
             I K+I  R ++ C  + PCNC   CGK+C C++    CEK+CGCP +CK  F+GCHC K+
Sbjct  676   IRKRITERKDQPCRQFNPCNCKSACGKQCACLLNGTCCEKYCGCPKSCKNRFRGCHCAKS  735

Query  1516  ECATNYCPCYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLL  1695
             +C +  CPC+A+ RECDPDVC  CWV CGDG++G+P  +  N++C+NMKLLL  QQ+VLL
Sbjct  736   QCRSRQCPCFAADRECDPDVCRNCWVGCGDGTLGVPSQRGDNYECRNMKLLLKQQQRVLL  795

Query  1696  GRSDIAGWGAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQL  1875
             GRSD++GWGAFLKN    V K+E++G YTGELISH EADK GK+YDR+N SFLFNLNDQ 
Sbjct  796   GRSDVSGWGAFLKN---SVGKHEYLGEYTGELISHREADKRGKIYDRENSSFLFNLNDQF  852

Query  1876  VIDAYRRGNKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
             V+DAYR+G+KLKF NHSPDPNC+AKV             ++VAG     DHR G
Sbjct  853   VLDAYRKGDKLKFANHSPDPNCYAKV-------------IMVAG-----DHRVG  888


 Score =   188 bits (477),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 130/223 (58%), Positives = 161/223 (72%), Gaps = 12/223 (5%)
 Frame = +1

Query  706   DLLAKRQTDAFDLQNSIGTGSGNKICS-SQEDGYASSDL--RSSIVLKNAVCpiklpkle  876
             DLL KRQ DAF + N +   +G K  + SQED YASS +   SS  +KN V PIKLP+++
Sbjct  128   DLLTKRQRDAFGMLNGLDLTNGEKDKNGSQEDSYASSAVLVGSSFGMKNVVRPIKLPEVK  187

Query  877   kippYTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALi-csdsdeeiieeegenefae  1053
             K+PPYTTW FL RNQ+M EDQSV+GRRRIYYD N GEALI     +E + EEE + EF +
Sbjct  188   KLPPYTTWIFLDRNQRMTEDQSVVGRRRIYYDQNGGEALICSDSEEEIVEEEEEKREFVD  247

Query  1054  sedYILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLIK-------EGATSKNENT  1212
             SEDYILRMTI++VGL D VLD LA  FSR P EVKARY+ L+K       E   S ++ T
Sbjct  248   SEDYILRMTIQEVGLSDAVLDSLAQCFSRSPCEVKARYEILMKGEKDAQCEKKGSTDDKT  307

Query  1213  EVTINSYLDEDLDAALSSFDNLFCQRCFVFNCQLHGCSQDLII  1341
             ++  +S+ D+DLDAAL SFDNLFC+RC VF+C+LHGCSQDL+ 
Sbjct  308   QMD-DSFFDKDLDAALDSFDNLFCRRCLVFDCRLHGCSQDLVF  349


 Score = 68.2 bits (165),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSKK  2167
             +I+V GDHR+GIFA + +NAG+EL YDY+Y+PD  PAWAK  +++  K
Sbjct  878   VIMVAGDHRVGIFAKERINAGEELFYDYRYEPDRAPAWAKKPETTGSK  925



>ref|XP_010652795.1| PREDICTED: histone-lysine N-methyltransferase CLF isoform X1 
[Vitis vinifera]
 emb|CBI21398.3| unnamed protein product [Vitis vinifera]
Length=934

 Score =   287 bits (735),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 135/234 (58%), Positives = 171/234 (73%), Gaps = 22/234 (9%)
 Frame = +1

Query  1339  ILKQIRVR-EELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKN  1515
             I K+I  R ++ C  Y PC C   CGK+C C++    CEK+CGCP +CK  F+GCHC K+
Sbjct  670   IRKRISERKDQPCRQYNPCGCQSACGKQCACLLNGTCCEKYCGCPKSCKNRFRGCHCAKS  729

Query  1516  ECATNYCPCYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLL  1695
             +C +  CPC+A+ RECDPDVC  CW+SCGDG++G+P  +  N++C+NMKLLL  QQ+VLL
Sbjct  730   QCRSRQCPCFAADRECDPDVCRNCWISCGDGTLGVPSQRGDNYECRNMKLLLKQQQRVLL  789

Query  1696  GRSDIAGWGAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQL  1875
             GRSD++GWGAFLKN    V K+E++G YTGELISH EADK GK+YDR+N SFLFNLNDQ 
Sbjct  790   GRSDVSGWGAFLKN---SVGKHEYLGEYTGELISHREADKRGKIYDRENSSFLFNLNDQF  846

Query  1876  VIDAYRRGNKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
             V+DAYR+G+KLKF NHSPDPNC+AKV             ++VAG     DHR G
Sbjct  847   VLDAYRKGDKLKFANHSPDPNCYAKV-------------IMVAG-----DHRVG  882


 Score =   198 bits (504),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 134/225 (60%), Positives = 162/225 (72%), Gaps = 10/225 (4%)
 Frame = +1

Query  694   DGSADLLAKRQTDAFDLQNSIGTGSGNKICS-SQEDGYASSD--LRSSIVLKNAVCpikl  864
             D S DLL KRQ DA D+QN     +G+K    SQEDG+ SS   L SSI +KNAV PIKL
Sbjct  92    DKSVDLLTKRQRDALDMQNGNDANNGDKASHCSQEDGHVSSAVLLGSSIAVKNAVRPIKL  151

Query  865   pklekippYTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALi-csdsdeeiieeegen  1041
              +++++PPYTTW FL RNQ+M EDQSV+GRRRIYYD   GEALI     +E I EEE + 
Sbjct  152   TEVKRLPPYTTWIFLDRNQRMTEDQSVVGRRRIYYDQTGGEALICSDSEEEAIEEEEEKK  211

Query  1042  efaesedYILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLIKEGAT---SKN---  1203
             EFA+ EDYILRMTI++ GL D VL+ L  + SRKP EVKARY+ L K   +   SKN   
Sbjct  212   EFADFEDYILRMTIKETGLSDPVLEALGRYLSRKPCEVKARYEILNKGEKSVVGSKNGVI  271

Query  1204  ENTEVTINSYLDEDLDAALSSFDNLFCQRCFVFNCQLHGCSQDLI  1338
             E+   T+ SYLD+DLDAAL SFDNLFC+RC VF+C+LHGCSQDL+
Sbjct  272   EDISQTLTSYLDKDLDAALDSFDNLFCRRCLVFDCRLHGCSQDLV  316


 Score = 65.1 bits (157),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSKK  2167
             +I+V GDHR+GIFA + ++AG+EL YDY+Y+PD  PAWA+  ++S  K
Sbjct  872   VIMVAGDHRVGIFAKERISAGEELFYDYRYEPDRAPAWARKPEASGVK  919



>ref|XP_010652796.1| PREDICTED: histone-lysine N-methyltransferase CLF isoform X2 
[Vitis vinifera]
Length=927

 Score =   287 bits (734),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 135/234 (58%), Positives = 171/234 (73%), Gaps = 22/234 (9%)
 Frame = +1

Query  1339  ILKQIRVR-EELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKN  1515
             I K+I  R ++ C  Y PC C   CGK+C C++    CEK+CGCP +CK  F+GCHC K+
Sbjct  663   IRKRISERKDQPCRQYNPCGCQSACGKQCACLLNGTCCEKYCGCPKSCKNRFRGCHCAKS  722

Query  1516  ECATNYCPCYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLL  1695
             +C +  CPC+A+ RECDPDVC  CW+SCGDG++G+P  +  N++C+NMKLLL  QQ+VLL
Sbjct  723   QCRSRQCPCFAADRECDPDVCRNCWISCGDGTLGVPSQRGDNYECRNMKLLLKQQQRVLL  782

Query  1696  GRSDIAGWGAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQL  1875
             GRSD++GWGAFLKN    V K+E++G YTGELISH EADK GK+YDR+N SFLFNLNDQ 
Sbjct  783   GRSDVSGWGAFLKN---SVGKHEYLGEYTGELISHREADKRGKIYDRENSSFLFNLNDQF  839

Query  1876  VIDAYRRGNKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
             V+DAYR+G+KLKF NHSPDPNC+AKV             ++VAG     DHR G
Sbjct  840   VLDAYRKGDKLKFANHSPDPNCYAKV-------------IMVAG-----DHRVG  875


 Score =   198 bits (504),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 134/225 (60%), Positives = 162/225 (72%), Gaps = 10/225 (4%)
 Frame = +1

Query  694   DGSADLLAKRQTDAFDLQNSIGTGSGNKICS-SQEDGYASSD--LRSSIVLKNAVCpikl  864
             D S DLL KRQ DA D+QN     +G+K    SQEDG+ SS   L SSI +KNAV PIKL
Sbjct  92    DKSVDLLTKRQRDALDMQNGNDANNGDKASHCSQEDGHVSSAVLLGSSIAVKNAVRPIKL  151

Query  865   pklekippYTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALi-csdsdeeiieeegen  1041
              +++++PPYTTW FL RNQ+M EDQSV+GRRRIYYD   GEALI     +E I EEE + 
Sbjct  152   TEVKRLPPYTTWIFLDRNQRMTEDQSVVGRRRIYYDQTGGEALICSDSEEEAIEEEEEKK  211

Query  1042  efaesedYILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLIKEGAT---SKN---  1203
             EFA+ EDYILRMTI++ GL D VL+ L  + SRKP EVKARY+ L K   +   SKN   
Sbjct  212   EFADFEDYILRMTIKETGLSDPVLEALGRYLSRKPCEVKARYEILNKGEKSVVGSKNGVI  271

Query  1204  ENTEVTINSYLDEDLDAALSSFDNLFCQRCFVFNCQLHGCSQDLI  1338
             E+   T+ SYLD+DLDAAL SFDNLFC+RC VF+C+LHGCSQDL+
Sbjct  272   EDISQTLTSYLDKDLDAALDSFDNLFCRRCLVFDCRLHGCSQDLV  316


 Score = 65.1 bits (157),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSKK  2167
             +I+V GDHR+GIFA + ++AG+EL YDY+Y+PD  PAWA+  ++S  K
Sbjct  865   VIMVAGDHRVGIFAKERISAGEELFYDYRYEPDRAPAWARKPEASGVK  912



>ref|XP_009621002.1| PREDICTED: histone-lysine N-methyltransferase CLF-like isoform 
X2 [Nicotiana tomentosiformis]
Length=907

 Score =   286 bits (733),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 132/226 (58%), Positives = 168/226 (74%), Gaps = 21/226 (9%)
 Frame = +1

Query  1360  REELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKNECATNYCP  1539
             +++ C  Y PCNC   CGK+CPC+V    CEK+CGC  +CK  F+GCHC K++C +  CP
Sbjct  651   KDKPCRQYNPCNCQAPCGKECPCIVNGTCCEKYCGCQKSCKNKFRGCHCAKSQCRSRQCP  710

Query  1540  CYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLLGRSDIAGW  1719
             C+A+ RECDPDVC  CW+SCGDGS+GIP  +  N++C+NMKLLL  QQ+VLLGRSD++GW
Sbjct  711   CFAADRECDPDVCRNCWISCGDGSLGIPSQRGDNYECKNMKLLLKQQQRVLLGRSDVSGW  770

Query  1720  GAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQLVIDAYRRG  1899
             GAFLKN    V K+E++G YTGE+ISH EADK GK+YDR+N SFLFNLN+Q V+DA+R+G
Sbjct  771   GAFLKN---SVGKHEYLGEYTGEIISHHEADKRGKIYDRENSSFLFNLNNQFVLDAHRKG  827

Query  1900  NKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
             +KLKF NHSPDPNC+AKV             ++VAG     DHR G
Sbjct  828   DKLKFANHSPDPNCYAKV-------------IMVAG-----DHRVG  855


 Score =   212 bits (540),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 136/229 (59%), Positives = 174/229 (76%), Gaps = 6/229 (3%)
 Frame = +1

Query  691   GDGSADLLAKRQTDAFDLQNSIGTGSGNKICS-SQEDGYASSD--LRSSIVLKNAVCpik  861
              D S DLL+KR+ DA D+QN I T +G+   + S++DGYASS   L SSI +K+AV PIK
Sbjct  73    ADISVDLLSKRKQDAIDMQNGIQTNNGDSDSNGSEDDGYASSAILLGSSIAVKDAVHPIK  132

Query  862   lpklekippYTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALi-csdsdeeiieeege  1038
             LP+++++PPYTTW FL RNQ+M EDQSV+GRRRIYYD N GEALI     +E + +EE +
Sbjct  133   LPEVKRLPPYTTWIFLDRNQRMTEDQSVVGRRRIYYDQNGGEALICSDSEEELLDDEEEK  192

Query  1039  nefaesedYILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLIKE--GATSKNENT  1212
              EF ESED++LRM I++VGL D VLDLL    SRKP+EVKARY+DL+KE    TS+NEN 
Sbjct  193   REFVESEDFMLRMAIKQVGLSDRVLDLLGQCLSRKPNEVKARYEDLVKEENACTSRNENF  252

Query  1213  EVTINSYLDEDLDAALSSFDNLFCQRCFVFNCQLHGCSQDLIILKQIRV  1359
             E T+N +LD+ LD AL SFDNLFC+RC VF+C+LHGCSQDLI   + ++
Sbjct  253   EGTLNLFLDKALDVALDSFDNLFCRRCLVFDCRLHGCSQDLIFAAEKQL  301


 Score = 65.9 bits (159),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 36/48 (75%), Gaps = 0/48 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSKK  2167
             +I+V GDHR+GIFA + M+AG+EL YDY Y PD  PAWA+  ++S  K
Sbjct  845   VIMVAGDHRVGIFAKERMSAGEELFYDYHYAPDRAPAWARKPEASGSK  892



>ref|XP_009621000.1| PREDICTED: histone-lysine N-methyltransferase CLF-like isoform 
X1 [Nicotiana tomentosiformis]
 ref|XP_009621001.1| PREDICTED: histone-lysine N-methyltransferase CLF-like isoform 
X1 [Nicotiana tomentosiformis]
Length=921

 Score =   287 bits (734),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 132/226 (58%), Positives = 168/226 (74%), Gaps = 21/226 (9%)
 Frame = +1

Query  1360  REELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKNECATNYCP  1539
             +++ C  Y PCNC   CGK+CPC+V    CEK+CGC  +CK  F+GCHC K++C +  CP
Sbjct  665   KDKPCRQYNPCNCQAPCGKECPCIVNGTCCEKYCGCQKSCKNKFRGCHCAKSQCRSRQCP  724

Query  1540  CYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLLGRSDIAGW  1719
             C+A+ RECDPDVC  CW+SCGDGS+GIP  +  N++C+NMKLLL  QQ+VLLGRSD++GW
Sbjct  725   CFAADRECDPDVCRNCWISCGDGSLGIPSQRGDNYECKNMKLLLKQQQRVLLGRSDVSGW  784

Query  1720  GAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQLVIDAYRRG  1899
             GAFLKN    V K+E++G YTGE+ISH EADK GK+YDR+N SFLFNLN+Q V+DA+R+G
Sbjct  785   GAFLKN---SVGKHEYLGEYTGEIISHHEADKRGKIYDRENSSFLFNLNNQFVLDAHRKG  841

Query  1900  NKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
             +KLKF NHSPDPNC+AKV             ++VAG     DHR G
Sbjct  842   DKLKFANHSPDPNCYAKV-------------IMVAG-----DHRVG  869


 Score =   212 bits (540),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 136/229 (59%), Positives = 174/229 (76%), Gaps = 6/229 (3%)
 Frame = +1

Query  691   GDGSADLLAKRQTDAFDLQNSIGTGSGNKICS-SQEDGYASSD--LRSSIVLKNAVCpik  861
              D S DLL+KR+ DA D+QN I T +G+   + S++DGYASS   L SSI +K+AV PIK
Sbjct  87    ADISVDLLSKRKQDAIDMQNGIQTNNGDSDSNGSEDDGYASSAILLGSSIAVKDAVHPIK  146

Query  862   lpklekippYTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALi-csdsdeeiieeege  1038
             LP+++++PPYTTW FL RNQ+M EDQSV+GRRRIYYD N GEALI     +E + +EE +
Sbjct  147   LPEVKRLPPYTTWIFLDRNQRMTEDQSVVGRRRIYYDQNGGEALICSDSEEELLDDEEEK  206

Query  1039  nefaesedYILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLIKE--GATSKNENT  1212
              EF ESED++LRM I++VGL D VLDLL    SRKP+EVKARY+DL+KE    TS+NEN 
Sbjct  207   REFVESEDFMLRMAIKQVGLSDRVLDLLGQCLSRKPNEVKARYEDLVKEENACTSRNENF  266

Query  1213  EVTINSYLDEDLDAALSSFDNLFCQRCFVFNCQLHGCSQDLIILKQIRV  1359
             E T+N +LD+ LD AL SFDNLFC+RC VF+C+LHGCSQDLI   + ++
Sbjct  267   EGTLNLFLDKALDVALDSFDNLFCRRCLVFDCRLHGCSQDLIFAAEKQL  315


 Score = 65.9 bits (159),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 36/48 (75%), Gaps = 0/48 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSKK  2167
             +I+V GDHR+GIFA + M+AG+EL YDY Y PD  PAWA+  ++S  K
Sbjct  859   VIMVAGDHRVGIFAKERMSAGEELFYDYHYAPDRAPAWARKPEASGSK  906



>ref|XP_011043519.1| PREDICTED: histone-lysine N-methyltransferase CLF-like [Populus 
euphratica]
Length=920

 Score =   286 bits (733),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 135/234 (58%), Positives = 172/234 (74%), Gaps = 22/234 (9%)
 Frame = +1

Query  1339  ILKQIRVR-EELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKN  1515
             I K+I  R ++ C  Y PC+C   CGK+C C++    CEK+CGCP +CK  F+GCHC K+
Sbjct  656   IRKRITERKDQPCRQYNPCSCQAACGKQCTCLLNGTCCEKYCGCPKSCKNRFRGCHCAKS  715

Query  1516  ECATNYCPCYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLL  1695
             +C +  CPC+A+ RECDPDVC  CWVSCGDG++GIP  +  N++C+NMKLLL  QQ+VLL
Sbjct  716   QCRSRQCPCFAADRECDPDVCRNCWVSCGDGTLGIPSQRGDNYECRNMKLLLKQQQRVLL  775

Query  1696  GRSDIAGWGAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQL  1875
             GRSD++GWGAFLK+    V K+E++G YTGELISH EADK GK+YDR+N SFLFNLNDQ 
Sbjct  776   GRSDVSGWGAFLKS---SVGKHEYLGEYTGELISHREADKRGKIYDRENSSFLFNLNDQF  832

Query  1876  VIDAYRRGNKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
             V+DAYR+G+KLKF NHSP+PNC+AKV             ++VAG     DHR G
Sbjct  833   VLDAYRKGDKLKFANHSPEPNCYAKV-------------IMVAG-----DHRVG  868


 Score =   180 bits (457),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 125/224 (56%), Positives = 158/224 (71%), Gaps = 8/224 (4%)
 Frame = +1

Query  694   DGSADLLAKRQTDAFDLQNSIGTGSGNKICSSQEDGYASSD---LRSSIVLKNAVCpikl  864
             D S DL  KRQ DA  +   I + + +K     E+   +S    L SSI +KNAV PIKL
Sbjct  92    DNSVDLFTKRQKDALSMHGGIDSINVDKDSRGSEEDVNTSTAVLLGSSIPVKNAVRPIKL  151

Query  865   pklekippYTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALi-csdsdeeiieeegen  1041
             P+++++PPYT+W FL RNQ+M EDQSV+GRRRIYYD N GEALI     +E I EEE + 
Sbjct  152   PEVKRLPPYTSWIFLDRNQRMTEDQSVLGRRRIYYDQNGGEALICSDSEEEIIDEEEEKR  211

Query  1042  efaesedYILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLIKEGAT---SKNENT  1212
             +F ESEDYILRMTI++ GL D V++ LA  FSR  SEVKAR++ L KE      SKN++ 
Sbjct  212   DFLESEDYILRMTIKEAGLSDPVVESLAECFSRSSSEVKARFEVLKKEEKAVEDSKNKDN  271

Query  1213  EV-TINSYLDEDLDAALSSFDNLFCQRCFVFNCQLHGCSQDLII  1341
             E  T+NS+LD+DL+ AL SFDNLFC+RC VF+C+LHGCSQDLI 
Sbjct  272   EAQTLNSFLDKDLEVALDSFDNLFCRRCLVFDCRLHGCSQDLIF  315


 Score = 68.2 bits (165),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSKK  2167
             +I+V GDHR+GIFA + +NAG+EL YDY+Y+PD  PAWA+  ++S  K
Sbjct  858   VIMVAGDHRVGIFAKERINAGEELFYDYRYEPDRAPAWARKPEASGSK  905



>dbj|BAC84951.1| PHCLF2 [Petunia x hybrida]
Length=916

 Score =   286 bits (732),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 132/226 (58%), Positives = 167/226 (74%), Gaps = 22/226 (10%)
 Frame = +1

Query  1360  REELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKNECATNYCP  1539
             +++ C  Y PCNC   CGK+CPC+V    CEK+CGCP NCK  F+GCHC K++C +  CP
Sbjct  661   KDQPCRQYNPCNCQAPCGKECPCIVNGTCCEKYCGCP-NCKNRFRGCHCAKSQCRSRQCP  719

Query  1540  CYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLLGRSDIAGW  1719
             C+A+ RECDPDVC  CW+SCGDG++G P  +  N++C+NMKLLL  QQ+VLLGRSD++GW
Sbjct  720   CFAADRECDPDVCRNCWISCGDGTLGTPSQRGDNYECRNMKLLLKQQQRVLLGRSDVSGW  779

Query  1720  GAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQLVIDAYRRG  1899
             GAFLKN    V K+E++G YTGE+ISH EADK GK+YDR++ SFLFNLNDQ V+DAYR+G
Sbjct  780   GAFLKN---SVGKHEYLGEYTGEIISHHEADKRGKIYDREDSSFLFNLNDQFVLDAYRKG  836

Query  1900  NKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
             +KLKF NHSP PNC+AKV             ++VAG     DHR G
Sbjct  837   DKLKFANHSPAPNCYAKV-------------IMVAG-----DHRVG  864


 Score =   218 bits (556),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 142/250 (57%), Positives = 180/250 (72%), Gaps = 11/250 (4%)
 Frame = +1

Query  691   GDGSADLLAKRQTDAFDLQNSIGTGSG-NKICSSQEDGYASSD--LRSSIVLKNAVCpik  861
             G  S DLL+KRQ DA D+ N I + +G N   SS++DGYASS   L SSI +KNAV PI 
Sbjct  85    GADSVDLLSKRQQDAIDMHNGIDSSNGDNDSNSSEDDGYASSAILLGSSIAVKNAVRPIT  144

Query  862   lpklekippYTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALi-csdsdeeiieeege  1038
             LP++ ++PPYTTW FL RNQ+M EDQSV+GRRRIYYD N GEALI     +E + +EE +
Sbjct  145   LPEMRRLPPYTTWVFLDRNQRMTEDQSVVGRRRIYYDQNGGEALICSDSEEEGLEDEEEK  204

Query  1039  nefaesedYILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLIKE--GATSKNENT  1212
              EF ESED++LRM I++VGL D VLDLLA   SRKPSE+KARY+D++KE     SKNE+ 
Sbjct  205   KEFVESEDFMLRMAIKQVGLSDTVLDLLAQCLSRKPSELKARYEDIVKEENACVSKNESI  264

Query  1213  EVTINSYLDEDLDAALSSFDNLFCQRCFVFNCQLHGCSQDLIILKQIRVREELCAHYTPC  1392
             E T++ +LD+D+DAAL SFDNLFC+RC VF+C+LHGCSQDLI+       E+  A ++P 
Sbjct  265   EGTVDFFLDKDIDAALDSFDNLFCRRCLVFDCRLHGCSQDLIL-----TAEKQSAWHSPD  319

Query  1393  NC*PHCGKKC  1422
                  CG  C
Sbjct  320   ADKEPCGPNC  329


 Score = 61.2 bits (147),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 36/48 (75%), Gaps = 0/48 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSKK  2167
             +I+V GDHR+GIFA + + AG+EL YDY+Y+ D  PAWA+  ++S  K
Sbjct  854   VIMVAGDHRVGIFAKERICAGEELFYDYRYEADKAPAWARKPEASGTK  901



>ref|XP_009795142.1| PREDICTED: histone-lysine N-methyltransferase CLF-like [Nicotiana 
sylvestris]
 ref|XP_009795143.1| PREDICTED: histone-lysine N-methyltransferase CLF-like [Nicotiana 
sylvestris]
Length=921

 Score =   286 bits (732),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 132/226 (58%), Positives = 167/226 (74%), Gaps = 21/226 (9%)
 Frame = +1

Query  1360  REELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKNECATNYCP  1539
             +++ C  Y PCNC   CGK+CPC+V    CEK+CGC  +CK  F+GCHC K++C +  CP
Sbjct  665   KDKPCRQYNPCNCQAPCGKECPCIVNGTCCEKYCGCQKSCKNKFRGCHCAKSQCRSRQCP  724

Query  1540  CYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLLGRSDIAGW  1719
             C+A+ RECDPDVC  CW+SCGDGS+GIP  +  N++C+NMKLLL  QQ VLLGRSD++GW
Sbjct  725   CFAADRECDPDVCRNCWISCGDGSLGIPSQRGDNYECKNMKLLLKQQQSVLLGRSDVSGW  784

Query  1720  GAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQLVIDAYRRG  1899
             GAFLKN    V K+E++G YTGE+ISH EADK GK+YDR+N SFLFNLN+Q V+DA+R+G
Sbjct  785   GAFLKN---SVGKHEYLGEYTGEIISHHEADKRGKIYDRENSSFLFNLNNQFVLDAHRKG  841

Query  1900  NKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
             +KLKF NHSPDPNC+AKV             ++VAG     DHR G
Sbjct  842   DKLKFANHSPDPNCYAKV-------------IMVAG-----DHRVG  869


 Score =   204 bits (518),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 132/229 (58%), Positives = 172/229 (75%), Gaps = 6/229 (3%)
 Frame = +1

Query  691   GDGSADLLAKRQTDAFDLQNSIGTGSGNKICS-SQEDGYASSD--LRSSIVLKNAVCpik  861
              D S DLL+KR+ DA  +QN I T +G+   + S++DGYASS   L SSI +K+A+ PI+
Sbjct  87    ADISVDLLSKRKQDAIYMQNGIQTNTGDSDSNGSEDDGYASSAILLGSSIAVKDAMHPIQ  146

Query  862   lpklekippYTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALi-csdsdeeiieeege  1038
             LP+++++PP+TTW FL RNQ+M EDQSV+GRRRIYYD N GEALI     +E + +EE +
Sbjct  147   LPEVKRLPPFTTWIFLDRNQRMTEDQSVVGRRRIYYDQNGGEALICSDSEEELLDDEEEK  206

Query  1039  nefaesedYILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLIKE--GATSKNENT  1212
              EF ESED++LRM I+KVGL D VLDLL    SRK SEVKARY+DL+KE    TS+NEN 
Sbjct  207   REFVESEDFMLRMAIKKVGLSDRVLDLLGQCLSRKLSEVKARYEDLVKEENACTSRNENI  266

Query  1213  EVTINSYLDEDLDAALSSFDNLFCQRCFVFNCQLHGCSQDLIILKQIRV  1359
             E T++ +LD+ LD AL SFDNLFC+RC VF+C+LHGCSQDLI   + ++
Sbjct  267   EGTLHLFLDKALDVALDSFDNLFCRRCLVFDCRLHGCSQDLIFAAEKQL  315


 Score = 62.0 bits (149),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 35/48 (73%), Gaps = 0/48 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSKK  2167
             +I+V GDHR+GIFA + M+AG+EL YDY Y  D  PAWA+  ++S  K
Sbjct  859   VIMVAGDHRVGIFAKERMSAGEELFYDYHYAHDRAPAWARKPEASGSK  906



>ref|XP_010270355.1| PREDICTED: histone-lysine N-methyltransferase CLF-like isoform 
X1 [Nelumbo nucifera]
Length=928

 Score =   286 bits (731),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 135/234 (58%), Positives = 170/234 (73%), Gaps = 22/234 (9%)
 Frame = +1

Query  1339  ILKQIRVR-EELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKN  1515
             I K+I  R ++ C  Y PC C   CGK+C C++    CEK+CGCP +CK  F+GCHC K+
Sbjct  665   IRKRITERKDQPCRQYNPCGCQSACGKQCACLLNGTCCEKYCGCPKSCKNRFRGCHCAKS  724

Query  1516  ECATNYCPCYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLL  1695
             +C +  CPC+A+ RECDPDVC  CWV CGDG++G+P  +  N++C+NMKLLL  QQ+VLL
Sbjct  725   QCRSRQCPCFAADRECDPDVCRNCWVGCGDGTLGVPSQRGDNYECRNMKLLLKQQQRVLL  784

Query  1696  GRSDIAGWGAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQL  1875
             GRSD++GWGAFLKN    V K+E++G YTGELISH EADK GK+YDR+N SFLFNLNDQ 
Sbjct  785   GRSDVSGWGAFLKN---SVGKHEYLGEYTGELISHREADKRGKIYDRENSSFLFNLNDQF  841

Query  1876  VIDAYRRGNKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
             V+DAYR+G+KLKF NHSPDPNC+AKV             ++VAG     DHR G
Sbjct  842   VLDAYRKGDKLKFANHSPDPNCYAKV-------------IMVAG-----DHRVG  877


 Score =   169 bits (427),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 126/222 (57%), Positives = 155/222 (70%), Gaps = 11/222 (5%)
 Frame = +1

Query  709   LLAKRQTDAFDLQNSIGTGSGNKICS-SQEDGYASSDL---RSSIVLKNAVCpiklpkle  876
             LL KRQ D   + N +   +G K  + +QED +ASS +    S  V  N V PIKLP+++
Sbjct  90    LLVKRQGDTLGMLNGLDLNNGEKDTNGAQEDNHASSAVLIGTSFGVKNNIVRPIKLPEVK  149

Query  877   kippYTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALicsdsdeeiieeegenefaes  1056
             K+PPYTTW FL RNQ+M EDQSV+GRRRIYYD N GEALICSDS+EEI+EEE +     +
Sbjct  150   KLPPYTTWIFLDRNQRMTEDQSVVGRRRIYYDQNGGEALICSDSEEEIVEEEEDKREFGN  209

Query  1057  -edYILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLIKEGATS---KNENTEVTI  1224
              EDYILR  I++VG  D VLDLLA  FSR+P EVKARY+ L KE   +   K  N E   
Sbjct  210   CEDYILRKAIQEVGSSDDVLDLLAQCFSRRPCEVKARYELLTKEEKDALFIKKGNIEDNT  269

Query  1225  ---NSYLDEDLDAALSSFDNLFCQRCFVFNCQLHGCSQDLII  1341
                +S+ D+DLDAAL SFDNLFC+RC VF+C+LHGCSQDL+ 
Sbjct  270   QMDDSFFDKDLDAALDSFDNLFCRRCLVFDCRLHGCSQDLVF  311


 Score = 67.8 bits (164),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSKK  2167
             +I+V GDHR+GIFA + +NAG+EL YDY+Y+PD  PAWAK  +++  K
Sbjct  867   VIMVAGDHRVGIFAKERINAGEELFYDYRYEPDRAPAWAKKPEATGSK  914



>ref|XP_010270364.1| PREDICTED: histone-lysine N-methyltransferase EZ1-like isoform 
X2 [Nelumbo nucifera]
Length=907

 Score =   285 bits (730),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 135/234 (58%), Positives = 170/234 (73%), Gaps = 22/234 (9%)
 Frame = +1

Query  1339  ILKQIRVR-EELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKN  1515
             I K+I  R ++ C  Y PC C   CGK+C C++    CEK+CGCP +CK  F+GCHC K+
Sbjct  644   IRKRITERKDQPCRQYNPCGCQSACGKQCACLLNGTCCEKYCGCPKSCKNRFRGCHCAKS  703

Query  1516  ECATNYCPCYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLL  1695
             +C +  CPC+A+ RECDPDVC  CWV CGDG++G+P  +  N++C+NMKLLL  QQ+VLL
Sbjct  704   QCRSRQCPCFAADRECDPDVCRNCWVGCGDGTLGVPSQRGDNYECRNMKLLLKQQQRVLL  763

Query  1696  GRSDIAGWGAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQL  1875
             GRSD++GWGAFLKN    V K+E++G YTGELISH EADK GK+YDR+N SFLFNLNDQ 
Sbjct  764   GRSDVSGWGAFLKN---SVGKHEYLGEYTGELISHREADKRGKIYDRENSSFLFNLNDQF  820

Query  1876  VIDAYRRGNKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
             V+DAYR+G+KLKF NHSPDPNC+AKV             ++VAG     DHR G
Sbjct  821   VLDAYRKGDKLKFANHSPDPNCYAKV-------------IMVAG-----DHRVG  856


 Score =   168 bits (426),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 126/222 (57%), Positives = 155/222 (70%), Gaps = 11/222 (5%)
 Frame = +1

Query  709   LLAKRQTDAFDLQNSIGTGSGNKICS-SQEDGYASSDL---RSSIVLKNAVCpiklpkle  876
             LL KRQ D   + N +   +G K  + +QED +ASS +    S  V  N V PIKLP+++
Sbjct  90    LLVKRQGDTLGMLNGLDLNNGEKDTNGAQEDNHASSAVLIGTSFGVKNNIVRPIKLPEVK  149

Query  877   kippYTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALicsdsdeeiieeegenefaes  1056
             K+PPYTTW FL RNQ+M EDQSV+GRRRIYYD N GEALICSDS+EEI+EEE +     +
Sbjct  150   KLPPYTTWIFLDRNQRMTEDQSVVGRRRIYYDQNGGEALICSDSEEEIVEEEEDKREFGN  209

Query  1057  -edYILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLIKEGATS---KNENTEVTI  1224
              EDYILR  I++VG  D VLDLLA  FSR+P EVKARY+ L KE   +   K  N E   
Sbjct  210   CEDYILRKAIQEVGSSDDVLDLLAQCFSRRPCEVKARYELLTKEEKDALFIKKGNIEDNT  269

Query  1225  ---NSYLDEDLDAALSSFDNLFCQRCFVFNCQLHGCSQDLII  1341
                +S+ D+DLDAAL SFDNLFC+RC VF+C+LHGCSQDL+ 
Sbjct  270   QMDDSFFDKDLDAALDSFDNLFCRRCLVFDCRLHGCSQDLVF  311


 Score = 68.2 bits (165),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSKK  2167
             +I+V GDHR+GIFA + +NAG+EL YDY+Y+PD  PAWAK  +++  K
Sbjct  846   VIMVAGDHRVGIFAKERINAGEELFYDYRYEPDRAPAWAKKPEATGSK  893



>gb|ADD60709.1| putative polycomb protein EZ1 [Oryza brachyantha]
Length=893

 Score =   285 bits (729),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 135/235 (57%), Positives = 169/235 (72%), Gaps = 22/235 (9%)
 Frame = +1

Query  1336  IILKQIRVR-EELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTK  1512
              I K+I  R ++ C  YTPC C   CGK+CPC+     CEK+CGCP  CK  F+GCHC K
Sbjct  628   FIRKRITERKDQPCRQYTPCGCQSACGKQCPCLTNGTCCEKYCGCPKMCKNRFRGCHCAK  687

Query  1513  NECATNYCPCYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVL  1692
             ++C +  CPC+A+ RECDPDVC  CWV CGDG++G+P  +  N++C+NMKLLL  QQ+VL
Sbjct  688   SQCRSRQCPCFAADRECDPDVCRNCWVGCGDGTLGVPNQRGDNYECRNMKLLLKQQQRVL  747

Query  1693  LGRSDIAGWGAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQ  1872
             LGRSD++GWGAFLKN    V K+E++G YTGELISH EADK GK+YDR+N SFLFNLN++
Sbjct  748   LGRSDVSGWGAFLKN---SVGKHEYLGEYTGELISHKEADKRGKIYDRENSSFLFNLNNE  804

Query  1873  LVIDAYRRGNKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
              V+DAYR G+KLKF NHSPDPNC+AKV             ++VAG     DHR G
Sbjct  805   YVLDAYRMGDKLKFANHSPDPNCYAKV-------------IMVAG-----DHRVG  841


 Score =   153 bits (387),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 118/249 (47%), Positives = 155/249 (62%), Gaps = 20/249 (8%)
 Frame = +1

Query  706   DLLAKRQTDAFDLQNSIGTGSGNKICSSQEDGYASSDLRSSIVL-------KNAVCpikl  864
             +LL KRQ DA    NS       +    +++G  S D  SS V+       KNA+ PI+L
Sbjct  79    NLLTKRQEDALCAVNS------RESSPDEDEGGNSQDECSSTVIVGGNLSTKNAIRPIRL  132

Query  865   pklekippYTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALi-csdsdeeiieeegen  1041
             P++  +PPYTTW FL RNQ+M EDQSV+GRRRIYYD N GEALI     DE + +EE + 
Sbjct  133   PEVSTLPPYTTWIFLDRNQRMQEDQSVLGRRRIYYDTNCGEALICSDSEDEAVDDEEEKK  192

Query  1042  efaesedYILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDL---IKEGATSKNENT  1212
             EF +SED I+RMTI++ G+ D VL+ LA    R P ++KARY+ L     EG+  K    
Sbjct  193   EFKDSEDRIIRMTIQECGMSDAVLETLARDIERAPDDIKARYEILEGEKPEGSFKKVSEL  252

Query  1213  EVTI-NSYLDEDLDAALSSFDNLFCQRCFVFNCQLHGCSQDLIILKQIRVREELCAHYTP  1389
              V + + Y D+DLDAAL SFDNLFC+RC VF+C+LHGCSQDL+   + ++   LC+    
Sbjct  253   NVKMEDMYGDKDLDAALDSFDNLFCRRCLVFDCKLHGCSQDLVFPTEKQL--PLCSSDDG  310

Query  1390  CNC*PHCGK  1416
               C  HC K
Sbjct  311   TPCGIHCYK  319


 Score = 64.3 bits (155),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSKK  2167
             +I+V GDHR+GIFA + ++AG+EL YDY+Y+PD  PAWA+  +++  K
Sbjct  831   VIMVAGDHRVGIFAKERISAGEELFYDYRYEPDRAPAWARKPEAAGAK  878



>ref|XP_011008519.1| PREDICTED: histone-lysine N-methyltransferase CLF-like isoform 
X1 [Populus euphratica]
Length=931

 Score =   285 bits (730),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 131/226 (58%), Positives = 167/226 (74%), Gaps = 21/226 (9%)
 Frame = +1

Query  1360  REELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKNECATNYCP  1539
             +++ C  Y PC+C   CGK+C C++    CEK+C CP +CK  F+GCHC K++C +  CP
Sbjct  675   KDQPCRQYNPCSCQTACGKQCTCLLNGTCCEKYCRCPKSCKSRFRGCHCAKSQCRSRQCP  734

Query  1540  CYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLLGRSDIAGW  1719
             C+A+ RECDPDVC  CW+SCGDG++GIP  +  N++C+NMKLLL  QQ+VLLGRSD++GW
Sbjct  735   CFAADRECDPDVCRNCWISCGDGTLGIPSQRGDNYECRNMKLLLKQQQRVLLGRSDVSGW  794

Query  1720  GAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQLVIDAYRRG  1899
             GAFLKN    V K+E++G YTGELISH EADK GK+YDR+N SFLFNLNDQ V+DAYR+G
Sbjct  795   GAFLKN---SVGKHEYLGEYTGELISHREADKRGKIYDRENSSFLFNLNDQFVLDAYRKG  851

Query  1900  NKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
             +KLKF NHSPDPNC+AKV             ++VAG     DHR G
Sbjct  852   DKLKFANHSPDPNCYAKV-------------IMVAG-----DHRVG  879


 Score =   188 bits (478),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 131/227 (58%), Positives = 165/227 (73%), Gaps = 8/227 (4%)
 Frame = +1

Query  694   DGSADLLAKRQTDAFDLQNSIGTGSGNKIC-SSQEDGYASSD--LRSSIVLKNAVCpikl  864
             D S DL  KRQ DA  +   I + + +K    S+EDG+AS+   L SSI +KNAV PIKL
Sbjct  92    DNSIDLFTKRQNDALSMHGGIDSTNVDKDSHGSEEDGHASTAVLLGSSIPVKNAVRPIKL  151

Query  865   pklekippYTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALi-csdsdeeiieeegen  1041
             P++ ++PPYT+W FL RNQ+M EDQSV+GRRRIYYD N GEALI     +E I EEEG+ 
Sbjct  152   PEVNRLPPYTSWVFLDRNQRMTEDQSVVGRRRIYYDQNGGEALICSDSEEEIIDEEEGKR  211

Query  1042  efaesedYILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLIKEGAT---SKNENT  1212
              F ESEDYILRMTI++ G  D V++ LA+ FSR PSEVKAR++ L KE      SKN++ 
Sbjct  212   YFVESEDYILRMTIKEAGSSDPVVESLAHCFSRSPSEVKARFEVLKKEEKAVEDSKNKDI  271

Query  1213  EV-TINSYLDEDLDAALSSFDNLFCQRCFVFNCQLHGCSQDLIILKQ  1350
             E  T+NS+L +DL+AAL SFDNLFC+RC VF+C+LHGCSQDLI L +
Sbjct  272   EAQTLNSFLVKDLEAALDSFDNLFCRRCLVFDCRLHGCSQDLIFLAE  318


 Score = 68.2 bits (165),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSKK  2167
             +I+V GDHR+GIFA + +NAG+EL YDY+Y+PD  PAWA+  ++S  K
Sbjct  869   VIMVAGDHRVGIFAKERINAGEELFYDYRYEPDRAPAWARKPEASGSK  916



>ref|XP_006656878.1| PREDICTED: histone-lysine N-methyltransferase EZ1-like [Oryza 
brachyantha]
Length=892

 Score =   285 bits (728),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 135/235 (57%), Positives = 169/235 (72%), Gaps = 22/235 (9%)
 Frame = +1

Query  1336  IILKQIRVR-EELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTK  1512
              I K+I  R ++ C  YTPC C   CGK+CPC+     CEK+CGCP  CK  F+GCHC K
Sbjct  627   FIRKRITERKDQPCRQYTPCGCQSACGKQCPCLTNGTCCEKYCGCPKMCKNRFRGCHCAK  686

Query  1513  NECATNYCPCYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVL  1692
             ++C +  CPC+A+ RECDPDVC  CWV CGDG++G+P  +  N++C+NMKLLL  QQ+VL
Sbjct  687   SQCRSRQCPCFAADRECDPDVCRNCWVGCGDGTLGVPNQRGDNYECRNMKLLLKQQQRVL  746

Query  1693  LGRSDIAGWGAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQ  1872
             LGRSD++GWGAFLKN    V K+E++G YTGELISH EADK GK+YDR+N SFLFNLN++
Sbjct  747   LGRSDVSGWGAFLKN---SVGKHEYLGEYTGELISHKEADKRGKIYDRENSSFLFNLNNE  803

Query  1873  LVIDAYRRGNKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
              V+DAYR G+KLKF NHSPDPNC+AKV             ++VAG     DHR G
Sbjct  804   YVLDAYRMGDKLKFANHSPDPNCYAKV-------------IMVAG-----DHRVG  840


 Score =   153 bits (387),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 118/249 (47%), Positives = 155/249 (62%), Gaps = 20/249 (8%)
 Frame = +1

Query  706   DLLAKRQTDAFDLQNSIGTGSGNKICSSQEDGYASSDLRSSIVL-------KNAVCpikl  864
             +LL KRQ DA    NS       +    +++G  S D  SS V+       KNA+ PI+L
Sbjct  78    NLLTKRQEDALCAVNS------RESSPDEDEGGNSQDECSSTVIVGGNLSTKNAIRPIRL  131

Query  865   pklekippYTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALi-csdsdeeiieeegen  1041
             P++  +PPYTTW FL RNQ+M EDQSV+GRRRIYYD N GEALI     DE + +EE + 
Sbjct  132   PEVSTLPPYTTWIFLDRNQRMQEDQSVLGRRRIYYDTNCGEALICSDSEDEAVDDEEEKK  191

Query  1042  efaesedYILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDL---IKEGATSKNENT  1212
             EF +SED I+RMTI++ G+ D VL+ LA    R P ++KARY+ L     EG+  K    
Sbjct  192   EFKDSEDRIIRMTIQECGMSDAVLETLARDIERAPDDIKARYEILEGEKPEGSFKKVSEL  251

Query  1213  EVTI-NSYLDEDLDAALSSFDNLFCQRCFVFNCQLHGCSQDLIILKQIRVREELCAHYTP  1389
              V + + Y D+DLDAAL SFDNLFC+RC VF+C+LHGCSQDL+   + ++   LC+    
Sbjct  252   NVKMEDMYGDKDLDAALDSFDNLFCRRCLVFDCKLHGCSQDLVFPTEKQL--PLCSSDDG  309

Query  1390  CNC*PHCGK  1416
               C  HC K
Sbjct  310   TPCGIHCYK  318


 Score = 64.3 bits (155),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSKK  2167
             +I+V GDHR+GIFA + ++AG+EL YDY+Y+PD  PAWA+  +++  K
Sbjct  830   VIMVAGDHRVGIFAKERISAGEELFYDYRYEPDRAPAWARKPEAAGAK  877



>ref|XP_011008520.1| PREDICTED: histone-lysine N-methyltransferase CLF-like isoform 
X2 [Populus euphratica]
Length=928

 Score =   285 bits (730),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 131/226 (58%), Positives = 167/226 (74%), Gaps = 21/226 (9%)
 Frame = +1

Query  1360  REELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKNECATNYCP  1539
             +++ C  Y PC+C   CGK+C C++    CEK+C CP +CK  F+GCHC K++C +  CP
Sbjct  672   KDQPCRQYNPCSCQTACGKQCTCLLNGTCCEKYCRCPKSCKSRFRGCHCAKSQCRSRQCP  731

Query  1540  CYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLLGRSDIAGW  1719
             C+A+ RECDPDVC  CW+SCGDG++GIP  +  N++C+NMKLLL  QQ+VLLGRSD++GW
Sbjct  732   CFAADRECDPDVCRNCWISCGDGTLGIPSQRGDNYECRNMKLLLKQQQRVLLGRSDVSGW  791

Query  1720  GAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQLVIDAYRRG  1899
             GAFLKN    V K+E++G YTGELISH EADK GK+YDR+N SFLFNLNDQ V+DAYR+G
Sbjct  792   GAFLKN---SVGKHEYLGEYTGELISHREADKRGKIYDRENSSFLFNLNDQFVLDAYRKG  848

Query  1900  NKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
             +KLKF NHSPDPNC+AKV             ++VAG     DHR G
Sbjct  849   DKLKFANHSPDPNCYAKV-------------IMVAG-----DHRVG  876


 Score =   188 bits (478),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 131/227 (58%), Positives = 165/227 (73%), Gaps = 8/227 (4%)
 Frame = +1

Query  694   DGSADLLAKRQTDAFDLQNSIGTGSGNKIC-SSQEDGYASSD--LRSSIVLKNAVCpikl  864
             D S DL  KRQ DA  +   I + + +K    S+EDG+AS+   L SSI +KNAV PIKL
Sbjct  89    DNSIDLFTKRQNDALSMHGGIDSTNVDKDSHGSEEDGHASTAVLLGSSIPVKNAVRPIKL  148

Query  865   pklekippYTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALi-csdsdeeiieeegen  1041
             P++ ++PPYT+W FL RNQ+M EDQSV+GRRRIYYD N GEALI     +E I EEEG+ 
Sbjct  149   PEVNRLPPYTSWVFLDRNQRMTEDQSVVGRRRIYYDQNGGEALICSDSEEEIIDEEEGKR  208

Query  1042  efaesedYILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLIKEGAT---SKNENT  1212
              F ESEDYILRMTI++ G  D V++ LA+ FSR PSEVKAR++ L KE      SKN++ 
Sbjct  209   YFVESEDYILRMTIKEAGSSDPVVESLAHCFSRSPSEVKARFEVLKKEEKAVEDSKNKDI  268

Query  1213  EV-TINSYLDEDLDAALSSFDNLFCQRCFVFNCQLHGCSQDLIILKQ  1350
             E  T+NS+L +DL+AAL SFDNLFC+RC VF+C+LHGCSQDLI L +
Sbjct  269   EAQTLNSFLVKDLEAALDSFDNLFCRRCLVFDCRLHGCSQDLIFLAE  315


 Score = 68.2 bits (165),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSKK  2167
             +I+V GDHR+GIFA + +NAG+EL YDY+Y+PD  PAWA+  ++S  K
Sbjct  866   VIMVAGDHRVGIFAKERINAGEELFYDYRYEPDRAPAWARKPEASGSK  913



>ref|XP_007047320.1| SET domain-containing protein isoform 4 [Theobroma cacao]
 gb|EOX91477.1| SET domain-containing protein isoform 4 [Theobroma cacao]
Length=1037

 Score =   286 bits (733),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 132/212 (62%), Positives = 166/212 (78%), Gaps = 6/212 (3%)
 Frame = +1

Query  1339  ILKQIRVR-EELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKN  1515
             I K+I  R ++ C  Y PC+C   CGK+C C++    CEK+CGCP +CK  F+GCHC K+
Sbjct  659   IRKRITERKDQPCRQYNPCSCQTACGKQCSCLLNGTCCEKYCGCPKSCKNRFRGCHCAKS  718

Query  1516  ECATNYCPCYASGRECDPDVCCFCWVSCGD--GSIGIPPDKVSNHKCQNMKLLLGHQQKV  1689
             +C +  CPC+A+ RECDPDVC  CWVSCGD  GS+G+PP +  N++C+NMKLLL  QQ+V
Sbjct  719   QCRSRQCPCFAADRECDPDVCRNCWVSCGDGTGSLGVPPQRGDNYECRNMKLLLKQQQRV  778

Query  1690  LLGRSDIAGWGAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLND  1869
             LLGRSD++GWGAFLKN    V K+E++G YTGELISH EADK GK+YDR+N SFLFNLND
Sbjct  779   LLGRSDVSGWGAFLKN---SVGKHEYLGEYTGELISHREADKRGKIYDRENSSFLFNLND  835

Query  1870  QLVIDAYRRGNKLKFINHSPDPNCFAKVNCSL  1965
             Q V+DAYR+G+KLKF NHSPDPNC+AKV+  L
Sbjct  836   QFVLDAYRKGDKLKFANHSPDPNCYAKVHNRL  867


 Score =   197 bits (500),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 127/221 (57%), Positives = 160/221 (72%), Gaps = 5/221 (2%)
 Frame = +1

Query  694   DGSADLLAKRQTDAFDLQNSIGTGSGNKICSSQEDGYASSDLRSSIVLKNAVCpiklpkl  873
             D ++DLL KRQ DA  +QN I   +G+K   S ++   +  + SSI +KNAV PIKL ++
Sbjct  88    DSASDLLTKRQKDALGMQNGIDVSNGDKDSHSYQEASTAVLMGSSIPVKNAVRPIKLTEV  147

Query  874   ekippYTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALi-csdsdeeiieeegenefa  1050
             +K+PPYTTW FL RNQ+M EDQSV+GRRRIYYD N GEALI     +E I EEE + +F 
Sbjct  148   KKLPPYTTWIFLDRNQRMTEDQSVVGRRRIYYDQNGGEALICSDSEEEVIEEEEEKRDFV  207

Query  1051  esedYILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLIKE---GATSKNENTEV-  1218
             ESED+ILRMTI++VGL D VL+ LA  FSR P EVKARY+ L+KE      SKN + E  
Sbjct  208   ESEDFILRMTIKEVGLSDPVLESLAQCFSRSPPEVKARYETLMKEEKDAGASKNADIEAQ  267

Query  1219  TINSYLDEDLDAALSSFDNLFCQRCFVFNCQLHGCSQDLII  1341
               NS+L++DL+A L SFDNLFC+RC VF+C+LHGCSQDLI 
Sbjct  268   NWNSFLEKDLEAGLDSFDNLFCRRCLVFDCRLHGCSQDLIF  308



>ref|XP_004511910.1| PREDICTED: histone-lysine N-methyltransferase CLF-like [Cicer 
arietinum]
Length=863

 Score =   284 bits (726),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 137/234 (59%), Positives = 169/234 (72%), Gaps = 22/234 (9%)
 Frame = +1

Query  1339  ILKQIRVR-EELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKN  1515
             I K+I  R ++ C  Y PC C   CGK+C C+     CEK+CGCP +CK  F+GCHC K+
Sbjct  599   IRKRITERKDQPCRQYNPCGCQTACGKQCSCLQNGTCCEKYCGCPKSCKNRFRGCHCAKS  658

Query  1516  ECATNYCPCYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLL  1695
             +C +  CPC+A+ RECDPDVC  CWVSCGDG++GIP  +  N++C+NMKLLL  QQKVLL
Sbjct  659   QCRSRQCPCFAADRECDPDVCRNCWVSCGDGTLGIPSQRGDNYECRNMKLLLKQQQKVLL  718

Query  1696  GRSDIAGWGAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQL  1875
             GRSD++GWGAFLKN    V K+E++G YTGELISH EADK GK+YDR+N SFLFNLNDQ 
Sbjct  719   GRSDVSGWGAFLKN---SVGKHEYLGEYTGELISHREADKRGKIYDRENSSFLFNLNDQF  775

Query  1876  VIDAYRRGNKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
             V+DAYR+G+KLKF NHSP PNC+AKV             ++VAG     DHR G
Sbjct  776   VLDAYRKGDKLKFANHSPVPNCYAKV-------------IMVAG-----DHRVG  811


 Score =   177 bits (449),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 123/228 (54%), Positives = 159/228 (70%), Gaps = 18/228 (8%)
 Frame = +1

Query  700   SADLLAKRQTDAFDLQNSIGTGSGNKICSSQEDGYASSD-------LRSSIVLKNAVCpi  858
             S DLL KRQ DA D+ N +  G+ +K    + +GY   D       L S++ +KNAV PI
Sbjct  93    SLDLLTKRQKDAVDMHNGVCGGNDDK----ESNGYHGDDHGSTAVLLGSNVAVKNAVRPI  148

Query  859   klpklekippYTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALi-csdsdeeiieeeg  1035
             KLP+++++PPYTTW FL RNQ+M EDQSV+GRRRIYYD N GEALI     +E I EEE 
Sbjct  149   KLPEVKRLPPYTTWIFLDRNQRMTEDQSVVGRRRIYYDQNGGEALICSDSEEEIIDEEEE  208

Query  1036  enefaesedYILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLIKE---GATSKN-  1203
             + EF +SED+ILRMTI + GL D V + LA  FSRK S++KARY+ L  +   G  SKN 
Sbjct  209   KREFVQSEDFILRMTIREFGLSDAVSETLAQCFSRKASDIKARYETLCNDDNAGGDSKNG  268

Query  1204  --ENTEVTINSYLDEDLDAALSSFDNLFCQRCFVFNCQLHGCSQDLII  1341
               E+   + NS+L++DL+AAL SFDNLFC+RC VF+C+LHGCSQDL+ 
Sbjct  269   DIEDNSQSDNSFLEKDLEAALDSFDNLFCRRCRVFDCRLHGCSQDLVF  316


 Score = 67.8 bits (164),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSKK  2167
             +I+V GDHR+GIFA + +NAG+EL YDY+Y+PD  PAWA+  ++S  K
Sbjct  801   VIMVAGDHRVGIFAKERINAGEELFYDYRYEPDRAPAWARKPEASGSK  848



>ref|XP_006404821.1| hypothetical protein EUTSA_v10000037mg [Eutrema salsugineum]
 ref|XP_006404822.1| hypothetical protein EUTSA_v10000037mg [Eutrema salsugineum]
 gb|ESQ46274.1| hypothetical protein EUTSA_v10000037mg [Eutrema salsugineum]
 gb|ESQ46275.1| hypothetical protein EUTSA_v10000037mg [Eutrema salsugineum]
Length=906

 Score =   285 bits (728),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 133/234 (57%), Positives = 172/234 (74%), Gaps = 6/234 (3%)
 Frame = +1

Query  1339  ILKQIRVR-EELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKN  1515
             I K+I  R ++ C  + PCNC   CGK+C C++    CEK+CGCP +CK  F+GCHC K+
Sbjct  641   IRKRITERKDQPCRQFNPCNCKTSCGKECTCLLNGTCCEKYCGCPKSCKNRFRGCHCAKS  700

Query  1516  ECATNYCPCYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLL  1695
             +C +  CPC+A+ RECDPDVC  CWV  GDG++G+P  +  N++C+NMKLLL  QQ+VLL
Sbjct  701   QCRSRQCPCFAADRECDPDVCRNCWVIGGDGTLGVPSQRGDNYECRNMKLLLKQQQRVLL  760

Query  1696  GRSDIAGWGAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQL  1875
             GRSD++GWGAFLKN    VSK+E++G YTGELISH EADK GK+YDR+N SFLFNLNDQ 
Sbjct  761   GRSDVSGWGAFLKN---SVSKHEYLGEYTGELISHKEADKRGKIYDRENSSFLFNLNDQF  817

Query  1876  VIDAYRRGNKLKFINHSPDPNCFAKVNCSLSPCLLQCF--QLIVAGGSFSIDHR  2031
             V+DAYR+G+KLKF NHSP+PNC+AKV        +  F  + I+AG     D+R
Sbjct  818   VLDAYRKGDKLKFANHSPEPNCYAKVIMVAGDHRVGIFAKERIMAGEELFYDYR  871


 Score =   168 bits (426),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 118/251 (47%), Positives = 165/251 (66%), Gaps = 11/251 (4%)
 Frame = +1

Query  682   GLVGDGSADLLAKRQTDAFDLQNSIGTGSGNKICSS-QEDGYASSDLR--SSIVLKNAVC  852
             G   DGS DLL KRQ D+  +++ I    G+K   S  EDG+ S+ +   SS+ +K ++ 
Sbjct  81    GSYKDGS-DLLVKRQRDSLGMKSGIDANDGDKNNHSFLEDGHVSAAMAQGSSVPVKISLR  139

Query  853   piklpklekippYTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALi-csdsdeeiiee  1029
             PIK+P ++++ PYTTW FL RNQ+M EDQSV+GRRRIYYD   GEALI     +E I EE
Sbjct  140   PIKIPDIKRLSPYTTWVFLDRNQRMTEDQSVVGRRRIYYDQTGGEALICSDSEEEVIDEE  199

Query  1030  egenefaesedYILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLIKEGATSKNEN  1209
             + + +F E ED+I+RMT+E++G+ D VL+ LAN  SR  SE+KAR+  L+KE   S++ +
Sbjct  200   DEKKDFVEPEDFIVRMTLEQLGVSDCVLEELANFLSRSSSEIKARHAVLMKEKEVSESGD  259

Query  1210  TEVTINSYLDEDLDAALSSFDNLFCQRCFVFNCQLHGCSQDLIILKQIRVREELCAHYTP  1389
              +   +S L++D++ AL SFDNLFC+RC VF+C+LHGCSQDLI        E+      P
Sbjct  260   NQAE-SSLLNKDMEGALDSFDNLFCRRCLVFDCRLHGCSQDLIFPA-----EKPAPWSAP  313

Query  1390  CNC*PHCGKKC  1422
              +    CG KC
Sbjct  314   VDENLTCGAKC  324


 Score = 63.5 bits (153),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSKK  2167
             +I+V GDHR+GIFA + + AG+EL YDY+Y+P+  PAWA+  ++S  K
Sbjct  843   VIMVAGDHRVGIFAKERIMAGEELFYDYRYEPERAPAWARKPEASGSK  890



>ref|NP_179919.1| histone-lysine N-methyltransferase CLF [Arabidopsis thaliana]
 sp|P93831.2|CLF_ARATH RecName: Full=Histone-lysine N-methyltransferase CLF; AltName: 
Full=Polycomb group protein CURLY LEAF; AltName: Full=Protein 
INCURVATA 1; AltName: Full=Protein SET DOMAIN GROUP 1; AltName: 
Full=Protein photoperiod insensitive flowering [Arabidopsis 
thaliana]
 gb|AAC23781.1| curly leaf protein (polycomb-group) [Arabidopsis thaliana]
 gb|AEC07449.1| histone-lysine N-methyltransferase CLF [Arabidopsis thaliana]
Length=902

 Score =   284 bits (727),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 134/234 (57%), Positives = 173/234 (74%), Gaps = 6/234 (3%)
 Frame = +1

Query  1339  ILKQI-RVREELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKN  1515
             I K+I   +++ C  + PCNC   CGK+CPC++    CEK+CGCP +CK  F+GCHC K+
Sbjct  637   IRKRITEKKDQPCRQFNPCNCKIACGKECPCLLNGTCCEKYCGCPKSCKNRFRGCHCAKS  696

Query  1516  ECATNYCPCYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLL  1695
             +C +  CPC+A+ RECDPDVC  CWV  GDGS+G+P  +  N++C+NMKLLL  QQ+VLL
Sbjct  697   QCRSRQCPCFAADRECDPDVCRNCWVIGGDGSLGVPSQRGDNYECRNMKLLLKQQQRVLL  756

Query  1696  GRSDIAGWGAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQL  1875
             G SD++GWGAFLKN    VSK+E++G YTGELISH EADK GK+YDR+NCSFLFNLNDQ 
Sbjct  757   GISDVSGWGAFLKN---SVSKHEYLGEYTGELISHKEADKRGKIYDRENCSFLFNLNDQF  813

Query  1876  VIDAYRRGNKLKFINHSPDPNCFAKVNCSLSPCLLQCF--QLIVAGGSFSIDHR  2031
             V+DAYR+G+KLKF NHSP+PNC+AKV        +  F  + I+AG     D+R
Sbjct  814   VLDAYRKGDKLKFANHSPEPNCYAKVIMVAGDHRVGIFAKERILAGEELFYDYR  867


 Score =   166 bits (421),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 113/223 (51%), Positives = 155/223 (70%), Gaps = 8/223 (4%)
 Frame = +1

Query  682   GLVGDGSADLLAKRQTDAFDLQNSIGTGSGNKICSSQEDGYASSDL--RSSIVLKNAVCp  855
             G   DGS DLL KRQ D+  +++ I   + N+     EDG ASS +   SS+ +K ++ P
Sbjct  78    GSCKDGS-DLLVKRQRDSPGMKSGIDESNNNRYV---EDGPASSGMVQGSSVPVKISLRP  133

Query  856   iklpklekippYTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALi-csdsdeeiieee  1032
             IK+P ++++ PYTTW FL RNQ+M EDQSV+GRRRIYYD   GEALI     +E I +EE
Sbjct  134   IKMPDIKRLSPYTTWVFLDRNQRMTEDQSVVGRRRIYYDQTGGEALICSDSEEEAIDDEE  193

Query  1033  genefaesedYILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLIKEGATSKNENT  1212
              + +F E EDYI+RMT+E++GL D VL  LA+  SR  SE+KAR+  L+KE   S++ + 
Sbjct  194   EKRDFLEPEDYIIRMTLEQLGLSDSVLAELASFLSRSTSEIKARHGVLMKEKEVSESGDN  253

Query  1213  EVTINSYLDEDLDAALSSFDNLFCQRCFVFNCQLHGCSQDLII  1341
             +   +S L++D++ AL SFDNLFC+RC VF+C+LHGCSQDLI 
Sbjct  254   QAE-SSLLNKDMEGALDSFDNLFCRRCLVFDCRLHGCSQDLIF  295


 Score = 63.2 bits (152),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 36/48 (75%), Gaps = 0/48 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSKK  2167
             +I+V GDHR+GIFA + + AG+EL YDY+Y+PD  PAWAK  ++   K
Sbjct  839   VIMVAGDHRVGIFAKERILAGEELFYDYRYEPDRAPAWAKKPEAPGSK  886



>dbj|BAH36888.1| Polycomb group protein [Physcomitrella patens]
 gb|ACR07925.1| CLF protein [Physcomitrella patens]
Length=999

 Score =   261 bits (667),  Expect(2) = 1e-78, Method: Compositional matrix adjust.
 Identities = 123/220 (56%), Positives = 155/220 (70%), Gaps = 11/220 (5%)
 Frame = +1

Query  1294  FVFNCQLHGCSQDLIILKQIRVREELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPL  1473
             + F   +H     LI  +    +++ C  YTPCNC   CGK+CPC++    CEK+CGC  
Sbjct  729   YTFKSVVH----PLIRKRLANGKDQTCRQYTPCNCLYTCGKQCPCLLNGTCCEKYCGCSK  784

Query  1474  NCKI*FQGCHCTKNECATNYCPCYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQ  1653
             +CK  F+GCHC K+ C +  CPC+A+GRECDPDVC  CWV CG+  +         + C 
Sbjct  785   SCKNRFRGCHCAKSNCCSRQCPCFAAGRECDPDVCRNCWVGCGEKHV----KPAVEYTCH  840

Query  1654  NMKLLLGHQQKVLLGRSDIAGWGAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYD  1833
             NMKL+L  QQ+VLLGRSD+AGWGAFLK     V+K+E++G YTGELISH EADK GK+YD
Sbjct  841   NMKLMLKQQQRVLLGRSDVAGWGAFLKK---TVAKHEYLGEYTGELISHREADKRGKIYD  897

Query  1834  RQNCSFLFNLNDQLVIDAYRRGNKLKFINHSPDPNCFAKV  1953
             R+N SFLFNLNDQ V+DA R+G+KLKF NHSP PNC+AKV
Sbjct  898   RENSSFLFNLNDQYVLDACRKGDKLKFANHSPTPNCYAKV  937


 Score = 62.8 bits (151),  Expect(2) = 1e-78, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAK  2143
             +I+V GDHR+GIFA + + AG+EL YDYQY+PD  P WA+
Sbjct  937   VIMVSGDHRVGIFAKERIGAGEELFYDYQYEPDRAPVWAR  976


 Score =   105 bits (263),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 73/195 (37%), Positives = 106/195 (54%), Gaps = 45/195 (23%)
 Frame = +1

Query  889   YTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALicsdsdeeiieeegenef-----ae  1053
             YTTW +L RNQ+M EDQSV+GRRRIYYD +  E LI SDS+EE   ++ + +      ++
Sbjct  153   YTTWIYLDRNQRMTEDQSVVGRRRIYYDSDGNETLIASDSEEEDPGDDDDKDEPKHDFSK  212

Query  1054  sedYILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLIKE---------------G  1188
              ED ++ M+I+++GL  +VL+ L++    KP E++ARY  L+K+               G
Sbjct  213   GEDTLIWMSIQELGLKSVVLNELSDVLDIKPEEIEARYDILLKDFAKNGGSEMLLPTAVG  272

Query  1189  ATSKNENTEVTINSY-------------------------LDEDLDAALSSFDNLFCQRC  1293
              T   E T  T   +                           +DL AA+ SFD LFC+RC
Sbjct  273   TTRDKEFTRGTFQEFSLFNSGKEAVKEENELPDTQEDDDNETKDLLAAMDSFDTLFCRRC  332

Query  1294  FVFNCQLHGCSQDLI  1338
              VF+C+LHGCSQ ++
Sbjct  333   LVFDCRLHGCSQAIV  347



>gb|KHN36244.1| Histone-lysine N-methyltransferase CLF [Glycine soja]
Length=867

 Score =   283 bits (725),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 139/240 (58%), Positives = 171/240 (71%), Gaps = 28/240 (12%)
 Frame = +1

Query  1339  ILKQIRVR-EELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKN  1515
             I K+I  R ++ C  Y PC C   CGK+CPC+     CEK+CGCP +CK  F+GCHC K+
Sbjct  597   IRKRITERKDQPCRQYNPCGCQSACGKQCPCLQNGTCCEKYCGCPKSCKNRFRGCHCAKS  656

Query  1516  ECATNYCPCYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLL  1695
             +C +  CPC+A+ RECDPDVC  CWVSCGDG++GIP  +  N++C+NMKLLL  QQ+VLL
Sbjct  657   QCRSRQCPCFAADRECDPDVCRNCWVSCGDGTLGIPSQRGDNYECRNMKLLLKQQQRVLL  716

Query  1696  GRSDIAGWGAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQ-  1872
             GRSDI+GWGAFLKN    V K+E++G YTGELISH EADK GK+YDR+N SFLFNLNDQ 
Sbjct  717   GRSDISGWGAFLKN---SVGKHEYLGEYTGELISHREADKRGKIYDRENSSFLFNLNDQA  773

Query  1873  -----LVIDAYRRGNKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
                   V+DAYR+G+KLKF NHSPDPNC+AKV             ++VAG     DHR G
Sbjct  774   SFYDFFVLDAYRKGDKLKFANHSPDPNCYAKV-------------IMVAG-----DHRVG  815


 Score =   173 bits (439),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 119/224 (53%), Positives = 156/224 (70%), Gaps = 10/224 (4%)
 Frame = +1

Query  700   SADLLAKRQTDAFDLQNSIGTGSGNKICSSQED---GYASSDLRSSIVLKNAVCpiklpk  870
             S DLL KRQ DA D+ N +   +G+   +   D   G  +  L S++ +KNAV PIKLP+
Sbjct  92    SLDLLTKRQKDAIDMHNGVHASNGDVESNGYHDDNHGSTAVLLGSNVAVKNAVRPIKLPE  151

Query  871   lekippYTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALi-csdsdeeiieeegenef  1047
             ++K+PPYTTW FL RNQ+M EDQSV+GRRRIYYD N GEALI     +E + +EE + EF
Sbjct  152   VKKLPPYTTWIFLDRNQRMTEDQSVVGRRRIYYDQNGGEALICSDSEEETMDDEEEKREF  211

Query  1048  aesedYILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLI---KEGATSK---NEN  1209
              ESEDYILRMT+++ GL D+VL+ LA  FSR  SE+KA+Y+ L      G  SK   +E 
Sbjct  212   IESEDYILRMTVKEFGLTDIVLESLAQCFSRNTSEIKAKYETLSIHDNAGGCSKAGDSEE  271

Query  1210  TEVTINSYLDEDLDAALSSFDNLFCQRCFVFNCQLHGCSQDLII  1341
                + N +L++DL+AAL SFDNLFC+RC VF+C+LHGCSQDL+ 
Sbjct  272   NSQSGNFFLEKDLEAALDSFDNLFCRRCLVFDCRLHGCSQDLVF  315


 Score = 64.7 bits (156),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSKK  2167
             +I+V GDHR+GIFA + + AG+EL YDY+Y+PD  PAWA+  ++S  K
Sbjct  805   VIMVAGDHRVGIFAKERICAGEELFYDYRYEPDRAPAWARKPEASGSK  852



>gb|EPS61713.1| hypothetical protein M569_13078, partial [Genlisea aurea]
Length=899

 Score =   284 bits (727),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 132/226 (58%), Positives = 166/226 (73%), Gaps = 21/226 (9%)
 Frame = +1

Query  1360  REELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKNECATNYCP  1539
             +++ C  + PC C   CGK C C+V    CEK+CGCP +CK  F+GCHC K++C +  CP
Sbjct  644   KDQPCRQFNPCGCQSACGKTCLCLVNGTVCEKYCGCPKSCKNRFRGCHCAKSQCRSRQCP  703

Query  1540  CYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLLGRSDIAGW  1719
             C+A+ RECDPDVC  CW+SCGDG++G+P  +  N++C+NMKLLL  QQKVLLGRSD++GW
Sbjct  704   CFAADRECDPDVCRNCWISCGDGTLGMPFQRGDNYECRNMKLLLKQQQKVLLGRSDVSGW  763

Query  1720  GAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQLVIDAYRRG  1899
             GAFLKN    V K+E++G YTGELISH EADK GK+YDR+N SFLFNLNDQ V+DAYR+G
Sbjct  764   GAFLKN---SVGKHEYLGEYTGELISHREADKRGKIYDRENSSFLFNLNDQFVLDAYRKG  820

Query  1900  NKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
             +KLKF NHSPDPNC+AKV             ++VAG     DHR G
Sbjct  821   DKLKFANHSPDPNCYAKV-------------ILVAG-----DHRVG  848


 Score =   194 bits (492),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 129/227 (57%), Positives = 162/227 (71%), Gaps = 8/227 (4%)
 Frame = +1

Query  685   LVGDGSADLLAKRQTDAFDLQNSIGTGS--GNKICSSQEDGYASSD--LRSSIVLKNAVC  852
             L  D   DLLAKRQ DA D+ N IGT S   N+  S+QED YA S   L SSI +KNAV 
Sbjct  82    LSADRGIDLLAKRQKDAIDMHNGIGTSSHGDNESTSTQEDEYAPSAILLGSSIAVKNAVR  141

Query  853   piklpklekippYTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALi-csdsdeeiiee  1029
             PIKLP+++K+PPYTTW FL RNQ+M EDQSV+GRRRIYYD + GEALI     +E + +E
Sbjct  142   PIKLPEVKKLPPYTTWIFLDRNQRMTEDQSVVGRRRIYYDQSGGEALICSDSEEEAVDDE  201

Query  1030  egenefaesedYILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLIKEGATSKNEN  1209
             E + EFA SEDYILRMT+++VG  D   +L+A   SRK SE+  RY++LIK        N
Sbjct  202   EEKKEFAGSEDYILRMTLKEVGSSDTAFELVAECLSRKSSEIMGRYEELIKSENAICEAN  261

Query  1210  TEVT---INSYLDEDLDAALSSFDNLFCQRCFVFNCQLHGCSQDLII  1341
             + ++   ++ Y+D+DLDAAL SFDNLFC+RC VF+C+LHGCSQDLI 
Sbjct  262   SGISECFVSPYIDKDLDAALDSFDNLFCRRCLVFDCRLHGCSQDLIF  308


 Score = 61.2 bits (147),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 36/48 (75%), Gaps = 0/48 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSKK  2167
             +I+V GDHR+GIFA + + AG+EL YDY+Y+ D  PAWAK  ++  K+
Sbjct  838   VILVAGDHRVGIFAKERIFAGEELFYDYRYEADRAPAWAKKPEAGGKR  885



>ref|XP_006361736.1| PREDICTED: histone-lysine N-methyltransferase CLF-like isoform 
X2 [Solanum tuberosum]
Length=889

 Score =   283 bits (725),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 135/234 (58%), Positives = 170/234 (73%), Gaps = 22/234 (9%)
 Frame = +1

Query  1339  ILKQIRVR-EELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKN  1515
             I K+I  R ++ C  + PC C   CGK+C C+V    CEK+CGCP  CK  F+GCHC K+
Sbjct  625   IRKRISERKDQPCRQFNPCGCQGPCGKECSCIVNGTCCEKYCGCPKGCKNRFRGCHCAKS  684

Query  1516  ECATNYCPCYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLL  1695
             +C +  CPC+A+GRECDPDVC  CW+SCGDG++G+P  +  +H+C+NMKLLL  QQKVLL
Sbjct  685   QCRSRQCPCFAAGRECDPDVCRNCWISCGDGTLGVPLQRGDSHECRNMKLLLKQQQKVLL  744

Query  1696  GRSDIAGWGAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQL  1875
             GRSD++GWGAFLKN    V K+E++G YTGELISH EADK GK+YDR+N SFLFNLNDQ 
Sbjct  745   GRSDVSGWGAFLKN---TVGKHEYLGEYTGELISHREADKRGKIYDRENSSFLFNLNDQF  801

Query  1876  VIDAYRRGNKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
             V+DA+R+G+KLKF NHSP PNC+AKV             ++VAG     DHR G
Sbjct  802   VLDAHRKGDKLKFANHSPVPNCYAKV-------------MMVAG-----DHRVG  837


 Score =   209 bits (531),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 148/269 (55%), Positives = 187/269 (70%), Gaps = 10/269 (4%)
 Frame = +1

Query  691   GDGSADLLAKRQTDAFDLQNSIGTGSGNKICSSQED-GYASSD--LRSSIVLKNAVCpik  861
              DG  DLL+KRQ DA D+QN + T + +   +S ED GYA+S   L SSI +KNAV PIK
Sbjct  87    ADGRIDLLSKRQKDALDMQNGVDTSNADDDSNSSEDDGYATSAILLGSSIAVKNAVRPIK  146

Query  862   lpklekippYTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALi-csdsdeeiieeege  1038
             LP++++IPPYT+W FL RNQ+M EDQSV+GRRRIYYD N GE LI     +E + EEE +
Sbjct  147   LPEVKRIPPYTSWIFLDRNQRMTEDQSVVGRRRIYYDQNGGETLICSDSDEEVLEEEEEK  206

Query  1039  nefaesedYILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLIKE--GATSKNENT  1212
               FAESEDY+LRMT+++VGL D+VLDLL    SRKPSEVKARY+ L+KE    TSKNE T
Sbjct  207   KVFAESEDYMLRMTVKEVGLSDIVLDLLGQCLSRKPSEVKARYEGLVKEDDAGTSKNEFT  266

Query  1213  EVTINSYLDEDLDAALSSFDNLFCQRCFVFNCQLHGCSQDLIILKQIRVREELCAHYTPC  1392
             E +++ YL +DLDAAL SFDNLFC+RC VF+C+LHGCSQDLI   + ++    C++    
Sbjct  267   ESSLDLYLAKDLDAALDSFDNLFCRRCLVFDCRLHGCSQDLIFPAEKQL-PWYCSNADME  325

Query  1393  NC*PHCGKKCPC---VVKSIYCEKFCGCP  1470
              C P+C    P    V +   C K  G P
Sbjct  326   PCGPNCFSLMPGRKHVSRRSKCSKGEGAP  354


 Score = 62.8 bits (151),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSKK  2167
             +++V GDHR+GIFA + + AG+EL YDY+Y+PD+ PAWA+  ++S  +
Sbjct  827   VMMVAGDHRVGIFANERICAGEELFYDYRYEPDSAPAWARKPEASGTR  874



>gb|ADD60685.1| putative polycomb protein EZ1 [Oryza australiensis]
Length=896

 Score =   283 bits (725),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 135/235 (57%), Positives = 169/235 (72%), Gaps = 22/235 (9%)
 Frame = +1

Query  1336  IILKQIRVR-EELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTK  1512
              I K+I  R ++ C  YTPC C   CGK+CPC+     CEK+CGCP  CK  F+GCHC K
Sbjct  631   FIRKRITERKDQPCRQYTPCGCQSACGKQCPCLTNGTCCEKYCGCPKMCKNRFRGCHCAK  690

Query  1513  NECATNYCPCYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVL  1692
             ++C +  CPC+A+ RECDPDVC  CWV CGDG++G+P  +  N++C+NMKLLL  QQ+VL
Sbjct  691   SQCRSRQCPCFAADRECDPDVCRNCWVGCGDGTLGVPNQRGDNYECRNMKLLLKQQQRVL  750

Query  1693  LGRSDIAGWGAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQ  1872
             LGRSD++GWGAFLKN    V K+E++G YTGELISH EADK GK+YDR+N SFLFNLN++
Sbjct  751   LGRSDVSGWGAFLKN---SVGKHEYLGEYTGELISHKEADKRGKIYDRENSSFLFNLNNE  807

Query  1873  LVIDAYRRGNKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
              V+DAYR G+KLKF NHSPDPNC+AKV             ++VAG     DHR G
Sbjct  808   YVLDAYRMGDKLKFANHSPDPNCYAKV-------------IMVAG-----DHRVG  844


 Score =   152 bits (385),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 116/249 (47%), Positives = 154/249 (62%), Gaps = 18/249 (7%)
 Frame = +1

Query  703   ADLLAKRQTDAFDLQNSIGTGSGNKICSSQEDGYASSDLRSSIVL------KNAVCpikl  864
             ++LLAKRQ DA    NS  +          EDG    +  S++++      +N+V PI+L
Sbjct  78    SNLLAKRQEDALCAVNSRESSP-----DESEDGNCQDECSSTVIVGGNLSARNSVRPIRL  132

Query  865   pklekippYTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALi-csdsdeeiieeegen  1041
             P++  +PPYTTW FL RNQ+M EDQSV+GRRRIYYD N GEALI     DE + +EE + 
Sbjct  133   PEVATLPPYTTWIFLDRNQRMQEDQSVLGRRRIYYDTNCGEALICSDSEDEAVEDEEEKK  192

Query  1042  efaesedYILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDL---IKEGATSKNENT  1212
             EF +SED I+RMTI++ G+ D VL+ LA    R P ++KARY+ L     EG + K    
Sbjct  193   EFKDSEDCIIRMTIQECGMSDAVLETLARDIERAPDDIKARYEILQGEKPEGYSKKVSEL  252

Query  1213  EVTINS-YLDEDLDAALSSFDNLFCQRCFVFNCQLHGCSQDLIILKQIRVREELCAHYTP  1389
              V +   Y D+DLDAAL SFDNLFC+RC VF+C+LHGCSQDL+   + +    LC+    
Sbjct  253   NVKMEDVYGDKDLDAALDSFDNLFCRRCLVFDCKLHGCSQDLVFPTEKQA--PLCSSDDG  310

Query  1390  CNC*PHCGK  1416
               C  HC K
Sbjct  311   TPCGIHCYK  319


 Score = 63.2 bits (152),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAK  2143
             +I+V GDHR+GIFA + ++AG+EL YDY+Y+PD  PAWA+
Sbjct  834   VIMVAGDHRVGIFAKERISAGEELFYDYRYEPDRAPAWAR  873



>ref|XP_002307273.2| Polycomb group protein CURLY LEAF [Populus trichocarpa]
 gb|EEE94269.2| Polycomb group protein CURLY LEAF [Populus trichocarpa]
Length=917

 Score =   284 bits (726),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 130/226 (58%), Positives = 167/226 (74%), Gaps = 5/226 (2%)
 Frame = +1

Query  1360  REELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKNECATNYCP  1539
             +++ C  Y PC+C   CGK+C C++    CEK+C CP +CK  F+GCHC K++C +  CP
Sbjct  661   KDQPCRQYNPCSCQTACGKQCTCLLNGTCCEKYCRCPKSCKNRFRGCHCAKSQCRSRQCP  720

Query  1540  CYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLLGRSDIAGW  1719
             C+A+ RECDPDVC  CW+SCGDG++GIP  +  N++C+NMKLLL  QQ+VLLGRSD++GW
Sbjct  721   CFAADRECDPDVCRNCWISCGDGTLGIPSQRGDNYECRNMKLLLKQQQRVLLGRSDVSGW  780

Query  1720  GAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQLVIDAYRRG  1899
             GAFLKN    V K+E++G YTGELISH EADK GK+YDR+N SFLFNLNDQ V+DAYR+G
Sbjct  781   GAFLKN---SVGKHEYLGEYTGELISHREADKRGKIYDRENSSFLFNLNDQFVLDAYRKG  837

Query  1900  NKLKFINHSPDPNCFAKVNCSLSPCLLQCF--QLIVAGGSFSIDHR  2031
             +KLKF NHSPDPNC+AKV        +  F  + I AG     D+R
Sbjct  838   DKLKFANHSPDPNCYAKVIMVTGDHRVGIFAKERINAGEELFYDYR  883


 Score =   188 bits (478),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 130/227 (57%), Positives = 164/227 (72%), Gaps = 8/227 (4%)
 Frame = +1

Query  694   DGSADLLAKRQTDAFDLQNSIGTGSGNKIC-SSQEDGYASSD--LRSSIVLKNAVCpikl  864
             D S DL  KRQ DA  +   I + + +K    S+EDG+AS+   L SSI +KNAV PIKL
Sbjct  92    DNSIDLFTKRQNDALSMHGGIDSTNVDKDSHGSEEDGHASTAVLLGSSIPVKNAVRPIKL  151

Query  865   pklekippYTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALi-csdsdeeiieeegen  1041
             P++ ++PPYT+W FL RNQ+M EDQSV+GRRRIYYD N GEALI     +E I EEE + 
Sbjct  152   PEVNRLPPYTSWVFLDRNQRMTEDQSVVGRRRIYYDQNGGEALICSDSEEEIIDEEEAKR  211

Query  1042  efaesedYILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLIKEGAT---SKNENT  1212
              F ESEDYILRMTI++ G  D V++ LA+ FSR PSEVKAR++ L KE      SKN++ 
Sbjct  212   YFVESEDYILRMTIKEAGSSDPVVESLAHCFSRSPSEVKARFEVLKKEEKAVEDSKNKDI  271

Query  1213  EV-TINSYLDEDLDAALSSFDNLFCQRCFVFNCQLHGCSQDLIILKQ  1350
             E  T+NS+L +DL+AAL SFDNLFC+RC VF+C+LHGCSQDLI L +
Sbjct  272   EAQTLNSFLVKDLEAALDSFDNLFCRRCLVFDCRLHGCSQDLIFLAE  318


 Score = 67.4 bits (163),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSKK  2167
             +I+V GDHR+GIFA + +NAG+EL YDY+Y+PD  PAWA+  ++S  K
Sbjct  855   VIMVTGDHRVGIFAKERINAGEELFYDYRYEPDRAPAWARKPEASGSK  902



>gb|ADD60698.1| putative polycomb protein EZ1 [Oryza officinalis]
Length=896

 Score =   283 bits (725),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 135/235 (57%), Positives = 169/235 (72%), Gaps = 22/235 (9%)
 Frame = +1

Query  1336  IILKQIRVR-EELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTK  1512
              I K+I  R ++ C  YTPC C   CGK+CPC+     CEK+CGCP  CK  F+GCHC K
Sbjct  631   FIRKRITERKDQPCRQYTPCGCQSACGKQCPCLTNGTCCEKYCGCPKMCKNRFRGCHCAK  690

Query  1513  NECATNYCPCYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVL  1692
             ++C +  CPC+A+ RECDPDVC  CWV CGDG++G+P  +  N++C+NMKLLL  QQ+VL
Sbjct  691   SQCRSRQCPCFAADRECDPDVCRNCWVGCGDGTLGVPNQRGDNYECRNMKLLLKQQQRVL  750

Query  1693  LGRSDIAGWGAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQ  1872
             LGRSD++GWGAFLKN    V K+E++G YTGELISH EADK GK+YDR+N SFLFNLN++
Sbjct  751   LGRSDVSGWGAFLKN---SVGKHEYLGEYTGELISHKEADKRGKIYDRENSSFLFNLNNE  807

Query  1873  LVIDAYRRGNKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
              V+DAYR G+KLKF NHSPDPNC+AKV             ++VAG     DHR G
Sbjct  808   YVLDAYRMGDKLKFANHSPDPNCYAKV-------------IMVAG-----DHRVG  844


 Score =   149 bits (376),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 114/249 (46%), Positives = 153/249 (61%), Gaps = 18/249 (7%)
 Frame = +1

Query  703   ADLLAKRQTDAFDLQNSIGTGSGNKICSSQEDGYASSDLRSSIVL------KNAVCpikl  864
             ++LL KRQ DA    NS  +          E G    +  S++++      +N+V PI+L
Sbjct  78    SNLLTKRQEDALCAVNSRESSP-----DESEGGNCQDECSSTVIVGGNLSSRNSVRPIRL  132

Query  865   pklekippYTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALi-csdsdeeiieeegen  1041
             P++  +PPYTTW FL RNQ+M EDQSV+GRRRIYYD N GEALI     DE + +EE + 
Sbjct  133   PEVATLPPYTTWIFLDRNQRMQEDQSVLGRRRIYYDTNCGEALICSDSEDEAVEDEEEKK  192

Query  1042  efaesedYILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDL---IKEGATSKNENT  1212
             EF +SED I+RMTI++ G+ D VL+ LA    R P ++KARY+ L     EG++ K    
Sbjct  193   EFKDSEDCIIRMTIQECGMSDAVLETLARDIERAPDDIKARYEILQGEKPEGSSKKVSEL  252

Query  1213  EVTINS-YLDEDLDAALSSFDNLFCQRCFVFNCQLHGCSQDLIILKQIRVREELCAHYTP  1389
              V +   Y D+DLDAAL SFDNLFC+RC VF+C+LHGCSQDL+   + +    LC+    
Sbjct  253   NVKMEDVYGDKDLDAALDSFDNLFCRRCLVFDCKLHGCSQDLVFPTEKQA--PLCSSDDG  310

Query  1390  CNC*PHCGK  1416
               C  HC K
Sbjct  311   TPCGIHCYK  319


 Score = 63.5 bits (153),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAK  2143
             +I+V GDHR+GIFA + ++AG+EL YDY+Y+PD  PAWA+
Sbjct  834   VIMVAGDHRVGIFAKERISAGEELFYDYRYEPDRAPAWAR  873



>ref|XP_010259296.1| PREDICTED: histone-lysine N-methyltransferase EZ3 isoform X3 
[Nelumbo nucifera]
Length=737

 Score =   280 bits (716),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 132/226 (58%), Positives = 166/226 (73%), Gaps = 21/226 (9%)
 Frame = +1

Query  1360  REELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKNECATNYCP  1539
             + +LC  YTPC C   CGK+CPC+ +   CEK+CGC  +CK  F+GCHC K++C +  CP
Sbjct  481   KHQLCKQYTPCGCQFMCGKQCPCLQEGTCCEKYCGCSKSCKNRFRGCHCAKSQCRSRQCP  540

Query  1540  CYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLLGRSDIAGW  1719
             C+A+GRECDPDVC  CWVSCGDGS+G PP +V  ++C NM LLL  QQ++LLGRSD+AGW
Sbjct  541   CFAAGRECDPDVCRNCWVSCGDGSLGQPPQRVDGYQCGNMSLLLKQQQRILLGRSDVAGW  600

Query  1720  GAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQLVIDAYRRG  1899
             GAF+KN    V+KN+++G YTGELISH EADK GK+YDR N SFLF+LNDQ V+DAYR+G
Sbjct  601   GAFIKN---PVNKNDYLGEYTGELISHQEADKRGKIYDRANSSFLFDLNDQYVLDAYRKG  657

Query  1900  NKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
             +KLKF NHS +PNC+AKV             ++VAG     DHR G
Sbjct  658   DKLKFANHSSNPNCYAKV-------------MLVAG-----DHRVG  685


 Score = 92.8 bits (229),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 63/151 (42%), Positives = 94/151 (62%), Gaps = 7/151 (5%)
 Frame = +1

Query  925   MPEDQSVIGRRRIYYDMNSGEALi-csdsdeeiieeegenefaesedYILRMTIEKVGLY  1101
             M EDQSV+GRR+IYYD    EALI     ++    EE ++EF+E ED IL   +++ G+ 
Sbjct  1     MAEDQSVLGRRQIYYDPCGSEALICSDSEEDIAEPEEEKHEFSEGEDQILWNVLQEHGVD  60

Query  1102  DMVLDLLANHFSRKPSEVKARYKDLIKEGATSKNENTEVTINS------YLDEDLDAALS  1263
               VL+LL+       +EV+ RY  L+++     ++N + ++         L++ L AAL 
Sbjct  61    QEVLNLLSQFIEATTTEVQERYNILMEQYHEKASKNMQDSVQGGFERSLLLEKSLSAALD  120

Query  1264  SFDNLFCQRCFVFNCQLHGCSQDLIILKQIR  1356
             SFDNLFC+RC VF+C+LHGCSQ+L+I  + R
Sbjct  121   SFDNLFCRRCLVFDCRLHGCSQNLVIPGEKR  151


 Score = 57.0 bits (136),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 27/66 (41%), Positives = 39/66 (59%), Gaps = 5/66 (8%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSKKLT*LHILSIIFF  2203
             +++V GDHR+GI+A + + A +EL YDY+Y PD  P WA+  + S K  T     S+   
Sbjct  675   VMLVAGDHRVGIYAKEHIEASEELFYDYRYGPDQAPIWARKPEGSKKDDT-----SVSHG  729

Query  2204  PGQKHH  2221
               QKH 
Sbjct  730   RAQKHQ  735



>ref|NP_001057379.1| Os06g0275500 [Oryza sativa Japonica Group]
 dbj|BAD68028.1| putative Polycomb protein EZ1 [Oryza sativa Japonica Group]
 dbj|BAD69169.1| putative Polycomb protein EZ1 [Oryza sativa Japonica Group]
 dbj|BAF19293.1| Os06g0275500 [Oryza sativa Japonica Group]
Length=896

 Score =   283 bits (724),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 135/235 (57%), Positives = 169/235 (72%), Gaps = 22/235 (9%)
 Frame = +1

Query  1336  IILKQIRVR-EELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTK  1512
              I K+I  R ++ C  YTPC C   CGK+CPC+     CEK+CGCP  CK  F+GCHC K
Sbjct  631   FIRKRITERKDQPCRQYTPCGCQSACGKQCPCLTNGTCCEKYCGCPKMCKNRFRGCHCAK  690

Query  1513  NECATNYCPCYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVL  1692
             ++C +  CPC+A+ RECDPDVC  CWV CGDG++G+P  +  N++C+NMKLLL  QQ+VL
Sbjct  691   SQCRSRQCPCFAADRECDPDVCRNCWVGCGDGTLGVPNQRGDNYECRNMKLLLKQQQRVL  750

Query  1693  LGRSDIAGWGAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQ  1872
             LGRSD++GWGAFLKN    V K+E++G YTGELISH EADK GK+YDR+N SFLFNLN++
Sbjct  751   LGRSDVSGWGAFLKN---SVGKHEYLGEYTGELISHKEADKRGKIYDRENSSFLFNLNNE  807

Query  1873  LVIDAYRRGNKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
              V+DAYR G+KLKF NHSPDPNC+AKV             ++VAG     DHR G
Sbjct  808   YVLDAYRMGDKLKFANHSPDPNCYAKV-------------IMVAG-----DHRVG  844


 Score =   148 bits (373),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 112/244 (46%), Positives = 155/244 (64%), Gaps = 8/244 (3%)
 Frame = +1

Query  703   ADLLAKRQTDAFDLQNSIGTGSGNKICSSQEDGYASSDL-RSSIVLKNAVCpiklpklek  879
             ++LL KR+ DA    NS  +       ++ +D  +S+ +   ++  +N+V PI+LP++  
Sbjct  78    SNLLTKRKEDALCAVNSRESSPDESEGANCQDECSSTVIVGGNLSARNSVRPIRLPEVAT  137

Query  880   ippYTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALi-csdsdeeiieeegenefaes  1056
             +PPYTTW FL RNQ+M EDQSV+GRRRIYYD N GEALI     DE + +EE + EF +S
Sbjct  138   LPPYTTWIFLDRNQRMQEDQSVLGRRRIYYDTNCGEALICSDSEDEAVEDEEEKKEFKDS  197

Query  1057  edYILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDL---IKEGATSKNENTEVTIN  1227
             ED I+RMTI++ G+ D VL+ LA    R P ++KARY+ L     EG++ K     V + 
Sbjct  198   EDCIIRMTIQECGMSDAVLETLARDIERAPDDIKARYEILQGEKPEGSSKKVSELNVKME  257

Query  1228  S-YLDEDLDAALSSFDNLFCQRCFVFNCQLHGCSQDLIILKQIRVREELCAHYTPCNC*P  1404
               Y D+DLDAAL SFDNLFC+RC VF+C+LHGCSQDL+   + +    LC+      C  
Sbjct  258   DVYGDKDLDAALDSFDNLFCRRCLVFDCKLHGCSQDLVFPTEKQA--PLCSSDEGTPCGI  315

Query  1405  HCGK  1416
             HC K
Sbjct  316   HCYK  319


 Score = 63.5 bits (153),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAK  2143
             +I+V GDHR+GIFA + ++AG+EL YDY+Y+PD  PAWA+
Sbjct  834   VIMVAGDHRVGIFAKERISAGEELFYDYRYEPDRAPAWAR  873



>ref|XP_010429289.1| PREDICTED: histone-lysine N-methyltransferase CLF isoform X2 
[Camelina sativa]
Length=837

 Score =   282 bits (721),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 133/234 (57%), Positives = 172/234 (74%), Gaps = 6/234 (3%)
 Frame = +1

Query  1339  ILKQIRVR-EELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKN  1515
             I K+I  R ++ C  + PCNC   CGK+C C++    CEK+CGCP +CK  F+GCHC K+
Sbjct  572   IRKRITERKDQPCRQFNPCNCKTACGKECSCLLNGTCCEKYCGCPKSCKNRFRGCHCAKS  631

Query  1516  ECATNYCPCYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLL  1695
             +C +  CPC+A+ RECDPDVC  CWV  GDG++G+P  +  N++C+NMKLLL  QQ+VLL
Sbjct  632   QCRSRQCPCFAADRECDPDVCRNCWVIGGDGTLGVPSQRGDNYECRNMKLLLKQQQRVLL  691

Query  1696  GRSDIAGWGAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQL  1875
             GRSD++GWGAFLKN    VSK+E++G YTGELISH EADK GK+YDR+N SFLFNLNDQ 
Sbjct  692   GRSDVSGWGAFLKN---SVSKHEYLGEYTGELISHKEADKRGKIYDRENSSFLFNLNDQF  748

Query  1876  VIDAYRRGNKLKFINHSPDPNCFAKVNCSLSPCLLQCF--QLIVAGGSFSIDHR  2031
             V+DAYR+G+KLKF NHSP+PNC+AKV        +  F  + I+AG     D+R
Sbjct  749   VLDAYRKGDKLKFANHSPEPNCYAKVIMVAGDHRVGIFAKERIMAGEELFYDYR  802


 Score =   163 bits (412),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 112/224 (50%), Positives = 158/224 (71%), Gaps = 6/224 (3%)
 Frame = +1

Query  682   GLVGDGSADLLAKRQTDAFDLQNSIGTGSGNKICSS-QEDGYASSDL--RSSIVLKNAVC  852
             G   DG+ DLL KRQ D+  +++ I    G++      +DG+A+S +   SS+ +K ++ 
Sbjct  9     GSCKDGN-DLLVKRQRDSPGMKSGIDASDGDRNNHRFVDDGHANSAIFQGSSVPVKISLR  67

Query  853   piklpklekippYTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALi-csdsdeeiiee  1029
             PIKLP ++++ PYTTW FL RNQ+M EDQSV+GRRRIYYD   GEALI     +E I +E
Sbjct  68    PIKLPDIKRLSPYTTWVFLDRNQRMTEDQSVVGRRRIYYDQTGGEALICSDSEEEVIDDE  127

Query  1030  egenefaesedYILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLIKEGATSKNEN  1209
             E + EF E ED+I+RMT+E++GL D VL+ LAN  SR+ SE+KAR+  L+KE   S++ +
Sbjct  128   EEKREFLEPEDFIIRMTLEQLGLSDSVLEELANLLSRRSSEIKARHGVLMKEKEISESGD  187

Query  1210  TEVTINSYLDEDLDAALSSFDNLFCQRCFVFNCQLHGCSQDLII  1341
              +   +S L++D++ AL SFDNLFC+RC VF+C+LHGCSQDLI 
Sbjct  188   NQAE-SSLLNKDMEGALDSFDNLFCRRCLVFDCRLHGCSQDLIF  230


 Score = 63.5 bits (153),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 36/48 (75%), Gaps = 0/48 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSKK  2167
             +I+V GDHR+GIFA + + AG+EL YDY+Y+PD  PAWAK  ++   K
Sbjct  774   VIMVAGDHRVGIFAKERIMAGEELFYDYRYEPDRAPAWAKKPEAPGSK  821



>gb|ADD60673.1| putative polycomb protein EZ1 [Oryza granulata]
Length=898

 Score =   283 bits (724),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 135/235 (57%), Positives = 169/235 (72%), Gaps = 22/235 (9%)
 Frame = +1

Query  1336  IILKQIRVR-EELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTK  1512
              I K+I  R ++ C  YTPC C   CGK+CPC+     CEK+CGCP  CK  F+GCHC K
Sbjct  633   FIRKRITERKDQPCRQYTPCGCQSACGKQCPCLTNGTCCEKYCGCPKMCKNRFRGCHCAK  692

Query  1513  NECATNYCPCYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVL  1692
             ++C +  CPC+A+ RECDPDVC  CWV CGDG++G+P  +  N++C+NMKLLL  QQ+VL
Sbjct  693   SQCRSRQCPCFAADRECDPDVCRNCWVGCGDGTLGVPNQRGDNYECRNMKLLLKQQQRVL  752

Query  1693  LGRSDIAGWGAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQ  1872
             LGRSD++GWGAFLKN    V K+E++G YTGELISH EADK GK+YDR+N SFLFNLN++
Sbjct  753   LGRSDVSGWGAFLKN---SVGKHEYLGEYTGELISHKEADKRGKIYDRENSSFLFNLNNE  809

Query  1873  LVIDAYRRGNKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
              V+DAYR G+KLKF NHSPDPNC+AKV             ++VAG     DHR G
Sbjct  810   YVLDAYRMGDKLKFANHSPDPNCYAKV-------------IMVAG-----DHRVG  846


 Score =   152 bits (383),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 115/257 (45%), Positives = 160/257 (62%), Gaps = 11/257 (4%)
 Frame = +1

Query  661   STGPPLTGLVGDGSADLLAKRQTDAFDLQNSIGTGSGNKICSSQEDGYASSDLRSSIVLK  840
             ++ P  T LV     +LL KR+ DA    NS  +       + Q++  ++  +  ++ +K
Sbjct  68    TSTPNSTDLV----LNLLTKRKEDAMCAVNSRESSPDENESNCQDECSSTVIVGGNLSVK  123

Query  841   NAVCpiklpklekippYTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALi-csdsdee  1017
             N+V P++LP++  +PPYTTW FL RNQ+M EDQSV+GRRRIYYD N GEALI     DE 
Sbjct  124   NSVRPVRLPEVAMLPPYTTWIFLDRNQRMQEDQSVLGRRRIYYDTNCGEALICSDSEDEA  183

Query  1018  iieeegenefaesedYILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLIK---EG  1188
             + +EE + EF +SED I+RMTI++ G+ D VL+ LA    R P ++KARY+ L +   EG
Sbjct  184   VEDEEEKKEFKDSEDCIIRMTIQECGMSDAVLETLARDIKRAPDDIKARYETLQQEKPEG  243

Query  1189  ATSKNENTEVTINS-YLDEDLDAALSSFDNLFCQRCFVFNCQLHGCSQDLIILKQIRVRE  1365
             +  K     V +   Y D+DLDAAL SFDNLFC+RC VF+C+LHGCSQDL+   +   + 
Sbjct  244   SFKKVSELNVKMEDVYGDKDLDAALDSFDNLFCRRCLVFDCKLHGCSQDLVFPTE--KQP  301

Query  1366  ELCAHYTPCNC*PHCGK  1416
              LC+      C  HC K
Sbjct  302   PLCSSDDGTPCGIHCYK  318


 Score = 65.5 bits (158),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSKK  2167
             +I+V GDHR+GIFA + ++AG+EL YDY+Y+PD  PAWA+  ++S  K
Sbjct  836   VIMVAGDHRVGIFAKERISAGEELFYDYRYEPDRAPAWARKPEASGAK  883



>ref|XP_010472335.1| PREDICTED: histone-lysine N-methyltransferase CLF-like [Camelina 
sativa]
Length=906

 Score =   283 bits (724),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 134/234 (57%), Positives = 172/234 (74%), Gaps = 6/234 (3%)
 Frame = +1

Query  1339  ILKQIRVR-EELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKN  1515
             I K+I  R ++ C  + PCNC   CGK+C C++    CEK+CGCP +CK  F+GCHC K+
Sbjct  641   IRKRITERKDQPCRQFNPCNCKTACGKECSCLLNGTCCEKYCGCPKSCKNRFRGCHCAKS  700

Query  1516  ECATNYCPCYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLL  1695
             +C +  CPC+A+ RECDPDVC  CWV  GDG++G+P  +  N++C+NMKLLL  QQ+VLL
Sbjct  701   QCRSRQCPCFAADRECDPDVCRNCWVIGGDGTLGVPSQRGDNYECRNMKLLLKQQQRVLL  760

Query  1696  GRSDIAGWGAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQL  1875
             GRSDI+GWGAFLKN    VSK+E++G YTGELISH EADK GK+YDR+N SFLFNLNDQ 
Sbjct  761   GRSDISGWGAFLKN---SVSKHEYLGEYTGELISHKEADKRGKIYDRENSSFLFNLNDQF  817

Query  1876  VIDAYRRGNKLKFINHSPDPNCFAKVNCSLSPCLLQCF--QLIVAGGSFSIDHR  2031
             V+DAYR+G+KLKF NHSP+PNC+AKV        +  F  + I+AG     D+R
Sbjct  818   VLDAYRKGDKLKFANHSPEPNCYAKVIMVAGDHRVGIFAKERIMAGEELFYDYR  871


 Score =   162 bits (411),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 113/224 (50%), Positives = 157/224 (70%), Gaps = 6/224 (3%)
 Frame = +1

Query  682   GLVGDGSADLLAKRQTDAFDLQNSIGTGSGNKICSS-QEDGYASSDL--RSSIVLKNAVC  852
             G   DG+ DLL KRQ D+  +++ I    G++      EDG+A+S +   SS+ +K ++ 
Sbjct  78    GSCKDGN-DLLVKRQRDSPGMKSGIDASDGDRNNHRFVEDGHANSAVVQGSSVPVKISLR  136

Query  853   piklpklekippYTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALi-csdsdeeiiee  1029
             PIKLP ++++ PYTTW FL RNQ+M EDQSV+GRRRIYYD   GEALI     +E I EE
Sbjct  137   PIKLPDIKRLSPYTTWVFLDRNQRMTEDQSVVGRRRIYYDQTGGEALICSDSEEELIDEE  196

Query  1030  egenefaesedYILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLIKEGATSKNEN  1209
             E + EF E ED+I+RMT+E++GL D VL+ LA   SR+ SE+KAR+  L+KE   S++ +
Sbjct  197   EEKREFLEPEDFIIRMTLEQLGLSDSVLEELAKILSRRASEIKARHGVLMKEKEISESGD  256

Query  1210  TEVTINSYLDEDLDAALSSFDNLFCQRCFVFNCQLHGCSQDLII  1341
              +   +S L++D++ AL SFDNLFC+RC VF+C+LHGCSQDLI 
Sbjct  257   NQAE-SSILNKDMEGALDSFDNLFCRRCLVFDCRLHGCSQDLIF  299


 Score = 63.9 bits (154),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 36/48 (75%), Gaps = 0/48 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSKK  2167
             +I+V GDHR+GIFA + + AG+EL YDY+Y+PD  PAWAK  ++   K
Sbjct  843   VIMVAGDHRVGIFAKERIMAGEELFYDYRYEPDRAPAWAKKPEAPGSK  890



>ref|XP_006361735.1| PREDICTED: histone-lysine N-methyltransferase CLF-like isoform 
X1 [Solanum tuberosum]
Length=922

 Score =   283 bits (725),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 135/234 (58%), Positives = 170/234 (73%), Gaps = 22/234 (9%)
 Frame = +1

Query  1339  ILKQIRVR-EELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKN  1515
             I K+I  R ++ C  + PC C   CGK+C C+V    CEK+CGCP  CK  F+GCHC K+
Sbjct  658   IRKRISERKDQPCRQFNPCGCQGPCGKECSCIVNGTCCEKYCGCPKGCKNRFRGCHCAKS  717

Query  1516  ECATNYCPCYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLL  1695
             +C +  CPC+A+GRECDPDVC  CW+SCGDG++G+P  +  +H+C+NMKLLL  QQKVLL
Sbjct  718   QCRSRQCPCFAAGRECDPDVCRNCWISCGDGTLGVPLQRGDSHECRNMKLLLKQQQKVLL  777

Query  1696  GRSDIAGWGAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQL  1875
             GRSD++GWGAFLKN    V K+E++G YTGELISH EADK GK+YDR+N SFLFNLNDQ 
Sbjct  778   GRSDVSGWGAFLKN---TVGKHEYLGEYTGELISHREADKRGKIYDRENSSFLFNLNDQF  834

Query  1876  VIDAYRRGNKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
             V+DA+R+G+KLKF NHSP PNC+AKV             ++VAG     DHR G
Sbjct  835   VLDAHRKGDKLKFANHSPVPNCYAKV-------------MMVAG-----DHRVG  870


 Score =   207 bits (528),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 138/223 (62%), Positives = 170/223 (76%), Gaps = 6/223 (3%)
 Frame = +1

Query  691   GDGSADLLAKRQTDAFDLQNSIGTGSGNKICSSQED-GYASSD--LRSSIVLKNAVCpik  861
              DG  DLL+KRQ DA D+QN + T + +   +S ED GYA+S   L SSI +KNAV PIK
Sbjct  87    ADGRIDLLSKRQKDALDMQNGVDTSNADDDSNSSEDDGYATSAILLGSSIAVKNAVRPIK  146

Query  862   lpklekippYTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALi-csdsdeeiieeege  1038
             LP++++IPPYT+W FL RNQ+M EDQSV+GRRRIYYD N GE LI     +E + EEE +
Sbjct  147   LPEVKRIPPYTSWIFLDRNQRMTEDQSVVGRRRIYYDQNGGETLICSDSDEEVLEEEEEK  206

Query  1039  nefaesedYILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLIKE--GATSKNENT  1212
               FAESEDY+LRMT+++VGL D+VLDLL    SRKPSEVKARY+ L+KE    TSKNE T
Sbjct  207   KVFAESEDYMLRMTVKEVGLSDIVLDLLGQCLSRKPSEVKARYEGLVKEDDAGTSKNEFT  266

Query  1213  EVTINSYLDEDLDAALSSFDNLFCQRCFVFNCQLHGCSQDLII  1341
             E +++ YL +DLDAAL SFDNLFC+RC VF+C+LHGCSQDLI 
Sbjct  267   ESSLDLYLAKDLDAALDSFDNLFCRRCLVFDCRLHGCSQDLIF  309


 Score = 63.2 bits (152),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSKK  2167
             +++V GDHR+GIFA + + AG+EL YDY+Y+PD+ PAWA+  ++S  +
Sbjct  860   VMMVAGDHRVGIFANERICAGEELFYDYRYEPDSAPAWARKPEASGTR  907



>gb|KHN42097.1| Histone-lysine N-methyltransferase CLF [Glycine soja]
Length=870

 Score =   282 bits (722),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 138/243 (57%), Positives = 171/243 (70%), Gaps = 31/243 (13%)
 Frame = +1

Query  1339  ILKQIRVR-EELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKN  1515
             I K+I  R ++ C  Y PC C   CGK+CPC+     CEK+CGCP +CK  F+GCHC K+
Sbjct  597   IRKRITERKDQPCRQYNPCGCQTACGKQCPCLQNGTCCEKYCGCPKSCKNRFRGCHCAKS  656

Query  1516  ECATNYCPCYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLL  1695
             +C +  CPC+A+ RECDPDVC  CWVSCGDG++GIP  +  N++C+NMKLLL  QQ+VLL
Sbjct  657   QCRSRQCPCFAADRECDPDVCRNCWVSCGDGTLGIPSQRGDNYECRNMKLLLKQQQRVLL  716

Query  1696  GRSDIAGWGAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQ-  1872
             GRSD++GWGAFLKN    V K+E++G YTGELISH EADK GK+YDR+N SFLFNLNDQ 
Sbjct  717   GRSDVSGWGAFLKN---SVGKHEYLGEYTGELISHREADKRGKIYDRENSSFLFNLNDQA  773

Query  1873  --------LVIDAYRRGNKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDH  2028
                      V+DAYR+G+KLKF NHSPDPNC+AKV             ++VAG     DH
Sbjct  774   SFYDFASFFVLDAYRKGDKLKFANHSPDPNCYAKV-------------IMVAG-----DH  815

Query  2029  RSG  2037
             R G
Sbjct  816   RVG  818


 Score =   176 bits (447),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 118/224 (53%), Positives = 158/224 (71%), Gaps = 10/224 (4%)
 Frame = +1

Query  700   SADLLAKRQTDAFDLQNSIGTGSGNKICSSQED---GYASSDLRSSIVLKNAVCpiklpk  870
             S DLL KRQ DA D+ N +   +G+   +   D   G  +  L S++ +KNAV PIKLP+
Sbjct  92    SLDLLTKRQKDAIDMHNGVHASNGDVESNGYHDDSHGSTAVLLGSNVAVKNAVRPIKLPE  151

Query  871   lekippYTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALi-csdsdeeiieeegenef  1047
             ++K+PPYTTW FL RNQ+M EDQSV+GRRRIYYD N GEALI     +E + +EE + +F
Sbjct  152   VKKLPPYTTWIFLDRNQRMTEDQSVVGRRRIYYDQNGGEALICSDSEEETMDDEEEKRQF  211

Query  1048  aesedYILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDL-IKEGA-----TSKNEN  1209
              ESEDYILRMT+++ GL D+VL+ LA  FSR  SE+KA+Y+ L I++ A        +E 
Sbjct  212   IESEDYILRMTVKEFGLTDIVLESLAQCFSRNTSEIKAKYETLSIQDNAGGCSKAGDSEE  271

Query  1210  TEVTINSYLDEDLDAALSSFDNLFCQRCFVFNCQLHGCSQDLII  1341
                + NS+L++DL+AAL SFDNLFC+RC VF+C+LHGCSQDL+ 
Sbjct  272   NSQSGNSFLEKDLEAALDSFDNLFCRRCLVFDCRLHGCSQDLVF  315


 Score = 64.7 bits (156),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSKK  2167
             +I+V GDHR+GIFA + + AG+EL YDY+Y+PD  PAWA+  ++S  K
Sbjct  808   VIMVAGDHRVGIFAKERICAGEELFYDYRYEPDRAPAWARKPEASGSK  855



>ref|XP_010932044.1| PREDICTED: histone-lysine N-methyltransferase EZ1-like isoform 
X1 [Elaeis guineensis]
Length=926

 Score =   283 bits (724),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 136/234 (58%), Positives = 168/234 (72%), Gaps = 22/234 (9%)
 Frame = +1

Query  1339  ILKQIRVR-EELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKN  1515
             I K+I  R ++    Y PC C   CGK+CPC+V    CEK+CGCP  CK  F+GCHC K+
Sbjct  662   IRKRITERKDQPYRQYNPCGCQSACGKQCPCLVNGTCCEKYCGCPKICKNRFRGCHCAKS  721

Query  1516  ECATNYCPCYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLL  1695
             +C +  CPC+A+ RECDPDVC  CWV CGDG++G P  +  N++C+NMKLLL  QQ+VLL
Sbjct  722   QCRSRQCPCFAADRECDPDVCRNCWVGCGDGTLGGPNQRGDNYECRNMKLLLKQQQRVLL  781

Query  1696  GRSDIAGWGAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQL  1875
             GRSD++GWGAFLKN    V K+E++G YTGELISH EADK GK+YDR+N SFLFNLNDQ 
Sbjct  782   GRSDVSGWGAFLKN---SVGKHEYLGEYTGELISHREADKRGKIYDRENSSFLFNLNDQF  838

Query  1876  VIDAYRRGNKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
             V+DAYR+G+KLKF NHSPDPNC+AKV             ++VAG     DHR G
Sbjct  839   VLDAYRKGDKLKFANHSPDPNCYAKV-------------IMVAG-----DHRVG  874


 Score =   164 bits (415),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 122/256 (48%), Positives = 159/256 (62%), Gaps = 23/256 (9%)
 Frame = +1

Query  706   DLLAKRQTDAFDLQNSIGTGSGNKICSS--QEDGYASSDLRSSIVL-------KNAVCpi  858
             +LL KRQ DA  + +S+    G K  SS  +E  YASS     IVL       K+ V PI
Sbjct  92    NLLTKRQDDALCMLSSLELSGGEKDSSSCQEESSYASS-----IVLIGTNYGGKSTVRPI  146

Query  859   klpklekippYTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALi-csdsdeeiieeeg  1035
             KLP++ K+PPYTTW FL RNQ+M EDQSV+GRRRIYYD + GEALI     ++ + +EE 
Sbjct  147   KLPEVLKLPPYTTWIFLDRNQRMAEDQSVVGRRRIYYDQSCGEALICSDSEEDVVEDEEE  206

Query  1036  enefaesedYILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLIKEGATSKNEN--  1209
             + EF  ++DYI+RMTI+KVGL D VLD LA    R   E++ARY  +IK   T +++   
Sbjct  207   KREFRSTDDYIIRMTIQKVGLSDAVLDSLAQCLERNTDEIRARYDSIIKIEKTEESDKKG  266

Query  1210  ---TEVTINSYLDE-DLDAALSSFDNLFCQRCFVFNCQLHGCSQDLIILKQIRVREELCA  1377
                 ++ I   L E DLDAAL SFDNLFC+RC VF+C+LHGCSQDL+   + ++      
Sbjct  267   QGGVDIQIEDALSEKDLDAALDSFDNLFCRRCLVFDCRLHGCSQDLVFPSEKQLAWSNSD  326

Query  1378  HYTPCNC*PHCGKKCP  1425
               TPC    HC +  P
Sbjct  327   DVTPCGS--HCYRLVP  340


 Score = 65.9 bits (159),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSKK  2167
             +I+V GDHR+GIFA + ++AG+EL YDY+Y+PD  PAWA+  ++S  K
Sbjct  864   VIMVAGDHRVGIFAKERISAGEELFYDYRYEPDRAPAWARKPEASGSK  911



>ref|XP_006295423.1| hypothetical protein CARUB_v10024520mg [Capsella rubella]
 gb|EOA28321.1| hypothetical protein CARUB_v10024520mg [Capsella rubella]
Length=906

 Score =   283 bits (723),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 133/234 (57%), Positives = 172/234 (74%), Gaps = 6/234 (3%)
 Frame = +1

Query  1339  ILKQIRVR-EELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKN  1515
             I K+I  R ++ C  + PCNC   CGK+C C++    CEK+CGCP +CK  F+GCHC K+
Sbjct  641   IRKRITERKDQPCRQFNPCNCKTACGKECTCLLNGTCCEKYCGCPKSCKNRFRGCHCAKS  700

Query  1516  ECATNYCPCYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLL  1695
             +C +  CPC+A+ RECDPDVC  CWV  GDG++G+P  +  N++C+NMKLLL  QQ+VLL
Sbjct  701   QCRSRQCPCFAADRECDPDVCRNCWVIGGDGTLGVPSQRGDNYECRNMKLLLKQQQRVLL  760

Query  1696  GRSDIAGWGAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQL  1875
             GRSD++GWGAFLKN    VSK+E++G YTGELISH EADK GK+YDR+N SFLFNLNDQ 
Sbjct  761   GRSDVSGWGAFLKN---SVSKHEYLGEYTGELISHKEADKRGKIYDRENSSFLFNLNDQF  817

Query  1876  VIDAYRRGNKLKFINHSPDPNCFAKVNCSLSPCLLQCF--QLIVAGGSFSIDHR  2031
             V+DAYR+G+KLKF NHSP+PNC+AKV        +  F  + I+AG     D+R
Sbjct  818   VLDAYRKGDKLKFANHSPEPNCYAKVIMVAGDHRVGIFAKERIMAGEELFYDYR  871


 Score =   162 bits (409),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 108/216 (50%), Positives = 149/216 (69%), Gaps = 5/216 (2%)
 Frame = +1

Query  706   DLLAKRQTDAFDLQNSIGTGSGNKICSS-QEDGYASSDL--RSSIVLKNAVCpiklpkle  876
             DLL KRQ D+  +++ I     +K      EDG+ +S +   SS+ +K ++ PIK+P ++
Sbjct  85    DLLVKRQKDSPGMKSGIDASDADKNNHRFVEDGHVNSAMVQGSSVPVKISLRPIKIPDIK  144

Query  877   kippYTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALi-csdsdeeiieeegenefae  1053
             ++ PYTTW FL RNQ+M EDQSV+GRRRIYYD   GEALI     +E I +EE + EF  
Sbjct  145   RLSPYTTWVFLDRNQRMTEDQSVVGRRRIYYDQTGGEALICSDSEEEVIDDEEEKREFLV  204

Query  1054  sedYILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLIKEGATSKNENTEVTINSY  1233
              EDYI+RMT+E++GL D VL+ LAN  SR  SE+KAR+  L+KE   S++   +   +S 
Sbjct  205   PEDYIIRMTLEQLGLADSVLEELANFLSRSSSEIKARHAVLMKEKEISESGYNQAE-SSL  263

Query  1234  LDEDLDAALSSFDNLFCQRCFVFNCQLHGCSQDLII  1341
             L++D++ AL SFDNLFC+RC VF+C+LHGCSQDLI 
Sbjct  264   LNKDMEGALDSFDNLFCRRCLVFDCRLHGCSQDLIF  299


 Score = 63.5 bits (153),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 36/48 (75%), Gaps = 0/48 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSKK  2167
             +I+V GDHR+GIFA + + AG+EL YDY+Y+PD  PAWAK  ++   K
Sbjct  843   VIMVAGDHRVGIFAKERIMAGEELFYDYRYEPDRAPAWAKKPEAPGSK  890



>gb|ADU32891.1| enhancer of zeste1 protein [Eulaliopsis binata]
 gb|ADU32893.1| enhancer of zeste1 protein [Eulaliopsis binata]
Length=935

 Score =   283 bits (724),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 133/235 (57%), Positives = 170/235 (72%), Gaps = 6/235 (3%)
 Frame = +1

Query  1336  IILKQIRVR-EELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTK  1512
              I K+I  R ++ C  Y PC C   CGK+CPC+     CEK+CGCP  CK  F+GCHC K
Sbjct  666   FIRKRITERKDQPCRQYNPCGCQSACGKQCPCLTNGTCCEKYCGCPKICKNRFRGCHCAK  725

Query  1513  NECATNYCPCYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVL  1692
             ++C +  CPC+A+ RECDPDVC  CWV CGDG++G+P  +  N++C+NMKLLL  QQ+VL
Sbjct  726   SQCRSRQCPCFAADRECDPDVCRNCWVGCGDGTLGVPNQRGDNYECRNMKLLLKQQQRVL  785

Query  1693  LGRSDIAGWGAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQ  1872
             LGRSD++GWGAFLKN    VSK+E++G YTGELISH EADK GK+YDR+N SFLFNLN++
Sbjct  786   LGRSDVSGWGAFLKN---SVSKHEYLGEYTGELISHKEADKRGKIYDRENSSFLFNLNNE  842

Query  1873  LVIDAYRRGNKLKFINHSPDPNCFAKVNCSLSPCLLQCF--QLIVAGGSFSIDHR  2031
              V+DAYR G+KLKF NH+PDPNC+AKV        +  F  + I+AG     D+R
Sbjct  843   YVLDAYRMGDKLKFANHAPDPNCYAKVIMVAGDHRVGIFAKERILAGEELFYDYR  897


 Score =   147 bits (371),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 115/250 (46%), Positives = 155/250 (62%), Gaps = 11/250 (4%)
 Frame = +1

Query  694   DGSADLLAKRQTDAFDLQNSIGTGSGNK--ICSSQEDGYASSDLR--SSIVLKNAVCpik  861
             D +++LL KRQ DA   Q+S+     +K  +    E  ++SS++    ++  KNA+ PIK
Sbjct  104   DLTSNLLTKRQDDALCTQHSLDVIQVDKDGVNFQDESLFSSSNVTFGGNLGPKNAIRPIK  163

Query  862   lpklekippYTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALi-csdsdeeiieeege  1038
             L ++ K+PPYTTW FL RNQ+M EDQSV+GRRRIYYD + GEALI     DE I +EE +
Sbjct  164   LSEVPKLPPYTTWIFLDRNQRMTEDQSVLGRRRIYYDASCGEALICSDSEDEAIEDEEEK  223

Query  1039  nefaesedYILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDL----IKEGATSKNE  1206
              EF  SED I+RMTI++ G+ D VL  LA +  R   +VKARY+ L     K+     +E
Sbjct  224   KEFKHSEDRIIRMTIQECGMSDPVLQTLARYMERATDDVKARYEILHGEKTKDSCKKGSE  283

Query  1207  NTEVTINSYLDEDLDAALSSFDNLFCQRCFVFNCQLHGCSQDLIILKQIRVREELCAHYT  1386
             +     + Y D+DLDAAL SFDNLFC+RC VF+C+LHGCSQDL+   + +          
Sbjct  284   HNAKVEDLYCDKDLDAALDSFDNLFCRRCLVFDCKLHGCSQDLVFPTEKQSAWSSVDDGV  343

Query  1387  PCNC*PHCGK  1416
             PC    HC K
Sbjct  344   PCGI--HCHK  351


 Score = 63.5 bits (153),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSKK  2167
             +I+V GDHR+GIFA + + AG+EL YDY+Y+PD  PAWA+  ++S  K
Sbjct  869   VIMVAGDHRVGIFAKERILAGEELFYDYRYEPDRAPAWARKPEASGGK  916



>gb|AIC33179.1| enhancer of zeste-like protein [Elaeis guineensis]
Length=919

 Score =   283 bits (723),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 132/226 (58%), Positives = 164/226 (73%), Gaps = 21/226 (9%)
 Frame = +1

Query  1360  REELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKNECATNYCP  1539
             +++ C  Y PC C   CGK+CPC+V    CEK+CGCP  CK  F+GCHC K++C +  CP
Sbjct  663   KDQPCRQYNPCGCQSACGKQCPCLVNGTCCEKYCGCPKICKNRFRGCHCAKSQCRSRQCP  722

Query  1540  CYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLLGRSDIAGW  1719
             C+A+ RECDPDVC  CW+ CGDG++G P     N++C+NMKLLL  QQ+VLLGRSD++GW
Sbjct  723   CFAADRECDPDVCRNCWIGCGDGTLGGPNQGGDNYECRNMKLLLKQQQRVLLGRSDVSGW  782

Query  1720  GAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQLVIDAYRRG  1899
             GAFLKN    V K+E++G YTGELISH EADK GK+YDR+N SFLFNLNDQ V+DAYR+G
Sbjct  783   GAFLKN---SVGKHEYLGEYTGELISHREADKRGKIYDRENSSFLFNLNDQFVLDAYRKG  839

Query  1900  NKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
             +KLKF NHSPDPNC+AKV             ++VAG     DHR G
Sbjct  840   DKLKFANHSPDPNCYAKV-------------IMVAG-----DHRVG  867


 Score =   162 bits (410),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 121/250 (48%), Positives = 155/250 (62%), Gaps = 13/250 (5%)
 Frame = +1

Query  694   DGSADLLAKRQTDAFDLQNSIGTGSGNKICSS--QEDGYASSD--LRSSIVLKNAVCpik  861
             D   +LL +RQ DA    NS+    G K  SS  +E  YASS   L S+   KNAV PIK
Sbjct  88    DTDVNLLTRRQDDAPCTLNSVELSGGEKDGSSCQEESSYASSTVILGSNFGGKNAVRPIK  147

Query  862   lpklekippYTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALi-csdsdeeiieeege  1038
             LP++ K+PPYTTW FL RNQ+M EDQSV+GRRRIYYD   GEALI     D+ + +E+ +
Sbjct  148   LPEVPKLPPYTTWIFLDRNQRMTEDQSVVGRRRIYYDRGCGEALICSDSEDDVVEDEDEK  207

Query  1039  nefaesedYILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLIKEGATSK-----N  1203
              +F  +EDYI+RM I+KVGL D VLDLLA    R   E++ARY+ +IK   T +      
Sbjct  208   KQFGSTEDYIIRMAIQKVGLSDAVLDLLAQCLGRNTDEIRARYESIIKIEKTEECVKKGE  267

Query  1204  ENTEVTINSYLDE-DLDAALSSFDNLFCQRCFVFNCQLHGCSQDLIILKQIRVREELCAH  1380
             +  ++     L E DLDAA  SFDNLFC+RC VF+C+LHGCSQDL+   + ++       
Sbjct  268   DGVDIKTEDALSEKDLDAASDSFDNLFCRRCLVFDCRLHGCSQDLVFPSEKQLPWSNSDD  327

Query  1381  YTPCNC*PHC  1410
              TPC    HC
Sbjct  328   DTPCGM--HC  335


 Score = 65.5 bits (158),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSKK  2167
             +I+V GDHR+GIFA + ++AG+EL YDY+Y+PD  PAWA+  ++S  K
Sbjct  857   VIMVAGDHRVGIFAKERISAGEELFYDYRYEPDRAPAWARKPEASGSK  904



>ref|XP_010419281.1| PREDICTED: histone-lysine N-methyltransferase CLF-like [Camelina 
sativa]
Length=851

 Score =   281 bits (720),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 133/234 (57%), Positives = 172/234 (74%), Gaps = 6/234 (3%)
 Frame = +1

Query  1339  ILKQIRVR-EELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKN  1515
             I K+I  R ++ C  + PCNC   CGK+C C++    CEK+CGCP +CK  F+GCHC K+
Sbjct  586   IRKRITERKDQPCRQFNPCNCKTACGKECSCLLNGTCCEKYCGCPKSCKNRFRGCHCAKS  645

Query  1516  ECATNYCPCYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLL  1695
             +C +  CPC+A+ RECDPDVC  CWV  GDG++G+P  +  N++C+NMKLLL  QQ+VLL
Sbjct  646   QCRSRQCPCFAADRECDPDVCRNCWVIGGDGTLGVPSQRGDNYECRNMKLLLKQQQRVLL  705

Query  1696  GRSDIAGWGAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQL  1875
             GRSD++GWGAFLKN    VSK+E++G YTGELISH EADK GK+YDR+N SFLFNLNDQ 
Sbjct  706   GRSDVSGWGAFLKN---SVSKHEYLGEYTGELISHKEADKRGKIYDRENSSFLFNLNDQF  762

Query  1876  VIDAYRRGNKLKFINHSPDPNCFAKVNCSLSPCLLQCF--QLIVAGGSFSIDHR  2031
             V+DAYR+G+KLKF NHSP+PNC+AKV        +  F  + I+AG     D+R
Sbjct  763   VLDAYRKGDKLKFANHSPEPNCYAKVIMVAGDHRVGIFAKERIMAGEELFYDYR  816


 Score =   163 bits (413),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 113/224 (50%), Positives = 157/224 (70%), Gaps = 6/224 (3%)
 Frame = +1

Query  682   GLVGDGSADLLAKRQTDAFDLQNSIGTGSGNKICSS-QEDGYASSDL--RSSIVLKNAVC  852
             G   DG+ DLL KRQ D+  +++ I    G++      EDG+A+S +   SS+ +K ++ 
Sbjct  78    GSCKDGN-DLLVKRQRDSPGMKSGIDASDGDRNNHRFVEDGHANSAVVQGSSVPVKISLR  136

Query  853   piklpklekippYTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALi-csdsdeeiiee  1029
             PIKLP ++++ PYTTW FL RNQ+M EDQSV+GRRRIYYD   GEALI     +E I +E
Sbjct  137   PIKLPDIKRLSPYTTWVFLDRNQRMTEDQSVVGRRRIYYDQTGGEALICSDSEEEVIDDE  196

Query  1030  egenefaesedYILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLIKEGATSKNEN  1209
             E + EF E ED I+RMT+E++GL D VL+ LAN  SR+ SE+KAR+  L+KE   S++ +
Sbjct  197   EEKREFLEPEDLIIRMTLEQLGLSDSVLEELANLLSRRASEIKARHGVLMKEKEISESGD  256

Query  1210  TEVTINSYLDEDLDAALSSFDNLFCQRCFVFNCQLHGCSQDLII  1341
              +   +S L++D++ AL SFDNLFC+RC VF+C+LHGCSQDLI 
Sbjct  257   NQAE-SSLLNKDMEGALDSFDNLFCRRCLVFDCRLHGCSQDLIF  299


 Score = 63.5 bits (153),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 36/48 (75%), Gaps = 0/48 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSKK  2167
             +I+V GDHR+GIFA + + AG+EL YDY+Y+PD  PAWAK  ++   K
Sbjct  788   VIMVAGDHRVGIFAKERIMAGEELFYDYRYEPDRAPAWAKKPEAPGSK  835



>ref|XP_010429288.1| PREDICTED: histone-lysine N-methyltransferase CLF isoform X1 
[Camelina sativa]
Length=906

 Score =   282 bits (722),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 133/234 (57%), Positives = 172/234 (74%), Gaps = 6/234 (3%)
 Frame = +1

Query  1339  ILKQIRVR-EELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKN  1515
             I K+I  R ++ C  + PCNC   CGK+C C++    CEK+CGCP +CK  F+GCHC K+
Sbjct  641   IRKRITERKDQPCRQFNPCNCKTACGKECSCLLNGTCCEKYCGCPKSCKNRFRGCHCAKS  700

Query  1516  ECATNYCPCYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLL  1695
             +C +  CPC+A+ RECDPDVC  CWV  GDG++G+P  +  N++C+NMKLLL  QQ+VLL
Sbjct  701   QCRSRQCPCFAADRECDPDVCRNCWVIGGDGTLGVPSQRGDNYECRNMKLLLKQQQRVLL  760

Query  1696  GRSDIAGWGAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQL  1875
             GRSD++GWGAFLKN    VSK+E++G YTGELISH EADK GK+YDR+N SFLFNLNDQ 
Sbjct  761   GRSDVSGWGAFLKN---SVSKHEYLGEYTGELISHKEADKRGKIYDRENSSFLFNLNDQF  817

Query  1876  VIDAYRRGNKLKFINHSPDPNCFAKVNCSLSPCLLQCF--QLIVAGGSFSIDHR  2031
             V+DAYR+G+KLKF NHSP+PNC+AKV        +  F  + I+AG     D+R
Sbjct  818   VLDAYRKGDKLKFANHSPEPNCYAKVIMVAGDHRVGIFAKERIMAGEELFYDYR  871


 Score =   163 bits (413),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 112/224 (50%), Positives = 158/224 (71%), Gaps = 6/224 (3%)
 Frame = +1

Query  682   GLVGDGSADLLAKRQTDAFDLQNSIGTGSGNKICSS-QEDGYASSDL--RSSIVLKNAVC  852
             G   DG+ DLL KRQ D+  +++ I    G++      +DG+A+S +   SS+ +K ++ 
Sbjct  78    GSCKDGN-DLLVKRQRDSPGMKSGIDASDGDRNNHRFVDDGHANSAIFQGSSVPVKISLR  136

Query  853   piklpklekippYTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALi-csdsdeeiiee  1029
             PIKLP ++++ PYTTW FL RNQ+M EDQSV+GRRRIYYD   GEALI     +E I +E
Sbjct  137   PIKLPDIKRLSPYTTWVFLDRNQRMTEDQSVVGRRRIYYDQTGGEALICSDSEEEVIDDE  196

Query  1030  egenefaesedYILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLIKEGATSKNEN  1209
             E + EF E ED+I+RMT+E++GL D VL+ LAN  SR+ SE+KAR+  L+KE   S++ +
Sbjct  197   EEKREFLEPEDFIIRMTLEQLGLSDSVLEELANLLSRRSSEIKARHGVLMKEKEISESGD  256

Query  1210  TEVTINSYLDEDLDAALSSFDNLFCQRCFVFNCQLHGCSQDLII  1341
              +   +S L++D++ AL SFDNLFC+RC VF+C+LHGCSQDLI 
Sbjct  257   NQAE-SSLLNKDMEGALDSFDNLFCRRCLVFDCRLHGCSQDLIF  299


 Score = 63.5 bits (153),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 36/48 (75%), Gaps = 0/48 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSKK  2167
             +I+V GDHR+GIFA + + AG+EL YDY+Y+PD  PAWAK  ++   K
Sbjct  843   VIMVAGDHRVGIFAKERIMAGEELFYDYRYEPDRAPAWAKKPEAPGSK  890



>ref|XP_010259293.1| PREDICTED: histone-lysine N-methyltransferase EZA1 isoform X1 
[Nelumbo nucifera]
Length=878

 Score =   282 bits (721),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 132/226 (58%), Positives = 166/226 (73%), Gaps = 21/226 (9%)
 Frame = +1

Query  1360  REELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKNECATNYCP  1539
             + +LC  YTPC C   CGK+CPC+ +   CEK+CGC  +CK  F+GCHC K++C +  CP
Sbjct  622   KHQLCKQYTPCGCQFMCGKQCPCLQEGTCCEKYCGCSKSCKNRFRGCHCAKSQCRSRQCP  681

Query  1540  CYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLLGRSDIAGW  1719
             C+A+GRECDPDVC  CWVSCGDGS+G PP +V  ++C NM LLL  QQ++LLGRSD+AGW
Sbjct  682   CFAAGRECDPDVCRNCWVSCGDGSLGQPPQRVDGYQCGNMSLLLKQQQRILLGRSDVAGW  741

Query  1720  GAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQLVIDAYRRG  1899
             GAF+KN    V+KN+++G YTGELISH EADK GK+YDR N SFLF+LNDQ V+DAYR+G
Sbjct  742   GAFIKN---PVNKNDYLGEYTGELISHQEADKRGKIYDRANSSFLFDLNDQYVLDAYRKG  798

Query  1900  NKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
             +KLKF NHS +PNC+AKV             ++VAG     DHR G
Sbjct  799   DKLKFANHSSNPNCYAKV-------------MLVAG-----DHRVG  826


 Score =   121 bits (303),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 88/228 (39%), Positives = 134/228 (59%), Gaps = 20/228 (9%)
 Frame = +1

Query  694   DGSADLLAKRQTDAFDLQNSIGTGSGNKICSSQEDGYASSDLRSSIVLKNAVCpiklpkl  873
             +GS D+L+ R  +A    +    GSG + C + E+  +S+ +R  ++ K           
Sbjct  78    NGSKDMLSFRAENALCKFSGSAQGSGERDCINDEEILSSTAIRLPLIEK-----------  126

Query  874   ekippYTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALi-csdsdeeiieeegenefa  1050
               IPPYTTW FL +NQ+M EDQSV+GRR+IYYD    EALI     ++    EE ++EF+
Sbjct  127   --IPPYTTWIFLDKNQRMAEDQSVLGRRQIYYDPCGSEALICSDSEEDIAEPEEEKHEFS  184

Query  1051  esedYILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLIKEGATSKNENTEVTINS  1230
             E ED IL   +++ G+   VL+LL+       +EV+ RY  L+++     ++N + ++  
Sbjct  185   EGEDQILWNVLQEHGVDQEVLNLLSQFIEATTTEVQERYNILMEQYHEKASKNMQDSVQG  244

Query  1231  ------YLDEDLDAALSSFDNLFCQRCFVFNCQLHGCSQDLIILKQIR  1356
                    L++ L AAL SFDNLFC+RC VF+C+LHGCSQ+L+I  + R
Sbjct  245   GFERSLLLEKSLSAALDSFDNLFCRRCLVFDCRLHGCSQNLVIPGEKR  292


 Score = 57.0 bits (136),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 27/66 (41%), Positives = 39/66 (59%), Gaps = 5/66 (8%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSKKLT*LHILSIIFF  2203
             +++V GDHR+GI+A + + A +EL YDY+Y PD  P WA+  + S K  T     S+   
Sbjct  816   VMLVAGDHRVGIYAKEHIEASEELFYDYRYGPDQAPIWARKPEGSKKDDT-----SVSHG  870

Query  2204  PGQKHH  2221
               QKH 
Sbjct  871   RAQKHQ  876



>ref|XP_010932045.1| PREDICTED: histone-lysine N-methyltransferase EZ1-like isoform 
X2 [Elaeis guineensis]
Length=919

 Score =   283 bits (723),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 136/234 (58%), Positives = 168/234 (72%), Gaps = 22/234 (9%)
 Frame = +1

Query  1339  ILKQIRVR-EELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKN  1515
             I K+I  R ++    Y PC C   CGK+CPC+V    CEK+CGCP  CK  F+GCHC K+
Sbjct  655   IRKRITERKDQPYRQYNPCGCQSACGKQCPCLVNGTCCEKYCGCPKICKNRFRGCHCAKS  714

Query  1516  ECATNYCPCYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLL  1695
             +C +  CPC+A+ RECDPDVC  CWV CGDG++G P  +  N++C+NMKLLL  QQ+VLL
Sbjct  715   QCRSRQCPCFAADRECDPDVCRNCWVGCGDGTLGGPNQRGDNYECRNMKLLLKQQQRVLL  774

Query  1696  GRSDIAGWGAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQL  1875
             GRSD++GWGAFLKN    V K+E++G YTGELISH EADK GK+YDR+N SFLFNLNDQ 
Sbjct  775   GRSDVSGWGAFLKN---SVGKHEYLGEYTGELISHREADKRGKIYDRENSSFLFNLNDQF  831

Query  1876  VIDAYRRGNKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
             V+DAYR+G+KLKF NHSPDPNC+AKV             ++VAG     DHR G
Sbjct  832   VLDAYRKGDKLKFANHSPDPNCYAKV-------------IMVAG-----DHRVG  867


 Score =   164 bits (415),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 122/256 (48%), Positives = 159/256 (62%), Gaps = 23/256 (9%)
 Frame = +1

Query  706   DLLAKRQTDAFDLQNSIGTGSGNKICSS--QEDGYASSDLRSSIVL-------KNAVCpi  858
             +LL KRQ DA  + +S+    G K  SS  +E  YASS     IVL       K+ V PI
Sbjct  92    NLLTKRQDDALCMLSSLELSGGEKDSSSCQEESSYASS-----IVLIGTNYGGKSTVRPI  146

Query  859   klpklekippYTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALi-csdsdeeiieeeg  1035
             KLP++ K+PPYTTW FL RNQ+M EDQSV+GRRRIYYD + GEALI     ++ + +EE 
Sbjct  147   KLPEVLKLPPYTTWIFLDRNQRMAEDQSVVGRRRIYYDQSCGEALICSDSEEDVVEDEEE  206

Query  1036  enefaesedYILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLIKEGATSKNEN--  1209
             + EF  ++DYI+RMTI+KVGL D VLD LA    R   E++ARY  +IK   T +++   
Sbjct  207   KREFRSTDDYIIRMTIQKVGLSDAVLDSLAQCLERNTDEIRARYDSIIKIEKTEESDKKG  266

Query  1210  ---TEVTINSYLDE-DLDAALSSFDNLFCQRCFVFNCQLHGCSQDLIILKQIRVREELCA  1377
                 ++ I   L E DLDAAL SFDNLFC+RC VF+C+LHGCSQDL+   + ++      
Sbjct  267   QGGVDIQIEDALSEKDLDAALDSFDNLFCRRCLVFDCRLHGCSQDLVFPSEKQLAWSNSD  326

Query  1378  HYTPCNC*PHCGKKCP  1425
               TPC    HC +  P
Sbjct  327   DVTPCGS--HCYRLVP  340


 Score = 65.9 bits (159),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSKK  2167
             +I+V GDHR+GIFA + ++AG+EL YDY+Y+PD  PAWA+  ++S  K
Sbjct  857   VIMVAGDHRVGIFAKERISAGEELFYDYRYEPDRAPAWARKPEASGSK  904



>ref|XP_008799009.1| PREDICTED: histone-lysine N-methyltransferase EZ1-like isoform 
X2 [Phoenix dactylifera]
Length=929

 Score =   283 bits (723),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 136/234 (58%), Positives = 168/234 (72%), Gaps = 22/234 (9%)
 Frame = +1

Query  1339  ILKQIRVR-EELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKN  1515
             I K+I  R ++    Y PC C   CGK+CPC+V    CEK+CGCP  CK  F+GCHC K+
Sbjct  665   IRKRITERKDQPYRQYNPCGCQSACGKQCPCLVNGTCCEKYCGCPKICKNRFRGCHCAKS  724

Query  1516  ECATNYCPCYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLL  1695
             +C +  CPC+A+ RECDPDVC  CWV CGDG++G P  +  N++C+NMKLLL  QQ+VLL
Sbjct  725   QCRSRQCPCFAADRECDPDVCRNCWVGCGDGTLGGPNQRGDNYECRNMKLLLKQQQRVLL  784

Query  1696  GRSDIAGWGAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQL  1875
             GRSD++GWGAFLKN    V K+E++G YTGELISH EADK GK+YDR+N SFLFNLNDQ 
Sbjct  785   GRSDVSGWGAFLKN---SVGKHEYLGEYTGELISHREADKRGKIYDRENSSFLFNLNDQF  841

Query  1876  VIDAYRRGNKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
             V+DAYR+G+KLKF NHSPDPNC+AKV             ++VAG     DHR G
Sbjct  842   VLDAYRKGDKLKFANHSPDPNCYAKV-------------IMVAG-----DHRVG  877


 Score =   162 bits (411),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 127/256 (50%), Positives = 159/256 (62%), Gaps = 23/256 (9%)
 Frame = +1

Query  706   DLLAKRQTDAFDLQNSIGTGSGNKICSS--QEDGYASSDLRSSIVL-------KNAVCpi  858
             +LL KRQ DA  + +S+    G K  SS  +E  YASS     IVL       KN V PI
Sbjct  92    NLLTKRQDDALCMLSSLELSGGEKDSSSCQEESSYASS-----IVLIGSNYGGKNTVRPI  146

Query  859   klpklekippYTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALi-csdsdeeiieeeg  1035
             KLP++ K+PPYTTW FL RNQ+M EDQSV+GRRRIYYD + GEALI     D+ + +EE 
Sbjct  147   KLPEVPKLPPYTTWIFLDRNQRMAEDQSVVGRRRIYYDQSCGEALICSDSEDDVVDDEEE  206

Query  1036  enefaesedYILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLIK----EGATSKN  1203
             + +F  +ED+I+RMTI+KVGL D VLD LA    R   E++ARY+ +IK    E    K 
Sbjct  207   KRQFGSTEDFIIRMTIQKVGLSDAVLDSLAQCLERSTDEIRARYESIIKIEKTEECVKKG  266

Query  1204  EN-TEVTINSYLDE-DLDAALSSFDNLFCQRCFVFNCQLHGCSQDLIILKQIRVREELCA  1377
             E   E+     L E DLDAAL SFDNLFC+RC VF+C+LHGCSQDL+   + ++      
Sbjct  267   EGGVEIQTEDALSEKDLDAALDSFDNLFCRRCLVFDCRLHGCSQDLVFPSEKQLPWSNSD  326

Query  1378  HYTPCNC*PHCGKKCP  1425
               TPC C  HC K  P
Sbjct  327   DVTPC-C-GHCYKLVP  340


 Score = 65.9 bits (159),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSKK  2167
             +I+V GDHR+GIFA + ++AG+EL YDY+Y+PD  PAWA+  ++S  K
Sbjct  867   VIMVAGDHRVGIFAKERISAGEELFYDYRYEPDRAPAWARKPEASGSK  914



>ref|XP_006850490.1| hypothetical protein AMTR_s00035p00184080 [Amborella trichopoda]
 gb|ERN12071.1| hypothetical protein AMTR_s00035p00184080 [Amborella trichopoda]
Length=935

 Score =   283 bits (723),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 135/234 (58%), Positives = 170/234 (73%), Gaps = 22/234 (9%)
 Frame = +1

Query  1339  ILKQIRVR-EELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKN  1515
             I K+I  R ++ C  +TPC+C   CGK+C C+     CEK+CGCP  CK  F+GCHC K+
Sbjct  671   IRKRIADRKDQPCRQFTPCSCQSSCGKQCSCLQNGTCCEKYCGCPKTCKNRFRGCHCAKS  730

Query  1516  ECATNYCPCYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLL  1695
             +C +  CPC+A+ RECDPDVC  CWV CGDG++G P  +  N++C+NMKLLL  QQ+VLL
Sbjct  731   QCRSRQCPCFAADRECDPDVCRNCWVGCGDGTMGGPNQRGDNYECRNMKLLLKQQQRVLL  790

Query  1696  GRSDIAGWGAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQL  1875
             GRSD++GWGAFLKN    V+K+E++G YTGELISH EADK GK+YDR+N SFLFNLNDQ 
Sbjct  791   GRSDVSGWGAFLKN---SVNKHEYLGEYTGELISHREADKRGKIYDRENSSFLFNLNDQF  847

Query  1876  VIDAYRRGNKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
             V+DAYR+G+KLKF NHSPDPNC+AKV             ++VAG     DHR G
Sbjct  848   VLDAYRKGDKLKFANHSPDPNCYAKV-------------IMVAG-----DHRVG  883


 Score =   157 bits (398),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 124/276 (45%), Positives = 167/276 (61%), Gaps = 10/276 (4%)
 Frame = +1

Query  541   LIFNSLFRALLPD*TFHHSTCFITGMSKLEAPPSNPH-LDPSTGPPLTGLVGDGSADLLA  717
             ++  SL + +  D   H          KL+      H L  S   P+   V D + DLL 
Sbjct  42    IVIESLRKTVAADRIIHVKRKIEENKQKLKVFTDRIHNLSKSRKLPMVNAV-DSNTDLLT  100

Query  718   KRQTDAFDLQNSIGTGSGNKICS--SQEDGYASSDL--RSSIVLKNAVCpiklpklekip  885
             KR  DA  + + +   +G +  S   +E   AS  +   S+   KN   PIKLP+ +KIP
Sbjct  101   KRLEDAMCMLSGLDLSAGEREQSLCVEESPNASPAIVFGSNSSGKNVFRPIKLPEEQKIP  160

Query  886   pYTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALicsdsdeeiieeegenefaes-ed  1062
             PYTTW FL RNQ+M EDQSV+GRRRIYYD + GEALICSDS+E+ I+EE + +     ED
Sbjct  161   PYTTWMFLDRNQRMTEDQSVVGRRRIYYDQSGGEALICSDSEEDTIDEEDDKKEFGDCED  220

Query  1063  YILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLIKEGATSKNENTEVTI---NSY  1233
             YILR TIE+VGL D VLD+LA  F     E+KARY+ L+ +  + +  + E+     ++ 
Sbjct  221   YILRKTIEEVGLSDTVLDILAQQFQTNAREIKARYELLLNQDKSKQYTSEELNAQREDAL  280

Query  1234  LDEDLDAALSSFDNLFCQRCFVFNCQLHGCSQDLII  1341
               +DLDAAL SFDNLFC+RC VF+C+LHGCSQDL++
Sbjct  281   AGKDLDAALDSFDNLFCRRCLVFDCRLHGCSQDLVL  316


 Score = 65.9 bits (159),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSKK  2167
             +I+V GDHR+GIFA + + AG+EL YDY+Y+PD  PAWA+  ++SS +
Sbjct  873   VIMVAGDHRVGIFAKERICAGEELFYDYRYEPDRAPAWARKPEASSSR  920



>ref|XP_008799008.1| PREDICTED: histone-lysine N-methyltransferase EZ1-like isoform 
X1 [Phoenix dactylifera]
Length=934

 Score =   283 bits (723),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 136/234 (58%), Positives = 168/234 (72%), Gaps = 22/234 (9%)
 Frame = +1

Query  1339  ILKQIRVR-EELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKN  1515
             I K+I  R ++    Y PC C   CGK+CPC+V    CEK+CGCP  CK  F+GCHC K+
Sbjct  670   IRKRITERKDQPYRQYNPCGCQSACGKQCPCLVNGTCCEKYCGCPKICKNRFRGCHCAKS  729

Query  1516  ECATNYCPCYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLL  1695
             +C +  CPC+A+ RECDPDVC  CWV CGDG++G P  +  N++C+NMKLLL  QQ+VLL
Sbjct  730   QCRSRQCPCFAADRECDPDVCRNCWVGCGDGTLGGPNQRGDNYECRNMKLLLKQQQRVLL  789

Query  1696  GRSDIAGWGAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQL  1875
             GRSD++GWGAFLKN    V K+E++G YTGELISH EADK GK+YDR+N SFLFNLNDQ 
Sbjct  790   GRSDVSGWGAFLKN---SVGKHEYLGEYTGELISHREADKRGKIYDRENSSFLFNLNDQF  846

Query  1876  VIDAYRRGNKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
             V+DAYR+G+KLKF NHSPDPNC+AKV             ++VAG     DHR G
Sbjct  847   VLDAYRKGDKLKFANHSPDPNCYAKV-------------IMVAG-----DHRVG  882


 Score =   162 bits (410),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 127/256 (50%), Positives = 159/256 (62%), Gaps = 23/256 (9%)
 Frame = +1

Query  706   DLLAKRQTDAFDLQNSIGTGSGNKICSS--QEDGYASSDLRSSIVL-------KNAVCpi  858
             +LL KRQ DA  + +S+    G K  SS  +E  YASS     IVL       KN V PI
Sbjct  92    NLLTKRQDDALCMLSSLELSGGEKDSSSCQEESSYASS-----IVLIGSNYGGKNTVRPI  146

Query  859   klpklekippYTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALi-csdsdeeiieeeg  1035
             KLP++ K+PPYTTW FL RNQ+M EDQSV+GRRRIYYD + GEALI     D+ + +EE 
Sbjct  147   KLPEVPKLPPYTTWIFLDRNQRMAEDQSVVGRRRIYYDQSCGEALICSDSEDDVVDDEEE  206

Query  1036  enefaesedYILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLIK----EGATSKN  1203
             + +F  +ED+I+RMTI+KVGL D VLD LA    R   E++ARY+ +IK    E    K 
Sbjct  207   KRQFGSTEDFIIRMTIQKVGLSDAVLDSLAQCLERSTDEIRARYESIIKIEKTEECVKKG  266

Query  1204  EN-TEVTINSYLDE-DLDAALSSFDNLFCQRCFVFNCQLHGCSQDLIILKQIRVREELCA  1377
             E   E+     L E DLDAAL SFDNLFC+RC VF+C+LHGCSQDL+   + ++      
Sbjct  267   EGGVEIQTEDALSEKDLDAALDSFDNLFCRRCLVFDCRLHGCSQDLVFPSEKQLPWSNSD  326

Query  1378  HYTPCNC*PHCGKKCP  1425
               TPC C  HC K  P
Sbjct  327   DVTPC-C-GHCYKLVP  340


 Score = 65.9 bits (159),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSKK  2167
             +I+V GDHR+GIFA + ++AG+EL YDY+Y+PD  PAWA+  ++S  K
Sbjct  872   VIMVAGDHRVGIFAKERISAGEELFYDYRYEPDRAPAWARKPEASGSK  919



>ref|XP_002437898.1| hypothetical protein SORBIDRAFT_10g004560 [Sorghum bicolor]
 gb|EER89265.1| hypothetical protein SORBIDRAFT_10g004560 [Sorghum bicolor]
Length=933

 Score =   283 bits (723),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 132/235 (56%), Positives = 170/235 (72%), Gaps = 6/235 (3%)
 Frame = +1

Query  1336  IILKQIRVR-EELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTK  1512
              I K+I  R ++ C  Y PC C   CGK+CPC+     CEK+CGCP  CK  F+GCHC K
Sbjct  664   FIRKRITERKDQPCRQYNPCGCQSACGKQCPCLTNGTCCEKYCGCPKICKNRFRGCHCAK  723

Query  1513  NECATNYCPCYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVL  1692
             ++C +  CPC+A+ RECDPDVC  CWV CGDG++G+P  +  N++C+NMKLLL  QQ+VL
Sbjct  724   SQCRSRQCPCFAADRECDPDVCRNCWVGCGDGTLGVPNQRGDNYECRNMKLLLKQQQRVL  783

Query  1693  LGRSDIAGWGAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQ  1872
             LGRSD++GWGAFLKN    V+K+E++G YTGELISH EADK GK+YDR+N SFLFNLN++
Sbjct  784   LGRSDVSGWGAFLKN---SVTKHEYLGEYTGELISHKEADKRGKIYDRENSSFLFNLNNE  840

Query  1873  LVIDAYRRGNKLKFINHSPDPNCFAKVNCSLSPCLLQCF--QLIVAGGSFSIDHR  2031
              V+DAYR G+KLKF NH+PDPNC+AKV        +  F  + I+AG     D+R
Sbjct  841   YVLDAYRMGDKLKFANHAPDPNCYAKVIMVAGDHRVGIFAKERILAGEELFYDYR  895


 Score =   144 bits (362),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 115/254 (45%), Positives = 155/254 (61%), Gaps = 19/254 (7%)
 Frame = +1

Query  694   DGSADLLAKRQTDA------FDLQNSIGTGSGNKICSSQEDGYASSDL--RSSIVLKNAV  849
             D +++LL KRQ DA      +D+   +    GN      E+ ++SS++    ++  KNA+
Sbjct  104   DLASNLLTKRQDDALCTLHSYDI-TPVDKDGGN---FQDENPFSSSNVIFGGNLGPKNAI  159

Query  850   CpiklpklekippYTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALi-csdsdeeiie  1026
              PIKLP++ K+PPYTTW FL RNQ+M EDQSV+GRRRIYYD + GEALI     DE I +
Sbjct  160   RPIKLPEVPKLPPYTTWIFLDRNQRMTEDQSVLGRRRIYYDTSCGEALICSDSEDEAIED  219

Query  1027  eegenefaesedYILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDL----IKEGAT  1194
             EE + EF  SED I+RMTI++ G+ D VL  LA +  R   ++KARY+ L     K+   
Sbjct  220   EEEKKEFKHSEDRIIRMTIQECGMSDAVLQTLARYMERATDDIKARYEILHGEKTKDSCK  279

Query  1195  SKNENTEVTINSYLDEDLDAALSSFDNLFCQRCFVFNCQLHGCSQDLIILKQIRVREELC  1374
                E+     + Y D+DLDAAL SFDNLFC+RC VF+C+LHGCSQDL+   + +      
Sbjct  280   KGTEHNAKVEDLYRDKDLDAALDSFDNLFCRRCLVFDCKLHGCSQDLVFPTEKQTAWSGV  339

Query  1375  AHYTPCNC*PHCGK  1416
                 PC    HC K
Sbjct  340   DDGVPCGI--HCYK  351


 Score = 63.9 bits (154),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSKK  2167
             +I+V GDHR+GIFA + + AG+EL YDY+Y+PD  PAWA+  ++S  K
Sbjct  867   VIMVAGDHRVGIFAKERILAGEELFYDYRYEPDRAPAWARKPEASGAK  914



>gb|ACV53437.1| enhancer of zeste-like protein 1 [Sorghum bicolor]
Length=911

 Score =   282 bits (722),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 132/235 (56%), Positives = 170/235 (72%), Gaps = 6/235 (3%)
 Frame = +1

Query  1336  IILKQIRVR-EELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTK  1512
              I K+I  R ++ C  Y PC C   CGK+CPC+     CEK+CGCP  CK  F+GCHC K
Sbjct  642   FIRKRITERKDQPCRQYNPCGCQSACGKQCPCLTNGTCCEKYCGCPKICKNRFRGCHCAK  701

Query  1513  NECATNYCPCYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVL  1692
             ++C +  CPC+A+ RECDPDVC  CWV CGDG++G+P  +  N++C+NMKLLL  QQ+VL
Sbjct  702   SQCRSRQCPCFAADRECDPDVCRNCWVGCGDGTLGVPNQRGDNYECRNMKLLLKQQQRVL  761

Query  1693  LGRSDIAGWGAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQ  1872
             LGRSD++GWGAFLKN    V+K+E++G YTGELISH EADK GK+YDR+N SFLFNLN++
Sbjct  762   LGRSDVSGWGAFLKN---SVTKHEYLGEYTGELISHKEADKRGKIYDRENSSFLFNLNNE  818

Query  1873  LVIDAYRRGNKLKFINHSPDPNCFAKVNCSLSPCLLQCF--QLIVAGGSFSIDHR  2031
              V+DAYR G+KLKF NH+PDPNC+AKV        +  F  + I+AG     D+R
Sbjct  819   YVLDAYRMGDKLKFANHAPDPNCYAKVIMVAGDHRVGIFAKERILAGEELFYDYR  873


 Score =   119 bits (299),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 96/198 (48%), Positives = 121/198 (61%), Gaps = 14/198 (7%)
 Frame = +1

Query  838   KNAVCpiklpklekippYTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALi-csdsde  1014
             KNA+ PIKLP++ K+PPYTTW FL RNQ+M EDQSV+GRRRIYYD + GEALI     DE
Sbjct  141   KNAIRPIKLPEVPKLPPYTTWIFLDRNQRMTEDQSVLGRRRIYYDTSCGEALICSDSEDE  200

Query  1015  eiieeegenefaesedYILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDL----IK  1182
              I +EE + EF  SED I+RMTI++ G+ D VL  LA +  R   ++KARY+ L     K
Sbjct  201   AIEDEEEKKEFKHSEDRIIRMTIQECGMSDAVLQTLARYMERATDDIKARYEILHGEKTK  260

Query  1183  EGATSKNENTEVTINSYLDEDLDAALSSFDNLFCQRCFVFNCQLHGCSQDLIILKQIRVR  1362
             +      E+     + Y D+DLDAAL SFDNLFC+RC        GCSQDL+   + +  
Sbjct  261   DSCKKGTEHNAKVEDLYRDKDLDAALDSFDNLFCRRCL-------GCSQDLVFPTEKQTA  313

Query  1363  EELCAHYTPCNC*PHCGK  1416
                     PC    HC K
Sbjct  314   WSGVDDGVPCGI--HCYK  329


 Score = 63.9 bits (154),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSKK  2167
             +I+V GDHR+GIFA + + AG+EL YDY+Y+PD  PAWA+  ++S  K
Sbjct  845   VIMVAGDHRVGIFAKERILAGEELFYDYRYEPDRAPAWARKPEASGAK  892



>ref|XP_006840562.1| hypothetical protein AMTR_s00045p00224440 [Amborella trichopoda]
 gb|ERN02237.1| hypothetical protein AMTR_s00045p00224440 [Amborella trichopoda]
Length=907

 Score =   282 bits (721),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 135/234 (58%), Positives = 170/234 (73%), Gaps = 22/234 (9%)
 Frame = +1

Query  1339  ILKQIRVR-EELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKN  1515
             I K+I  R ++ C  +TPC+C   CGK+C C+     CEK+CGCP  CK  F+GCHC+K+
Sbjct  643   IRKRITDRKDQPCRQFTPCSCQSSCGKQCSCLQHGTCCEKYCGCPKTCKNRFRGCHCSKS  702

Query  1516  ECATNYCPCYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLL  1695
             +C +  CPC+A+ RECDPDVC  CW  CGDG++G P  +  N++C+NMKLLL  QQ+VLL
Sbjct  703   QCRSRQCPCFAADRECDPDVCRNCWAGCGDGTMGGPSQRGDNYECRNMKLLLKQQQRVLL  762

Query  1696  GRSDIAGWGAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQL  1875
             GRSD++GWGAFLKN    V+K+E+IG YTGELISH EADK GK+YDR+N SFLFNLNDQ 
Sbjct  763   GRSDVSGWGAFLKN---SVNKHEYIGEYTGELISHREADKRGKIYDRENSSFLFNLNDQF  819

Query  1876  VIDAYRRGNKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
             V+DAYR+G+KLKF NHSPDPNC+AKV             ++VAG     DHR G
Sbjct  820   VLDAYRKGDKLKFANHSPDPNCYAKV-------------IMVAG-----DHRVG  855


 Score =   140 bits (353),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 83/154 (54%), Positives = 112/154 (73%), Gaps = 4/154 (3%)
 Frame = +1

Query  892   TTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALicsdsdeeiieeegenefaes-edYI  1068
             T W FL RNQ+M EDQSV+GRRRIYYD + GEALICSDS+E+ +++E + +     EDYI
Sbjct  158   TAWLFLDRNQRMTEDQSVLGRRRIYYDRSGGEALICSDSEEDPVDDEDDKKEFGDCEDYI  217

Query  1069  LRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLIKEGATSKNENTEVTI---NSYLD  1239
             L+ TIE+VGL D VLD+LA  F     E+KARY+ L+ +  + +  + E+     ++   
Sbjct  218   LQKTIEEVGLSDTVLDILAQQFQTSACEIKARYELLLNQDKSKQCTSEELNAKREHALAG  277

Query  1240  EDLDAALSSFDNLFCQRCFVFNCQLHGCSQDLII  1341
             +DLDAAL SFDNLFC+RC VF+C+LHGCSQDL++
Sbjct  278   KDLDAALDSFDNLFCRRCLVFDCRLHGCSQDLVL  311


 Score = 65.5 bits (158),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSKK  2167
             +I+V GDHR+GIFA + + AG+EL YDY+Y+PD  PAWA+  ++SS +
Sbjct  845   VIMVAGDHRVGIFAKERICAGEELFYDYRYEPDCAPAWARGPEASSSR  892



>ref|XP_002878682.1| hypothetical protein ARALYDRAFT_481208 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54941.1| hypothetical protein ARALYDRAFT_481208 [Arabidopsis lyrata subsp. 
lyrata]
Length=900

 Score =   281 bits (720),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 134/234 (57%), Positives = 172/234 (74%), Gaps = 6/234 (3%)
 Frame = +1

Query  1339  ILKQIRVR-EELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKN  1515
             I K+I  R ++ C  + PCNC   CGK+CPC++    CEK+CGCP +CK  F+GCHC K+
Sbjct  635   IRKRITERKDQPCRQFNPCNCKIACGKECPCLLNGTCCEKYCGCPKSCKNRFRGCHCAKS  694

Query  1516  ECATNYCPCYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLL  1695
             +C +  CPC+A+ RECDPDVC  CWV  GDGS+G+P  +  N++C+NMKLLL  QQ+VLL
Sbjct  695   QCRSRQCPCFAADRECDPDVCRNCWVIGGDGSLGVPSQRGDNYECRNMKLLLKQQQRVLL  754

Query  1696  GRSDIAGWGAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQL  1875
             G SD++GWGAFLKN    VSK+E++G YTGELISH EADK GK+YDR+N SFLFNLNDQ 
Sbjct  755   GISDVSGWGAFLKN---SVSKHEYLGEYTGELISHKEADKRGKIYDRENSSFLFNLNDQF  811

Query  1876  VIDAYRRGNKLKFINHSPDPNCFAKVNCSLSPCLLQCF--QLIVAGGSFSIDHR  2031
             V+DAYR+G+KLKF NHSP+PNC+AKV        +  F  + I+AG     D+R
Sbjct  812   VLDAYRKGDKLKFANHSPEPNCYAKVIMVAGDHRVGIFAKERILAGEELFYDYR  865


 Score =   164 bits (416),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 112/219 (51%), Positives = 153/219 (70%), Gaps = 7/219 (3%)
 Frame = +1

Query  694   DGSADLLAKRQTDAFDLQNSIGTGSGNKICSSQEDGYASSDL--RSSIVLKNAVCpiklp  867
             DGS +LL KRQ D+  +++ I   + N      EDG A+S +   SS+ +K ++ PIK+P
Sbjct  83    DGS-NLLVKRQRDSPGMKSGIDESNNNHRFV--EDGPANSGMVQGSSVPVKISLRPIKMP  139

Query  868   klekippYTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALi-csdsdeeiieeegene  1044
              ++++ PYTTW FL RNQ+M EDQSV+GRRRIYYD   GEALI     +E I +EE + +
Sbjct  140   DIKRLSPYTTWVFLDRNQRMTEDQSVVGRRRIYYDQTGGEALICSDSEEEAIDDEEEKRD  199

Query  1045  faesedYILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLIKEGATSKNENTEVTI  1224
             F E EDYI+RMT+E++GL D VL+ LAN  SR  SE+KARY  LIKE   S++ + +   
Sbjct  200   FLEPEDYIIRMTLEQLGLSDSVLEELANFLSRSSSEIKARYGVLIKEKEVSESGDNQAE-  258

Query  1225  NSYLDEDLDAALSSFDNLFCQRCFVFNCQLHGCSQDLII  1341
             +S  ++D++ AL SFDNLFC+RC VF+C+LHGCSQDLI 
Sbjct  259   SSLFNKDMEGALDSFDNLFCRRCLVFDCRLHGCSQDLIF  297


 Score = 62.8 bits (151),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 36/48 (75%), Gaps = 0/48 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSKK  2167
             +I+V GDHR+GIFA + + AG+EL YDY+Y+PD  PAWAK  ++   K
Sbjct  837   VIMVAGDHRVGIFAKERILAGEELFYDYRYEPDRAPAWAKKPEAPGSK  884



>emb|CAA71599.1| curly leaf [Arabidopsis thaliana]
Length=902

 Score =   281 bits (720),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 134/234 (57%), Positives = 172/234 (74%), Gaps = 6/234 (3%)
 Frame = +1

Query  1339  ILKQI-RVREELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKN  1515
             I K+I   +++ C  + PCNC   CGK+CPC++     EK+CGCP +CK  F+GCHC K+
Sbjct  637   IRKRITEKKDQPCRQFNPCNCQIACGKECPCLLNGTCYEKYCGCPKSCKNRFRGCHCAKS  696

Query  1516  ECATNYCPCYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLL  1695
             +C +  CPC+A+ RECDPDVC  CWV  GDGS+G+P  +  N++C+NMKLLL  QQ+VLL
Sbjct  697   QCRSRQCPCFAADRECDPDVCRNCWVIGGDGSLGVPSQRGDNYECRNMKLLLKQQQRVLL  756

Query  1696  GRSDIAGWGAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQL  1875
             G SDI+GWGAFLKN    VSK+E++G YTGELISH EADK GK+YDR+NCSFLFNLNDQ 
Sbjct  757   GISDISGWGAFLKN---SVSKHEYLGEYTGELISHKEADKRGKIYDRENCSFLFNLNDQF  813

Query  1876  VIDAYRRGNKLKFINHSPDPNCFAKVNCSLSPCLLQCF--QLIVAGGSFSIDHR  2031
             V+DAYR+G+KLKF NHSP+PNC+AKV        +  F  + I+AG     D+R
Sbjct  814   VLDAYRKGDKLKFANHSPEPNCYAKVIMVAGDHRVGIFAKERILAGEELFYDYR  867


 Score =   168 bits (426),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 113/219 (52%), Positives = 154/219 (70%), Gaps = 8/219 (4%)
 Frame = +1

Query  694   DGSADLLAKRQTDAFDLQNSIGTGSGNKICSSQEDGYASSDL--RSSIVLKNAVCpiklp  867
             DGS DLL KRQ D+  +++ I   + N+     EDG ASS +   SS+ +K ++ PIK+P
Sbjct  82    DGS-DLLVKRQRDSPGMKSGIDESNNNRYV---EDGPASSGMVQGSSVPVKISLRPIKMP  137

Query  868   klekippYTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALi-csdsdeeiieeegene  1044
              ++++ PYTTW FL RNQ+M EDQSV+GRRRIYYD   GEALI     +E I +EE + +
Sbjct  138   DIKRLSPYTTWVFLDRNQRMTEDQSVVGRRRIYYDQTGGEALICSDSEEEAIDDEEEKRD  197

Query  1045  faesedYILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLIKEGATSKNENTEVTI  1224
             F E EDYI+RMT+E++GL D VL  LAN  SR  SE+KAR+  L+KE   S++ + +   
Sbjct  198   FLEPEDYIIRMTLEQLGLSDSVLAELANFLSRSTSEIKARHGVLMKEKEVSESGDNQAE-  256

Query  1225  NSYLDEDLDAALSSFDNLFCQRCFVFNCQLHGCSQDLII  1341
             +S L++D++ AL SFDNLFC+RC VF+C+LHGCSQDLI 
Sbjct  257   SSLLNKDMEGALDSFDNLFCRRCLVFDCRLHGCSQDLIF  295


 Score = 63.2 bits (152),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 36/48 (75%), Gaps = 0/48 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSKK  2167
             +I+V GDHR+GIFA + + AG+EL YDY+Y+PD  PAWAK  ++   K
Sbjct  839   VIMVAGDHRVGIFAKERILAGEELFYDYRYEPDRAPAWAKKPEAPGSK  886



>gb|EEE65516.1| hypothetical protein OsJ_20958 [Oryza sativa Japonica Group]
Length=1009

 Score =   283 bits (723),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 135/235 (57%), Positives = 169/235 (72%), Gaps = 22/235 (9%)
 Frame = +1

Query  1336  IILKQIRVR-EELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTK  1512
              I K+I  R ++ C  YTPC C   CGK+CPC+     CEK+CGCP  CK  F+GCHC K
Sbjct  744   FIRKRITERKDQPCRQYTPCGCQSACGKQCPCLTNGTCCEKYCGCPKMCKNRFRGCHCAK  803

Query  1513  NECATNYCPCYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVL  1692
             ++C +  CPC+A+ RECDPDVC  CWV CGDG++G+P  +  N++C+NMKLLL  QQ+VL
Sbjct  804   SQCRSRQCPCFAADRECDPDVCRNCWVGCGDGTLGVPNQRGDNYECRNMKLLLKQQQRVL  863

Query  1693  LGRSDIAGWGAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQ  1872
             LGRSD++GWGAFLKN    V K+E++G YTGELISH EADK GK+YDR+N SFLFNLN++
Sbjct  864   LGRSDVSGWGAFLKN---SVGKHEYLGEYTGELISHKEADKRGKIYDRENSSFLFNLNNE  920

Query  1873  LVIDAYRRGNKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
              V+DAYR G+KLKF NHSPDPNC+AKV             ++VAG     DHR G
Sbjct  921   YVLDAYRMGDKLKFANHSPDPNCYAKV-------------IMVAG-----DHRVG  957


 Score =   149 bits (375),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 112/244 (46%), Positives = 155/244 (64%), Gaps = 8/244 (3%)
 Frame = +1

Query  703   ADLLAKRQTDAFDLQNSIGTGSGNKICSSQEDGYASSDL-RSSIVLKNAVCpiklpklek  879
             ++LL KR+ DA    NS  +       ++ +D  +S+ +   ++  +N+V PI+LP++  
Sbjct  191   SNLLTKRKEDALCAVNSRESSPDESEGANCQDECSSTVIVGGNLSARNSVRPIRLPEVAT  250

Query  880   ippYTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALi-csdsdeeiieeegenefaes  1056
             +PPYTTW FL RNQ+M EDQSV+GRRRIYYD N GEALI     DE + +EE + EF +S
Sbjct  251   LPPYTTWIFLDRNQRMQEDQSVLGRRRIYYDTNCGEALICSDSEDEAVEDEEEKKEFKDS  310

Query  1057  edYILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDL---IKEGATSKNENTEVTIN  1227
             ED I+RMTI++ G+ D VL+ LA    R P ++KARY+ L     EG++ K     V + 
Sbjct  311   EDCIIRMTIQECGMSDAVLETLARDIERAPDDIKARYEILQGEKPEGSSKKVSELNVKME  370

Query  1228  S-YLDEDLDAALSSFDNLFCQRCFVFNCQLHGCSQDLIILKQIRVREELCAHYTPCNC*P  1404
               Y D+DLDAAL SFDNLFC+RC VF+C+LHGCSQDL+   + +    LC+      C  
Sbjct  371   DVYGDKDLDAALDSFDNLFCRRCLVFDCKLHGCSQDLVFPTEKQA--PLCSSDEGTPCGI  428

Query  1405  HCGK  1416
             HC K
Sbjct  429   HCYK  432


 Score = 63.2 bits (152),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAK  2143
             +I+V GDHR+GIFA + ++AG+EL YDY+Y+PD  PAWA+
Sbjct  947   VIMVAGDHRVGIFAKERISAGEELFYDYRYEPDRAPAWAR  986



>gb|EEC80388.1| hypothetical protein OsI_22514 [Oryza sativa Indica Group]
Length=1000

 Score =   283 bits (723),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 135/235 (57%), Positives = 169/235 (72%), Gaps = 22/235 (9%)
 Frame = +1

Query  1336  IILKQIRVR-EELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTK  1512
              I K+I  R ++ C  YTPC C   CGK+CPC+     CEK+CGCP  CK  F+GCHC K
Sbjct  735   FIRKRITERKDQPCRQYTPCGCQSACGKQCPCLTNGTCCEKYCGCPKMCKNRFRGCHCAK  794

Query  1513  NECATNYCPCYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVL  1692
             ++C +  CPC+A+ RECDPDVC  CWV CGDG++G+P  +  N++C+NMKLLL  QQ+VL
Sbjct  795   SQCRSRQCPCFAADRECDPDVCRNCWVGCGDGTLGVPNQRGDNYECRNMKLLLKQQQRVL  854

Query  1693  LGRSDIAGWGAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQ  1872
             LGRSD++GWGAFLKN    V K+E++G YTGELISH EADK GK+YDR+N SFLFNLN++
Sbjct  855   LGRSDVSGWGAFLKN---SVGKHEYLGEYTGELISHKEADKRGKIYDRENSSFLFNLNNE  911

Query  1873  LVIDAYRRGNKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
              V+DAYR G+KLKF NHSPDPNC+AKV             ++VAG     DHR G
Sbjct  912   YVLDAYRMGDKLKFANHSPDPNCYAKV-------------IMVAG-----DHRVG  948


 Score =   149 bits (375),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 112/244 (46%), Positives = 155/244 (64%), Gaps = 8/244 (3%)
 Frame = +1

Query  703   ADLLAKRQTDAFDLQNSIGTGSGNKICSSQEDGYASSDL-RSSIVLKNAVCpiklpklek  879
             ++LL KR+ DA    NS  +       ++ +D  +S+ +   ++  +N+V PI+LP++  
Sbjct  182   SNLLTKRKEDALCAVNSRESSPDESEGANCQDECSSTVIVGGNLSARNSVRPIRLPEVAT  241

Query  880   ippYTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALi-csdsdeeiieeegenefaes  1056
             +PPYTTW FL RNQ+M EDQSV+GRRRIYYD N GEALI     DE + +EE + EF +S
Sbjct  242   LPPYTTWIFLDRNQRMQEDQSVLGRRRIYYDTNCGEALICSDSEDEAVEDEEEKKEFKDS  301

Query  1057  edYILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDL---IKEGATSKNENTEVTIN  1227
             ED I+RMTI++ G+ D VL+ LA    R P ++KARY+ L     EG++ K     V + 
Sbjct  302   EDCIIRMTIQECGMSDAVLETLARDIERAPDDIKARYEILQGEKPEGSSKKVSEHNVKME  361

Query  1228  S-YLDEDLDAALSSFDNLFCQRCFVFNCQLHGCSQDLIILKQIRVREELCAHYTPCNC*P  1404
               Y D+DLDAAL SFDNLFC+RC VF+C+LHGCSQDL+   + +    LC+      C  
Sbjct  362   DVYGDKDLDAALDSFDNLFCRRCLVFDCKLHGCSQDLVFPTEKQA--PLCSSDEGTPCGI  419

Query  1405  HCGK  1416
             HC K
Sbjct  420   HCYK  423


 Score = 63.2 bits (152),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAK  2143
             +I+V GDHR+GIFA + ++AG+EL YDY+Y+PD  PAWA+
Sbjct  938   VIMVAGDHRVGIFAKERISAGEELFYDYRYEPDRAPAWAR  977



>ref|NP_001105078.1| histone-lysine N-methyltransferase EZ1 [Zea mays]
 sp|Q8S4P6.1|EZ1_MAIZE RecName: Full=Histone-lysine N-methyltransferase EZ1; AltName: 
Full=Enhancer of zeste protein 1 [Zea mays]
 gb|AAM13420.1|AF443596_1 enhancer of zeste-like protein 1 [Zea mays]
 gb|AFW75638.1| enhancer of zeste1 [Zea mays]
Length=931

 Score =   281 bits (719),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 129/226 (57%), Positives = 166/226 (73%), Gaps = 5/226 (2%)
 Frame = +1

Query  1360  REELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKNECATNYCP  1539
             +++ C  Y PC C   CGK+CPC+     CEK+CGCP  CK  F+GCHC K++C +  CP
Sbjct  671   KDQPCRQYNPCGCQSTCGKQCPCLSNGTCCEKYCGCPKICKNRFRGCHCAKSQCRSRQCP  730

Query  1540  CYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLLGRSDIAGW  1719
             C+A+ RECDPDVC  CWV CGDG++G+P  +  N++C+NMKLLL  QQ+VLLGRSD++GW
Sbjct  731   CFAADRECDPDVCRNCWVGCGDGTLGVPNQRGDNYECRNMKLLLKQQQRVLLGRSDVSGW  790

Query  1720  GAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQLVIDAYRRG  1899
             GAFLKN    VSK+E++G YTGELISH EADK GK+YDR+N SFLFNLN++ V+DAYR G
Sbjct  791   GAFLKN---SVSKHEYLGEYTGELISHKEADKRGKIYDRENSSFLFNLNNEYVLDAYRMG  847

Query  1900  NKLKFINHSPDPNCFAKVNCSLSPCLLQCF--QLIVAGGSFSIDHR  2031
             +KLKF NH+PDPNC+AKV        +  F  + I+AG     D+R
Sbjct  848   DKLKFANHAPDPNCYAKVIMVTGDHRVGIFAKERILAGEELFYDYR  893


 Score =   143 bits (361),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 107/251 (43%), Positives = 145/251 (58%), Gaps = 12/251 (5%)
 Frame = +1

Query  694   DGSADLLAKRQTDAFDLQNSIGTGSGNKICSS--QEDGYASSDLR--SSIVLKNAVCpik  861
             D +++LL KRQ DA    +S+     +K   +   E  ++SS++    ++  KNA+    
Sbjct  103   DSASNLLTKRQDDALCTLHSLDIIPVDKDGGTFQDESPFSSSNVMFGGNLGPKNAIIRPI  162

Query  862   lpklekipp-YTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALi-csdsdeeiieeeg  1035
                     P YTTW FL RNQ+M EDQSV+GRRRIYYD + GEALI     DE I +EE 
Sbjct  163   KLPEVPKLPPYTTWIFLDRNQRMTEDQSVLGRRRIYYDTSCGEALICSDSEDEAIEDEEE  222

Query  1036  enefaesedYILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDL----IKEGATSKN  1203
             + EF  SED+I+RMT+++ G+ D VL  LA H  R   ++KARY+ L     K+      
Sbjct  223   KKEFKHSEDHIIRMTVQECGMSDAVLQTLARHMERAADDIKARYEILHGEKTKDSCKKGT  282

Query  1204  ENTEVTINSYLDEDLDAALSSFDNLFCQRCFVFNCQLHGCSQDLIILKQIRVREELCAHY  1383
             E+     + Y D+DLDAAL SFDNLFC+RC VF+C+LHGCSQDL+   + +         
Sbjct  283   EHNVKVEDLYCDKDLDAALDSFDNLFCRRCLVFDCKLHGCSQDLVFPTEKQPAWSGVDDS  342

Query  1384  TPCNC*PHCGK  1416
              PC    HC K
Sbjct  343   VPCGI--HCHK  351


 Score = 63.2 bits (152),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSKK  2167
             +I+V GDHR+GIFA + + AG+EL YDY+Y+PD  PAWA+  ++S  K
Sbjct  865   VIMVTGDHRVGIFAKERILAGEELFYDYRYEPDRAPAWARKPEASGAK  912



>ref|XP_008648283.1| PREDICTED: histone-lysine N-methyltransferase EZ1 isoform X1 
[Zea mays]
Length=957

 Score =   281 bits (720),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 129/226 (57%), Positives = 166/226 (73%), Gaps = 5/226 (2%)
 Frame = +1

Query  1360  REELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKNECATNYCP  1539
             +++ C  Y PC C   CGK+CPC+     CEK+CGCP  CK  F+GCHC K++C +  CP
Sbjct  697   KDQPCRQYNPCGCQSTCGKQCPCLSNGTCCEKYCGCPKICKNRFRGCHCAKSQCRSRQCP  756

Query  1540  CYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLLGRSDIAGW  1719
             C+A+ RECDPDVC  CWV CGDG++G+P  +  N++C+NMKLLL  QQ+VLLGRSD++GW
Sbjct  757   CFAADRECDPDVCRNCWVGCGDGTLGVPNQRGDNYECRNMKLLLKQQQRVLLGRSDVSGW  816

Query  1720  GAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQLVIDAYRRG  1899
             GAFLKN    VSK+E++G YTGELISH EADK GK+YDR+N SFLFNLN++ V+DAYR G
Sbjct  817   GAFLKN---SVSKHEYLGEYTGELISHKEADKRGKIYDRENSSFLFNLNNEYVLDAYRMG  873

Query  1900  NKLKFINHSPDPNCFAKVNCSLSPCLLQCF--QLIVAGGSFSIDHR  2031
             +KLKF NH+PDPNC+AKV        +  F  + I+AG     D+R
Sbjct  874   DKLKFANHAPDPNCYAKVIMVTGDHRVGIFAKERILAGEELFYDYR  919


 Score =   143 bits (360),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 107/251 (43%), Positives = 146/251 (58%), Gaps = 12/251 (5%)
 Frame = +1

Query  694   DGSADLLAKRQTDAFDLQNSIGTGSGNKICSSQEDG--YASSDLR--SSIVLKNAVCpik  861
             D +++LL KRQ DA    +S+     +K   + +D   ++SS++    ++  KNA+    
Sbjct  129   DSASNLLTKRQDDALCTLHSLDIIPVDKDGGTFQDESPFSSSNVMFGGNLGPKNAIIRPI  188

Query  862   lpklekipp-YTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALi-csdsdeeiieeeg  1035
                     P YTTW FL RNQ+M EDQSV+GRRRIYYD + GEALI     DE I +EE 
Sbjct  189   KLPEVPKLPPYTTWIFLDRNQRMTEDQSVLGRRRIYYDTSCGEALICSDSEDEAIEDEEE  248

Query  1036  enefaesedYILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDL----IKEGATSKN  1203
             + EF  SED+I+RMT+++ G+ D VL  LA H  R   ++KARY+ L     K+      
Sbjct  249   KKEFKHSEDHIIRMTVQECGMSDAVLQTLARHMERAADDIKARYEILHGEKTKDSCKKGT  308

Query  1204  ENTEVTINSYLDEDLDAALSSFDNLFCQRCFVFNCQLHGCSQDLIILKQIRVREELCAHY  1383
             E+     + Y D+DLDAAL SFDNLFC+RC VF+C+LHGCSQDL+   + +         
Sbjct  309   EHNVKVEDLYCDKDLDAALDSFDNLFCRRCLVFDCKLHGCSQDLVFPTEKQPAWSGVDDS  368

Query  1384  TPCNC*PHCGK  1416
              PC    HC K
Sbjct  369   VPCGI--HCHK  377


 Score = 63.2 bits (152),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSKK  2167
             +I+V GDHR+GIFA + + AG+EL YDY+Y+PD  PAWA+  ++S  K
Sbjct  891   VIMVTGDHRVGIFAKERILAGEELFYDYRYEPDRAPAWARKPEASGAK  938



>gb|AAR31181.1| enhancer of zeste-like 1 [Zea mays]
Length=931

 Score =   281 bits (719),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 129/226 (57%), Positives = 166/226 (73%), Gaps = 5/226 (2%)
 Frame = +1

Query  1360  REELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKNECATNYCP  1539
             +++ C  Y PC C   CGK+CPC+     CEK+CGCP  CK  F+GCHC K++C +  CP
Sbjct  671   KDQPCRQYNPCGCQSTCGKQCPCLSNGTCCEKYCGCPKICKNRFRGCHCAKSQCRSRQCP  730

Query  1540  CYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLLGRSDIAGW  1719
             C+A+ RECDPDVC  CWV CGDG++G+P  +  N++C+NMKLLL  QQ+VLLGRSD++GW
Sbjct  731   CFAADRECDPDVCRNCWVGCGDGTLGVPNQRGDNYECRNMKLLLKQQQRVLLGRSDVSGW  790

Query  1720  GAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQLVIDAYRRG  1899
             GAFLKN    VSK+E++G YTGELISH EADK GK+YDR+N SFLFNLN++ V+DAYR G
Sbjct  791   GAFLKN---SVSKHEYLGEYTGELISHKEADKRGKIYDRENSSFLFNLNNEYVLDAYRMG  847

Query  1900  NKLKFINHSPDPNCFAKVNCSLSPCLLQCF--QLIVAGGSFSIDHR  2031
             +KLKF NH+PDPNC+AKV        +  F  + I+AG     D+R
Sbjct  848   DKLKFANHAPDPNCYAKVIMVTGDHRVGIFAKERILAGEELFYDYR  893


 Score =   143 bits (361),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 107/251 (43%), Positives = 145/251 (58%), Gaps = 12/251 (5%)
 Frame = +1

Query  694   DGSADLLAKRQTDAFDLQNSIGTGSGNKICSS--QEDGYASSDLR--SSIVLKNAVCpik  861
             D +++LL KRQ DA    +S+     +K   +   E  ++SS++    ++  KNA+    
Sbjct  103   DSASNLLTKRQDDALCTLHSLDIIPVDKDGGTFQDESPFSSSNVMFGGNLGPKNAIIRPI  162

Query  862   lpklekipp-YTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALi-csdsdeeiieeeg  1035
                     P YTTW FL RNQ+M EDQSV+GRRRIYYD + GEALI     DE I +EE 
Sbjct  163   KLPEVPKLPPYTTWIFLDRNQRMTEDQSVLGRRRIYYDTSCGEALICSDSEDEAIEDEEE  222

Query  1036  enefaesedYILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDL----IKEGATSKN  1203
             + EF  SED+I+RMT+++ G+ D VL  LA H  R   ++KARY+ L     K+      
Sbjct  223   KKEFKHSEDHIIRMTVQECGMSDAVLQTLARHMERAADDIKARYEILHGEKTKDSCKKGT  282

Query  1204  ENTEVTINSYLDEDLDAALSSFDNLFCQRCFVFNCQLHGCSQDLIILKQIRVREELCAHY  1383
             E+     + Y D+DLDAAL SFDNLFC+RC VF+C+LHGCSQDL+   + +         
Sbjct  283   EHNVKVEDLYCDKDLDAALDSFDNLFCRRCLVFDCKLHGCSQDLVFPTEKQPAWSGVDDS  342

Query  1384  TPCNC*PHCGK  1416
              PC    HC K
Sbjct  343   VPCGI--HCHK  351


 Score = 63.2 bits (152),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSKK  2167
             +I+V GDHR+GIFA + + AG+EL YDY+Y+PD  PAWA+  ++S  K
Sbjct  865   VIMVTGDHRVGIFAKERILAGEELFYDYRYEPDRAPAWARKPEASGAK  912



>gb|ACN26587.1| unknown [Zea mays]
Length=295

 Score =   264 bits (675),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 131/234 (56%), Positives = 164/234 (70%), Gaps = 21/234 (9%)
 Frame = +1

Query  1336  IILKQIRVREELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKN  1515
              + K+I   ++    Y PC C   CGK CPCV     CEK+CGC  +CK  F+GCHC K+
Sbjct  32    TVRKRIGDGKQWYTQYNPCVCQQMCGKDCPCVENGTCCEKYCGCSKSCKNKFRGCHCAKS  91

Query  1516  ECATNYCPCYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLL  1695
             +C +  CPC+A+ RECDPDVC  CWVSCGDGS+G PP +   ++C NMKLLL  QQ++LL
Sbjct  92    QCRSRQCPCFAASRECDPDVCRNCWVSCGDGSLGEPPARGDGYQCGNMKLLLKQQQRILL  151

Query  1696  GRSDIAGWGAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQL  1875
             GRSD+AGWGAF+KN    V+KN+++G YTGELISH EADK GK+YDR N SFLF+LNDQ 
Sbjct  152   GRSDVAGWGAFIKN---PVNKNDYLGEYTGELISHKEADKRGKIYDRANSSFLFDLNDQY  208

Query  1876  VIDAYRRGNKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
             V+DAYR+G+KLKF NHS +PNC+AKV             ++VAG     DHR G
Sbjct  209   VLDAYRKGDKLKFANHSSNPNCYAKV-------------MLVAG-----DHRVG  244


 Score = 58.2 bits (139),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSK  2164
             +++V GDHR+GI+A + + A +EL YDY+Y PD  PAWA+  + S K
Sbjct  234   VMLVAGDHRVGIYAKEHIEASEELFYDYRYGPDQAPAWARRPEGSKK  280



>ref|XP_004964752.1| PREDICTED: histone-lysine N-methyltransferase EZ1-like isoform 
X2 [Setaria italica]
Length=922

 Score =   281 bits (718),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 132/234 (56%), Positives = 170/234 (73%), Gaps = 6/234 (3%)
 Frame = +1

Query  1339  ILKQIRVR-EELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKN  1515
             I K+I  R ++ C  Y PC C   CGK+CPC+  +  CEK+CGC   CK  F+GCHC K+
Sbjct  654   IRKRITERKDQPCRQYNPCGCQSACGKQCPCLTNATCCEKYCGCSKICKNRFRGCHCAKS  713

Query  1516  ECATNYCPCYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLL  1695
             +C +  CPC+A+ RECDPDVC  CWV CGDG++G+P  +  N++C+NMKLLL  QQ+VLL
Sbjct  714   QCRSRQCPCFAADRECDPDVCRNCWVGCGDGTLGVPNQRGDNYECRNMKLLLKQQQRVLL  773

Query  1696  GRSDIAGWGAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQL  1875
             GRSD++GWGAFLKN    V+K+E++G YTGELISH EADK GK+YDR+N SFLFNLN++ 
Sbjct  774   GRSDVSGWGAFLKN---SVNKHEYLGEYTGELISHKEADKRGKIYDRENSSFLFNLNNEF  830

Query  1876  VIDAYRRGNKLKFINHSPDPNCFAKVNCSLSPCLLQCF--QLIVAGGSFSIDHR  2031
             V+DAYR G+KLKF NHSPDPNC+AKV        +  F  + I+AG     D+R
Sbjct  831   VLDAYRMGDKLKFANHSPDPNCYAKVIMVAGDHRVGIFAKERILAGEELFYDYR  884


 Score =   148 bits (373),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 114/239 (48%), Positives = 156/239 (65%), Gaps = 14/239 (6%)
 Frame = +1

Query  661   STGPPLTGLVG-DGSADLLAKRQTDAFDLQNSIGTGSGNKICSSQEDG--YASSD--LRS  825
             S   P+  L G D +++LL KRQ DA    +S      +K  SS +D   ++SS+  L  
Sbjct  90    SKSKPINTLKGTDLASNLLTKRQDDALCTLHSADICPADKDGSSFQDESLFSSSNAILGG  149

Query  826   SIVLKNAVCpiklpklekippYTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALi-cs  1002
             ++  KN++ PIKLP++ K+PPYTTW FL RNQ+M EDQSV+GRRRIYYD + GEALI   
Sbjct  150   NLSAKNSIRPIKLPEVPKLPPYTTWIFLDRNQRMSEDQSVLGRRRIYYDASCGEALICSD  209

Query  1003  dsdeeiieeegenefaesedYILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLIK  1182
               +E I +EE + EF  SED I+RMT+++ G+ D VL  LA H  R   ++KARY+  I 
Sbjct  210   SEEEGIDDEEEKKEFKHSEDCIIRMTVQECGMSDAVLHTLAQHLDRATDDIKARYE--IL  267

Query  1183  EGATSKN------ENTEVTINSYLDEDLDAALSSFDNLFCQRCFVFNCQLHGCSQDLII  1341
             +G  +++      E+     + Y D+DLDAAL SFDNLFC+RC VF+C+LHGCSQDL+ 
Sbjct  268   QGEKTQDSCKKVIEHNAKVEDLYGDKDLDAALDSFDNLFCRRCLVFDCKLHGCSQDLVF  326


 Score = 62.8 bits (151),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 36/48 (75%), Gaps = 0/48 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSKK  2167
             +I+V GDHR+GIFA + + AG+EL YDY+Y+PD  PAWA+  + S  K
Sbjct  856   VIMVAGDHRVGIFAKERILAGEELFYDYRYEPDRAPAWARKPEDSRGK  903



>ref|XP_010938257.1| PREDICTED: histone-lysine N-methyltransferase EZ3 isoform X2 
[Elaeis guineensis]
Length=750

 Score =   277 bits (709),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 131/235 (56%), Positives = 168/235 (71%), Gaps = 5/235 (2%)
 Frame = +1

Query  1339  ILKQIRVREELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKNE  1518
             I K+I   +  C  +TPC C   CGK+CPC+     CEK+CGC  +CK  F+GCHC K++
Sbjct  489   IRKRIGDGQLACKQFTPCGCQQMCGKQCPCMDNGTCCEKYCGCSKSCKNRFRGCHCAKSQ  548

Query  1519  CATNYCPCYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLLG  1698
             C +  CPC+A+GRECDPDVC  CWVSCGDGS+G PP +   ++C NMKLLL  QQ++LLG
Sbjct  549   CRSRQCPCFAAGRECDPDVCRNCWVSCGDGSLGEPPARGDGYQCGNMKLLLKQQQRILLG  608

Query  1699  RSDIAGWGAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQLV  1878
             RSD+AGWGAF+KN    V+KN+++G YTGELISH EADK GK+YDR N SFLF+LNDQ V
Sbjct  609   RSDVAGWGAFIKN---PVNKNDYLGEYTGELISHKEADKRGKIYDRANSSFLFDLNDQYV  665

Query  1879  IDAYRRGNKLKFINHSPDPNCFAKVNCSLSPCLLQCF--QLIVAGGSFSIDHRSG  2037
             +DAYR+G+KLKF NHS +PNC+AK+        +  F  + + AG     D+R G
Sbjct  666   LDAYRKGDKLKFANHSSNPNCYAKIMLVAGDHRVGIFAKEHVEAGEELFYDYRYG  720


 Score =   101 bits (251),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 69/145 (48%), Positives = 95/145 (66%), Gaps = 6/145 (4%)
 Frame = +1

Query  925   MPEDQSVIGRRRIYYDMNSGEALi-csdsdeeiieeegenefaesedYILRMTIEKVGLY  1101
             M +DQSV+GRRRIYYD    EALI     +E    EE ++EF+E ED IL   I++ GL+
Sbjct  1     MADDQSVVGRRRIYYDPYGSEALICSESDEEIADSEEEKHEFSEGEDQILWKAIQEHGLH  60

Query  1102  DMVLDLLANHFSRKPSEVKARYKDLI----KEGATSK-NENTEVTINSYLDEDLDAALSS  1266
               VL++L        SE+K RY+ L+    K G  S+ ++ TE     +L++ L+AAL S
Sbjct  61    QDVLNILVLFIDATHSEIKERYETLMEKHEKHGKNSEVSDKTEPEERLFLNKTLNAALDS  120

Query  1267  FDNLFCQRCFVFNCQLHGCSQDLII  1341
             FDNLFC+RC +F+C+LHGCSQ+LII
Sbjct  121   FDNLFCRRCLIFDCRLHGCSQNLII  145


 Score = 63.2 bits (152),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSK  2164
             I++V GDHR+GIFA + + AG+EL YDY+Y PD  PAWA+ L  S +
Sbjct  690   IMLVAGDHRVGIFAKEHVEAGEELFYDYRYGPDQAPAWARKLDGSKR  736



>ref|XP_004964751.1| PREDICTED: histone-lysine N-methyltransferase EZ1-like isoform 
X1 [Setaria italica]
Length=956

 Score =   281 bits (718),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 132/234 (56%), Positives = 170/234 (73%), Gaps = 6/234 (3%)
 Frame = +1

Query  1339  ILKQIRVR-EELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKN  1515
             I K+I  R ++ C  Y PC C   CGK+CPC+  +  CEK+CGC   CK  F+GCHC K+
Sbjct  688   IRKRITERKDQPCRQYNPCGCQSACGKQCPCLTNATCCEKYCGCSKICKNRFRGCHCAKS  747

Query  1516  ECATNYCPCYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLL  1695
             +C +  CPC+A+ RECDPDVC  CWV CGDG++G+P  +  N++C+NMKLLL  QQ+VLL
Sbjct  748   QCRSRQCPCFAADRECDPDVCRNCWVGCGDGTLGVPNQRGDNYECRNMKLLLKQQQRVLL  807

Query  1696  GRSDIAGWGAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQL  1875
             GRSD++GWGAFLKN    V+K+E++G YTGELISH EADK GK+YDR+N SFLFNLN++ 
Sbjct  808   GRSDVSGWGAFLKN---SVNKHEYLGEYTGELISHKEADKRGKIYDRENSSFLFNLNNEF  864

Query  1876  VIDAYRRGNKLKFINHSPDPNCFAKVNCSLSPCLLQCF--QLIVAGGSFSIDHR  2031
             V+DAYR G+KLKF NHSPDPNC+AKV        +  F  + I+AG     D+R
Sbjct  865   VLDAYRMGDKLKFANHSPDPNCYAKVIMVAGDHRVGIFAKERILAGEELFYDYR  918


 Score =   148 bits (373),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 114/239 (48%), Positives = 156/239 (65%), Gaps = 14/239 (6%)
 Frame = +1

Query  661   STGPPLTGLVG-DGSADLLAKRQTDAFDLQNSIGTGSGNKICSSQEDG--YASSD--LRS  825
             S   P+  L G D +++LL KRQ DA    +S      +K  SS +D   ++SS+  L  
Sbjct  124   SKSKPINTLKGTDLASNLLTKRQDDALCTLHSADICPADKDGSSFQDESLFSSSNAILGG  183

Query  826   SIVLKNAVCpiklpklekippYTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALi-cs  1002
             ++  KN++ PIKLP++ K+PPYTTW FL RNQ+M EDQSV+GRRRIYYD + GEALI   
Sbjct  184   NLSAKNSIRPIKLPEVPKLPPYTTWIFLDRNQRMSEDQSVLGRRRIYYDASCGEALICSD  243

Query  1003  dsdeeiieeegenefaesedYILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLIK  1182
               +E I +EE + EF  SED I+RMT+++ G+ D VL  LA H  R   ++KARY+  I 
Sbjct  244   SEEEGIDDEEEKKEFKHSEDCIIRMTVQECGMSDAVLHTLAQHLDRATDDIKARYE--IL  301

Query  1183  EGATSKN------ENTEVTINSYLDEDLDAALSSFDNLFCQRCFVFNCQLHGCSQDLII  1341
             +G  +++      E+     + Y D+DLDAAL SFDNLFC+RC VF+C+LHGCSQDL+ 
Sbjct  302   QGEKTQDSCKKVIEHNAKVEDLYGDKDLDAALDSFDNLFCRRCLVFDCKLHGCSQDLVF  360


 Score = 62.8 bits (151),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 36/48 (75%), Gaps = 0/48 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSKK  2167
             +I+V GDHR+GIFA + + AG+EL YDY+Y+PD  PAWA+  + S  K
Sbjct  890   VIMVAGDHRVGIFAKERILAGEELFYDYRYEPDRAPAWARKPEDSRGK  937



>ref|XP_010927438.1| PREDICTED: LOW QUALITY PROTEIN: histone-lysine N-methyltransferase 
EZ1-like [Elaeis guineensis]
Length=919

 Score =   280 bits (716),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 131/226 (58%), Positives = 164/226 (73%), Gaps = 21/226 (9%)
 Frame = +1

Query  1360  REELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKNECATNYCP  1539
             +++ C  Y PC C   CGK+CPC+V    CEK+CGCP  CK  F+GCHC K++C +  CP
Sbjct  663   KDQPCRQYNPCGCQSACGKQCPCLVNGTCCEKYCGCPKICKNRFRGCHCAKSQCRSRQCP  722

Query  1540  CYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLLGRSDIAGW  1719
             C+A+ RECDPDVC  CW+ CGDG++G P     N++C+NMKLLL  QQ+VLLGRSD++GW
Sbjct  723   CFAADRECDPDVCRNCWIGCGDGTLGGPNQGGDNYECRNMKLLLKQQQRVLLGRSDVSGW  782

Query  1720  GAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQLVIDAYRRG  1899
             GAFLKN    V K+E++G YTGELISH EADK GK+YDR+N SFLFNLNDQ V+DAYR+G
Sbjct  783   GAFLKN---GVGKHEYLGEYTGELISHREADKRGKIYDRENSSFLFNLNDQFVLDAYRKG  839

Query  1900  NKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
             +KLKF NHSP+PNC+AKV             ++VAG     DHR G
Sbjct  840   DKLKFANHSPNPNCYAKV-------------IMVAG-----DHRVG  867


 Score =   162 bits (410),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 120/250 (48%), Positives = 155/250 (62%), Gaps = 13/250 (5%)
 Frame = +1

Query  694   DGSADLLAKRQTDAFDLQNSIGTGSGNKICSS--QEDGYASSD--LRSSIVLKNAVCpik  861
             D   +LL +RQ DA    NS+    G K  S+  +E  YASS   L S+   KNAV PIK
Sbjct  88    DTDXNLLTRRQDDALCTLNSVELSGGEKDGSNCQEESSYASSTVILGSNFGGKNAVRPIK  147

Query  862   lpklekippYTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALi-csdsdeeiieeege  1038
             LP++ K+PPYTTW FL RNQ+M EDQSV+GRRRIYYD   GEALI     D+ + +E+ +
Sbjct  148   LPEVPKLPPYTTWIFLDRNQRMTEDQSVVGRRRIYYDRGCGEALICSDSEDDVVEDEDEK  207

Query  1039  nefaesedYILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLIKEGATSK-----N  1203
              +F  +EDYI+RM I+KVGL D VLDLLA    R   E++ARY+ +IK   T +      
Sbjct  208   KQFGSTEDYIIRMAIQKVGLSDAVLDLLAQCLGRNTDEIRARYESIIKIEKTEECVKKGE  267

Query  1204  ENTEVTINSYLDE-DLDAALSSFDNLFCQRCFVFNCQLHGCSQDLIILKQIRVREELCAH  1380
             +  ++     L E DLDAA  SFDNLFC+RC VF+C+LHGCSQDL+   + ++       
Sbjct  268   DGVDIKTEDALSEKDLDAASDSFDNLFCRRCLVFDCRLHGCSQDLVFPSEKQLPWSNSDD  327

Query  1381  YTPCNC*PHC  1410
              TPC    HC
Sbjct  328   DTPCGM--HC  335


 Score = 67.0 bits (162),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSKK  2167
             +I+V GDHR+GIFA + +NAG+EL YDY+Y+PD  PAWA+  ++S  +
Sbjct  857   VIMVAGDHRVGIFAKERINAGEELFYDYRYEPDRAPAWARKPEASGSR  904



>ref|XP_009386332.1| PREDICTED: histone-lysine N-methyltransferase EZ1 isoform X1 
[Musa acuminata subsp. malaccensis]
Length=923

 Score =   280 bits (716),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 134/234 (57%), Positives = 168/234 (72%), Gaps = 22/234 (9%)
 Frame = +1

Query  1339  ILKQIRVR-EELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKN  1515
             I K+I  R ++ C  Y PC C   CGK+C C++    CEK+CGCP  CK  F+GCHC K+
Sbjct  659   IRKRITERKDQPCRQYNPCGCQSACGKQCRCLLNGTCCEKYCGCPKICKNRFRGCHCAKS  718

Query  1516  ECATNYCPCYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLL  1695
             +C +  CPC+A+ RECDPDVC  CWV CGDG++G P  +  N++C+NMKLLL  +Q+VLL
Sbjct  719   QCRSRQCPCFAADRECDPDVCRNCWVGCGDGTLGGPNQRGDNYECRNMKLLLKQRQRVLL  778

Query  1696  GRSDIAGWGAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQL  1875
             GRSD++GWGAFLKN    V K+E++G YTGELISH EADK GK+YDR+N SFLFNLNDQ 
Sbjct  779   GRSDVSGWGAFLKN---SVGKHEYLGEYTGELISHREADKRGKIYDRENSSFLFNLNDQF  835

Query  1876  VIDAYRRGNKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
             V+DAYR+G+KLKF NHSPDPNC+AKV             ++VAG     DHR G
Sbjct  836   VLDAYRKGDKLKFANHSPDPNCYAKV-------------IMVAG-----DHRVG  871


 Score =   159 bits (403),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 110/227 (48%), Positives = 151/227 (67%), Gaps = 11/227 (5%)
 Frame = +1

Query  694   DGSADLLAKRQTDAFDLQNSIGTGSGNKICSS--QEDGYASSD--LRSSIVLKNAVCpik  861
             D   +LL +RQ DA    NS+   +G K   S  +E  YASS   + ++   KN V  IK
Sbjct  88    DLDTNLLTRRQDDALCTVNSLEQSAGEKDSGSCQEESSYASSTVLIGNNFGGKNGVRLIK  147

Query  862   lpklekippYTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALi-csdsdeeiieeege  1038
             LP++ K+PPYTTW FL RNQ M EDQSV+GRRRIYYD N GEALI     D+ + +EE +
Sbjct  148   LPEVPKLPPYTTWIFLDRNQIMTEDQSVVGRRRIYYDQNCGEALICSDSEDDFVEDEEEK  207

Query  1039  nefaesedYILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLIKEGATSK-NENTE  1215
              EF   ED+I+RMTIE+VGL D+ LD L+    +   E++AR+++ +K+ +  +  +N E
Sbjct  208   KEFGTHEDFIIRMTIERVGLSDVALDTLSQSLEKNSVEIRARFENFLKQDSNEECVKNVE  267

Query  1216  VTIN-----SYLDEDLDAALSSFDNLFCQRCFVFNCQLHGCSQDLII  1341
             V  N     ++L++DL+AAL SFDNLFC+RC VF+C+LHGCSQDL+ 
Sbjct  268   VEPNVRVDDAFLEKDLEAALDSFDNLFCRRCLVFDCRLHGCSQDLVF  314


 Score = 66.6 bits (161),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSKK  2167
             +I+V GDHR+GIFA + ++AG+EL YDY+Y+PD  PAWA+  +SS  K
Sbjct  861   VIMVAGDHRVGIFAKERISAGEELFYDYRYEPDRAPAWARKPESSVSK  908



>ref|XP_009386334.1| PREDICTED: histone-lysine N-methyltransferase EZ1 isoform X3 
[Musa acuminata subsp. malaccensis]
Length=913

 Score =   280 bits (716),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 134/234 (57%), Positives = 168/234 (72%), Gaps = 22/234 (9%)
 Frame = +1

Query  1339  ILKQIRVR-EELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKN  1515
             I K+I  R ++ C  Y PC C   CGK+C C++    CEK+CGCP  CK  F+GCHC K+
Sbjct  649   IRKRITERKDQPCRQYNPCGCQSACGKQCRCLLNGTCCEKYCGCPKICKNRFRGCHCAKS  708

Query  1516  ECATNYCPCYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLL  1695
             +C +  CPC+A+ RECDPDVC  CWV CGDG++G P  +  N++C+NMKLLL  +Q+VLL
Sbjct  709   QCRSRQCPCFAADRECDPDVCRNCWVGCGDGTLGGPNQRGDNYECRNMKLLLKQRQRVLL  768

Query  1696  GRSDIAGWGAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQL  1875
             GRSD++GWGAFLKN    V K+E++G YTGELISH EADK GK+YDR+N SFLFNLNDQ 
Sbjct  769   GRSDVSGWGAFLKN---SVGKHEYLGEYTGELISHREADKRGKIYDRENSSFLFNLNDQF  825

Query  1876  VIDAYRRGNKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
             V+DAYR+G+KLKF NHSPDPNC+AKV             ++VAG     DHR G
Sbjct  826   VLDAYRKGDKLKFANHSPDPNCYAKV-------------IMVAG-----DHRVG  861


 Score =   160 bits (404),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 110/227 (48%), Positives = 151/227 (67%), Gaps = 11/227 (5%)
 Frame = +1

Query  694   DGSADLLAKRQTDAFDLQNSIGTGSGNKICSS--QEDGYASSD--LRSSIVLKNAVCpik  861
             D   +LL +RQ DA    NS+   +G K   S  +E  YASS   + ++   KN V  IK
Sbjct  78    DLDTNLLTRRQDDALCTVNSLEQSAGEKDSGSCQEESSYASSTVLIGNNFGGKNGVRLIK  137

Query  862   lpklekippYTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALi-csdsdeeiieeege  1038
             LP++ K+PPYTTW FL RNQ M EDQSV+GRRRIYYD N GEALI     D+ + +EE +
Sbjct  138   LPEVPKLPPYTTWIFLDRNQIMTEDQSVVGRRRIYYDQNCGEALICSDSEDDFVEDEEEK  197

Query  1039  nefaesedYILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLIKEGATSK-NENTE  1215
              EF   ED+I+RMTIE+VGL D+ LD L+    +   E++AR+++ +K+ +  +  +N E
Sbjct  198   KEFGTHEDFIIRMTIERVGLSDVALDTLSQSLEKNSVEIRARFENFLKQDSNEECVKNVE  257

Query  1216  VTIN-----SYLDEDLDAALSSFDNLFCQRCFVFNCQLHGCSQDLII  1341
             V  N     ++L++DL+AAL SFDNLFC+RC VF+C+LHGCSQDL+ 
Sbjct  258   VEPNVRVDDAFLEKDLEAALDSFDNLFCRRCLVFDCRLHGCSQDLVF  304


 Score = 66.6 bits (161),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSKK  2167
             +I+V GDHR+GIFA + ++AG+EL YDY+Y+PD  PAWA+  +SS  K
Sbjct  851   VIMVAGDHRVGIFAKERISAGEELFYDYRYEPDRAPAWARKPESSVSK  898



>ref|XP_009386333.1| PREDICTED: histone-lysine N-methyltransferase EZ1 isoform X2 
[Musa acuminata subsp. malaccensis]
Length=918

 Score =   280 bits (716),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 134/234 (57%), Positives = 168/234 (72%), Gaps = 22/234 (9%)
 Frame = +1

Query  1339  ILKQIRVR-EELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKN  1515
             I K+I  R ++ C  Y PC C   CGK+C C++    CEK+CGCP  CK  F+GCHC K+
Sbjct  654   IRKRITERKDQPCRQYNPCGCQSACGKQCRCLLNGTCCEKYCGCPKICKNRFRGCHCAKS  713

Query  1516  ECATNYCPCYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLL  1695
             +C +  CPC+A+ RECDPDVC  CWV CGDG++G P  +  N++C+NMKLLL  +Q+VLL
Sbjct  714   QCRSRQCPCFAADRECDPDVCRNCWVGCGDGTLGGPNQRGDNYECRNMKLLLKQRQRVLL  773

Query  1696  GRSDIAGWGAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQL  1875
             GRSD++GWGAFLKN    V K+E++G YTGELISH EADK GK+YDR+N SFLFNLNDQ 
Sbjct  774   GRSDVSGWGAFLKN---SVGKHEYLGEYTGELISHREADKRGKIYDRENSSFLFNLNDQF  830

Query  1876  VIDAYRRGNKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
             V+DAYR+G+KLKF NHSPDPNC+AKV             ++VAG     DHR G
Sbjct  831   VLDAYRKGDKLKFANHSPDPNCYAKV-------------IMVAG-----DHRVG  866


 Score =   159 bits (403),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 110/227 (48%), Positives = 151/227 (67%), Gaps = 11/227 (5%)
 Frame = +1

Query  694   DGSADLLAKRQTDAFDLQNSIGTGSGNKICSS--QEDGYASSD--LRSSIVLKNAVCpik  861
             D   +LL +RQ DA    NS+   +G K   S  +E  YASS   + ++   KN V  IK
Sbjct  88    DLDTNLLTRRQDDALCTVNSLEQSAGEKDSGSCQEESSYASSTVLIGNNFGGKNGVRLIK  147

Query  862   lpklekippYTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALi-csdsdeeiieeege  1038
             LP++ K+PPYTTW FL RNQ M EDQSV+GRRRIYYD N GEALI     D+ + +EE +
Sbjct  148   LPEVPKLPPYTTWIFLDRNQIMTEDQSVVGRRRIYYDQNCGEALICSDSEDDFVEDEEEK  207

Query  1039  nefaesedYILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLIKEGATSK-NENTE  1215
              EF   ED+I+RMTIE+VGL D+ LD L+    +   E++AR+++ +K+ +  +  +N E
Sbjct  208   KEFGTHEDFIIRMTIERVGLSDVALDTLSQSLEKNSVEIRARFENFLKQDSNEECVKNVE  267

Query  1216  VTIN-----SYLDEDLDAALSSFDNLFCQRCFVFNCQLHGCSQDLII  1341
             V  N     ++L++DL+AAL SFDNLFC+RC VF+C+LHGCSQDL+ 
Sbjct  268   VEPNVRVDDAFLEKDLEAALDSFDNLFCRRCLVFDCRLHGCSQDLVF  314


 Score = 66.6 bits (161),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSKK  2167
             +I+V GDHR+GIFA + ++AG+EL YDY+Y+PD  PAWA+  +SS  K
Sbjct  856   VIMVAGDHRVGIFAKERISAGEELFYDYRYEPDRAPAWARKPESSVSK  903



>ref|XP_009140462.1| PREDICTED: histone-lysine N-methyltransferase CLF [Brassica rapa]
Length=909

 Score =   280 bits (715),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 128/226 (57%), Positives = 167/226 (74%), Gaps = 5/226 (2%)
 Frame = +1

Query  1360  REELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKNECATNYCP  1539
             +++ C  + PCNC   CGK+C C++    CEK+CGCP +CK  F+GCHC K++C +  CP
Sbjct  652   KDQPCRQFNPCNCKTACGKECTCLLNGTCCEKYCGCPKSCKNRFRGCHCAKSQCRSRQCP  711

Query  1540  CYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLLGRSDIAGW  1719
             C+A+ RECDPDVC  CWV  GDG++G+P  +  N++C+NMKLLL  QQ+VLLG SD++GW
Sbjct  712   CFAADRECDPDVCRNCWVIGGDGTLGVPSQRGDNYECRNMKLLLKQQQRVLLGISDVSGW  771

Query  1720  GAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQLVIDAYRRG  1899
             GAFLKN    VSK+E++G YTGELISH EADK GK+YDR+N SFLFNLNDQ V+DAYR+G
Sbjct  772   GAFLKN---SVSKHEYLGEYTGELISHKEADKRGKIYDRENSSFLFNLNDQFVLDAYRKG  828

Query  1900  NKLKFINHSPDPNCFAKVNCSLSPCLLQCF--QLIVAGGSFSIDHR  2031
             +KLKF NHSP+PNC+AKV        +  F  + I+AG     D+R
Sbjct  829   DKLKFANHSPEPNCYAKVIMVAGDHRVGIFAKERILAGEELFYDYR  874


 Score =   169 bits (428),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 114/227 (50%), Positives = 155/227 (68%), Gaps = 9/227 (4%)
 Frame = +1

Query  682   GLVGDGSADLLAKRQTDAFDLQNSIGTGSGNKI---CSSQEDGYASSDLR---SSIVLKN  843
             G   DGS DLL KRQ D+  +++ +     +K     S  EDG ASS      SS+ +K 
Sbjct  82    GSYKDGS-DLLVKRQRDSPGMKSGVNASDADKSNNHSSFLEDGNASSTTMVQGSSVPVKI  140

Query  844   AVCpiklpklekippYTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALi-csdsdeei  1020
             ++ PIK+P ++++ PYTTW FL RNQ+M EDQSV+GRRRIYYD   GEALI     +E I
Sbjct  141   SLRPIKMPDVKRLSPYTTWVFLDRNQRMTEDQSVVGRRRIYYDQTGGEALICSDSEEEAI  200

Query  1021  ieeegenefaesedYILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLIKEGATSK  1200
              EE+ +  F E ED+I+RMT++++GL D VL+ LAN  SR  SE+KARY+ L+KE   S+
Sbjct  201   DEEDEKRAFLEPEDFIIRMTLDQLGLSDSVLEELANFLSRSSSEIKARYEVLMKEKEVSE  260

Query  1201  NENTEVTINSYLDEDLDAALSSFDNLFCQRCFVFNCQLHGCSQDLII  1341
             + + +   +S L++D+D AL SFDNLFC+RC VF+C+LHGCSQDLI 
Sbjct  261   SGDNQAE-SSLLNKDMDGALDSFDNLFCRRCLVFDCRLHGCSQDLIF  306


 Score = 64.3 bits (155),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSKK  2167
             +I+V GDHR+GIFA + + AG+EL YDY+Y+PD  PAWA+  ++S  K
Sbjct  846   VIMVAGDHRVGIFAKERILAGEELFYDYRYEPDRAPAWARKPEASGSK  893



>gb|KFK32747.1| histone-lysine n-methyltransferase clf [Arabis alpina]
Length=906

 Score =   279 bits (713),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 128/226 (57%), Positives = 167/226 (74%), Gaps = 5/226 (2%)
 Frame = +1

Query  1360  REELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKNECATNYCP  1539
             +++ C  + PCNC   CGK+C C++    CEK+CGCP +CK  F+GCHC K++C +  CP
Sbjct  649   KDQPCRQFNPCNCKTACGKECTCLLNGTCCEKYCGCPKSCKNRFRGCHCAKSQCRSRQCP  708

Query  1540  CYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLLGRSDIAGW  1719
             C+A+ RECDPDVC  CWV  GDG++G+P  +  N++C+NMKLLL  QQ+VLLG SD++GW
Sbjct  709   CFAADRECDPDVCRNCWVIGGDGTLGVPNQRGDNYECRNMKLLLKQQQRVLLGTSDVSGW  768

Query  1720  GAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQLVIDAYRRG  1899
             GAFLKN    VSK+E++G YTGELISH EADK GK+YDR+N SFLFNLNDQ V+DAYR+G
Sbjct  769   GAFLKN---SVSKHEYLGEYTGELISHKEADKRGKIYDRENSSFLFNLNDQFVLDAYRKG  825

Query  1900  NKLKFINHSPDPNCFAKVNCSLSPCLLQCF--QLIVAGGSFSIDHR  2031
             +KLKF NHSP+PNC+AKV        +  F  + I+AG     D+R
Sbjct  826   DKLKFANHSPEPNCYAKVIMVAGDHRVGIFAKERIMAGEELFYDYR  871


 Score =   167 bits (422),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 112/220 (51%), Positives = 155/220 (70%), Gaps = 6/220 (3%)
 Frame = +1

Query  694   DGSADLLAKRQTDAFDLQNSI-GTGSGNKICSSQEDGYASSDLR--SSIVLKNAVCpikl  864
             DGS DLL KRQ D+  +++ I G  +     S  EDGY +S +   SS+ +K ++ PIK+
Sbjct  82    DGS-DLLVKRQRDSPGMKSGIDGNDADRNNHSFLEDGYVNSAMAQGSSVPVKISLRPIKI  140

Query  865   pklekippYTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALi-csdsdeeiieeegen  1041
             P ++++ PYTTW FL RNQ+M EDQSV+GRRRIYYD   GEALI     +E I EE+ + 
Sbjct  141   PDIKRLSPYTTWVFLDRNQRMTEDQSVVGRRRIYYDQTGGEALICSDSEEEVIDEEDEKR  200

Query  1042  efaesedYILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLIKEGATSKNENTEVT  1221
              F E ED+I+RMT+E++GL D VL+ LAN  SR  SE+KAR++ L+KE   S++ + +  
Sbjct  201   HFVEPEDFIIRMTLEQLGLSDSVLEELANFLSRNSSEIKARHEVLMKEKKVSQSGDNQAE  260

Query  1222  INSYLDEDLDAALSSFDNLFCQRCFVFNCQLHGCSQDLII  1341
              +S L++D++ AL SFDNLFC+RC VF+C+LHGCSQDLI 
Sbjct  261   -SSLLNKDMEGALDSFDNLFCRRCLVFDCRLHGCSQDLIF  299


 Score = 64.7 bits (156),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSKK  2167
             +I+V GDHR+GIFA + + AG+EL YDY+Y+PD  PAWA+  ++S  K
Sbjct  843   VIMVAGDHRVGIFAKERIMAGEELFYDYRYEPDRAPAWARKPEASGSK  890



>ref|XP_001768188.1| polycomb group protein [Physcomitrella patens]
 gb|EDQ67061.1| polycomb group protein [Physcomitrella patens]
Length=892

 Score =   255 bits (651),  Expect(2) = 8e-77, Method: Compositional matrix adjust.
 Identities = 123/223 (55%), Positives = 155/223 (70%), Gaps = 14/223 (6%)
 Frame = +1

Query  1294  FVFNCQLHGCSQDLIILKQIRVREELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPL  1473
             + F   +H     LI  +    +++ C  YTPCNC   CGK+CPC++    CEK+CGC  
Sbjct  619   YTFKSVVH----PLIRKRLANGKDQTCRQYTPCNCLYTCGKQCPCLLNGTCCEKYCGCSK  674

Query  1474  NCKI*FQGCHCTKNECATNYCPCYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQ  1653
             +CK  F+GCHC K+ C +  CPC+A+GRECDPDVC  CWV CG+  +         + C 
Sbjct  675   SCKNRFRGCHCAKSNCCSRQCPCFAAGRECDPDVCRNCWVGCGEKHV----KPAVEYTCH  730

Query  1654  NMKLLLGHQQKVLLGRSDIAGWGAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYD  1833
             NMKL+L  QQ+VLLGRSD+AGWGAFLK     V+K+E++G YTGELISH EADK GK+YD
Sbjct  731   NMKLMLKQQQRVLLGRSDVAGWGAFLKK---TVAKHEYLGEYTGELISHREADKRGKIYD  787

Query  1834  RQNCSFLFNLNDQ---LVIDAYRRGNKLKFINHSPDPNCFAKV  1953
             R+N SFLFNLNDQ    V+DA R+G+KLKF NHSP PNC+AKV
Sbjct  788   RENSSFLFNLNDQASLYVLDACRKGDKLKFANHSPTPNCYAKV  830


 Score = 62.4 bits (150),  Expect(2) = 8e-77, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAK  2143
             +I+V GDHR+GIFA + + AG+EL YDYQY+PD  P WA+
Sbjct  830   VIMVSGDHRVGIFAKERIGAGEELFYDYQYEPDRAPVWAR  869


 Score =   115 bits (288),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 73/160 (46%), Positives = 106/160 (66%), Gaps = 10/160 (6%)
 Frame = +1

Query  889   YTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALicsdsdeeiieeegenef-----ae  1053
             YTTW +L RNQ+M EDQSV+GRRRIYYD +  E LI SDS+EE   ++ + +      ++
Sbjct  153   YTTWIYLDRNQRMTEDQSVVGRRRIYYDSDGNETLIASDSEEEDPGDDDDKDEPKHDFSK  212

Query  1054  sedYILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLIKEGATS--KNENTEVTIN  1227
              ED ++ M+I+++GL  +VL+ L++    KP E++ARY  L+K+ A +  K EN      
Sbjct  213   GEDTLIWMSIQELGLKSVVLNELSDVLDIKPEEIEARYDILLKDFAKNAVKEENELPDTQ  272

Query  1228  SYLD---EDLDAALSSFDNLFCQRCFVFNCQLHGCSQDLI  1338
                D   +DL AA+ SFD LFC+RC VF+C+LHGCSQ ++
Sbjct  273   EDDDNETKDLLAAMDSFDTLFCRRCLVFDCRLHGCSQAIV  312



>ref|XP_006840446.1| hypothetical protein AMTR_s00045p00168580 [Amborella trichopoda]
 gb|ERN02121.1| hypothetical protein AMTR_s00045p00168580 [Amborella trichopoda]
Length=852

 Score =   278 bits (711),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 131/226 (58%), Positives = 165/226 (73%), Gaps = 21/226 (9%)
 Frame = +1

Query  1360  REELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKNECATNYCP  1539
             +++ C  YTPC C   CGK+CPC+     CEK+CGCP  CK  F+GCHC K++C +  CP
Sbjct  596   KQQSCKQYTPCGCDLICGKECPCMNNGTCCEKYCGCPKICKNRFRGCHCAKSQCRSRQCP  655

Query  1540  CYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLLGRSDIAGW  1719
             C+A+GRECDPDVC  CWVSCGDG++G PP +  N+ C NMKLLL  QQ++LLG+SD+AGW
Sbjct  656   CFAAGRECDPDVCRNCWVSCGDGTLGGPPLRGDNYNCGNMKLLLKQQQRILLGKSDVAGW  715

Query  1720  GAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQLVIDAYRRG  1899
             GAFLKN    V++N+++G YTGELISH EADK GK+YDR N SFLFNLNDQ V+DA+R+G
Sbjct  716   GAFLKN---PVNRNDYLGEYTGELISHREADKRGKIYDRANSSFLFNLNDQFVLDAFRKG  772

Query  1900  NKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
             +KLKF NHS +PNC+AKV             ++VAG     DHR G
Sbjct  773   DKLKFANHSSNPNCYAKV-------------MMVAG-----DHRVG  800


 Score =   112 bits (281),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 75/158 (47%), Positives = 98/158 (62%), Gaps = 7/158 (4%)
 Frame = +1

Query  889   YTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALi-csdsdeeiieeegenefaesedY  1065
             YT+W +L RNQ+M EDQSV+GRRRIYYD    EALI     +E    EE ++EF+E ED 
Sbjct  146   YTSWIYLERNQRMAEDQSVVGRRRIYYDACGSEALICSDSEEEFAEREEEKHEFSEGEDR  205

Query  1066  ILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLIK--EGATSKNENTEVTINS---  1230
             IL   I+  GL D VL+ L+        E+KARY+ L++  E   SK +  +   +S   
Sbjct  206   ILWNAIQGYGLKDEVLNTLSQFIDASSFEIKARYETLVEQYEYKYSKKDGVKDKTDSEWS  265

Query  1231  -YLDEDLDAALSSFDNLFCQRCFVFNCQLHGCSQDLII  1341
              +L+  L A L SFDNLFC+RC VF+C+LHGCS  LI 
Sbjct  266   IHLNRSLSATLDSFDNLFCRRCLVFDCRLHGCSHGLIT  303


 Score = 58.2 bits (139),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/48 (46%), Positives = 35/48 (73%), Gaps = 0/48 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSKK  2167
             +++V GDHR+GI+A + + A +EL YDY+Y+PD  P WA+  + S+ K
Sbjct  790   VMMVAGDHRVGIYAKEHIEASEELFYDYRYEPDRAPIWARRPEGSTSK  837



>emb|CBI36953.3| unnamed protein product [Vitis vinifera]
Length=382

 Score =   265 bits (678),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 130/228 (57%), Positives = 163/228 (71%), Gaps = 6/228 (3%)
 Frame = +1

Query  1360  REELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKNECATNYCP  1539
             + + C  YTPC C   CGK+CPC      CEK+CGC  +CK  F+GCHC K++C +  CP
Sbjct  127   KNQSCKQYTPCGCLSMCGKECPCQSNGTCCEKYCGCSKSCKNRFRGCHCAKSQCRSRQCP  186

Query  1540  CYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLLGRSDIAGW  1719
             C+A+GRECDPDVC  CWVSCGDGS+G PP K  + +C NM+LLL  QQ++LL +SD+AGW
Sbjct  187   CFAAGRECDPDVCRNCWVSCGDGSLGEPP-KRGDGQCGNMRLLLRQQQRILLAKSDVAGW  245

Query  1720  GAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQLVIDAYRRG  1899
             GAFLKN    V+KN+++G YTGELISH EADK GK+YDR N SFLF+LNDQ V+DAYR+G
Sbjct  246   GAFLKN---SVNKNDYLGEYTGELISHREADKRGKIYDRANSSFLFDLNDQYVLDAYRKG  302

Query  1900  NKLKFINHSPDPNCFAKVNCSLSPCLLQCF--QLIVAGGSFSIDHRSG  2037
             +KLKF NHS +PNC+AKV        +  F  + I AG     D+R G
Sbjct  303   DKLKFANHSSNPNCYAKVMLVAGDHRVGIFAKEHIEAGEELFYDYRYG  350


 Score = 62.0 bits (149),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSK  2164
             +++V GDHR+GIFA + + AG+EL YDY+Y PD  PAWA+  ++S +
Sbjct  320   VMLVAGDHRVGIFAKEHIEAGEELFYDYRYGPDQAPAWARKPEASKR  366



>ref|XP_004984614.1| PREDICTED: histone-lysine N-methyltransferase EZ3-like isoform 
X3 [Setaria italica]
Length=727

 Score =   275 bits (703),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 133/234 (57%), Positives = 164/234 (70%), Gaps = 21/234 (9%)
 Frame = +1

Query  1336  IILKQIRVREELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKN  1515
              + K+I   ++    Y PC C   CGK CPCV     CEK+CGC  +CK  F+GCHC K+
Sbjct  464   TVRKRIGDGKQWYTQYNPCGCQQMCGKDCPCVENGTCCEKYCGCSKSCKNKFRGCHCAKS  523

Query  1516  ECATNYCPCYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLL  1695
             +C +  CPC+A+ RECDPDVC  CWVSCGDGS+G PP +   ++C NMKLLL  QQ++LL
Sbjct  524   QCRSRQCPCFAASRECDPDVCRNCWVSCGDGSLGEPPARGDGYQCGNMKLLLKQQQRILL  583

Query  1696  GRSDIAGWGAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQL  1875
             GRSDIAGWGAF+KN    VSKN+++G YTGELISH EADK GK+YDR N SFLF+LNDQ 
Sbjct  584   GRSDIAGWGAFIKN---PVSKNDYLGEYTGELISHKEADKRGKIYDRANSSFLFDLNDQF  640

Query  1876  VIDAYRRGNKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
             V+DAYR+G+KLKF NHS +PNC+AKV             ++VAG     DHR G
Sbjct  641   VLDAYRKGDKLKFANHSSNPNCYAKV-------------MLVAG-----DHRVG  676


 Score = 83.2 bits (204),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 55/140 (39%), Positives = 82/140 (59%), Gaps = 2/140 (1%)
 Frame = +1

Query  925   MPEDQSVIGRRRIYYDMNSGEALi-csdsdeeiieeegenefaesedYILRMTIEKVGLY  1101
             M +DQSV GRRRIYYD    EALI     +E    EE ++ F   ED ++    ++ GL 
Sbjct  1     MADDQSV-GRRRIYYDAAGDEALICSDSDEEIPEPEEEKHFFTGGEDQLIWKATQEHGLN  59

Query  1102  DMVLDLLANHFSRKPSEVKARYKDLIKEGATSKNENTEVTINSYLDEDLDAALSSFDNLF  1281
               V+++L+      PSE++ R + L ++       + ++     L + +DA L SFDNLF
Sbjct  60    REVVNVLSQFIEATPSEIEERSEVLFEKNEKHSGSSDKIQRQLSLGKTMDAILDSFDNLF  119

Query  1282  CQRCFVFNCQLHGCSQDLII  1341
             C+RC VF+C+LHGCSQ+L+ 
Sbjct  120   CRRCLVFDCRLHGCSQNLVF  139


 Score = 58.5 bits (140),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSK  2164
             +++V GDHR+GI+A + + A +EL YDY+Y PD  PAWA+  + S K
Sbjct  666   VMLVAGDHRVGIYAKEHIEASEELFYDYRYGPDQAPAWARRPEGSKK  712



>gb|AEZ06400.1| CLF-like protein [Aquilegia coerulea]
Length=897

 Score =   278 bits (710),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 133/235 (57%), Positives = 168/235 (71%), Gaps = 22/235 (9%)
 Frame = +1

Query  1336  IILKQI-RVREELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTK  1512
              I K+I   +++ C  Y PC C   CGK+C C++    CEK+CGCP +CK  F+GCHC K
Sbjct  632   TIRKRITEKKDQPCRQYNPCGCQSACGKQCSCLINGTCCEKYCGCPKSCKFRFRGCHCAK  691

Query  1513  NECATNYCPCYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVL  1692
             ++C +  CPC+A+ RECDPDVC  C +SCGDG +G P  +  N++C+NMKLLL  QQ+VL
Sbjct  692   SQCRSRQCPCFAANRECDPDVCRNCRISCGDGDLGGPSQEGDNYECRNMKLLLKQQQRVL  751

Query  1693  LGRSDIAGWGAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQ  1872
             LGRSD++GWGAFLKN    V K+E++G YTGELISH EADK GK+YDR+N SFLFNLNDQ
Sbjct  752   LGRSDVSGWGAFLKN---SVGKHEYLGEYTGELISHREADKRGKIYDRENSSFLFNLNDQ  808

Query  1873  LVIDAYRRGNKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
              V+DAYR+G+KLKF NHSP+PNC+AKV             L+VAG     DHR G
Sbjct  809   FVLDAYRKGDKLKFANHSPNPNCYAKV-------------LMVAG-----DHRVG  845


 Score =   170 bits (431),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 118/227 (52%), Positives = 155/227 (68%), Gaps = 16/227 (7%)
 Frame = +1

Query  700   SADLLAKRQTDAFDLQNSIGTGSGNKICSS-QEDGYASSD--LRSSIVLKNAVCpiklpk  870
             S +LL KRQ DA  + N+    +G K  +  +ED YASS   L +S   KN + PIKLP+
Sbjct  66    SENLLTKRQQDAICMFNASELNNGEKENNGCEEDRYASSAVLLGASFGAKNVIPPIKLPQ  125

Query  871   lekippYTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALi-csdsdeeiieeegenef  1047
             + K+PPYTTW FL RNQ+MP+DQS++GRRRIYYD N GEAL+     +E + +EE + EF
Sbjct  126   VNKLPPYTTWIFLDRNQRMPDDQSIVGRRRIYYDQNGGEALLCSDSEEEVVEDEEDKREF  185

Query  1048  aesedYILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLI---------KEGATSK  1200
                EDYILRMTI++VG  D+VL+ LA  FSRKP EVK RY +LI         K+G  + 
Sbjct  186   MSVEDYILRMTIQEVGSSDVVLESLAQCFSRKPCEVKERYDNLIKGEKVSECLKKGDVAA  245

Query  1201  NENTEVTINSYLDEDLDAALSSFDNLFCQRCFVFNCQLHGCSQDLII  1341
             +   E    ++L++DL+AAL SFDNLFC+RC VF+C+LHGCSQDL+ 
Sbjct  246   DPQLE---EAFLNKDLEAALDSFDNLFCRRCLVFDCRLHGCSQDLVF  289


 Score = 59.7 bits (143),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAK  2143
             +++V GDHR+GIFA + + AG+EL YDY+Y+PD  PAWA+
Sbjct  835   VLMVAGDHRVGIFAKERICAGEELFYDYRYEPDHAPAWAR  874



>ref|XP_004984613.1| PREDICTED: histone-lysine N-methyltransferase EZ3-like isoform 
X2 [Setaria italica]
Length=894

 Score =   277 bits (709),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 133/234 (57%), Positives = 164/234 (70%), Gaps = 21/234 (9%)
 Frame = +1

Query  1336  IILKQIRVREELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKN  1515
              + K+I   ++    Y PC C   CGK CPCV     CEK+CGC  +CK  F+GCHC K+
Sbjct  631   TVRKRIGDGKQWYTQYNPCGCQQMCGKDCPCVENGTCCEKYCGCSKSCKNKFRGCHCAKS  690

Query  1516  ECATNYCPCYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLL  1695
             +C +  CPC+A+ RECDPDVC  CWVSCGDGS+G PP +   ++C NMKLLL  QQ++LL
Sbjct  691   QCRSRQCPCFAASRECDPDVCRNCWVSCGDGSLGEPPARGDGYQCGNMKLLLKQQQRILL  750

Query  1696  GRSDIAGWGAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQL  1875
             GRSDIAGWGAF+KN    VSKN+++G YTGELISH EADK GK+YDR N SFLF+LNDQ 
Sbjct  751   GRSDIAGWGAFIKN---PVSKNDYLGEYTGELISHKEADKRGKIYDRANSSFLFDLNDQF  807

Query  1876  VIDAYRRGNKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
             V+DAYR+G+KLKF NHS +PNC+AKV             ++VAG     DHR G
Sbjct  808   VLDAYRKGDKLKFANHSSNPNCYAKV-------------MLVAG-----DHRVG  843


 Score =   103 bits (256),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 63/152 (41%), Positives = 92/152 (61%), Gaps = 2/152 (1%)
 Frame = +1

Query  889   YTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALi-csdsdeeiieeegenefaesedY  1065
             YTTW FL +NQ+M +DQSV GRRRIYYD    EALI     +E    EE ++ F   ED 
Sbjct  159   YTTWIFLDKNQRMADDQSV-GRRRIYYDAAGDEALICSDSDEEIPEPEEEKHFFTGGEDQ  217

Query  1066  ILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLIKEGATSKNENTEVTINSYLDED  1245
             ++    ++ GL   V+++L+      PSE++ R + L ++       + ++     L + 
Sbjct  218   LIWKATQEHGLNREVVNVLSQFIEATPSEIEERSEVLFEKNEKHSGSSDKIQRQLSLGKT  277

Query  1246  LDAALSSFDNLFCQRCFVFNCQLHGCSQDLII  1341
             +DA L SFDNLFC+RC VF+C+LHGCSQ+L+ 
Sbjct  278   MDAILDSFDNLFCRRCLVFDCRLHGCSQNLVF  309


 Score = 58.9 bits (141),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSK  2164
             +++V GDHR+GI+A + + A +EL YDY+Y PD  PAWA+  + S K
Sbjct  833   VMLVAGDHRVGIYAKEHIEASEELFYDYRYGPDQAPAWARRPEGSKK  879



>ref|XP_008454290.1| PREDICTED: histone-lysine N-methyltransferase EZA1 isoform X7 
[Cucumis melo]
Length=747

 Score =   274 bits (701),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 130/226 (58%), Positives = 164/226 (73%), Gaps = 22/226 (10%)
 Frame = +1

Query  1360  REELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKNECATNYCP  1539
             + + C  YTPC C   CGK+CPC+     CEK+CGC  +CK  F+GCHC K++C +  CP
Sbjct  492   KNQSCKQYTPCGCLSSCGKQCPCLHNGTCCEKYCGCSKSCKNRFRGCHCAKSQCRSRQCP  551

Query  1540  CYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLLGRSDIAGW  1719
             C+A+GRECDPDVC  CWVSCGDGS+G PP +  + +C NM+LLL  QQ++LLG+SD+AGW
Sbjct  552   CFAAGRECDPDVCRNCWVSCGDGSLGEPP-RQGDGQCGNMRLLLRQQQRILLGKSDVAGW  610

Query  1720  GAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQLVIDAYRRG  1899
             GAFLKN    V+KN+++G YTGELISH EADK GK+YDR N SFLF+LNDQ V+DAYR+G
Sbjct  611   GAFLKN---SVNKNDYLGEYTGELISHREADKRGKIYDRANSSFLFDLNDQYVLDAYRKG  667

Query  1900  NKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
             +KLKF NHS +PNC+AKV             ++VAG     DHR G
Sbjct  668   DKLKFANHSSNPNCYAKV-------------MLVAG-----DHRVG  695


 Score = 87.4 bits (215),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 62/145 (43%), Positives = 92/145 (63%), Gaps = 8/145 (6%)
 Frame = +1

Query  925   MPEDQSVIGRRRIYYDMNSGEALi-csdsdeeiieeegenefaesedYILRMTIEKVGLY  1101
             M EDQSV+GRRRIYYD +  EALI     +E    E+ ++EF+E ED +L + I++ G+ 
Sbjct  1     MAEDQSVVGRRRIYYDQHGSEALICSDSEEELAEPEDEKHEFSEGEDRVLWIIIQEHGVG  60

Query  1102  DMVLDLLANHFSRKPSEVKARYKDLIKEGATSKNENTEVTINSY------LDEDLDAALS  1263
             + VL +L++      SE++ RY +++KE     + +++V   S       L + L + L 
Sbjct  61    ENVLQILSHSIGCTTSEIQERY-NVLKERNYKTDLSSKVLEESMSKKGISLYKSLSSTLD  119

Query  1264  SFDNLFCQRCFVFNCQLHGCSQDLI  1338
             SFDNLFC+RC VF+C+LHGCSQ LI
Sbjct  120   SFDNLFCRRCMVFDCRLHGCSQSLI  144


 Score = 58.9 bits (141),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSK  2164
             +++V GDHR+GIFA + + A +EL YDY+Y PD  PAWA+  + S +
Sbjct  685   VMLVAGDHRVGIFAKERIEATEELFYDYRYGPDQAPAWARRPEGSKR  731



>ref|XP_010938256.1| PREDICTED: histone-lysine N-methyltransferase EZ3 isoform X1 
[Elaeis guineensis]
Length=916

 Score =   277 bits (709),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 131/235 (56%), Positives = 168/235 (71%), Gaps = 5/235 (2%)
 Frame = +1

Query  1339  ILKQIRVREELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKNE  1518
             I K+I   +  C  +TPC C   CGK+CPC+     CEK+CGC  +CK  F+GCHC K++
Sbjct  655   IRKRIGDGQLACKQFTPCGCQQMCGKQCPCMDNGTCCEKYCGCSKSCKNRFRGCHCAKSQ  714

Query  1519  CATNYCPCYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLLG  1698
             C +  CPC+A+GRECDPDVC  CWVSCGDGS+G PP +   ++C NMKLLL  QQ++LLG
Sbjct  715   CRSRQCPCFAAGRECDPDVCRNCWVSCGDGSLGEPPARGDGYQCGNMKLLLKQQQRILLG  774

Query  1699  RSDIAGWGAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQLV  1878
             RSD+AGWGAF+KN    V+KN+++G YTGELISH EADK GK+YDR N SFLF+LNDQ V
Sbjct  775   RSDVAGWGAFIKN---PVNKNDYLGEYTGELISHKEADKRGKIYDRANSSFLFDLNDQYV  831

Query  1879  IDAYRRGNKLKFINHSPDPNCFAKVNCSLSPCLLQCF--QLIVAGGSFSIDHRSG  2037
             +DAYR+G+KLKF NHS +PNC+AK+        +  F  + + AG     D+R G
Sbjct  832   LDAYRKGDKLKFANHSSNPNCYAKIMLVAGDHRVGIFAKEHVEAGEELFYDYRYG  886


 Score =   119 bits (298),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 76/157 (48%), Positives = 104/157 (66%), Gaps = 6/157 (4%)
 Frame = +1

Query  889   YTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALi-csdsdeeiieeegenefaesedY  1065
             YT W FL +NQ+M +DQSV+GRRRIYYD    EALI     +E    EE ++EF+E ED 
Sbjct  155   YTAWIFLDKNQRMADDQSVVGRRRIYYDPYGSEALICSESDEEIADSEEEKHEFSEGEDQ  214

Query  1066  ILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLI----KEGATSK-NENTEVTINS  1230
             IL   I++ GL+  VL++L        SE+K RY+ L+    K G  S+ ++ TE     
Sbjct  215   ILWKAIQEHGLHQDVLNILVLFIDATHSEIKERYETLMEKHEKHGKNSEVSDKTEPEERL  274

Query  1231  YLDEDLDAALSSFDNLFCQRCFVFNCQLHGCSQDLII  1341
             +L++ L+AAL SFDNLFC+RC +F+C+LHGCSQ+LII
Sbjct  275   FLNKTLNAALDSFDNLFCRRCLIFDCRLHGCSQNLII  311


 Score = 63.5 bits (153),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSK  2164
             I++V GDHR+GIFA + + AG+EL YDY+Y PD  PAWA+ L  S +
Sbjct  856   IMLVAGDHRVGIFAKEHVEAGEELFYDYRYGPDQAPAWARKLDGSKR  902



>ref|XP_008776528.1| PREDICTED: histone-lysine N-methyltransferase EZ1-like [Phoenix 
dactylifera]
Length=919

 Score =   277 bits (709),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 129/226 (57%), Positives = 164/226 (73%), Gaps = 21/226 (9%)
 Frame = +1

Query  1360  REELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKNECATNYCP  1539
             +++ C  Y PC C   CGK+CPC+V    CEK+C CP  CK  F+GCHC K++C +  CP
Sbjct  663   KDQPCRQYNPCGCQSACGKQCPCLVNGTCCEKYCRCPKICKNRFRGCHCAKSQCRSRQCP  722

Query  1540  CYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLLGRSDIAGW  1719
             C+A+ RECDPDVC  CW+ CGDG++G P  +  N++C+NMKLLL  QQ+VLLGRSD++GW
Sbjct  723   CFAADRECDPDVCRNCWIGCGDGTLGGPNQRGDNYECRNMKLLLKQQQRVLLGRSDVSGW  782

Query  1720  GAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQLVIDAYRRG  1899
             GAFLKN    V K+E++G YTGELISH EADK GK+YDR+N SFLFNLNDQ V+DA+R+G
Sbjct  783   GAFLKN---SVGKHEYLGEYTGELISHREADKRGKIYDRENSSFLFNLNDQFVLDAHRKG  839

Query  1900  NKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
             +KLKF NHSP+PNC+AKV             ++VAG     DHR G
Sbjct  840   DKLKFANHSPNPNCYAKV-------------IMVAG-----DHRVG  867


 Score =   164 bits (416),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 125/250 (50%), Positives = 156/250 (62%), Gaps = 13/250 (5%)
 Frame = +1

Query  694   DGSADLLAKRQTDAFDLQNSIGTGSGNKICSS--QEDGYASSD--LRSSIVLKNAVCpik  861
             D   +LL KRQ DA    NS+    G K  SS  +E  YASS   L S+   KNAV PIK
Sbjct  88    DVDVNLLTKRQDDALCTLNSLELSGGEKDSSSCQEESSYASSTVILGSNFGGKNAVRPIK  147

Query  862   lpklekippYTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALi-csdsdeeiieeege  1038
             LP++ K+PPYTTW FL RNQ+M EDQSV+GRRRIYYD   GEALI     D+ + +EE +
Sbjct  148   LPEVPKLPPYTTWIFLDRNQRMTEDQSVVGRRRIYYDRGCGEALICSDSEDDVVEDEEEK  207

Query  1039  nefaesedYILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLIKEGATSK-----N  1203
              EF  +EDYI+RM I+KVGL D VLD LA    RK  E++ARY+ +IK   T +      
Sbjct  208   KEFGSTEDYIIRMVIQKVGLSDAVLDSLAQCLERKTDEIRARYESIIKIEKTEECVKKGE  267

Query  1204  ENTEVTINSYLDE-DLDAALSSFDNLFCQRCFVFNCQLHGCSQDLIILKQIRVREELCAH  1380
             +  ++ I   L E DLDAAL SFDNLFC+RC VF+C+ HGCSQDL+   + ++       
Sbjct  268   DGVDIKIADALSEKDLDAALDSFDNLFCRRCLVFDCRRHGCSQDLLFPSEKQLPWSNSDD  327

Query  1381  YTPCNC*PHC  1410
              TPC    HC
Sbjct  328   DTPCGT--HC  335


 Score = 61.6 bits (148),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSKK  2167
             +I+V GDHR+GIFA + ++AG+EL YDY+Y+ D  PAWA+  ++S  +
Sbjct  857   VIMVAGDHRVGIFAKERISAGEELFYDYRYEADRAPAWARKPEASGSR  904



>ref|XP_004984612.1| PREDICTED: histone-lysine N-methyltransferase EZ3-like isoform 
X1 [Setaria italica]
Length=897

 Score =   277 bits (708),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 133/234 (57%), Positives = 164/234 (70%), Gaps = 21/234 (9%)
 Frame = +1

Query  1336  IILKQIRVREELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKN  1515
              + K+I   ++    Y PC C   CGK CPCV     CEK+CGC  +CK  F+GCHC K+
Sbjct  634   TVRKRIGDGKQWYTQYNPCGCQQMCGKDCPCVENGTCCEKYCGCSKSCKNKFRGCHCAKS  693

Query  1516  ECATNYCPCYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLL  1695
             +C +  CPC+A+ RECDPDVC  CWVSCGDGS+G PP +   ++C NMKLLL  QQ++LL
Sbjct  694   QCRSRQCPCFAASRECDPDVCRNCWVSCGDGSLGEPPARGDGYQCGNMKLLLKQQQRILL  753

Query  1696  GRSDIAGWGAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQL  1875
             GRSDIAGWGAF+KN    VSKN+++G YTGELISH EADK GK+YDR N SFLF+LNDQ 
Sbjct  754   GRSDIAGWGAFIKN---PVSKNDYLGEYTGELISHKEADKRGKIYDRANSSFLFDLNDQF  810

Query  1876  VIDAYRRGNKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
             V+DAYR+G+KLKF NHS +PNC+AKV             ++VAG     DHR G
Sbjct  811   VLDAYRKGDKLKFANHSSNPNCYAKV-------------MLVAG-----DHRVG  846


 Score =   103 bits (256),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 63/152 (41%), Positives = 92/152 (61%), Gaps = 2/152 (1%)
 Frame = +1

Query  889   YTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALi-csdsdeeiieeegenefaesedY  1065
             YTTW FL +NQ+M +DQSV GRRRIYYD    EALI     +E    EE ++ F   ED 
Sbjct  159   YTTWIFLDKNQRMADDQSV-GRRRIYYDAAGDEALICSDSDEEIPEPEEEKHFFTGGEDQ  217

Query  1066  ILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLIKEGATSKNENTEVTINSYLDED  1245
             ++    ++ GL   V+++L+      PSE++ R + L ++       + ++     L + 
Sbjct  218   LIWKATQEHGLNREVVNVLSQFIEATPSEIEERSEVLFEKNEKHSGSSDKIQRQLSLGKT  277

Query  1246  LDAALSSFDNLFCQRCFVFNCQLHGCSQDLII  1341
             +DA L SFDNLFC+RC VF+C+LHGCSQ+L+ 
Sbjct  278   MDAILDSFDNLFCRRCLVFDCRLHGCSQNLVF  309


 Score = 58.9 bits (141),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSK  2164
             +++V GDHR+GI+A + + A +EL YDY+Y PD  PAWA+  + S K
Sbjct  836   VMLVAGDHRVGIYAKEHIEASEELFYDYRYGPDQAPAWARRPEGSKK  882



>ref|XP_008813375.1| PREDICTED: histone-lysine N-methyltransferase EZ3 [Phoenix dactylifera]
Length=918

 Score =   277 bits (708),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 132/235 (56%), Positives = 168/235 (71%), Gaps = 5/235 (2%)
 Frame = +1

Query  1339  ILKQIRVREELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKNE  1518
             I K+I   +  C  YTPC+C   CGK+CPC+     CEK+CGC  +CK  F+GCHC K++
Sbjct  657   IRKRIGDGQLACKQYTPCSCQQMCGKQCPCMDNGTCCEKYCGCSKSCKNRFRGCHCAKSQ  716

Query  1519  CATNYCPCYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLLG  1698
             C +  CPC+A+GRECDPDVC  CWVSCGDGS+G P  +   ++C NMKLLL  QQ++LLG
Sbjct  717   CRSRQCPCFAAGRECDPDVCRNCWVSCGDGSLGEPATRGDGYQCGNMKLLLKQQQRILLG  776

Query  1699  RSDIAGWGAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQLV  1878
             RSD+AGWGAF+KN    V+KN+++G YTGELISH EADK GK+YDR N SFLF+LNDQ V
Sbjct  777   RSDVAGWGAFIKN---PVNKNDYLGEYTGELISHKEADKRGKIYDRANSSFLFDLNDQYV  833

Query  1879  IDAYRRGNKLKFINHSPDPNCFAKVNCSLSPCLLQCF--QLIVAGGSFSIDHRSG  2037
             +DAYR+G+KLKF NHS +PNC+AK+        +  F  + I AG     D+R G
Sbjct  834   LDAYRKGDKLKFANHSSNPNCYAKIMLVAGDHRVGIFAKEHIEAGEELFYDYRYG  888


 Score =   119 bits (297),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 103/157 (66%), Gaps = 6/157 (4%)
 Frame = +1

Query  889   YTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALi-csdsdeeiieeegenefaesedY  1065
             YT W FL +NQ+M EDQSV+GRRRIYYD    EALI     +E    EE ++EF+E ED 
Sbjct  155   YTAWIFLDKNQRMAEDQSVVGRRRIYYDPYGNEALICSDSDEEIADLEEEKHEFSEGEDQ  214

Query  1066  ILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLIK-----EGATSKNENTEVTINS  1230
             IL   I++ GL+  VL++L        SE++ RY+ L++     E  +  ++ TE     
Sbjct  215   ILWKAIQEHGLHQDVLNILVLFIDATHSEIEERYETLVEKHEKHEKNSEVSDKTEPEERL  274

Query  1231  YLDEDLDAALSSFDNLFCQRCFVFNCQLHGCSQDLII  1341
             +L++ L+AAL SFDNLFC+RC +F+C+LHGCSQ+LII
Sbjct  275   FLNKTLNAALDSFDNLFCRRCLIFDCRLHGCSQNLII  311


 Score = 63.5 bits (153),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 26/47 (55%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSK  2164
             I++V GDHR+GIFA + + AG+EL YDY+Y PD  PAWA+ L  S +
Sbjct  858   IMLVAGDHRVGIFAKEHIEAGEELFYDYRYGPDQAPAWARKLDGSKR  904



>gb|KDO86989.1| hypothetical protein CISIN_1g002895mg [Citrus sinensis]
Length=824

 Score =   275 bits (704),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 132/226 (58%), Positives = 163/226 (72%), Gaps = 22/226 (10%)
 Frame = +1

Query  1360  REELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKNECATNYCP  1539
             + + C  YTPC C   CGK+CPC+     CEK+CGC  +CK  F+GCHC K++C +  CP
Sbjct  569   KNQSCKQYTPCGCQSMCGKQCPCLHNGTCCEKYCGCSKSCKNRFRGCHCAKSQCRSRQCP  628

Query  1540  CYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLLGRSDIAGW  1719
             C+A+GRECDPDVC  CWVSCGDGS+G PP K  + +C NM+LLL  QQ++LL +SD+AGW
Sbjct  629   CFAAGRECDPDVCRNCWVSCGDGSLGEPP-KRGDGQCGNMRLLLRQQQRILLAKSDVAGW  687

Query  1720  GAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQLVIDAYRRG  1899
             GAFLKN    VSKN+++G YTGELISH EADK GK+YDR N SFLF+LNDQ V+DAYR+G
Sbjct  688   GAFLKN---SVSKNDYLGEYTGELISHREADKRGKIYDRANSSFLFDLNDQYVLDAYRKG  744

Query  1900  NKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
             +KLKF NHS +PNCFAKV             ++VAG     DHR G
Sbjct  745   DKLKFANHSSNPNCFAKV-------------MLVAG-----DHRVG  772


 Score = 88.2 bits (217),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 64/146 (44%), Positives = 86/146 (59%), Gaps = 6/146 (4%)
 Frame = +1

Query  889   YTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALi-csdsdeeiieeegenefaesedY  1065
             YTTW FL +NQ+M EDQSV+GRRRIYYD +  EAL+     ++ I  EE ++EF++ ED 
Sbjct  124   YTTWIFLDKNQRMAEDQSVVGRRRIYYDQHGSEALVCSDSEEDIIEPEEEKHEFSDGEDR  183

Query  1066  ILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLIKEGATSKN----ENTEVTINSY  1233
             IL    E+ GL + V++ ++       SEV+ RY  L KE    KN    E+        
Sbjct  184   ILWTVFEEHGLGEEVINAVSQFIGIATSEVQDRYSTL-KEKYDGKNLKEFEDAGHERGIA  242

Query  1234  LDEDLDAALSSFDNLFCQRCFVFNCQ  1311
             L++ L AAL SFDNLFC+RC     Q
Sbjct  243   LEKSLSAALDSFDNLFCRRCLSRAVQ  268


 Score = 60.1 bits (144),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = +2

Query  2015  FR*IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSKK  2167
             F  +++V GDHR+GIFA + + A +EL YDY+Y PD  PAWA+  + S ++
Sbjct  759   FAKVMLVAGDHRVGIFAKEHIEASEELFYDYRYGPDQAPAWARKPEGSKRE  809



>gb|KHG06300.1| Histone-lysine N-methyltransferase CLF [Gossypium arboreum]
Length=951

 Score =   277 bits (709),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 137/247 (55%), Positives = 173/247 (70%), Gaps = 35/247 (14%)
 Frame = +1

Query  1339  ILKQIRVR-EELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKN  1515
             I K+I  R ++ C  Y PC+C   CGK+C C++    CEK+CGCP +CK  F+GCHC K+
Sbjct  674   IRKRITERKDQPCRQYNPCSCQTACGKQCSCLLNGTCCEKYCGCPKSCKNRFRGCHCAKS  733

Query  1516  ECATNYCPCYASGRECDPDVCCFCWVSCGD--GSIGIPPDKVSNHKCQNMKLLLGHQQKV  1689
             +C +  CPC+A+ RECDPDVC  CWVSCGD  GS+G+PP +  N++C+NMKLLL  QQ+V
Sbjct  734   QCRSRQCPCFAADRECDPDVCRNCWVSCGDGTGSLGVPPQRGDNYECRNMKLLLKQQQRV  793

Query  1690  LLGRSDIAGWGAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLND  1869
             LLGRSD++GWGAFLKN    V K+E++G YTGELISH EADK GK+YDR+N SFLFNLND
Sbjct  794   LLGRSDVSGWGAFLKN---NVGKHEYLGEYTGELISHREADKRGKIYDRENSSFLFNLND  850

Query  1870  Q-----------LVIDAYRRGNKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSF  2016
             Q            V+DAYR+G+KLKF NHSP+PNC+AKV             ++VAG   
Sbjct  851   QACPFIILFLEDFVLDAYRKGDKLKFANHSPEPNCYAKV-------------IMVAG---  894

Query  2017  SIDHRSG  2037
               DHR G
Sbjct  895   --DHRVG  899


 Score =   186 bits (472),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 125/240 (52%), Positives = 161/240 (67%), Gaps = 24/240 (10%)
 Frame = +1

Query  694   DGSADLLAKRQTDAFDLQNSIGTGSGNKICSSQEDGYASSDLRSSIVLKNAVCpiklpkl  873
             D ++DLL KRQ DA  +QN I   +G+K   S ++   +  + SSI +KNAV PIKL ++
Sbjct  88    DSASDLLTKRQKDALGMQNGIDASNGDKDGYSYQEPSTAVLMGSSIPVKNAVRPIKLTEV  147

Query  874   ekippYTTWAFL--------------------HRNQKMPEDQSVIGRRRIYYDMNSGEAL  993
             +K+PPYTTW FL                     RNQ+M EDQSV+GRRRIYYD N GEAL
Sbjct  148   KKLPPYTTWIFLDRTSVRKKCNGKAYFPPKGRRRNQRMTEDQSVVGRRRIYYDQNGGEAL  207

Query  994   i-csdsdeeiieeegenefaesedYILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYK  1170
             I     +E I E+E + +F ESED+ILRMTI++VGL D VL+ LA   SR P++VKARY+
Sbjct  208   ICSDSEEELIEEDEEKKDFVESEDFILRMTIKEVGLSDPVLESLAQCLSRSPADVKARYE  267

Query  1171  DLIKE---GATSKNENTEVTINSYLDEDLDAALSSFDNLFCQRCFVFNCQLHGCSQDLII  1341
              L+KE   GA+   +  E   NS+LD+DL+AAL SFDNLFC+RC VF+C+LHGCSQDLI 
Sbjct  268   TLMKEEDTGASKNRDTEEQNWNSFLDKDLEAALDSFDNLFCRRCLVFDCRLHGCSQDLIF  327


 Score = 67.8 bits (164),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSKK  2167
             +I+V GDHR+GIFA + +NAG+EL YDY+Y+PD  PAWA+  ++S  K
Sbjct  889   VIMVAGDHRVGIFAKERINAGEELFYDYRYEPDRAPAWARKPEASGSK  936



>ref|XP_008454287.1| PREDICTED: histone-lysine N-methyltransferase EZA1 isoform X4 
[Cucumis melo]
Length=841

 Score =   276 bits (705),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 130/226 (58%), Positives = 164/226 (73%), Gaps = 22/226 (10%)
 Frame = +1

Query  1360  REELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKNECATNYCP  1539
             + + C  YTPC C   CGK+CPC+     CEK+CGC  +CK  F+GCHC K++C +  CP
Sbjct  586   KNQSCKQYTPCGCLSSCGKQCPCLHNGTCCEKYCGCSKSCKNRFRGCHCAKSQCRSRQCP  645

Query  1540  CYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLLGRSDIAGW  1719
             C+A+GRECDPDVC  CWVSCGDGS+G PP +  + +C NM+LLL  QQ++LLG+SD+AGW
Sbjct  646   CFAAGRECDPDVCRNCWVSCGDGSLGEPP-RQGDGQCGNMRLLLRQQQRILLGKSDVAGW  704

Query  1720  GAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQLVIDAYRRG  1899
             GAFLKN    V+KN+++G YTGELISH EADK GK+YDR N SFLF+LNDQ V+DAYR+G
Sbjct  705   GAFLKN---SVNKNDYLGEYTGELISHREADKRGKIYDRANSSFLFDLNDQYVLDAYRKG  761

Query  1900  NKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
             +KLKF NHS +PNC+AKV             ++VAG     DHR G
Sbjct  762   DKLKFANHSSNPNCYAKV-------------MLVAG-----DHRVG  789


 Score = 64.7 bits (156),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 53/151 (35%), Positives = 74/151 (49%), Gaps = 47/151 (31%)
 Frame = +1

Query  889   YTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALi-csdsdeeiieeegenefaesedY  1065
             YTTW FL RNQ+M EDQSV+GRRRIYYD +  EALI     +E    E+ ++EF+E ED 
Sbjct  134   YTTWIFLDRNQRMAEDQSVVGRRRIYYDQHGSEALICSDSEEELAEPEDEKHEFSEGEDR  193

Query  1066  ILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLIKEGATSKNENTEVTINSYLDED  1245
             +L + I++ G+ + VL +L++      SE++                             
Sbjct  194   VLWIIIQEHGVGENVLQILSHSIGCTTSEIQ-----------------------------  224

Query  1246  LDAALSSFDNLFCQRCFVFNCQLHGCSQDLI  1338
                              VF+C+LHGCSQ LI
Sbjct  225   -----------------VFDCRLHGCSQSLI  238


 Score = 59.3 bits (142),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSK  2164
             +++V GDHR+GIFA + + A +EL YDY+Y PD  PAWA+  + S +
Sbjct  779   VMLVAGDHRVGIFAKERIEATEELFYDYRYGPDQAPAWARRPEGSKR  825



>gb|KHG06299.1| Histone-lysine N-methyltransferase CLF [Gossypium arboreum]
Length=956

 Score =   277 bits (709),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 137/247 (55%), Positives = 173/247 (70%), Gaps = 35/247 (14%)
 Frame = +1

Query  1339  ILKQIRVR-EELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKN  1515
             I K+I  R ++ C  Y PC+C   CGK+C C++    CEK+CGCP +CK  F+GCHC K+
Sbjct  679   IRKRITERKDQPCRQYNPCSCQTACGKQCSCLLNGTCCEKYCGCPKSCKNRFRGCHCAKS  738

Query  1516  ECATNYCPCYASGRECDPDVCCFCWVSCGD--GSIGIPPDKVSNHKCQNMKLLLGHQQKV  1689
             +C +  CPC+A+ RECDPDVC  CWVSCGD  GS+G+PP +  N++C+NMKLLL  QQ+V
Sbjct  739   QCRSRQCPCFAADRECDPDVCRNCWVSCGDGTGSLGVPPQRGDNYECRNMKLLLKQQQRV  798

Query  1690  LLGRSDIAGWGAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLND  1869
             LLGRSD++GWGAFLKN    V K+E++G YTGELISH EADK GK+YDR+N SFLFNLND
Sbjct  799   LLGRSDVSGWGAFLKN---NVGKHEYLGEYTGELISHREADKRGKIYDRENSSFLFNLND  855

Query  1870  Q-----------LVIDAYRRGNKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSF  2016
             Q            V+DAYR+G+KLKF NHSP+PNC+AKV             ++VAG   
Sbjct  856   QACPFIILFLEDFVLDAYRKGDKLKFANHSPEPNCYAKV-------------IMVAG---  899

Query  2017  SIDHRSG  2037
               DHR G
Sbjct  900   --DHRVG  904


 Score =   186 bits (472),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 125/240 (52%), Positives = 161/240 (67%), Gaps = 24/240 (10%)
 Frame = +1

Query  694   DGSADLLAKRQTDAFDLQNSIGTGSGNKICSSQEDGYASSDLRSSIVLKNAVCpiklpkl  873
             D ++DLL KRQ DA  +QN I   +G+K   S ++   +  + SSI +KNAV PIKL ++
Sbjct  88    DSASDLLTKRQKDALGMQNGIDASNGDKDGYSYQEPSTAVLMGSSIPVKNAVRPIKLTEV  147

Query  874   ekippYTTWAFL--------------------HRNQKMPEDQSVIGRRRIYYDMNSGEAL  993
             +K+PPYTTW FL                     RNQ+M EDQSV+GRRRIYYD N GEAL
Sbjct  148   KKLPPYTTWIFLDRTSVRKKCNGKAYFPPKGRRRNQRMTEDQSVVGRRRIYYDQNGGEAL  207

Query  994   i-csdsdeeiieeegenefaesedYILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYK  1170
             I     +E I E+E + +F ESED+ILRMTI++VGL D VL+ LA   SR P++VKARY+
Sbjct  208   ICSDSEEELIEEDEEKKDFVESEDFILRMTIKEVGLSDPVLESLAQCLSRSPADVKARYE  267

Query  1171  DLIKE---GATSKNENTEVTINSYLDEDLDAALSSFDNLFCQRCFVFNCQLHGCSQDLII  1341
              L+KE   GA+   +  E   NS+LD+DL+AAL SFDNLFC+RC VF+C+LHGCSQDLI 
Sbjct  268   TLMKEEDTGASKNRDTEEQNWNSFLDKDLEAALDSFDNLFCRRCLVFDCRLHGCSQDLIF  327


 Score = 67.8 bits (164),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSKK  2167
             +I+V GDHR+GIFA + +NAG+EL YDY+Y+PD  PAWA+  ++S  K
Sbjct  894   VIMVAGDHRVGIFAKERINAGEELFYDYRYEPDRAPAWARKPEASGSK  941



>ref|XP_010227998.1| PREDICTED: histone-lysine N-methyltransferase EZ1 [Brachypodium 
distachyon]
Length=880

 Score =   276 bits (706),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 132/235 (56%), Positives = 167/235 (71%), Gaps = 22/235 (9%)
 Frame = +1

Query  1336  IILKQI-RVREELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTK  1512
              I K+I   +++ C  Y PC C   CGK+CPC+     CEK+CGCP  CK  F+GCHC K
Sbjct  615   FIRKRITEKKDQPCRQYNPCGCQSACGKQCPCLTNGTCCEKYCGCPKMCKNRFRGCHCAK  674

Query  1513  NECATNYCPCYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVL  1692
             ++C +  CPC+A+ RECDPDVC  CWV CGDGS+G+P  +  N++C+NMKLLL  QQ+VL
Sbjct  675   SQCRSRQCPCFAADRECDPDVCRNCWVGCGDGSLGVPNQRGDNYECRNMKLLLKQQQRVL  734

Query  1693  LGRSDIAGWGAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQ  1872
             LGRSDI+GWGAFLKN    V K+E++G YTGELISH EADK GK+YD +N SFLFNLN++
Sbjct  735   LGRSDISGWGAFLKN---SVGKHEYLGEYTGELISHKEADKRGKIYDIENSSFLFNLNNE  791

Query  1873  LVIDAYRRGNKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
              V+DA+R G+KLKF NHSP+PNC+AKV             ++VAG     DHR G
Sbjct  792   YVLDAFRMGDKLKFANHSPNPNCYAKV-------------IMVAG-----DHRVG  828


 Score =   147 bits (370),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 113/243 (47%), Positives = 149/243 (61%), Gaps = 9/243 (4%)
 Frame = +1

Query  703   ADLLAKRQTDAFDLQNSIGTGSGNKICSSQEDGYASSDLRSSIVLKNAVCpiklpkleki  882
             +DLL  RQ DA    +S+      K   S E+   SS   S+   KN   PIKLP+L ++
Sbjct  69    SDLLTTRQDDALSSVHSLDVYPNEKDGDSSEE--ESSYAMSTASAKNVAHPIKLPELPRL  126

Query  883   ppYTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEAL-icsdsdeeiieeegenefaese  1059
             PPYTTW FL RNQ+M EDQSV+GRRRIYYD N GEAL      DE + +EE + EF  SE
Sbjct  127   PPYTTWTFLDRNQRMTEDQSVLGRRRIYYDANCGEALIASDSEDEAVEDEEEKKEFKGSE  186

Query  1060  dYILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLIKEGATSKNEN-TEVTI---N  1227
             DY++RMTI++ G+ D VL+ LA  F R   ++KARY+ L  E      +N +E+     +
Sbjct  187   DYLIRMTIQECGMSDTVLETLAQCFDRAAGDIKARYEILNGEKTELHLKNVSELNAKVED  246

Query  1228  SYLDEDLDAALSSFDNLFCQRCFVFNCQLHGCSQDLIILKQIRVREELCAHYTPCNC*PH  1407
             +Y D+DLDAAL S+DNLFC+RC VF+C+LH CSQDL+   + +    +     PC    H
Sbjct  247   AYRDKDLDAALDSYDNLFCRRCLVFDCKLHLCSQDLVFPTEKQQAWNIGDDGIPCGI--H  304

Query  1408  CGK  1416
             C K
Sbjct  305   CYK  307


 Score = 58.2 bits (139),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAK  2143
             +I+V GDHR+GIFA + + AG+EL YDY+Y+ D  PAWA+
Sbjct  818   VIMVAGDHRVGIFAKERIGAGEELFYDYRYEADRAPAWAR  857



>ref|XP_009416259.1| PREDICTED: histone-lysine N-methyltransferase EZ3 isoform X1 
[Musa acuminata subsp. malaccensis]
Length=917

 Score =   277 bits (708),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 129/228 (57%), Positives = 164/228 (72%), Gaps = 5/228 (2%)
 Frame = +1

Query  1360  REELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKNECATNYCP  1539
             +++ C  YTPC C   CGK+CPC+     CEK+CGC   CK  F+GCHC K++C +  CP
Sbjct  663   KQQSCKQYTPCGCQQMCGKQCPCMHNGTCCEKYCGCSKGCKNRFRGCHCAKSQCRSRQCP  722

Query  1540  CYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLLGRSDIAGW  1719
             C+A+GRECDPDVC  CWVSCGDGS+G PPD+   + C NMKLLL  Q+++LL RSD+AGW
Sbjct  723   CFAAGRECDPDVCRNCWVSCGDGSLGEPPDRGDGYHCGNMKLLLKQQERILLARSDVAGW  782

Query  1720  GAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQLVIDAYRRG  1899
             GAF++N    V+KN+++G YTGELISH EADK GK+YDR N SFLF+LNDQ V+DAYR+G
Sbjct  783   GAFIRN---PVNKNDYLGEYTGELISHREADKRGKIYDRANSSFLFDLNDQYVLDAYRKG  839

Query  1900  NKLKFINHSPDPNCFAKVNCSLSPCLLQCF--QLIVAGGSFSIDHRSG  2037
             +KLKF NHS +PNC+AKV        +  F  + I AG     D+R G
Sbjct  840   DKLKFANHSSNPNCYAKVMLVAGDHRVGIFAKEHIEAGEELFYDYRYG  887


 Score =   110 bits (276),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 72/160 (45%), Positives = 102/160 (64%), Gaps = 11/160 (7%)
 Frame = +1

Query  889   YTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALi-csdsdeeiieeegenefaesedY  1065
             YTTW FL++NQ+M EDQSV+GRRRIYYD    EALI     +E    EE ++EF+E ED 
Sbjct  155   YTTWIFLNKNQRMAEDQSVVGRRRIYYDPVGNEALICSDTDEEIAEPEEEKHEFSEGEDQ  214

Query  1066  ILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLIK--------EGATSKNENTEVT  1221
             IL   I++ G+   VL++L         E++ RY+ L+         E   S  +++E  
Sbjct  215   ILWKAIQEHGINQEVLNILHQFIDATHDEIEDRYEMLLSKHNKKHRSEPKDSDEKDSEGR  274

Query  1222  INSYLDEDLDAALSSFDNLFCQRCFVFNCQLHGCSQDLII  1341
             +  + D+ L+AAL SFDNLFC+RC +F+C+LHGCSQ+L+I
Sbjct  275   L--FSDKSLNAALDSFDNLFCRRCLIFDCRLHGCSQNLVI  312


 Score = 62.0 bits (149),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSK  2164
             +++V GDHR+GIFA + + AG+EL YDY+Y PD  PAWA+  + S +
Sbjct  857   VMLVAGDHRVGIFAKEHIEAGEELFYDYRYGPDQAPAWARKPEGSKR  903



>ref|XP_009416267.1| PREDICTED: histone-lysine N-methyltransferase EZ3 isoform X2 
[Musa acuminata subsp. malaccensis]
Length=881

 Score =   276 bits (706),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 129/228 (57%), Positives = 164/228 (72%), Gaps = 5/228 (2%)
 Frame = +1

Query  1360  REELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKNECATNYCP  1539
             +++ C  YTPC C   CGK+CPC+     CEK+CGC   CK  F+GCHC K++C +  CP
Sbjct  627   KQQSCKQYTPCGCQQMCGKQCPCMHNGTCCEKYCGCSKGCKNRFRGCHCAKSQCRSRQCP  686

Query  1540  CYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLLGRSDIAGW  1719
             C+A+GRECDPDVC  CWVSCGDGS+G PPD+   + C NMKLLL  Q+++LL RSD+AGW
Sbjct  687   CFAAGRECDPDVCRNCWVSCGDGSLGEPPDRGDGYHCGNMKLLLKQQERILLARSDVAGW  746

Query  1720  GAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQLVIDAYRRG  1899
             GAF++N    V+KN+++G YTGELISH EADK GK+YDR N SFLF+LNDQ V+DAYR+G
Sbjct  747   GAFIRN---PVNKNDYLGEYTGELISHREADKRGKIYDRANSSFLFDLNDQYVLDAYRKG  803

Query  1900  NKLKFINHSPDPNCFAKVNCSLSPCLLQCF--QLIVAGGSFSIDHRSG  2037
             +KLKF NHS +PNC+AKV        +  F  + I AG     D+R G
Sbjct  804   DKLKFANHSSNPNCYAKVMLVAGDHRVGIFAKEHIEAGEELFYDYRYG  851


 Score =   110 bits (276),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 72/160 (45%), Positives = 102/160 (64%), Gaps = 11/160 (7%)
 Frame = +1

Query  889   YTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALi-csdsdeeiieeegenefaesedY  1065
             YTTW FL++NQ+M EDQSV+GRRRIYYD    EALI     +E    EE ++EF+E ED 
Sbjct  119   YTTWIFLNKNQRMAEDQSVVGRRRIYYDPVGNEALICSDTDEEIAEPEEEKHEFSEGEDQ  178

Query  1066  ILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLIK--------EGATSKNENTEVT  1221
             IL   I++ G+   VL++L         E++ RY+ L+         E   S  +++E  
Sbjct  179   ILWKAIQEHGINQEVLNILHQFIDATHDEIEDRYEMLLSKHNKKHRSEPKDSDEKDSEGR  238

Query  1222  INSYLDEDLDAALSSFDNLFCQRCFVFNCQLHGCSQDLII  1341
             +  + D+ L+AAL SFDNLFC+RC +F+C+LHGCSQ+L+I
Sbjct  239   L--FSDKSLNAALDSFDNLFCRRCLIFDCRLHGCSQNLVI  276


 Score = 61.6 bits (148),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSK  2164
             +++V GDHR+GIFA + + AG+EL YDY+Y PD  PAWA+  + S +
Sbjct  821   VMLVAGDHRVGIFAKEHIEAGEELFYDYRYGPDQAPAWARKPEGSKR  867



>ref|XP_008454286.1| PREDICTED: histone-lysine N-methyltransferase EZA1 isoform X3 
[Cucumis melo]
Length=888

 Score =   276 bits (706),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 130/226 (58%), Positives = 164/226 (73%), Gaps = 22/226 (10%)
 Frame = +1

Query  1360  REELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKNECATNYCP  1539
             + + C  YTPC C   CGK+CPC+     CEK+CGC  +CK  F+GCHC K++C +  CP
Sbjct  633   KNQSCKQYTPCGCLSSCGKQCPCLHNGTCCEKYCGCSKSCKNRFRGCHCAKSQCRSRQCP  692

Query  1540  CYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLLGRSDIAGW  1719
             C+A+GRECDPDVC  CWVSCGDGS+G PP +  + +C NM+LLL  QQ++LLG+SD+AGW
Sbjct  693   CFAAGRECDPDVCRNCWVSCGDGSLGEPP-RQGDGQCGNMRLLLRQQQRILLGKSDVAGW  751

Query  1720  GAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQLVIDAYRRG  1899
             GAFLKN    V+KN+++G YTGELISH EADK GK+YDR N SFLF+LNDQ V+DAYR+G
Sbjct  752   GAFLKN---SVNKNDYLGEYTGELISHREADKRGKIYDRANSSFLFDLNDQYVLDAYRKG  808

Query  1900  NKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
             +KLKF NHS +PNC+AKV             ++VAG     DHR G
Sbjct  809   DKLKFANHSSNPNCYAKV-------------MLVAG-----DHRVG  836


 Score =   108 bits (270),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 71/157 (45%), Positives = 102/157 (65%), Gaps = 8/157 (5%)
 Frame = +1

Query  889   YTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALi-csdsdeeiieeegenefaesedY  1065
             YTTW FL RNQ+M EDQSV+GRRRIYYD +  EALI     +E    E+ ++EF+E ED 
Sbjct  134   YTTWIFLDRNQRMAEDQSVVGRRRIYYDQHGSEALICSDSEEELAEPEDEKHEFSEGEDR  193

Query  1066  ILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLIKEGATSKNENTEVTINSY----  1233
             +L + I++ G+ + VL +L++      SE++ RY +++KE     + +++V   S     
Sbjct  194   VLWIIIQEHGVGENVLQILSHSIGCTTSEIQERY-NVLKERNYKTDLSSKVLEESMSKKG  252

Query  1234  --LDEDLDAALSSFDNLFCQRCFVFNCQLHGCSQDLI  1338
               L + L + L SFDNLFC+RC VF+C+LHGCSQ LI
Sbjct  253   ISLYKSLSSTLDSFDNLFCRRCMVFDCRLHGCSQSLI  289


 Score = 59.3 bits (142),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSK  2164
             +++V GDHR+GIFA + + A +EL YDY+Y PD  PAWA+  + S +
Sbjct  826   VMLVAGDHRVGIFAKERIEATEELFYDYRYGPDQAPAWARRPEGSKR  872



>ref|XP_008454284.1| PREDICTED: histone-lysine N-methyltransferase EZA1 isoform X1 
[Cucumis melo]
Length=892

 Score =   276 bits (706),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 130/226 (58%), Positives = 164/226 (73%), Gaps = 22/226 (10%)
 Frame = +1

Query  1360  REELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKNECATNYCP  1539
             + + C  YTPC C   CGK+CPC+     CEK+CGC  +CK  F+GCHC K++C +  CP
Sbjct  637   KNQSCKQYTPCGCLSSCGKQCPCLHNGTCCEKYCGCSKSCKNRFRGCHCAKSQCRSRQCP  696

Query  1540  CYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLLGRSDIAGW  1719
             C+A+GRECDPDVC  CWVSCGDGS+G PP +  + +C NM+LLL  QQ++LLG+SD+AGW
Sbjct  697   CFAAGRECDPDVCRNCWVSCGDGSLGEPP-RQGDGQCGNMRLLLRQQQRILLGKSDVAGW  755

Query  1720  GAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQLVIDAYRRG  1899
             GAFLKN    V+KN+++G YTGELISH EADK GK+YDR N SFLF+LNDQ V+DAYR+G
Sbjct  756   GAFLKN---SVNKNDYLGEYTGELISHREADKRGKIYDRANSSFLFDLNDQYVLDAYRKG  812

Query  1900  NKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
             +KLKF NHS +PNC+AKV             ++VAG     DHR G
Sbjct  813   DKLKFANHSSNPNCYAKV-------------MLVAG-----DHRVG  840


 Score =   108 bits (270),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 71/157 (45%), Positives = 102/157 (65%), Gaps = 8/157 (5%)
 Frame = +1

Query  889   YTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALi-csdsdeeiieeegenefaesedY  1065
             YTTW FL RNQ+M EDQSV+GRRRIYYD +  EALI     +E    E+ ++EF+E ED 
Sbjct  134   YTTWIFLDRNQRMAEDQSVVGRRRIYYDQHGSEALICSDSEEELAEPEDEKHEFSEGEDR  193

Query  1066  ILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLIKEGATSKNENTEVTINSY----  1233
             +L + I++ G+ + VL +L++      SE++ RY +++KE     + +++V   S     
Sbjct  194   VLWIIIQEHGVGENVLQILSHSIGCTTSEIQERY-NVLKERNYKTDLSSKVLEESMSKKG  252

Query  1234  --LDEDLDAALSSFDNLFCQRCFVFNCQLHGCSQDLI  1338
               L + L + L SFDNLFC+RC VF+C+LHGCSQ LI
Sbjct  253   ISLYKSLSSTLDSFDNLFCRRCMVFDCRLHGCSQSLI  289


 Score = 59.3 bits (142),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSK  2164
             +++V GDHR+GIFA + + A +EL YDY+Y PD  PAWA+  + S +
Sbjct  830   VMLVAGDHRVGIFAKERIEATEELFYDYRYGPDQAPAWARRPEGSKR  876



>ref|XP_008454285.1| PREDICTED: histone-lysine N-methyltransferase EZA1 isoform X2 
[Cucumis melo]
Length=890

 Score =   276 bits (706),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 130/226 (58%), Positives = 164/226 (73%), Gaps = 22/226 (10%)
 Frame = +1

Query  1360  REELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKNECATNYCP  1539
             + + C  YTPC C   CGK+CPC+     CEK+CGC  +CK  F+GCHC K++C +  CP
Sbjct  635   KNQSCKQYTPCGCLSSCGKQCPCLHNGTCCEKYCGCSKSCKNRFRGCHCAKSQCRSRQCP  694

Query  1540  CYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLLGRSDIAGW  1719
             C+A+GRECDPDVC  CWVSCGDGS+G PP +  + +C NM+LLL  QQ++LLG+SD+AGW
Sbjct  695   CFAAGRECDPDVCRNCWVSCGDGSLGEPP-RQGDGQCGNMRLLLRQQQRILLGKSDVAGW  753

Query  1720  GAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQLVIDAYRRG  1899
             GAFLKN    V+KN+++G YTGELISH EADK GK+YDR N SFLF+LNDQ V+DAYR+G
Sbjct  754   GAFLKN---SVNKNDYLGEYTGELISHREADKRGKIYDRANSSFLFDLNDQYVLDAYRKG  810

Query  1900  NKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
             +KLKF NHS +PNC+AKV             ++VAG     DHR G
Sbjct  811   DKLKFANHSSNPNCYAKV-------------MLVAG-----DHRVG  838


 Score =   108 bits (271),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 71/157 (45%), Positives = 102/157 (65%), Gaps = 8/157 (5%)
 Frame = +1

Query  889   YTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALi-csdsdeeiieeegenefaesedY  1065
             YTTW FL RNQ+M EDQSV+GRRRIYYD +  EALI     +E    E+ ++EF+E ED 
Sbjct  134   YTTWIFLDRNQRMAEDQSVVGRRRIYYDQHGSEALICSDSEEELAEPEDEKHEFSEGEDR  193

Query  1066  ILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLIKEGATSKNENTEVTINSY----  1233
             +L + I++ G+ + VL +L++      SE++ RY +++KE     + +++V   S     
Sbjct  194   VLWIIIQEHGVGENVLQILSHSIGCTTSEIQERY-NVLKERNYKTDLSSKVLEESMSKKG  252

Query  1234  --LDEDLDAALSSFDNLFCQRCFVFNCQLHGCSQDLI  1338
               L + L + L SFDNLFC+RC VF+C+LHGCSQ LI
Sbjct  253   ISLYKSLSSTLDSFDNLFCRRCMVFDCRLHGCSQSLI  289


 Score = 59.3 bits (142),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSK  2164
             +++V GDHR+GIFA + + A +EL YDY+Y PD  PAWA+  + S +
Sbjct  828   VMLVAGDHRVGIFAKERIEATEELFYDYRYGPDQAPAWARRPEGSKR  874



>gb|KDO86988.1| hypothetical protein CISIN_1g002895mg [Citrus sinensis]
Length=840

 Score =   275 bits (703),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 132/226 (58%), Positives = 163/226 (72%), Gaps = 22/226 (10%)
 Frame = +1

Query  1360  REELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKNECATNYCP  1539
             + + C  YTPC C   CGK+CPC+     CEK+CGC  +CK  F+GCHC K++C +  CP
Sbjct  585   KNQSCKQYTPCGCQSMCGKQCPCLHNGTCCEKYCGCSKSCKNRFRGCHCAKSQCRSRQCP  644

Query  1540  CYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLLGRSDIAGW  1719
             C+A+GRECDPDVC  CWVSCGDGS+G PP K  + +C NM+LLL  QQ++LL +SD+AGW
Sbjct  645   CFAAGRECDPDVCRNCWVSCGDGSLGEPP-KRGDGQCGNMRLLLRQQQRILLAKSDVAGW  703

Query  1720  GAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQLVIDAYRRG  1899
             GAFLKN    VSKN+++G YTGELISH EADK GK+YDR N SFLF+LNDQ V+DAYR+G
Sbjct  704   GAFLKN---SVSKNDYLGEYTGELISHREADKRGKIYDRANSSFLFDLNDQYVLDAYRKG  760

Query  1900  NKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
             +KLKF NHS +PNCFAKV             ++VAG     DHR G
Sbjct  761   DKLKFANHSSNPNCFAKV-------------MLVAG-----DHRVG  788


 Score =   110 bits (276),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 73/155 (47%), Positives = 98/155 (63%), Gaps = 6/155 (4%)
 Frame = +1

Query  889   YTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALi-csdsdeeiieeegenefaesedY  1065
             YTTW FL +NQ+M EDQSV+GRRRIYYD +  EAL+     ++ I  EE ++EF++ ED 
Sbjct  124   YTTWIFLDKNQRMAEDQSVVGRRRIYYDQHGSEALVCSDSEEDIIEPEEEKHEFSDGEDR  183

Query  1066  ILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLIKEGATSKN----ENTEVTINSY  1233
             IL    E+ GL + V++ ++       SEV+ RY  L KE    KN    E+        
Sbjct  184   ILWTVFEEHGLGEEVINAVSQFIGIATSEVQDRYSTL-KEKYDGKNLKEFEDAGHERGIA  242

Query  1234  LDEDLDAALSSFDNLFCQRCFVFNCQLHGCSQDLI  1338
             L++ L AAL SFDNLFC+RC +F+C+LHGCSQ LI
Sbjct  243   LEKSLSAALDSFDNLFCRRCLLFDCRLHGCSQTLI  277


 Score = 59.7 bits (143),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = +2

Query  2015  FR*IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSKK  2167
             F  +++V GDHR+GIFA + + A +EL YDY+Y PD  PAWA+  + S ++
Sbjct  775   FAKVMLVAGDHRVGIFAKEHIEASEELFYDYRYGPDQAPAWARKPEGSKRE  825



>ref|XP_006444504.1| hypothetical protein CICLE_v10018849mg [Citrus clementina]
 gb|ESR57744.1| hypothetical protein CICLE_v10018849mg [Citrus clementina]
Length=840

 Score =   275 bits (703),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 132/226 (58%), Positives = 163/226 (72%), Gaps = 22/226 (10%)
 Frame = +1

Query  1360  REELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKNECATNYCP  1539
             + + C  YTPC C   CGK+CPC+     CEK+CGC  +CK  F+GCHC K++C +  CP
Sbjct  585   KNQSCKQYTPCGCQSMCGKQCPCLHNGTCCEKYCGCSKSCKNRFRGCHCAKSQCRSRQCP  644

Query  1540  CYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLLGRSDIAGW  1719
             C+A+GRECDPDVC  CWVSCGDGS+G PP K  + +C NM+LLL  QQ++LL +SD+AGW
Sbjct  645   CFAAGRECDPDVCRNCWVSCGDGSLGEPP-KRGDGQCGNMRLLLRQQQRILLAKSDVAGW  703

Query  1720  GAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQLVIDAYRRG  1899
             GAFLKN    VSKN+++G YTGELISH EADK GK+YDR N SFLF+LNDQ V+DAYR+G
Sbjct  704   GAFLKN---SVSKNDYLGEYTGELISHREADKRGKIYDRANSSFLFDLNDQYVLDAYRKG  760

Query  1900  NKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
             +KLKF NHS +PNCFAKV             ++VAG     DHR G
Sbjct  761   DKLKFANHSSNPNCFAKV-------------MLVAG-----DHRVG  788


 Score =   111 bits (277),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 73/155 (47%), Positives = 98/155 (63%), Gaps = 6/155 (4%)
 Frame = +1

Query  889   YTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALi-csdsdeeiieeegenefaesedY  1065
             YTTW FL +NQ+M EDQSV+GRRRIYYD +  EAL+     ++ I  EE ++EF++ ED 
Sbjct  124   YTTWIFLEKNQRMAEDQSVVGRRRIYYDQHGSEALVCSDSEEDIIEPEEEKHEFSDGEDR  183

Query  1066  ILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLIKEGATSKN----ENTEVTINSY  1233
             IL    E+ GL + V++ ++       SEV+ RY  L KE    KN    E+        
Sbjct  184   ILWTVFEEHGLGEEVINAVSQFIGIATSEVQDRYSTL-KEKYDGKNLKEFEDAGHERGIA  242

Query  1234  LDEDLDAALSSFDNLFCQRCFVFNCQLHGCSQDLI  1338
             L++ L AAL SFDNLFC+RC +F+C+LHGCSQ LI
Sbjct  243   LEKSLSAALDSFDNLFCRRCLLFDCRLHGCSQTLI  277


 Score = 59.7 bits (143),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = +2

Query  2015  FR*IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSKK  2167
             F  +++V GDHR+GIFA + + A +EL YDY+Y PD  PAWA+  + S ++
Sbjct  775   FAKVMLVAGDHRVGIFAKEHIEASEELFYDYRYGPDQAPAWARKPEGSKRE  825



>ref|XP_004164981.1| PREDICTED: LOW QUALITY PROTEIN: histone-lysine N-methyltransferase 
EZA1-like [Cucumis sativus]
Length=889

 Score =   275 bits (704),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 130/226 (58%), Positives = 164/226 (73%), Gaps = 22/226 (10%)
 Frame = +1

Query  1360  REELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKNECATNYCP  1539
             + + C  YTPC C   CGK+CPC+     CEK+CGC  +CK  F+GCHC K++C +  CP
Sbjct  634   KNQSCKQYTPCGCLSSCGKQCPCLHNGTCCEKYCGCSKSCKNRFRGCHCAKSQCRSRQCP  693

Query  1540  CYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLLGRSDIAGW  1719
             C+A+GRECDPDVC  CWVSCGDGS+G PP +  + +C NM+LLL  QQ++LLG+SD+AGW
Sbjct  694   CFAAGRECDPDVCRNCWVSCGDGSMGEPP-RQGDGQCGNMRLLLRQQQRILLGKSDVAGW  752

Query  1720  GAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQLVIDAYRRG  1899
             GAFLKN    V+KN+++G YTGELISH EADK GK+YDR N SFLF+LNDQ V+DAYR+G
Sbjct  753   GAFLKN---SVNKNDYLGEYTGELISHREADKRGKIYDRANSSFLFDLNDQYVLDAYRKG  809

Query  1900  NKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
             +KLKF NHS +PNC+AKV             ++VAG     DHR G
Sbjct  810   DKLKFANHSSNPNCYAKV-------------MLVAG-----DHRVG  837


 Score =   105 bits (263),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 71/157 (45%), Positives = 101/157 (64%), Gaps = 8/157 (5%)
 Frame = +1

Query  889   YTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALi-csdsdeeiieeegenefaesedY  1065
             YTTW FL RNQ+M EDQSV+GRRRIYYD +  EALI     +E    E+ ++EF+E ED 
Sbjct  131   YTTWIFLDRNQRMAEDQSVVGRRRIYYDQHGSEALICSDSEEELAEPEDXKHEFSEGEDR  190

Query  1066  ILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLIKEGATSKNENTEVTINSY----  1233
             +L + I++ G+ + VL LL++      SE++ R  +++KE     + +++V   S     
Sbjct  191   VLWIIIQEHGVGENVLQLLSHSIGCTTSEIQERC-NVLKERNYRADLSSKVLEESVFKKG  249

Query  1234  --LDEDLDAALSSFDNLFCQRCFVFNCQLHGCSQDLI  1338
               L + L + L SFDNLFC+RC VF+C+LHGCSQ LI
Sbjct  250   ISLYKSLSSTLDSFDNLFCRRCMVFDCRLHGCSQSLI  286


 Score = 59.3 bits (142),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSK  2164
             +++V GDHR+GIFA + + A +EL YDY+Y PD  PAWA+  + S +
Sbjct  827   VMLVAGDHRVGIFAKEHIEATEELFYDYRYGPDQAPAWARRPEGSKR  873



>gb|KDO86987.1| hypothetical protein CISIN_1g002895mg [Citrus sinensis]
Length=834

 Score =   274 bits (701),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 132/226 (58%), Positives = 163/226 (72%), Gaps = 22/226 (10%)
 Frame = +1

Query  1360  REELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKNECATNYCP  1539
             + + C  YTPC C   CGK+CPC+     CEK+CGC  +CK  F+GCHC K++C +  CP
Sbjct  579   KNQSCKQYTPCGCQSMCGKQCPCLHNGTCCEKYCGCSKSCKNRFRGCHCAKSQCRSRQCP  638

Query  1540  CYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLLGRSDIAGW  1719
             C+A+GRECDPDVC  CWVSCGDGS+G PP K  + +C NM+LLL  QQ++LL +SD+AGW
Sbjct  639   CFAAGRECDPDVCRNCWVSCGDGSLGEPP-KRGDGQCGNMRLLLRQQQRILLAKSDVAGW  697

Query  1720  GAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQLVIDAYRRG  1899
             GAFLKN    VSKN+++G YTGELISH EADK GK+YDR N SFLF+LNDQ V+DAYR+G
Sbjct  698   GAFLKN---SVSKNDYLGEYTGELISHREADKRGKIYDRANSSFLFDLNDQYVLDAYRKG  754

Query  1900  NKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
             +KLKF NHS +PNCFAKV             ++VAG     DHR G
Sbjct  755   DKLKFANHSSNPNCFAKV-------------MLVAG-----DHRVG  782


 Score =   110 bits (275),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 73/155 (47%), Positives = 98/155 (63%), Gaps = 6/155 (4%)
 Frame = +1

Query  889   YTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALi-csdsdeeiieeegenefaesedY  1065
             YTTW FL +NQ+M EDQSV+GRRRIYYD +  EAL+     ++ I  EE ++EF++ ED 
Sbjct  124   YTTWIFLDKNQRMAEDQSVVGRRRIYYDQHGSEALVCSDSEEDIIEPEEEKHEFSDGEDR  183

Query  1066  ILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLIKEGATSKN----ENTEVTINSY  1233
             IL    E+ GL + V++ ++       SEV+ RY  L KE    KN    E+        
Sbjct  184   ILWTVFEEHGLGEEVINAVSQFIGIATSEVQDRYSTL-KEKYDGKNLKEFEDAGHERGIA  242

Query  1234  LDEDLDAALSSFDNLFCQRCFVFNCQLHGCSQDLI  1338
             L++ L AAL SFDNLFC+RC +F+C+LHGCSQ LI
Sbjct  243   LEKSLSAALDSFDNLFCRRCLLFDCRLHGCSQTLI  277


 Score = 59.7 bits (143),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = +2

Query  2015  FR*IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSKK  2167
             F  +++V GDHR+GIFA + + A +EL YDY+Y PD  PAWA+  + S ++
Sbjct  769   FAKVMLVAGDHRVGIFAKEHIEASEELFYDYRYGPDQAPAWARKPEGSKRE  819



>gb|KGN52856.1| hypothetical protein Csa_4G003700 [Cucumis sativus]
Length=894

 Score =   275 bits (704),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 130/226 (58%), Positives = 164/226 (73%), Gaps = 22/226 (10%)
 Frame = +1

Query  1360  REELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKNECATNYCP  1539
             + + C  YTPC C   CGK+CPC+     CEK+CGC  +CK  F+GCHC K++C +  CP
Sbjct  639   KNQSCKQYTPCGCLSSCGKQCPCLHNGTCCEKYCGCSKSCKNRFRGCHCAKSQCRSRQCP  698

Query  1540  CYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLLGRSDIAGW  1719
             C+A+GRECDPDVC  CWVSCGDGS+G PP +  + +C NM+LLL  QQ++LLG+SD+AGW
Sbjct  699   CFAAGRECDPDVCRNCWVSCGDGSMGEPP-RQGDGQCGNMRLLLRQQQRILLGKSDVAGW  757

Query  1720  GAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQLVIDAYRRG  1899
             GAFLKN    V+KN+++G YTGELISH EADK GK+YDR N SFLF+LNDQ V+DAYR+G
Sbjct  758   GAFLKN---SVNKNDYLGEYTGELISHREADKRGKIYDRANSSFLFDLNDQYVLDAYRKG  814

Query  1900  NKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
             +KLKF NHS +PNC+AKV             ++VAG     DHR G
Sbjct  815   DKLKFANHSSNPNCYAKV-------------MLVAG-----DHRVG  842


 Score =   105 bits (261),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 71/157 (45%), Positives = 101/157 (64%), Gaps = 8/157 (5%)
 Frame = +1

Query  889   YTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALi-csdsdeeiieeegenefaesedY  1065
             YTTW FL RNQ+M EDQSV+GRRRIYYD +  EALI     +E    E+ ++EF+E ED 
Sbjct  131   YTTWIFLDRNQRMAEDQSVVGRRRIYYDQHGSEALICSDSEEELAEPEDEKHEFSEGEDR  190

Query  1066  ILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLIKEGATSKNENTEVTINSY----  1233
             +L + I++ G+ + VL LL++      SE++ R  +++KE     + +++V   S     
Sbjct  191   VLWIIIQEHGVGENVLQLLSHSIGCTTSEIQERC-NVLKERNYRADLSSKVLEESVFKKG  249

Query  1234  --LDEDLDAALSSFDNLFCQRCFVFNCQLHGCSQDLI  1338
               L + L + L SFDNLFC+RC VF+C+LHGCSQ LI
Sbjct  250   ISLYKSLSSTLDSFDNLFCRRCMVFDCRLHGCSQSLI  286


 Score = 59.3 bits (142),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSK  2164
             +++V GDHR+GIFA + + A +EL YDY+Y PD  PAWA+  + S +
Sbjct  832   VMLVAGDHRVGIFAKEHIEATEELFYDYRYGPDQAPAWARRPEGSKR  878



>gb|AFW88591.1| putative SET-domain containing protein family [Zea mays]
Length=555

 Score =   268 bits (684),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 128/221 (58%), Positives = 158/221 (71%), Gaps = 21/221 (10%)
 Frame = +1

Query  1375  AHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKNECATNYCPCYASG  1554
               Y+PC C   CGK CPC  K   CEK+CGC  +CK  F+GCHC K++C +  CPC+A+ 
Sbjct  305   TQYSPCACQQMCGKDCPCADKGTCCEKYCGCSKSCKNKFRGCHCAKSQCRSRQCPCFAAS  364

Query  1555  RECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLLGRSDIAGWGAFLK  1734
             RECDPDVC  CWVSCGDGS+G P  +   ++C NMKLLL  QQ++LLGRSD+AGWGAF+K
Sbjct  365   RECDPDVCRNCWVSCGDGSLGEPLARGDGYQCGNMKLLLKQQQRILLGRSDVAGWGAFIK  424

Query  1735  NCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQLVIDAYRRGNKLKF  1914
             N    V+KN+++G YTGELISH EADK GK+YDR N SFLF+LNDQ V+DAYR+G+KLKF
Sbjct  425   N---PVNKNDYLGEYTGELISHKEADKRGKIYDRANSSFLFDLNDQYVLDAYRKGDKLKF  481

Query  1915  INHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
              NHS +PNC+AKV             ++VAG     DHR G
Sbjct  482   ANHSSNPNCYAKV-------------MLVAG-----DHRVG  504


 Score = 58.5 bits (140),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSK  2164
             +++V GDHR+GI+A + + A +EL YDY+Y PD  PAWA+  + S K
Sbjct  494   VMLVAGDHRVGIYAKEHIEASEELFYDYRYGPDQAPAWARRPEGSKK  540



>ref|XP_004152222.1| PREDICTED: histone-lysine N-methyltransferase EZA1-like [Cucumis 
sativus]
Length=889

 Score =   275 bits (703),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 130/226 (58%), Positives = 164/226 (73%), Gaps = 22/226 (10%)
 Frame = +1

Query  1360  REELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKNECATNYCP  1539
             + + C  YTPC C   CGK+CPC+     CEK+CGC  +CK  F+GCHC K++C +  CP
Sbjct  634   KNQSCKQYTPCGCLSSCGKQCPCLHNGTCCEKYCGCSKSCKNRFRGCHCAKSQCRSRQCP  693

Query  1540  CYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLLGRSDIAGW  1719
             C+A+GRECDPDVC  CWVSCGDGS+G PP +  + +C NM+LLL  QQ++LLG+SD+AGW
Sbjct  694   CFAAGRECDPDVCRNCWVSCGDGSMGEPP-RQGDGQCGNMRLLLRQQQRILLGKSDVAGW  752

Query  1720  GAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQLVIDAYRRG  1899
             GAFLKN    V+KN+++G YTGELISH EADK GK+YDR N SFLF+LNDQ V+DAYR+G
Sbjct  753   GAFLKN---SVNKNDYLGEYTGELISHREADKRGKIYDRANSSFLFDLNDQYVLDAYRKG  809

Query  1900  NKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
             +KLKF NHS +PNC+AKV             ++VAG     DHR G
Sbjct  810   DKLKFANHSSNPNCYAKV-------------MLVAG-----DHRVG  837


 Score =   105 bits (261),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 71/157 (45%), Positives = 101/157 (64%), Gaps = 8/157 (5%)
 Frame = +1

Query  889   YTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALi-csdsdeeiieeegenefaesedY  1065
             YTTW FL RNQ+M EDQSV+GRRRIYYD +  EALI     +E    E+ ++EF+E ED 
Sbjct  131   YTTWIFLDRNQRMAEDQSVVGRRRIYYDQHGSEALICSDSEEELAEPEDEKHEFSEGEDR  190

Query  1066  ILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLIKEGATSKNENTEVTINSY----  1233
             +L + I++ G+ + VL LL++      SE++ R  +++KE     + +++V   S     
Sbjct  191   VLWIIIQEHGVGENVLQLLSHSIGCTTSEIQERC-NVLKERNYRADLSSKVLEESVFKKG  249

Query  1234  --LDEDLDAALSSFDNLFCQRCFVFNCQLHGCSQDLI  1338
               L + L + L SFDNLFC+RC VF+C+LHGCSQ LI
Sbjct  250   ISLYKSLSSTLDSFDNLFCRRCMVFDCRLHGCSQSLI  286


 Score = 59.3 bits (142),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSK  2164
             +++V GDHR+GIFA + + A +EL YDY+Y PD  PAWA+  + S +
Sbjct  827   VMLVAGDHRVGIFAKEHIEATEELFYDYRYGPDQAPAWARRPEGSKR  873



>ref|XP_002994616.1| hypothetical protein SELMODRAFT_138884 [Selaginella moellendorffii]
 gb|EFJ04316.1| hypothetical protein SELMODRAFT_138884 [Selaginella moellendorffii]
Length=833

 Score =   274 bits (700),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 132/233 (57%), Positives = 168/233 (72%), Gaps = 21/233 (9%)
 Frame = +1

Query  1339  ILKQIRVREELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKNE  1518
             I K++   ++ C  YTPC+C   CGK+C C      CEK+CGC  NCK  F+GCHC K++
Sbjct  571   IRKRLVDGKDGCRQYTPCSCSESCGKQCSCHRNGTCCEKYCGCSKNCKNRFRGCHCAKSQ  630

Query  1519  CATNYCPCYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLLG  1698
             C++  CPC+A+GRECDPDVC  CW+ CGDGS G PP +  +++C+NMKLLL  QQ+VLLG
Sbjct  631   CSSRQCPCFAAGRECDPDVCRNCWIGCGDGSQGGPPARGDSYECRNMKLLLKQQQRVLLG  690

Query  1699  RSDIAGWGAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQLV  1878
             RSD+AGWGAFLK     V+K++++G YTGELISH EADK GK+YDR+N SFLFNLNDQ V
Sbjct  691   RSDVAGWGAFLK---TPVNKHDYLGEYTGELISHREADKRGKIYDRENSSFLFNLNDQYV  747

Query  1879  IDAYRRGNKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
             +DA R+G+KLKF NHSP+PNC+AKV             ++VAG     DHR G
Sbjct  748   LDACRKGDKLKFANHSPNPNCYAKV-------------IMVAG-----DHRVG  782


 Score =   130 bits (326),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 95/215 (44%), Positives = 137/215 (64%), Gaps = 16/215 (7%)
 Frame = +1

Query  706   DLLAKRQTDAFDLQNSIGT--GSGNKICSSQEDGYASSDLRSSIVLKNAVCpiklpklek  879
             D+L  R   A    N +GT   + ++ C SQ+D  A   L ++   K+ V P++L  ++K
Sbjct  59    DMLNTRIQKAL---NKLGTDPAAADQQCGSQDDSSAPI-LFNNSGGKSIVKPVRLQTVQK  114

Query  880   ippYTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALi-csdsdeeiieeegenefaes  1056
              PPYTTW FL RNQ+M EDQSV+GRRRIYYD    EALI     +E++ EEE + +F++ 
Sbjct  115   TPPYTTWIFLDRNQRMAEDQSVVGRRRIYYDSAENEALICSDSEEEQVEEEEEKRDFSKG  174

Query  1057  edYILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLIKEGATSKNENTEVTINSYL  1236
             +D+++R T+++ GL  M+   LA+    KPSE++ARY+ L K+G   K+E          
Sbjct  175   DDFLIRATVQEHGLSKMMFKALADCLDAKPSEIEARYEILAKDGDKLKSEEK--------  226

Query  1237  DEDLDAALSSFDNLFCQRCFVFNCQLHGCSQDLII  1341
               DL +A+ SFDNLFC+RC VF+C+LHGCSQ +II
Sbjct  227   -HDLLSAMDSFDNLFCRRCLVFDCRLHGCSQPVII  260


 Score = 58.2 bits (139),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSK  2164
             +I+V GDHR+GIFA + ++AG+EL YDY+Y+ D  P WA+  +   K
Sbjct  772   VIMVAGDHRVGIFAKERISAGEELFYDYRYEADRAPPWARKPEDGQK  818



>ref|XP_006492341.1| PREDICTED: histone-lysine N-methyltransferase EZA1-like [Citrus 
sinensis]
 gb|KDO86986.1| hypothetical protein CISIN_1g002895mg [Citrus sinensis]
Length=864

 Score =   275 bits (702),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 132/226 (58%), Positives = 163/226 (72%), Gaps = 22/226 (10%)
 Frame = +1

Query  1360  REELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKNECATNYCP  1539
             + + C  YTPC C   CGK+CPC+     CEK+CGC  +CK  F+GCHC K++C +  CP
Sbjct  609   KNQSCKQYTPCGCQSMCGKQCPCLHNGTCCEKYCGCSKSCKNRFRGCHCAKSQCRSRQCP  668

Query  1540  CYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLLGRSDIAGW  1719
             C+A+GRECDPDVC  CWVSCGDGS+G PP K  + +C NM+LLL  QQ++LL +SD+AGW
Sbjct  669   CFAAGRECDPDVCRNCWVSCGDGSLGEPP-KRGDGQCGNMRLLLRQQQRILLAKSDVAGW  727

Query  1720  GAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQLVIDAYRRG  1899
             GAFLKN    VSKN+++G YTGELISH EADK GK+YDR N SFLF+LNDQ V+DAYR+G
Sbjct  728   GAFLKN---SVSKNDYLGEYTGELISHREADKRGKIYDRANSSFLFDLNDQYVLDAYRKG  784

Query  1900  NKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
             +KLKF NHS +PNCFAKV             ++VAG     DHR G
Sbjct  785   DKLKFANHSSNPNCFAKV-------------MLVAG-----DHRVG  812


 Score =   110 bits (276),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 73/155 (47%), Positives = 98/155 (63%), Gaps = 6/155 (4%)
 Frame = +1

Query  889   YTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALi-csdsdeeiieeegenefaesedY  1065
             YTTW FL +NQ+M EDQSV+GRRRIYYD +  EAL+     ++ I  EE ++EF++ ED 
Sbjct  124   YTTWIFLDKNQRMAEDQSVVGRRRIYYDQHGSEALVCSDSEEDIIEPEEEKHEFSDGEDR  183

Query  1066  ILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLIKEGATSKN----ENTEVTINSY  1233
             IL    E+ GL + V++ ++       SEV+ RY  L KE    KN    E+        
Sbjct  184   ILWTVFEEHGLGEEVINAVSQFIGIATSEVQDRYSTL-KEKYDGKNLKEFEDAGHERGIA  242

Query  1234  LDEDLDAALSSFDNLFCQRCFVFNCQLHGCSQDLI  1338
             L++ L AAL SFDNLFC+RC +F+C+LHGCSQ LI
Sbjct  243   LEKSLSAALDSFDNLFCRRCLLFDCRLHGCSQTLI  277


 Score = 59.7 bits (143),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = +2

Query  2015  FR*IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSKK  2167
             F  +++V GDHR+GIFA + + A +EL YDY+Y PD  PAWA+  + S ++
Sbjct  799   FAKVMLVAGDHRVGIFAKEHIEASEELFYDYRYGPDQAPAWARKPEGSKRE  849



>ref|XP_002987466.1| hypothetical protein SELMODRAFT_446978 [Selaginella moellendorffii]
 gb|EFJ11553.1| hypothetical protein SELMODRAFT_446978 [Selaginella moellendorffii]
Length=835

 Score =   274 bits (700),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 132/233 (57%), Positives = 168/233 (72%), Gaps = 21/233 (9%)
 Frame = +1

Query  1339  ILKQIRVREELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKNE  1518
             I K++   ++ C  YTPC+C   CGK+C C      CEK+CGC  NCK  F+GCHC K++
Sbjct  573   IRKRLVDGKDGCRQYTPCSCSESCGKQCSCHRNGTCCEKYCGCSKNCKNRFRGCHCAKSQ  632

Query  1519  CATNYCPCYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLLG  1698
             C++  CPC+A+GRECDPDVC  CW+ CGDGS G PP +  +++C+NMKLLL  QQ+VLLG
Sbjct  633   CSSRQCPCFAAGRECDPDVCRNCWIGCGDGSQGGPPARGDSYECRNMKLLLKQQQRVLLG  692

Query  1699  RSDIAGWGAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQLV  1878
             RSD+AGWGAFLK     V+K++++G YTGELISH EADK GK+YDR+N SFLFNLNDQ V
Sbjct  693   RSDVAGWGAFLK---TPVNKHDYLGEYTGELISHREADKRGKIYDRENSSFLFNLNDQYV  749

Query  1879  IDAYRRGNKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
             +DA R+G+KLKF NHSP+PNC+AKV             ++VAG     DHR G
Sbjct  750   LDACRKGDKLKFANHSPNPNCYAKV-------------IMVAG-----DHRVG  784


 Score =   130 bits (326),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 95/215 (44%), Positives = 137/215 (64%), Gaps = 16/215 (7%)
 Frame = +1

Query  706   DLLAKRQTDAFDLQNSIGT--GSGNKICSSQEDGYASSDLRSSIVLKNAVCpiklpklek  879
             D+L  R   A    N +GT   + ++ C SQ+D  A   L ++   K+ V P++L  ++K
Sbjct  73    DMLNTRIQKAL---NKLGTDPAAADQQCGSQDDSSAPI-LFNNSGGKSIVKPVRLQTVQK  128

Query  880   ippYTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALi-csdsdeeiieeegenefaes  1056
              PPYTTW FL RNQ+M EDQSV+GRRRIYYD    EALI     +E++ EEE + +F++ 
Sbjct  129   TPPYTTWIFLDRNQRMAEDQSVVGRRRIYYDSAENEALICSDSEEEQVEEEEEKRDFSKG  188

Query  1057  edYILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLIKEGATSKNENTEVTINSYL  1236
             +D+++R T+++ GL  M+   LA+    KPSE++ARY+ L K+G   K+E          
Sbjct  189   DDFLIRATVQEHGLSKMMFKALADCLDAKPSEIEARYEILAKDGDKLKSEEK--------  240

Query  1237  DEDLDAALSSFDNLFCQRCFVFNCQLHGCSQDLII  1341
               DL +A+ SFDNLFC+RC VF+C+LHGCSQ +II
Sbjct  241   -HDLLSAMDSFDNLFCRRCLVFDCRLHGCSQPVII  274


 Score = 58.2 bits (139),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSK  2164
             +I+V GDHR+GIFA + ++AG+EL YDY+Y+ D  P WA+  +   K
Sbjct  774   VIMVAGDHRVGIFAKERISAGEELFYDYRYEADRAPPWARKPEDGQK  820



>ref|XP_002980071.1| hypothetical protein SELMODRAFT_111860 [Selaginella moellendorffii]
 gb|EFJ18941.1| hypothetical protein SELMODRAFT_111860 [Selaginella moellendorffii]
Length=820

 Score =   273 bits (699),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 132/233 (57%), Positives = 168/233 (72%), Gaps = 21/233 (9%)
 Frame = +1

Query  1339  ILKQIRVREELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKNE  1518
             I K++   ++ C  YTPC+C   CGK+C C      CEK+CGC  NCK  F+GCHC K++
Sbjct  558   IRKRLVDGKDGCRQYTPCSCSESCGKQCSCHRNGTCCEKYCGCSKNCKNRFRGCHCAKSQ  617

Query  1519  CATNYCPCYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLLG  1698
             C++  CPC+A+GRECDPDVC  CW+ CGDGS G PP +  +++C+NMKLLL  QQ+VLLG
Sbjct  618   CSSRQCPCFAAGRECDPDVCRNCWIGCGDGSQGGPPARGDSYECRNMKLLLKQQQRVLLG  677

Query  1699  RSDIAGWGAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQLV  1878
             RSD+AGWGAFLK     V+K++++G YTGELISH EADK GK+YDR+N SFLFNLNDQ V
Sbjct  678   RSDVAGWGAFLK---TPVNKHDYLGEYTGELISHREADKRGKIYDRENSSFLFNLNDQYV  734

Query  1879  IDAYRRGNKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
             +DA R+G+KLKF NHSP+PNC+AKV             ++VAG     DHR G
Sbjct  735   LDACRKGDKLKFANHSPNPNCYAKV-------------IMVAG-----DHRVG  769


 Score =   129 bits (323),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 95/215 (44%), Positives = 136/215 (63%), Gaps = 16/215 (7%)
 Frame = +1

Query  706   DLLAKRQTDAFDLQNSIGT--GSGNKICSSQEDGYASSDLRSSIVLKNAVCpiklpklek  879
             D+L  R   A    N +GT   + ++ C SQ+D  A   L ++   K+ V P++L  ++K
Sbjct  59    DMLNTRIQKAL---NKLGTDPAAADQQCGSQDDSSAPI-LFNNSGGKSIVKPVRLQTVQK  114

Query  880   ippYTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALi-csdsdeeiieeegenefaes  1056
              PPYTTW FL RNQ+M EDQSV+GRRRIYYD    EALI     +E++ EEE + +F++ 
Sbjct  115   TPPYTTWIFLDRNQRMAEDQSVVGRRRIYYDSAENEALICSDSEEEQVEEEEEKRDFSKG  174

Query  1057  edYILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLIKEGATSKNENTEVTINSYL  1236
             +D+++R T+++ G   MV   LA+    KPSE++ARY+ L K+G   K+E          
Sbjct  175   DDFLIRATVQEHGSSKMVFKALADCLDAKPSEIEARYEILAKDGDKLKSEEK--------  226

Query  1237  DEDLDAALSSFDNLFCQRCFVFNCQLHGCSQDLII  1341
               DL +A+ SFDNLFC+RC VF+C+LHGCSQ +II
Sbjct  227   -HDLLSAMDSFDNLFCRRCLVFDCRLHGCSQPVII  260


 Score = 58.2 bits (139),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSK  2164
             +I+V GDHR+GIFA + ++AG+EL YDY+Y+ D  P WA+  +   K
Sbjct  759   VIMVAGDHRVGIFAKERISAGEELFYDYRYEADRAPPWARKPEDGQK  805



>ref|XP_008648300.1| PREDICTED: histone-lysine N-methyltransferase EZ3 isoform X2 
[Zea mays]
Length=730

 Score =   271 bits (693),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 131/234 (56%), Positives = 164/234 (70%), Gaps = 21/234 (9%)
 Frame = +1

Query  1336  IILKQIRVREELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKN  1515
              + K+I   ++    Y PC C   CGK CPCV     CEK+CGC  +CK  F+GCHC K+
Sbjct  467   TVRKRIGDGKQWYTQYNPCVCQQMCGKDCPCVENGTCCEKYCGCSKSCKNKFRGCHCAKS  526

Query  1516  ECATNYCPCYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLL  1695
             +C +  CPC+A+ RECDPDVC  CWVSCGDGS+G PP +   ++C NMKLLL  QQ++LL
Sbjct  527   QCRSRQCPCFAASRECDPDVCRNCWVSCGDGSLGEPPARGDGYQCGNMKLLLKQQQRILL  586

Query  1696  GRSDIAGWGAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQL  1875
             GRSD+AGWGAF+KN    V+KN+++G YTGELISH EADK GK+YDR N SFLF+LNDQ 
Sbjct  587   GRSDVAGWGAFIKN---PVNKNDYLGEYTGELISHKEADKRGKIYDRANSSFLFDLNDQY  643

Query  1876  VIDAYRRGNKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
             V+DAYR+G+KLKF NHS +PNC+AKV             ++VAG     DHR G
Sbjct  644   VLDAYRKGDKLKFANHSSNPNCYAKV-------------MLVAG-----DHRVG  679


 Score = 91.7 bits (226),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 63/168 (38%), Positives = 90/168 (54%), Gaps = 8/168 (5%)
 Frame = +1

Query  925   MPEDQSVIGRRRIYYDMNSGEAL--icsdsdeeiieeegenefaesedYILRMTIEKVGL  1098
             M +DQSV+GRRRIYYD    EAL    SD +    EEE        +  I R T E  GL
Sbjct  1     MADDQSVVGRRRIYYDPIGNEALICSDSDEEIPEPEEEKHFFTEGEDQLIWRATQEH-GL  59

Query  1099  YDMVLDLLANHFSRKPSEVKARYKDLIKEGATSKNENTEVTINSYLDEDLDAALSSFDNL  1278
                V+++L       PSE++ R + L ++   +   + ++     LD+ +DA L SFDNL
Sbjct  60    NREVVNVLCQFIDSTPSEIEERSEVLFEKNEKNSGSSDKIERQLSLDKTMDAVLDSFDNL  119

Query  1279  FCQRCFVFNCQLHGCSQDLIILKQIRVREELCAHYTPCNC*PHCGKKC  1422
             FC+RC VF+C+LHGCSQ+L+        E+    + P      CG++C
Sbjct  120   FCRRCLVFDCRLHGCSQNLVFPS-----EKQPYSFEPDENKKPCGRQC  162


 Score = 58.5 bits (140),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSK  2164
             +++V GDHR+GI+A + + A +EL YDY+Y PD  PAWA+  + S K
Sbjct  669   VMLVAGDHRVGIYAKEHIEASEELFYDYRYGPDQAPAWARRPEGSKK  715



>ref|XP_011082418.1| PREDICTED: histone-lysine N-methyltransferase EZ3 isoform X3 
[Sesamum indicum]
 ref|XP_011082419.1| PREDICTED: histone-lysine N-methyltransferase EZ3 isoform X3 
[Sesamum indicum]
Length=669

 Score =   270 bits (689),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 130/228 (57%), Positives = 163/228 (71%), Gaps = 6/228 (3%)
 Frame = +1

Query  1360  REELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKNECATNYCP  1539
             +++ C  YTPC C   CGK+CPC+     CEK+CGC   CK  F+GCHC K++C +  CP
Sbjct  413   KDQPCKQYTPCGCQSLCGKQCPCLKNGTCCEKYCGCSKGCKNRFRGCHCAKSQCKSRQCP  472

Query  1540  CYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLLGRSDIAGW  1719
             C+A+GRECDPDVC  CWVSCGDGS+G PP K  + +C NM+LLL  QQ++LL +SD+AGW
Sbjct  473   CFAAGRECDPDVCRNCWVSCGDGSLGEPP-KQGDGQCGNMRLLLRQQQRILLSKSDVAGW  531

Query  1720  GAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQLVIDAYRRG  1899
             GAFLKN    V+KN+++G YTGELISH EADK GK+YDR N SFLF+LNDQ V+DAYR+G
Sbjct  532   GAFLKN---SVNKNDYLGEYTGELISHREADKRGKIYDRANSSFLFDLNDQYVLDAYRKG  588

Query  1900  NKLKFINHSPDPNCFAKVNCSLSPCLLQCF--QLIVAGGSFSIDHRSG  2037
             +KLKF NHS  PNC+AKV        +  F  + I AG     D+R G
Sbjct  589   DKLKFANHSSTPNCYAKVMLVAGDHRVGIFANERIEAGEELFYDYRYG  636


 Score = 93.6 bits (231),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 69/147 (47%), Positives = 89/147 (61%), Gaps = 11/147 (7%)
 Frame = +1

Query  925   MPEDQSVIGRRRIYYDMNSGEALi-csdsdeeiieeegenefaesedYILRMTIEKVGLY  1101
             M +DQSV+GRRRIYYD +  EALI     +E    E  ++EF+E ED ILRM  E+ G+ 
Sbjct  1     MADDQSVVGRRRIYYDQHGSEALICSDSEEELGEPEGEKHEFSEVEDRILRMASEEFGVG  60

Query  1102  DMVLDLLANHFSRKPSEVKAR-----YKDLI---KEGATSKNENTEVTINSYLDEDLDAA  1257
             D VL+ L         E++ R      KD I    +  +S  E +E   N +LD+ L AA
Sbjct  61    DEVLNALTQFVGGTSREIQERCNMFMEKDRIMGKHKLQSSGEEGSE--DNVFLDKSLSAA  118

Query  1258  LSSFDNLFCQRCFVFNCQLHGCSQDLI  1338
             L SFDNLFC+RC VF+C+LHGCSQ LI
Sbjct  119   LDSFDNLFCRRCLVFDCRLHGCSQILI  145


 Score = 65.1 bits (157),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSKK  2167
             +++V GDHR+GIFA + + AG+EL YDY+Y PD  PAWA+  ++SSK+
Sbjct  606   VMLVAGDHRVGIFANERIEAGEELFYDYRYGPDQAPAWARKPEASSKR  653



>ref|XP_010652245.1| PREDICTED: histone-lysine N-methyltransferase EZA1 isoform X3 
[Vitis vinifera]
Length=763

 Score =   271 bits (694),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 130/228 (57%), Positives = 163/228 (71%), Gaps = 6/228 (3%)
 Frame = +1

Query  1360  REELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKNECATNYCP  1539
             + + C  YTPC C   CGK+CPC      CEK+CGC  +CK  F+GCHC K++C +  CP
Sbjct  508   KNQSCKQYTPCGCLSMCGKECPCQSNGTCCEKYCGCSKSCKNRFRGCHCAKSQCRSRQCP  567

Query  1540  CYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLLGRSDIAGW  1719
             C+A+GRECDPDVC  CWVSCGDGS+G PP K  + +C NM+LLL  QQ++LL +SD+AGW
Sbjct  568   CFAAGRECDPDVCRNCWVSCGDGSLGEPP-KRGDGQCGNMRLLLRQQQRILLAKSDVAGW  626

Query  1720  GAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQLVIDAYRRG  1899
             GAFLKN    V+KN+++G YTGELISH EADK GK+YDR N SFLF+LNDQ V+DAYR+G
Sbjct  627   GAFLKN---SVNKNDYLGEYTGELISHREADKRGKIYDRANSSFLFDLNDQYVLDAYRKG  683

Query  1900  NKLKFINHSPDPNCFAKVNCSLSPCLLQCF--QLIVAGGSFSIDHRSG  2037
             +KLKF NHS +PNC+AKV        +  F  + I AG     D+R G
Sbjct  684   DKLKFANHSSNPNCYAKVMLVAGDHRVGIFAKEHIEAGEELFYDYRYG  731


 Score = 92.4 bits (228),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 68/147 (46%), Positives = 92/147 (63%), Gaps = 11/147 (7%)
 Frame = +1

Query  925   MPEDQSVIGRRRIYYDMNSGEALi-csdsdeeiieeegenefaesedYILRMTIEKVGLY  1101
             M EDQSV+GRRRIYYD +  EALI     ++    EE ++EF+ESED IL M  ++ GL 
Sbjct  1     MAEDQSVVGRRRIYYDQHGSEALICSDSEEDIPEPEEEKHEFSESEDRILWMAFKEHGLS  60

Query  1102  DMVLDLLANHFSRKPSEVKAR-------YKDLIKEGATSKNEN-TEVTINSYLDEDLDAA  1257
             + VLDL++ +     SE++ R       Y+D   +      E+ +E +I   LD+ L AA
Sbjct  61    EEVLDLVSQYIGGSNSEIQDRCNILREKYQDKHDKSLKGSGESWSERSI--LLDKSLGAA  118

Query  1258  LSSFDNLFCQRCFVFNCQLHGCSQDLI  1338
             L SFDNLFC+RC VF+C+LHGCSQ  I
Sbjct  119   LDSFDNLFCRRCLVFDCRLHGCSQSPI  145


 Score = 62.0 bits (149),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSK  2164
             +++V GDHR+GIFA + + AG+EL YDY+Y PD  PAWA+  ++S +
Sbjct  701   VMLVAGDHRVGIFAKEHIEAGEELFYDYRYGPDQAPAWARKPEASKR  747



>ref|XP_011082416.1| PREDICTED: histone-lysine N-methyltransferase EZA1 isoform X1 
[Sesamum indicum]
Length=804

 Score =   271 bits (694),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 130/228 (57%), Positives = 163/228 (71%), Gaps = 6/228 (3%)
 Frame = +1

Query  1360  REELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKNECATNYCP  1539
             +++ C  YTPC C   CGK+CPC+     CEK+CGC   CK  F+GCHC K++C +  CP
Sbjct  548   KDQPCKQYTPCGCQSLCGKQCPCLKNGTCCEKYCGCSKGCKNRFRGCHCAKSQCKSRQCP  607

Query  1540  CYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLLGRSDIAGW  1719
             C+A+GRECDPDVC  CWVSCGDGS+G PP K  + +C NM+LLL  QQ++LL +SD+AGW
Sbjct  608   CFAAGRECDPDVCRNCWVSCGDGSLGEPP-KQGDGQCGNMRLLLRQQQRILLSKSDVAGW  666

Query  1720  GAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQLVIDAYRRG  1899
             GAFLKN    V+KN+++G YTGELISH EADK GK+YDR N SFLF+LNDQ V+DAYR+G
Sbjct  667   GAFLKN---SVNKNDYLGEYTGELISHREADKRGKIYDRANSSFLFDLNDQYVLDAYRKG  723

Query  1900  NKLKFINHSPDPNCFAKVNCSLSPCLLQCF--QLIVAGGSFSIDHRSG  2037
             +KLKF NHS  PNC+AKV        +  F  + I AG     D+R G
Sbjct  724   DKLKFANHSSTPNCYAKVMLVAGDHRVGIFANERIEAGEELFYDYRYG  771


 Score =   115 bits (287),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 78/159 (49%), Positives = 99/159 (62%), Gaps = 11/159 (7%)
 Frame = +1

Query  889   YTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALi-csdsdeeiieeegenefaesedY  1065
             YTTW FL RNQ+M +DQSV+GRRRIYYD +  EALI     +E    E  ++EF+E ED 
Sbjct  124   YTTWIFLDRNQRMADDQSVVGRRRIYYDQHGSEALICSDSEEELGEPEGEKHEFSEVEDR  183

Query  1066  ILRMTIEKVGLYDMVLDLLANHFSRKPSEVKAR-----YKDLI---KEGATSKNENTEVT  1221
             ILRM  E+ G+ D VL+ L         E++ R      KD I    +  +S  E +E  
Sbjct  184   ILRMASEEFGVGDEVLNALTQFVGGTSREIQERCNMFMEKDRIMGKHKLQSSGEEGSE--  241

Query  1222  INSYLDEDLDAALSSFDNLFCQRCFVFNCQLHGCSQDLI  1338
              N +LD+ L AAL SFDNLFC+RC VF+C+LHGCSQ LI
Sbjct  242   DNVFLDKSLSAALDSFDNLFCRRCLVFDCRLHGCSQILI  280


 Score = 65.5 bits (158),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSKK  2167
             +++V GDHR+GIFA + + AG+EL YDY+Y PD  PAWA+  ++SSK+
Sbjct  741   VMLVAGDHRVGIFANERIEAGEELFYDYRYGPDQAPAWARKPEASSKR  788



>tpg|DAA45021.1| TPA: putative SET-domain containing protein family [Zea mays]
Length=895

 Score =   273 bits (698),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 131/234 (56%), Positives = 164/234 (70%), Gaps = 21/234 (9%)
 Frame = +1

Query  1336  IILKQIRVREELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKN  1515
              + K+I   ++    Y PC C   CGK CPCV     CEK+CGC  +CK  F+GCHC K+
Sbjct  632   TVRKRIGDGKQWYTQYNPCVCQQMCGKDCPCVENGTCCEKYCGCSKSCKNKFRGCHCAKS  691

Query  1516  ECATNYCPCYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLL  1695
             +C +  CPC+A+ RECDPDVC  CWVSCGDGS+G PP +   ++C NMKLLL  QQ++LL
Sbjct  692   QCRSRQCPCFAASRECDPDVCRNCWVSCGDGSLGEPPARGDGYQCGNMKLLLKQQQRILL  751

Query  1696  GRSDIAGWGAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQL  1875
             GRSD+AGWGAF+KN    V+KN+++G YTGELISH EADK GK+YDR N SFLF+LNDQ 
Sbjct  752   GRSDVAGWGAFIKN---PVNKNDYLGEYTGELISHKEADKRGKIYDRANSSFLFDLNDQY  808

Query  1876  VIDAYRRGNKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
             V+DAYR+G+KLKF NHS +PNC+AKV             ++VAG     DHR G
Sbjct  809   VLDAYRKGDKLKFANHSSNPNCYAKV-------------MLVAG-----DHRVG  844


 Score =   112 bits (279),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 71/180 (39%), Positives = 100/180 (56%), Gaps = 8/180 (4%)
 Frame = +1

Query  889   YTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEAL--icsdsdeeiieeegenefaesed  1062
             YTTW FL +NQ+M +DQSV+GRRRIYYD    EAL    SD +    EEE        + 
Sbjct  157   YTTWIFLDKNQRMADDQSVVGRRRIYYDPIGNEALICSDSDEEIPEPEEEKHFFTEGEDQ  216

Query  1063  YILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLIKEGATSKNENTEVTINSYLDE  1242
              I R T E  GL   V+++L       PSE++ R + L ++   +   + ++     LD+
Sbjct  217   LIWRATQEH-GLNREVVNVLCQFIDSTPSEIEERSEVLFEKNEKNSGSSDKIERQLSLDK  275

Query  1243  DLDAALSSFDNLFCQRCFVFNCQLHGCSQDLIILKQIRVREELCAHYTPCNC*PHCGKKC  1422
              +DA L SFDNLFC+RC VF+C+LHGCSQ+L+        E+    + P      CG++C
Sbjct  276   TMDAVLDSFDNLFCRRCLVFDCRLHGCSQNLVFPS-----EKQPYSFEPDENKKPCGRQC  330


 Score = 58.9 bits (141),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSK  2164
             +++V GDHR+GI+A + + A +EL YDY+Y PD  PAWA+  + S K
Sbjct  834   VMLVAGDHRVGIYAKEHIEASEELFYDYRYGPDQAPAWARRPEGSKK  880



>ref|XP_008648292.1| PREDICTED: histone-lysine N-methyltransferase EZ3 isoform X1 
[Zea mays]
 tpg|DAA45022.1| TPA: putative SET-domain containing protein family [Zea mays]
Length=898

 Score =   273 bits (698),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 131/234 (56%), Positives = 164/234 (70%), Gaps = 21/234 (9%)
 Frame = +1

Query  1336  IILKQIRVREELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKN  1515
              + K+I   ++    Y PC C   CGK CPCV     CEK+CGC  +CK  F+GCHC K+
Sbjct  635   TVRKRIGDGKQWYTQYNPCVCQQMCGKDCPCVENGTCCEKYCGCSKSCKNKFRGCHCAKS  694

Query  1516  ECATNYCPCYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLL  1695
             +C +  CPC+A+ RECDPDVC  CWVSCGDGS+G PP +   ++C NMKLLL  QQ++LL
Sbjct  695   QCRSRQCPCFAASRECDPDVCRNCWVSCGDGSLGEPPARGDGYQCGNMKLLLKQQQRILL  754

Query  1696  GRSDIAGWGAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQL  1875
             GRSD+AGWGAF+KN    V+KN+++G YTGELISH EADK GK+YDR N SFLF+LNDQ 
Sbjct  755   GRSDVAGWGAFIKN---PVNKNDYLGEYTGELISHKEADKRGKIYDRANSSFLFDLNDQY  811

Query  1876  VIDAYRRGNKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
             V+DAYR+G+KLKF NHS +PNC+AKV             ++VAG     DHR G
Sbjct  812   VLDAYRKGDKLKFANHSSNPNCYAKV-------------MLVAG-----DHRVG  847


 Score =   112 bits (279),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 71/180 (39%), Positives = 100/180 (56%), Gaps = 8/180 (4%)
 Frame = +1

Query  889   YTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEAL--icsdsdeeiieeegenefaesed  1062
             YTTW FL +NQ+M +DQSV+GRRRIYYD    EAL    SD +    EEE        + 
Sbjct  157   YTTWIFLDKNQRMADDQSVVGRRRIYYDPIGNEALICSDSDEEIPEPEEEKHFFTEGEDQ  216

Query  1063  YILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLIKEGATSKNENTEVTINSYLDE  1242
              I R T E  GL   V+++L       PSE++ R + L ++   +   + ++     LD+
Sbjct  217   LIWRATQEH-GLNREVVNVLCQFIDSTPSEIEERSEVLFEKNEKNSGSSDKIERQLSLDK  275

Query  1243  DLDAALSSFDNLFCQRCFVFNCQLHGCSQDLIILKQIRVREELCAHYTPCNC*PHCGKKC  1422
              +DA L SFDNLFC+RC VF+C+LHGCSQ+L+        E+    + P      CG++C
Sbjct  276   TMDAVLDSFDNLFCRRCLVFDCRLHGCSQNLVFPS-----EKQPYSFEPDENKKPCGRQC  330


 Score = 58.9 bits (141),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSK  2164
             +++V GDHR+GI+A + + A +EL YDY+Y PD  PAWA+  + S K
Sbjct  837   VMLVAGDHRVGIYAKEHIEASEELFYDYRYGPDQAPAWARRPEGSKK  883



>ref|NP_001105079.1| histone-lysine N-methyltransferase EZ3 [Zea mays]
 sp|Q8S4P4.1|EZ3_MAIZE RecName: Full=Histone-lysine N-methyltransferase EZ3; AltName: 
Full=Enhancer of zeste protein 3 [Zea mays]
 gb|AAM13422.1|AF443598_1 enhancer of zeste-like protein 3 [Zea mays]
Length=895

 Score =   273 bits (698),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 131/234 (56%), Positives = 164/234 (70%), Gaps = 21/234 (9%)
 Frame = +1

Query  1336  IILKQIRVREELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKN  1515
              + K+I   ++    Y PC C   CGK CPCV     CEK+CGC  +CK  F+GCHC K+
Sbjct  632   TVRKRIGDGKQWYTQYNPCVCQQMCGKDCPCVENGTCCEKYCGCSKSCKNKFRGCHCAKS  691

Query  1516  ECATNYCPCYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLL  1695
             +C +  CPC+A+ RECDPDVC  CWVSCGDGS+G PP +   ++C NMKLLL  QQ++LL
Sbjct  692   QCRSRQCPCFAASRECDPDVCRNCWVSCGDGSLGEPPARGDGYQCGNMKLLLKQQQRILL  751

Query  1696  GRSDIAGWGAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQL  1875
             GRSD+AGWGAF+KN    V+KN+++G YTGELISH EADK GK+YDR N SFLF+LNDQ 
Sbjct  752   GRSDVAGWGAFIKN---PVNKNDYLGEYTGELISHKEADKRGKIYDRANSSFLFDLNDQY  808

Query  1876  VIDAYRRGNKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
             V+DAYR+G+KLKF NHS +PNC+AKV             ++VAG     DHR G
Sbjct  809   VLDAYRKGDKLKFANHSSNPNCYAKV-------------MLVAG-----DHRVG  844


 Score =   112 bits (279),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 71/180 (39%), Positives = 100/180 (56%), Gaps = 8/180 (4%)
 Frame = +1

Query  889   YTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEAL--icsdsdeeiieeegenefaesed  1062
             YTTW FL +NQ+M +DQSV+GRRRIYYD    EAL    SD +    EEE        + 
Sbjct  157   YTTWIFLDKNQRMADDQSVVGRRRIYYDPVGNEALICSDSDEEIPEPEEEKHFFTEGEDQ  216

Query  1063  YILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLIKEGATSKNENTEVTINSYLDE  1242
              I R T E  GL   V+++L       PSE++ R + L ++   +   + ++     LD+
Sbjct  217   LIWRATQEH-GLNREVVNVLCQFIDSTPSEIEERSEVLFEKNEKNSGSSDKIERQLSLDK  275

Query  1243  DLDAALSSFDNLFCQRCFVFNCQLHGCSQDLIILKQIRVREELCAHYTPCNC*PHCGKKC  1422
              +DA L SFDNLFC+RC VF+C+LHGCSQ+L+        E+    + P      CG++C
Sbjct  276   TMDAVLDSFDNLFCRRCLVFDCRLHGCSQNLVFPT-----EKQPYSFEPDENKKPCGRQC  330


 Score = 58.9 bits (141),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSK  2164
             +++V GDHR+GI+A + + A +EL YDY+Y PD  PAWA+  + S K
Sbjct  834   VMLVAGDHRVGIYAKEHIEASEELFYDYRYGPDQAPAWARRPEGSKK  880



>ref|XP_002465374.1| hypothetical protein SORBIDRAFT_01g037450 [Sorghum bicolor]
 gb|EER92372.1| hypothetical protein SORBIDRAFT_01g037450 [Sorghum bicolor]
 gb|ACV60617.1| enhancer of zeste-like protein 3 [Sorghum bicolor]
Length=899

 Score =   273 bits (698),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 131/234 (56%), Positives = 164/234 (70%), Gaps = 21/234 (9%)
 Frame = +1

Query  1336  IILKQIRVREELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKN  1515
              + K+I   ++    Y PC C   CGK CPCV     CEK+CGC  +CK  F+GCHC K+
Sbjct  636   TVRKRIGDGKQWYTQYNPCVCQQMCGKDCPCVENGTCCEKYCGCSKSCKNKFRGCHCAKS  695

Query  1516  ECATNYCPCYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLL  1695
             +C +  CPC+A+ RECDPDVC  CWVSCGDGS+G PP +   ++C NMKLLL  QQ++LL
Sbjct  696   QCRSRQCPCFAANRECDPDVCRNCWVSCGDGSLGEPPARGDGYQCGNMKLLLKQQQRILL  755

Query  1696  GRSDIAGWGAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQL  1875
             GRSD+AGWGAF+KN    V+KN+++G YTGELISH EADK GK+YDR N SFLF+LNDQ 
Sbjct  756   GRSDVAGWGAFIKN---PVNKNDYLGEYTGELISHKEADKRGKIYDRANSSFLFDLNDQY  812

Query  1876  VIDAYRRGNKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
             V+DAYR+G+KLKF NHS +PNC+AKV             ++VAG     DHR G
Sbjct  813   VLDAYRKGDKLKFANHSSNPNCYAKV-------------MLVAG-----DHRVG  848


 Score =   111 bits (277),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 66/153 (43%), Positives = 90/153 (59%), Gaps = 3/153 (2%)
 Frame = +1

Query  889   YTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEAL--icsdsdeeiieeegenefaesed  1062
             YTTW FL +NQ+M +DQSV+GRRRIYYD    EAL    SD +    EEE        + 
Sbjct  158   YTTWIFLDKNQRMADDQSVVGRRRIYYDPVGNEALICSDSDEEIPEPEEEKHFFTEGEDQ  217

Query  1063  YILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLIKEGATSKNENTEVTINSYLDE  1242
              I R T E  GL   V+++L       PSE++ R + L ++       + ++     LD+
Sbjct  218   LIWRATQEH-GLNREVINVLCQFIDATPSEIEERSEVLFEKNEKHSASSDKIESQLSLDK  276

Query  1243  DLDAALSSFDNLFCQRCFVFNCQLHGCSQDLII  1341
              +DA L SFDNLFC+RC VF+C+LHGCSQ+L+ 
Sbjct  277   TMDAVLDSFDNLFCRRCLVFDCRLHGCSQNLVF  309


 Score = 60.1 bits (144),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSK  2164
             +++V GDHR+GI+A + + A DEL YDY+Y PD  PAWA+  + S K
Sbjct  838   VMLVAGDHRVGIYAKEHIEASDELFYDYRYGPDQAPAWARRPEGSKK  884



>gb|AHA56717.1| EZ2 [Eulaliopsis binata]
Length=898

 Score =   272 bits (696),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 131/234 (56%), Positives = 164/234 (70%), Gaps = 21/234 (9%)
 Frame = +1

Query  1336  IILKQIRVREELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKN  1515
              + K+I   ++    Y PC C   CGK CPCV     CEK+CGC  +CK  F+GCHC K+
Sbjct  635   TVRKRIGDGKQWYTQYNPCVCQQMCGKDCPCVENGTCCEKYCGCSKSCKNKFRGCHCAKS  694

Query  1516  ECATNYCPCYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLL  1695
             +C +  CPC+A+ RECDPDVC  CWVSCGDGS+G PP +   ++C NMKLLL  QQ++LL
Sbjct  695   QCRSRQCPCFAANRECDPDVCRNCWVSCGDGSLGEPPARGDGYQCGNMKLLLKQQQRILL  754

Query  1696  GRSDIAGWGAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQL  1875
             GRSD+AGWGAF+KN    V+KN+++G YTGELISH EADK GK+YDR N SFLF+LNDQ 
Sbjct  755   GRSDVAGWGAFIKN---PVNKNDYLGEYTGELISHKEADKRGKIYDRANSSFLFDLNDQY  811

Query  1876  VIDAYRRGNKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
             V+DAYR+G+KLKF NHS +PNC+AKV             ++VAG     DHR G
Sbjct  812   VLDAYRKGDKLKFANHSSNPNCYAKV-------------MLVAG-----DHRVG  847


 Score =   112 bits (281),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 66/152 (43%), Positives = 94/152 (62%), Gaps = 1/152 (1%)
 Frame = +1

Query  889   YTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALi-csdsdeeiieeegenefaesedY  1065
             YTTW FL +NQ+M EDQSV+GRRRIYYD    EALI     +E    EE ++ F E ED 
Sbjct  157   YTTWIFLDKNQRMAEDQSVVGRRRIYYDPVGNEALICSDSDEEIPEPEEEKHFFTEGEDQ  216

Query  1066  ILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLIKEGATSKNENTEVTINSYLDED  1245
             ++    ++ GL   V++L+       PSE++ RY+ L ++       + ++     LD+ 
Sbjct  217   LIWRAAQEYGLNREVVNLVCQFIDATPSEIEERYEVLFEKNEKYSGSSDKIESQLSLDKT  276

Query  1246  LDAALSSFDNLFCQRCFVFNCQLHGCSQDLII  1341
             +D  L SFDNLFC+RC VF+C+LHGCSQ+L+ 
Sbjct  277   MDTILDSFDNLFCRRCLVFDCRLHGCSQNLVF  308


 Score = 58.9 bits (141),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSK  2164
             +++V GDHR+GI+A + + A +EL YDY+Y PD  PAWA+  + S K
Sbjct  837   VMLVAGDHRVGIYAKEHIEASEELFYDYRYGPDQAPAWARRPEGSKK  883



>ref|XP_002270605.1| PREDICTED: histone-lysine N-methyltransferase EZA1 isoform X1 
[Vitis vinifera]
Length=906

 Score =   273 bits (697),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 130/228 (57%), Positives = 163/228 (71%), Gaps = 6/228 (3%)
 Frame = +1

Query  1360  REELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKNECATNYCP  1539
             + + C  YTPC C   CGK+CPC      CEK+CGC  +CK  F+GCHC K++C +  CP
Sbjct  651   KNQSCKQYTPCGCLSMCGKECPCQSNGTCCEKYCGCSKSCKNRFRGCHCAKSQCRSRQCP  710

Query  1540  CYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLLGRSDIAGW  1719
             C+A+GRECDPDVC  CWVSCGDGS+G PP K  + +C NM+LLL  QQ++LL +SD+AGW
Sbjct  711   CFAAGRECDPDVCRNCWVSCGDGSLGEPP-KRGDGQCGNMRLLLRQQQRILLAKSDVAGW  769

Query  1720  GAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQLVIDAYRRG  1899
             GAFLKN    V+KN+++G YTGELISH EADK GK+YDR N SFLF+LNDQ V+DAYR+G
Sbjct  770   GAFLKN---SVNKNDYLGEYTGELISHREADKRGKIYDRANSSFLFDLNDQYVLDAYRKG  826

Query  1900  NKLKFINHSPDPNCFAKVNCSLSPCLLQCF--QLIVAGGSFSIDHRSG  2037
             +KLKF NHS +PNC+AKV        +  F  + I AG     D+R G
Sbjct  827   DKLKFANHSSNPNCYAKVMLVAGDHRVGIFAKEHIEAGEELFYDYRYG  874


 Score =   115 bits (287),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 94/240 (39%), Positives = 135/240 (56%), Gaps = 25/240 (10%)
 Frame = +1

Query  649   HLDPSTGPPLTGLV-GDGSADLLAKRQTDAFDLQNSIGTGSGNKICSSQEDGYASSDLRS  825
              L P+T      L+ G+G   +L+ R  +     +    GSG+K  ++ ++  +S+  + 
Sbjct  64    QLVPATSKKDVLLIEGNGPGSMLSLRAENPLFKFSGFPQGSGDKDYANSQEVVSSTSTKL  123

Query  826   SIVLKNAVCpiklpklekippYTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALi-cs  1002
               V K             IPPYT+W FL RNQ+M EDQSV+GRRRIYYD +  EALI   
Sbjct  124   PYVEK-------------IPPYTSWIFLDRNQRMAEDQSVVGRRRIYYDQHGSEALICSD  170

Query  1003  dsdeeiieeegenefaesedYILRMTIEKVGLYDMVLDLLANHFSRKPSEVKAR------  1164
               ++    EE ++EF+ESED IL M  ++ GL + VLDL++ +     SE++ R      
Sbjct  171   SEEDIPEPEEEKHEFSESEDRILWMAFKEHGLSEEVLDLVSQYIGGSNSEIQDRCNILRE  230

Query  1165  -YKDLIKEGATSKNEN-TEVTINSYLDEDLDAALSSFDNLFCQRCFVFNCQLHGCSQDLI  1338
              Y+D   +      E+ +E +I   LD+ L AAL SFDNLFC+RC VF+C+LHGCSQ  I
Sbjct  231   KYQDKHDKSLKGSGESWSERSI--LLDKSLGAALDSFDNLFCRRCLVFDCRLHGCSQSPI  288


 Score = 62.4 bits (150),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSK  2164
             +++V GDHR+GIFA + + AG+EL YDY+Y PD  PAWA+  ++S +
Sbjct  844   VMLVAGDHRVGIFAKEHIEAGEELFYDYRYGPDQAPAWARKPEASKR  890



>ref|XP_006349182.1| PREDICTED: histone-lysine N-methyltransferase EZA1-like [Solanum 
tuberosum]
Length=829

 Score =   271 bits (693),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 130/226 (58%), Positives = 160/226 (71%), Gaps = 22/226 (10%)
 Frame = +1

Query  1360  REELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKNECATNYCP  1539
             + + C  Y PC C P CGK CPC+     CEK+CGC  +CK  F+GCHC K++C +  CP
Sbjct  576   KNQSCIQYNPCGCQPMCGKHCPCLQNGTCCEKYCGCSKSCKNRFRGCHCAKSQCRSRQCP  635

Query  1540  CYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLLGRSDIAGW  1719
             C+A+GRECDPDVC  CWVSCGDGS+G PP +    +C NM+LLL  QQ++LL +SD+AGW
Sbjct  636   CFAAGRECDPDVCRNCWVSCGDGSLGEPP-RQGEGQCGNMRLLLRQQQRILLSKSDVAGW  694

Query  1720  GAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQLVIDAYRRG  1899
             GAFLKN V    KN+++G YTGELISH EADK GK+YDR N SFLF+LNDQ V+DAYR+G
Sbjct  695   GAFLKNPVY---KNDYLGEYTGELISHREADKRGKIYDRANSSFLFDLNDQYVLDAYRKG  751

Query  1900  NKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
             +KLKF NHS +PNCFAKV             ++VAG     DHR G
Sbjct  752   DKLKFANHSSNPNCFAKV-------------MLVAG-----DHRVG  779


 Score =   114 bits (284),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 74/159 (47%), Positives = 100/159 (63%), Gaps = 11/159 (7%)
 Frame = +1

Query  889   YTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALi-csdsdeeiieeegenefaesedY  1065
             YTTW FL +NQ+M EDQSV+GRRRIYYD +  EALI     ++    EE +  F+E ED 
Sbjct  133   YTTWIFLDKNQRMAEDQSVVGRRRIYYDQHGSEALICSDSEEDIAEPEEEKRHFSEGEDK  192

Query  1066  ILRMTIEKVGLYDMVLDLLANHFSRKPSEV-------KARYKDLIKEGATSKNENTEVTI  1224
             ILRM  ++ GL + VLD+L  +     SE+       + +++D   +G + K+       
Sbjct  193   ILRMASQEFGLNEEVLDILTQYVGGTTSEILEHCNVLEEKHQDT--DGKSLKDSRESGFG  250

Query  1225  NS-YLDEDLDAALSSFDNLFCQRCFVFNCQLHGCSQDLI  1338
              S +LD+ L AAL SFDNLFC+RC VF+C+LHGCSQ LI
Sbjct  251   GSMFLDKSLTAALDSFDNLFCRRCLVFDCRLHGCSQILI  289


 Score = 54.3 bits (129),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 22/43 (51%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +2

Query  2015  FR*IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAK  2143
             F  +++V GDHR+GIFA + + A +EL YDY+Y PD  P WA+
Sbjct  766   FAKVMLVAGDHRVGIFAKERIEASEELFYDYRYGPDQAPIWAR  808



>ref|XP_010652244.1| PREDICTED: histone-lysine N-methyltransferase EZA1 isoform X2 
[Vitis vinifera]
Length=902

 Score =   272 bits (696),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 130/228 (57%), Positives = 163/228 (71%), Gaps = 6/228 (3%)
 Frame = +1

Query  1360  REELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKNECATNYCP  1539
             + + C  YTPC C   CGK+CPC      CEK+CGC  +CK  F+GCHC K++C +  CP
Sbjct  647   KNQSCKQYTPCGCLSMCGKECPCQSNGTCCEKYCGCSKSCKNRFRGCHCAKSQCRSRQCP  706

Query  1540  CYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLLGRSDIAGW  1719
             C+A+GRECDPDVC  CWVSCGDGS+G PP K  + +C NM+LLL  QQ++LL +SD+AGW
Sbjct  707   CFAAGRECDPDVCRNCWVSCGDGSLGEPP-KRGDGQCGNMRLLLRQQQRILLAKSDVAGW  765

Query  1720  GAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQLVIDAYRRG  1899
             GAFLKN    V+KN+++G YTGELISH EADK GK+YDR N SFLF+LNDQ V+DAYR+G
Sbjct  766   GAFLKN---SVNKNDYLGEYTGELISHREADKRGKIYDRANSSFLFDLNDQYVLDAYRKG  822

Query  1900  NKLKFINHSPDPNCFAKVNCSLSPCLLQCF--QLIVAGGSFSIDHRSG  2037
             +KLKF NHS +PNC+AKV        +  F  + I AG     D+R G
Sbjct  823   DKLKFANHSSNPNCYAKVMLVAGDHRVGIFAKEHIEAGEELFYDYRYG  870


 Score =   115 bits (287),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 94/240 (39%), Positives = 135/240 (56%), Gaps = 25/240 (10%)
 Frame = +1

Query  649   HLDPSTGPPLTGLV-GDGSADLLAKRQTDAFDLQNSIGTGSGNKICSSQEDGYASSDLRS  825
              L P+T      L+ G+G   +L+ R  +     +    GSG+K  ++ ++  +S+  + 
Sbjct  64    QLVPATSKKDVLLIEGNGPGSMLSLRAENPLFKFSGFPQGSGDKDYANSQEVVSSTSTKL  123

Query  826   SIVLKNAVCpiklpklekippYTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALi-cs  1002
               V K             IPPYT+W FL RNQ+M EDQSV+GRRRIYYD +  EALI   
Sbjct  124   PYVEK-------------IPPYTSWIFLDRNQRMAEDQSVVGRRRIYYDQHGSEALICSD  170

Query  1003  dsdeeiieeegenefaesedYILRMTIEKVGLYDMVLDLLANHFSRKPSEVKAR------  1164
               ++    EE ++EF+ESED IL M  ++ GL + VLDL++ +     SE++ R      
Sbjct  171   SEEDIPEPEEEKHEFSESEDRILWMAFKEHGLSEEVLDLVSQYIGGSNSEIQDRCNILRE  230

Query  1165  -YKDLIKEGATSKNEN-TEVTINSYLDEDLDAALSSFDNLFCQRCFVFNCQLHGCSQDLI  1338
              Y+D   +      E+ +E +I   LD+ L AAL SFDNLFC+RC VF+C+LHGCSQ  I
Sbjct  231   KYQDKHDKSLKGSGESWSERSI--LLDKSLGAALDSFDNLFCRRCLVFDCRLHGCSQSPI  288


 Score = 62.4 bits (150),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSK  2164
             +++V GDHR+GIFA + + AG+EL YDY+Y PD  PAWA+  ++S +
Sbjct  840   VMLVAGDHRVGIFAKEHIEAGEELFYDYRYGPDQAPAWARKPEASKR  886



>ref|XP_010556692.1| PREDICTED: histone-lysine N-methyltransferase EZA1 isoform X1 
[Tarenaya hassleriana]
Length=900

 Score =   272 bits (695),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 130/222 (59%), Positives = 159/222 (72%), Gaps = 22/222 (10%)
 Frame = +1

Query  1372  CAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKNECATNYCPCYAS  1551
             C  YTPC+C   CGK+CPC+     CEK+CGC  +CK  F+GCHC K++C +  CPC+A+
Sbjct  649   CKQYTPCSCQSMCGKECPCLTNGTCCEKYCGCSKSCKNRFRGCHCAKSQCRSRQCPCFAA  708

Query  1552  GRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLLGRSDIAGWGAFL  1731
             GRECDPDVC  CWVSCGDGS+G PP K    +C NM+LLL  QQ++LL +SD+AGWGAFL
Sbjct  709   GRECDPDVCRNCWVSCGDGSLGEPP-KRGEGQCGNMRLLLRQQQRILLAKSDVAGWGAFL  767

Query  1732  KNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQLVIDAYRRGNKLK  1911
             KN    V+KNE++G YTGELISH EADK GK+YDR N SFLF+LNDQ V+DA+R+G+KLK
Sbjct  768   KN---SVNKNEYLGEYTGELISHREADKRGKIYDRANSSFLFDLNDQYVLDAHRKGDKLK  824

Query  1912  FINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
             F NHS  PNC+AKV             + VAG     DHR G
Sbjct  825   FANHSSKPNCYAKV-------------MFVAG-----DHRVG  848


 Score =   110 bits (276),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 73/152 (48%), Positives = 99/152 (65%), Gaps = 2/152 (1%)
 Frame = +1

Query  889   YTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALicsdsdeeiieeegenefaesedYI  1068
             YTTW FL RNQ+M EDQSV+GRR+IYYD + GE LICSDS+E+   +E ++EFAE +D +
Sbjct  174   YTTWIFLDRNQRMAEDQSVLGRRQIYYDQHGGETLICSDSEEDAEPDEEKHEFAEGQDRV  233

Query  1069  LRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLIKEGATSKNE--NTEVTINSYLDE  1242
             +    ++ GL D V D L         ++  RY DL  +   +  E  ++   +   L++
Sbjct  234   IWSIGQEYGLGDEVQDALCQFLGLNVEDILERYNDLKLKNEQNVEECSDSGSKLGISLEK  293

Query  1243  DLDAALSSFDNLFCQRCFVFNCQLHGCSQDLI  1338
              L AAL SFDNLFC+RC VF+C+LHGCSQ LI
Sbjct  294   GLSAALDSFDNLFCRRCLVFDCRLHGCSQTLI  325


 Score = 59.3 bits (142),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSK  2164
             ++ V GDHR+GIFA + + A +EL YDY+Y PD  PAWA+  + S K
Sbjct  838   VMFVAGDHRVGIFANERIEASEELFYDYRYGPDQAPAWARKPEGSKK  884



>ref|XP_010556694.1| PREDICTED: histone-lysine N-methyltransferase EZA1 isoform X2 
[Tarenaya hassleriana]
Length=899

 Score =   272 bits (695),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 130/222 (59%), Positives = 159/222 (72%), Gaps = 22/222 (10%)
 Frame = +1

Query  1372  CAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKNECATNYCPCYAS  1551
             C  YTPC+C   CGK+CPC+     CEK+CGC  +CK  F+GCHC K++C +  CPC+A+
Sbjct  648   CKQYTPCSCQSMCGKECPCLTNGTCCEKYCGCSKSCKNRFRGCHCAKSQCRSRQCPCFAA  707

Query  1552  GRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLLGRSDIAGWGAFL  1731
             GRECDPDVC  CWVSCGDGS+G PP K    +C NM+LLL  QQ++LL +SD+AGWGAFL
Sbjct  708   GRECDPDVCRNCWVSCGDGSLGEPP-KRGEGQCGNMRLLLRQQQRILLAKSDVAGWGAFL  766

Query  1732  KNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQLVIDAYRRGNKLK  1911
             KN    V+KNE++G YTGELISH EADK GK+YDR N SFLF+LNDQ V+DA+R+G+KLK
Sbjct  767   KN---SVNKNEYLGEYTGELISHREADKRGKIYDRANSSFLFDLNDQYVLDAHRKGDKLK  823

Query  1912  FINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
             F NHS  PNC+AKV             + VAG     DHR G
Sbjct  824   FANHSSKPNCYAKV-------------MFVAG-----DHRVG  847


 Score =   110 bits (276),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 73/152 (48%), Positives = 99/152 (65%), Gaps = 2/152 (1%)
 Frame = +1

Query  889   YTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALicsdsdeeiieeegenefaesedYI  1068
             YTTW FL RNQ+M EDQSV+GRR+IYYD + GE LICSDS+E+   +E ++EFAE +D +
Sbjct  173   YTTWIFLDRNQRMAEDQSVLGRRQIYYDQHGGETLICSDSEEDAEPDEEKHEFAEGQDRV  232

Query  1069  LRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLIKEGATSKNE--NTEVTINSYLDE  1242
             +    ++ GL D V D L         ++  RY DL  +   +  E  ++   +   L++
Sbjct  233   IWSIGQEYGLGDEVQDALCQFLGLNVEDILERYNDLKLKNEQNVEECSDSGSKLGISLEK  292

Query  1243  DLDAALSSFDNLFCQRCFVFNCQLHGCSQDLI  1338
              L AAL SFDNLFC+RC VF+C+LHGCSQ LI
Sbjct  293   GLSAALDSFDNLFCRRCLVFDCRLHGCSQTLI  324


 Score = 59.3 bits (142),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSK  2164
             ++ V GDHR+GIFA + + A +EL YDY+Y PD  PAWA+  + S K
Sbjct  837   VMFVAGDHRVGIFANERIEASEELFYDYRYGPDQAPAWARKPEGSKK  883



>gb|EPS72293.1| hypothetical protein M569_02463, partial [Genlisea aurea]
Length=396

 Score =   259 bits (663),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 127/222 (57%), Positives = 158/222 (71%), Gaps = 22/222 (10%)
 Frame = +1

Query  1372  CAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKNECATNYCPCYAS  1551
             C  Y PC+C P CGK+CPC+     CEK+CGC +NCK  F+GCHC K++C +  CPC+A+
Sbjct  146   CKQYNPCSCQPMCGKECPCLQTGTCCEKYCGCSINCKNRFRGCHCAKSQCKSRLCPCFAA  205

Query  1552  GRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLLGRSDIAGWGAFL  1731
             GRECDPDVC +CWV CG G +G P  +  N +C+NMKLLL  QQ++LL +SDIAGWGAFL
Sbjct  206   GRECDPDVCRYCWVGCGGGELGEPTRRGDN-QCENMKLLLRQQQRILLAKSDIAGWGAFL  264

Query  1732  KNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQLVIDAYRRGNKLK  1911
             K     V+KN+++G YTGELISH EADK GK+YDR N SFLF+LND+ V+DAYR+G+KLK
Sbjct  265   KR---NVNKNDYLGEYTGELISHQEADKRGKIYDRANSSFLFDLNDKFVLDAYRKGDKLK  321

Query  1912  FINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
             F NHS  PNC AKV             ++VAG     DHR G
Sbjct  322   FANHSSTPNCHAKV-------------MLVAG-----DHRVG  345


 Score = 58.9 bits (141),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/47 (47%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSK  2164
             +++V GDHR+GI+A + + AG E+ YDY+Y PD  PAWA+  ++S +
Sbjct  335   VMLVAGDHRVGIYANESVEAGQEIFYDYRYGPDQAPAWARKPETSKR  381



>gb|ABI94364.1| enhancer of zeste 1 [Triticum monococcum]
Length=890

 Score =   271 bits (694),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 128/220 (58%), Positives = 157/220 (71%), Gaps = 21/220 (10%)
 Frame = +1

Query  1378  HYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKNECATNYCPCYASGR  1557
              YTPC C   C K CPCV     CEK+CGC  +CK  F+GCHC K++C +  CPC+A+ R
Sbjct  642   QYTPCGCQEMCNKNCPCVENGTCCEKYCGCSKSCKNRFRGCHCAKSQCRSRQCPCFAASR  701

Query  1558  ECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLLGRSDIAGWGAFLKN  1737
             ECDPDVC  CWVSCGDGS+G PP++   ++C NMKLLL  QQ++LLG+SD+AGWGAF+KN
Sbjct  702   ECDPDVCRNCWVSCGDGSLGEPPERGDGYQCGNMKLLLKQQQRILLGKSDVAGWGAFIKN  761

Query  1738  CVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQLVIDAYRRGNKLKFI  1917
                 V KN+++G YTGELISH EADK GK+YDR N SFLF+LNDQ V+DAYR+G+KLKF 
Sbjct  762   ---PVHKNDYLGEYTGELISHKEADKRGKIYDRANSSFLFDLNDQFVLDAYRKGDKLKFA  818

Query  1918  NHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
             NHS  PNC+AKV             ++VAG     DHR G
Sbjct  819   NHSSSPNCYAKV-------------MMVAG-----DHRVG  840


 Score =   100 bits (249),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 60/153 (39%), Positives = 87/153 (57%), Gaps = 3/153 (2%)
 Frame = +1

Query  889   YTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEAL--icsdsdeeiieeegenefaesed  1062
             YTTW FL +NQ+M +D+S+ GRRRIYYD    EAL    SD +    EEE        + 
Sbjct  159   YTTWIFLDKNQRMADDRSIAGRRRIYYDSAGNEALICSESDEEIPQPEEEKHVFTEGEDQ  218

Query  1063  YILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLIKEGATSKNENTEVTINSYLDE  1242
              I + T E+ GL    L+++       PSE++ R + L ++       + ++     LD+
Sbjct  219   LIWKATQER-GLSQEDLNVICQFIDASPSEIEGRSEFLFEKHEKHSEFSDKIESQLPLDK  277

Query  1243  DLDAALSSFDNLFCQRCFVFNCQLHGCSQDLII  1341
              +D  L SFDNLFC+RC  F+C+LHGCSQ+L+ 
Sbjct  278   TVDIVLDSFDNLFCRRCLGFDCRLHGCSQNLVF  310


 Score = 56.6 bits (135),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/47 (47%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSK  2164
             +++V GDHR+GI+A + + A  EL YDY+Y PD  PAWA+  + + K
Sbjct  830   VMMVAGDHRVGIYAREHIEASAELFYDYRYGPDQAPAWARRPEGAKK  876



>ref|XP_010322207.1| PREDICTED: EZ1 protein isoform X1 [Solanum lycopersicum]
Length=828

 Score =   270 bits (690),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 129/226 (57%), Positives = 160/226 (71%), Gaps = 22/226 (10%)
 Frame = +1

Query  1360  REELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKNECATNYCP  1539
             + + C  Y PC C P CGK CPC+     CEK+CGC  +CK  F+GCHC K++C +  CP
Sbjct  575   KNQSCIQYNPCGCQPMCGKHCPCLQNGTCCEKYCGCSKSCKNRFRGCHCAKSQCRSRQCP  634

Query  1540  CYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLLGRSDIAGW  1719
             C+A+GRECDPDVC  CWVSCGDGS+G PP +    +C NM+LLL  QQ++LL +S++AGW
Sbjct  635   CFAAGRECDPDVCRNCWVSCGDGSLGEPP-RQGEGQCGNMRLLLRQQQRILLSKSEVAGW  693

Query  1720  GAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQLVIDAYRRG  1899
             GAFLKN V    KN+++G YTGELISH EADK GK+YDR N SFLF+LNDQ V+DAYR+G
Sbjct  694   GAFLKNPVY---KNDYLGEYTGELISHREADKRGKIYDRANSSFLFDLNDQYVLDAYRKG  750

Query  1900  NKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
             +KLKF NHS +PNCFAKV             ++VAG     DHR G
Sbjct  751   DKLKFANHSSNPNCFAKV-------------MLVAG-----DHRVG  778


 Score =   113 bits (282),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 74/159 (47%), Positives = 99/159 (62%), Gaps = 11/159 (7%)
 Frame = +1

Query  889   YTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALi-csdsdeeiieeegenefaesedY  1065
             YTTW FL +NQ+M EDQSV+GRRRIYYD +  EALI     ++    EE +  F+E ED 
Sbjct  132   YTTWIFLDKNQRMAEDQSVVGRRRIYYDQHGSEALICSDSEEDIAEPEEEKRHFSEGEDK  191

Query  1066  ILRMTIEKVGLYDMVLDLLANHFSRKPSEV-------KARYKDLIKEGATSKNENTEVTI  1224
             ILRM   + GL + VLD+L  +     SE+       + +++D   +G + K+       
Sbjct  192   ILRMASREFGLNEEVLDILTQYVGGTTSEILEHCNVLEEKHQDT--DGKSLKDSRESGFG  249

Query  1225  NS-YLDEDLDAALSSFDNLFCQRCFVFNCQLHGCSQDLI  1338
              S +LD+ L AAL SFDNLFC+RC VF+C+LHGCSQ LI
Sbjct  250   GSMFLDKSLTAALDSFDNLFCRRCLVFDCRLHGCSQILI  288


 Score = 55.8 bits (133),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  2015  FR*IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSK  2164
             F  +++V GDHR+GIFA + + A +EL YDY+Y PD  P WA+  + + +
Sbjct  765   FAKVMLVAGDHRVGIFAKERIEASEELFYDYRYGPDQAPIWARKPEGTKR  814



>ref|NP_001234760.1| EZ1 protein [Solanum lycopersicum]
 gb|ABU96077.1| EZ1 [Solanum lycopersicum]
Length=829

 Score =   270 bits (690),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 129/226 (57%), Positives = 160/226 (71%), Gaps = 22/226 (10%)
 Frame = +1

Query  1360  REELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKNECATNYCP  1539
             + + C  Y PC C P CGK CPC+     CEK+CGC  +CK  F+GCHC K++C +  CP
Sbjct  576   KNQSCIQYNPCGCQPMCGKHCPCLQNGTCCEKYCGCSKSCKNRFRGCHCAKSQCRSRQCP  635

Query  1540  CYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLLGRSDIAGW  1719
             C+A+GRECDPDVC  CWVSCGDGS+G PP +    +C NM+LLL  QQ++LL +S++AGW
Sbjct  636   CFAAGRECDPDVCRNCWVSCGDGSLGEPP-RQGEGQCGNMRLLLRQQQRILLSKSEVAGW  694

Query  1720  GAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQLVIDAYRRG  1899
             GAFLKN V    KN+++G YTGELISH EADK GK+YDR N SFLF+LNDQ V+DAYR+G
Sbjct  695   GAFLKNPVY---KNDYLGEYTGELISHREADKRGKIYDRANSSFLFDLNDQYVLDAYRKG  751

Query  1900  NKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
             +KLKF NHS +PNCFAKV             ++VAG     DHR G
Sbjct  752   DKLKFANHSSNPNCFAKV-------------MLVAG-----DHRVG  779


 Score =   113 bits (282),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 74/159 (47%), Positives = 99/159 (62%), Gaps = 11/159 (7%)
 Frame = +1

Query  889   YTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALi-csdsdeeiieeegenefaesedY  1065
             YTTW FL +NQ+M EDQSV+GRRRIYYD +  EALI     ++    EE +  F+E ED 
Sbjct  133   YTTWIFLDKNQRMAEDQSVVGRRRIYYDQHGSEALICSDSEEDIAEPEEEKRHFSEGEDK  192

Query  1066  ILRMTIEKVGLYDMVLDLLANHFSRKPSEV-------KARYKDLIKEGATSKNENTEVTI  1224
             ILRM   + GL + VLD+L  +     SE+       + +++D   +G + K+       
Sbjct  193   ILRMASREFGLNEEVLDILTQYVGGTTSEILEHCNVLEEKHQDT--DGKSLKDSRESGFG  250

Query  1225  NS-YLDEDLDAALSSFDNLFCQRCFVFNCQLHGCSQDLI  1338
              S +LD+ L AAL SFDNLFC+RC VF+C+LHGCSQ LI
Sbjct  251   GSMFLDKSLTAALDSFDNLFCRRCLVFDCRLHGCSQILI  289


 Score = 55.8 bits (133),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/50 (44%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  2015  FR*IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSK  2164
             F  +++V GDHR+GIFA + + A +EL YDY+Y PD  P WA+  + + +
Sbjct  766   FAKVMLVAGDHRVGIFAKERIEASEELFYDYRYGPDQAPIWARKPEGTKR  815



>ref|XP_011042257.1| PREDICTED: histone-lysine N-methyltransferase EZA1 isoform X3 
[Populus euphratica]
Length=872

 Score =   270 bits (691),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 129/226 (57%), Positives = 163/226 (72%), Gaps = 22/226 (10%)
 Frame = +1

Query  1360  REELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKNECATNYCP  1539
             + + C  +TPC C   CGK+CPC+     CEK+CGC  +CK  F+GCHC K++C +  CP
Sbjct  617   KNQSCKQFTPCGCQSMCGKQCPCLHNGTCCEKYCGCSKSCKNRFRGCHCAKSQCRSRQCP  676

Query  1540  CYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLLGRSDIAGW  1719
             C+A+GRECDPDVC  CWVSCGDGS+G PP K  + +C NM+LLL  QQ++LL +SD+AGW
Sbjct  677   CFAAGRECDPDVCRNCWVSCGDGSLGEPP-KRGDGQCGNMRLLLRQQQRILLAKSDVAGW  735

Query  1720  GAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQLVIDAYRRG  1899
             GAFLKN    V+KN+++G YTGELISH EADK GK+YDR N SFLF+LNDQ V+DAYR+G
Sbjct  736   GAFLKN---PVNKNDYLGEYTGELISHREADKRGKIYDRANSSFLFDLNDQFVLDAYRKG  792

Query  1900  NKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
             +KLKF NHS +PNC+AKV             ++VAG     DHR G
Sbjct  793   DKLKFANHSSNPNCYAKV-------------MLVAG-----DHRVG  820


 Score =   108 bits (269),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 73/156 (47%), Positives = 104/156 (67%), Gaps = 8/156 (5%)
 Frame = +1

Query  889   YTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALicsdsdeeiieeegenefaesedYI  1068
             YTTW FL +NQ+M EDQSV+GRRRIYYD +  EALICSDS+E+   EE ++EF + ED I
Sbjct  127   YTTWIFLDKNQRMAEDQSVVGRRRIYYDQHGSEALICSDSEEDNEPEEEKHEFCDGEDRI  186

Query  1069  LRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLIKEGATSKNENTEVTINSY-----  1233
             L M   + GL + VL++++       +E++ R + L  E   S +++ + T +S      
Sbjct  187   LWMISREHGLAEEVLNVVSQFIGVGTTEIQERCRTL--EEKYSGDQSVKDTSDSVTGRGI  244

Query  1234  -LDEDLDAALSSFDNLFCQRCFVFNCQLHGCSQDLI  1338
              +++ L  AL SFDNLFC+RC +F+C+LHGCSQ LI
Sbjct  245   SMEKSLSTALDSFDNLFCRRCLLFDCRLHGCSQTLI  280


 Score = 58.9 bits (141),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSK  2164
             +++V GDHR+GIFA + + A +EL YDY+Y PD  PAWA+  + S +
Sbjct  810   VMLVAGDHRVGIFAKEHIEACEELFYDYRYGPDQAPAWARKPEGSKR  856



>ref|XP_011042258.1| PREDICTED: histone-lysine N-methyltransferase EZA1 isoform X4 
[Populus euphratica]
Length=762

 Score =   268 bits (686),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 129/226 (57%), Positives = 163/226 (72%), Gaps = 22/226 (10%)
 Frame = +1

Query  1360  REELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKNECATNYCP  1539
             + + C  +TPC C   CGK+CPC+     CEK+CGC  +CK  F+GCHC K++C +  CP
Sbjct  507   KNQSCKQFTPCGCQSMCGKQCPCLHNGTCCEKYCGCSKSCKNRFRGCHCAKSQCRSRQCP  566

Query  1540  CYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLLGRSDIAGW  1719
             C+A+GRECDPDVC  CWVSCGDGS+G PP K  + +C NM+LLL  QQ++LL +SD+AGW
Sbjct  567   CFAAGRECDPDVCRNCWVSCGDGSLGEPP-KRGDGQCGNMRLLLRQQQRILLAKSDVAGW  625

Query  1720  GAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQLVIDAYRRG  1899
             GAFLKN    V+KN+++G YTGELISH EADK GK+YDR N SFLF+LNDQ V+DAYR+G
Sbjct  626   GAFLKN---PVNKNDYLGEYTGELISHREADKRGKIYDRANSSFLFDLNDQFVLDAYRKG  682

Query  1900  NKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
             +KLKF NHS +PNC+AKV             ++VAG     DHR G
Sbjct  683   DKLKFANHSSNPNCYAKV-------------MLVAG-----DHRVG  710


 Score = 88.2 bits (217),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 65/144 (45%), Positives = 94/144 (65%), Gaps = 8/144 (6%)
 Frame = +1

Query  925   MPEDQSVIGRRRIYYDMNSGEALicsdsdeeiieeegenefaesedYILRMTIEKVGLYD  1104
             M EDQSV+GRRRIYYD +  EALICSDS+E+   EE ++EF + ED IL M   + GL +
Sbjct  1     MAEDQSVVGRRRIYYDQHGSEALICSDSEEDNEPEEEKHEFCDGEDRILWMISREHGLAE  60

Query  1105  MVLDLLANHFSRKPSEVKARYKDLIKEGATSKNENTEVTINSY------LDEDLDAALSS  1266
              VL++++       +E++ R + L  E   S +++ + T +S       +++ L  AL S
Sbjct  61    EVLNVVSQFIGVGTTEIQERCRTL--EEKYSGDQSVKDTSDSVTGRGISMEKSLSTALDS  118

Query  1267  FDNLFCQRCFVFNCQLHGCSQDLI  1338
             FDNLFC+RC +F+C+LHGCSQ LI
Sbjct  119   FDNLFCRRCLLFDCRLHGCSQTLI  142


 Score = 58.9 bits (141),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSK  2164
             +++V GDHR+GIFA + + A +EL YDY+Y PD  PAWA+  + S +
Sbjct  700   VMLVAGDHRVGIFAKEHIEACEELFYDYRYGPDQAPAWARKPEGSKR  746



>ref|XP_007051110.1| Enhancer of zeste, ezh, putative isoform 1 [Theobroma cacao]
 gb|EOX95267.1| Enhancer of zeste, ezh, putative isoform 1 [Theobroma cacao]
Length=885

 Score =   271 bits (692),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 129/226 (57%), Positives = 162/226 (72%), Gaps = 22/226 (10%)
 Frame = +1

Query  1360  REELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKNECATNYCP  1539
             + + C  YTPC C   CGK+CPC+     CEK+CGC  +CK  F+GCHC K++C +  CP
Sbjct  630   KNQSCKQYTPCGCQSMCGKQCPCLHNGTCCEKYCGCSKSCKNRFRGCHCAKSQCRSRQCP  689

Query  1540  CYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLLGRSDIAGW  1719
             C+A+GRECDPDVC  CWVSCG GS+G PP K  + +C NM+LLL  QQ++LL +SD+AGW
Sbjct  690   CFAAGRECDPDVCRNCWVSCGGGSLGEPP-KRGDGQCGNMRLLLRQQQRILLAKSDVAGW  748

Query  1720  GAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQLVIDAYRRG  1899
             GAFLKN    V+KN+++G YTGELISH EADK GK+YDR N SFLF+LNDQ V+DAYR+G
Sbjct  749   GAFLKN---SVNKNDYLGEYTGELISHREADKRGKIYDRANSSFLFDLNDQYVLDAYRKG  805

Query  1900  NKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
             +KLKF NHS +PNC+AKV             ++VAG     DHR G
Sbjct  806   DKLKFANHSSNPNCYAKV-------------MLVAG-----DHRVG  833


 Score =   106 bits (265),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 69/156 (44%), Positives = 99/156 (63%), Gaps = 8/156 (5%)
 Frame = +1

Query  889   YTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALi-csdsdeeiieeegenefaesedY  1065
             YTTW FL +NQ+M EDQSV+GRRRIYYD +  EALI     ++    EE ++EF+E ED 
Sbjct  131   YTTWIFLDKNQRMAEDQSVVGRRRIYYDQHGSEALICSDSEEDVAEPEEEKHEFSEGEDR  190

Query  1066  ILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLIKE-----GATSKNENTEVTINS  1230
             IL    ++ GL + +L  ++       S++K R+  L ++        S++  +E  I+ 
Sbjct  191   ILWTVSQEFGLGEEILQAVSQFIGVGISDIKERHGILTEKYSDQNAKDSEDSGSEKGIS-  249

Query  1231  YLDEDLDAALSSFDNLFCQRCFVFNCQLHGCSQDLI  1338
              L++ L AAL SFDNLFC+RC +F+C+LHGCSQ LI
Sbjct  250   -LEKSLSAALDSFDNLFCRRCLLFDCRLHGCSQTLI  284


 Score = 59.7 bits (143),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSK  2164
             +++V GDHR+GIFA + + A +EL YDY+Y PD  PAWA+  + S +
Sbjct  823   VMLVAGDHRVGIFAKERIEASEELFYDYRYGPDQAPAWARKPEGSKR  869



>ref|XP_007051111.1| Enhancer of zeste, ezh, putative isoform 2 [Theobroma cacao]
 gb|EOX95268.1| Enhancer of zeste, ezh, putative isoform 2 [Theobroma cacao]
Length=842

 Score =   270 bits (690),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 129/226 (57%), Positives = 162/226 (72%), Gaps = 22/226 (10%)
 Frame = +1

Query  1360  REELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKNECATNYCP  1539
             + + C  YTPC C   CGK+CPC+     CEK+CGC  +CK  F+GCHC K++C +  CP
Sbjct  587   KNQSCKQYTPCGCQSMCGKQCPCLHNGTCCEKYCGCSKSCKNRFRGCHCAKSQCRSRQCP  646

Query  1540  CYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLLGRSDIAGW  1719
             C+A+GRECDPDVC  CWVSCG GS+G PP K  + +C NM+LLL  QQ++LL +SD+AGW
Sbjct  647   CFAAGRECDPDVCRNCWVSCGGGSLGEPP-KRGDGQCGNMRLLLRQQQRILLAKSDVAGW  705

Query  1720  GAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQLVIDAYRRG  1899
             GAFLKN    V+KN+++G YTGELISH EADK GK+YDR N SFLF+LNDQ V+DAYR+G
Sbjct  706   GAFLKN---SVNKNDYLGEYTGELISHREADKRGKIYDRANSSFLFDLNDQYVLDAYRKG  762

Query  1900  NKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
             +KLKF NHS +PNC+AKV             ++VAG     DHR G
Sbjct  763   DKLKFANHSSNPNCYAKV-------------MLVAG-----DHRVG  790


 Score =   106 bits (265),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 69/156 (44%), Positives = 99/156 (63%), Gaps = 8/156 (5%)
 Frame = +1

Query  889   YTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALi-csdsdeeiieeegenefaesedY  1065
             YTTW FL +NQ+M EDQSV+GRRRIYYD +  EALI     ++    EE ++EF+E ED 
Sbjct  131   YTTWIFLDKNQRMAEDQSVVGRRRIYYDQHGSEALICSDSEEDVAEPEEEKHEFSEGEDR  190

Query  1066  ILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLIKE-----GATSKNENTEVTINS  1230
             IL    ++ GL + +L  ++       S++K R+  L ++        S++  +E  I+ 
Sbjct  191   ILWTVSQEFGLGEEILQAVSQFIGVGISDIKERHGILTEKYSDQNAKDSEDSGSEKGIS-  249

Query  1231  YLDEDLDAALSSFDNLFCQRCFVFNCQLHGCSQDLI  1338
              L++ L AAL SFDNLFC+RC +F+C+LHGCSQ LI
Sbjct  250   -LEKSLSAALDSFDNLFCRRCLLFDCRLHGCSQTLI  284


 Score = 59.3 bits (142),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSK  2164
             +++V GDHR+GIFA + + A +EL YDY+Y PD  PAWA+  + S +
Sbjct  780   VMLVAGDHRVGIFAKERIEASEELFYDYRYGPDQAPAWARKPEGSKR  826



>ref|XP_008659027.1| PREDICTED: histone-lysine N-methyltransferase EZ2 isoform X2 
[Zea mays]
Length=870

 Score =   270 bits (691),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 128/221 (58%), Positives = 158/221 (71%), Gaps = 21/221 (10%)
 Frame = +1

Query  1375  AHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKNECATNYCPCYASG  1554
               Y+PC C   CGK CPC  K   CEK+CGC  +CK  F+GCHC K++C +  CPC+A+ 
Sbjct  620   TQYSPCACQQMCGKDCPCADKGTCCEKYCGCSKSCKNKFRGCHCAKSQCRSRQCPCFAAS  679

Query  1555  RECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLLGRSDIAGWGAFLK  1734
             RECDPDVC  CWVSCGDGS+G P  +   ++C NMKLLL  QQ++LLGRSD+AGWGAF+K
Sbjct  680   RECDPDVCRNCWVSCGDGSLGEPLARGDGYQCGNMKLLLKQQQRILLGRSDVAGWGAFIK  739

Query  1735  NCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQLVIDAYRRGNKLKF  1914
             N    V+KN+++G YTGELISH EADK GK+YDR N SFLF+LNDQ V+DAYR+G+KLKF
Sbjct  740   N---PVNKNDYLGEYTGELISHKEADKRGKIYDRANSSFLFDLNDQYVLDAYRKGDKLKF  796

Query  1915  INHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
              NHS +PNC+AKV             ++VAG     DHR G
Sbjct  797   ANHSSNPNCYAKV-------------MLVAG-----DHRVG  819


 Score =   113 bits (283),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 87/222 (39%), Positives = 128/222 (58%), Gaps = 9/222 (4%)
 Frame = +1

Query  691   GDGSADLLAKRQTDAFDLQNSIGTGSGNKICSSQEDGYASSDL----RSSIVLKNAVCpi  858
             G+  +   A+RQ  + DL N IG      + S QE+  A+  L      +   +  V  +
Sbjct  87    GNALSQRAAERQCGS-DLANGIGE---RDVVSVQEENLATGTLALSSSGATAQRTIVRFV  142

Query  859   klpklekippYTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALi-csdsdeeiieeeg  1035
             KLP +EKIPPYTTW FL +NQ+M +DQSV+GRRRIYYD    EALI     +E    EE 
Sbjct  143   KLPLVEKIPPYTTWIFLDKNQRMADDQSVVGRRRIYYDTVGNEALICSDSDEEIPEPEEE  202

Query  1036  enefaesedYILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLIKEGATSKNENTE  1215
             ++ F + ED+++    +  GL   V+++L       PSE++ R + L ++       + +
Sbjct  203   KHFFTKGEDHLIWRATQDHGLNQEVVNVLCQFIGATPSEIEERSEVLFEKNEKHSGSSDK  262

Query  1216  VTINSYLDEDLDAALSSFDNLFCQRCFVFNCQLHGCSQDLII  1341
             +     LD+ +DA L SFDNLFC+RC VF+C+LHGCSQ+L+ 
Sbjct  263   IESRLSLDKTMDAVLDSFDNLFCRRCLVFDCRLHGCSQNLVF  304


 Score = 58.9 bits (141),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSK  2164
             +++V GDHR+GI+A + + A +EL YDY+Y PD  PAWA+  + S K
Sbjct  809   VMLVAGDHRVGIYAKEHIEASEELFYDYRYGPDQAPAWARRPEGSKK  855



>dbj|BAJ84922.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=871

 Score =   270 bits (691),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 127/220 (58%), Positives = 156/220 (71%), Gaps = 21/220 (10%)
 Frame = +1

Query  1378  HYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKNECATNYCPCYASGR  1557
              YTPC C   C K CPC      CEK+CGC  +CK  F+GCHC K++C +  CPC+A+ R
Sbjct  623   QYTPCGCQEMCNKNCPCAENGTCCEKYCGCSKSCKNRFRGCHCAKSQCRSRQCPCFAASR  682

Query  1558  ECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLLGRSDIAGWGAFLKN  1737
             ECDPDVC  CWVSCGDGS+G PP++   ++C NMKLLL  QQ++LLG+SD+AGWGAF+KN
Sbjct  683   ECDPDVCRNCWVSCGDGSLGEPPERGDGYQCGNMKLLLKQQQRILLGKSDVAGWGAFIKN  742

Query  1738  CVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQLVIDAYRRGNKLKFI  1917
                 V KN+++G YTGELISH EADK GK+YDR N SFLF+LNDQ V+DAYR+G+KLKF 
Sbjct  743   ---PVHKNDYLGEYTGELISHKEADKRGKIYDRANSSFLFDLNDQFVLDAYRKGDKLKFA  799

Query  1918  NHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
             NHS  PNC+AKV             ++VAG     DHR G
Sbjct  800   NHSSSPNCYAKV-------------MMVAG-----DHRVG  821


 Score =   100 bits (249),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 64/170 (38%), Positives = 96/170 (56%), Gaps = 2/170 (1%)
 Frame = +1

Query  889   YTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALi-csdsdeeiieeegenefaesedY  1065
             YTTW FL +NQ+M +DQS+ GRRRIYYD    EALI     +E    EE ++ F E ED 
Sbjct  140   YTTWIFLDKNQRMADDQSIAGRRRIYYDSAGNEALICSESDEEIPQPEEEKHVFTEGEDQ  199

Query  1066  ILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLIKEGATSKNENTEVTINSYLDED  1245
             ++    ++ GL     +++       P E++ R + L ++       + +      LD+ 
Sbjct  200   LIWKATQEHGLSQENFNVICQFIDASPLEIEGRSEFLFEKNEKHSEFSDKTESQLSLDKT  259

Query  1246  LDAALSSFDNLFCQRCFVFNCQLHGCSQDLIILKQIRV-REELCAHYTPC  1392
             +D  L SFDNLFC+RC VF+C+LHGCSQ+L+   + +    EL  + +PC
Sbjct  260   VDVVLDSFDNLFCRRCLVFDCRLHGCSQNLVFPSEKQPCGFELDGYKSPC  309


 Score = 56.2 bits (134),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/47 (47%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSK  2164
             +++V GDHR+GI+A + + A  EL YDY+Y PD  PAWA+  + + K
Sbjct  811   VMMVAGDHRVGIYAREHIEASAELFYDYRYGPDQAPAWARRPEGAKK  857



>ref|XP_002302766.2| hypothetical protein POPTR_0002s19670g [Populus trichocarpa]
 gb|EEE82039.2| hypothetical protein POPTR_0002s19670g [Populus trichocarpa]
Length=863

 Score =   270 bits (690),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 129/226 (57%), Positives = 163/226 (72%), Gaps = 22/226 (10%)
 Frame = +1

Query  1360  REELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKNECATNYCP  1539
             + + C  +TPC C   CGK+CPC+     CEK+CGC  +CK  F+GCHC K++C +  CP
Sbjct  608   KNQSCKQFTPCGCQSMCGKQCPCLHNGTCCEKYCGCSKSCKNRFRGCHCAKSQCRSRQCP  667

Query  1540  CYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLLGRSDIAGW  1719
             C+A+GRECDPDVC  CWVSCGDGS+G PP K  + +C NM+LLL  QQ++LL +SD+AGW
Sbjct  668   CFAAGRECDPDVCRNCWVSCGDGSLGEPP-KQGDGQCGNMRLLLRQQQRILLAKSDVAGW  726

Query  1720  GAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQLVIDAYRRG  1899
             GAFLKN    V+KN+++G YTGELISH EADK GK+YDR N SFLF+LNDQ V+DAYR+G
Sbjct  727   GAFLKN---PVNKNDYLGEYTGELISHREADKRGKIYDRANSSFLFDLNDQFVLDAYRKG  783

Query  1900  NKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
             +KLKF NHS +PNC+AKV             ++VAG     DHR G
Sbjct  784   DKLKFANHSSNPNCYAKV-------------MLVAG-----DHRVG  811


 Score = 99.0 bits (245),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 71/161 (44%), Positives = 97/161 (60%), Gaps = 30/161 (19%)
 Frame = +1

Query  889   YTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALicsdsdeeiieeegenefaesedYI  1068
             YTTW FL +NQ+M EDQSV+GRRRIYYD +  EALICSDS+E+   EE ++EF + ED I
Sbjct  188   YTTWIFLDKNQRMAEDQSVVGRRRIYYDQHGSEALICSDSEEDNEPEEEKHEFCDGEDRI  247

Query  1069  LRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLIKEGATSKNENTEVTINSYLDEDL  1248
             L M   + GL + VL++++       +E+++                            L
Sbjct  248   LWMVSREHGLAEEVLNVVSQFIGVGTTEIQS----------------------------L  279

Query  1249  DAALSSFDNLFCQRCFVFNCQLHGCSQDLIILKQIRVREEL  1371
              AAL SFDNLFC+RC +F+C+LHGCSQ LI    +RV ++L
Sbjct  280   SAALDSFDNLFCRRCLLFDCRLHGCSQTLI--NPLRVVKDL  318


 Score = 58.9 bits (141),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSK  2164
             +++V GDHR+GIFA + + A +EL YDY+Y PD  PAWA+  + S +
Sbjct  801   VMLVAGDHRVGIFAKEHIEACEELFYDYRYGPDQAPAWARKPEGSKR  847



>ref|XP_011042256.1| PREDICTED: histone-lysine N-methyltransferase EZA1 isoform X2 
[Populus euphratica]
Length=896

 Score =   270 bits (691),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 129/226 (57%), Positives = 163/226 (72%), Gaps = 22/226 (10%)
 Frame = +1

Query  1360  REELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKNECATNYCP  1539
             + + C  +TPC C   CGK+CPC+     CEK+CGC  +CK  F+GCHC K++C +  CP
Sbjct  641   KNQSCKQFTPCGCQSMCGKQCPCLHNGTCCEKYCGCSKSCKNRFRGCHCAKSQCRSRQCP  700

Query  1540  CYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLLGRSDIAGW  1719
             C+A+GRECDPDVC  CWVSCGDGS+G PP K  + +C NM+LLL  QQ++LL +SD+AGW
Sbjct  701   CFAAGRECDPDVCRNCWVSCGDGSLGEPP-KRGDGQCGNMRLLLRQQQRILLAKSDVAGW  759

Query  1720  GAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQLVIDAYRRG  1899
             GAFLKN    V+KN+++G YTGELISH EADK GK+YDR N SFLF+LNDQ V+DAYR+G
Sbjct  760   GAFLKN---PVNKNDYLGEYTGELISHREADKRGKIYDRANSSFLFDLNDQFVLDAYRKG  816

Query  1900  NKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
             +KLKF NHS +PNC+AKV             ++VAG     DHR G
Sbjct  817   DKLKFANHSSNPNCYAKV-------------MLVAG-----DHRVG  844


 Score =   108 bits (269),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 73/156 (47%), Positives = 104/156 (67%), Gaps = 8/156 (5%)
 Frame = +1

Query  889   YTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALicsdsdeeiieeegenefaesedYI  1068
             YTTW FL +NQ+M EDQSV+GRRRIYYD +  EALICSDS+E+   EE ++EF + ED I
Sbjct  127   YTTWIFLDKNQRMAEDQSVVGRRRIYYDQHGSEALICSDSEEDNEPEEEKHEFCDGEDRI  186

Query  1069  LRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLIKEGATSKNENTEVTINSY-----  1233
             L M   + GL + VL++++       +E++ R + L  E   S +++ + T +S      
Sbjct  187   LWMISREHGLAEEVLNVVSQFIGVGTTEIQERCRTL--EEKYSGDQSVKDTSDSVTGRGI  244

Query  1234  -LDEDLDAALSSFDNLFCQRCFVFNCQLHGCSQDLI  1338
              +++ L  AL SFDNLFC+RC +F+C+LHGCSQ LI
Sbjct  245   SMEKSLSTALDSFDNLFCRRCLLFDCRLHGCSQTLI  280


 Score = 58.9 bits (141),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSK  2164
             +++V GDHR+GIFA + + A +EL YDY+Y PD  PAWA+  + S +
Sbjct  834   VMLVAGDHRVGIFAKEHIEACEELFYDYRYGPDQAPAWARKPEGSKR  880



>ref|XP_002320296.1| Polycomb group protein MEDEA [Populus trichocarpa]
 gb|EEE98611.1| Polycomb group protein MEDEA [Populus trichocarpa]
Length=812

 Score =   269 bits (687),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 127/228 (56%), Positives = 163/228 (71%), Gaps = 6/228 (3%)
 Frame = +1

Query  1360  REELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKNECATNYCP  1539
             + + C  YTPC C   CGK+CPC+     CEK+CGC  +CK  F+GCHC K++C +  CP
Sbjct  557   KNQSCKQYTPCGCQSMCGKQCPCLHNGTCCEKYCGCSKSCKNRFRGCHCAKSQCRSRQCP  616

Query  1540  CYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLLGRSDIAGW  1719
             C+A+GRECDPD+C  CWVSCGDGS+G PP K  + +C NM+LLL  QQ++LL +SD+AGW
Sbjct  617   CFAAGRECDPDICRNCWVSCGDGSLGEPP-KRGDGQCGNMRLLLRQQQRILLAKSDVAGW  675

Query  1720  GAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQLVIDAYRRG  1899
             GAFLK     V+KN+++G YTGELISH EADK GK+YDR N SFLF+LNDQ V+DAYR+G
Sbjct  676   GAFLKK---PVNKNDYLGEYTGELISHREADKRGKIYDRANSSFLFDLNDQFVLDAYRKG  732

Query  1900  NKLKFINHSPDPNCFAKVNCSLSPCLLQCF--QLIVAGGSFSIDHRSG  2037
             +KLKF NHS +PNC+AKV   +    +  F  + I A      D+R G
Sbjct  733   DKLKFANHSSNPNCYAKVMLVVGDHRVGIFANERIEASEELFYDYRYG  780


 Score =   115 bits (289),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 77/156 (49%), Positives = 110/156 (71%), Gaps = 8/156 (5%)
 Frame = +1

Query  889   YTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALicsdsdeeiieeegenefaesedYI  1068
             YTTW FL +NQ+M EDQSV+GRRRIYYD +  EALICSDS+E+I  EE ++EF+E ED  
Sbjct  128   YTTWIFLDKNQRMAEDQSVVGRRRIYYDRHGSEALICSDSEEDIEPEEEKHEFSEGEDRF  187

Query  1069  LRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLIKEGATSKNENTEVTINSY-----  1233
             L M  +++GL + VL++++       SE++ R + L ++   S ++N + +I+S      
Sbjct  188   LWMVFQELGLAEEVLNIVSQFIGVGTSEIQERCRMLAEK--YSNDQNVKDSIDSVSERGI  245

Query  1234  -LDEDLDAALSSFDNLFCQRCFVFNCQLHGCSQDLI  1338
              L++ L AAL SFDNLFC+RC +F+C+LHGCSQ LI
Sbjct  246   SLEKSLSAALDSFDNLFCRRCLLFDCRLHGCSQTLI  281


 Score = 57.8 bits (138),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSK  2164
             +++V GDHR+GIFA + + A +EL YDY+Y PD  PAWA+  + S +
Sbjct  750   VMLVVGDHRVGIFANERIEASEELFYDYRYGPDQTPAWARKPEGSKR  796



>ref|XP_006339876.1| PREDICTED: histone-lysine N-methyltransferase EZA1-like [Solanum 
tuberosum]
Length=843

 Score =   270 bits (689),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 130/228 (57%), Positives = 161/228 (71%), Gaps = 23/228 (10%)
 Frame = +1

Query  1360  REELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCP--LNCKI*FQGCHCTKNECATNY  1533
             +++LC HY PCNC   CGK+CPC+V    CEK+CGC    NCK  F+GC C K +C +  
Sbjct  568   KDKLCRHYNPCNCQVPCGKECPCIVNGTPCEKYCGCKSIKNCKNHFRGCFCIKGQCRSRQ  627

Query  1534  CPCYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLLGRSDIA  1713
             CPC+A  RECDPDVC  CW+SCGDG++ IPP +  N+ C+NMKLLL   Q+VLLGRSD++
Sbjct  628   CPCFAVDRECDPDVCRNCWISCGDGTLDIPPQRGDNNDCENMKLLLKQHQRVLLGRSDVS  687

Query  1714  GWGAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQLVIDAYR  1893
             GWGAFLK     V K+E++G YTGE+ISH EAD+ GK+YD  N SFLFNLNDQ V+DAYR
Sbjct  688   GWGAFLKK---SVGKHEYLGEYTGEIISHHEADRRGKIYDLINSSFLFNLNDQCVLDAYR  744

Query  1894  RGNKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
             +G+KLKF NHSPDPNC+ KV              I+AGG    DH+ G
Sbjct  745   KGDKLKFANHSPDPNCYPKV--------------IMAGG----DHKVG  774


 Score =   204 bits (520),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 132/222 (59%), Positives = 170/222 (77%), Gaps = 5/222 (2%)
 Frame = +1

Query  691   GDGSADLLAKRQTDAFDLQNSIGTGSG-NKICSSQEDGYASSDLR--SSIVLKNAVCpik  861
              D S DLL+KRQ D  ++Q  IG+ +G N   S ++DGYASS++R  SSI + +AVCPI 
Sbjct  83    ADISIDLLSKRQQDVINMQTGIGSSNGDNDSNSYEDDGYASSEIRLGSSIAVNSAVCPII  142

Query  862   lpklekippYTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALicsdsdeeiieeegen  1041
             LP++E++P YTTW FL RNQ+MP +QSV+G RRIYYD NSGEALICSDS+EE++E++ E 
Sbjct  143   LPQVERLPQYTTWVFLDRNQEMPVNQSVVGCRRIYYDKNSGEALICSDSEEELLEDKQEK  202

Query  1042  efaesedYILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLIKEGAT--SKNENTE  1215
             +F E ED +LR TI+++GL D VL+LL    SRKPSEVKARY+DL+K+     SKNE+ +
Sbjct  203   QFVEYEDVMLRSTIQQIGLSDTVLELLGQFLSRKPSEVKARYEDLVKDKHECPSKNESIQ  262

Query  1216  VTINSYLDEDLDAALSSFDNLFCQRCFVFNCQLHGCSQDLII  1341
              T + +LD DLDAAL SFD LFC+RC VF+CQ HGCSQDLI 
Sbjct  263   GTPDLFLDNDLDAALDSFDTLFCRRCLVFDCQSHGCSQDLIF  304



>ref|XP_009783487.1| PREDICTED: histone-lysine N-methyltransferase EZA1 isoform X3 
[Nicotiana sylvestris]
Length=687

 Score =   266 bits (680),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 128/226 (57%), Positives = 161/226 (71%), Gaps = 22/226 (10%)
 Frame = +1

Query  1360  REELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKNECATNYCP  1539
             + + C  Y PC C P CGK CPC+     CEK+CGC  +CK  F+GCHC K++C +  CP
Sbjct  432   KNQSCIQYNPCGCHPVCGKNCPCLQNGTCCEKYCGCSKSCKNRFRGCHCAKSQCRSRQCP  491

Query  1540  CYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLLGRSDIAGW  1719
             C+A+GRECDPDVC  CWVSCGDGS+G PP +    +C NM+LLL  QQ++LL +S+IAGW
Sbjct  492   CFAAGRECDPDVCRNCWVSCGDGSLGEPP-RRGEGQCGNMRLLLRQQQRILLSKSEIAGW  550

Query  1720  GAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQLVIDAYRRG  1899
             GAFLKN    V+KN+++G YTGELISH EAD+ GK+YDR N SFLF+LNDQ V+DAYR+G
Sbjct  551   GAFLKN---PVNKNDYLGEYTGELISHREADRRGKIYDRANSSFLFDLNDQYVLDAYRKG  607

Query  1900  NKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
             +KLKF NHS +PNC+AKV             ++VAG     DHR G
Sbjct  608   DKLKFANHSSNPNCYAKV-------------MLVAG-----DHRVG  635


 Score = 89.0 bits (219),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 61/145 (42%), Positives = 89/145 (61%), Gaps = 7/145 (5%)
 Frame = +1

Query  925   MPEDQSVIGRRRIYYDMNSGEALi-csdsdeeiieeegenefaesedYILRMTIEKVGLY  1101
             M EDQSV GRRRIYYD +  EALI     ++    EE + +F+E ED IL M  ++ GL 
Sbjct  1     MAEDQSVAGRRRIYYDQHGSEALICSDSEEDIAEPEEEKRDFSEGEDKILWMASQEFGLS  60

Query  1102  DMVLDLLANHFSRKPSEVKARYKDLIKEGATSKNEN------TEVTINSYLDEDLDAALS  1263
             + V+D+L ++     SE+      L+++   + +++      + +  N +LD+ L AAL 
Sbjct  61    EEVVDILTHYVGGTSSEILEHCNLLVEKHQNTDSKSFKDSGKSGLGGNIFLDKSLTAALD  120

Query  1264  SFDNLFCQRCFVFNCQLHGCSQDLI  1338
             SFDNLFC+RC VF+C+LHGCSQ  I
Sbjct  121   SFDNLFCRRCLVFDCRLHGCSQIFI  145


 Score = 57.4 bits (137),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 22/47 (47%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSK  2164
             +++V GDHR+GIFA + + A DEL YDY+Y PD  P WA+  + + +
Sbjct  625   VMLVAGDHRVGIFAKERIEASDELFYDYRYGPDQAPIWARKPEGTKR  671



>emb|CDY17381.1| BnaA10g10150D [Brassica napus]
Length=841

 Score =   269 bits (688),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 123/198 (62%), Positives = 150/198 (76%), Gaps = 4/198 (2%)
 Frame = +1

Query  1360  REELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKNECATNYCP  1539
             + + C  YTPC C   CGK CPC+     CEK+CGC  +CK  F+GCHC K++C +  CP
Sbjct  606   KNQSCKQYTPCGCLSMCGKDCPCLTNETCCEKYCGCSKSCKNRFRGCHCAKSQCRSRQCP  665

Query  1540  CYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLLGRSDIAGW  1719
             C+A+GRECDPDVC  CWVSCGDGS+G  P +    +C NM+LLL  QQ++LLG+SD+AGW
Sbjct  666   CFAAGRECDPDVCRNCWVSCGDGSLGEAPRR-GEGQCGNMRLLLRQQQRILLGKSDVAGW  724

Query  1720  GAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQLVIDAYRRG  1899
             GAFLKN    VSKNE++G YTGELISH EADK GK+YDR N SFLF+LNDQ V+DA R+G
Sbjct  725   GAFLKN---SVSKNEYLGEYTGELISHREADKRGKIYDRANSSFLFDLNDQFVLDAQRKG  781

Query  1900  NKLKFINHSPDPNCFAKV  1953
             +KLKF NHS  PNC+AKV
Sbjct  782   DKLKFANHSAKPNCYAKV  799


 Score =   106 bits (264),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 74/156 (47%), Positives = 100/156 (64%), Gaps = 6/156 (4%)
 Frame = +1

Query  889   YTTWAFLHR----NQKMPEDQSVIGRRRIYYDMNSGEALicsdsdeeiieeegenefaes  1056
             YTTW FL R    NQ+M EDQSV+GRR+IYYD + GE LICSDS+EE   EE + E++E 
Sbjct  142   YTTWIFLDRQVLLNQRMVEDQSVVGRRQIYYDQHGGETLICSDSEEEPEPEEEKREYSEG  201

Query  1057  edYILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLI--KEGATSKNENTEVTINS  1230
             ED I+ +  ++ G+ + V D L+   +   SE+  RY +L    E       ++   +  
Sbjct  202   EDCIIWLIGQEYGMGEKVQDALSQFLTLDASEILERYNELKLKNEQNAEAFSDSGFKLGI  261

Query  1231  YLDEDLDAALSSFDNLFCQRCFVFNCQLHGCSQDLI  1338
              L++ L AAL SFDNLFC+RC VF+C+LHGCSQ LI
Sbjct  262   SLEKGLSAALDSFDNLFCRRCLVFDCRLHGCSQPLI  297



>dbj|BAJ99573.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=343

 Score =   256 bits (654),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 130/235 (55%), Positives = 160/235 (68%), Gaps = 20/235 (9%)
 Frame = +1

Query  1336  IILKQIRVR-EELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTK  1512
              I K+I  R +EL  HY PC C   CGK+CPC      CEKFCGCP  C+  F GC C K
Sbjct  45    FIRKRIAARKDELRQHYNPCGCQLACGKQCPCQKNGTCCEKFCGCPEACRNRFLGCKCAK  104

Query  1513  NECATNYCPCYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVL  1692
              +C +  CPC+A+ RECDPD+C +C V CG+GS+G+P  +  N+ CQNMKLLL  QQKV+
Sbjct  105   AQCRSRQCPCFAADRECDPDMCIYCGVGCGEGSLGVPNQRGDNYGCQNMKLLLRQQQKVV  164

Query  1693  LGRSDIAGWGAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQ  1872
             LGRSD++GWGAF+K     V K+E +G YTGELISH EA K G+ YDR+N SFLFNLN++
Sbjct  165   LGRSDVSGWGAFVK-LQNTVGKDECLGEYTGELISHREAAKRGQRYDRENSSFLFNLNNE  223

Query  1873  LVIDAYRRGNKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
              V+DA+R GNKLKF NHSPDPNC+AKV             ++VAG     DHR G
Sbjct  224   FVLDAFRMGNKLKFANHSPDPNCYAKV-------------MLVAG-----DHRVG  260


 Score = 57.0 bits (136),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 22/39 (56%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWA  2140
             +++V GDHR+GIFA + +NAG+E+ YDY Y P+  PAWA
Sbjct  250   VMLVAGDHRVGIFANERINAGEEIFYDYHYAPEEAPAWA  288



>ref|XP_009604958.1| PREDICTED: histone-lysine N-methyltransferase EZA1 isoform X4 
[Nicotiana tomentosiformis]
Length=687

 Score =   266 bits (680),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 128/226 (57%), Positives = 161/226 (71%), Gaps = 22/226 (10%)
 Frame = +1

Query  1360  REELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKNECATNYCP  1539
             + + C  Y PC C P CGK CPC+     CEK+CGC  +CK  F+GCHC K++C +  CP
Sbjct  432   KNQSCIQYNPCGCQPVCGKHCPCLQNGTCCEKYCGCSKSCKNRFRGCHCAKSQCRSRQCP  491

Query  1540  CYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLLGRSDIAGW  1719
             C+A+GRECDPDVC  CWVSCGDGS+G PP +    +C NM+LLL  QQ++LL +S++AGW
Sbjct  492   CFAAGRECDPDVCRNCWVSCGDGSLGEPP-RRGEGQCGNMRLLLRQQQRILLSKSEVAGW  550

Query  1720  GAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQLVIDAYRRG  1899
             GAFLKN    V+KN+++G YTGELISH EADK GK+YDR N SFLF+LNDQ V+DAYR+G
Sbjct  551   GAFLKN---PVNKNDYLGEYTGELISHREADKRGKIYDRANSSFLFDLNDQYVLDAYRKG  607

Query  1900  NKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
             +KLKF NHS +PNC+AKV             ++VAG     DHR G
Sbjct  608   DKLKFANHSSNPNCYAKV-------------MLVAG-----DHRVG  635


 Score = 89.7 bits (221),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 64/145 (44%), Positives = 88/145 (61%), Gaps = 7/145 (5%)
 Frame = +1

Query  925   MPEDQSVIGRRRIYYDMNSGEALi-csdsdeeiieeegenefaesedYILRMTIEKVGLY  1101
             M EDQSV GRRRIYYD +  EALI     ++    EE +  F+E ED IL M  ++ GL 
Sbjct  1     MAEDQSVAGRRRIYYDQHGSEALICSDSEEDIAEPEEEKRNFSEGEDKILWMVSQEFGLN  60

Query  1102  DMVLDLLANHFSRKPSEVKARYKDLIK-----EGATSKNE-NTEVTINSYLDEDLDAALS  1263
             + VLD+L ++     SE+      L++     +G + K+   + +  N +LD+ L AAL 
Sbjct  61    EEVLDILTHYVGGTSSEILEHCNLLVENHQNTDGKSLKDSGKSGLGGNIFLDKSLTAALD  120

Query  1264  SFDNLFCQRCFVFNCQLHGCSQDLI  1338
             SFDNLFC+RC VF+C+LHGCSQ  I
Sbjct  121   SFDNLFCRRCLVFDCRLHGCSQIFI  145


 Score = 57.4 bits (137),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 22/47 (47%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSK  2164
             +++V GDHR+GIFA + + A DEL YDY+Y PD  P WA+  + + +
Sbjct  625   VMLVAGDHRVGIFAKERIEASDELFYDYRYGPDQAPIWARKPEGTKR  671



>ref|XP_011042255.1| PREDICTED: histone-lysine N-methyltransferase EZA1 isoform X1 
[Populus euphratica]
Length=900

 Score =   270 bits (690),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 129/226 (57%), Positives = 163/226 (72%), Gaps = 22/226 (10%)
 Frame = +1

Query  1360  REELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKNECATNYCP  1539
             + + C  +TPC C   CGK+CPC+     CEK+CGC  +CK  F+GCHC K++C +  CP
Sbjct  645   KNQSCKQFTPCGCQSMCGKQCPCLHNGTCCEKYCGCSKSCKNRFRGCHCAKSQCRSRQCP  704

Query  1540  CYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLLGRSDIAGW  1719
             C+A+GRECDPDVC  CWVSCGDGS+G PP K  + +C NM+LLL  QQ++LL +SD+AGW
Sbjct  705   CFAAGRECDPDVCRNCWVSCGDGSLGEPP-KRGDGQCGNMRLLLRQQQRILLAKSDVAGW  763

Query  1720  GAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQLVIDAYRRG  1899
             GAFLKN    V+KN+++G YTGELISH EADK GK+YDR N SFLF+LNDQ V+DAYR+G
Sbjct  764   GAFLKN---PVNKNDYLGEYTGELISHREADKRGKIYDRANSSFLFDLNDQFVLDAYRKG  820

Query  1900  NKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
             +KLKF NHS +PNC+AKV             ++VAG     DHR G
Sbjct  821   DKLKFANHSSNPNCYAKV-------------MLVAG-----DHRVG  848


 Score =   108 bits (269),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 73/156 (47%), Positives = 104/156 (67%), Gaps = 8/156 (5%)
 Frame = +1

Query  889   YTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALicsdsdeeiieeegenefaesedYI  1068
             YTTW FL +NQ+M EDQSV+GRRRIYYD +  EALICSDS+E+   EE ++EF + ED I
Sbjct  127   YTTWIFLDKNQRMAEDQSVVGRRRIYYDQHGSEALICSDSEEDNEPEEEKHEFCDGEDRI  186

Query  1069  LRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLIKEGATSKNENTEVTINSY-----  1233
             L M   + GL + VL++++       +E++ R + L  E   S +++ + T +S      
Sbjct  187   LWMISREHGLAEEVLNVVSQFIGVGTTEIQERCRTL--EEKYSGDQSVKDTSDSVTGRGI  244

Query  1234  -LDEDLDAALSSFDNLFCQRCFVFNCQLHGCSQDLI  1338
              +++ L  AL SFDNLFC+RC +F+C+LHGCSQ LI
Sbjct  245   SMEKSLSTALDSFDNLFCRRCLLFDCRLHGCSQTLI  280


 Score = 58.9 bits (141),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSK  2164
             +++V GDHR+GIFA + + A +EL YDY+Y PD  PAWA+  + S +
Sbjct  838   VMLVAGDHRVGIFAKEHIEACEELFYDYRYGPDQAPAWARKPEGSKR  884



>ref|XP_009111326.1| PREDICTED: histone-lysine N-methyltransferase EZA1 isoform X1 
[Brassica rapa]
 ref|XP_009111327.1| PREDICTED: histone-lysine N-methyltransferase EZA1 isoform X2 
[Brassica rapa]
Length=833

 Score =   269 bits (687),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 130/226 (58%), Positives = 158/226 (70%), Gaps = 22/226 (10%)
 Frame = +1

Query  1360  REELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKNECATNYCP  1539
             + + C  YTPC C   CGK CPC+     CEK+CGC  +CK  F+GCHC K++C +  CP
Sbjct  577   KNQSCKQYTPCGCLSMCGKDCPCLTNETCCEKYCGCSKSCKNRFRGCHCAKSQCRSRQCP  636

Query  1540  CYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLLGRSDIAGW  1719
             C+A+GRECDPDVC  CWVSCGDGS+G  P +    +C NM+LLL  QQ++LLG+SD+AGW
Sbjct  637   CFAAGRECDPDVCRNCWVSCGDGSLGEAP-RRGEGQCGNMRLLLRQQQRILLGKSDVAGW  695

Query  1720  GAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQLVIDAYRRG  1899
             GAFLKN    VSKNE++G YTGELISH EADK GK+YDR N SFLF+LNDQ V+DA R+G
Sbjct  696   GAFLKN---SVSKNEYLGEYTGELISHREADKRGKIYDRANSSFLFDLNDQFVLDAQRKG  752

Query  1900  NKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
             +KLKF NHS  PNC+AKV             + VAG     DHR G
Sbjct  753   DKLKFANHSAKPNCYAKV-------------MFVAG-----DHRVG  780


 Score =   112 bits (279),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 74/152 (49%), Positives = 100/152 (66%), Gaps = 2/152 (1%)
 Frame = +1

Query  889   YTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALicsdsdeeiieeegenefaesedYI  1068
             YTTW FL RNQ+M EDQSV+GRR+IYYD + GE LICSDS+EE   EE + E++E ED I
Sbjct  127   YTTWIFLDRNQRMVEDQSVVGRRQIYYDQHGGETLICSDSEEEPEPEEEKREYSEGEDCI  186

Query  1069  LRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLI--KEGATSKNENTEVTINSYLDE  1242
             + +  ++ G+ + V D L+   +   SE+  RY +L    E       ++   +   L++
Sbjct  187   IWLIGQEYGMGEKVQDALSQFLTLDASEILERYNELKLKNEQNAEAFSDSGFKLGISLEK  246

Query  1243  DLDAALSSFDNLFCQRCFVFNCQLHGCSQDLI  1338
              L AAL SFDNLFC+RC VF+C+LHGCSQ LI
Sbjct  247   GLSAALDSFDNLFCRRCLVFDCRLHGCSQPLI  278


 Score = 62.8 bits (151),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 35/48 (73%), Gaps = 0/48 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSKK  2167
             ++ V GDHR+GIFA + + A +EL YDY+Y PD  PAWA+  + SSKK
Sbjct  770   VMFVAGDHRVGIFANERIEASEELFYDYRYGPDQAPAWARKPEGSSKK  817



>ref|XP_008659029.1| PREDICTED: histone-lysine N-methyltransferase EZ2 isoform X4 
[Zea mays]
 gb|AFW88590.1| putative SET-domain containing protein family [Zea mays]
Length=730

 Score =   267 bits (682),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 128/221 (58%), Positives = 158/221 (71%), Gaps = 21/221 (10%)
 Frame = +1

Query  1375  AHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKNECATNYCPCYASG  1554
               Y+PC C   CGK CPC  K   CEK+CGC  +CK  F+GCHC K++C +  CPC+A+ 
Sbjct  480   TQYSPCACQQMCGKDCPCADKGTCCEKYCGCSKSCKNKFRGCHCAKSQCRSRQCPCFAAS  539

Query  1555  RECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLLGRSDIAGWGAFLK  1734
             RECDPDVC  CWVSCGDGS+G P  +   ++C NMKLLL  QQ++LLGRSD+AGWGAF+K
Sbjct  540   RECDPDVCRNCWVSCGDGSLGEPLARGDGYQCGNMKLLLKQQQRILLGRSDVAGWGAFIK  599

Query  1735  NCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQLVIDAYRRGNKLKF  1914
             N    V+KN+++G YTGELISH EADK GK+YDR N SFLF+LNDQ V+DAYR+G+KLKF
Sbjct  600   N---PVNKNDYLGEYTGELISHKEADKRGKIYDRANSSFLFDLNDQYVLDAYRKGDKLKF  656

Query  1915  INHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
              NHS +PNC+AKV             ++VAG     DHR G
Sbjct  657   ANHSSNPNCYAKV-------------MLVAG-----DHRVG  679


 Score = 91.7 bits (226),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 56/140 (40%), Positives = 84/140 (60%), Gaps = 1/140 (1%)
 Frame = +1

Query  925   MPEDQSVIGRRRIYYDMNSGEALi-csdsdeeiieeegenefaesedYILRMTIEKVGLY  1101
             M +DQSV+GRRRIYYD    EALI     +E    EE ++ F + ED+++    +  GL 
Sbjct  1     MADDQSVVGRRRIYYDTVGNEALICSDSDEEIPEPEEEKHFFTKGEDHLIWRATQDHGLN  60

Query  1102  DMVLDLLANHFSRKPSEVKARYKDLIKEGATSKNENTEVTINSYLDEDLDAALSSFDNLF  1281
               V+++L       PSE++ R + L ++       + ++     LD+ +DA L SFDNLF
Sbjct  61    QEVVNVLCQFIGATPSEIEERSEVLFEKNEKHSGSSDKIESRLSLDKTMDAVLDSFDNLF  120

Query  1282  CQRCFVFNCQLHGCSQDLII  1341
             C+RC VF+C+LHGCSQ+L+ 
Sbjct  121   CRRCLVFDCRLHGCSQNLVF  140


 Score = 58.5 bits (140),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSK  2164
             +++V GDHR+GI+A + + A +EL YDY+Y PD  PAWA+  + S K
Sbjct  669   VMLVAGDHRVGIYAKEHIEASEELFYDYRYGPDQAPAWARRPEGSKK  715



>ref|XP_009604955.1| PREDICTED: histone-lysine N-methyltransferase EZA1 isoform X1 
[Nicotiana tomentosiformis]
Length=831

 Score =   269 bits (687),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 128/226 (57%), Positives = 161/226 (71%), Gaps = 22/226 (10%)
 Frame = +1

Query  1360  REELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKNECATNYCP  1539
             + + C  Y PC C P CGK CPC+     CEK+CGC  +CK  F+GCHC K++C +  CP
Sbjct  576   KNQSCIQYNPCGCQPVCGKHCPCLQNGTCCEKYCGCSKSCKNRFRGCHCAKSQCRSRQCP  635

Query  1540  CYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLLGRSDIAGW  1719
             C+A+GRECDPDVC  CWVSCGDGS+G PP +    +C NM+LLL  QQ++LL +S++AGW
Sbjct  636   CFAAGRECDPDVCRNCWVSCGDGSLGEPP-RRGEGQCGNMRLLLRQQQRILLSKSEVAGW  694

Query  1720  GAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQLVIDAYRRG  1899
             GAFLKN    V+KN+++G YTGELISH EADK GK+YDR N SFLF+LNDQ V+DAYR+G
Sbjct  695   GAFLKN---PVNKNDYLGEYTGELISHREADKRGKIYDRANSSFLFDLNDQYVLDAYRKG  751

Query  1900  NKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
             +KLKF NHS +PNC+AKV             ++VAG     DHR G
Sbjct  752   DKLKFANHSSNPNCYAKV-------------MLVAG-----DHRVG  779


 Score =   111 bits (277),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 98/157 (62%), Gaps = 7/157 (4%)
 Frame = +1

Query  889   YTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALi-csdsdeeiieeegenefaesedY  1065
             YTTW FL RNQ+M EDQSV GRRRIYYD +  EALI     ++    EE +  F+E ED 
Sbjct  133   YTTWIFLDRNQRMAEDQSVAGRRRIYYDQHGSEALICSDSEEDIAEPEEEKRNFSEGEDK  192

Query  1066  ILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLIK-----EGATSKNE-NTEVTIN  1227
             IL M  ++ GL + VLD+L ++     SE+      L++     +G + K+   + +  N
Sbjct  193   ILWMVSQEFGLNEEVLDILTHYVGGTSSEILEHCNLLVENHQNTDGKSLKDSGKSGLGGN  252

Query  1228  SYLDEDLDAALSSFDNLFCQRCFVFNCQLHGCSQDLI  1338
              +LD+ L AAL SFDNLFC+RC VF+C+LHGCSQ  I
Sbjct  253   IFLDKSLTAALDSFDNLFCRRCLVFDCRLHGCSQIFI  289


 Score = 57.4 bits (137),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 22/47 (47%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSK  2164
             +++V GDHR+GIFA + + A DEL YDY+Y PD  P WA+  + + +
Sbjct  769   VMLVAGDHRVGIFAKERIEASDELFYDYRYGPDQAPIWARKPEGTKR  815



>ref|XP_009604957.1| PREDICTED: histone-lysine N-methyltransferase EZA1 isoform X3 
[Nicotiana tomentosiformis]
Length=829

 Score =   269 bits (687),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 128/226 (57%), Positives = 161/226 (71%), Gaps = 22/226 (10%)
 Frame = +1

Query  1360  REELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKNECATNYCP  1539
             + + C  Y PC C P CGK CPC+     CEK+CGC  +CK  F+GCHC K++C +  CP
Sbjct  574   KNQSCIQYNPCGCQPVCGKHCPCLQNGTCCEKYCGCSKSCKNRFRGCHCAKSQCRSRQCP  633

Query  1540  CYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLLGRSDIAGW  1719
             C+A+GRECDPDVC  CWVSCGDGS+G PP +    +C NM+LLL  QQ++LL +S++AGW
Sbjct  634   CFAAGRECDPDVCRNCWVSCGDGSLGEPP-RRGEGQCGNMRLLLRQQQRILLSKSEVAGW  692

Query  1720  GAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQLVIDAYRRG  1899
             GAFLKN    V+KN+++G YTGELISH EADK GK+YDR N SFLF+LNDQ V+DAYR+G
Sbjct  693   GAFLKN---PVNKNDYLGEYTGELISHREADKRGKIYDRANSSFLFDLNDQYVLDAYRKG  749

Query  1900  NKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
             +KLKF NHS +PNC+AKV             ++VAG     DHR G
Sbjct  750   DKLKFANHSSNPNCYAKV-------------MLVAG-----DHRVG  777


 Score =   110 bits (276),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 98/157 (62%), Gaps = 7/157 (4%)
 Frame = +1

Query  889   YTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALi-csdsdeeiieeegenefaesedY  1065
             YTTW FL RNQ+M EDQSV GRRRIYYD +  EALI     ++    EE +  F+E ED 
Sbjct  131   YTTWIFLDRNQRMAEDQSVAGRRRIYYDQHGSEALICSDSEEDIAEPEEEKRNFSEGEDK  190

Query  1066  ILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLIK-----EGATSKNE-NTEVTIN  1227
             IL M  ++ GL + VLD+L ++     SE+      L++     +G + K+   + +  N
Sbjct  191   ILWMVSQEFGLNEEVLDILTHYVGGTSSEILEHCNLLVENHQNTDGKSLKDSGKSGLGGN  250

Query  1228  SYLDEDLDAALSSFDNLFCQRCFVFNCQLHGCSQDLI  1338
              +LD+ L AAL SFDNLFC+RC VF+C+LHGCSQ  I
Sbjct  251   IFLDKSLTAALDSFDNLFCRRCLVFDCRLHGCSQIFI  287


 Score = 57.4 bits (137),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 22/47 (47%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSK  2164
             +++V GDHR+GIFA + + A DEL YDY+Y PD  P WA+  + + +
Sbjct  767   VMLVAGDHRVGIFAKERIEASDELFYDYRYGPDQAPIWARKPEGTKR  813



>ref|XP_009604956.1| PREDICTED: histone-lysine N-methyltransferase EZA1 isoform X2 
[Nicotiana tomentosiformis]
Length=830

 Score =   268 bits (686),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 128/226 (57%), Positives = 161/226 (71%), Gaps = 22/226 (10%)
 Frame = +1

Query  1360  REELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKNECATNYCP  1539
             + + C  Y PC C P CGK CPC+     CEK+CGC  +CK  F+GCHC K++C +  CP
Sbjct  575   KNQSCIQYNPCGCQPVCGKHCPCLQNGTCCEKYCGCSKSCKNRFRGCHCAKSQCRSRQCP  634

Query  1540  CYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLLGRSDIAGW  1719
             C+A+GRECDPDVC  CWVSCGDGS+G PP +    +C NM+LLL  QQ++LL +S++AGW
Sbjct  635   CFAAGRECDPDVCRNCWVSCGDGSLGEPP-RRGEGQCGNMRLLLRQQQRILLSKSEVAGW  693

Query  1720  GAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQLVIDAYRRG  1899
             GAFLKN    V+KN+++G YTGELISH EADK GK+YDR N SFLF+LNDQ V+DAYR+G
Sbjct  694   GAFLKN---PVNKNDYLGEYTGELISHREADKRGKIYDRANSSFLFDLNDQYVLDAYRKG  750

Query  1900  NKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
             +KLKF NHS +PNC+AKV             ++VAG     DHR G
Sbjct  751   DKLKFANHSSNPNCYAKV-------------MLVAG-----DHRVG  778


 Score =   110 bits (276),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 98/157 (62%), Gaps = 7/157 (4%)
 Frame = +1

Query  889   YTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALi-csdsdeeiieeegenefaesedY  1065
             YTTW FL RNQ+M EDQSV GRRRIYYD +  EALI     ++    EE +  F+E ED 
Sbjct  132   YTTWIFLDRNQRMAEDQSVAGRRRIYYDQHGSEALICSDSEEDIAEPEEEKRNFSEGEDK  191

Query  1066  ILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLIK-----EGATSKNE-NTEVTIN  1227
             IL M  ++ GL + VLD+L ++     SE+      L++     +G + K+   + +  N
Sbjct  192   ILWMVSQEFGLNEEVLDILTHYVGGTSSEILEHCNLLVENHQNTDGKSLKDSGKSGLGGN  251

Query  1228  SYLDEDLDAALSSFDNLFCQRCFVFNCQLHGCSQDLI  1338
              +LD+ L AAL SFDNLFC+RC VF+C+LHGCSQ  I
Sbjct  252   IFLDKSLTAALDSFDNLFCRRCLVFDCRLHGCSQIFI  288


 Score = 57.4 bits (137),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 22/47 (47%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSK  2164
             +++V GDHR+GIFA + + A DEL YDY+Y PD  P WA+  + + +
Sbjct  768   VMLVAGDHRVGIFAKERIEASDELFYDYRYGPDQAPIWARKPEGTKR  814



>ref|XP_010456095.1| PREDICTED: histone-lysine N-methyltransferase EZA1-like isoform 
X3 [Camelina sativa]
Length=854

 Score =   269 bits (687),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 130/226 (58%), Positives = 158/226 (70%), Gaps = 22/226 (10%)
 Frame = +1

Query  1360  REELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKNECATNYCP  1539
             + + C  YTPC C   CGK CPC+     CEK+CGC  +CK  F+GCHC K++C +  CP
Sbjct  599   KNQSCKQYTPCGCVSMCGKDCPCLTNETCCEKYCGCSKSCKNRFRGCHCAKSQCRSRQCP  658

Query  1540  CYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLLGRSDIAGW  1719
             C+A+GRECDPDVC  CWVSCGDGS+G  P +    +C NM+LLL  QQ++LLG+SD+AGW
Sbjct  659   CFAAGRECDPDVCRNCWVSCGDGSLGEAP-RRGEGQCGNMRLLLRQQQRILLGKSDVAGW  717

Query  1720  GAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQLVIDAYRRG  1899
             GAFLKN    VSKNE++G YTGELISH EADK GK+YDR N SFLF+LNDQ V+DA R+G
Sbjct  718   GAFLKN---SVSKNEYLGEYTGELISHREADKRGKIYDRANSSFLFDLNDQYVLDAQRKG  774

Query  1900  NKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
             +KLKF NHS  PNC+AKV             + VAG     DHR G
Sbjct  775   DKLKFANHSAKPNCYAKV-------------MFVAG-----DHRVG  802


 Score =   108 bits (270),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 72/152 (47%), Positives = 100/152 (66%), Gaps = 2/152 (1%)
 Frame = +1

Query  889   YTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALicsdsdeeiieeegenefaesedYI  1068
             YTTW FL RNQ+M EDQSV+GRR+IYY+ + GE LICSDS+EE   EE + E++E ED +
Sbjct  133   YTTWIFLDRNQRMAEDQSVVGRRQIYYEHHGGETLICSDSEEEPEPEEEKREYSEGEDSV  192

Query  1069  LRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLIKEGATSKN--ENTEVTINSYLDE  1242
             +    ++ G+ + V D L    S   S++  RY +L  +   +     N+ + +   L++
Sbjct  193   IWSIGQEYGMGEKVQDALCQFLSVDASDILERYDELKLKNVDNVEGFSNSGLKLGISLEK  252

Query  1243  DLDAALSSFDNLFCQRCFVFNCQLHGCSQDLI  1338
              L AAL SFDNLFC+RC VF+C+LHGCSQ LI
Sbjct  253   GLGAALDSFDNLFCRRCLVFDCRLHGCSQPLI  284


 Score = 59.3 bits (142),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSK  2164
             ++ V GDHR+GIFA + + A +EL YDY+Y PD  PAWA+  + S K
Sbjct  792   VMFVAGDHRVGIFANERIEASEELFYDYRYGPDQAPAWARKPEGSKK  838



>ref|XP_010456094.1| PREDICTED: histone-lysine N-methyltransferase EZA1-like isoform 
X2 [Camelina sativa]
Length=854

 Score =   269 bits (687),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 130/226 (58%), Positives = 158/226 (70%), Gaps = 22/226 (10%)
 Frame = +1

Query  1360  REELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKNECATNYCP  1539
             + + C  YTPC C   CGK CPC+     CEK+CGC  +CK  F+GCHC K++C +  CP
Sbjct  599   KNQSCKQYTPCGCVSMCGKDCPCLTNETCCEKYCGCSKSCKNRFRGCHCAKSQCRSRQCP  658

Query  1540  CYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLLGRSDIAGW  1719
             C+A+GRECDPDVC  CWVSCGDGS+G  P +    +C NM+LLL  QQ++LLG+SD+AGW
Sbjct  659   CFAAGRECDPDVCRNCWVSCGDGSLGEAP-RRGEGQCGNMRLLLRQQQRILLGKSDVAGW  717

Query  1720  GAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQLVIDAYRRG  1899
             GAFLKN    VSKNE++G YTGELISH EADK GK+YDR N SFLF+LNDQ V+DA R+G
Sbjct  718   GAFLKN---SVSKNEYLGEYTGELISHREADKRGKIYDRANSSFLFDLNDQYVLDAQRKG  774

Query  1900  NKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
             +KLKF NHS  PNC+AKV             + VAG     DHR G
Sbjct  775   DKLKFANHSAKPNCYAKV-------------MFVAG-----DHRVG  802


 Score =   108 bits (270),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 72/152 (47%), Positives = 100/152 (66%), Gaps = 2/152 (1%)
 Frame = +1

Query  889   YTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALicsdsdeeiieeegenefaesedYI  1068
             YTTW FL RNQ+M EDQSV+GRR+IYY+ + GE LICSDS+EE   EE + E++E ED +
Sbjct  133   YTTWIFLDRNQRMAEDQSVVGRRQIYYEHHGGETLICSDSEEEPEPEEEKREYSEGEDSV  192

Query  1069  LRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLIKEGATSKN--ENTEVTINSYLDE  1242
             +    ++ G+ + V D L    S   S++  RY +L  +   +     N+ + +   L++
Sbjct  193   IWSIGQEYGMGEKVQDALCQFLSVDASDILERYDELKLKNVDNVEGFSNSGLKLGISLEK  252

Query  1243  DLDAALSSFDNLFCQRCFVFNCQLHGCSQDLI  1338
              L AAL SFDNLFC+RC VF+C+LHGCSQ LI
Sbjct  253   GLGAALDSFDNLFCRRCLVFDCRLHGCSQPLI  284


 Score = 59.3 bits (142),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSK  2164
             ++ V GDHR+GIFA + + A +EL YDY+Y PD  PAWA+  + S K
Sbjct  792   VMFVAGDHRVGIFANERIEASEELFYDYRYGPDQAPAWARKPEGSKK  838



>ref|XP_010456093.1| PREDICTED: histone-lysine N-methyltransferase EZA1-like isoform 
X1 [Camelina sativa]
Length=855

 Score =   269 bits (687),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 130/226 (58%), Positives = 158/226 (70%), Gaps = 22/226 (10%)
 Frame = +1

Query  1360  REELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKNECATNYCP  1539
             + + C  YTPC C   CGK CPC+     CEK+CGC  +CK  F+GCHC K++C +  CP
Sbjct  600   KNQSCKQYTPCGCVSMCGKDCPCLTNETCCEKYCGCSKSCKNRFRGCHCAKSQCRSRQCP  659

Query  1540  CYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLLGRSDIAGW  1719
             C+A+GRECDPDVC  CWVSCGDGS+G  P +    +C NM+LLL  QQ++LLG+SD+AGW
Sbjct  660   CFAAGRECDPDVCRNCWVSCGDGSLGEAP-RRGEGQCGNMRLLLRQQQRILLGKSDVAGW  718

Query  1720  GAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQLVIDAYRRG  1899
             GAFLKN    VSKNE++G YTGELISH EADK GK+YDR N SFLF+LNDQ V+DA R+G
Sbjct  719   GAFLKN---SVSKNEYLGEYTGELISHREADKRGKIYDRANSSFLFDLNDQYVLDAQRKG  775

Query  1900  NKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
             +KLKF NHS  PNC+AKV             + VAG     DHR G
Sbjct  776   DKLKFANHSAKPNCYAKV-------------MFVAG-----DHRVG  803


 Score =   108 bits (270),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 72/152 (47%), Positives = 100/152 (66%), Gaps = 2/152 (1%)
 Frame = +1

Query  889   YTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALicsdsdeeiieeegenefaesedYI  1068
             YTTW FL RNQ+M EDQSV+GRR+IYY+ + GE LICSDS+EE   EE + E++E ED +
Sbjct  134   YTTWIFLDRNQRMAEDQSVVGRRQIYYEHHGGETLICSDSEEEPEPEEEKREYSEGEDSV  193

Query  1069  LRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLIKEGATSKN--ENTEVTINSYLDE  1242
             +    ++ G+ + V D L    S   S++  RY +L  +   +     N+ + +   L++
Sbjct  194   IWSIGQEYGMGEKVQDALCQFLSVDASDILERYDELKLKNVDNVEGFSNSGLKLGISLEK  253

Query  1243  DLDAALSSFDNLFCQRCFVFNCQLHGCSQDLI  1338
              L AAL SFDNLFC+RC VF+C+LHGCSQ LI
Sbjct  254   GLGAALDSFDNLFCRRCLVFDCRLHGCSQPLI  285


 Score = 59.3 bits (142),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSK  2164
             ++ V GDHR+GIFA + + A +EL YDY+Y PD  PAWA+  + S K
Sbjct  793   VMFVAGDHRVGIFANERIEASEELFYDYRYGPDQAPAWARKPEGSKK  839



>emb|CDY07102.1| BnaCnng01170D [Brassica napus]
Length=856

 Score =   269 bits (687),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 130/226 (58%), Positives = 158/226 (70%), Gaps = 22/226 (10%)
 Frame = +1

Query  1360  REELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKNECATNYCP  1539
             + + C  YTPC C   CGK CPC+     CEK+CGC  +CK  F+GCHC K++C +  CP
Sbjct  600   KNQSCKQYTPCGCLSMCGKDCPCLTNETCCEKYCGCSKSCKNRFRGCHCAKSQCRSRQCP  659

Query  1540  CYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLLGRSDIAGW  1719
             C+A+GRECDPDVC  CWVSCGDGS+G  P +    +C NM+LLL  QQ++LLG+SD+AGW
Sbjct  660   CFAAGRECDPDVCRNCWVSCGDGSLGEAP-RRGEGQCGNMRLLLRQQQRILLGKSDVAGW  718

Query  1720  GAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQLVIDAYRRG  1899
             GAFLKN    VSKNE++G YTGELISH EADK GK+YDR N SFLF+LNDQ V+DA R+G
Sbjct  719   GAFLKN---SVSKNEYLGEYTGELISHREADKRGKIYDRANSSFLFDLNDQFVLDAQRKG  775

Query  1900  NKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
             +KLKF NHS  PNC+AKV             + VAG     DHR G
Sbjct  776   DKLKFANHSAKPNCYAKV-------------MFVAG-----DHRVG  803


 Score =   103 bits (257),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 77/166 (46%), Positives = 100/166 (60%), Gaps = 20/166 (12%)
 Frame = +1

Query  889   YTTWAFLHR----------NQKMPEDQSVIGRRRIYYDMNSGEALicsdsdeeiieeege  1038
             YTTW FL R          NQ+M EDQSV+GRR+IYYD + GE LICSDS+EE   EE +
Sbjct  130   YTTWIFLDRHEFHSDVLNQNQRMVEDQSVVGRRQIYYDQHGGETLICSDSEEEPEPEEEK  189

Query  1039  nefaesedYILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLIKEGATSKNENTEV  1218
              E++E ED I+ +  ++ G+ + V D L+       SE+  RY +L         +N E 
Sbjct  190   REYSEGEDCIIWLIGQEYGMGEEVQDALSQFLILDASEILERYNEL----KLKNQQNVEA  245

Query  1219  TINS------YLDEDLDAALSSFDNLFCQRCFVFNCQLHGCSQDLI  1338
               +S       LD+ L AAL SFDNLFC+RC VF+C+LHGCSQ LI
Sbjct  246   FSDSGFKLGISLDKGLSAALDSFDNLFCRRCLVFDCRLHGCSQPLI  291


 Score = 62.8 bits (151),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 35/48 (73%), Gaps = 0/48 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSKK  2167
             ++ V GDHR+GIFA + + A +EL YDY+Y PD  PAWA+  + SSKK
Sbjct  793   VMFVAGDHRVGIFANERIEASEELFYDYRYGPDQAPAWARKPEGSSKK  840



>ref|XP_008659028.1| PREDICTED: histone-lysine N-methyltransferase EZ2 isoform X3 
[Zea mays]
Length=750

 Score =   267 bits (682),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 128/221 (58%), Positives = 158/221 (71%), Gaps = 21/221 (10%)
 Frame = +1

Query  1375  AHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKNECATNYCPCYASG  1554
               Y+PC C   CGK CPC  K   CEK+CGC  +CK  F+GCHC K++C +  CPC+A+ 
Sbjct  500   TQYSPCACQQMCGKDCPCADKGTCCEKYCGCSKSCKNKFRGCHCAKSQCRSRQCPCFAAS  559

Query  1555  RECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLLGRSDIAGWGAFLK  1734
             RECDPDVC  CWVSCGDGS+G P  +   ++C NMKLLL  QQ++LLGRSD+AGWGAF+K
Sbjct  560   RECDPDVCRNCWVSCGDGSLGEPLARGDGYQCGNMKLLLKQQQRILLGRSDVAGWGAFIK  619

Query  1735  NCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQLVIDAYRRGNKLKF  1914
             N    V+KN+++G YTGELISH EADK GK+YDR N SFLF+LNDQ V+DAYR+G+KLKF
Sbjct  620   N---PVNKNDYLGEYTGELISHKEADKRGKIYDRANSSFLFDLNDQYVLDAYRKGDKLKF  676

Query  1915  INHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
              NHS +PNC+AKV             ++VAG     DHR G
Sbjct  677   ANHSSNPNCYAKV-------------MLVAG-----DHRVG  699


 Score = 99.0 bits (245),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 59/145 (41%), Positives = 88/145 (61%), Gaps = 1/145 (1%)
 Frame = +1

Query  910   HRNQKMPEDQSVIGRRRIYYDMNSGEALi-csdsdeeiieeegenefaesedYILRMTIE  1086
              RNQ+M +DQSV+GRRRIYYD    EALI     +E    EE ++ F + ED+++    +
Sbjct  16    RRNQRMADDQSVVGRRRIYYDTVGNEALICSDSDEEIPEPEEEKHFFTKGEDHLIWRATQ  75

Query  1087  KVGLYDMVLDLLANHFSRKPSEVKARYKDLIKEGATSKNENTEVTINSYLDEDLDAALSS  1266
               GL   V+++L       PSE++ R + L ++       + ++     LD+ +DA L S
Sbjct  76    DHGLNQEVVNVLCQFIGATPSEIEERSEVLFEKNEKHSGSSDKIESRLSLDKTMDAVLDS  135

Query  1267  FDNLFCQRCFVFNCQLHGCSQDLII  1341
             FDNLFC+RC VF+C+LHGCSQ+L+ 
Sbjct  136   FDNLFCRRCLVFDCRLHGCSQNLVF  160


 Score = 58.5 bits (140),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSK  2164
             +++V GDHR+GI+A + + A +EL YDY+Y PD  PAWA+  + S K
Sbjct  689   VMLVAGDHRVGIYAKEHIEASEELFYDYRYGPDQAPAWARRPEGSKK  735



>ref|XP_006396399.1| hypothetical protein EUTSA_v10028423mg [Eutrema salsugineum]
 gb|ESQ37852.1| hypothetical protein EUTSA_v10028423mg [Eutrema salsugineum]
Length=839

 Score =   268 bits (686),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 131/226 (58%), Positives = 158/226 (70%), Gaps = 22/226 (10%)
 Frame = +1

Query  1360  REELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKNECATNYCP  1539
             + + C  YTPC C   CGK+CPC      CEK+CGC  +CK  F+GCHC K++C +  CP
Sbjct  584   KNQSCKQYTPCGCQSMCGKECPCQTNETCCEKYCGCSKSCKNRFRGCHCAKSQCRSRQCP  643

Query  1540  CYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLLGRSDIAGW  1719
             C+A+GRECDPDVC  CWVSCGDGS+G  P +    +C NM+LLL  QQ++LLG+SDIAGW
Sbjct  644   CFAAGRECDPDVCRNCWVSCGDGSLGEAP-RRGEGQCGNMRLLLRQQQRILLGKSDIAGW  702

Query  1720  GAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQLVIDAYRRG  1899
             GAFLKN    VSKNE++G YTGELISH EADK GK+YDR N SFLF+LNDQ V+DA R+G
Sbjct  703   GAFLKN---SVSKNEYLGEYTGELISHREADKRGKIYDRANSSFLFDLNDQYVLDAQRKG  759

Query  1900  NKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
             +KLKF NHS  PNC+AKV             + VAG     DHR G
Sbjct  760   DKLKFANHSAKPNCYAKV-------------MFVAG-----DHRVG  787


 Score =   111 bits (277),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 73/152 (48%), Positives = 102/152 (67%), Gaps = 2/152 (1%)
 Frame = +1

Query  889   YTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALicsdsdeeiieeegenefaesedYI  1068
             YTTW FL RNQ+M EDQSV+GRR+IYYD + GE LICSDS+EE   EE   E++E ED +
Sbjct  117   YTTWIFLDRNQRMAEDQSVVGRRQIYYDQHGGETLICSDSEEEPEPEEERREYSEGEDSV  176

Query  1069  LRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDL-IKEGATSKN-ENTEVTINSYLDE  1242
             + +  ++ G+ + V D L    S   S++  R+ +L +K     +N  ++   +  +L++
Sbjct  177   IWLIGQEYGMGEEVQDALCQILSLDASDILERFNELKLKNEQNVENFSDSRFKLGIFLEK  236

Query  1243  DLDAALSSFDNLFCQRCFVFNCQLHGCSQDLI  1338
              L AAL SFDNLFC+RC VF+C+LHGCSQ LI
Sbjct  237   GLSAALDSFDNLFCRRCLVFDCRLHGCSQPLI  268


 Score = 59.3 bits (142),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSK  2164
             ++ V GDHR+GIFA + + A +EL YDY+Y PD  PAWA+  + S K
Sbjct  777   VMFVAGDHRVGIFANERIEASEELFYDYRYGPDQAPAWARKPEGSKK  823



>ref|XP_009783486.1| PREDICTED: histone-lysine N-methyltransferase EZA1 isoform X2 
[Nicotiana sylvestris]
Length=841

 Score =   268 bits (686),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 128/226 (57%), Positives = 161/226 (71%), Gaps = 22/226 (10%)
 Frame = +1

Query  1360  REELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKNECATNYCP  1539
             + + C  Y PC C P CGK CPC+     CEK+CGC  +CK  F+GCHC K++C +  CP
Sbjct  586   KNQSCIQYNPCGCHPVCGKNCPCLQNGTCCEKYCGCSKSCKNRFRGCHCAKSQCRSRQCP  645

Query  1540  CYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLLGRSDIAGW  1719
             C+A+GRECDPDVC  CWVSCGDGS+G PP +    +C NM+LLL  QQ++LL +S+IAGW
Sbjct  646   CFAAGRECDPDVCRNCWVSCGDGSLGEPP-RRGEGQCGNMRLLLRQQQRILLSKSEIAGW  704

Query  1720  GAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQLVIDAYRRG  1899
             GAFLKN    V+KN+++G YTGELISH EAD+ GK+YDR N SFLF+LNDQ V+DAYR+G
Sbjct  705   GAFLKN---PVNKNDYLGEYTGELISHREADRRGKIYDRANSSFLFDLNDQYVLDAYRKG  761

Query  1900  NKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
             +KLKF NHS +PNC+AKV             ++VAG     DHR G
Sbjct  762   DKLKFANHSSNPNCYAKV-------------MLVAG-----DHRVG  789


 Score =   110 bits (274),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 70/157 (45%), Positives = 99/157 (63%), Gaps = 7/157 (4%)
 Frame = +1

Query  889   YTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALi-csdsdeeiieeegenefaesedY  1065
             YTTW FL RNQ+M EDQSV GRRRIYYD +  EALI     ++    EE + +F+E ED 
Sbjct  143   YTTWIFLDRNQRMAEDQSVAGRRRIYYDQHGSEALICSDSEEDIAEPEEEKRDFSEGEDK  202

Query  1066  ILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLIKEGATSKNEN------TEVTIN  1227
             IL M  ++ GL + V+D+L ++     SE+      L+++   + +++      + +  N
Sbjct  203   ILWMASQEFGLSEEVVDILTHYVGGTSSEILEHCNLLVEKHQNTDSKSFKDSGKSGLGGN  262

Query  1228  SYLDEDLDAALSSFDNLFCQRCFVFNCQLHGCSQDLI  1338
              +LD+ L AAL SFDNLFC+RC VF+C+LHGCSQ  I
Sbjct  263   IFLDKSLTAALDSFDNLFCRRCLVFDCRLHGCSQIFI  299


 Score = 57.8 bits (138),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 22/47 (47%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSK  2164
             +++V GDHR+GIFA + + A DEL YDY+Y PD  P WA+  + + +
Sbjct  779   VMLVAGDHRVGIFAKERIEASDELFYDYRYGPDQAPIWARKPEGTKR  825



>ref|XP_002874946.1| swinger [Arabidopsis lyrata subsp. lyrata]
 gb|EFH51205.1| swinger [Arabidopsis lyrata subsp. lyrata]
Length=846

 Score =   268 bits (686),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 130/226 (58%), Positives = 158/226 (70%), Gaps = 22/226 (10%)
 Frame = +1

Query  1360  REELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKNECATNYCP  1539
             + + C  YTPC C   CGK CPC+     CEK+CGC  +CK  F+GCHC K++C +  CP
Sbjct  591   KNQSCKQYTPCGCLSMCGKDCPCLTNETCCEKYCGCSKSCKNRFRGCHCAKSQCRSRQCP  650

Query  1540  CYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLLGRSDIAGW  1719
             C+A+GRECDPDVC  CWVSCGDGS+G  P +    +C NM+LLL  QQ++LLG+SD+AGW
Sbjct  651   CFAAGRECDPDVCRNCWVSCGDGSLGEAP-RRGEGQCGNMRLLLRQQQRILLGKSDVAGW  709

Query  1720  GAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQLVIDAYRRG  1899
             GAFLKN    VSKNE++G YTGELISH EADK GK+YDR N SFLF+LNDQ V+DA R+G
Sbjct  710   GAFLKN---SVSKNEYLGEYTGELISHREADKRGKIYDRANSSFLFDLNDQYVLDAQRKG  766

Query  1900  NKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
             +KLKF NHS  PNC+AKV             + VAG     DHR G
Sbjct  767   DKLKFANHSAKPNCYAKV-------------MFVAG-----DHRVG  794


 Score =   115 bits (288),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 75/152 (49%), Positives = 105/152 (69%), Gaps = 2/152 (1%)
 Frame = +1

Query  889   YTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALicsdsdeeiieeegenefaesedYI  1068
             YTTW FL RNQ+M EDQSV+GRR+IYY+ + GE LICSDS+EE   EE + E++E ED +
Sbjct  128   YTTWIFLDRNQRMAEDQSVVGRRQIYYERHGGETLICSDSEEEPEPEEEKREYSEGEDSV  187

Query  1069  LRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDL-IKEGATSKN-ENTEVTINSYLDE  1242
             + +  ++ G+ + V D L    S   S++  RY +L +K+   ++N  N+   +   L++
Sbjct  188   IWLIGQEYGMGEEVQDSLCQFLSVDASDILGRYNELKLKDEQNTENFSNSGFKLGISLEK  247

Query  1243  DLDAALSSFDNLFCQRCFVFNCQLHGCSQDLI  1338
             DL AAL SFDNLFC+RC VF+C+LHGCSQ LI
Sbjct  248   DLGAALDSFDNLFCRRCLVFDCRLHGCSQPLI  279


 Score = 59.3 bits (142),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSK  2164
             ++ V GDHR+GIFA + + A +EL YDY+Y PD  PAWA+  + S K
Sbjct  784   VMFVAGDHRVGIFANERIEASEELFYDYRYGPDQAPAWARKPEGSKK  830



>emb|CDY22021.1| BnaA09g00500D [Brassica napus]
Length=852

 Score =   268 bits (686),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 130/226 (58%), Positives = 158/226 (70%), Gaps = 22/226 (10%)
 Frame = +1

Query  1360  REELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKNECATNYCP  1539
             + + C  YTPC C   CGK CPC+     CEK+CGC  +CK  F+GCHC K++C +  CP
Sbjct  596   KNQSCKQYTPCGCLSMCGKDCPCLTNETCCEKYCGCSKSCKNRFRGCHCAKSQCRSRQCP  655

Query  1540  CYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLLGRSDIAGW  1719
             C+A+GRECDPDVC  CWVSCGDGS+G  P +    +C NM+LLL  QQ++LLG+SD+AGW
Sbjct  656   CFAAGRECDPDVCRNCWVSCGDGSLGEAP-RRGEGQCGNMRLLLRQQQRILLGKSDVAGW  714

Query  1720  GAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQLVIDAYRRG  1899
             GAFLKN    VSKNE++G YTGELISH EADK GK+YDR N SFLF+LNDQ V+DA R+G
Sbjct  715   GAFLKN---SVSKNEYLGEYTGELISHREADKRGKIYDRANSSFLFDLNDQFVLDAQRKG  771

Query  1900  NKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
             +KLKF NHS  PNC+AKV             + VAG     DHR G
Sbjct  772   DKLKFANHSAKPNCYAKV-------------MFVAG-----DHRVG  799


 Score =   106 bits (264),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 74/156 (47%), Positives = 100/156 (64%), Gaps = 6/156 (4%)
 Frame = +1

Query  889   YTTWAFLHR----NQKMPEDQSVIGRRRIYYDMNSGEALicsdsdeeiieeegenefaes  1056
             YTTW FL R    NQ+M EDQSV+GRR+IYYD + GE LICSDS+EE   EE + E++E 
Sbjct  142   YTTWIFLDRQVLLNQRMVEDQSVVGRRQIYYDQHGGETLICSDSEEEPEPEEEKREYSEG  201

Query  1057  edYILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLI--KEGATSKNENTEVTINS  1230
             ED I+ +  ++ G+ + V D L+   +   SE+  RY +L    E       ++   +  
Sbjct  202   EDCIIWLIGQEYGMGEKVQDALSQFLTLDASEILERYNELKLKNEQNAEAFSDSGFKLGI  261

Query  1231  YLDEDLDAALSSFDNLFCQRCFVFNCQLHGCSQDLI  1338
              L++ L AAL SFDNLFC+RC VF+C+LHGCSQ LI
Sbjct  262   SLEKGLSAALDSFDNLFCRRCLVFDCRLHGCSQPLI  297


 Score = 62.8 bits (151),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 35/48 (73%), Gaps = 0/48 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSKK  2167
             ++ V GDHR+GIFA + + A +EL YDY+Y PD  PAWA+  + SSKK
Sbjct  789   VMFVAGDHRVGIFANERIEASEELFYDYRYGPDQAPAWARKPEGSSKK  836



>ref|XP_006396400.1| hypothetical protein EUTSA_v10028423mg [Eutrema salsugineum]
 gb|ESQ37853.1| hypothetical protein EUTSA_v10028423mg [Eutrema salsugineum]
Length=851

 Score =   268 bits (686),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 131/226 (58%), Positives = 158/226 (70%), Gaps = 22/226 (10%)
 Frame = +1

Query  1360  REELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKNECATNYCP  1539
             + + C  YTPC C   CGK+CPC      CEK+CGC  +CK  F+GCHC K++C +  CP
Sbjct  596   KNQSCKQYTPCGCQSMCGKECPCQTNETCCEKYCGCSKSCKNRFRGCHCAKSQCRSRQCP  655

Query  1540  CYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLLGRSDIAGW  1719
             C+A+GRECDPDVC  CWVSCGDGS+G  P +    +C NM+LLL  QQ++LLG+SDIAGW
Sbjct  656   CFAAGRECDPDVCRNCWVSCGDGSLGEAP-RRGEGQCGNMRLLLRQQQRILLGKSDIAGW  714

Query  1720  GAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQLVIDAYRRG  1899
             GAFLKN    VSKNE++G YTGELISH EADK GK+YDR N SFLF+LNDQ V+DA R+G
Sbjct  715   GAFLKN---SVSKNEYLGEYTGELISHREADKRGKIYDRANSSFLFDLNDQYVLDAQRKG  771

Query  1900  NKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
             +KLKF NHS  PNC+AKV             + VAG     DHR G
Sbjct  772   DKLKFANHSAKPNCYAKV-------------MFVAG-----DHRVG  799


 Score =   111 bits (277),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 73/152 (48%), Positives = 102/152 (67%), Gaps = 2/152 (1%)
 Frame = +1

Query  889   YTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALicsdsdeeiieeegenefaesedYI  1068
             YTTW FL RNQ+M EDQSV+GRR+IYYD + GE LICSDS+EE   EE   E++E ED +
Sbjct  129   YTTWIFLDRNQRMAEDQSVVGRRQIYYDQHGGETLICSDSEEEPEPEEERREYSEGEDSV  188

Query  1069  LRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDL-IKEGATSKN-ENTEVTINSYLDE  1242
             + +  ++ G+ + V D L    S   S++  R+ +L +K     +N  ++   +  +L++
Sbjct  189   IWLIGQEYGMGEEVQDALCQILSLDASDILERFNELKLKNEQNVENFSDSRFKLGIFLEK  248

Query  1243  DLDAALSSFDNLFCQRCFVFNCQLHGCSQDLI  1338
              L AAL SFDNLFC+RC VF+C+LHGCSQ LI
Sbjct  249   GLSAALDSFDNLFCRRCLVFDCRLHGCSQPLI  280


 Score = 59.3 bits (142),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSK  2164
             ++ V GDHR+GIFA + + A +EL YDY+Y PD  PAWA+  + S K
Sbjct  789   VMFVAGDHRVGIFANERIEASEELFYDYRYGPDQAPAWARKPEGSKK  835



>ref|XP_009783485.1| PREDICTED: histone-lysine N-methyltransferase EZA1 isoform X1 
[Nicotiana sylvestris]
Length=843

 Score =   268 bits (686),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 128/226 (57%), Positives = 161/226 (71%), Gaps = 22/226 (10%)
 Frame = +1

Query  1360  REELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKNECATNYCP  1539
             + + C  Y PC C P CGK CPC+     CEK+CGC  +CK  F+GCHC K++C +  CP
Sbjct  588   KNQSCIQYNPCGCHPVCGKNCPCLQNGTCCEKYCGCSKSCKNRFRGCHCAKSQCRSRQCP  647

Query  1540  CYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLLGRSDIAGW  1719
             C+A+GRECDPDVC  CWVSCGDGS+G PP +    +C NM+LLL  QQ++LL +S+IAGW
Sbjct  648   CFAAGRECDPDVCRNCWVSCGDGSLGEPP-RRGEGQCGNMRLLLRQQQRILLSKSEIAGW  706

Query  1720  GAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQLVIDAYRRG  1899
             GAFLKN    V+KN+++G YTGELISH EAD+ GK+YDR N SFLF+LNDQ V+DAYR+G
Sbjct  707   GAFLKN---PVNKNDYLGEYTGELISHREADRRGKIYDRANSSFLFDLNDQYVLDAYRKG  763

Query  1900  NKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
             +KLKF NHS +PNC+AKV             ++VAG     DHR G
Sbjct  764   DKLKFANHSSNPNCYAKV-------------MLVAG-----DHRVG  791


 Score =   110 bits (274),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 70/157 (45%), Positives = 99/157 (63%), Gaps = 7/157 (4%)
 Frame = +1

Query  889   YTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALi-csdsdeeiieeegenefaesedY  1065
             YTTW FL RNQ+M EDQSV GRRRIYYD +  EALI     ++    EE + +F+E ED 
Sbjct  145   YTTWIFLDRNQRMAEDQSVAGRRRIYYDQHGSEALICSDSEEDIAEPEEEKRDFSEGEDK  204

Query  1066  ILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLIKEGATSKNEN------TEVTIN  1227
             IL M  ++ GL + V+D+L ++     SE+      L+++   + +++      + +  N
Sbjct  205   ILWMASQEFGLSEEVVDILTHYVGGTSSEILEHCNLLVEKHQNTDSKSFKDSGKSGLGGN  264

Query  1228  SYLDEDLDAALSSFDNLFCQRCFVFNCQLHGCSQDLI  1338
              +LD+ L AAL SFDNLFC+RC VF+C+LHGCSQ  I
Sbjct  265   IFLDKSLTAALDSFDNLFCRRCLVFDCRLHGCSQIFI  301


 Score = 57.8 bits (138),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 22/47 (47%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSK  2164
             +++V GDHR+GIFA + + A DEL YDY+Y PD  P WA+  + + +
Sbjct  781   VMLVAGDHRVGIFAKERIEASDELFYDYRYGPDQAPIWARKPEGTKR  827



>ref|XP_008659026.1| PREDICTED: histone-lysine N-methyltransferase EZ2 isoform X1 
[Zea mays]
Length=891

 Score =   269 bits (688),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 128/221 (58%), Positives = 158/221 (71%), Gaps = 21/221 (10%)
 Frame = +1

Query  1375  AHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKNECATNYCPCYASG  1554
               Y+PC C   CGK CPC  K   CEK+CGC  +CK  F+GCHC K++C +  CPC+A+ 
Sbjct  641   TQYSPCACQQMCGKDCPCADKGTCCEKYCGCSKSCKNKFRGCHCAKSQCRSRQCPCFAAS  700

Query  1555  RECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLLGRSDIAGWGAFLK  1734
             RECDPDVC  CWVSCGDGS+G P  +   ++C NMKLLL  QQ++LLGRSD+AGWGAF+K
Sbjct  701   RECDPDVCRNCWVSCGDGSLGEPLARGDGYQCGNMKLLLKQQQRILLGRSDVAGWGAFIK  760

Query  1735  NCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQLVIDAYRRGNKLKF  1914
             N    V+KN+++G YTGELISH EADK GK+YDR N SFLF+LNDQ V+DAYR+G+KLKF
Sbjct  761   N---PVNKNDYLGEYTGELISHKEADKRGKIYDRANSSFLFDLNDQYVLDAYRKGDKLKF  817

Query  1915  INHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
              NHS +PNC+AKV             ++VAG     DHR G
Sbjct  818   ANHSSNPNCYAKV-------------MLVAG-----DHRVG  840


 Score =   113 bits (283),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 87/222 (39%), Positives = 128/222 (58%), Gaps = 9/222 (4%)
 Frame = +1

Query  691   GDGSADLLAKRQTDAFDLQNSIGTGSGNKICSSQEDGYASSDL----RSSIVLKNAVCpi  858
             G+  +   A+RQ  + DL N IG      + S QE+  A+  L      +   +  V  +
Sbjct  87    GNALSQRAAERQCGS-DLANGIGE---RDVVSVQEENLATGTLALSSSGATAQRTIVRFV  142

Query  859   klpklekippYTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALi-csdsdeeiieeeg  1035
             KLP +EKIPPYTTW FL +NQ+M +DQSV+GRRRIYYD    EALI     +E    EE 
Sbjct  143   KLPLVEKIPPYTTWIFLDKNQRMADDQSVVGRRRIYYDTVGNEALICSDSDEEIPEPEEE  202

Query  1036  enefaesedYILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLIKEGATSKNENTE  1215
             ++ F + ED+++    +  GL   V+++L       PSE++ R + L ++       + +
Sbjct  203   KHFFTKGEDHLIWRATQDHGLNQEVVNVLCQFIGATPSEIEERSEVLFEKNEKHSGSSDK  262

Query  1216  VTINSYLDEDLDAALSSFDNLFCQRCFVFNCQLHGCSQDLII  1341
             +     LD+ +DA L SFDNLFC+RC VF+C+LHGCSQ+L+ 
Sbjct  263   IESRLSLDKTMDAVLDSFDNLFCRRCLVFDCRLHGCSQNLVF  304


 Score = 58.9 bits (141),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSK  2164
             +++V GDHR+GI+A + + A +EL YDY+Y PD  PAWA+  + S K
Sbjct  830   VMLVAGDHRVGIYAKEHIEASEELFYDYRYGPDQAPAWARRPEGSKK  876



>ref|XP_010422654.1| PREDICTED: histone-lysine N-methyltransferase EZA1 isoform X1 
[Camelina sativa]
Length=855

 Score =   268 bits (686),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 130/226 (58%), Positives = 158/226 (70%), Gaps = 22/226 (10%)
 Frame = +1

Query  1360  REELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKNECATNYCP  1539
             + + C  YTPC C   CGK CPC+     CEK+CGC  +CK  F+GCHC K++C +  CP
Sbjct  600   KNQSCKQYTPCGCVSMCGKDCPCLTNETCCEKYCGCSKSCKNRFRGCHCAKSQCRSRQCP  659

Query  1540  CYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLLGRSDIAGW  1719
             C+A+GRECDPDVC  CWVSCGDGS+G  P +    +C NM+LLL  QQ++LLG+SD+AGW
Sbjct  660   CFAAGRECDPDVCRNCWVSCGDGSLGEAP-RRGEGQCGNMRLLLRQQQRILLGKSDVAGW  718

Query  1720  GAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQLVIDAYRRG  1899
             GAFLKN    VSKNE++G YTGELISH EADK GK+YDR N SFLF+LNDQ V+DA R+G
Sbjct  719   GAFLKN---SVSKNEYLGEYTGELISHREADKRGKIYDRANSSFLFDLNDQYVLDAQRKG  775

Query  1900  NKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
             +KLKF NHS  PNC+AKV             + VAG     DHR G
Sbjct  776   DKLKFANHSAKPNCYAKV-------------MFVAG-----DHRVG  803


 Score =   108 bits (270),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 74/152 (49%), Positives = 100/152 (66%), Gaps = 2/152 (1%)
 Frame = +1

Query  889   YTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALicsdsdeeiieeegenefaesedYI  1068
             YTTW FL RNQ+M EDQSV+GRR+IYY+ + GE LICSDS+EE   EE + E++E ED +
Sbjct  134   YTTWIFLDRNQRMAEDQSVVGRRQIYYEHHGGETLICSDSEEEPEPEEEKREYSEGEDSV  193

Query  1069  LRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDL-IKEGATSKN-ENTEVTINSYLDE  1242
             +    ++ G+ + V D L    S   S++  RY +L +K     K   N+   +   L++
Sbjct  194   IWSIGQEYGMGEKVQDALCQFLSVDASDILERYDELKLKNVENVKGFSNSGFKLGISLEK  253

Query  1243  DLDAALSSFDNLFCQRCFVFNCQLHGCSQDLI  1338
              L AAL SFDNLFC+RC VF+C+LHGCSQ LI
Sbjct  254   GLGAALDSFDNLFCRRCLVFDCRLHGCSQPLI  285


 Score = 59.3 bits (142),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSK  2164
             ++ V GDHR+GIFA + + A +EL YDY+Y PD  PAWA+  + S K
Sbjct  793   VMFVAGDHRVGIFANERIEASEELFYDYRYGPDQAPAWARKPEGSKK  839



>gb|EYU46811.1| hypothetical protein MIMGU_mgv1a002769mg [Erythranthe guttata]
Length=639

 Score =   264 bits (674),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 128/226 (57%), Positives = 162/226 (72%), Gaps = 22/226 (10%)
 Frame = +1

Query  1360  REELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKNECATNYCP  1539
             ++E    Y+PC C P CGK CPC+ K   CEK+CGC  +CK  F+GCHC K++C +  CP
Sbjct  383   KDEPYKQYSPCACHPLCGKDCPCLQKGTCCEKYCGCSKSCKNRFRGCHCAKSQCKSRQCP  442

Query  1540  CYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLLGRSDIAGW  1719
             C+A+GRECDPDVC  CW+SCGDGS+G PP +    +C NMKLLL  QQ++LL +SD+AGW
Sbjct  443   CFAAGRECDPDVCRNCWISCGDGSLGEPP-RRGESQCGNMKLLLRQQQRILLSKSDVAGW  501

Query  1720  GAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQLVIDAYRRG  1899
             GAF+KN    V+KN+++G YTGELISH EADK GK+YDR N SFLF+LND+ V+DAYR+G
Sbjct  502   GAFVKN---SVNKNDYLGEYTGELISHQEADKRGKIYDRANSSFLFDLNDKYVLDAYRKG  558

Query  1900  NKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
             +KLKF NHS  PNC+AKV             ++VAG     DHR G
Sbjct  559   DKLKFANHSAAPNCYAKV-------------MLVAG-----DHRVG  586


 Score = 57.4 bits (137),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 37/53 (70%), Gaps = 0/53 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSKKLT*LH  2182
             +++V GDHR+GI+A + + +G+EL YDY+Y PD  P WA+   +S +  + LH
Sbjct  576   VMLVAGDHRVGIYANEHIQSGEELFYDYRYGPDQAPPWARRPDTSKRDDSPLH  628



>ref|XP_010422656.1| PREDICTED: histone-lysine N-methyltransferase EZA1 isoform X2 
[Camelina sativa]
Length=854

 Score =   268 bits (686),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 130/226 (58%), Positives = 158/226 (70%), Gaps = 22/226 (10%)
 Frame = +1

Query  1360  REELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKNECATNYCP  1539
             + + C  YTPC C   CGK CPC+     CEK+CGC  +CK  F+GCHC K++C +  CP
Sbjct  599   KNQSCKQYTPCGCVSMCGKDCPCLTNETCCEKYCGCSKSCKNRFRGCHCAKSQCRSRQCP  658

Query  1540  CYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLLGRSDIAGW  1719
             C+A+GRECDPDVC  CWVSCGDGS+G  P +    +C NM+LLL  QQ++LLG+SD+AGW
Sbjct  659   CFAAGRECDPDVCRNCWVSCGDGSLGEAP-RRGEGQCGNMRLLLRQQQRILLGKSDVAGW  717

Query  1720  GAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQLVIDAYRRG  1899
             GAFLKN    VSKNE++G YTGELISH EADK GK+YDR N SFLF+LNDQ V+DA R+G
Sbjct  718   GAFLKN---SVSKNEYLGEYTGELISHREADKRGKIYDRANSSFLFDLNDQYVLDAQRKG  774

Query  1900  NKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
             +KLKF NHS  PNC+AKV             + VAG     DHR G
Sbjct  775   DKLKFANHSAKPNCYAKV-------------MFVAG-----DHRVG  802


 Score =   108 bits (270),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 74/152 (49%), Positives = 100/152 (66%), Gaps = 2/152 (1%)
 Frame = +1

Query  889   YTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALicsdsdeeiieeegenefaesedYI  1068
             YTTW FL RNQ+M EDQSV+GRR+IYY+ + GE LICSDS+EE   EE + E++E ED +
Sbjct  133   YTTWIFLDRNQRMAEDQSVVGRRQIYYEHHGGETLICSDSEEEPEPEEEKREYSEGEDSV  192

Query  1069  LRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDL-IKEGATSKN-ENTEVTINSYLDE  1242
             +    ++ G+ + V D L    S   S++  RY +L +K     K   N+   +   L++
Sbjct  193   IWSIGQEYGMGEKVQDALCQFLSVDASDILERYDELKLKNVENVKGFSNSGFKLGISLEK  252

Query  1243  DLDAALSSFDNLFCQRCFVFNCQLHGCSQDLI  1338
              L AAL SFDNLFC+RC VF+C+LHGCSQ LI
Sbjct  253   GLGAALDSFDNLFCRRCLVFDCRLHGCSQPLI  284


 Score = 59.3 bits (142),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSK  2164
             ++ V GDHR+GIFA + + A +EL YDY+Y PD  PAWA+  + S K
Sbjct  792   VMFVAGDHRVGIFANERIEASEELFYDYRYGPDQAPAWARKPEGSKK  838



>ref|NP_001105650.1| histone-lysine N-methyltransferase EZ2 [Zea mays]
 sp|Q8S4P5.1|EZ2_MAIZE RecName: Full=Histone-lysine N-methyltransferase EZ2; AltName: 
Full=Enhancer of zeste protein 2 [Zea mays]
 gb|AAM13421.1|AF443597_1 enhancer of zeste-like protein 2 [Zea mays]
 gb|AFW88589.1| putative SET-domain containing protein family [Zea mays]
Length=894

 Score =   269 bits (687),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 128/221 (58%), Positives = 158/221 (71%), Gaps = 21/221 (10%)
 Frame = +1

Query  1375  AHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKNECATNYCPCYASG  1554
               Y+PC C   CGK CPC  K   CEK+CGC  +CK  F+GCHC K++C +  CPC+A+ 
Sbjct  644   TQYSPCACQQMCGKDCPCADKGTCCEKYCGCSKSCKNKFRGCHCAKSQCRSRQCPCFAAS  703

Query  1555  RECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLLGRSDIAGWGAFLK  1734
             RECDPDVC  CWVSCGDGS+G P  +   ++C NMKLLL  QQ++LLGRSD+AGWGAF+K
Sbjct  704   RECDPDVCRNCWVSCGDGSLGEPLARGDGYQCGNMKLLLKQQQRILLGRSDVAGWGAFIK  763

Query  1735  NCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQLVIDAYRRGNKLKF  1914
             N    V+KN+++G YTGELISH EADK GK+YDR N SFLF+LNDQ V+DAYR+G+KLKF
Sbjct  764   N---PVNKNDYLGEYTGELISHKEADKRGKIYDRANSSFLFDLNDQYVLDAYRKGDKLKF  820

Query  1915  INHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
              NHS +PNC+AKV             ++VAG     DHR G
Sbjct  821   ANHSSNPNCYAKV-------------MLVAG-----DHRVG  843


 Score =   113 bits (283),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 87/222 (39%), Positives = 128/222 (58%), Gaps = 9/222 (4%)
 Frame = +1

Query  691   GDGSADLLAKRQTDAFDLQNSIGTGSGNKICSSQEDGYASSDL----RSSIVLKNAVCpi  858
             G+  +   A+RQ  + DL N IG      + S QE+  A+  L      +   +  V  +
Sbjct  87    GNALSQRAAERQCGS-DLANGIGE---RDVVSVQEENLATGTLALSSSGATAQRTIVRFV  142

Query  859   klpklekippYTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALi-csdsdeeiieeeg  1035
             KLP +EKIPPYTTW FL +NQ+M +DQSV+GRRRIYYD    EALI     +E    EE 
Sbjct  143   KLPLVEKIPPYTTWIFLDKNQRMADDQSVVGRRRIYYDTVGNEALICSDSDEEIPEPEEE  202

Query  1036  enefaesedYILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLIKEGATSKNENTE  1215
             ++ F + ED+++    +  GL   V+++L       PSE++ R + L ++       + +
Sbjct  203   KHFFTKGEDHLIWRATQDHGLNQEVVNVLCQFIGATPSEIEERSEVLFEKNEKHSGSSDK  262

Query  1216  VTINSYLDEDLDAALSSFDNLFCQRCFVFNCQLHGCSQDLII  1341
             +     LD+ +DA L SFDNLFC+RC VF+C+LHGCSQ+L+ 
Sbjct  263   IESRLSLDKTMDAVLDSFDNLFCRRCLVFDCRLHGCSQNLVF  304


 Score = 58.9 bits (141),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSK  2164
             +++V GDHR+GI+A + + A +EL YDY+Y PD  PAWA+  + S K
Sbjct  833   VMLVAGDHRVGIYAKEHIEASEELFYDYRYGPDQAPAWARRPEGSKK  879



>gb|KDO86985.1| hypothetical protein CISIN_1g002895mg [Citrus sinensis]
Length=869

 Score =   268 bits (686),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 132/231 (57%), Positives = 163/231 (71%), Gaps = 27/231 (12%)
 Frame = +1

Query  1360  REELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCG-----CPLNCKI*FQGCHCTKNECA  1524
             + + C  YTPC C   CGK+CPC+     CEK+CG     C  +CK  F+GCHC K++C 
Sbjct  609   KNQSCKQYTPCGCQSMCGKQCPCLHNGTCCEKYCGYSFLRCSKSCKNRFRGCHCAKSQCR  668

Query  1525  TNYCPCYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLLGRS  1704
             +  CPC+A+GRECDPDVC  CWVSCGDGS+G PP K  + +C NM+LLL  QQ++LL +S
Sbjct  669   SRQCPCFAAGRECDPDVCRNCWVSCGDGSLGEPP-KRGDGQCGNMRLLLRQQQRILLAKS  727

Query  1705  DIAGWGAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQLVID  1884
             D+AGWGAFLKN V   SKN+++G YTGELISH EADK GK+YDR N SFLF+LNDQ V+D
Sbjct  728   DVAGWGAFLKNSV---SKNDYLGEYTGELISHREADKRGKIYDRANSSFLFDLNDQYVLD  784

Query  1885  AYRRGNKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
             AYR+G+KLKF NHS +PNCFAKV             ++VAG     DHR G
Sbjct  785   AYRKGDKLKFANHSSNPNCFAKV-------------MLVAG-----DHRVG  817


 Score =   110 bits (276),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 73/155 (47%), Positives = 98/155 (63%), Gaps = 6/155 (4%)
 Frame = +1

Query  889   YTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALi-csdsdeeiieeegenefaesedY  1065
             YTTW FL +NQ+M EDQSV+GRRRIYYD +  EAL+     ++ I  EE ++EF++ ED 
Sbjct  124   YTTWIFLDKNQRMAEDQSVVGRRRIYYDQHGSEALVCSDSEEDIIEPEEEKHEFSDGEDR  183

Query  1066  ILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLIKEGATSKN----ENTEVTINSY  1233
             IL    E+ GL + V++ ++       SEV+ RY  L KE    KN    E+        
Sbjct  184   ILWTVFEEHGLGEEVINAVSQFIGIATSEVQDRYSTL-KEKYDGKNLKEFEDAGHERGIA  242

Query  1234  LDEDLDAALSSFDNLFCQRCFVFNCQLHGCSQDLI  1338
             L++ L AAL SFDNLFC+RC +F+C+LHGCSQ LI
Sbjct  243   LEKSLSAALDSFDNLFCRRCLLFDCRLHGCSQTLI  277


 Score = 59.7 bits (143),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = +2

Query  2015  FR*IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSKK  2167
             F  +++V GDHR+GIFA + + A +EL YDY+Y PD  PAWA+  + S ++
Sbjct  804   FAKVMLVAGDHRVGIFAKEHIEASEELFYDYRYGPDQAPAWARKPEGSKRE  854



>ref|XP_006651312.1| PREDICTED: histone-lysine N-methyltransferase EZ3-like [Oryza 
brachyantha]
Length=891

 Score =   269 bits (687),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 128/234 (55%), Positives = 163/234 (70%), Gaps = 21/234 (9%)
 Frame = +1

Query  1336  IILKQIRVREELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKN  1515
              + K+I   ++    Y PC C   CGK CPC+     CEK+CGC  +CK  F+GCHC K+
Sbjct  628   TVRKRIGDGKKWYTQYNPCGCQQMCGKDCPCLENGTCCEKYCGCSKSCKNRFRGCHCAKS  687

Query  1516  ECATNYCPCYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLL  1695
             +C +  CPC+A+ RECDPDVC  CWVSCGDGS+G PP +   ++C NMKLLL  QQ++LL
Sbjct  688   QCRSRQCPCFAANRECDPDVCRNCWVSCGDGSLGEPPARGDGYQCGNMKLLLKQQQRILL  747

Query  1696  GRSDIAGWGAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQL  1875
             G+SD+AGWGAF+KN    V++N+++G YTGELISH EADK GK+YDR N SFLF+LN+Q 
Sbjct  748   GKSDVAGWGAFIKN---PVNRNDYLGEYTGELISHREADKRGKIYDRANSSFLFDLNEQY  804

Query  1876  VIDAYRRGNKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
             V+DAYR+G+KLKF NHS  PNCFAKV             ++VAG     DHR G
Sbjct  805   VLDAYRKGDKLKFANHSSSPNCFAKV-------------MLVAG-----DHRVG  840


 Score =   103 bits (257),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 65/152 (43%), Positives = 92/152 (61%), Gaps = 2/152 (1%)
 Frame = +1

Query  889   YTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALi-csdsdeeiieeegenefaesedY  1065
             YTTW FL +NQ+M +DQSV GRRRIYYD    EALI     D+    EE ++ F E ED 
Sbjct  157   YTTWIFLDKNQRMADDQSV-GRRRIYYDPIVNEALICSESDDDIPEPEEEKHVFTEGEDQ  215

Query  1066  ILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLIKEGATSKNENTEVTINSYLDED  1245
             ++    +  GL   V ++L       PSE++ R + L ++       + +  +  +LD+ 
Sbjct  216   LIWKATQDHGLSREVSNVLCQFVDATPSEIEERSEVLFEKYEKQSQSSYKTEMQLFLDKT  275

Query  1246  LDAALSSFDNLFCQRCFVFNCQLHGCSQDLII  1341
             +D AL SFDNLFC+RC VF+C+LHGCSQ+L+ 
Sbjct  276   MDVALDSFDNLFCRRCLVFDCRLHGCSQNLVF  307


 Score = 57.4 bits (137),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  2015  FR*IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSK  2164
             F  +++V GDHR+GI+A   + A +EL YDY+Y PD  PAWA+  + S K
Sbjct  827   FAKVMLVAGDHRVGIYAKDRIEASEELFYDYRYGPDQAPAWARRPEGSKK  876



>ref|NP_567221.1| histone-lysine N-methyltransferase EZA1 [Arabidopsis thaliana]
 sp|Q9ZSM8.1|EZA1_ARATH RecName: Full=Histone-lysine N-methyltransferase EZA1; AltName: 
Full=CURLY LEAF-like 1; AltName: Full=Protein SET DOMAIN 
GROUP 10; AltName: Full=Protein SWINGER [Arabidopsis thaliana]
 gb|AAD09108.1| EZA1 [Arabidopsis thaliana]
 gb|AAL09711.1| AT4g02020/T10M13_3 [Arabidopsis thaliana]
 gb|AAL90954.1| AT4g02020/T10M13_3 [Arabidopsis thaliana]
 gb|AEE82112.1| histone-lysine N-methyltransferase EZA1 [Arabidopsis thaliana]
Length=856

 Score =   268 bits (685),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 130/226 (58%), Positives = 158/226 (70%), Gaps = 22/226 (10%)
 Frame = +1

Query  1360  REELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKNECATNYCP  1539
             + + C  YTPC C   CGK CPC+     CEK+CGC  +CK  F+GCHC K++C +  CP
Sbjct  601   KNQSCKQYTPCGCLSMCGKDCPCLTNETCCEKYCGCSKSCKNRFRGCHCAKSQCRSRQCP  660

Query  1540  CYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLLGRSDIAGW  1719
             C+A+GRECDPDVC  CWVSCGDGS+G  P +    +C NM+LLL  QQ++LLG+SD+AGW
Sbjct  661   CFAAGRECDPDVCRNCWVSCGDGSLGEAP-RRGEGQCGNMRLLLRQQQRILLGKSDVAGW  719

Query  1720  GAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQLVIDAYRRG  1899
             GAFLKN    VSKNE++G YTGELISH EADK GK+YDR N SFLF+LNDQ V+DA R+G
Sbjct  720   GAFLKN---SVSKNEYLGEYTGELISHHEADKRGKIYDRANSSFLFDLNDQYVLDAQRKG  776

Query  1900  NKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
             +KLKF NHS  PNC+AKV             + VAG     DHR G
Sbjct  777   DKLKFANHSAKPNCYAKV-------------MFVAG-----DHRVG  804


 Score =   112 bits (279),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 75/152 (49%), Positives = 101/152 (66%), Gaps = 2/152 (1%)
 Frame = +1

Query  889   YTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALicsdsdeeiieeegenefaesedYI  1068
             YTTW FL RNQ+M EDQSV+GRR+IYY+ + GE LICSDS+EE   EE + EF+E ED I
Sbjct  133   YTTWIFLDRNQRMAEDQSVVGRRQIYYEQHGGETLICSDSEEEPEPEEEKREFSEGEDSI  192

Query  1069  LRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLIKEGATSKNE--NTEVTINSYLDE  1242
             + +  ++ G+ + V D L    S   S++  RY +L  +   +  E  N+   +   L++
Sbjct  193   IWLIGQEYGMGEEVQDALCQLLSVDASDILERYNELKLKDKQNTEEFSNSGFKLGISLEK  252

Query  1243  DLDAALSSFDNLFCQRCFVFNCQLHGCSQDLI  1338
              L AAL SFDNLFC+RC VF+C+LHGCSQ LI
Sbjct  253   GLGAALDSFDNLFCRRCLVFDCRLHGCSQPLI  284


 Score = 57.8 bits (138),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSK  2164
             ++ V GDHR+GIFA + + A +EL YDY+Y PD  P WA+  + S K
Sbjct  794   VMFVAGDHRVGIFANERIEASEELFYDYRYGPDQAPVWARKPEGSKK  840



>ref|XP_009346619.1| PREDICTED: histone-lysine N-methyltransferase EZA1-like isoform 
X2 [Pyrus x bretschneideri]
Length=672

 Score =   264 bits (675),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 127/219 (58%), Positives = 160/219 (73%), Gaps = 22/219 (10%)
 Frame = +1

Query  1381  YTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKNECATNYCPCYASGRE  1560
             YTPC C   CGK+CPC+     CEK+CGC  +CK  F+GCHC K++C +  CPC+A+GRE
Sbjct  424   YTPCGCQSMCGKECPCMSNGTCCEKYCGCSKSCKNRFRGCHCAKSQCRSRQCPCFAAGRE  483

Query  1561  CDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLLGRSDIAGWGAFLKNC  1740
             CDPDVC  CWVSCGDGS+G PP +  + +C NM+LLL  QQ++LLG+SD+AGWGAFLKN 
Sbjct  484   CDPDVCRHCWVSCGDGSLGEPP-RQGDSQCGNMRLLLRQQQRILLGKSDVAGWGAFLKN-  541

Query  1741  VICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQLVIDAYRRGNKLKFIN  1920
                V+KN+++G YTGE+ISH EADK GK+YDR N SFLF+LN+Q V+DAYR+G+KLKF N
Sbjct  542   --PVNKNDYLGEYTGEIISHQEADKRGKIYDRVNSSFLFDLNEQYVLDAYRKGDKLKFAN  599

Query  1921  HSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
             HS +PNC AKV             ++VAG     DHR G
Sbjct  600   HSSNPNCHAKV-------------MLVAG-----DHRVG  620


 Score = 94.7 bits (234),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 68/139 (49%), Positives = 90/139 (65%), Gaps = 5/139 (4%)
 Frame = +1

Query  925   MPEDQSVIGRRRIYYDMNSGEALicsdsdeeiieeegenef-aesedYILRMTIEKVGLY  1101
             M EDQSV+GRRRIYYD +  EAL+ S +D+E  E E      +  ED IL M  ++ GL 
Sbjct  1     MAEDQSVVGRRRIYYDEDGSEALVYSGTDDEAEEPEEVKHEFSAGEDRILLMAFQEHGLG  60

Query  1102  DMVLDLLANHFSRKPSEVKARYKDLIKEGATSKNENTEVTINSYLDEDLDAALSSFDNLF  1281
             + V++L+        S++ ARY + IKE    K E+ E  I+  LD+ L+AAL SFDNLF
Sbjct  61    EEVVELVKEFIGVPISDILARY-NTIKERNPEKCEH-EGCIS--LDKSLNAALDSFDNLF  116

Query  1282  CQRCFVFNCQLHGCSQDLI  1338
             C+RC VF+C+LHGCSQ LI
Sbjct  117   CRRCLVFDCRLHGCSQPLI  135



>ref|XP_010228709.1| PREDICTED: histone-lysine N-methyltransferase EZ3 [Brachypodium 
distachyon]
Length=758

 Score =   266 bits (680),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 130/233 (56%), Positives = 162/233 (70%), Gaps = 21/233 (9%)
 Frame = +1

Query  1339  ILKQIRVREELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKNE  1518
             + K+I   ++    YTPC C   C K CPC+     CEK+CGC  +CK  F+GCHC K++
Sbjct  496   VRKRIGDGKKWETQYTPCGCQQMCTKGCPCMDNVTCCEKYCGCSKSCKNRFRGCHCAKSQ  555

Query  1519  CATNYCPCYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLLG  1698
             C +  CPC+A+ RECDPDVC  CWVSCGDGS+G PP +   ++C+NMKLLL  QQ++LLG
Sbjct  556   CRSRQCPCFAASRECDPDVCRNCWVSCGDGSLGEPPARGDGYQCENMKLLLKQQQRILLG  615

Query  1699  RSDIAGWGAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQLV  1878
             RSD+AGWGAF KN    V KN+++G YTGELISH EADK GK+YDR N SFLF+LNDQ V
Sbjct  616   RSDVAGWGAFTKN---PVQKNDYLGEYTGELISHKEADKRGKIYDRANSSFLFDLNDQYV  672

Query  1879  IDAYRRGNKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
             +DA R+G+KLKF NHS +PNCFAKV             ++VAG     DHR G
Sbjct  673   LDANRKGDKLKFANHSYNPNCFAKV-------------MMVAG-----DHRVG  707


 Score =   106 bits (265),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 74/174 (43%), Positives = 101/174 (58%), Gaps = 10/174 (6%)
 Frame = +1

Query  889   YTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEAL--icsdsdeeiieeegenefaesed  1062
             YTTW FL +NQ+M +DQS++GRRRIYYD    EAL    SD +     EE      E + 
Sbjct  156   YTTWTFLDKNQRMADDQSIVGRRRIYYDSVGNEALICSESDEEIPEPGEEKHVFTGEEDQ  215

Query  1063  YILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDL-IKEGATSK-NENTEVTINSYL  1236
              I ++T E  G    VL  +    +  PSE++ R K L +K    S  +E TE    S+L
Sbjct  216   LIWKVTQEH-GSSQEVLSAICQFVTASPSEIEDRSKFLCVKNDKYSGFSEKTE----SHL  270

Query  1237  DEDLDAALSSFDNLFCQRCFVFNCQLHGCSQDLIILKQIRV-REELCAHYTPCN  1395
             D+ +D  L SFDNLFC+RC VF+C+LHGCSQ+L+   + +    EL  + TPC+
Sbjct  271   DKTVDMVLDSFDNLFCRRCLVFDCRLHGCSQNLVFPSEKQPCGFELDENKTPCS  324


 Score = 57.0 bits (136),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 35/51 (69%), Gaps = 0/51 (0%)
 Frame = +2

Query  2015  FR*IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSKK  2167
             F  +++V GDHR+GI+A + + A +EL YDY+Y PD  P WAK  + S K+
Sbjct  694   FAKVMMVAGDHRVGIYAGERIEASEELFYDYRYGPDQTPHWAKRPEGSKKE  744



>ref|XP_010429047.1| PREDICTED: histone-lysine N-methyltransferase EZA1-like isoform 
X2 [Camelina sativa]
Length=855

 Score =   268 bits (684),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 129/226 (57%), Positives = 158/226 (70%), Gaps = 22/226 (10%)
 Frame = +1

Query  1360  REELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKNECATNYCP  1539
             + + C  YTPC C   CGK CPC+     CEK+CGC  +CK  F+GCHC K++C +  CP
Sbjct  600   KNQSCKQYTPCGCVSMCGKDCPCLTNETCCEKYCGCSKSCKNRFRGCHCAKSQCRSRQCP  659

Query  1540  CYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLLGRSDIAGW  1719
             C+A+GRECDPDVC  CWVSCGDG++G  P +    +C NM+LLL  QQ++LLG+SD+AGW
Sbjct  660   CFAAGRECDPDVCRNCWVSCGDGTLGEAP-RRGEGQCGNMRLLLRQQQRILLGKSDVAGW  718

Query  1720  GAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQLVIDAYRRG  1899
             GAFLKN    VSKNE++G YTGELISH EADK GK+YDR N SFLF+LNDQ V+DA R+G
Sbjct  719   GAFLKN---SVSKNEYLGEYTGELISHREADKRGKIYDRANSSFLFDLNDQYVLDAQRKG  775

Query  1900  NKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
             +KLKF NHS  PNC+AKV             + VAG     DHR G
Sbjct  776   DKLKFANHSAKPNCYAKV-------------MFVAG-----DHRVG  803


 Score =   108 bits (270),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 76/160 (48%), Positives = 101/160 (63%), Gaps = 10/160 (6%)
 Frame = +1

Query  889   YTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALicsdsdeeiieeegenefaesedYI  1068
             YTTW FL RNQ+M EDQSV+GRR+IYY+ + GE LICSDS+EE   EE + E++E ED +
Sbjct  134   YTTWIFLDRNQRMAEDQSVVGRRQIYYEHHGGETLICSDSEEEPEPEEEKREYSEGEDSV  193

Query  1069  LRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLIKEGATSKNENTEVTINS------  1230
             +    ++ G+ + V D L    S   S++  RY +L  +      EN E   NS      
Sbjct  194   IWSIGQEYGMGEKVQDALCQFLSVDASDILERYNELKLKNV----ENVEGFSNSGFKLGI  249

Query  1231  YLDEDLDAALSSFDNLFCQRCFVFNCQLHGCSQDLIILKQ  1350
              L++ L AAL SFDNLFC+RC VF+C+LHGCSQ LI   +
Sbjct  250   SLEKGLGAALDSFDNLFCRRCLVFDCRLHGCSQPLITASE  289


 Score = 59.3 bits (142),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSK  2164
             ++ V GDHR+GIFA + + A +EL YDY+Y PD  PAWA+  + S K
Sbjct  793   VMFVAGDHRVGIFANERIEASEELFYDYRYGPDQAPAWARKPEGSKK  839



>ref|XP_010429044.1| PREDICTED: histone-lysine N-methyltransferase EZA1-like isoform 
X1 [Camelina sativa]
Length=856

 Score =   268 bits (684),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 129/226 (57%), Positives = 158/226 (70%), Gaps = 22/226 (10%)
 Frame = +1

Query  1360  REELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKNECATNYCP  1539
             + + C  YTPC C   CGK CPC+     CEK+CGC  +CK  F+GCHC K++C +  CP
Sbjct  601   KNQSCKQYTPCGCVSMCGKDCPCLTNETCCEKYCGCSKSCKNRFRGCHCAKSQCRSRQCP  660

Query  1540  CYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLLGRSDIAGW  1719
             C+A+GRECDPDVC  CWVSCGDG++G  P +    +C NM+LLL  QQ++LLG+SD+AGW
Sbjct  661   CFAAGRECDPDVCRNCWVSCGDGTLGEAP-RRGEGQCGNMRLLLRQQQRILLGKSDVAGW  719

Query  1720  GAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQLVIDAYRRG  1899
             GAFLKN    VSKNE++G YTGELISH EADK GK+YDR N SFLF+LNDQ V+DA R+G
Sbjct  720   GAFLKN---SVSKNEYLGEYTGELISHREADKRGKIYDRANSSFLFDLNDQYVLDAQRKG  776

Query  1900  NKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
             +KLKF NHS  PNC+AKV             + VAG     DHR G
Sbjct  777   DKLKFANHSAKPNCYAKV-------------MFVAG-----DHRVG  804


 Score =   108 bits (270),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 76/160 (48%), Positives = 101/160 (63%), Gaps = 10/160 (6%)
 Frame = +1

Query  889   YTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALicsdsdeeiieeegenefaesedYI  1068
             YTTW FL RNQ+M EDQSV+GRR+IYY+ + GE LICSDS+EE   EE + E++E ED +
Sbjct  135   YTTWIFLDRNQRMAEDQSVVGRRQIYYEHHGGETLICSDSEEEPEPEEEKREYSEGEDSV  194

Query  1069  LRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLIKEGATSKNENTEVTINS------  1230
             +    ++ G+ + V D L    S   S++  RY +L  +      EN E   NS      
Sbjct  195   IWSIGQEYGMGEKVQDALCQFLSVDASDILERYNELKLKNV----ENVEGFSNSGFKLGI  250

Query  1231  YLDEDLDAALSSFDNLFCQRCFVFNCQLHGCSQDLIILKQ  1350
              L++ L AAL SFDNLFC+RC VF+C+LHGCSQ LI   +
Sbjct  251   SLEKGLGAALDSFDNLFCRRCLVFDCRLHGCSQPLITASE  290


 Score = 59.3 bits (142),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSK  2164
             ++ V GDHR+GIFA + + A +EL YDY+Y PD  PAWA+  + S K
Sbjct  794   VMFVAGDHRVGIFANERIEASEELFYDYRYGPDQAPAWARKPEGSKK  840



>ref|XP_010429054.1| PREDICTED: histone-lysine N-methyltransferase EZA1-like isoform 
X3 [Camelina sativa]
Length=855

 Score =   267 bits (683),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 129/226 (57%), Positives = 158/226 (70%), Gaps = 22/226 (10%)
 Frame = +1

Query  1360  REELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKNECATNYCP  1539
             + + C  YTPC C   CGK CPC+     CEK+CGC  +CK  F+GCHC K++C +  CP
Sbjct  600   KNQSCKQYTPCGCVSMCGKDCPCLTNETCCEKYCGCSKSCKNRFRGCHCAKSQCRSRQCP  659

Query  1540  CYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLLGRSDIAGW  1719
             C+A+GRECDPDVC  CWVSCGDG++G  P +    +C NM+LLL  QQ++LLG+SD+AGW
Sbjct  660   CFAAGRECDPDVCRNCWVSCGDGTLGEAP-RRGEGQCGNMRLLLRQQQRILLGKSDVAGW  718

Query  1720  GAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQLVIDAYRRG  1899
             GAFLKN    VSKNE++G YTGELISH EADK GK+YDR N SFLF+LNDQ V+DA R+G
Sbjct  719   GAFLKN---SVSKNEYLGEYTGELISHREADKRGKIYDRANSSFLFDLNDQYVLDAQRKG  775

Query  1900  NKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
             +KLKF NHS  PNC+AKV             + VAG     DHR G
Sbjct  776   DKLKFANHSAKPNCYAKV-------------MFVAG-----DHRVG  803


 Score =   108 bits (270),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 76/160 (48%), Positives = 101/160 (63%), Gaps = 10/160 (6%)
 Frame = +1

Query  889   YTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALicsdsdeeiieeegenefaesedYI  1068
             YTTW FL RNQ+M EDQSV+GRR+IYY+ + GE LICSDS+EE   EE + E++E ED +
Sbjct  134   YTTWIFLDRNQRMAEDQSVVGRRQIYYEHHGGETLICSDSEEEPEPEEEKREYSEGEDSV  193

Query  1069  LRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLIKEGATSKNENTEVTINS------  1230
             +    ++ G+ + V D L    S   S++  RY +L  +      EN E   NS      
Sbjct  194   IWSIGQEYGMGEKVQDALCQFLSVDASDILERYNELKLKNV----ENVEGFSNSGFKLGI  249

Query  1231  YLDEDLDAALSSFDNLFCQRCFVFNCQLHGCSQDLIILKQ  1350
              L++ L AAL SFDNLFC+RC VF+C+LHGCSQ LI   +
Sbjct  250   SLEKGLGAALDSFDNLFCRRCLVFDCRLHGCSQPLITASE  289


 Score = 59.3 bits (142),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSK  2164
             ++ V GDHR+GIFA + + A +EL YDY+Y PD  PAWA+  + S K
Sbjct  793   VMFVAGDHRVGIFANERIEASEELFYDYRYGPDQAPAWARKPEGSKK  839



>gb|AAC78694.1| putative curlyleaf-like 1 homeotic protein [Arabidopsis thaliana]
 emb|CAB80695.1| polycomb group-like protein [Arabidopsis thaliana]
Length=898

 Score =   268 bits (685),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 130/226 (58%), Positives = 158/226 (70%), Gaps = 22/226 (10%)
 Frame = +1

Query  1360  REELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKNECATNYCP  1539
             + + C  YTPC C   CGK CPC+     CEK+CGC  +CK  F+GCHC K++C +  CP
Sbjct  643   KNQSCKQYTPCGCLSMCGKDCPCLTNETCCEKYCGCSKSCKNRFRGCHCAKSQCRSRQCP  702

Query  1540  CYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLLGRSDIAGW  1719
             C+A+GRECDPDVC  CWVSCGDGS+G  P +    +C NM+LLL  QQ++LLG+SD+AGW
Sbjct  703   CFAAGRECDPDVCRNCWVSCGDGSLGEAP-RRGEGQCGNMRLLLRQQQRILLGKSDVAGW  761

Query  1720  GAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQLVIDAYRRG  1899
             GAFLKN    VSKNE++G YTGELISH EADK GK+YDR N SFLF+LNDQ V+DA R+G
Sbjct  762   GAFLKN---SVSKNEYLGEYTGELISHHEADKRGKIYDRANSSFLFDLNDQYVLDAQRKG  818

Query  1900  NKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
             +KLKF NHS  PNC+AKV             + VAG     DHR G
Sbjct  819   DKLKFANHSAKPNCYAKV-------------MFVAG-----DHRVG  846


 Score =   117 bits (293),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 80/168 (48%), Positives = 110/168 (65%), Gaps = 3/168 (2%)
 Frame = +1

Query  889   YTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALicsdsdeeiieeegenefaesedYI  1068
             YTTW FL RNQ+M EDQSV+GRR+IYY+ + GE LICSDS+EE   EE + EF+E ED I
Sbjct  199   YTTWIFLDRNQRMAEDQSVVGRRQIYYEQHGGETLICSDSEEEPEPEEEKREFSEGEDSI  258

Query  1069  LRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLIKEGATSKNE--NTEVTINSYLDE  1242
             + +  ++ G+ + V D L    S   S++  RY +L  +   +  E  N+   +   L++
Sbjct  259   IWLIGQEYGMGEEVQDALCQLLSVDASDILERYNELKLKDKQNTEEFSNSGFKLGISLEK  318

Query  1243  DLDAALSSFDNLFCQRCFVFNCQLHGCSQDLI-ILKQIRVREELCAHY  1383
              L AAL SFDNLFC+RC VF+C+LHGCSQ LI  LK +R   E C+++
Sbjct  319   GLGAALDSFDNLFCRRCLVFDCRLHGCSQPLISALKAVREVPETCSNF  366


 Score = 57.8 bits (138),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSK  2164
             ++ V GDHR+GIFA + + A +EL YDY+Y PD  P WA+  + S K
Sbjct  836   VMFVAGDHRVGIFANERIEASEELFYDYRYGPDQAPVWARKPEGSKK  882



>emb|CDY38942.1| BnaA04g13630D [Brassica napus]
Length=907

 Score =   268 bits (685),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 126/226 (56%), Positives = 164/226 (73%), Gaps = 7/226 (3%)
 Frame = +1

Query  1360  REELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKNECATNYCP  1539
             +++ C  + PCNC   CGK+C C++    CEK+CGCP +CK  F+GCHC K++C +  CP
Sbjct  652   KDQPCRQFNPCNCKTACGKECTCLLNGTCCEKYCGCPKSCKNRFRGCHCAKSQCRSRQCP  711

Query  1540  CYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLLGRSDIAGW  1719
             C+A+ RECDPDVC  CWV  GDG++G+P  +  N++C+NMKLLL  QQ+VLLG SD++GW
Sbjct  712   CFAADRECDPDVCRNCWVIGGDGTLGVPSQRGDNYECRNMKLLLKQQQRVLLGISDVSGW  771

Query  1720  GAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQLVIDAYRRG  1899
             GAFLKN    VSK+E++G YTGELISH EADK GK+YDR+N SFLFNLNDQ    AYR+G
Sbjct  772   GAFLKN---SVSKHEYLGEYTGELISHKEADKRGKIYDRENSSFLFNLNDQ--AHAYRKG  826

Query  1900  NKLKFINHSPDPNCFAKVNCSLSPCLLQCF--QLIVAGGSFSIDHR  2031
             +KLKF NHSP+PNC+AKV        +  F  + I+AG     D+R
Sbjct  827   DKLKFANHSPEPNCYAKVIMVAGDHRVGIFAKERILAGEELFYDYR  872


 Score =   169 bits (427),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 114/227 (50%), Positives = 155/227 (68%), Gaps = 9/227 (4%)
 Frame = +1

Query  682   GLVGDGSADLLAKRQTDAFDLQNSIGTGSGNKI---CSSQEDGYASSDLR---SSIVLKN  843
             G   DGS DLL KRQ D+  +++ +     +K     S  EDG ASS      SS+ +K 
Sbjct  82    GSYKDGS-DLLVKRQRDSPGMKSGVNASDADKSNNHSSFLEDGNASSTTMVQGSSVPVKI  140

Query  844   AVCpiklpklekippYTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALi-csdsdeei  1020
             ++ PIK+P ++++ PYTTW FL RNQ+M EDQSV+GRRRIYYD   GEALI     +E I
Sbjct  141   SLRPIKMPDVKRLSPYTTWVFLDRNQRMTEDQSVVGRRRIYYDQTGGEALICSDSEEEAI  200

Query  1021  ieeegenefaesedYILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLIKEGATSK  1200
              EE+ +  F E ED+I+RMT++++GL D VL+ LAN  SR  SE+KARY+ L+KE   S+
Sbjct  201   DEEDEKRAFLEPEDFIIRMTLDQLGLSDSVLEELANFLSRSSSEIKARYEVLMKEKEVSE  260

Query  1201  NENTEVTINSYLDEDLDAALSSFDNLFCQRCFVFNCQLHGCSQDLII  1341
             + + +   +S L++D+D AL SFDNLFC+RC VF+C+LHGCSQDLI 
Sbjct  261   SGDNQAE-SSLLNKDMDGALDSFDNLFCRRCLVFDCRLHGCSQDLIF  306


 Score = 64.3 bits (155),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSKK  2167
             +I+V GDHR+GIFA + + AG+EL YDY+Y+PD  PAWA+  ++S  K
Sbjct  844   VIMVAGDHRVGIFAKERILAGEELFYDYRYEPDRAPAWARKPEASGSK  891



>gb|ABK41491.1| swinger [Arabidopsis lyrata subsp. lyrata]
Length=849

 Score =   267 bits (682),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 129/226 (57%), Positives = 158/226 (70%), Gaps = 22/226 (10%)
 Frame = +1

Query  1360  REELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKNECATNYCP  1539
             + + C  YTPC C   CGK CPC+     CEK+CGC  +CK  F+GCHC K++C +  CP
Sbjct  594   KNQSCKQYTPCGCLSMCGKDCPCLTNETCCEKYCGCSKSCKNRFRGCHCAKSQCRSRQCP  653

Query  1540  CYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLLGRSDIAGW  1719
             C+A+GRECDPDVC  CWVSCGDGS+G  P +    +C NM+LLL  QQ++LLG+SD+AGW
Sbjct  654   CFAAGRECDPDVCRNCWVSCGDGSLGEAP-RRGEGQCGNMRLLLRQQQRILLGKSDVAGW  712

Query  1720  GAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQLVIDAYRRG  1899
             GAFLKN    VSKNE++G YTGELISH EADK GK+YDR N SFLF+LND+ V+DA R+G
Sbjct  713   GAFLKN---SVSKNEYLGEYTGELISHREADKRGKIYDRANSSFLFDLNDRYVLDAQRKG  769

Query  1900  NKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
             +KLKF NHS  PNC+AKV             + VAG     DHR G
Sbjct  770   DKLKFANHSAKPNCYAKV-------------MFVAG-----DHRVG  797


 Score =   114 bits (286),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 75/152 (49%), Positives = 101/152 (66%), Gaps = 2/152 (1%)
 Frame = +1

Query  889   YTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALicsdsdeeiieeegenefaesedYI  1068
             YTTW FL RNQ+M EDQSV+GRR+IYY+ + GE LICSDS+EE   EE + E++E ED +
Sbjct  133   YTTWIFLDRNQRMAEDQSVVGRRQIYYEKHGGETLICSDSEEEPEPEEEKREYSEGEDSV  192

Query  1069  LRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLI--KEGATSKNENTEVTINSYLDE  1242
             + +  ++ G+ + V D L    S   S++  RY +L    E  T    N+   +   L++
Sbjct  193   IWLIGQEYGMGEEVQDSLCQFLSVDASDILGRYNELKLKDEQNTEDFSNSGFKLGISLEK  252

Query  1243  DLDAALSSFDNLFCQRCFVFNCQLHGCSQDLI  1338
             DL AAL SFDNLFC+RC VF+C+LHGCSQ LI
Sbjct  253   DLGAALDSFDNLFCRRCLVFDCRLHGCSQPLI  284


 Score = 59.3 bits (142),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSK  2164
             ++ V GDHR+GIFA + + A +EL YDY+Y PD  PAWA+  + S K
Sbjct  787   VMFVAGDHRVGIFANERIEASEELFYDYRYGPDQAPAWARKPEGSKK  833



>ref|XP_007145145.1| hypothetical protein PHAVU_007G213900g [Phaseolus vulgaris]
 gb|ESW17139.1| hypothetical protein PHAVU_007G213900g [Phaseolus vulgaris]
Length=853

 Score =   266 bits (681),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 129/226 (57%), Positives = 161/226 (71%), Gaps = 22/226 (10%)
 Frame = +1

Query  1360  REELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKNECATNYCP  1539
             + + C  YTPC C   CGK+C CV     CEK+CGC  +CK  F+GCHC K++C +  CP
Sbjct  598   KNQSCKQYTPCGCQSMCGKECTCVNGGTCCEKYCGCSKSCKNRFRGCHCAKSQCRSRQCP  657

Query  1540  CYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLLGRSDIAGW  1719
             C+A+GRECDPDVC  CWVSCGDGS+G PP +    +C NM+LLL  QQ++LL +SD+AGW
Sbjct  658   CFAAGRECDPDVCRNCWVSCGDGSLGEPP-RRGEGQCGNMRLLLRQQQRILLAKSDVAGW  716

Query  1720  GAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQLVIDAYRRG  1899
             GAFLKN    V+KN+++G YTGELISH EADK GK+YDR N SFLF+LNDQ V+DAYR+G
Sbjct  717   GAFLKN---PVNKNDYLGEYTGELISHREADKRGKIYDRANSSFLFDLNDQYVLDAYRKG  773

Query  1900  NKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
             +KLKF NHS +PNC+AKV             ++VAG     DHR G
Sbjct  774   DKLKFANHSSNPNCYAKV-------------MLVAG-----DHRVG  801


 Score =   115 bits (289),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 75/158 (47%), Positives = 104/158 (66%), Gaps = 9/158 (6%)
 Frame = +1

Query  889   YTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALi-csdsdeeiieeegenefaesedY  1065
             YT+W FL RNQ+M EDQSV+GRRRIYYD +  EALI     +E    EE ++EF+E+ED 
Sbjct  142   YTSWIFLDRNQRMAEDQSVVGRRRIYYDQHGSEALICSDSEEESTEHEEEKHEFSEAEDR  201

Query  1066  ILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLIKEGATSK----NENT---EVTI  1224
             +L M  E+ GL + VL++++       SE++ RYK  IKE    +    +EN+   E  I
Sbjct  202   VLWMAFEEYGLNEEVLNIVSEFVGGTSSEIQERYKS-IKEKNIGRLDQPSENSGDCESII  260

Query  1225  NSYLDEDLDAALSSFDNLFCQRCFVFNCQLHGCSQDLI  1338
                 ++ L+AAL SFDNLFC+RC +F+C+LHGCSQ L+
Sbjct  261   GISPEKSLNAALDSFDNLFCRRCLIFDCRLHGCSQPLV  298


 Score = 56.6 bits (135),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 22/45 (49%), Positives = 33/45 (73%), Gaps = 0/45 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSS  2158
             +++V GDHR+GIFA + ++A +EL YDY+Y PD  P WA+  + S
Sbjct  791   VMLVAGDHRVGIFAKEHIDASEELFYDYRYGPDQAPPWARKPEGS  835



>ref|XP_002515279.1| enhancer of zeste, ezh, putative [Ricinus communis]
 gb|EEF47263.1| enhancer of zeste, ezh, putative [Ricinus communis]
Length=884

 Score =   267 bits (683),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 128/226 (57%), Positives = 162/226 (72%), Gaps = 22/226 (10%)
 Frame = +1

Query  1360  REELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKNECATNYCP  1539
             + + C  YTPC C   CGK+CPC+     CEK+CGC  +CK  F+GCHC K++C +  CP
Sbjct  629   KNQSCKQYTPCGCQSMCGKQCPCLHNGTCCEKYCGCSKSCKNRFRGCHCAKSQCRSRQCP  688

Query  1540  CYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLLGRSDIAGW  1719
             C+A+GRECDPDVC  CWVSCGD S+G PP K  + +C NM+LLL  QQ++LL +S+IAGW
Sbjct  689   CFAAGRECDPDVCRNCWVSCGDSSLGEPP-KRGDGQCGNMRLLLRQQQRILLAKSNIAGW  747

Query  1720  GAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQLVIDAYRRG  1899
             GAFLKN    V+KN+++G YTGELISH EADK GK+YDR N SFLF+LN+Q V+DAYR+G
Sbjct  748   GAFLKN---PVNKNDYLGEYTGELISHREADKRGKIYDRANSSFLFDLNEQYVLDAYRKG  804

Query  1900  NKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
             +KLKF NHS +PNC+AKV             ++VAG     DHR G
Sbjct  805   DKLKFANHSSNPNCYAKV-------------MLVAG-----DHRVG  832


 Score =   111 bits (277),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 101/157 (64%), Gaps = 9/157 (6%)
 Frame = +1

Query  889   YTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALi-csdsdeeiieeegenefaesedY  1065
             YTTW FL RNQ+M EDQSV+GRRRIYYD N  EALI     ++    EE +++F+E ED 
Sbjct  126   YTTWIFLDRNQRMAEDQSVVGRRRIYYDQNGNEALICSDSEEDIAEPEEEKHDFSEGEDR  185

Query  1066  ILRMTIEKVGLYDMVLDLLANHFSRKPSEVKAR---YKDLIKE---GATSKNENTEVTIN  1227
             IL M  ++ GL + VL++++       S+++ R    K+   E   G  S +  +E  I+
Sbjct  186   ILWMVFQEHGLAEEVLNIVSQFIGVPISDIQERCSMLKERFDEEQNGKDSGDSASEKGIS  245

Query  1228  SYLDEDLDAALSSFDNLFCQRCFVFNCQLHGCSQDLI  1338
               L++ L AAL SFDNLFC+RC +F+C+LHGCSQ LI
Sbjct  246   --LEKSLSAALDSFDNLFCRRCLLFDCRLHGCSQALI  280


 Score = 59.3 bits (142),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSK  2164
             +++V GDHR+GIFA + + A +EL YDY+Y PD  PAWA+  + S +
Sbjct  822   VMLVAGDHRVGIFAKEHIEASEELFYDYRYGPDQAPAWARKPEGSRR  868



>ref|XP_008235145.1| PREDICTED: histone-lysine N-methyltransferase EZA1 isoform X2 
[Prunus mume]
Length=762

 Score =   265 bits (677),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 129/226 (57%), Positives = 161/226 (71%), Gaps = 22/226 (10%)
 Frame = +1

Query  1360  REELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKNECATNYCP  1539
             + + C  YTPC C   CGK CPC      CEK+CGC  +CK  F+GCHC K++C +  CP
Sbjct  507   KNQSCKLYTPCGCQSMCGKHCPCQHSGTCCEKYCGCSKSCKNRFRGCHCAKSQCRSRQCP  566

Query  1540  CYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLLGRSDIAGW  1719
             C+A+GRECDPDVC  CWVSCGDGS+G PP +  + +C NM+LLL  QQ++LL +SD+AGW
Sbjct  567   CFAAGRECDPDVCRNCWVSCGDGSLGEPP-RQGDGQCGNMRLLLRQQQRILLAKSDVAGW  625

Query  1720  GAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQLVIDAYRRG  1899
             GAFLKN    V+KN+++G YTGELISH EADK GK+YDR N SFLF+LNDQ V+DAYR+G
Sbjct  626   GAFLKN---PVNKNDYLGEYTGELISHQEADKRGKIYDRANSSFLFDLNDQYVLDAYRKG  682

Query  1900  NKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
             +KLKF NHS +PNC+AKV             ++VAG     DHR G
Sbjct  683   DKLKFANHSSNPNCYAKV-------------MLVAG-----DHRVG  710


 Score = 83.6 bits (205),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 62/165 (38%), Positives = 96/165 (58%), Gaps = 9/165 (5%)
 Frame = +1

Query  925   MPEDQSVIGRRRIYYD---MNSGEALi-csdsdeeiieeegenefaesedYILRMTIEKV  1092
             M +DQSV+GRRRIYYD    +  EAL+     +E    EE ++EF   ED I+ M  ++ 
Sbjct  1     MADDQSVVGRRRIYYDKDGTDGSEALVCSDTDEEIAEPEEVKHEFTAGEDRIMSMAFQEH  60

Query  1093  GLYDMVLDLLANHFSRKPSEVKARYKDLIKEGATSKNENTEVTINSY---LDEDLDAALS  1263
             G+ + V+ +++        E+  RY + IK+    + + +  + +++   LD+ L AAL 
Sbjct  61    GIGEEVVKVVSQFIGATTLEILVRY-NTIKDREKHEPKGSGDSGSNWCISLDKSLSAALD  119

Query  1264  SFDNLFCQRCFVFNCQLHGCSQDLIILKQIRVR-EELCAHYTPCN  1395
             SFDNLFC+RC +F+C+LHGCSQ LI   + +V   E     TPC+
Sbjct  120   SFDNLFCRRCLLFDCRLHGCSQPLIYPSEKQVHWSEQDEERTPCS  164


 Score = 57.4 bits (137),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 21/47 (45%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSK  2164
             +++V GDHR+GIFA + +++G+E+ YDY+Y PD  P WA+  + S +
Sbjct  700   VMLVAGDHRVGIFAKEHIDSGEEIFYDYRYGPDQAPPWAQKPEGSKR  746



>ref|XP_009346618.1| PREDICTED: histone-lysine N-methyltransferase EZA1-like isoform 
X1 [Pyrus x bretschneideri]
Length=822

 Score =   266 bits (679),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 127/219 (58%), Positives = 160/219 (73%), Gaps = 22/219 (10%)
 Frame = +1

Query  1381  YTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKNECATNYCPCYASGRE  1560
             YTPC C   CGK+CPC+     CEK+CGC  +CK  F+GCHC K++C +  CPC+A+GRE
Sbjct  574   YTPCGCQSMCGKECPCMSNGTCCEKYCGCSKSCKNRFRGCHCAKSQCRSRQCPCFAAGRE  633

Query  1561  CDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLLGRSDIAGWGAFLKNC  1740
             CDPDVC  CWVSCGDGS+G PP +  + +C NM+LLL  QQ++LLG+SD+AGWGAFLKN 
Sbjct  634   CDPDVCRHCWVSCGDGSLGEPP-RQGDSQCGNMRLLLRQQQRILLGKSDVAGWGAFLKN-  691

Query  1741  VICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQLVIDAYRRGNKLKFIN  1920
                V+KN+++G YTGE+ISH EADK GK+YDR N SFLF+LN+Q V+DAYR+G+KLKF N
Sbjct  692   --PVNKNDYLGEYTGEIISHQEADKRGKIYDRVNSSFLFDLNEQYVLDAYRKGDKLKFAN  749

Query  1921  HSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
             HS +PNC AKV             ++VAG     DHR G
Sbjct  750   HSSNPNCHAKV-------------MLVAG-----DHRVG  770


 Score =   115 bits (289),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 77/151 (51%), Positives = 100/151 (66%), Gaps = 5/151 (3%)
 Frame = +1

Query  889   YTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALicsdsdeeiieeegenef-aesedY  1065
             YTTW FL RNQ+M EDQSV+GRRRIYYD +  EAL+ S +D+E  E E      +  ED 
Sbjct  139   YTTWIFLDRNQRMAEDQSVVGRRRIYYDEDGSEALVYSGTDDEAEEPEEVKHEFSAGEDR  198

Query  1066  ILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLIKEGATSKNENTEVTINSYLDED  1245
             IL M  ++ GL + V++L+        S++ ARY + IKE    K E+ E  I+  LD+ 
Sbjct  199   ILLMAFQEHGLGEEVVELVKEFIGVPISDILARY-NTIKERNPEKCEH-EGCIS--LDKS  254

Query  1246  LDAALSSFDNLFCQRCFVFNCQLHGCSQDLI  1338
             L+AAL SFDNLFC+RC VF+C+LHGCSQ LI
Sbjct  255   LNAALDSFDNLFCRRCLVFDCRLHGCSQPLI  285



>ref|NP_001289854.1| histone-lysine N-methyltransferase CLF-like [Solanum lycopersicum]
 gb|AGZ03697.1| enhancer of zeste protein [Solanum lycopersicum]
Length=841

 Score =   266 bits (680),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 129/228 (57%), Positives = 162/228 (71%), Gaps = 23/228 (10%)
 Frame = +1

Query  1360  REELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCP--LNCKI*FQGCHCTKNECATNY  1533
             +++L  HY PCNC   CGK+CPC+V    CEK+CGC    NCK  F+GC C K +C +  
Sbjct  566   KDKLRRHYNPCNCQVPCGKECPCIVNGTLCEKYCGCKSFKNCKNHFRGCFCVKGQCRSRQ  625

Query  1534  CPCYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLLGRSDIA  1713
             CPC+A  RECDPDVC  CW+SCGDG++ IPP +  ++ C+NMKLLL  +QKVLLGRSD++
Sbjct  626   CPCFAVDRECDPDVCRNCWISCGDGTLDIPPQRSDSNDCENMKLLLKQRQKVLLGRSDVS  685

Query  1714  GWGAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQLVIDAYR  1893
             GWGAFLKN    V K+E++G YTGE+ISH EAD+ GK+YD  N SFLFNL+DQ V+DAYR
Sbjct  686   GWGAFLKN---SVGKHEYLGEYTGEIISHHEADRRGKIYDLINSSFLFNLDDQCVLDAYR  742

Query  1894  RGNKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
             +G+KLKF NHSPDPNC+ KV              I+AGG    DH+ G
Sbjct  743   KGDKLKFANHSPDPNCYPKV--------------IMAGG----DHKVG  772


 Score =   206 bits (523),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 135/222 (61%), Positives = 170/222 (77%), Gaps = 5/222 (2%)
 Frame = +1

Query  691   GDGSADLLAKRQTDAFDLQNSIGTGSG-NKICSSQEDGYASSDLR--SSIVLKNAVCpik  861
              D S DLL+KRQ D  ++Q  IG+ +G N   SS++DGYASS++R  SSI +K+AVCPI 
Sbjct  83    ADSSIDLLSKRQQDVINMQTGIGSSNGDNDSNSSEDDGYASSEIRLGSSIAIKSAVCPII  142

Query  862   lpklekippYTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALicsdsdeeiieeegen  1041
             LP++E++P YTTW FL RNQ+MP +QSV+G RRIYYD NSGEALICSDS+EE++E E E 
Sbjct  143   LPQVERLPQYTTWVFLDRNQQMPMNQSVVGCRRIYYDKNSGEALICSDSEEELLEGEQEK  202

Query  1042  efaesedYILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLIKEGA--TSKNENTE  1215
             +FAE ED +L  TI+++GL D VL+LL    SRKPSEVK RY+DL+K+     SKNEN +
Sbjct  203   KFAEYEDVMLCSTIQQIGLSDTVLELLGQFLSRKPSEVKVRYEDLVKDKYECASKNENIQ  262

Query  1216  VTINSYLDEDLDAALSSFDNLFCQRCFVFNCQLHGCSQDLII  1341
              T + +LD DLDAAL SFD LFC+RC VF+CQ HGCSQDLI 
Sbjct  263   GTPDLFLDNDLDAALDSFDTLFCRRCLVFDCQSHGCSQDLIF  304



>dbj|BAC84952.1| PHCLF3 [Petunia x hybrida]
Length=814

 Score =   266 bits (679),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 128/226 (57%), Positives = 159/226 (70%), Gaps = 22/226 (10%)
 Frame = +1

Query  1360  REELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKNECATNYCP  1539
             + + C  Y PC C P CGK CPC+     CEK+CGC  +CK  F+GCHC K++C +  CP
Sbjct  561   KNQSCIQYNPCGCQPTCGKDCPCLQNGTCCEKYCGCSKSCKNRFRGCHCAKSQCRSRQCP  620

Query  1540  CYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLLGRSDIAGW  1719
             C+A+GRECDPDVC  CWVSCGDGS G PP +    +C NM+LLL  QQ++LL +S +AGW
Sbjct  621   CFAAGRECDPDVCRNCWVSCGDGSSGEPP-RQGEGQCGNMRLLLRQQQRILLAKSHVAGW  679

Query  1720  GAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQLVIDAYRRG  1899
             GAFLKN    V+KN+++G YTGELISH EADK GK+YDR N SFLF+LNDQ V+DAYR+G
Sbjct  680   GAFLKN---PVNKNDYLGEYTGELISHREADKRGKIYDRANSSFLFDLNDQYVLDAYRKG  736

Query  1900  NKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
             +KLKF NHS +PNC+AKV             ++VAG     DHR G
Sbjct  737   DKLKFANHSSNPNCYAKV-------------MLVAG-----DHRVG  764


 Score =   115 bits (289),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 89/221 (40%), Positives = 127/221 (57%), Gaps = 20/221 (9%)
 Frame = +1

Query  697   GSADLLAKRQTDAFDLQNSIGTGSGNKICSSQEDGYASSDLRSSIVLKNAVCpiklpkle  876
             GS  +L+ R  +       +  GSG++  ++ E+  +S+  +  ++ K            
Sbjct  82    GSGKMLSLRVANPLCKVGGLLQGSGDRDYANGEEVVSSTTAKLPVIEK------------  129

Query  877   kippYTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALi-csdsdeeiieeegenefae  1053
              IPPYTTW FL RNQ+M EDQSV+GRRRIYYD +  EALI     ++    EEG+ EF+E
Sbjct  130   -IPPYTTWIFLDRNQRMAEDQSVVGRRRIYYDKHGSEALICSDSEEDIAEPEEGKREFSE  188

Query  1054  sedYILRMTIEKVGLYDMVLDLLANHFSRKPSEVKAR-----YKDLIKEGATSKNENTEV  1218
              ED IL M  ++ GL + VLD+LA++     SE+  R      K    +G + K+     
Sbjct  189   GEDKILWMASQEFGLSEEVLDILAHYVGGTTSEILERCNVLSEKHQDTDGKSLKDSGESG  248

Query  1219  TINS-YLDEDLDAALSSFDNLFCQRCFVFNCQLHGCSQDLI  1338
             +  + +LD+ L AA  SFDNLFC+RC VF+C+LHGCSQ LI
Sbjct  249   SRGTIFLDKSLSAASDSFDNLFCRRCLVFDCRLHGCSQMLI  289


 Score = 55.5 bits (132),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/48 (44%), Positives = 33/48 (69%), Gaps = 0/48 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSKK  2167
             +++V GDHR+GIFA + + A  EL YDY+Y PD  P WA+  + + ++
Sbjct  754   VMLVAGDHRVGIFAKEHIEASQELFYDYRYGPDQAPIWARKPEGTKRE  801



>ref|XP_006588568.1| PREDICTED: histone-lysine N-methyltransferase EZA1-like isoform 
X7 [Glycine max]
Length=811

 Score =   265 bits (678),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 129/226 (57%), Positives = 161/226 (71%), Gaps = 22/226 (10%)
 Frame = +1

Query  1360  REELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKNECATNYCP  1539
             + + C  YTPC C   CGK+C CV     CEK+CGC  +CK  F+GCHC K++C +  CP
Sbjct  556   KNQSCKQYTPCGCQSMCGKECTCVNGGTCCEKYCGCSKSCKNRFRGCHCAKSQCRSRQCP  615

Query  1540  CYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLLGRSDIAGW  1719
             C+A+GRECDPDVC  CWVSCGDGS+G PP +    +C NM+LLL  QQ++LL +SD+AGW
Sbjct  616   CFAAGRECDPDVCRNCWVSCGDGSLGEPP-RRGEGQCGNMRLLLRQQQRILLSKSDVAGW  674

Query  1720  GAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQLVIDAYRRG  1899
             GAFLKN    V+KN+++G YTGELISH EADK GK+YDR N SFLF+LNDQ V+DAYR+G
Sbjct  675   GAFLKN---PVNKNDYLGEYTGELISHREADKRGKIYDRANSSFLFDLNDQYVLDAYRKG  731

Query  1900  NKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
             +KLKF NHS +PNC+AKV             ++VAG     DHR G
Sbjct  732   DKLKFANHSSNPNCYAKV-------------MLVAG-----DHRVG  759


 Score =   109 bits (272),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 75/159 (47%), Positives = 102/159 (64%), Gaps = 10/159 (6%)
 Frame = +1

Query  889   YTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALi-csdsdeeiieeegenefaesedY  1065
             YT+W FL RNQ+M EDQSV+GRRRIYYD +  EALI     +E    EE ++EF+E+ED 
Sbjct  70    YTSWIFLDRNQRMAEDQSVVGRRRIYYDQHGSEALICSDSEEELTGPEEEKHEFSEAEDR  129

Query  1066  ILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLIKEGATSK----NENT---EVTI  1224
             ++ M  E+ GL D VL++++        E++ RYK  IKE    +    +EN+   E  I
Sbjct  130   VIWMAFEEYGLNDEVLNIVSEFVGGTSLEIQERYK-TIKEKNIGRLDQPSENSGEYESII  188

Query  1225  NSYLDEDLDAALSSFDNLFCQRCF-VFNCQLHGCSQDLI  1338
                 ++ L AAL SFDNLFC+RC  +F+C+LHGCSQ LI
Sbjct  189   GICPEKSLSAALDSFDNLFCRRCLQIFDCRLHGCSQPLI  227


 Score = 57.8 bits (138),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 22/47 (47%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSK  2164
             +++V GDHR+GIFA + ++A +EL YDY+Y PD  P WA+  + S +
Sbjct  749   VMLVAGDHRVGIFAKEHIDASEELFYDYRYGPDQAPPWARKPEGSKR  795



>ref|XP_006588566.1| PREDICTED: histone-lysine N-methyltransferase EZA1-like isoform 
X5 [Glycine max]
Length=866

 Score =   266 bits (680),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 129/226 (57%), Positives = 161/226 (71%), Gaps = 22/226 (10%)
 Frame = +1

Query  1360  REELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKNECATNYCP  1539
             + + C  YTPC C   CGK+C CV     CEK+CGC  +CK  F+GCHC K++C +  CP
Sbjct  611   KNQSCKQYTPCGCQSMCGKECTCVNGGTCCEKYCGCSKSCKNRFRGCHCAKSQCRSRQCP  670

Query  1540  CYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLLGRSDIAGW  1719
             C+A+GRECDPDVC  CWVSCGDGS+G PP +    +C NM+LLL  QQ++LL +SD+AGW
Sbjct  671   CFAAGRECDPDVCRNCWVSCGDGSLGEPP-RRGEGQCGNMRLLLRQQQRILLSKSDVAGW  729

Query  1720  GAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQLVIDAYRRG  1899
             GAFLKN    V+KN+++G YTGELISH EADK GK+YDR N SFLF+LNDQ V+DAYR+G
Sbjct  730   GAFLKN---PVNKNDYLGEYTGELISHREADKRGKIYDRANSSFLFDLNDQYVLDAYRKG  786

Query  1900  NKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
             +KLKF NHS +PNC+AKV             ++VAG     DHR G
Sbjct  787   DKLKFANHSSNPNCYAKV-------------MLVAG-----DHRVG  814


 Score =   109 bits (272),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 75/159 (47%), Positives = 102/159 (64%), Gaps = 10/159 (6%)
 Frame = +1

Query  889   YTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALi-csdsdeeiieeegenefaesedY  1065
             YT+W FL RNQ+M EDQSV+GRRRIYYD +  EALI     +E    EE ++EF+E+ED 
Sbjct  125   YTSWIFLDRNQRMAEDQSVVGRRRIYYDQHGSEALICSDSEEELTGPEEEKHEFSEAEDR  184

Query  1066  ILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLIKEGATSK----NENT---EVTI  1224
             ++ M  E+ GL D VL++++        E++ RYK  IKE    +    +EN+   E  I
Sbjct  185   VIWMAFEEYGLNDEVLNIVSEFVGGTSLEIQERYK-TIKEKNIGRLDQPSENSGEYESII  243

Query  1225  NSYLDEDLDAALSSFDNLFCQRCF-VFNCQLHGCSQDLI  1338
                 ++ L AAL SFDNLFC+RC  +F+C+LHGCSQ LI
Sbjct  244   GICPEKSLSAALDSFDNLFCRRCLQIFDCRLHGCSQPLI  282


 Score = 57.8 bits (138),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 22/47 (47%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSK  2164
             +++V GDHR+GIFA + ++A +EL YDY+Y PD  P WA+  + S +
Sbjct  804   VMLVAGDHRVGIFAKEHIDASEELFYDYRYGPDQAPPWARKPEGSKR  850



>ref|XP_006588563.1| PREDICTED: histone-lysine N-methyltransferase EZA1-like isoform 
X2 [Glycine max]
Length=871

 Score =   266 bits (680),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 129/226 (57%), Positives = 161/226 (71%), Gaps = 22/226 (10%)
 Frame = +1

Query  1360  REELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKNECATNYCP  1539
             + + C  YTPC C   CGK+C CV     CEK+CGC  +CK  F+GCHC K++C +  CP
Sbjct  616   KNQSCKQYTPCGCQSMCGKECTCVNGGTCCEKYCGCSKSCKNRFRGCHCAKSQCRSRQCP  675

Query  1540  CYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLLGRSDIAGW  1719
             C+A+GRECDPDVC  CWVSCGDGS+G PP +    +C NM+LLL  QQ++LL +SD+AGW
Sbjct  676   CFAAGRECDPDVCRNCWVSCGDGSLGEPP-RRGEGQCGNMRLLLRQQQRILLSKSDVAGW  734

Query  1720  GAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQLVIDAYRRG  1899
             GAFLKN    V+KN+++G YTGELISH EADK GK+YDR N SFLF+LNDQ V+DAYR+G
Sbjct  735   GAFLKN---PVNKNDYLGEYTGELISHREADKRGKIYDRANSSFLFDLNDQYVLDAYRKG  791

Query  1900  NKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
             +KLKF NHS +PNC+AKV             ++VAG     DHR G
Sbjct  792   DKLKFANHSSNPNCYAKV-------------MLVAG-----DHRVG  819


 Score =   109 bits (272),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 75/159 (47%), Positives = 102/159 (64%), Gaps = 10/159 (6%)
 Frame = +1

Query  889   YTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALi-csdsdeeiieeegenefaesedY  1065
             YT+W FL RNQ+M EDQSV+GRRRIYYD +  EALI     +E    EE ++EF+E+ED 
Sbjct  130   YTSWIFLDRNQRMAEDQSVVGRRRIYYDQHGSEALICSDSEEELTGPEEEKHEFSEAEDR  189

Query  1066  ILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLIKEGATSK----NENT---EVTI  1224
             ++ M  E+ GL D VL++++        E++ RYK  IKE    +    +EN+   E  I
Sbjct  190   VIWMAFEEYGLNDEVLNIVSEFVGGTSLEIQERYK-TIKEKNIGRLDQPSENSGEYESII  248

Query  1225  NSYLDEDLDAALSSFDNLFCQRCF-VFNCQLHGCSQDLI  1338
                 ++ L AAL SFDNLFC+RC  +F+C+LHGCSQ LI
Sbjct  249   GICPEKSLSAALDSFDNLFCRRCLQIFDCRLHGCSQPLI  287


 Score = 57.8 bits (138),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 22/47 (47%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSK  2164
             +++V GDHR+GIFA + ++A +EL YDY+Y PD  P WA+  + S +
Sbjct  809   VMLVAGDHRVGIFAKEHIDASEELFYDYRYGPDQAPPWARKPEGSKR  855



>ref|XP_006588565.1| PREDICTED: histone-lysine N-methyltransferase EZA1-like isoform 
X4 [Glycine max]
Length=870

 Score =   266 bits (680),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 129/226 (57%), Positives = 161/226 (71%), Gaps = 22/226 (10%)
 Frame = +1

Query  1360  REELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKNECATNYCP  1539
             + + C  YTPC C   CGK+C CV     CEK+CGC  +CK  F+GCHC K++C +  CP
Sbjct  615   KNQSCKQYTPCGCQSMCGKECTCVNGGTCCEKYCGCSKSCKNRFRGCHCAKSQCRSRQCP  674

Query  1540  CYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLLGRSDIAGW  1719
             C+A+GRECDPDVC  CWVSCGDGS+G PP +    +C NM+LLL  QQ++LL +SD+AGW
Sbjct  675   CFAAGRECDPDVCRNCWVSCGDGSLGEPP-RRGEGQCGNMRLLLRQQQRILLSKSDVAGW  733

Query  1720  GAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQLVIDAYRRG  1899
             GAFLKN    V+KN+++G YTGELISH EADK GK+YDR N SFLF+LNDQ V+DAYR+G
Sbjct  734   GAFLKN---PVNKNDYLGEYTGELISHREADKRGKIYDRANSSFLFDLNDQYVLDAYRKG  790

Query  1900  NKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
             +KLKF NHS +PNC+AKV             ++VAG     DHR G
Sbjct  791   DKLKFANHSSNPNCYAKV-------------MLVAG-----DHRVG  818


 Score =   109 bits (272),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 75/159 (47%), Positives = 102/159 (64%), Gaps = 10/159 (6%)
 Frame = +1

Query  889   YTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALi-csdsdeeiieeegenefaesedY  1065
             YT+W FL RNQ+M EDQSV+GRRRIYYD +  EALI     +E    EE ++EF+E+ED 
Sbjct  130   YTSWIFLDRNQRMAEDQSVVGRRRIYYDQHGSEALICSDSEEELTGPEEEKHEFSEAEDR  189

Query  1066  ILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLIKEGATSK----NENT---EVTI  1224
             ++ M  E+ GL D VL++++        E++ RYK  IKE    +    +EN+   E  I
Sbjct  190   VIWMAFEEYGLNDEVLNIVSEFVGGTSLEIQERYK-TIKEKNIGRLDQPSENSGEYESII  248

Query  1225  NSYLDEDLDAALSSFDNLFCQRCF-VFNCQLHGCSQDLI  1338
                 ++ L AAL SFDNLFC+RC  +F+C+LHGCSQ LI
Sbjct  249   GICPEKSLSAALDSFDNLFCRRCLQIFDCRLHGCSQPLI  287


 Score = 57.8 bits (138),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 22/47 (47%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSK  2164
             +++V GDHR+GIFA + ++A +EL YDY+Y PD  P WA+  + S +
Sbjct  808   VMLVAGDHRVGIFAKEHIDASEELFYDYRYGPDQAPPWARKPEGSKR  854



>ref|XP_006588564.1| PREDICTED: histone-lysine N-methyltransferase EZA1-like isoform 
X3 [Glycine max]
Length=870

 Score =   266 bits (680),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 129/226 (57%), Positives = 161/226 (71%), Gaps = 22/226 (10%)
 Frame = +1

Query  1360  REELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKNECATNYCP  1539
             + + C  YTPC C   CGK+C CV     CEK+CGC  +CK  F+GCHC K++C +  CP
Sbjct  615   KNQSCKQYTPCGCQSMCGKECTCVNGGTCCEKYCGCSKSCKNRFRGCHCAKSQCRSRQCP  674

Query  1540  CYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLLGRSDIAGW  1719
             C+A+GRECDPDVC  CWVSCGDGS+G PP +    +C NM+LLL  QQ++LL +SD+AGW
Sbjct  675   CFAAGRECDPDVCRNCWVSCGDGSLGEPP-RRGEGQCGNMRLLLRQQQRILLSKSDVAGW  733

Query  1720  GAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQLVIDAYRRG  1899
             GAFLKN    V+KN+++G YTGELISH EADK GK+YDR N SFLF+LNDQ V+DAYR+G
Sbjct  734   GAFLKN---PVNKNDYLGEYTGELISHREADKRGKIYDRANSSFLFDLNDQYVLDAYRKG  790

Query  1900  NKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
             +KLKF NHS +PNC+AKV             ++VAG     DHR G
Sbjct  791   DKLKFANHSSNPNCYAKV-------------MLVAG-----DHRVG  818


 Score =   114 bits (284),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 75/158 (47%), Positives = 102/158 (65%), Gaps = 9/158 (6%)
 Frame = +1

Query  889   YTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALi-csdsdeeiieeegenefaesedY  1065
             YT+W FL RNQ+M EDQSV+GRRRIYYD +  EALI     +E    EE ++EF+E+ED 
Sbjct  130   YTSWIFLDRNQRMAEDQSVVGRRRIYYDQHGSEALICSDSEEELTGPEEEKHEFSEAEDR  189

Query  1066  ILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLIKEGATSK----NENT---EVTI  1224
             ++ M  E+ GL D VL++++        E++ RYK  IKE    +    +EN+   E  I
Sbjct  190   VIWMAFEEYGLNDEVLNIVSEFVGGTSLEIQERYK-TIKEKNIGRLDQPSENSGEYESII  248

Query  1225  NSYLDEDLDAALSSFDNLFCQRCFVFNCQLHGCSQDLI  1338
                 ++ L AAL SFDNLFC+RC +F+C+LHGCSQ LI
Sbjct  249   GICPEKSLSAALDSFDNLFCRRCLIFDCRLHGCSQPLI  286


 Score = 57.8 bits (138),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 22/47 (47%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSK  2164
             +++V GDHR+GIFA + ++A +EL YDY+Y PD  P WA+  + S +
Sbjct  808   VMLVAGDHRVGIFAKEHIDASEELFYDYRYGPDQAPPWARKPEGSKR  854



>ref|XP_003535927.1| PREDICTED: histone-lysine N-methyltransferase EZA1-like isoform 
X1 [Glycine max]
Length=869

 Score =   266 bits (680),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 129/226 (57%), Positives = 161/226 (71%), Gaps = 22/226 (10%)
 Frame = +1

Query  1360  REELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKNECATNYCP  1539
             + + C  YTPC C   CGK+C CV     CEK+CGC  +CK  F+GCHC K++C +  CP
Sbjct  614   KNQSCKQYTPCGCQSMCGKECTCVNGGTCCEKYCGCSKSCKNRFRGCHCAKSQCRSRQCP  673

Query  1540  CYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLLGRSDIAGW  1719
             C+A+GRECDPDVC  CWVSCGDGS+G PP +    +C NM+LLL  QQ++LL +SD+AGW
Sbjct  674   CFAAGRECDPDVCRNCWVSCGDGSLGEPP-RRGEGQCGNMRLLLRQQQRILLSKSDVAGW  732

Query  1720  GAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQLVIDAYRRG  1899
             GAFLKN    V+KN+++G YTGELISH EADK GK+YDR N SFLF+LNDQ V+DAYR+G
Sbjct  733   GAFLKN---PVNKNDYLGEYTGELISHREADKRGKIYDRANSSFLFDLNDQYVLDAYRKG  789

Query  1900  NKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
             +KLKF NHS +PNC+AKV             ++VAG     DHR G
Sbjct  790   DKLKFANHSSNPNCYAKV-------------MLVAG-----DHRVG  817


 Score =   114 bits (284),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 75/158 (47%), Positives = 102/158 (65%), Gaps = 9/158 (6%)
 Frame = +1

Query  889   YTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALi-csdsdeeiieeegenefaesedY  1065
             YT+W FL RNQ+M EDQSV+GRRRIYYD +  EALI     +E    EE ++EF+E+ED 
Sbjct  130   YTSWIFLDRNQRMAEDQSVVGRRRIYYDQHGSEALICSDSEEELTGPEEEKHEFSEAEDR  189

Query  1066  ILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLIKEGATSK----NENT---EVTI  1224
             ++ M  E+ GL D VL++++        E++ RYK  IKE    +    +EN+   E  I
Sbjct  190   VIWMAFEEYGLNDEVLNIVSEFVGGTSLEIQERYK-TIKEKNIGRLDQPSENSGEYESII  248

Query  1225  NSYLDEDLDAALSSFDNLFCQRCFVFNCQLHGCSQDLI  1338
                 ++ L AAL SFDNLFC+RC +F+C+LHGCSQ LI
Sbjct  249   GICPEKSLSAALDSFDNLFCRRCLIFDCRLHGCSQPLI  286


 Score = 57.8 bits (138),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 22/47 (47%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSK  2164
             +++V GDHR+GIFA + ++A +EL YDY+Y PD  P WA+  + S +
Sbjct  807   VMLVAGDHRVGIFAKEHIDASEELFYDYRYGPDQAPPWARKPEGSKR  853



>ref|XP_003519745.1| PREDICTED: histone-lysine N-methyltransferase EZA1-like [Glycine 
max]
Length=868

 Score =   266 bits (679),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 128/226 (57%), Positives = 161/226 (71%), Gaps = 22/226 (10%)
 Frame = +1

Query  1360  REELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKNECATNYCP  1539
             + + C  YTPC C   CGK+C C+     CEK+CGC  +CK  F+GCHC K++C +  CP
Sbjct  613   KNQSCKQYTPCGCQSMCGKECTCINGGTCCEKYCGCSKSCKNRFRGCHCAKSQCRSRQCP  672

Query  1540  CYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLLGRSDIAGW  1719
             C+A+GRECDPDVC  CWVSCGDGS+G PP +    +C NM+LLL  QQ++LL +SD+AGW
Sbjct  673   CFAAGRECDPDVCRNCWVSCGDGSLGEPPRR-GEGQCGNMRLLLRQQQRILLAKSDVAGW  731

Query  1720  GAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQLVIDAYRRG  1899
             GAFLKN    V+KN+++G YTGELISH EADK GK+YDR N SFLF+LNDQ V+DAYR+G
Sbjct  732   GAFLKN---PVNKNDYLGEYTGELISHREADKRGKIYDRANSSFLFDLNDQYVLDAYRKG  788

Query  1900  NKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
             +KLKF NHS +PNC+AKV             ++VAG     DHR G
Sbjct  789   DKLKFANHSSNPNCYAKV-------------MLVAG-----DHRVG  816


 Score =   112 bits (280),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 74/158 (47%), Positives = 102/158 (65%), Gaps = 9/158 (6%)
 Frame = +1

Query  889   YTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALi-csdsdeeiieeegenefaesedY  1065
             YT+W FL RNQ+M EDQSV+GRRRIYYD +  EALI     +E    EE ++EF+E+ED 
Sbjct  130   YTSWIFLDRNQRMAEDQSVVGRRRIYYDQHGSEALICSDSEEELTEPEEEKHEFSEAEDR  189

Query  1066  ILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLIKEGATSK----NENT---EVTI  1224
             ++ M  E+ GL   V ++++        E++ RYK  IKE    +    ++N+   E TI
Sbjct  190   VIWMAFEEYGLNKEVPNIVSEFVGGTSLEIQERYK-TIKEKNIGRLDQPSQNSGEYESTI  248

Query  1225  NSYLDEDLDAALSSFDNLFCQRCFVFNCQLHGCSQDLI  1338
                L++ L AAL SFDNLFC+RC +F+C+LHGCSQ LI
Sbjct  249   GICLEKSLSAALDSFDNLFCRRCLIFDCRLHGCSQPLI  286


 Score = 57.8 bits (138),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 22/47 (47%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSK  2164
             +++V GDHR+GIFA + ++A +EL YDY+Y PD  P WA+  + S +
Sbjct  806   VMLVAGDHRVGIFAKEHIDASEELFYDYRYGPDQAPPWARKPEGSKR  852



>ref|XP_008235144.1| PREDICTED: histone-lysine N-methyltransferase EZA1 isoform X1 
[Prunus mume]
Length=909

 Score =   266 bits (681),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 129/226 (57%), Positives = 161/226 (71%), Gaps = 22/226 (10%)
 Frame = +1

Query  1360  REELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKNECATNYCP  1539
             + + C  YTPC C   CGK CPC      CEK+CGC  +CK  F+GCHC K++C +  CP
Sbjct  654   KNQSCKLYTPCGCQSMCGKHCPCQHSGTCCEKYCGCSKSCKNRFRGCHCAKSQCRSRQCP  713

Query  1540  CYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLLGRSDIAGW  1719
             C+A+GRECDPDVC  CWVSCGDGS+G PP +  + +C NM+LLL  QQ++LL +SD+AGW
Sbjct  714   CFAAGRECDPDVCRNCWVSCGDGSLGEPP-RQGDGQCGNMRLLLRQQQRILLAKSDVAGW  772

Query  1720  GAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQLVIDAYRRG  1899
             GAFLKN    V+KN+++G YTGELISH EADK GK+YDR N SFLF+LNDQ V+DAYR+G
Sbjct  773   GAFLKN---PVNKNDYLGEYTGELISHQEADKRGKIYDRANSSFLFDLNDQYVLDAYRKG  829

Query  1900  NKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
             +KLKF NHS +PNC+AKV             ++VAG     DHR G
Sbjct  830   DKLKFANHSSNPNCYAKV-------------MLVAG-----DHRVG  857


 Score =   105 bits (261),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 71/177 (40%), Positives = 106/177 (60%), Gaps = 9/177 (5%)
 Frame = +1

Query  889   YTTWAFLHRNQKMPEDQSVIGRRRIYYD---MNSGEALi-csdsdeeiieeegenefaes  1056
             YTTW FL RNQ+M +DQSV+GRRRIYYD    +  EAL+     +E    EE ++EF   
Sbjct  136   YTTWIFLDRNQRMADDQSVVGRRRIYYDKDGTDGSEALVCSDTDEEIAEPEEVKHEFTAG  195

Query  1057  edYILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLIKEGATSKNENTEVTINSY-  1233
             ED I+ M  ++ G+ + V+ +++        E+  RY + IK+    + + +  + +++ 
Sbjct  196   EDRIMSMAFQEHGIGEEVVKVVSQFIGATTLEILVRY-NTIKDREKHEPKGSGDSGSNWC  254

Query  1234  --LDEDLDAALSSFDNLFCQRCFVFNCQLHGCSQDLIILKQIRVR-EELCAHYTPCN  1395
               LD+ L AAL SFDNLFC+RC +F+C+LHGCSQ LI   + +V   E     TPC+
Sbjct  255   ISLDKSLSAALDSFDNLFCRRCLLFDCRLHGCSQPLIYPSEKQVHWSEQDEERTPCS  311


 Score = 57.8 bits (138),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 21/47 (45%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSK  2164
             +++V GDHR+GIFA + +++G+E+ YDY+Y PD  P WA+  + S +
Sbjct  847   VMLVAGDHRVGIFAKEHIDSGEEIFYDYRYGPDQAPPWAQKPEGSKR  893



>ref|XP_010315972.1| PREDICTED: histone-lysine N-methyltransferase CLF-like isoform 
X2 [Solanum lycopersicum]
Length=840

 Score =   265 bits (678),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 128/228 (56%), Positives = 162/228 (71%), Gaps = 23/228 (10%)
 Frame = +1

Query  1360  REELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCP--LNCKI*FQGCHCTKNECATNY  1533
             +++L  HY PCNC   CGK+CPC+V    CEK+CGC    NCK  F+GC C K +C +  
Sbjct  565   KDKLRRHYNPCNCQVPCGKECPCIVNGTLCEKYCGCKSFKNCKNHFRGCFCVKGQCRSRQ  624

Query  1534  CPCYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLLGRSDIA  1713
             CPC+A  RECDPDVC  CW+SCGDG++ IPP +  ++ C+NMKLLL  +Q+VLLGRSD++
Sbjct  625   CPCFAVDRECDPDVCRNCWISCGDGTLDIPPQRSDSNDCENMKLLLKQRQRVLLGRSDVS  684

Query  1714  GWGAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQLVIDAYR  1893
             GWGAFLKN    V K+E++G YTGE+ISH EAD+ GK+YD  N SFLFNL+DQ V+DAYR
Sbjct  685   GWGAFLKN---SVGKHEYLGEYTGEIISHHEADRRGKIYDLINSSFLFNLDDQCVLDAYR  741

Query  1894  RGNKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
             +G+KLKF NHSPDPNC+ KV              I+AGG    DH+ G
Sbjct  742   KGDKLKFANHSPDPNCYPKV--------------IMAGG----DHKVG  771


 Score =   206 bits (523),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 135/222 (61%), Positives = 170/222 (77%), Gaps = 5/222 (2%)
 Frame = +1

Query  691   GDGSADLLAKRQTDAFDLQNSIGTGSG-NKICSSQEDGYASSDLR--SSIVLKNAVCpik  861
              D S DLL+KRQ D  ++Q  IG+ +G N   SS++DGYASS++R  SSI +K+AVCPI 
Sbjct  83    ADSSIDLLSKRQQDVINMQTGIGSSNGDNDSNSSEDDGYASSEIRLGSSIAIKSAVCPII  142

Query  862   lpklekippYTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALicsdsdeeiieeegen  1041
             LP++E++P YTTW FL RNQ+MP +QSV+G RRIYYD NSGEALICSDS+EE++E E E 
Sbjct  143   LPQVERLPQYTTWVFLDRNQQMPMNQSVVGCRRIYYDKNSGEALICSDSEEELLEGEQEK  202

Query  1042  efaesedYILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLIKEGA--TSKNENTE  1215
             +FAE ED +L  TI+++GL D VL+LL    SRKPSEVK RY+DL+K+     SKNEN +
Sbjct  203   KFAEYEDVMLCSTIQQIGLSDTVLELLGQFLSRKPSEVKERYEDLVKDKYECASKNENIQ  262

Query  1216  VTINSYLDEDLDAALSSFDNLFCQRCFVFNCQLHGCSQDLII  1341
              T + +LD DLDAAL SFD LFC+RC VF+CQ HGCSQDLI 
Sbjct  263   GTPDLFLDNDLDAALDSFDTLFCRRCLVFDCQSHGCSQDLIF  304



>ref|XP_010315973.1| PREDICTED: histone-lysine N-methyltransferase CLF-like isoform 
X3 [Solanum lycopersicum]
Length=824

 Score =   265 bits (677),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 128/228 (56%), Positives = 162/228 (71%), Gaps = 23/228 (10%)
 Frame = +1

Query  1360  REELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCP--LNCKI*FQGCHCTKNECATNY  1533
             +++L  HY PCNC   CGK+CPC+V    CEK+CGC    NCK  F+GC C K +C +  
Sbjct  566   KDKLRRHYNPCNCQVPCGKECPCIVNGTLCEKYCGCKSFKNCKNHFRGCFCVKGQCRSRQ  625

Query  1534  CPCYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLLGRSDIA  1713
             CPC+A  RECDPDVC  CW+SCGDG++ IPP +  ++ C+NMKLLL  +Q+VLLGRSD++
Sbjct  626   CPCFAVDRECDPDVCRNCWISCGDGTLDIPPQRSDSNDCENMKLLLKQRQRVLLGRSDVS  685

Query  1714  GWGAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQLVIDAYR  1893
             GWGAFLKN    V K+E++G YTGE+ISH EAD+ GK+YD  N SFLFNL+DQ V+DAYR
Sbjct  686   GWGAFLKN---SVGKHEYLGEYTGEIISHHEADRRGKIYDLINSSFLFNLDDQCVLDAYR  742

Query  1894  RGNKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
             +G+KLKF NHSPDPNC+ KV              I+AGG    DH+ G
Sbjct  743   KGDKLKFANHSPDPNCYPKV--------------IMAGG----DHKVG  772


 Score =   206 bits (523),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 135/222 (61%), Positives = 170/222 (77%), Gaps = 5/222 (2%)
 Frame = +1

Query  691   GDGSADLLAKRQTDAFDLQNSIGTGSG-NKICSSQEDGYASSDLR--SSIVLKNAVCpik  861
              D S DLL+KRQ D  ++Q  IG+ +G N   SS++DGYASS++R  SSI +K+AVCPI 
Sbjct  83    ADSSIDLLSKRQQDVINMQTGIGSSNGDNDSNSSEDDGYASSEIRLGSSIAIKSAVCPII  142

Query  862   lpklekippYTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALicsdsdeeiieeegen  1041
             LP++E++P YTTW FL RNQ+MP +QSV+G RRIYYD NSGEALICSDS+EE++E E E 
Sbjct  143   LPQVERLPQYTTWVFLDRNQQMPMNQSVVGCRRIYYDKNSGEALICSDSEEELLEGEQEK  202

Query  1042  efaesedYILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLIKEGA--TSKNENTE  1215
             +FAE ED +L  TI+++GL D VL+LL    SRKPSEVK RY+DL+K+     SKNEN +
Sbjct  203   KFAEYEDVMLCSTIQQIGLSDTVLELLGQFLSRKPSEVKERYEDLVKDKYECASKNENIQ  262

Query  1216  VTINSYLDEDLDAALSSFDNLFCQRCFVFNCQLHGCSQDLII  1341
              T + +LD DLDAAL SFD LFC+RC VF+CQ HGCSQDLI 
Sbjct  263   GTPDLFLDNDLDAALDSFDTLFCRRCLVFDCQSHGCSQDLIF  304



>ref|XP_010315966.1| PREDICTED: histone-lysine N-methyltransferase CLF-like isoform 
X1 [Solanum lycopersicum]
 ref|XP_010315967.1| PREDICTED: histone-lysine N-methyltransferase CLF-like isoform 
X1 [Solanum lycopersicum]
 ref|XP_010315968.1| PREDICTED: histone-lysine N-methyltransferase CLF-like isoform 
X1 [Solanum lycopersicum]
 ref|XP_010315969.1| PREDICTED: histone-lysine N-methyltransferase CLF-like isoform 
X1 [Solanum lycopersicum]
 ref|XP_010315970.1| PREDICTED: histone-lysine N-methyltransferase CLF-like isoform 
X1 [Solanum lycopersicum]
 ref|XP_010315971.1| PREDICTED: histone-lysine N-methyltransferase CLF-like isoform 
X1 [Solanum lycopersicum]
Length=841

 Score =   265 bits (678),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 128/228 (56%), Positives = 162/228 (71%), Gaps = 23/228 (10%)
 Frame = +1

Query  1360  REELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCP--LNCKI*FQGCHCTKNECATNY  1533
             +++L  HY PCNC   CGK+CPC+V    CEK+CGC    NCK  F+GC C K +C +  
Sbjct  566   KDKLRRHYNPCNCQVPCGKECPCIVNGTLCEKYCGCKSFKNCKNHFRGCFCVKGQCRSRQ  625

Query  1534  CPCYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLLGRSDIA  1713
             CPC+A  RECDPDVC  CW+SCGDG++ IPP +  ++ C+NMKLLL  +Q+VLLGRSD++
Sbjct  626   CPCFAVDRECDPDVCRNCWISCGDGTLDIPPQRSDSNDCENMKLLLKQRQRVLLGRSDVS  685

Query  1714  GWGAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQLVIDAYR  1893
             GWGAFLKN    V K+E++G YTGE+ISH EAD+ GK+YD  N SFLFNL+DQ V+DAYR
Sbjct  686   GWGAFLKN---SVGKHEYLGEYTGEIISHHEADRRGKIYDLINSSFLFNLDDQCVLDAYR  742

Query  1894  RGNKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
             +G+KLKF NHSPDPNC+ KV              I+AGG    DH+ G
Sbjct  743   KGDKLKFANHSPDPNCYPKV--------------IMAGG----DHKVG  772


 Score =   206 bits (523),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 135/222 (61%), Positives = 170/222 (77%), Gaps = 5/222 (2%)
 Frame = +1

Query  691   GDGSADLLAKRQTDAFDLQNSIGTGSG-NKICSSQEDGYASSDLR--SSIVLKNAVCpik  861
              D S DLL+KRQ D  ++Q  IG+ +G N   SS++DGYASS++R  SSI +K+AVCPI 
Sbjct  83    ADSSIDLLSKRQQDVINMQTGIGSSNGDNDSNSSEDDGYASSEIRLGSSIAIKSAVCPII  142

Query  862   lpklekippYTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALicsdsdeeiieeegen  1041
             LP++E++P YTTW FL RNQ+MP +QSV+G RRIYYD NSGEALICSDS+EE++E E E 
Sbjct  143   LPQVERLPQYTTWVFLDRNQQMPMNQSVVGCRRIYYDKNSGEALICSDSEEELLEGEQEK  202

Query  1042  efaesedYILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLIKEGA--TSKNENTE  1215
             +FAE ED +L  TI+++GL D VL+LL    SRKPSEVK RY+DL+K+     SKNEN +
Sbjct  203   KFAEYEDVMLCSTIQQIGLSDTVLELLGQFLSRKPSEVKERYEDLVKDKYECASKNENIQ  262

Query  1216  VTINSYLDEDLDAALSSFDNLFCQRCFVFNCQLHGCSQDLII  1341
              T + +LD DLDAAL SFD LFC+RC VF+CQ HGCSQDLI 
Sbjct  263   GTPDLFLDNDLDAALDSFDTLFCRRCLVFDCQSHGCSQDLIF  304



>ref|XP_009378727.1| PREDICTED: histone-lysine N-methyltransferase EZA1-like isoform 
X3 [Pyrus x bretschneideri]
Length=672

 Score =   261 bits (666),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 127/219 (58%), Positives = 159/219 (73%), Gaps = 22/219 (10%)
 Frame = +1

Query  1381  YTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKNECATNYCPCYASGRE  1560
             +TPC C   CGK+C C+     CEK+CGC  +CK  F+GCHC K++C +  CPC+A+GRE
Sbjct  424   HTPCGCQSMCGKECSCMSNGTCCEKYCGCSKSCKNRFRGCHCAKSQCRSRQCPCFAAGRE  483

Query  1561  CDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLLGRSDIAGWGAFLKNC  1740
             CDPDVC  CWVSCGDGS+G PP K  + +C NM+LLL  QQ++LLG+SDIAGWGAFLKN 
Sbjct  484   CDPDVCHHCWVSCGDGSLGKPP-KQGDSQCGNMRLLLRQQQRILLGKSDIAGWGAFLKN-  541

Query  1741  VICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQLVIDAYRRGNKLKFIN  1920
                V+KN+++G YTGE+ISH EADK GK+YDR N SFLF+LN+Q V+DAYR+G+KLKF N
Sbjct  542   --PVNKNDYLGEYTGEIISHQEADKRGKIYDRVNSSFLFDLNEQYVLDAYRKGDKLKFAN  599

Query  1921  HSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
             HS +PNC AKV             ++VAG     DHR G
Sbjct  600   HSSNPNCHAKV-------------MLVAG-----DHRVG  620


 Score = 82.4 bits (202),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 65/139 (47%), Positives = 84/139 (60%), Gaps = 5/139 (4%)
 Frame = +1

Query  925   MPEDQSVIGRRRIYYDMNSGEALicsdsdeeiieeegenef-aesedYILRMTIEKVGLY  1101
             M EDQSV+GRRRIYYD +  EAL+ S SD+E  E E      +  ED IL M  ++ GL 
Sbjct  1     MAEDQSVVGRRRIYYDEDGSEALVYSGSDDEAEEPEKVEHEFSAGEDRILLMAFQEHGLG  60

Query  1102  DMVLDLLANHFSRKPSEVKARYKDLIKEGATSKNENTEVTINSYLDEDLDAALSSFDNLF  1281
             + V++++         E+  RY + IKE  + K E         LD+ L AAL SFDNLF
Sbjct  61    EEVVEVVREFIGVPILEILDRY-NTIKERNSEKREPDGCI---SLDKSLIAALDSFDNLF  116

Query  1282  CQRCFVFNCQLHGCSQDLI  1338
             C+RC VF+C+LHGCSQ LI
Sbjct  117   CRRCLVFDCRLHGCSQPLI  135



>gb|EMS47378.1| Histone-lysine N-methyltransferase EZ1 [Triticum urartu]
Length=829

 Score =   263 bits (673),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 133/235 (57%), Positives = 158/235 (67%), Gaps = 22/235 (9%)
 Frame = +1

Query  1336  IILKQIRVRE-ELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTK  1512
             +I K+I  R+ EL  HY PC C   CGK+CPC      CEKFCGCP  CK  F+GC C K
Sbjct  533   LITKRIAARKGELRQHYNPCGCQSACGKQCPCRENYTSCEKFCGCPKACKNRFRGCKCAK  592

Query  1513  NECATNYCPCYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVL  1692
              +C    CPC+A+ RECDPDVC  C V CGDGS+G+P  +  N+ CQNMKLLL  QQKV+
Sbjct  593   AQCRNRQCPCFAADRECDPDVCRNCGVGCGDGSLGVPNQRGDNYGCQNMKLLLRQQQKVV  652

Query  1693  LGRSDIAGWGAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQ  1872
             LGRSD++GWGAF+KN    V K++ +G YTGELISH EA K G+ YDR N SFLFNLN +
Sbjct  653   LGRSDVSGWGAFVKN---TVGKDDCLGEYTGELISHREAAKRGQRYDRDNSSFLFNLNTE  709

Query  1873  LVIDAYRRGNKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
              V+DA+R GNKLKF NHSPDPNC+AKV             + VAG     DHR G
Sbjct  710   FVLDAFRMGNKLKFANHSPDPNCYAKV-------------MFVAG-----DHRVG  746


 Score =   124 bits (310),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 104/236 (44%), Positives = 144/236 (61%), Gaps = 20/236 (8%)
 Frame = +1

Query  679   TGLVGDGSA-DLLAKRQTD----AFDLQNSIGTGSGNKICSSQED---GYASSDLRSSIV  834
             + L G G A +LL  RQ D       L+  +    G    SSQED   G  ++ L   + 
Sbjct  110   SALDGTGLATNLLTPRQDDVSCSTLGLELCLAEKDGG---SSQEDSPYGTLTATLGGILT  166

Query  835   LKNAVCpiklpklekippYTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALicsdsde  1014
              KNA  PI+LP +  +PPYTTW FL RNQ+M EDQS   R+ IYY+ + G+AL+ SDS++
Sbjct  167   AKNANKPIELPTVSGLPPYTTWVFLDRNQRMTEDQSAFHRQNIYYNADCGKALMFSDSED  226

Query  1015  eiieeegenefaesedY-ILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLIKEGA  1191
             E++E+E E    +S +   +RMTI+  G+ D VL+ LA  F +   ++KARY+  I +G 
Sbjct  227   EVVEDEEEKREFKSSEDCFIRMTIDGCGMSDEVLETLAQCFEKTAGDIKARYE--ILQGE  284

Query  1192  TSKNENTEV-TINS-----YLDEDLDAALSSFDNLFCQRCFVFNCQLHGCSQDLII  1341
              ++  + EV  +N+     Y D+DL AAL SFDNLFC+RC VF C+LHGCSQDLI 
Sbjct  285   NTEGSSKEVPKLNAKLKDIYHDKDLAAALDSFDNLFCRRCLVFYCKLHGCSQDLIF  340


 Score = 56.6 bits (135),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWA  2140
             ++ V GDHR+GIFA + +NAG E+ YDY Y PD  PAWA
Sbjct  736   VMFVAGDHRVGIFANERINAGTEIFYDYHYAPDEAPAWA  774



>emb|CDX89569.1| BnaC04g35880D [Brassica napus]
Length=910

 Score =   265 bits (676),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 126/235 (54%), Positives = 165/235 (70%), Gaps = 6/235 (3%)
 Frame = +1

Query  1336  IILKQIRVREELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKN  1515
             I  K    +++ C  + PCNC   CGK+C C++    CEK+CGCP +CK  F+GCHC K+
Sbjct  644   IRKKSTDKKDQPCRQFNPCNCKTACGKECTCLLNGTCCEKYCGCPKSCKNRFRGCHCAKS  703

Query  1516  ECATNYCPCYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLL  1695
             +C +  CPC+A+ RECDPDVC  CWV  GDG++G+P  +  N++C+NMKLLL  QQ+VLL
Sbjct  704   QCRSRQCPCFAADRECDPDVCRNCWVIGGDGTLGVPSQRGDNYECRNMKLLLKQQQRVLL  763

Query  1696  GRSDIAGWGAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQL  1875
             G SD++GWGAFLKN    VSK+E++G YTGELISH EADK GK+YDR+N SFLFNLNDQ 
Sbjct  764   GISDVSGWGAFLKN---SVSKHEYLGEYTGELISHKEADKRGKIYDRENSSFLFNLNDQA  820

Query  1876  VIDAYR-RGNKLKFINHSPDPNCFAKVNCSLSPCLLQCF--QLIVAGGSFSIDHR  2031
              +   R +G+KLKF NHSP+PNC+AKV        +  F  + I+AG     D+R
Sbjct  821   RLSLSRLKGDKLKFANHSPEPNCYAKVIMVAGDHRVGIFAKERILAGEELFYDYR  875


 Score =   169 bits (427),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 120/254 (47%), Positives = 163/254 (64%), Gaps = 14/254 (6%)
 Frame = +1

Query  682   GLVGDGSADLLAKRQTDAFDLQNSIGTGSGNKI---CSSQEDGYASSDLR---SSIVLKN  843
             G   DGS DLL KRQ D+  +++ +     +K     S  EDG ASS      SS+ +K 
Sbjct  82    GSYKDGS-DLLVKRQRDSPGMKSGLNASDADKSNNHSSFLEDGNASSTTMVQGSSVPVKI  140

Query  844   AVCpiklpklekippYTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALi-csdsdeei  1020
             ++ PIK+P ++++ PYTTW FL RNQ+M EDQSV+GRRRIYYD   GEALI     +E I
Sbjct  141   SLRPIKMPDVKRLSPYTTWVFLDRNQRMTEDQSVVGRRRIYYDQTGGEALICSDSEEEAI  200

Query  1021  ieeegenefaesedYILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLIKEGATSK  1200
              EE+ +  F E ED+I+RMT++++GL D VL+ LAN  SR  SE+KARY+ L+KE   S+
Sbjct  201   DEEDEKRAFVEPEDFIIRMTLDQLGLSDSVLEELANFLSRSSSEIKARYEVLMKEKEISE  260

Query  1201  NENTEVTINSYLDEDLDAALSSFDNLFCQRCFVFNCQLHGCSQDLIILKQIRVREELCAH  1380
             + + +   +S L++D+D AL SFDNLFC+RC VF+C+LHGCSQDLI        E+    
Sbjct  261   SGDNQAE-SSLLNKDMDGALDSFDNLFCRRCLVFDCRLHGCSQDLIFPA-----EKPAPW  314

Query  1381  YTPCNC*PHCGKKC  1422
              TP +    CG  C
Sbjct  315   TTPVDENLTCGANC  328


 Score = 64.3 bits (155),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSKK  2167
             +I+V GDHR+GIFA + + AG+EL YDY+Y+PD  PAWA+  ++S  K
Sbjct  847   VIMVAGDHRVGIFAKERILAGEELFYDYRYEPDRAPAWARKPEASGSK  894



>gb|EEC75093.1| hypothetical protein OsI_11249 [Oryza sativa Indica Group]
Length=679

 Score =   260 bits (665),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 126/234 (54%), Positives = 162/234 (69%), Gaps = 21/234 (9%)
 Frame = +1

Query  1336  IILKQIRVREELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKN  1515
              + K+I   ++    Y PC C   CGK C CV     CEK+CGC  +CK  F+GCHC K+
Sbjct  416   TVRKRIGDGKQWYTQYNPCGCQQMCGKDCACVENGTCCEKYCGCSKSCKNRFRGCHCAKS  475

Query  1516  ECATNYCPCYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLL  1695
             +C +  CPC+A+ RECDPDVC  CWVSCGDGS+G P  +   ++C NMKLLL  QQ++LL
Sbjct  476   QCRSRQCPCFAASRECDPDVCRNCWVSCGDGSLGEPLARGDGYQCGNMKLLLKQQQRILL  535

Query  1696  GRSDIAGWGAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQL  1875
             G+SD+AGWGAF+KN    V++N+++G YTGELISH EADK GK+YDR N SFLF+LN+Q 
Sbjct  536   GKSDVAGWGAFIKN---PVNRNDYLGEYTGELISHREADKRGKIYDRANSSFLFDLNEQY  592

Query  1876  VIDAYRRGNKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
             V+DAYR+G+KLKF NHS +PNC+AKV             ++VAG     DHR G
Sbjct  593   VLDAYRKGDKLKFANHSSNPNCYAKV-------------MLVAG-----DHRVG  628


 Score = 57.4 bits (137),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSK  2164
             +++V GDHR+GI+A   + A +EL YDY+Y PD  PAWA+  + S K
Sbjct  618   VMLVAGDHRVGIYAKDRIEASEELFYDYRYGPDQAPAWARRPEGSKK  664



>ref|XP_008386718.1| PREDICTED: histone-lysine N-methyltransferase EZA1-like isoform 
X2 [Malus domestica]
Length=672

 Score =   260 bits (664),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 126/219 (58%), Positives = 159/219 (73%), Gaps = 22/219 (10%)
 Frame = +1

Query  1381  YTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKNECATNYCPCYASGRE  1560
             YTPC C   CGK+C C+     CEK+CGC  +CK  F+GCHC K++C +  CPC+A+GRE
Sbjct  424   YTPCXCQSMCGKECSCMSNGTCCEKYCGCSKSCKNRFRGCHCAKSQCRSRQCPCFAAGRE  483

Query  1561  CDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLLGRSDIAGWGAFLKNC  1740
             CDPDVC  CWVSCGDGS+G PP +  + +C NM+LLL  QQ++LLG+SD+AGWGAFLKN 
Sbjct  484   CDPDVCRHCWVSCGDGSLGEPP-RQGDSQCGNMRLLLRQQQRILLGKSDVAGWGAFLKN-  541

Query  1741  VICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQLVIDAYRRGNKLKFIN  1920
                V+KN+++G YTGE+ISH EADK GK+YDR N SFLF+LN+Q V+DAYR+G+KLKF N
Sbjct  542   --PVNKNDYLGEYTGEIISHQEADKRGKIYDRVNSSFLFDLNEQYVLDAYRKGDKLKFAN  599

Query  1921  HSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
             HS +PNC AKV             ++VAG     DHR G
Sbjct  600   HSSNPNCHAKV-------------MLVAG-----DHRVG  620


 Score = 94.7 bits (234),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 66/139 (47%), Positives = 87/139 (63%), Gaps = 5/139 (4%)
 Frame = +1

Query  925   MPEDQSVIGRRRIYYDMNSGEALicsdsdeeiieeegenef-aesedYILRMTIEKVGLY  1101
             M EDQSV+GRRRIYYD +  EAL+ S +D+E  E E      +  ED IL M  ++ GL 
Sbjct  1     MAEDQSVVGRRRIYYDEDGSEALVYSGTDDEAEEPEEVKHEFSAGEDRILLMAFQEHGLG  60

Query  1102  DMVLDLLANHFSRKPSEVKARYKDLIKEGATSKNENTEVTINSYLDEDLDAALSSFDNLF  1281
             + V++L+        S++ ARY + IKE    K E+        LD+ L+AAL SFDNLF
Sbjct  61    EEVVELVKEFIGAPISDILARY-NTIKERNPEKCEHDGCI---SLDKSLNAALDSFDNLF  116

Query  1282  CQRCFVFNCQLHGCSQDLI  1338
             C+RC VF+C+LHGCSQ LI
Sbjct  117   CRRCLVFDCRLHGCSQPLI  135



>gb|AAN01115.1|AF407010_1 SET domain-containing protein [Oryza sativa]
 gb|AEJ08686.1| set domain protein [Oryza sativa]
Length=895

 Score =   264 bits (675),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 126/234 (54%), Positives = 162/234 (69%), Gaps = 21/234 (9%)
 Frame = +1

Query  1336  IILKQIRVREELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKN  1515
              + K+I   ++    Y PC C   CGK C CV     CEK+CGC  +CK  F+GCHC K+
Sbjct  632   TVRKRIGDGKQWYTQYNPCGCQQMCGKDCACVENGTCCEKYCGCSKSCKNRFRGCHCAKS  691

Query  1516  ECATNYCPCYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLL  1695
             +C +  CPC+A+ RECDPDVC  CWVSCGDGS+G PP +   ++C NMKLLL  QQ++LL
Sbjct  692   QCRSRQCPCFAASRECDPDVCRNCWVSCGDGSLGEPPARGDGYQCGNMKLLLKQQQRILL  751

Query  1696  GRSDIAGWGAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQL  1875
             G+SD+AGWGAF+KN    V++N+++G YTGELISH EADK GK+YDR N SFLF+LN+Q 
Sbjct  752   GKSDVAGWGAFIKN---PVNRNDYLGEYTGELISHREADKRGKIYDRANSSFLFDLNEQY  808

Query  1876  VIDAYRRGNKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
             V+DAYR+G+ LKF NHS +PNC+AKV             ++VAG     DHR G
Sbjct  809   VLDAYRKGDNLKFANHSSNPNCYAKV-------------MLVAG-----DHRVG  844


 Score =   106 bits (265),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 73/187 (39%), Positives = 106/187 (57%), Gaps = 7/187 (4%)
 Frame = +1

Query  889   YTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALi-csdsdeeiieeegenefaesedY  1065
             YTTW FL +NQ+M +DQSV GRRRIYYD    EALI     D+    EE ++ F E ED 
Sbjct  159   YTTWIFLDKNQRMADDQSV-GRRRIYYDPIVNEALICSESDDDVPEPEEEKHVFTEGEDQ  217

Query  1066  ILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLIKEGATSKNENTEVTINSYLDED  1245
             ++    +  GL   VL++L       PSE++ R + L ++       + +  +  +LD+ 
Sbjct  218   LIWKATQDHGLSREVLNVLCQFVDATPSEIEERSEVLFEKYEKQSQSSYKTDLQLFLDKT  277

Query  1246  LDAALSSFDNLFCQRCFVFNCQLHGCSQDLIILKQIRVREELCAHYTPCNC*PHCGKKCP  1425
             +D AL SFDNLFC+RC VF+C+LHGCSQ+L+   +    ++   H    N  P CG +C 
Sbjct  278   MDVALDSFDNLFCRRCLVFDCRLHGCSQNLVFPSE----KQPYGHELDENKRP-CGDQCY  332

Query  1426  CVVKSIY  1446
                + +Y
Sbjct  333   LRRREVY  339


 Score = 57.8 bits (138),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSK  2164
             +++V GDHR+GI+A   + A +EL YDY+Y PD  PAWA+  + S K
Sbjct  834   VMLVAGDHRVGIYAKDRIEASEELFYDYRYGPDQAPAWARRPEGSKK  880



>ref|XP_004495901.1| PREDICTED: histone-lysine N-methyltransferase EZA1-like [Cicer 
arietinum]
Length=866

 Score =   263 bits (673),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 131/234 (56%), Positives = 165/234 (71%), Gaps = 23/234 (10%)
 Frame = +1

Query  1339  ILKQIRV-REELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKN  1515
             ILK+I   + + C  YTPC C   CGK C CV     CEK+CGC  +CK  F+GCHC K+
Sbjct  603   ILKRIADGKNQSCKQYTPCGCQSMCGKDCSCVNGGTCCEKYCGCSKSCKNRFRGCHCAKS  662

Query  1516  ECATNYCPCYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLL  1695
             +C +  CPC+A+GRECDPDVC  CWVSCGDG++G  P +    +C NM+LLL  QQ++LL
Sbjct  663   QCRSRQCPCFAAGRECDPDVCRNCWVSCGDGTLG-EPTRRGEGQCGNMRLLLRQQQRILL  721

Query  1696  GRSDIAGWGAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQL  1875
             G+SD+AGWGAFLKN    V+KN+++G YTGELISH EADK GK+YDR N SFLF+LN+Q 
Sbjct  722   GKSDVAGWGAFLKN---PVNKNDYLGEYTGELISHREADKRGKIYDRANSSFLFDLNEQY  778

Query  1876  VIDAYRRGNKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
             V+DAYR+G+KLKF NHS +PNC+AKV             ++VAG     DHR G
Sbjct  779   VLDAYRKGDKLKFANHSSNPNCYAKV-------------MLVAG-----DHRVG  814


 Score =   117 bits (293),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 90/194 (46%), Positives = 123/194 (63%), Gaps = 13/194 (7%)
 Frame = +1

Query  889   YTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALicsdsdeeiieeegenefaesedYI  1068
             YT+W FL RNQ+M +DQSV+GRRRIYYD +  EALICSDS+EE   EE ++EF E+ED I
Sbjct  131   YTSWIFLGRNQRMADDQSVVGRRRIYYDHHGSEALICSDSEEETEPEEEKHEFCEAEDRI  190

Query  1069  LRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYK-------DLIKEGATSKNENTEVTIN  1227
             L M  E+ GL + VL++++ +      E++ RYK       D + + + S  E+ E  ++
Sbjct  191   LWMAFEEHGLNEEVLNVVSKYVGGTSLEIQERYKSIRENNMDRLDQHSKSSGEH-ESLMS  249

Query  1228  SYLDEDLDAALSSFDNLFCQRCFVFNCQLHGCSQDLII--LKQIRVREELCAHYTPCNC*  1401
              YL+++L  AL S DNLFC+RC +F+C+LHGCSQ LI    KQI V  E      PC+  
Sbjct  250   MYLEKNLSEALDSLDNLFCRRCLIFDCRLHGCSQPLIYPSEKQI-VWYEPDGERKPCS--  306

Query  1402  PHCGKKCPCVVKSI  1443
               C  K   VVKS+
Sbjct  307   DQCYLKQLKVVKSL  320


 Score = 57.8 bits (138),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 22/47 (47%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSK  2164
             +++V GDHR+GIFA + ++A +EL YDY+Y PD  P WA+  + S +
Sbjct  804   VMLVAGDHRVGIFAKEHIDASEELFYDYRYGPDQAPPWARKPEGSKR  850



>ref|XP_009378725.1| PREDICTED: histone-lysine N-methyltransferase EZA1-like isoform 
X1 [Pyrus x bretschneideri]
Length=822

 Score =   263 bits (671),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 127/219 (58%), Positives = 159/219 (73%), Gaps = 22/219 (10%)
 Frame = +1

Query  1381  YTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKNECATNYCPCYASGRE  1560
             +TPC C   CGK+C C+     CEK+CGC  +CK  F+GCHC K++C +  CPC+A+GRE
Sbjct  574   HTPCGCQSMCGKECSCMSNGTCCEKYCGCSKSCKNRFRGCHCAKSQCRSRQCPCFAAGRE  633

Query  1561  CDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLLGRSDIAGWGAFLKNC  1740
             CDPDVC  CWVSCGDGS+G PP K  + +C NM+LLL  QQ++LLG+SDIAGWGAFLKN 
Sbjct  634   CDPDVCHHCWVSCGDGSLGKPP-KQGDSQCGNMRLLLRQQQRILLGKSDIAGWGAFLKN-  691

Query  1741  VICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQLVIDAYRRGNKLKFIN  1920
                V+KN+++G YTGE+ISH EADK GK+YDR N SFLF+LN+Q V+DAYR+G+KLKF N
Sbjct  692   --PVNKNDYLGEYTGEIISHQEADKRGKIYDRVNSSFLFDLNEQYVLDAYRKGDKLKFAN  749

Query  1921  HSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
             HS +PNC AKV             ++VAG     DHR G
Sbjct  750   HSSNPNCHAKV-------------MLVAG-----DHRVG  770


 Score =   103 bits (257),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 74/151 (49%), Positives = 94/151 (62%), Gaps = 5/151 (3%)
 Frame = +1

Query  889   YTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALicsdsdeeiieeegenef-aesedY  1065
             YTTW FL RNQ+M EDQSV+GRRRIYYD +  EAL+ S SD+E  E E      +  ED 
Sbjct  139   YTTWIFLDRNQRMAEDQSVVGRRRIYYDEDGSEALVYSGSDDEAEEPEKVEHEFSAGEDR  198

Query  1066  ILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLIKEGATSKNENTEVTINSYLDED  1245
             IL M  ++ GL + V++++         E+  RY + IKE  + K E         LD+ 
Sbjct  199   ILLMAFQEHGLGEEVVEVVREFIGVPILEILDRY-NTIKERNSEKREPDGCI---SLDKS  254

Query  1246  LDAALSSFDNLFCQRCFVFNCQLHGCSQDLI  1338
             L AAL SFDNLFC+RC VF+C+LHGCSQ LI
Sbjct  255   LIAALDSFDNLFCRRCLVFDCRLHGCSQPLI  285



>ref|XP_009378726.1| PREDICTED: histone-lysine N-methyltransferase EZA1-like isoform 
X2 [Pyrus x bretschneideri]
Length=767

 Score =   261 bits (668),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 120/191 (63%), Positives = 150/191 (79%), Gaps = 4/191 (2%)
 Frame = +1

Query  1381  YTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKNECATNYCPCYASGRE  1560
             +TPC C   CGK+C C+     CEK+CGC  +CK  F+GCHC K++C +  CPC+A+GRE
Sbjct  574   HTPCGCQSMCGKECSCMSNGTCCEKYCGCSKSCKNRFRGCHCAKSQCRSRQCPCFAAGRE  633

Query  1561  CDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLLGRSDIAGWGAFLKNC  1740
             CDPDVC  CWVSCGDGS+G PP K  + +C NM+LLL  QQ++LLG+SDIAGWGAFLKN 
Sbjct  634   CDPDVCHHCWVSCGDGSLGKPP-KQGDSQCGNMRLLLRQQQRILLGKSDIAGWGAFLKN-  691

Query  1741  VICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQLVIDAYRRGNKLKFIN  1920
                V+KN+++G YTGE+ISH EADK GK+YDR N SFLF+LN+Q V+DAYR+G+KLKF N
Sbjct  692   --PVNKNDYLGEYTGEIISHQEADKRGKIYDRVNSSFLFDLNEQYVLDAYRKGDKLKFAN  749

Query  1921  HSPDPNCFAKV  1953
             HS +PNC AKV
Sbjct  750   HSSNPNCHAKV  760


 Score =   103 bits (258),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 74/151 (49%), Positives = 94/151 (62%), Gaps = 5/151 (3%)
 Frame = +1

Query  889   YTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALicsdsdeeiieeegenef-aesedY  1065
             YTTW FL RNQ+M EDQSV+GRRRIYYD +  EAL+ S SD+E  E E      +  ED 
Sbjct  139   YTTWIFLDRNQRMAEDQSVVGRRRIYYDEDGSEALVYSGSDDEAEEPEKVEHEFSAGEDR  198

Query  1066  ILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLIKEGATSKNENTEVTINSYLDED  1245
             IL M  ++ GL + V++++         E+  RY + IKE  + K E         LD+ 
Sbjct  199   ILLMAFQEHGLGEEVVEVVREFIGVPILEILDRY-NTIKERNSEKREPDGCI---SLDKS  254

Query  1246  LDAALSSFDNLFCQRCFVFNCQLHGCSQDLI  1338
             L AAL SFDNLFC+RC VF+C+LHGCSQ LI
Sbjct  255   LIAALDSFDNLFCRRCLVFDCRLHGCSQPLI  285



>ref|XP_008386717.1| PREDICTED: histone-lysine N-methyltransferase EZA1-like isoform 
X1 [Malus domestica]
Length=822

 Score =   262 bits (670),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 126/219 (58%), Positives = 159/219 (73%), Gaps = 22/219 (10%)
 Frame = +1

Query  1381  YTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKNECATNYCPCYASGRE  1560
             YTPC C   CGK+C C+     CEK+CGC  +CK  F+GCHC K++C +  CPC+A+GRE
Sbjct  574   YTPCXCQSMCGKECSCMSNGTCCEKYCGCSKSCKNRFRGCHCAKSQCRSRQCPCFAAGRE  633

Query  1561  CDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLLGRSDIAGWGAFLKNC  1740
             CDPDVC  CWVSCGDGS+G PP +  + +C NM+LLL  QQ++LLG+SD+AGWGAFLKN 
Sbjct  634   CDPDVCRHCWVSCGDGSLGEPP-RQGDSQCGNMRLLLRQQQRILLGKSDVAGWGAFLKN-  691

Query  1741  VICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQLVIDAYRRGNKLKFIN  1920
                V+KN+++G YTGE+ISH EADK GK+YDR N SFLF+LN+Q V+DAYR+G+KLKF N
Sbjct  692   --PVNKNDYLGEYTGEIISHQEADKRGKIYDRVNSSFLFDLNEQYVLDAYRKGDKLKFAN  749

Query  1921  HSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
             HS +PNC AKV             ++VAG     DHR G
Sbjct  750   HSSNPNCHAKV-------------MLVAG-----DHRVG  770


 Score =   115 bits (289),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 75/151 (50%), Positives = 97/151 (64%), Gaps = 5/151 (3%)
 Frame = +1

Query  889   YTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALicsdsdeeiieeegenef-aesedY  1065
             YTTW FL RNQ+M EDQSV+GRRRIYYD +  EAL+ S +D+E  E E      +  ED 
Sbjct  139   YTTWIFLDRNQRMAEDQSVVGRRRIYYDEDGSEALVYSGTDDEAEEPEEVKHEFSAGEDR  198

Query  1066  ILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLIKEGATSKNENTEVTINSYLDED  1245
             IL M  ++ GL + V++L+        S++ ARY + IKE    K E+        LD+ 
Sbjct  199   ILLMAFQEHGLGEEVVELVKEFIGAPISDILARY-NTIKERNPEKCEHDGCI---SLDKS  254

Query  1246  LDAALSSFDNLFCQRCFVFNCQLHGCSQDLI  1338
             L+AAL SFDNLFC+RC VF+C+LHGCSQ LI
Sbjct  255   LNAALDSFDNLFCRRCLVFDCRLHGCSQPLI  285



>ref|NP_001049899.1| Os03g0307800 [Oryza sativa Japonica Group]
 gb|ABF95544.1| Polycomb protein EZ3, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF11813.1| Os03g0307800 [Oryza sativa Japonica Group]
 gb|EEE58920.1| hypothetical protein OsJ_10569 [Oryza sativa Japonica Group]
Length=895

 Score =   262 bits (670),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 126/234 (54%), Positives = 162/234 (69%), Gaps = 21/234 (9%)
 Frame = +1

Query  1336  IILKQIRVREELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKN  1515
              + K+I   ++    Y PC C   CGK C CV     CEK+CGC  +CK  F+GCHC K+
Sbjct  632   TVRKRIGDGKQWYTQYNPCGCQQMCGKDCACVENGTCCEKYCGCSKSCKNRFRGCHCAKS  691

Query  1516  ECATNYCPCYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLL  1695
             +C +  CPC+A+ RECDPDVC  CWVSCGDGS+G P  +   ++C NMKLLL  QQ++LL
Sbjct  692   QCRSRQCPCFAASRECDPDVCRNCWVSCGDGSLGEPLARGDGYQCGNMKLLLKQQQRILL  751

Query  1696  GRSDIAGWGAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQL  1875
             G+SD+AGWGAF+KN    V++N+++G YTGELISH EADK GK+YDR N SFLF+LN+Q 
Sbjct  752   GKSDVAGWGAFIKN---PVNRNDYLGEYTGELISHREADKRGKIYDRANSSFLFDLNEQY  808

Query  1876  VIDAYRRGNKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
             V+DAYR+G+KLKF NHS +PNC+AKV             ++VAG     DHR G
Sbjct  809   VLDAYRKGDKLKFANHSSNPNCYAKV-------------MLVAG-----DHRVG  844


 Score =   106 bits (265),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 73/187 (39%), Positives = 106/187 (57%), Gaps = 7/187 (4%)
 Frame = +1

Query  889   YTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALi-csdsdeeiieeegenefaesedY  1065
             YTTW FL +NQ+M +DQSV GRRRIYYD    EALI     D+    EE ++ F E ED 
Sbjct  159   YTTWIFLDKNQRMADDQSV-GRRRIYYDPIVNEALICSESDDDVPEPEEEKHVFTEGEDQ  217

Query  1066  ILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLIKEGATSKNENTEVTINSYLDED  1245
             ++    +  GL   VL++L       PSE++ R + L ++       + +  +  +LD+ 
Sbjct  218   LIWKATQDHGLSREVLNVLCQFVDATPSEIEERSEVLFEKYEKQSQSSYKTDLQLFLDKT  277

Query  1246  LDAALSSFDNLFCQRCFVFNCQLHGCSQDLIILKQIRVREELCAHYTPCNC*PHCGKKCP  1425
             +D AL SFDNLFC+RC VF+C+LHGCSQ+L+   +    ++   H    N  P CG +C 
Sbjct  278   MDVALDSFDNLFCRRCLVFDCRLHGCSQNLVFPSE----KQPYGHELDENKRP-CGDQCY  332

Query  1426  CVVKSIY  1446
                + +Y
Sbjct  333   LRRREVY  339


 Score = 57.8 bits (138),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSK  2164
             +++V GDHR+GI+A   + A +EL YDY+Y PD  PAWA+  + S K
Sbjct  834   VMLVAGDHRVGIYAKDRIEASEELFYDYRYGPDQAPAWARRPEGSKK  880



>emb|CAD18871.3| enhancer of zeste protein [Oryza sativa Indica Group]
Length=895

 Score =   262 bits (669),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 126/234 (54%), Positives = 162/234 (69%), Gaps = 21/234 (9%)
 Frame = +1

Query  1336  IILKQIRVREELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKN  1515
              + K+I   ++    Y PC C   CGK C CV     CEK+CGC  +CK  F+GCHC K+
Sbjct  632   TVRKRIGDGKQWYTQYNPCGCQQMCGKDCACVENGTCCEKYCGCSKSCKNRFRGCHCAKS  691

Query  1516  ECATNYCPCYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLL  1695
             +C +  CPC+A+ RECDPDVC  CWVSCGDGS+G P  +   ++C NMKLLL  QQ++LL
Sbjct  692   QCRSRQCPCFAASRECDPDVCRNCWVSCGDGSLGEPLARGDGYQCGNMKLLLKQQQRILL  751

Query  1696  GRSDIAGWGAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQL  1875
             G+SD+AGWGAF+KN    V++N+++G YTGELISH EADK GK+YDR N SFLF+LN+Q 
Sbjct  752   GKSDVAGWGAFIKN---PVNRNDYLGEYTGELISHREADKRGKIYDRANSSFLFDLNEQY  808

Query  1876  VIDAYRRGNKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
             V+DAYR+G+KLKF NHS +PNC+AKV             ++VAG     DHR G
Sbjct  809   VLDAYRKGDKLKFANHSSNPNCYAKV-------------MLVAG-----DHRVG  844


 Score = 99.0 bits (245),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 63/152 (41%), Positives = 90/152 (59%), Gaps = 2/152 (1%)
 Frame = +1

Query  889   YTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALi-csdsdeeiieeegenefaesedY  1065
             YTTW FL +NQ+M +DQ ++ RRRIYYD    EALI     D+    EE ++ F E ED 
Sbjct  159   YTTWIFLDKNQRMADDQ-LVCRRRIYYDPIVNEALICSESDDDVPEPEEEKHVFTEGEDQ  217

Query  1066  ILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLIKEGATSKNENTEVTINSYLDED  1245
             ++    +  GL   VL++L       PSE++ R + L ++       + E     +L + 
Sbjct  218   LIWKATQDHGLSREVLNVLCQFVDATPSEIEERSEVLFEKYEKQSQSSYETDFQLFLGKT  277

Query  1246  LDAALSSFDNLFCQRCFVFNCQLHGCSQDLII  1341
             +D AL SFDNLFC+RC VF+C+LHGCSQ+L+ 
Sbjct  278   MDVALDSFDNLFCRRCLVFDCRLHGCSQNLVF  309


 Score = 57.8 bits (138),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSK  2164
             +++V GDHR+GI+A   + A +EL YDY+Y PD  PAWA+  + S K
Sbjct  834   VMLVAGDHRVGIYAKDRIEASEELFYDYRYGPDQAPAWARRPEGSKK  880



>emb|CDP17065.1| unnamed protein product [Coffea canephora]
Length=867

 Score =   261 bits (667),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 130/247 (53%), Positives = 164/247 (66%), Gaps = 43/247 (17%)
 Frame = +1

Query  1360  REELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKNECATNYCP  1539
             + + C  YTPC C P CGK+CPC+     CEK+CGC  +CK  F+GCHC K++C +  CP
Sbjct  591   KNQSCKQYTPCGCQPICGKQCPCLQNGTCCEKYCGCSKSCKNRFRGCHCAKSQCRSRQCP  650

Query  1540  CYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLLGRSDIAGW  1719
             C+A+GRECDPDVC  CWVSCGDGS+G PP +  + +C NM+LLL  QQ++LL +SD+AGW
Sbjct  651   CFAAGRECDPDVCRNCWVSCGDGSLGEPP-RQGDGQCGNMRLLLRQQQRILLAKSDVAGW  709

Query  1720  GAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQ---------  1872
             GAFLKN    V+KN+++G YTGELISH EADK GK+YDR N SFLF+LNDQ         
Sbjct  710   GAFLKN---PVNKNDYLGEYTGELISHREADKRGKIYDRANSSFLFDLNDQARHELLVKR  766

Query  1873  ------------LVIDAYRRGNKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSF  2016
                          V+DAYR+G+KLKF NHS +PNC+AKV             ++VAG   
Sbjct  767   NCESIPTNCYLDYVLDAYRKGDKLKFANHSANPNCYAKV-------------ILVAG---  810

Query  2017  SIDHRSG  2037
               DHR G
Sbjct  811   --DHRVG  815


 Score =   116 bits (291),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 77/157 (49%), Positives = 101/157 (64%), Gaps = 7/157 (4%)
 Frame = +1

Query  889   YTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALi-csdsdeeiieeegenefaesedY  1065
             YTTW FL +NQ+M EDQSV+GRRRIYYD +  EALI     +E +  EE ++EF+E+ED 
Sbjct  134   YTTWIFLDKNQRMAEDQSVVGRRRIYYDPHGSEALICSDSEEEMVAPEEEKHEFSEAEDR  193

Query  1066  ILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLIKEGATSKNEN------TEVTIN  1227
             IL MT  + GL + VL +L        SE++ R   L +E     N+N      TE   +
Sbjct  194   ILWMTFTEYGLDEEVLKILIQFVGGTTSEIQERCNMLNEENQARLNKNLLGSEKTESEES  253

Query  1228  SYLDEDLDAALSSFDNLFCQRCFVFNCQLHGCSQDLI  1338
             ++L + L AAL SFDNLFC+RC VF+C+LHGCSQ LI
Sbjct  254   AFLGKRLSAALDSFDNLFCRRCLVFDCRLHGCSQILI  290


 Score = 57.0 bits (136),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 23/45 (51%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSS  2158
             +I+V GDHR+GIFA + + A +EL YDY+Y PD  P WA+  + S
Sbjct  805   VILVAGDHRVGIFANQHIGASEELFYDYRYGPDQAPIWARKPEGS  849



>gb|KHN30637.1| Histone-lysine N-methyltransferase EZA1 [Glycine soja]
Length=872

 Score =   261 bits (667),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 129/228 (57%), Positives = 161/228 (71%), Gaps = 24/228 (11%)
 Frame = +1

Query  1360  REELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKNECATNYCP  1539
             + + C  YTPC C   CGK+C CV     CEK+CGC  +CK  F+GCHC K++C +  CP
Sbjct  615   KNQSCKQYTPCGCQSMCGKECTCVNGGTCCEKYCGCSKSCKNRFRGCHCAKSQCRSRQCP  674

Query  1540  CYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLLGRSDIAGW  1719
             C+A+GRECDPDVC  CWVSCGDGS+G PP +    +C NM+LLL  QQ++LL +SD+AGW
Sbjct  675   CFAAGRECDPDVCRNCWVSCGDGSLGEPP-RRGEGQCGNMRLLLRQQQRILLSKSDVAGW  733

Query  1720  GAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQ--LVIDAYR  1893
             GAFLKN    V+KN+++G YTGELISH EADK GK+YDR N SFLF+LNDQ   V+DAYR
Sbjct  734   GAFLKN---PVNKNDYLGEYTGELISHREADKRGKIYDRANSSFLFDLNDQASYVLDAYR  790

Query  1894  RGNKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
             +G+KLKF NHS +PNC+AKV             ++VAG     DHR G
Sbjct  791   KGDKLKFANHSSNPNCYAKV-------------MLVAG-----DHRVG  820


 Score =   114 bits (284),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 75/158 (47%), Positives = 102/158 (65%), Gaps = 9/158 (6%)
 Frame = +1

Query  889   YTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALi-csdsdeeiieeegenefaesedY  1065
             YT+W FL RNQ+M EDQSV+GRRRIYYD +  EALI     +E    EE ++EF+E+ED 
Sbjct  130   YTSWIFLDRNQRMAEDQSVVGRRRIYYDQHGSEALICSDSEEELTGPEEEKHEFSEAEDR  189

Query  1066  ILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLIKEGATSK----NENT---EVTI  1224
             ++ M  E+ GL D VL++++        E++ RYK  IKE    +    +EN+   E  I
Sbjct  190   VIWMAFEEYGLNDEVLNIVSEFVGGTSLEIQERYK-TIKEKNIGRLDQPSENSGEYESII  248

Query  1225  NSYLDEDLDAALSSFDNLFCQRCFVFNCQLHGCSQDLI  1338
                 ++ L AAL SFDNLFC+RC +F+C+LHGCSQ LI
Sbjct  249   GICPEKSLSAALDSFDNLFCRRCLIFDCRLHGCSQPLI  286


 Score = 57.8 bits (138),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 22/47 (47%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSK  2164
             +++V GDHR+GIFA + ++A +EL YDY+Y PD  P WA+  + S +
Sbjct  810   VMLVAGDHRVGIFAKEHIDASEELFYDYRYGPDQAPPWARKPEGSKR  856



>gb|KHN08633.1| Histone-lysine N-methyltransferase EZA1 [Glycine soja]
Length=870

 Score =   261 bits (666),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 128/228 (56%), Positives = 161/228 (71%), Gaps = 24/228 (11%)
 Frame = +1

Query  1360  REELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKNECATNYCP  1539
             + + C  YTPC C   CGK+C C+     CEK+CGC  +CK  F+GCHC K++C +  CP
Sbjct  613   KNQSCKQYTPCGCQSMCGKECTCINGGTCCEKYCGCSKSCKNRFRGCHCAKSQCRSRQCP  672

Query  1540  CYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLLGRSDIAGW  1719
             C+A+GRECDPDVC  CWVSCGDGS+G PP +    +C NM+LLL  QQ++LL +SD+AGW
Sbjct  673   CFAAGRECDPDVCRNCWVSCGDGSLGEPPRR-GEGQCGNMRLLLRQQQRILLAKSDVAGW  731

Query  1720  GAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQ--LVIDAYR  1893
             GAFLKN    V+KN+++G YTGELISH EADK GK+YDR N SFLF+LNDQ   V+DAYR
Sbjct  732   GAFLKN---PVNKNDYLGEYTGELISHREADKRGKIYDRANSSFLFDLNDQASYVLDAYR  788

Query  1894  RGNKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
             +G+KLKF NHS +PNC+AKV             ++VAG     DHR G
Sbjct  789   KGDKLKFANHSSNPNCYAKV-------------MLVAG-----DHRVG  818


 Score =   112 bits (280),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 74/158 (47%), Positives = 102/158 (65%), Gaps = 9/158 (6%)
 Frame = +1

Query  889   YTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALi-csdsdeeiieeegenefaesedY  1065
             YT+W FL RNQ+M EDQSV+GRRRIYYD +  EALI     +E    EE ++EF+E+ED 
Sbjct  130   YTSWIFLDRNQRMAEDQSVVGRRRIYYDQHGSEALICSDSEEELTEPEEEKHEFSEAEDR  189

Query  1066  ILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLIKEGATSK----NENT---EVTI  1224
             ++ M  E+ GL   V ++++        E++ RYK  IKE    +    ++N+   E TI
Sbjct  190   VIWMAFEEYGLNKEVPNIVSEFVGGTSLEIQERYK-TIKEKNIGRLDQPSQNSGEYESTI  248

Query  1225  NSYLDEDLDAALSSFDNLFCQRCFVFNCQLHGCSQDLI  1338
                L++ L AAL SFDNLFC+RC +F+C+LHGCSQ LI
Sbjct  249   GICLEKSLSAALDSFDNLFCRRCLIFDCRLHGCSQPLI  286


 Score = 57.8 bits (138),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 22/47 (47%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSK  2164
             +++V GDHR+GIFA + ++A +EL YDY+Y PD  P WA+  + S +
Sbjct  808   VMLVAGDHRVGIFAKEHIDASEELFYDYRYGPDQAPPWARKPEGSKR  854



>gb|KEH43199.1| histone-lysine N-methyltransferase [Medicago truncatula]
Length=631

 Score =   256 bits (654),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 124/226 (55%), Positives = 160/226 (71%), Gaps = 22/226 (10%)
 Frame = +1

Query  1360  REELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKNECATNYCP  1539
             + + C  YTPC C   CGK C C+     CEK+CGC  +CK  F+GCHC K++C +  CP
Sbjct  376   KNQSCMQYTPCGCQSMCGKDCSCLNGGTCCEKYCGCSKSCKNRFRGCHCAKSQCRSRQCP  435

Query  1540  CYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLLGRSDIAGW  1719
             C+A+GRECDPDVC  CWVSCGDG++G  P +    +C NM+LLL  QQ+++LG+SD++GW
Sbjct  436   CFAAGRECDPDVCRNCWVSCGDGTLG-EPHRRGEGQCGNMRLLLRQQQRIILGKSDVSGW  494

Query  1720  GAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQLVIDAYRRG  1899
             GAFLKN    V+KN+++G YTGELISH EADK GK+YDR N SFLF+LN+Q V+DAYR+G
Sbjct  495   GAFLKN---PVNKNDYLGEYTGELISHREADKRGKIYDRANSSFLFDLNEQYVLDAYRKG  551

Query  1900  NKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
             +KLKF NHS +PNC+AKV             ++VAG     DHR G
Sbjct  552   DKLKFANHSSNPNCYAKV-------------MLVAG-----DHRVG  579


 Score = 70.9 bits (172),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 40/114 (35%), Positives = 64/114 (56%), Gaps = 9/114 (8%)
 Frame = +1

Query  1075  MTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDL-------IKEGATSKNENTEVTINSY  1233
             M  E+ GL + VL++++ +      E++ RYK +       + +   S  E+ E  ++ Y
Sbjct  1     MAFEEHGLNEEVLNVVSKYVGGTSLEIQERYKSIRGSNIGRLDQHPKSSGEH-EFPMSMY  59

Query  1234  LDEDLDAALSSFDNLFCQRCFVFNCQLHGCSQDLIILKQIR-VREELCAHYTPC  1392
             L+++L  AL S DNLFC+RC +F+C+LHGCSQ LI   + + V  E      PC
Sbjct  60    LEKNLSDALDSLDNLFCRRCLIFDCRLHGCSQPLIYPSEKKTVWSEPVGDRKPC  113


 Score = 58.2 bits (139),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSK  2164
             +++V GDHR+GIFA + ++AG+EL YDY Y PD  P WA+  + S +
Sbjct  569   VMLVAGDHRVGIFAKEHIDAGEELFYDYCYGPDQAPPWARKPEGSKR  615



>gb|KEH43197.1| histone-lysine N-methyltransferase [Medicago truncatula]
Length=759

 Score =   257 bits (657),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 124/226 (55%), Positives = 160/226 (71%), Gaps = 22/226 (10%)
 Frame = +1

Query  1360  REELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKNECATNYCP  1539
             + + C  YTPC C   CGK C C+     CEK+CGC  +CK  F+GCHC K++C +  CP
Sbjct  504   KNQSCMQYTPCGCQSMCGKDCSCLNGGTCCEKYCGCSKSCKNRFRGCHCAKSQCRSRQCP  563

Query  1540  CYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLLGRSDIAGW  1719
             C+A+GRECDPDVC  CWVSCGDG++G  P +    +C NM+LLL  QQ+++LG+SD++GW
Sbjct  564   CFAAGRECDPDVCRNCWVSCGDGTLG-EPHRRGEGQCGNMRLLLRQQQRIILGKSDVSGW  622

Query  1720  GAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQLVIDAYRRG  1899
             GAFLKN    V+KN+++G YTGELISH EADK GK+YDR N SFLF+LN+Q V+DAYR+G
Sbjct  623   GAFLKN---PVNKNDYLGEYTGELISHREADKRGKIYDRANSSFLFDLNEQYVLDAYRKG  679

Query  1900  NKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
             +KLKF NHS +PNC+AKV             ++VAG     DHR G
Sbjct  680   DKLKFANHSSNPNCYAKV-------------MLVAG-----DHRVG  707


 Score =   112 bits (279),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 78/177 (44%), Positives = 111/177 (63%), Gaps = 10/177 (6%)
 Frame = +1

Query  889   YTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALicsdsdeeiieeegenefa-esedY  1065
             YT+W FL RNQ+M +DQSV+GRRRIYYD    EALICSDS+EE+ E +GE     ++ED 
Sbjct  66    YTSWIFLDRNQRMADDQSVVGRRRIYYDQRGSEALICSDSEEELTEPDGEKHEFCDAEDR  125

Query  1066  ILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDL-------IKEGATSKNENTEVTI  1224
             IL M  E+ GL + VL++++ +      E++ RYK +       + +   S  E+ E  +
Sbjct  126   ILCMAFEEHGLNEEVLNVVSKYVGGTSLEIQERYKSIRGSNIGRLDQHPKSSGEH-EFPM  184

Query  1225  NSYLDEDLDAALSSFDNLFCQRCFVFNCQLHGCSQDLIILKQIR-VREELCAHYTPC  1392
             + YL+++L  AL S DNLFC+RC +F+C+LHGCSQ LI   + + V  E      PC
Sbjct  185   SMYLEKNLSDALDSLDNLFCRRCLIFDCRLHGCSQPLIYPSEKKTVWSEPVGDRKPC  241


 Score = 58.2 bits (139),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSK  2164
             +++V GDHR+GIFA + ++AG+EL YDY Y PD  P WA+  + S +
Sbjct  697   VMLVAGDHRVGIFAKEHIDAGEELFYDYCYGPDQAPPWARKPEGSKR  743



>gb|KEH43204.1| histone-lysine N-methyltransferase [Medicago truncatula]
Length=780

 Score =   258 bits (658),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 124/226 (55%), Positives = 160/226 (71%), Gaps = 22/226 (10%)
 Frame = +1

Query  1360  REELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKNECATNYCP  1539
             + + C  YTPC C   CGK C C+     CEK+CGC  +CK  F+GCHC K++C +  CP
Sbjct  525   KNQSCMQYTPCGCQSMCGKDCSCLNGGTCCEKYCGCSKSCKNRFRGCHCAKSQCRSRQCP  584

Query  1540  CYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLLGRSDIAGW  1719
             C+A+GRECDPDVC  CWVSCGDG++G  P +    +C NM+LLL  QQ+++LG+SD++GW
Sbjct  585   CFAAGRECDPDVCRNCWVSCGDGTLG-EPHRRGEGQCGNMRLLLRQQQRIILGKSDVSGW  643

Query  1720  GAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQLVIDAYRRG  1899
             GAFLKN    V+KN+++G YTGELISH EADK GK+YDR N SFLF+LN+Q V+DAYR+G
Sbjct  644   GAFLKN---PVNKNDYLGEYTGELISHREADKRGKIYDRANSSFLFDLNEQYVLDAYRKG  700

Query  1900  NKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
             +KLKF NHS +PNC+AKV             ++VAG     DHR G
Sbjct  701   DKLKFANHSSNPNCYAKV-------------MLVAG-----DHRVG  728


 Score =   112 bits (279),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 78/177 (44%), Positives = 111/177 (63%), Gaps = 10/177 (6%)
 Frame = +1

Query  889   YTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALicsdsdeeiieeegenefa-esedY  1065
             YT+W FL RNQ+M +DQSV+GRRRIYYD    EALICSDS+EE+ E +GE     ++ED 
Sbjct  87    YTSWIFLDRNQRMADDQSVVGRRRIYYDQRGSEALICSDSEEELTEPDGEKHEFCDAEDR  146

Query  1066  ILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDL-------IKEGATSKNENTEVTI  1224
             IL M  E+ GL + VL++++ +      E++ RYK +       + +   S  E+ E  +
Sbjct  147   ILCMAFEEHGLNEEVLNVVSKYVGGTSLEIQERYKSIRGSNIGRLDQHPKSSGEH-EFPM  205

Query  1225  NSYLDEDLDAALSSFDNLFCQRCFVFNCQLHGCSQDLIILKQIR-VREELCAHYTPC  1392
             + YL+++L  AL S DNLFC+RC +F+C+LHGCSQ LI   + + V  E      PC
Sbjct  206   SMYLEKNLSDALDSLDNLFCRRCLIFDCRLHGCSQPLIYPSEKKTVWSEPVGDRKPC  262


 Score = 58.5 bits (140),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSK  2164
             +++V GDHR+GIFA + ++AG+EL YDY Y PD  P WA+  + S +
Sbjct  718   VMLVAGDHRVGIFAKEHIDAGEELFYDYCYGPDQAPPWARKPEGSKR  764



>gb|AES61647.2| histone-lysine N-methyltransferase [Medicago truncatula]
Length=831

 Score =   258 bits (660),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 124/226 (55%), Positives = 160/226 (71%), Gaps = 22/226 (10%)
 Frame = +1

Query  1360  REELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKNECATNYCP  1539
             + + C  YTPC C   CGK C C+     CEK+CGC  +CK  F+GCHC K++C +  CP
Sbjct  576   KNQSCMQYTPCGCQSMCGKDCSCLNGGTCCEKYCGCSKSCKNRFRGCHCAKSQCRSRQCP  635

Query  1540  CYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLLGRSDIAGW  1719
             C+A+GRECDPDVC  CWVSCGDG++G  P +    +C NM+LLL  QQ+++LG+SD++GW
Sbjct  636   CFAAGRECDPDVCRNCWVSCGDGTLG-EPHRRGEGQCGNMRLLLRQQQRIILGKSDVSGW  694

Query  1720  GAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQLVIDAYRRG  1899
             GAFLKN    V+KN+++G YTGELISH EADK GK+YDR N SFLF+LN+Q V+DAYR+G
Sbjct  695   GAFLKN---PVNKNDYLGEYTGELISHREADKRGKIYDRANSSFLFDLNEQYVLDAYRKG  751

Query  1900  NKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
             +KLKF NHS +PNC+AKV             ++VAG     DHR G
Sbjct  752   DKLKFANHSSNPNCYAKV-------------MLVAG-----DHRVG  779


 Score =   112 bits (279),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 78/177 (44%), Positives = 111/177 (63%), Gaps = 10/177 (6%)
 Frame = +1

Query  889   YTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALicsdsdeeiieeegenefa-esedY  1065
             YT+W FL RNQ+M +DQSV+GRRRIYYD    EALICSDS+EE+ E +GE     ++ED 
Sbjct  138   YTSWIFLDRNQRMADDQSVVGRRRIYYDQRGSEALICSDSEEELTEPDGEKHEFCDAEDR  197

Query  1066  ILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDL-------IKEGATSKNENTEVTI  1224
             IL M  E+ GL + VL++++ +      E++ RYK +       + +   S  E+ E  +
Sbjct  198   ILCMAFEEHGLNEEVLNVVSKYVGGTSLEIQERYKSIRGSNIGRLDQHPKSSGEH-EFPM  256

Query  1225  NSYLDEDLDAALSSFDNLFCQRCFVFNCQLHGCSQDLIILKQIR-VREELCAHYTPC  1392
             + YL+++L  AL S DNLFC+RC +F+C+LHGCSQ LI   + + V  E      PC
Sbjct  257   SMYLEKNLSDALDSLDNLFCRRCLIFDCRLHGCSQPLIYPSEKKTVWSEPVGDRKPC  313


 Score = 58.5 bits (140),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSK  2164
             +++V GDHR+GIFA + ++AG+EL YDY Y PD  P WA+  + S +
Sbjct  769   VMLVAGDHRVGIFAKEHIDAGEELFYDYCYGPDQAPPWARKPEGSKR  815



>ref|XP_003591396.1| Histone-lysine N-methyltransferase EZA1 [Medicago truncatula]
Length=829

 Score =   258 bits (660),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 124/226 (55%), Positives = 160/226 (71%), Gaps = 22/226 (10%)
 Frame = +1

Query  1360  REELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKNECATNYCP  1539
             + + C  YTPC C   CGK C C+     CEK+CGC  +CK  F+GCHC K++C +  CP
Sbjct  574   KNQSCMQYTPCGCQSMCGKDCSCLNGGTCCEKYCGCSKSCKNRFRGCHCAKSQCRSRQCP  633

Query  1540  CYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLLGRSDIAGW  1719
             C+A+GRECDPDVC  CWVSCGDG++G  P +    +C NM+LLL  QQ+++LG+SD++GW
Sbjct  634   CFAAGRECDPDVCRNCWVSCGDGTLG-EPHRRGEGQCGNMRLLLRQQQRIILGKSDVSGW  692

Query  1720  GAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQLVIDAYRRG  1899
             GAFLKN    V+KN+++G YTGELISH EADK GK+YDR N SFLF+LN+Q V+DAYR+G
Sbjct  693   GAFLKN---PVNKNDYLGEYTGELISHREADKRGKIYDRANSSFLFDLNEQYVLDAYRKG  749

Query  1900  NKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
             +KLKF NHS +PNC+AKV             ++VAG     DHR G
Sbjct  750   DKLKFANHSSNPNCYAKV-------------MLVAG-----DHRVG  777


 Score =   112 bits (279),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 78/177 (44%), Positives = 111/177 (63%), Gaps = 10/177 (6%)
 Frame = +1

Query  889   YTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALicsdsdeeiieeegenefa-esedY  1065
             YT+W FL RNQ+M +DQSV+GRRRIYYD    EALICSDS+EE+ E +GE     ++ED 
Sbjct  136   YTSWIFLDRNQRMADDQSVVGRRRIYYDQRGSEALICSDSEEELTEPDGEKHEFCDAEDR  195

Query  1066  ILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDL-------IKEGATSKNENTEVTI  1224
             IL M  E+ GL + VL++++ +      E++ RYK +       + +   S  E+ E  +
Sbjct  196   ILCMAFEEHGLNEEVLNVVSKYVGGTSLEIQERYKSIRGSNIGRLDQHPKSSGEH-EFPM  254

Query  1225  NSYLDEDLDAALSSFDNLFCQRCFVFNCQLHGCSQDLIILKQIR-VREELCAHYTPC  1392
             + YL+++L  AL S DNLFC+RC +F+C+LHGCSQ LI   + + V  E      PC
Sbjct  255   SMYLEKNLSDALDSLDNLFCRRCLIFDCRLHGCSQPLIYPSEKKTVWSEPVGDRKPC  311


 Score = 58.5 bits (140),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSK  2164
             +++V GDHR+GIFA + ++AG+EL YDY Y PD  P WA+  + S +
Sbjct  767   VMLVAGDHRVGIFAKEHIDAGEELFYDYCYGPDQAPPWARKPEGSKR  813



>gb|KEH43196.1| histone-lysine N-methyltransferase [Medicago truncatula]
Length=811

 Score =   258 bits (659),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 124/226 (55%), Positives = 160/226 (71%), Gaps = 22/226 (10%)
 Frame = +1

Query  1360  REELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKNECATNYCP  1539
             + + C  YTPC C   CGK C C+     CEK+CGC  +CK  F+GCHC K++C +  CP
Sbjct  556   KNQSCMQYTPCGCQSMCGKDCSCLNGGTCCEKYCGCSKSCKNRFRGCHCAKSQCRSRQCP  615

Query  1540  CYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLLGRSDIAGW  1719
             C+A+GRECDPDVC  CWVSCGDG++G  P +    +C NM+LLL  QQ+++LG+SD++GW
Sbjct  616   CFAAGRECDPDVCRNCWVSCGDGTLG-EPHRRGEGQCGNMRLLLRQQQRIILGKSDVSGW  674

Query  1720  GAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQLVIDAYRRG  1899
             GAFLKN    V+KN+++G YTGELISH EADK GK+YDR N SFLF+LN+Q V+DAYR+G
Sbjct  675   GAFLKN---PVNKNDYLGEYTGELISHREADKRGKIYDRANSSFLFDLNEQYVLDAYRKG  731

Query  1900  NKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
             +KLKF NHS +PNC+AKV             ++VAG     DHR G
Sbjct  732   DKLKFANHSSNPNCYAKV-------------MLVAG-----DHRVG  759


 Score =   112 bits (279),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 78/177 (44%), Positives = 111/177 (63%), Gaps = 10/177 (6%)
 Frame = +1

Query  889   YTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALicsdsdeeiieeegenefa-esedY  1065
             YT+W FL RNQ+M +DQSV+GRRRIYYD    EALICSDS+EE+ E +GE     ++ED 
Sbjct  118   YTSWIFLDRNQRMADDQSVVGRRRIYYDQRGSEALICSDSEEELTEPDGEKHEFCDAEDR  177

Query  1066  ILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDL-------IKEGATSKNENTEVTI  1224
             IL M  E+ GL + VL++++ +      E++ RYK +       + +   S  E+ E  +
Sbjct  178   ILCMAFEEHGLNEEVLNVVSKYVGGTSLEIQERYKSIRGSNIGRLDQHPKSSGEH-EFPM  236

Query  1225  NSYLDEDLDAALSSFDNLFCQRCFVFNCQLHGCSQDLIILKQIR-VREELCAHYTPC  1392
             + YL+++L  AL S DNLFC+RC +F+C+LHGCSQ LI   + + V  E      PC
Sbjct  237   SMYLEKNLSDALDSLDNLFCRRCLIFDCRLHGCSQPLIYPSEKKTVWSEPVGDRKPC  293


 Score = 58.5 bits (140),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSK  2164
             +++V GDHR+GIFA + ++AG+EL YDY Y PD  P WA+  + S +
Sbjct  749   VMLVAGDHRVGIFAKEHIDAGEELFYDYCYGPDQAPPWARKPEGSKR  795



>gb|KEH43202.1| histone-lysine N-methyltransferase [Medicago truncatula]
Length=821

 Score =   258 bits (659),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 124/226 (55%), Positives = 160/226 (71%), Gaps = 22/226 (10%)
 Frame = +1

Query  1360  REELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKNECATNYCP  1539
             + + C  YTPC C   CGK C C+     CEK+CGC  +CK  F+GCHC K++C +  CP
Sbjct  566   KNQSCMQYTPCGCQSMCGKDCSCLNGGTCCEKYCGCSKSCKNRFRGCHCAKSQCRSRQCP  625

Query  1540  CYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLLGRSDIAGW  1719
             C+A+GRECDPDVC  CWVSCGDG++G  P +    +C NM+LLL  QQ+++LG+SD++GW
Sbjct  626   CFAAGRECDPDVCRNCWVSCGDGTLG-EPHRRGEGQCGNMRLLLRQQQRIILGKSDVSGW  684

Query  1720  GAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQLVIDAYRRG  1899
             GAFLKN    V+KN+++G YTGELISH EADK GK+YDR N SFLF+LN+Q V+DAYR+G
Sbjct  685   GAFLKN---PVNKNDYLGEYTGELISHREADKRGKIYDRANSSFLFDLNEQYVLDAYRKG  741

Query  1900  NKLKFINHSPDPNCFAKVNCSLSPCLLQCFQLIVAGGSFSIDHRSG  2037
             +KLKF NHS +PNC+AKV             ++VAG     DHR G
Sbjct  742   DKLKFANHSSNPNCYAKV-------------MLVAG-----DHRVG  769


 Score =   112 bits (279),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 78/177 (44%), Positives = 111/177 (63%), Gaps = 10/177 (6%)
 Frame = +1

Query  889   YTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALicsdsdeeiieeegenefa-esedY  1065
             YT+W FL RNQ+M +DQSV+GRRRIYYD    EALICSDS+EE+ E +GE     ++ED 
Sbjct  128   YTSWIFLDRNQRMADDQSVVGRRRIYYDQRGSEALICSDSEEELTEPDGEKHEFCDAEDR  187

Query  1066  ILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDL-------IKEGATSKNENTEVTI  1224
             IL M  E+ GL + VL++++ +      E++ RYK +       + +   S  E+ E  +
Sbjct  188   ILCMAFEEHGLNEEVLNVVSKYVGGTSLEIQERYKSIRGSNIGRLDQHPKSSGEH-EFPM  246

Query  1225  NSYLDEDLDAALSSFDNLFCQRCFVFNCQLHGCSQDLIILKQIR-VREELCAHYTPC  1392
             + YL+++L  AL S DNLFC+RC +F+C+LHGCSQ LI   + + V  E      PC
Sbjct  247   SMYLEKNLSDALDSLDNLFCRRCLIFDCRLHGCSQPLIYPSEKKTVWSEPVGDRKPC  303


 Score = 58.5 bits (140),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSK  2164
             +++V GDHR+GIFA + ++AG+EL YDY Y PD  P WA+  + S +
Sbjct  759   VMLVAGDHRVGIFAKEHIDAGEELFYDYCYGPDQAPPWARKPEGSKR  805



>gb|KEH43200.1| histone-lysine N-methyltransferase [Medicago truncatula]
Length=763

 Score =   256 bits (655),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 117/202 (58%), Positives = 152/202 (75%), Gaps = 4/202 (2%)
 Frame = +1

Query  1360  REELCAHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKNECATNYCP  1539
             + + C  YTPC C   CGK C C+     CEK+CGC  +CK  F+GCHC K++C +  CP
Sbjct  566   KNQSCMQYTPCGCQSMCGKDCSCLNGGTCCEKYCGCSKSCKNRFRGCHCAKSQCRSRQCP  625

Query  1540  CYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLLGRSDIAGW  1719
             C+A+GRECDPDVC  CWVSCGDG++G  P +    +C NM+LLL  QQ+++LG+SD++GW
Sbjct  626   CFAAGRECDPDVCRNCWVSCGDGTLG-EPHRRGEGQCGNMRLLLRQQQRIILGKSDVSGW  684

Query  1720  GAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQLVIDAYRRG  1899
             GAFLKN    V+KN+++G YTGELISH EADK GK+YDR N SFLF+LN+Q V+DAYR+G
Sbjct  685   GAFLKN---PVNKNDYLGEYTGELISHREADKRGKIYDRANSSFLFDLNEQYVLDAYRKG  741

Query  1900  NKLKFINHSPDPNCFAKVNCSL  1965
             +KLKF NHS +PNC+AK+   L
Sbjct  742   DKLKFANHSSNPNCYAKLERDL  763


 Score =   112 bits (279),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 78/177 (44%), Positives = 111/177 (63%), Gaps = 10/177 (6%)
 Frame = +1

Query  889   YTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALicsdsdeeiieeegenefa-esedY  1065
             YT+W FL RNQ+M +DQSV+GRRRIYYD    EALICSDS+EE+ E +GE     ++ED 
Sbjct  128   YTSWIFLDRNQRMADDQSVVGRRRIYYDQRGSEALICSDSEEELTEPDGEKHEFCDAEDR  187

Query  1066  ILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDL-------IKEGATSKNENTEVTI  1224
             IL M  E+ GL + VL++++ +      E++ RYK +       + +   S  E+ E  +
Sbjct  188   ILCMAFEEHGLNEEVLNVVSKYVGGTSLEIQERYKSIRGSNIGRLDQHPKSSGEH-EFPM  246

Query  1225  NSYLDEDLDAALSSFDNLFCQRCFVFNCQLHGCSQDLIILKQIR-VREELCAHYTPC  1392
             + YL+++L  AL S DNLFC+RC +F+C+LHGCSQ LI   + + V  E      PC
Sbjct  247   SMYLEKNLSDALDSLDNLFCRRCLIFDCRLHGCSQPLIYPSEKKTVWSEPVGDRKPC  303



>ref|XP_006590684.1| PREDICTED: LOW QUALITY PROTEIN: histone-lysine N-methyltransferase 
EZ1-like [Glycine max]
Length=786

 Score =   234 bits (596),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 116/204 (57%), Positives = 145/204 (71%), Gaps = 5/204 (2%)
 Frame = +1

Query  1345  KQIRVREELC-AHYTPCNC*PHCGKKCPCVVKSIYCEKFCGCPLNCKI*FQGCHCTKNEC  1521
             ++I   + LC   YTPC C   CGK+C C+V    CEK+CGC  +C   F+GC CTK++C
Sbjct  519   RKIAYGQNLCNKQYTPCGCHGICGKECSCLVNGTCCEKYCGCSKHCSNRFRGCRCTKSQC  578

Query  1522  ATNYCPCYASGRECDPDVCCFCWVSCGDGSIGIPPDKVSNHKCQNMKLLLGHQQKVLLGR  1701
              +  CPC+A+ RECDPDVC  CWVSCGD S+G  P +  + KC NM LLLG ++++LL +
Sbjct  579   KSRSCPCFAANRECDPDVCQNCWVSCGDDSLGRLP-RHEDAKCGNMNLLLGQKERILLAK  637

Query  1702  SDIAGWGAFLKNCVICVSKNEFIGGYTGELISHFEADKHGKVYDRQNCSFLFNLNDQLVI  1881
             SD+ GWGAF KN    +SKN  +G YTGELI   EA+K GK+YDR N SFLFNLNDQ VI
Sbjct  638   SDVIGWGAFAKN---PISKNVCLGEYTGELIPPKEAEKRGKLYDRINTSFLFNLNDQWVI  694

Query  1882  DAYRRGNKLKFINHSPDPNCFAKV  1953
             DA+R G+KLKF NHS  PNC+AKV
Sbjct  695   DAFRMGDKLKFANHSSKPNCYAKV  718


 Score = 60.1 bits (144),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 36/48 (75%), Gaps = 0/48 (0%)
 Frame = +2

Query  2024  IIVVGGDHRLGIFALKDMNAGDELLYDYQYDPDTCPAWAKDLQSSSKK  2167
             +++VGGDHR+GIFA +++ AGDE+ YDY YD D+ P WA     ++KK
Sbjct  718   VMLVGGDHRVGIFARENIKAGDEIFYDYGYDLDSAPLWALPPNEAAKK  765


 Score = 82.0 bits (201),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 52/159 (33%), Positives = 96/159 (60%), Gaps = 9/159 (6%)
 Frame = +1

Query  889   YTTWAFLHRNQKMPEDQSVIGRRRIYYDMNSGEALi-csdsdeeiieeegenefaesedY  1065
             YT+W ++ RN++M +DQSVIG+ ++Y+D N GE +I   + +E +  E+ ++EF E ED 
Sbjct  129   YTSWVYVARNERMVDDQSVIGKYQMYHDKNKGEMVICSDNEEEIVDPEDVKHEFTEVEDK  188

Query  1066  ILRMTIEKVGLYDMVLDLLANHFSRKPSEVKARYKDLIKEGATSKNEN--------TEVT  1221
              LRMT+E+ G  + VL+++        SE++ RY+ L ++     +++         E  
Sbjct  189   FLRMTLEEYGCTEEVLNVVKKFVKTTNSEIQERYEKLKEKNMEILDQHCEDCHCRGCENH  248

Query  1222  INSYLDEDLDAALSSFDNLFCQRCFVFNCQLHGCSQDLI  1338
             +   L++ L   L +F+NL C++C +F+C +HG ++ L+
Sbjct  249   LGLCLEKSLSVTLETFNNLLCRQCLIFDCPMHGINKPLV  287



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 7968885068208