BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c24249_g4_i3 len=3047 path=[5675:0-1043 12560:1044-1044
6718:1045-1757 1804:1758-2799 8565:2800-3046]

Length=3047
                                                                      Score     E

ref|XP_011077784.1|  PREDICTED: ABC transporter G family member 22      994   0.0      
ref|XP_009622617.1|  PREDICTED: ABC transporter G family member 2...    989   0.0      
ref|XP_009796795.1|  PREDICTED: ABC transporter G family member 2...    988   0.0      
ref|XP_002322764.1|  ABC transporter family protein                     957   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_011042537.1|  PREDICTED: ABC transporter G family member 2...    957   0.0      
gb|KDP36071.1|  hypothetical protein JCGZ_08715                         957   0.0      
ref|XP_004228604.1|  PREDICTED: ABC transporter G family member 2...    956   0.0      
ref|XP_006348422.1|  PREDICTED: ABC transporter G family member 2...    953   0.0      
ref|XP_006575266.1|  PREDICTED: ABC transporter G family member 2...    952   0.0      
ref|XP_003519092.1|  PREDICTED: ABC transporter G family member 2...    951   0.0      
ref|XP_007028065.1|  White-brown-complex ABC transporter family i...    950   0.0      
ref|XP_004497624.1|  PREDICTED: ABC transporter G family member 2...    950   0.0      
ref|XP_007145759.1|  hypothetical protein PHAVU_007G265300g             948   0.0      
ref|XP_011094213.1|  PREDICTED: ABC transporter G family member 2...    947   0.0      
gb|EYU38702.1|  hypothetical protein MIMGU_mgv1a001826mg                944   0.0      
ref|XP_008241111.1|  PREDICTED: ABC transporter G family member 2...    944   0.0      
ref|XP_003535833.2|  PREDICTED: ABC transporter G family member 2...    944   0.0      
ref|XP_008241114.1|  PREDICTED: ABC transporter G family member 2...    943   0.0      
ref|XP_007204637.1|  hypothetical protein PRUPE_ppa001882mg             943   0.0      
ref|XP_010110448.1|  ABC transporter G family member 22                 940   0.0      
ref|XP_002524100.1|  ATP-binding cassette transporter, putative         939   0.0      Ricinus communis
ref|XP_006481645.1|  PREDICTED: ABC transporter G family member 2...    937   0.0      
ref|XP_006430003.1|  hypothetical protein CICLE_v10011143mg             934   0.0      
ref|XP_010653238.1|  PREDICTED: ABC transporter G family member 2...    933   0.0      
gb|KEH41805.1|  white-brown-complex ABC transporter family protein      928   0.0      
emb|CBI39105.3|  unnamed protein product                                927   0.0      
ref|XP_007028064.1|  White-brown-complex ABC transporter family i...    927   0.0      
ref|XP_004303381.1|  PREDICTED: ABC transporter G family member 2...    924   0.0      
ref|XP_009362643.1|  PREDICTED: ABC transporter G family member 2...    918   0.0      
ref|XP_009362642.1|  PREDICTED: ABC transporter G family member 2...    918   0.0      
ref|XP_011047134.1|  PREDICTED: ABC transporter G family member 2...    914   0.0      
ref|XP_011047133.1|  PREDICTED: ABC transporter G family member 2...    914   0.0      
ref|XP_008392009.1|  PREDICTED: ABC transporter G family member 2...    914   0.0      
ref|XP_004494278.1|  PREDICTED: ABC transporter G family member 2...    912   0.0      
emb|CDP10560.1|  unnamed protein product                                912   0.0      
ref|XP_002309268.1|  ABC transporter family protein                     912   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_006604670.1|  PREDICTED: ABC transporter G family member 2...    910   0.0      
ref|XP_003553629.1|  PREDICTED: ABC transporter G family member 2...    909   0.0      
ref|XP_010036577.1|  PREDICTED: ABC transporter G family member 2...    909   0.0      
gb|KEH24294.1|  white-brown-complex ABC transporter family protein      908   0.0      
ref|XP_004136536.1|  PREDICTED: ABC transporter G family member 2...    906   0.0      
ref|XP_007163009.1|  hypothetical protein PHAVU_001G198400g             905   0.0      
ref|XP_003521505.1|  PREDICTED: ABC transporter G family member 2...    905   0.0      
ref|XP_008442971.1|  PREDICTED: ABC transporter G family member 2...    904   0.0      
ref|XP_010557969.1|  PREDICTED: ABC transporter G family member 2...    904   0.0      
ref|XP_008442969.1|  PREDICTED: ABC transporter G family member 2...    899   0.0      
ref|XP_008359521.1|  PREDICTED: ABC transporter G family member 2...    899   0.0      
ref|XP_010677592.1|  PREDICTED: ABC transporter G family member 22      897   0.0      
ref|XP_009348549.1|  PREDICTED: ABC transporter G family member 2...    896   0.0      
gb|KHN43592.1|  ABC transporter G family member 22                      894   0.0      
ref|XP_009796796.1|  PREDICTED: ABC transporter G family member 2...    890   0.0      
ref|XP_010491222.1|  PREDICTED: ABC transporter G family member 2...    889   0.0      
ref|XP_010452592.1|  PREDICTED: ABC transporter G family member 22      886   0.0      
ref|XP_006287123.1|  hypothetical protein CARUB_v10000295mg             885   0.0      
ref|XP_002873263.1|  abc transporter family protein                     884   0.0      
ref|NP_568169.1|  ABC transporter G family member 22                    884   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010423326.1|  PREDICTED: ABC transporter G family member 2...    883   0.0      
ref|XP_009122262.1|  PREDICTED: ABC transporter G family member 2...    880   0.0      
ref|XP_009122263.1|  PREDICTED: ABC transporter G family member 2...    879   0.0      
emb|CDX70095.1|  BnaA10g24440D                                          879   0.0      
ref|XP_010248083.1|  PREDICTED: ABC transporter G family member 2...    879   0.0      
emb|CDX98933.1|  BnaC09g49020D                                          878   0.0      
emb|CDY14079.1|  BnaC02g01960D                                          878   0.0      
ref|XP_011094211.1|  PREDICTED: ABC transporter G family member 2...    873   0.0      
ref|XP_006399125.1|  hypothetical protein EUTSA_v10012760mg             869   0.0      
emb|CDY04991.1|  BnaAnng01730D                                          866   0.0      
ref|XP_009125649.1|  PREDICTED: ABC transporter G family member 2...    865   0.0      
ref|XP_008790027.1|  PREDICTED: ABC transporter G family member 2...    864   0.0      
ref|XP_008790010.1|  PREDICTED: ABC transporter G family member 2...    863   0.0      
ref|XP_010519981.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...    862   0.0      
ref|XP_011042541.1|  PREDICTED: ABC transporter G family member 2...    860   0.0      
ref|XP_008790019.1|  PREDICTED: ABC transporter G family member 2...    858   0.0      
ref|XP_010917903.1|  PREDICTED: ABC transporter G family member 2...    858   0.0      
gb|KDO70704.1|  hypothetical protein CISIN_1g0045372mg                  851   0.0      
gb|KHG09828.1|  ABC transporter G family member 22                      850   0.0      
gb|AIU41652.1|  ABC transporter family protein                          850   0.0      
ref|XP_011094212.1|  PREDICTED: ABC transporter G family member 2...    843   0.0      
ref|XP_006588894.1|  PREDICTED: ABC transporter G family member 2...    845   0.0      
ref|XP_009412321.1|  PREDICTED: ABC transporter G family member 2...    838   0.0      
ref|XP_004161297.1|  PREDICTED: ABC transporter G family member 2...    832   0.0      
ref|XP_010653240.1|  PREDICTED: ABC transporter G family member 2...    829   0.0      
ref|XP_008241115.1|  PREDICTED: ABC transporter G family member 2...    828   0.0      
ref|XP_004494279.1|  PREDICTED: ABC transporter G family member 2...    821   0.0      
gb|KEH41804.1|  white-brown-complex ABC transporter family protein      813   0.0      
ref|XP_006604672.1|  PREDICTED: ABC transporter G family member 2...    813   0.0      
gb|KEH24295.1|  white-brown-complex ABC transporter family protein      811   0.0      
ref|XP_011047135.1|  PREDICTED: ABC transporter G family member 2...    815   0.0      
ref|XP_009348556.1|  PREDICTED: ABC transporter G family member 2...    811   0.0      
ref|XP_009362644.1|  PREDICTED: ABC transporter G family member 2...    811   0.0      
ref|XP_007028066.1|  White-brown-complex ABC transporter family i...    812   0.0      
gb|EEC74548.1|  hypothetical protein OsI_10084                          815   0.0      Oryza sativa Indica Group [Indian rice]
ref|NP_001049014.1|  Os03g0157400                                       813   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_010503972.1|  PREDICTED: ABC transporter G family member 2...    811   0.0      
dbj|BAK06297.1|  predicted protein                                      812   0.0      
ref|XP_004494280.1|  PREDICTED: ABC transporter G family member 2...    803   0.0      
ref|XP_006403815.1|  hypothetical protein EUTSA_v10010138mg             809   0.0      
gb|KDO70706.1|  hypothetical protein CISIN_1g0045372mg                  801   0.0      
dbj|BAJ88390.1|  predicted protein                                      808   0.0      
ref|XP_004985644.1|  PREDICTED: ABC transporter G family member 2...    807   0.0      
ref|XP_010553410.1|  PREDICTED: ABC transporter G family member 2...    806   0.0      
ref|XP_006430004.1|  hypothetical protein CICLE_v10011143mg             800   0.0      
ref|XP_010515694.1|  PREDICTED: ABC transporter G family member 27      805   0.0      
ref|XP_006649428.1|  PREDICTED: ABC transporter G family member 2...    803   0.0      
ref|XP_010426848.1|  PREDICTED: ABC transporter G family member 2...    805   0.0      
ref|XP_002876135.1|  abc transporter family protein                     804   0.0      
ref|XP_006604673.1|  PREDICTED: ABC transporter G family member 2...    797   0.0      
ref|XP_006292375.1|  hypothetical protein CARUB_v10018588mg             803   0.0      
ref|XP_010491223.1|  PREDICTED: ABC transporter G family member 2...    799   0.0      
ref|XP_003562060.1|  PREDICTED: ABC transporter G family member 2...    798   0.0      
emb|CDY23205.1|  BnaA04g05540D                                          797   0.0      
ref|XP_009139468.1|  PREDICTED: ABC transporter G family member 27      796   0.0      
ref|NP_001031843.1|  ABC transporter G family member 22                 794   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_008664823.1|  PREDICTED: uncharacterized protein LOC100216...    795   0.0      
gb|EMS65761.1|  ABC transporter G family member 22                      790   0.0      
ref|XP_009388615.1|  PREDICTED: ABC transporter G family member 2...    793   0.0      
ref|XP_009405790.1|  PREDICTED: ABC transporter G family member 2...    791   0.0      
sp|Q9FT51.1|AB27G_ARATH  RecName: Full=ABC transporter G family m...    790   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_009388622.1|  PREDICTED: ABC transporter G family member 2...    791   0.0      
ref|XP_002465834.1|  hypothetical protein SORBIDRAFT_01g046620          790   0.0      Sorghum bicolor [broomcorn]
gb|KEH41808.1|  white-brown-complex ABC transporter family protein      783   0.0      
ref|NP_190799.2|  ABC transporter G family member 27                    790   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_008664829.1|  PREDICTED: uncharacterized protein LOC100216...    788   0.0      
ref|XP_006430002.1|  hypothetical protein CICLE_v10011143mg             783   0.0      
emb|CDX95330.1|  BnaC04g28280D                                          785   0.0      
ref|XP_006373817.1|  hypothetical protein POPTR_0016s06620g             783   0.0      
ref|XP_004985645.1|  PREDICTED: ABC transporter G family member 2...    782   0.0      
gb|KDO70707.1|  hypothetical protein CISIN_1g0045372mg                  764   0.0      
ref|XP_007163008.1|  hypothetical protein PHAVU_001G198400g             758   0.0      
gb|EPS59306.1|  hypothetical protein M569_15501                         755   0.0      
ref|XP_010426847.1|  PREDICTED: ABC transporter G family member 2...    753   0.0      
ref|XP_010917904.1|  PREDICTED: ABC transporter G family member 2...    751   0.0      
ref|XP_010503974.1|  PREDICTED: ABC transporter G family member 2...    745   0.0      
gb|KFK40221.1|  hypothetical protein AALP_AA3G346400                    745   0.0      
ref|XP_010553412.1|  PREDICTED: ABC transporter G family member 2...    741   0.0      
dbj|BAB11402.1|  ABC transporter-like protein                           730   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_006854611.1|  hypothetical protein AMTR_s00030p00144980          730   0.0      
ref|XP_010503973.1|  PREDICTED: ABC transporter G family member 2...    719   0.0      
ref|XP_010244004.1|  PREDICTED: ABC transporter G family member 2...    713   0.0      
ref|XP_010244001.1|  PREDICTED: ABC transporter G family member 2...    713   0.0      
gb|KDO70708.1|  hypothetical protein CISIN_1g0045372mg                  701   0.0      
gb|KDO70709.1|  hypothetical protein CISIN_1g0045372mg                  698   0.0      
ref|XP_010247278.1|  PREDICTED: ABC transporter G family member 2...    707   0.0      
ref|XP_002263430.1|  PREDICTED: ABC transporter G family member 2...    707   0.0      Vitis vinifera
ref|XP_010244002.1|  PREDICTED: ABC transporter G family member 2...    707   0.0      
ref|XP_006381927.1|  hypothetical protein POPTR_0006s21400g             695   0.0      
emb|CBI35490.3|  unnamed protein product                                701   0.0      
ref|XP_010653239.1|  PREDICTED: ABC transporter G family member 2...    692   0.0      
gb|ABR17189.1|  unknown                                                 688   0.0      Picea sitchensis
ref|XP_010911944.1|  PREDICTED: ABC transporter G family member 2...    679   0.0      
gb|EMT07325.1|  ABC transporter G family member 22                      671   0.0      
ref|XP_009799080.1|  PREDICTED: ABC transporter G family member 2...    672   0.0      
gb|AAM51832.1|AC105730_6  Putative ABC transporter                      665   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_002526137.1|  ATP-binding cassette transporter, putative         664   0.0      Ricinus communis
ref|XP_011101660.1|  PREDICTED: ABC transporter G family member 2...    660   0.0      
ref|XP_007200734.1|  hypothetical protein PRUPE_ppa021401mg             653   0.0      
ref|XP_009599779.1|  PREDICTED: ABC transporter G family member 2...    657   0.0      
ref|XP_006362828.1|  PREDICTED: ABC transporter G family member 2...    650   0.0      
ref|XP_010320061.1|  PREDICTED: ABC transporter G family member 2...    648   0.0      
tpg|DAA43438.1|  TPA: hypothetical protein ZEAMMB73_582925              653   0.0      
ref|XP_004237766.1|  PREDICTED: ABC transporter G family member 2...    647   0.0      
ref|XP_009415591.1|  PREDICTED: ABC transporter G family member 2...    639   0.0      
ref|XP_008237629.1|  PREDICTED: ABC transporter G family member 2...    644   0.0      
ref|XP_007019433.1|  White-brown-complex ABC transporter family         642   0.0      
gb|EYU17426.1|  hypothetical protein MIMGU_mgv1a002142mg                639   0.0      
ref|XP_009360789.1|  PREDICTED: ABC transporter G family member 2...    636   0.0      
gb|KDP43029.1|  hypothetical protein JCGZ_25215                         629   0.0      
ref|XP_008356252.1|  PREDICTED: ABC transporter G family member 2...    610   0.0      
ref|XP_004292538.1|  PREDICTED: ABC transporter G family member 2...    606   0.0      
ref|XP_010680137.1|  PREDICTED: ABC transporter G family member 2...    593   0.0      
gb|AAK63861.1|AF389289_1  AT5g06530/F15M7_6                             580   0.0      Arabidopsis thaliana [mouse-ear cress]
gb|KDO70711.1|  hypothetical protein CISIN_1g0045372mg                  570   0.0      
ref|XP_006826407.1|  hypothetical protein AMTR_s00004p00153830          567   0.0      
emb|CAN66426.1|  hypothetical protein VITISV_029010                     554   5e-180   Vitis vinifera
ref|XP_001763976.1|  ATP-binding cassette transporter, subfamily ...    546   1e-178   
ref|XP_009799082.1|  PREDICTED: ABC transporter G family member 2...    546   2e-177   
gb|KHN10345.1|  ABC transporter G family member 27                      545   3e-177   
gb|KDP37810.1|  hypothetical protein JCGZ_06712                         514   8e-166   
ref|XP_002992999.1|  hypothetical protein SELMODRAFT_136316             505   3e-164   
gb|KFK44944.1|  hypothetical protein AALP_AA1G323000                    504   3e-162   
emb|CDP13689.1|  unnamed protein product                                504   1e-161   
ref|XP_006482405.1|  PREDICTED: ABC transporter G family member 1...    502   3e-161   
gb|KDO72270.1|  hypothetical protein CISIN_1g039221mg                   500   1e-160   
ref|XP_010478591.1|  PREDICTED: ABC transporter G family member 14      500   1e-160   
ref|XP_006430907.1|  hypothetical protein CICLE_v10011273mg             500   2e-160   
ref|XP_011095584.1|  PREDICTED: ABC transporter G family member 26      501   2e-160   
ref|XP_006878615.1|  hypothetical protein AMTR_s00011p00258490          499   3e-160   
ref|XP_009607601.1|  PREDICTED: ABC transporter G family member 9...    499   3e-160   
ref|XP_002519942.1|  ATP-binding cassette transporter, putative         499   4e-160   Ricinus communis
emb|CDY47690.1|  BnaCnng15320D                                          498   6e-160   
ref|XP_009145231.1|  PREDICTED: ABC transporter G family member 1...    498   6e-160   
ref|XP_010499718.1|  PREDICTED: ABC transporter G family member 1...    498   1e-159   
ref|XP_010518955.1|  PREDICTED: ABC transporter G family member 14      497   1e-159   
gb|KHG16348.1|  ABC transporter G family member 14                      498   2e-159   
ref|XP_006303926.1|  hypothetical protein CARUB_v10008545mg             497   2e-159   
ref|XP_010540713.1|  PREDICTED: ABC transporter G family member 14      497   2e-159   
ref|NP_564383.1|  ABC transporter G family member 14                    497   2e-159   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002991839.1|  ATP-binding cassette transporter                   492   3e-159   
ref|XP_004147769.1|  PREDICTED: ABC transporter G family member 1...    497   3e-159   
ref|XP_009114967.1|  PREDICTED: ABC transporter G family member 14      497   3e-159   
ref|XP_011098341.1|  PREDICTED: ABC transporter G family member 9       496   4e-159   
ref|XP_002893685.1|  abc transporter family protein                     496   7e-159   
ref|XP_006415305.1|  hypothetical protein EUTSA_v10007027mg             495   2e-158   
ref|XP_004164431.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...    495   2e-158   
ref|XP_009766511.1|  PREDICTED: ABC transporter G family member 9...    494   2e-158   
gb|EYU27464.1|  hypothetical protein MIMGU_mgv1a002345mg                495   4e-158   
ref|XP_002270533.2|  PREDICTED: ABC transporter G family member 14      494   6e-158   Vitis vinifera
ref|XP_006385164.1|  ABC transporter family protein                     494   7e-158   
gb|KHG01243.1|  ABC transporter G family member 9                       492   2e-157   
emb|CDY12299.1|  BnaA09g24990D                                          494   2e-157   
ref|XP_004294923.1|  PREDICTED: ABC transporter G family member 2...    494   2e-157   
ref|XP_009757349.1|  PREDICTED: ABC transporter G family member 1...    491   4e-157   
ref|XP_007040852.1|  ATP-binding cassette 14                            491   6e-157   
ref|XP_004246010.1|  PREDICTED: ABC transporter G family member 14      490   8e-157   
gb|AAG50724.1|AC079041_17  ABC transporter, putative                    490   1e-156   Arabidopsis thaliana [mouse-ear cress]
gb|EYU29117.1|  hypothetical protein MIMGU_mgv1a002688mg                490   1e-156   
ref|XP_008221126.1|  PREDICTED: ABC transporter G family member 14      491   1e-156   
ref|XP_009605917.1|  PREDICTED: ABC transporter G family member 1...    489   1e-156   
emb|CDP05875.1|  unnamed protein product                                489   2e-156   
ref|XP_006359961.1|  PREDICTED: ABC transporter G family member 1...    489   2e-156   
ref|XP_009605775.1|  PREDICTED: ABC transporter G family member 9       488   3e-156   
ref|XP_008387860.1|  PREDICTED: ABC transporter G family member 14      489   4e-156   
gb|KHG20314.1|  ABC transporter G family member 14                      488   1e-155   
ref|XP_009792869.1|  PREDICTED: ABC transporter G family member 9...    486   1e-155   
emb|CAN70956.1|  hypothetical protein VITISV_028138                     488   1e-155   Vitis vinifera
ref|XP_002281949.1|  PREDICTED: ABC transporter G family member 9       486   1e-155   Vitis vinifera
ref|XP_006452648.1|  hypothetical protein CICLE_v10010223mg             488   2e-155   
ref|XP_006474829.1|  PREDICTED: ABC transporter G family member 2...    488   2e-155   
ref|XP_003547739.1|  PREDICTED: ABC transporter G family member 1...    487   3e-155   
ref|XP_008218542.1|  PREDICTED: ABC transporter G family member 26      488   3e-155   
ref|XP_006841289.1|  hypothetical protein AMTR_s00134p00069640          486   4e-155   
ref|XP_003548769.1|  PREDICTED: ABC transporter G family member 1...    486   5e-155   
emb|CDP07185.1|  unnamed protein product                                486   6e-155   
emb|CDY46506.1|  BnaA02g27560D                                          486   7e-155   
ref|XP_004293103.1|  PREDICTED: ABC transporter G family member 9...    485   7e-155   
gb|KHG30511.1|  ABC transporter G family member 22                      486   7e-155   
ref|XP_007226971.1|  hypothetical protein PRUPE_ppa002442mg             486   8e-155   
gb|AES95438.2|  white-brown-complex ABC transporter family protein      484   1e-154   
ref|XP_010275138.1|  PREDICTED: ABC transporter G family member 14      485   1e-154   
ref|XP_004512314.1|  PREDICTED: ABC transporter G family member 1...    485   2e-154   
ref|XP_006359003.1|  PREDICTED: ABC transporter G family member 9...    483   2e-154   
ref|XP_008451875.1|  PREDICTED: ABC transporter G family member 14      484   3e-154   
ref|XP_010262410.1|  PREDICTED: ABC transporter G family member 2...    485   3e-154   
ref|XP_010542511.1|  PREDICTED: ABC transporter G family member 2...    484   5e-154   
ref|XP_008349497.1|  PREDICTED: ABC transporter G family member 2...    484   9e-154   
ref|XP_004297158.1|  PREDICTED: ABC transporter G family member 2...    484   1e-153   
gb|KEH38788.1|  white-brown-complex ABC transporter family protein      481   1e-153   
ref|XP_007020427.1|  ABC-2 type transporter family protein              484   1e-153   
ref|XP_007158067.1|  hypothetical protein PHAVU_002G121200g             483   1e-153   
gb|KDO59196.1|  hypothetical protein CISIN_1g044602mg                   483   1e-153   
ref|XP_008347335.1|  PREDICTED: ABC transporter G family member 1...    486   2e-153   
ref|XP_004244204.1|  PREDICTED: ABC transporter G family member 9       481   2e-153   
ref|XP_003517105.2|  PREDICTED: ABC transporter G family member 1...    482   2e-153   
ref|XP_003537708.1|  PREDICTED: ABC transporter G family member 1...    482   2e-153   
gb|KHN28317.1|  ABC transporter G family member 14                      481   5e-153   
ref|XP_010542512.1|  PREDICTED: ABC transporter G family member 2...    482   5e-153   
ref|XP_010054006.1|  PREDICTED: ABC transporter G family member 14      481   6e-153   
ref|XP_007207412.1|  hypothetical protein PRUPE_ppa014606mg             481   9e-153   
ref|XP_008775311.1|  PREDICTED: ABC transporter G family member 9...    479   1e-152   
ref|XP_004491527.1|  PREDICTED: ABC transporter G family member 2...    481   1e-152   
ref|XP_004252105.1|  PREDICTED: ABC transporter G family member 9...    479   1e-152   
ref|XP_010676724.1|  PREDICTED: ABC transporter G family member 14      479   2e-152   
ref|XP_010676075.1|  PREDICTED: ABC transporter G family member 26      480   2e-152   
emb|CDX99764.1|  BnaC02g35560D                                          480   2e-152   
ref|XP_004291249.1|  PREDICTED: ABC transporter G family member 1...    479   2e-152   
ref|XP_003541854.2|  PREDICTED: ABC transporter G family member 9...    478   3e-152   
ref|XP_010675645.1|  PREDICTED: ABC transporter G family member 9       477   9e-152   
ref|XP_010265331.1|  PREDICTED: ABC transporter G family member 2...    478   1e-151   
ref|XP_007156346.1|  hypothetical protein PHAVU_003G278800g             477   1e-151   
gb|KDP27016.1|  hypothetical protein JCGZ_20951                         476   1e-151   
ref|XP_001780064.1|  ATP-binding cassette transporter, subfamily ...    474   1e-151   
ref|XP_008799253.1|  PREDICTED: ABC transporter G family member 9...    476   2e-151   
ref|XP_004244029.1|  PREDICTED: ABC transporter G family member 26      478   2e-151   
ref|XP_009367249.1|  PREDICTED: ABC transporter G family member 26      478   3e-151   
ref|XP_006855537.1|  hypothetical protein AMTR_s00057p00214480          476   4e-151   
ref|XP_010111780.1|  ABC transporter G family member 14                 476   4e-151   
ref|XP_003612480.1|  ABC transporter-like protein                       475   1e-150   
ref|XP_006346115.1|  PREDICTED: ABC transporter G family member 2...    476   1e-150   
gb|AIU41651.1|  ABC transporter family protein                          476   1e-150   
ref|XP_008237669.1|  PREDICTED: ABC transporter G family member 9...    473   1e-150   
gb|KDP39319.1|  hypothetical protein JCGZ_01076                         475   2e-150   
ref|XP_008347334.1|  PREDICTED: ABC transporter G family member 1...    478   2e-150   
ref|XP_002267511.2|  PREDICTED: ABC transporter G family member 26      474   4e-150   
ref|XP_010918656.1|  PREDICTED: ABC transporter G family member 1...    473   5e-150   
ref|XP_010034170.1|  PREDICTED: ABC transporter G family member 9       473   6e-150   
ref|XP_006361228.1|  PREDICTED: ABC transporter G family member 1...    473   9e-150   
ref|XP_011095242.1|  PREDICTED: ABC transporter G family member 9...    471   1e-149   
ref|XP_010943390.1|  PREDICTED: ABC transporter G family member 1...    472   1e-149   
ref|XP_006361227.1|  PREDICTED: ABC transporter G family member 1...    472   2e-149   
ref|XP_010251517.1|  PREDICTED: ABC transporter G family member 1...    471   2e-149   
emb|CBI20349.3|  unnamed protein product                                468   2e-149   
ref|XP_009383080.1|  PREDICTED: ABC transporter G family member 9       470   3e-149   
ref|XP_011082193.1|  PREDICTED: ABC transporter G family member 1...    471   3e-149   
ref|XP_002304113.2|  hypothetical protein POPTR_0003s03650g             471   3e-149   
ref|XP_011095241.1|  PREDICTED: ABC transporter G family member 9...    471   4e-149   
ref|XP_009124723.1|  PREDICTED: ABC transporter G family member 26      471   5e-149   
ref|XP_011013139.1|  PREDICTED: ABC transporter G family member 1...    470   6e-149   
ref|XP_011028515.1|  PREDICTED: ABC transporter G family member 1...    470   8e-149   
ref|XP_009781518.1|  PREDICTED: ABC transporter G family member 26      471   1e-148   
ref|XP_009406087.1|  PREDICTED: ABC transporter G family member 2...    469   1e-148   
ref|XP_009628134.1|  PREDICTED: ABC transporter G family member 26      471   1e-148   
ref|XP_008226675.1|  PREDICTED: ABC transporter G family member 9       468   1e-148   
ref|XP_009336649.1|  PREDICTED: ABC transporter G family member 2...    471   1e-148   
ref|XP_008797781.1|  PREDICTED: ABC transporter G family member 26      469   2e-148   
ref|XP_010943389.1|  PREDICTED: ABC transporter G family member 1...    468   5e-148   
ref|XP_009395262.1|  PREDICTED: ABC transporter G family member 9...    467   5e-148   
emb|CDP00551.1|  unnamed protein product                                468   6e-148   
ref|XP_009129040.1|  PREDICTED: ABC transporter G family member 2...    468   1e-147   
ref|XP_010465139.1|  PREDICTED: ABC transporter G family member 26      468   1e-147   
gb|KDP27020.1|  hypothetical protein JCGZ_20955                         464   1e-147   
ref|XP_007225163.1|  hypothetical protein PRUPE_ppa002351mg             468   2e-147   
ref|XP_010942700.1|  PREDICTED: ABC transporter G family member 26      467   2e-147   
ref|XP_008243143.1|  PREDICTED: ABC transporter G family member 21      467   2e-147   
ref|XP_002884953.1|  abc transporter family protein                     467   2e-147   
ref|XP_010324495.1|  PREDICTED: ABC transporter G family member 1...    467   2e-147   
ref|XP_010556399.1|  PREDICTED: ABC transporter G family member 2...    467   3e-147   
emb|CDY24203.1|  BnaC01g37830D                                          467   3e-147   
emb|CAN62390.1|  hypothetical protein VITISV_039480                     467   3e-147   
ref|XP_010648137.1|  PREDICTED: ABC transporter G family member 21      466   4e-147   
ref|XP_003520157.2|  PREDICTED: ABC transporter G family member 2...    466   4e-147   
ref|XP_007046353.1|  ABC-2 type transporter family protein              466   4e-147   
ref|XP_010500190.1|  PREDICTED: ABC transporter G family member 2...    466   4e-147   
ref|XP_002876921.1|  hypothetical protein ARALYDRAFT_904727             466   5e-147   
gb|KFK39853.1|  hypothetical protein AALP_AA3G297000                    466   6e-147   
ref|XP_006300234.1|  hypothetical protein CARUB_v10016471mg             466   6e-147   
ref|XP_010487069.1|  PREDICTED: ABC transporter G family member 2...    466   6e-147   
ref|XP_007153314.1|  hypothetical protein PHAVU_003G024700g             465   9e-147   
ref|XP_006395639.1|  hypothetical protein EUTSA_v10003766mg             465   9e-147   
ref|XP_007214012.1|  hypothetical protein PRUPE_ppa014861mg             463   9e-147   
ref|XP_010918655.1|  PREDICTED: ABC transporter G family member 1...    465   9e-147   
ref|XP_011038858.1|  PREDICTED: ABC transporter G family member 26      465   2e-146   
gb|AET00827.2|  white-brown-complex ABC transporter family protein      464   2e-146   
ref|NP_187928.2|  ABC transporter G family member 26                    464   3e-146   
ref|XP_008389336.1|  PREDICTED: ABC transporter G family member 2...    464   3e-146   
ref|XP_006437762.1|  hypothetical protein CICLE_v10030868mg             464   4e-146   
ref|XP_002533914.1|  ATP-binding cassette transporter, putative         462   5e-146   
ref|XP_004498150.1|  PREDICTED: ABC transporter G family member 2...    463   1e-145   
ref|XP_006484387.1|  PREDICTED: ABC transporter G family member 2...    463   1e-145   
ref|XP_010265777.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...    462   1e-145   
ref|XP_008339724.1|  PREDICTED: ABC transporter G family member 2...    462   2e-145   
ref|XP_002522797.1|  ATP-binding cassette transporter, putative         462   2e-145   
ref|XP_010109266.1|  ABC transporter G family member 26                 480   2e-145   
ref|XP_008361741.1|  PREDICTED: ABC transporter G family member 2...    462   2e-145   
ref|XP_010502439.1|  PREDICTED: ABC transporter G family member 2...    461   3e-145   
emb|CDY51602.1|  BnaCnng21050D                                          460   5e-145   
ref|XP_007149612.1|  hypothetical protein PHAVU_005G084300g             459   6e-145   
gb|KDO70136.1|  hypothetical protein CISIN_1g005545mg                   461   7e-145   
ref|XP_010448138.1|  PREDICTED: ABC transporter G family member 9       459   8e-145   
ref|XP_010425209.1|  PREDICTED: ABC transporter G family member 2...    459   1e-144   
ref|NP_194472.3|  ABC transporter G family member 9                     458   1e-144   
ref|XP_006359002.1|  PREDICTED: ABC transporter G family member 9...    458   2e-144   
gb|KHN16959.1|  ABC transporter G family member 14                      456   2e-144   
emb|CDP08055.1|  unnamed protein product                                458   2e-144   
ref|XP_007021331.1|  White-brown-complex ABC transporter family         457   2e-144   
gb|KHN07718.1|  ABC transporter G family member 21                      456   2e-144   
ref|XP_010514180.1|  PREDICTED: ABC transporter G family member 2...    459   2e-144   
ref|XP_006290691.1|  hypothetical protein CARUB_v10016784mg             459   3e-144   
ref|XP_010921129.1|  PREDICTED: ABC transporter G family member 9       457   3e-144   
ref|XP_006857737.1|  hypothetical protein AMTR_s00061p00187570          459   4e-144   
ref|XP_002992849.1|  hypothetical protein SELMODRAFT_136119             455   5e-144   
ref|XP_010463057.1|  PREDICTED: ABC transporter G family member 1...    454   5e-144   
ref|XP_006286036.1|  hypothetical protein CARUB_v10007565mg             457   5e-144   
ref|XP_010433373.1|  PREDICTED: ABC transporter G family member 9...    457   5e-144   
gb|EYU26406.1|  hypothetical protein MIMGU_mgv1a004006mg                454   5e-144   
gb|KCW50637.1|  hypothetical protein EUGRSUZ_J00337                     456   6e-144   
ref|XP_009802424.1|  PREDICTED: ABC transporter G family member 1...    457   6e-144   
ref|XP_002969079.1|  ATP-binding cassette transporter                   454   6e-144   
gb|EPS69022.1|  hypothetical protein M569_05746                         454   7e-144   
ref|XP_003552990.1|  PREDICTED: ABC transporter G family member 2...    457   1e-143   
gb|KDP29341.1|  hypothetical protein JCGZ_18262                         457   1e-143   
gb|KHN07535.1|  ABC transporter G family member 21                      453   1e-143   
ref|XP_004134251.1|  PREDICTED: ABC transporter G family member 9...    455   1e-143   
ref|XP_002314895.1|  hypothetical protein POPTR_0010s14180g             457   1e-143   
ref|XP_003617868.1|  ABC transporter G family member                    457   2e-143   
dbj|BAB01414.1|  ABC transporter-like protein                           457   2e-143   
ref|XP_009414356.1|  PREDICTED: ABC transporter G family member 26      456   2e-143   
ref|XP_011077437.1|  PREDICTED: ABC transporter G family member 21      456   2e-143   
ref|XP_006370303.1|  hypothetical protein POPTR_0001s41450g             454   3e-143   
gb|KFK29257.1|  hypothetical protein AALP_AA7G109600                    455   3e-143   
ref|XP_007199008.1|  hypothetical protein PRUPE_ppa017466mg             454   3e-143   
ref|XP_009631041.1|  PREDICTED: ABC transporter G family member 1...    455   4e-143   
ref|XP_010324496.1|  PREDICTED: ABC transporter G family member 1...    454   4e-143   
gb|EPS63929.1|  hypothetical protein M569_10851                         454   5e-143   
ref|XP_009383524.1|  PREDICTED: ABC transporter G family member 2...    454   6e-143   
emb|CDY48079.1|  BnaA06g33490D                                          455   7e-143   
ref|XP_004496215.1|  PREDICTED: ABC transporter G family member 2...    455   8e-143   
ref|XP_009152126.1|  PREDICTED: ABC transporter G family member 21      454   8e-143   
ref|XP_006407250.1|  hypothetical protein EUTSA_v10020198mg             455   9e-143   
ref|XP_002300394.2|  ABC transporter family protein                     453   2e-142   
ref|XP_006573283.1|  PREDICTED: ABC transporter G family member 2...    454   3e-142   
ref|XP_003591854.1|  ABC transporter G family member                    453   3e-142   
ref|XP_004252106.1|  PREDICTED: ABC transporter G family member 9...    464   3e-142   
ref|XP_010324497.1|  PREDICTED: ABC transporter G family member 1...    451   4e-142   
ref|XP_009416919.1|  PREDICTED: ABC transporter G family member 2...    452   4e-142   
ref|XP_011071699.1|  PREDICTED: ABC transporter G family member 1...    452   6e-142   
ref|XP_009406088.1|  PREDICTED: ABC transporter G family member 2...    451   6e-142   
ref|XP_003544606.1|  PREDICTED: ABC transporter G family member 2...    453   7e-142   
gb|KFK38655.1|  hypothetical protein AALP_AA3G143100                    453   7e-142   
ref|XP_002867504.1|  abc transporter family protein                     451   8e-142   
gb|KHN36795.1|  ABC transporter G family member 9                       447   1e-141   
ref|XP_011042498.1|  PREDICTED: ABC transporter G family member 9...    450   1e-141   
ref|XP_010438619.1|  PREDICTED: ABC transporter G family member 9...    450   1e-141   
ref|XP_007142441.1|  hypothetical protein PHAVU_008G280800g             452   2e-141   
ref|XP_010520902.1|  PREDICTED: ABC transporter G family member 9...    449   2e-141   
emb|CBI18157.3|  unnamed protein product                                450   2e-141   
emb|CDX92829.1|  BnaC07g40870D                                          450   2e-141   
emb|CAN62144.1|  hypothetical protein VITISV_007841                     448   3e-141   
emb|CDY29304.1|  BnaC01g19560D                                          449   3e-141   
ref|NP_001189973.1|  ABC transporter G family member 21                 451   3e-141   
emb|CAB43874.1|  putative protei                                        449   5e-141   
emb|CAN73913.1|  hypothetical protein VITISV_035231                     450   5e-141   
ref|XP_006413078.1|  hypothetical protein EUTSA_v10024656mg             449   6e-141   
ref|XP_006595681.1|  PREDICTED: ABC transporter G family member 2...    450   6e-141   
gb|KHN43910.1|  ABC transporter G family member 26                      450   7e-141   
ref|XP_003519640.2|  PREDICTED: ABC transporter G family member 2...    450   8e-141   
ref|XP_003526081.1|  PREDICTED: ABC transporter G family member 9...    447   1e-140   
ref|XP_010066762.1|  PREDICTED: ABC transporter G family member 21      449   1e-140   
emb|CDY29837.1|  BnaA03g48580D                                          448   1e-140   
ref|XP_009143407.1|  PREDICTED: ABC transporter G family member 9       448   1e-140   
ref|XP_007133073.1|  hypothetical protein PHAVU_011G149300g             447   2e-140   
ref|XP_007143780.1|  hypothetical protein PHAVU_007G100900g             449   2e-140   
ref|XP_011008785.1|  PREDICTED: ABC transporter G family member 21      449   2e-140   
ref|XP_007140113.1|  hypothetical protein PHAVU_008G085200g             449   3e-140   
ref|XP_009137658.1|  PREDICTED: ABC transporter G family member 9...    447   3e-140   
ref|XP_008386302.1|  PREDICTED: ABC transporter G family member 9...    446   3e-140   
ref|XP_009378509.1|  PREDICTED: ABC transporter G family member 9       446   6e-140   
ref|XP_010277245.1|  PREDICTED: ABC transporter G family member 9...    456   7e-140   
gb|KHN31682.1|  ABC transporter G family member 26                      447   9e-140   
ref|XP_002524381.1|  ATP-binding cassette transporter, putative         447   1e-139   
ref|XP_009768130.1|  PREDICTED: ABC transporter G family member 2...    446   1e-139   
gb|EMT12374.1|  ABC transporter G family member 26                      446   2e-139   
ref|XP_006451938.1|  hypothetical protein CICLE_v10007744mg             444   3e-139   
ref|XP_010256405.1|  PREDICTED: ABC transporter G family member 25      443   1e-138   
ref|XP_004487681.1|  PREDICTED: ABC transporter G family member 9...    442   2e-138   
gb|KEH19433.1|  white-brown-complex ABC transporter family protein      442   2e-138   
ref|XP_009586692.1|  PREDICTED: ABC transporter G family member 2...    443   3e-138   
emb|CDP16843.1|  unnamed protein product                                442   4e-138   
ref|XP_006464709.1|  PREDICTED: ABC transporter G family member 9...    441   4e-138   
ref|XP_009345933.1|  PREDICTED: ABC transporter G family member 2...    441   5e-138   
gb|EYU28941.1|  hypothetical protein MIMGU_mgv1a002356mg                442   6e-138   
ref|XP_002268373.1|  PREDICTED: ABC transporter G family member 25      442   7e-138   
ref|XP_010063246.1|  PREDICTED: ABC transporter G family member 26      442   8e-138   
ref|XP_009793168.1|  PREDICTED: ABC transporter G family member 2...    441   1e-137   
ref|XP_006589394.1|  PREDICTED: ABC transporter G family member 2...    442   1e-137   
gb|KHN08925.1|  ABC transporter G family member 9                       439   1e-137   
ref|XP_009769371.1|  PREDICTED: ABC transporter G family member 25      441   1e-137   
ref|XP_011029437.1|  PREDICTED: ABC transporter G family member 9...    439   1e-137   
ref|XP_004250400.1|  PREDICTED: ABC transporter G family member 25      440   4e-137   
ref|XP_003556255.1|  PREDICTED: ABC transporter G family member 2...    440   5e-137   
ref|XP_006351917.1|  PREDICTED: ABC transporter G family member 2...    438   7e-137   
ref|XP_009593646.1|  PREDICTED: ABC transporter G family member 21      438   8e-137   
ref|XP_009604112.1|  PREDICTED: ABC transporter G family member 25      437   3e-136   
ref|XP_003563648.1|  PREDICTED: ABC transporter G family member 2...    437   4e-136   
ref|XP_007019995.1|  ATP-binding casette family G25                     437   4e-136   
ref|XP_009397435.1|  PREDICTED: ABC transporter G family member 14      436   5e-136   
ref|XP_008805673.1|  PREDICTED: ABC transporter G family member 1...    437   6e-136   
ref|XP_010528033.1|  PREDICTED: ABC transporter G family member 2...    436   2e-135   
ref|XP_010227525.1|  PREDICTED: ABC transporter G family member 2...    436   3e-135   
ref|XP_003555426.1|  PREDICTED: ABC transporter G family member 2...    434   4e-135   
gb|KDP43365.1|  hypothetical protein JCGZ_25470                         434   6e-135   
ref|XP_008382026.1|  PREDICTED: ABC transporter G family member 2...    433   1e-134   
ref|XP_008452359.1|  PREDICTED: ABC transporter G family member 9...    430   1e-134   
ref|XP_008791161.1|  PREDICTED: ABC transporter G family member 2...    432   1e-134   
ref|XP_007143640.1|  hypothetical protein PHAVU_007G088800g             432   2e-134   
gb|KHG09588.1|  ABC transporter G family member 25                      432   3e-134   
ref|XP_009356025.1|  PREDICTED: ABC transporter G family member 2...    433   3e-134   
ref|XP_010912511.1|  PREDICTED: ABC transporter G family member 2...    431   3e-134   
ref|XP_003535544.1|  PREDICTED: ABC transporter G family member 2...    432   3e-134   
ref|XP_011074938.1|  PREDICTED: ABC transporter G family member 2...    432   3e-134   
ref|XP_002316916.1|  ABC transporter family protein                     430   4e-134   
gb|EYU22839.1|  hypothetical protein MIMGU_mgv1a002620mg                431   4e-134   
ref|XP_004139680.1|  PREDICTED: ABC transporter G family member 2...    429   6e-134   
ref|XP_010248096.1|  PREDICTED: ABC transporter G family member 2...    431   6e-134   
ref|XP_002438658.1|  hypothetical protein SORBIDRAFT_10g023750          431   1e-133   
ref|XP_006366061.1|  PREDICTED: ABC transporter G family member 2...    431   1e-133   
gb|KHG11002.1|  ABC transporter G family member 25                      430   1e-133   
gb|KGN44483.1|  hypothetical protein Csa_7G307400                       429   2e-133   
ref|XP_008461920.1|  PREDICTED: ABC transporter G family member 25      429   2e-133   
ref|XP_004236984.1|  PREDICTED: ABC transporter G family member 21      430   2e-133   
ref|XP_010105155.1|  ABC transporter G family member 25                 429   4e-133   
ref|XP_004134252.1|  PREDICTED: ABC transporter G family member 9...    427   5e-133   
ref|XP_010910173.1|  PREDICTED: ABC transporter G family member 1...    428   9e-133   
ref|XP_004965922.1|  PREDICTED: ABC transporter G family member 2...    428   2e-132   
ref|XP_008380991.1|  PREDICTED: ABC transporter G family member 25      427   2e-132   
ref|XP_008457190.1|  PREDICTED: ABC transporter G family member 21      427   4e-132   
gb|KHN00888.1|  ABC transporter G family member 21                      427   4e-132   
ref|XP_009384518.1|  PREDICTED: ABC transporter G family member 1...    425   7e-132   
ref|XP_010930786.1|  PREDICTED: ABC transporter G family member 25      425   7e-132   
ref|XP_004170842.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...    426   7e-132   
ref|XP_008237152.1|  PREDICTED: ABC transporter G family member 25      426   1e-131   
ref|XP_008781545.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...    425   1e-131   
gb|KGN61520.1|  hypothetical protein Csa_2G153580                       425   1e-131   
ref|XP_008797958.1|  PREDICTED: ABC transporter G family member 1...    424   2e-131   
ref|XP_010678675.1|  PREDICTED: ABC transporter G family member 25      425   2e-131   
ref|XP_006493205.1|  PREDICTED: ABC transporter G family member 9...    424   3e-131   
ref|XP_009412322.1|  PREDICTED: ABC transporter G family member 2...    423   4e-131   
ref|XP_009105860.1|  PREDICTED: ABC transporter G family member 25      424   4e-131   
ref|XP_010415916.1|  PREDICTED: ABC transporter G family member 2...    424   5e-131   
ref|NP_001147989.1|  ATPase, coupled to transmembrane movement of...    422   5e-131   
ref|XP_010471215.1|  PREDICTED: ABC transporter G family member 2...    423   5e-131   
ref|XP_008452272.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...    422   7e-131   



>ref|XP_011077784.1| PREDICTED: ABC transporter G family member 22 [Sesamum indicum]
Length=754

 Score =   994 bits (2570),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 545/752 (72%), Positives = 615/752 (82%), Gaps = 40/752 (5%)
 Frame = -2

Query  2875  EQTNST-SLLRTKSDQLVEaiaaakgsarARLPRLSAEFAGSGVPESVRMLSRKPSRRLM  2699
             ++TNST SL+RTKSDQLVE +AAA  + ++ L    A  A SG  ES   LSR  SRRL 
Sbjct  4     QKTNSTTSLIRTKSDQLVETMAAALAAMKSPLSSGDAA-ASSGGLESSGNLSRMSSRRLA  62

Query  2698  ppspggggsgGTNSTHIRKSRSAQMKLDLDElssgsvlsrassasl--GFSFTGFSVRPD  2525
               SPG        +THIRKSRSAQMK DLD+L+SG+ LSRASSASL   FSFTGF+V PD
Sbjct  63    AASPGRSSGSVGKNTHIRKSRSAQMKFDLDDLNSGAALSRASSASLGFSFSFTGFTVPPD  122

Query  2524  ESADSKPFSDDENPEDLEAGTKKKRSIPAEPTFPIYLKFTEVSYKIVIKGVTFSEEKDIL  2345
             E AD KPFSDDE PEDLEAG +KK+ + +EPT PIYLKFT+V+YK+V++G+T + E+DIL
Sbjct  123   EIADLKPFSDDEIPEDLEAGRQKKK-LHSEPTLPIYLKFTDVTYKVVLRGMTSTVERDIL  181

Query  2344  NGISGAVDPGEVLALMGPSGCGKTTLLSLLGGRIRDPS-AGSITYNQHPYSKLLKSRIGF  2168
             NGI+G+VDPGEVLALMGPSG GKTTLLS+LGGR+R+P+  GSITYN  PYSK LKSRIGF
Sbjct  182   NGITGSVDPGEVLALMGPSGSGKTTLLSILGGRVREPAPGGSITYNDQPYSKCLKSRIGF  241

Query  2167  VTQDDILFPHLTVKETLIYAARLRLPRTLTKEEKDKRAMDVIYELGLDRCQDTMIGGSFV  1988
             VTQDD+LFPHLTVKETL YAARLRLPRTLTKEEKD+RA DVI ELGL+RCQDTMIGGSFV
Sbjct  242   VTQDDVLFPHLTVKETLSYAARLRLPRTLTKEEKDQRATDVICELGLERCQDTMIGGSFV  301

Query  1987  RGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILHEIAKAGKTVITTIH  1808
             RGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVD LHEIA+AGKTVITTIH
Sbjct  302   RGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDTLHEIAEAGKTVITTIH  361

Query  1807  QPSSRLF--------------------------------HkfdklilleflldLANGNIN  1724
             QPSSRLF                                     +   EF+LDLANGN+ 
Sbjct  362   QPSSRLFLKFDKLILLGKGSLLYYGKASEAMVYFSSIGCSPLIAMNPAEFMLDLANGNVT  421

Query  1723  DVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYETRVAETEKKKLMAPLPVE  1544
             D+S+PSEL DKVQ  + + E    NGKP+PA+VHEYLV  YETRVAE EKKK+M P+PV+
Sbjct  422   DISVPSELEDKVQMGDPEAEI--KNGKPAPAVVHEYLVETYETRVAEIEKKKIMNPIPVD  479

Query  1543  EELKSKVRYLKREWGASWSEQYVLLFHRGIRERWHDYFSWLRITQVIATALILGMLWWQS  1364
             EE+KSKV   KREWGASW EQY +LF RG++ER HDYFSWLRITQV+ATA ILG+LWWQS
Sbjct  480   EEIKSKVCSTKREWGASWCEQYSILFRRGLKERRHDYFSWLRITQVLATATILGLLWWQS  539

Query  1363  GGDTPSQMQDQAGLLFFIAVFWGFFPVFTAIFTFPQEKAMLSKERAADMYRLSAYFAART  1184
             G D P+++QDQAGLLFFIAVFWGFFPVFTAIFTFPQE+AMLSKERAADMYRLSAYF ART
Sbjct  540   GSDNPNELQDQAGLLFFIAVFWGFFPVFTAIFTFPQERAMLSKERAADMYRLSAYFVART  599

Query  1183  TSdlpldlllpliflLVVYFMAGLKQDASSFLLTAVTVFLCIVVAQGLGLAIGATLMDLK  1004
             TSDLPLDL+LP++FLLVVYFMAGL+ +A SF LT VTVFLCI+ AQGLGLAIGATLMDLK
Sbjct  600   TSDLPLDLILPVLFLLVVYFMAGLRMNAGSFFLTIVTVFLCIIAAQGLGLAIGATLMDLK  659

Query  1003  KATTLASVTVMTFMLAGGYFIKKVPGFIVWLRDLSFNYHTFKLLLKVQYEHKTNSVNGVQ  824
             KATTLASVTVMTFMLAGGYF+K VP FI WLR LSFNYHT+KLLLKVQYEH ++S+NGV+
Sbjct  660   KATTLASVTVMTFMLAGGYFVKNVPVFISWLRYLSFNYHTYKLLLKVQYEHISHSINGVR  719

Query  823   IDSGIKEVGALAAMAVSYRLLAYISLRRMKLQ  728
             ID+G KEVG LA M V YRLLAY+SLRRMKL 
Sbjct  720   IDNGYKEVGVLATMVVGYRLLAYLSLRRMKLH  751



>ref|XP_009622617.1| PREDICTED: ABC transporter G family member 22-like [Nicotiana 
tomentosiformis]
Length=744

 Score =   989 bits (2558),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 546/752 (73%), Positives = 621/752 (83%), Gaps = 47/752 (6%)
 Frame = -2

Query  2878  MEQTNSTSLLRTKSDQLVEaiaaakgsarARLPRLSAEFAGSGVPESVRMLSRKPSRRLM  2699
             M++ ++TSLLRTKSDQLVEAI+AA G+ ++ +          G PE+   LSRK SRRL 
Sbjct  2     MDKPSTTSLLRTKSDQLVEAISAAMGATKSPISE------AVGGPET---LSRKSSRRLA  52

Query  2698  ppspggggsgGTNSTHIRKSRSAQMKLDLDElssgsvlsrassasl--GFSFTGFSVRPD  2525
               SPG   S    +THIRKSRSAQ+K DLDE+SSG+ LSRASSASL   FSFTGF+V PD
Sbjct  53    AASPGRSSSSIGKNTHIRKSRSAQLKFDLDEVSSGAALSRASSASLGLSFSFTGFTVPPD  112

Query  2524  ESADSKPFSDDENPEDLEAGTKKKRSIPAEPTFPIYLKFTEVSYKIVIKGVTFSEEKDIL  2345
             E AD KPFSDD+ PED+EAGT+K + I AEPT PIYLKFTEV YK+VIKGVT + EK+IL
Sbjct  113   EIADLKPFSDDDIPEDIEAGTRKMK-IQAEPTLPIYLKFTEVCYKVVIKGVTSTREKEIL  171

Query  2344  NGISGAVDPGEVLALMGPSGCGKTTLLSLLGGRIRDPSAG-SITYNQHPYSKLLKSRIGF  2168
              GISG+VDPGEVLA+MGPSG GKTTLLSLLGGRI++P+ G SITYN+ PYSKLLKSRIGF
Sbjct  172   TGISGSVDPGEVLAMMGPSGSGKTTLLSLLGGRIKEPTGGGSITYNEQPYSKLLKSRIGF  231

Query  2167  VTQDDILFPHLTVKETLIYAARLRLPRTLTKEEKDKRAMDVIYELGLDRCQDTMIGGSFV  1988
             VTQDDILFPHLTV+ETL YAARLRLP+TLTKEEK+KRA+DVIYELGL+RCQDTMIGGSFV
Sbjct  232   VTQDDILFPHLTVRETLTYAARLRLPKTLTKEEKEKRAIDVIYELGLERCQDTMIGGSFV  291

Query  1987  RGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILHEIAKAGKTVITTIH  1808
             RGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALR+V+ILH+IA+AGKTVITTIH
Sbjct  292   RGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRMVEILHDIAEAGKTVITTIH  351

Query  1807  QPSSRLFHk--------------------------------fdklilleflldLANGNIN  1724
             QPSSRLFHK                                   +   EFLLDLANGN+N
Sbjct  352   QPSSRLFHKFDKLILLGKGSLLYFGKASEAMVYFSAIGCSPLISMNPAEFLLDLANGNLN  411

Query  1723  DVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYETRVAETEKKKLMAPLPVE  1544
             DVS+PSEL DKVQ  NS  E    NGKP+P +VHEYLV  YET+VAE+EKKKLMAP+ ++
Sbjct  412   DVSVPSELEDKVQIGNSDRE--TGNGKPTPIVVHEYLVEAYETQVAESEKKKLMAPMMID  469

Query  1543  EELKSKVRYLKREWGASWSEQYVLLFHRGIRERWHDYFSWLRITQVIATALILGMLWWQS  1364
             EELKSKV  +KREWGASW EQY +LF RG++ER +DYFSWLRITQVIATALILGMLWWQS
Sbjct  470   EELKSKVFSIKREWGASWCEQYSILFWRGLKERRYDYFSWLRITQVIATALILGMLWWQS  529

Query  1363  GGDTPSQMQDQAGLLFFIAVFWGFFPVFTAIFTFPQEKAMLSKERAADMYRLSAYFAART  1184
             GGD+P QM++Q+GLLFFIAVFWGFFPVFTAIFTFPQE+AML+KER+ADMYRLSAYF ART
Sbjct  530   GGDSPKQMREQSGLLFFIAVFWGFFPVFTAIFTFPQERAMLNKERSADMYRLSAYFLART  589

Query  1183  TSdlpldlllpliflLVVYFMAGLKQDASSFLLTAVTVFLCIVVAQGLGLAIGATLMDLK  1004
             TSD+PLDL+LP++FLLVVYFMAGLK DA +F LT +T FLCIV AQGLGLAIGATLMDLK
Sbjct  590   TSDIPLDLILPVLFLLVVYFMAGLKHDADAFFLTVLTTFLCIVAAQGLGLAIGATLMDLK  649

Query  1003  KATTLASVTVMTFMLAGGYFIKKVPGFIVWLRDLSFNYHTFKLLLKVQYEHKTNSVNGVQ  824
             KATTLASVTVMTFMLAGGYF+KKVP FI WLR LS+NY T+KLLLKVQY+ K + V+G++
Sbjct  650   KATTLASVTVMTFMLAGGYFVKKVPVFISWLRYLSYNYQTYKLLLKVQYKEKNDWVDGIK  709

Query  823   IDSGIKEVGALAAMAVSYRLLAYISLRRMKLQ  728
             + SG+KEV  L AM   YRLLAYISLRRMKL 
Sbjct  710   VGSGVKEVCILLAMVFGYRLLAYISLRRMKLH  741



>ref|XP_009796795.1| PREDICTED: ABC transporter G family member 22-like isoform X1 
[Nicotiana sylvestris]
Length=744

 Score =   988 bits (2555),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 541/757 (71%), Positives = 615/757 (81%), Gaps = 57/757 (8%)
 Frame = -2

Query  2878  MEQTNSTSLLRTKSDQLVEaiaaakgsarARLPRLSAEFAG---SGVPESV---RMLSRK  2717
             M++ ++TSLLRTKSDQLVEA              +SA   G   S + E+V     LSRK
Sbjct  2     MDKPSTTSLLRTKSDQLVEA--------------ISAAMGGTKSSPISEAVGGPETLSRK  47

Query  2716  PSRRLMppspggggsgGTNSTHIRKSRSAQMKLDLDElssgsvlsrassasl--GFSFTG  2543
              SRRL   SPG   S    +THIRKSRSAQ+K DLDE+SSG+ LSRASSASL   FSFTG
Sbjct  48    SSRRLATASPGRSSSSIGKNTHIRKSRSAQLKFDLDEVSSGAALSRASSASLGLSFSFTG  107

Query  2542  FSVRPDESADSKPFSDDENPEDLEAGTKKKRSIPAEPTFPIYLKFTEVSYKIVIKGVTFS  2363
             F+V PDE AD KPFSDD+ PED+EAGT+K + I AEPT PIYLKFTEV YK+VIKGVT +
Sbjct  108   FTVPPDEIADLKPFSDDDIPEDIEAGTRKMK-IQAEPTLPIYLKFTEVCYKVVIKGVTST  166

Query  2362  EEKDILNGISGAVDPGEVLALMGPSGCGKTTLLSLLGGRIRDPSAGSITYNQHPYSKLLK  2183
              EK+IL GISG+VDPGEVLA+MGPSG GKTTLLSLLGGRI++P+ GSITYN+ PYSKLLK
Sbjct  167   REKEILTGISGSVDPGEVLAMMGPSGSGKTTLLSLLGGRIKEPTGGSITYNEQPYSKLLK  226

Query  2182  SRIGFVTQDDILFPHLTVKETLIYAARLRLPRTLTKEEKDKRAMDVIYELGLDRCQDTMI  2003
             SRIGFVTQDDILFPHLTV+ETL YAARLRLP+TLTKEEK+KRA+DVIYELGL+RCQDTMI
Sbjct  227   SRIGFVTQDDILFPHLTVRETLTYAARLRLPKTLTKEEKEKRAIDVIYELGLERCQDTMI  286

Query  2002  GGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILHEIAKAGKTV  1823
             GGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALR+V+ILH+IA+ GKTV
Sbjct  287   GGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRMVEILHDIAETGKTV  346

Query  1822  ITTIHQPSSRLFHk--------------------------------fdklilleflldLA  1739
             ITTIHQPSSRLFHK                                   +   EFLLDLA
Sbjct  347   ITTIHQPSSRLFHKFDKLILLGKGSLLYFGKASEAMVYFSAIGCSPLISMNPAEFLLDLA  406

Query  1738  NGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYETRVAETEKKKLMA  1559
             NGN+NDVS+PSEL D+VQ  NS  E    NGKP+P +VHEYLV  YET+VAE+EKKKLMA
Sbjct  407   NGNLNDVSVPSELEDRVQIGNSDRE--TGNGKPTPIVVHEYLVEAYETQVAESEKKKLMA  464

Query  1558  PLPVEEELKSKVRYLKREWGASWSEQYVLLFHRGIRERWHDYFSWLRITQVIATALILGM  1379
             P+ ++EELKSKV  + REWGASW EQY +LF RG++ER +DYFSWLRITQVIATALILGM
Sbjct  465   PMMIDEELKSKVFSINREWGASWCEQYSILFRRGLKERRYDYFSWLRITQVIATALILGM  524

Query  1378  LWWQSGGDTPSQMQDQAGLLFFIAVFWGFFPVFTAIFTFPQEKAMLSKERAADMYRLSAY  1199
             LWWQSGGD+P QM++Q+GLLFFIAVFWGFFPVFTAIFTFPQE+AML+KER+ADMYRLSAY
Sbjct  525   LWWQSGGDSPKQMREQSGLLFFIAVFWGFFPVFTAIFTFPQERAMLNKERSADMYRLSAY  584

Query  1198  FAARTTSdlpldlllpliflLVVYFMAGLKQDASSFLLTAVTVFLCIVVAQGLGLAIGAT  1019
             F ARTTSD+PLDL+LP++FLLVVYFMAGLK +A +F LT +T FLCIV AQGLGLAIGAT
Sbjct  585   FLARTTSDIPLDLILPVLFLLVVYFMAGLKHEADAFFLTVLTTFLCIVAAQGLGLAIGAT  644

Query  1018  LMDLKKATTLASVTVMTFMLAGGYFIKKVPGFIVWLRDLSFNYHTFKLLLKVQYEHKTNS  839
             LMDLKKATTLASVTVMTFMLAGGYF+KKVP FI WLR LS+NY T+KLLLKVQY+ K + 
Sbjct  645   LMDLKKATTLASVTVMTFMLAGGYFVKKVPVFISWLRYLSYNYQTYKLLLKVQYKEKNDW  704

Query  838   VNGVQIDSGIKEVGALAAMAVSYRLLAYISLRRMKLQ  728
             V+G+++ SG+KEV  L AM   YRLLAYISLRRMKL 
Sbjct  705   VDGIKVGSGVKEVCILLAMVFGYRLLAYISLRRMKLH  741



>ref|XP_002322764.1| ABC transporter family protein [Populus trichocarpa]
 gb|EEF04525.1| ABC transporter family protein [Populus trichocarpa]
Length=744

 Score =   957 bits (2475),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 532/752 (71%), Positives = 606/752 (81%), Gaps = 46/752 (6%)
 Frame = -2

Query  2878  MEQTNSTSLLRTKSDQLVEaiaaakgsarARLPRLSAEFAGSGVPESVRMLSRKPSRRLM  2699
             ME+ N TSL RT+S+QLVE +AAA  S        + E  G     S   LSRK S+RLM
Sbjct  1     MEKEN-TSLARTRSEQLVETVAAAFKSPS------NNEAIGVSDGSSGGTLSRKSSKRLM  53

Query  2698  ppspggggsgGTN-STHIRKSRSAQMKLDLDElssgsvlsrassasl--GFSFTGFSVRP  2528
               +  G  + G N +THIRKSRSAQMK DLD++SSG+ LSRASSASL   FSFTGF++ P
Sbjct  54    MAASPGRSTSGGNKNTHIRKSRSAQMKFDLDDVSSGAALSRASSASLGFSFSFTGFNMPP  113

Query  2527  DESADSKPFSDDENPEDLEAGTKKKRSIPAEPTFPIYLKFTEVSYKIVIKGVTFSEEKDI  2348
             DE ADSKPFSDD+ PEDLEAGT+K +    EPT PIYLKFT+V+YK++IKG+T +EEKDI
Sbjct  114   DEIADSKPFSDDDIPEDLEAGTRKPK-FQTEPTLPIYLKFTDVTYKVIIKGMTSTEEKDI  172

Query  2347  LNGISGAVDPGEVLALMGPSGCGKTTLLSLLGGRIRDPS-AGSITYNQHPYSKLLKSRIG  2171
             L GISG+VDPGEVLALMGPSG GKTTLL+L+GGR+   +  GS+TYN  PYSK LKSRIG
Sbjct  173   LYGISGSVDPGEVLALMGPSGSGKTTLLNLIGGRLNQTTVGGSLTYNDQPYSKFLKSRIG  232

Query  2170  FVTQDDILFPHLTVKETLIYAARLRLPRTLTKEEKDKRAMDVIYELGLDRCQDTMIGGSF  1991
             FVTQDD+LFPHLTVKETL YAA LRLP+TLTKE+K KRA+DVIYELGL+RCQDTMIGGSF
Sbjct  233   FVTQDDVLFPHLTVKETLTYAALLRLPKTLTKEQKQKRAIDVIYELGLERCQDTMIGGSF  292

Query  1990  VRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILHEIAKAGKTVITTI  1811
             VRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIV +L +IA+ GKTV+TTI
Sbjct  293   VRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVQLLQDIAEGGKTVVTTI  352

Query  1810  HQPSSRLFHk--------------------------------fdklilleflldLANGNI  1727
             HQPSSRLFHK                                   +   EFLLDLANGNI
Sbjct  353   HQPSSRLFHKFDKLILLGKGSLLYFGKASEAMLYFSSIGCNPLIAMNPAEFLLDLANGNI  412

Query  1726  NDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYETRVAETEKKKLMAPLPV  1547
             NDVS+PSEL DKVQ  NS+ E TRN GKPSPA+VHEYLV  YETRVA+ EKKKLM P+P+
Sbjct  413   NDVSVPSELEDKVQIGNSEAE-TRN-GKPSPAVVHEYLVEAYETRVADKEKKKLMVPIPL  470

Query  1546  EEELKSKVRYLKREWGASWSEQYVLLFHRGIRERWHDYFSWLRITQVIATALILGMLWWQ  1367
             +EE+KSKV   KR+WGASW EQY +LF RGI+ER HDYFSWLRITQV++TA+ILG+LWW+
Sbjct  471   DEEVKSKVSSRKRQWGASWWEQYTILFCRGIKERRHDYFSWLRITQVLSTAIILGLLWWK  530

Query  1366  SGGDTPSQMQDQAGLLFFIAVFWGFFPVFTAIFTFPQEKAMLSKERAADMYRLSAYFAAR  1187
             S   +P  +QDQAGLLFFIAVFWGFFPVFTAIFTFPQE+AMLSKERAADMYRLSAYF AR
Sbjct  531   SDSSSPKGLQDQAGLLFFIAVFWGFFPVFTAIFTFPQERAMLSKERAADMYRLSAYFLAR  590

Query  1186  TTSdlpldlllpliflLVVYFMAGLKQDASSFLLTAVTVFLCIVVAQGLGLAIGATLMDL  1007
             TTSDLPLDL+LP++FLLVVYFMAGL+  A+ F LT +TVFLCIV AQGLGLAIGATLMDL
Sbjct  591   TTSDLPLDLILPVLFLLVVYFMAGLRLSAAPFFLTMLTVFLCIVAAQGLGLAIGATLMDL  650

Query  1006  KKATTLASVTVMTFMLAGGYFIKKVPGFIVWLRDLSFNYHTFKLLLKVQYEHKTNSVNGV  827
             K+ATTLASVTVMTFMLAGGYF+KKVP F+ W+R +SFNYHT+KLLLKVQYEH T ++NG+
Sbjct  651   KRATTLASVTVMTFMLAGGYFVKKVPVFVSWIRYMSFNYHTYKLLLKVQYEHMTPAINGI  710

Query  826   QIDSGIKEVGALAAMAVSYRLLAYISLRRMKL  731
              ID G+ EV AL AM   YRLLAYISLRRMKL
Sbjct  711   GIDGGLTEVSALVAMVFGYRLLAYISLRRMKL  742



>ref|XP_011042537.1| PREDICTED: ABC transporter G family member 22 isoform X1 [Populus 
euphratica]
 ref|XP_011042538.1| PREDICTED: ABC transporter G family member 22 isoform X1 [Populus 
euphratica]
 ref|XP_011042539.1| PREDICTED: ABC transporter G family member 22 isoform X1 [Populus 
euphratica]
 ref|XP_011042540.1| PREDICTED: ABC transporter G family member 22 isoform X1 [Populus 
euphratica]
Length=744

 Score =   957 bits (2474),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 526/752 (70%), Positives = 603/752 (80%), Gaps = 46/752 (6%)
 Frame = -2

Query  2878  MEQTNSTSLLRTKSDQLVEaiaaakgsarARLPRLSAEFAGSGVPESVRMLSRKPSRRLM  2699
             ME+ N TSL RT+S+QLVE +AAA  S         ++ +  G       LSRK S+RLM
Sbjct  1     MEKEN-TSLARTRSEQLVETVAAAFKSPSNNEANAVSDASSGGT------LSRKSSKRLM  53

Query  2698  ppspggggsgGTN-STHIRKSRSAQMKLDLDElssgsvlsrassasl--GFSFTGFSVRP  2528
               +  G  + G N +THIRKSRSAQMK DLD++SSG+ LSRASSASL   FSFTGF++ P
Sbjct  54    MAASPGRSTSGGNKNTHIRKSRSAQMKFDLDDVSSGAALSRASSASLGFSFSFTGFNMPP  113

Query  2527  DESADSKPFSDDENPEDLEAGTKKKRSIPAEPTFPIYLKFTEVSYKIVIKGVTFSEEKDI  2348
             DE ADSKPFSDD+ PEDLEAGT+K +    EPT PIYLKFT+V+YK++IKG+T +EEKDI
Sbjct  114   DEIADSKPFSDDDIPEDLEAGTRKPK-FQTEPTLPIYLKFTDVTYKVIIKGMTSTEEKDI  172

Query  2347  LNGISGAVDPGEVLALMGPSGCGKTTLLSLLGGRIRDPS-AGSITYNQHPYSKLLKSRIG  2171
             LNGISG+VDPGEVLALMGPSG GKTTLL+L+GGR+   +  G++TYN  PYSK LKSRIG
Sbjct  173   LNGISGSVDPGEVLALMGPSGSGKTTLLNLIGGRLNQTTVGGALTYNDQPYSKFLKSRIG  232

Query  2170  FVTQDDILFPHLTVKETLIYAARLRLPRTLTKEEKDKRAMDVIYELGLDRCQDTMIGGSF  1991
             FVTQDD+LFPHLTVKETL YAA LRLP+TLT+E+K KRA+DVIYELGL+RCQDTMIGGSF
Sbjct  233   FVTQDDVLFPHLTVKETLTYAALLRLPKTLTEEQKQKRAIDVIYELGLERCQDTMIGGSF  292

Query  1990  VRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILHEIAKAGKTVITTI  1811
             VRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIV +L +IA+ GKTV+TTI
Sbjct  293   VRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVQLLQDIAEGGKTVVTTI  352

Query  1810  HQPSSRLFHk--------------------------------fdklilleflldLANGNI  1727
             HQPSSRLFHK                                   +   EFLLDLANGNI
Sbjct  353   HQPSSRLFHKFDKLILLGKGSLLYFGKASEAMLYFSSIGCNPLIAMNPAEFLLDLANGNI  412

Query  1726  NDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYETRVAETEKKKLMAPLPV  1547
             NDVS+PSEL DKVQ WNS  E    NGKPSPA+VHEYLV  YETR A+ EKKKLM P+P+
Sbjct  413   NDVSVPSELEDKVQIWNSDAE--MRNGKPSPAVVHEYLVEAYETRAADKEKKKLMVPIPL  470

Query  1546  EEELKSKVRYLKREWGASWSEQYVLLFHRGIRERWHDYFSWLRITQVIATALILGMLWWQ  1367
             +EE+KSKV   KR+WGASW EQY +LF RGI+ER HDYFSWLRITQV++TA+ILG+LWW+
Sbjct  471   DEEVKSKVSSRKRQWGASWWEQYTILFCRGIKERRHDYFSWLRITQVLSTAIILGLLWWK  530

Query  1366  SGGDTPSQMQDQAGLLFFIAVFWGFFPVFTAIFTFPQEKAMLSKERAADMYRLSAYFAAR  1187
             S   +P  +QDQAGLLFFIAVFWGFFPVFTAIFTFPQE+AMLSKERAADMYRLSAYF AR
Sbjct  531   SDSSSPKGLQDQAGLLFFIAVFWGFFPVFTAIFTFPQERAMLSKERAADMYRLSAYFLAR  590

Query  1186  TTSdlpldlllpliflLVVYFMAGLKQDASSFLLTAVTVFLCIVVAQGLGLAIGATLMDL  1007
             TTSDLPLDL+LP++FLLVVYFMAGL+  A+ F LT +TVFLCIV AQGLGLAIGATLMDL
Sbjct  591   TTSDLPLDLILPVLFLLVVYFMAGLRLSAAPFFLTVLTVFLCIVAAQGLGLAIGATLMDL  650

Query  1006  KKATTLASVTVMTFMLAGGYFIKKVPGFIVWLRDLSFNYHTFKLLLKVQYEHKTNSVNGV  827
             K+ATTLASVTVMTFMLAGGYF+KKVP F+ W+R +SFNYHT+KLLLKVQYE+ T ++N  
Sbjct  651   KRATTLASVTVMTFMLAGGYFVKKVPVFVSWIRYMSFNYHTYKLLLKVQYENVTPAINSN  710

Query  826   QIDSGIKEVGALAAMAVSYRLLAYISLRRMKL  731
              IDSG+ EV AL AM   YRLLAYISLRRMKL
Sbjct  711   GIDSGLTEVSALVAMVFGYRLLAYISLRRMKL  742



>gb|KDP36071.1| hypothetical protein JCGZ_08715 [Jatropha curcas]
Length=749

 Score =   957 bits (2473),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 527/754 (70%), Positives = 601/754 (80%), Gaps = 45/754 (6%)
 Frame = -2

Query  2878  MEQTNSTSLLRTKSDQLVEaiaaakgsarARLPRLSAEFAGSGVPESVRMLSRKPSRRLM  2699
             ME+T  +SL+RTKSDQLVE +AAA      + P  S    G    ES   LSRK S+RLM
Sbjct  1     MEKTTVSSLVRTKSDQLVETVAAAF-----KSPPKSEAVIGGATSESSGTLSRKSSKRLM  55

Query  2698  pps--pggggsgGTNSTHIRKSRSAQMKLDLDElssgsvlsrassasl--GFSFTGFSVR  2531
               S        G   +THIRKSRSAQ+K DLD++SSG+ LSRASSASL   FSFTGF+V 
Sbjct  56    MASPGRSSSVGGSNKNTHIRKSRSAQLKFDLDDVSSGAALSRASSASLGLSFSFTGFAVP  115

Query  2530  PDESADSKPFSDDENPEDLEAGTKKKRSIPAEPTFPIYLKFTEVSYKIVIKGVTFSEEKD  2351
              DE ADSKPFSDD+ PED+EAG +K +    EPT PIYLKFT+V+YK+ IKG+T S EKD
Sbjct  116   QDEIADSKPFSDDDIPEDIEAGNRKPK-FQTEPTLPIYLKFTDVTYKVTIKGMTSSVEKD  174

Query  2350  ILNGISGAVDPGEVLALMGPSGCGKTTLLSLLGGRIRDPS-AGSITYNQHPYSKLLKSRI  2174
             ILNGI+G+VDPG+VLALMGPSG GKT+LL+LL GR+   +  GS+TYN   YSK LKSRI
Sbjct  175   ILNGITGSVDPGQVLALMGPSGSGKTSLLNLLAGRLIPANVGGSVTYNDQRYSKFLKSRI  234

Query  2173  GFVTQDDILFPHLTVKETLIYAARLRLPRTLTKEEKDKRAMDVIYELGLDRCQDTMIGGS  1994
             GFVTQDD+LFPHLTVKETL YAA LRLP+ LTKE+K+KRA+DVIYELGL+RCQDTMIGGS
Sbjct  235   GFVTQDDVLFPHLTVKETLTYAALLRLPKKLTKEQKEKRAIDVIYELGLERCQDTMIGGS  294

Query  1993  FVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILHEIAKAGKTVITT  1814
             FVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIV +L +IA+AGKTV+TT
Sbjct  295   FVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVQMLQDIAEAGKTVVTT  354

Query  1813  IHQPSSRLFHk--------------------------------fdklilleflldLANGN  1730
             IHQPSSRLFHK                                   +   EFLLDLANGN
Sbjct  355   IHQPSSRLFHKFDKLILLGKGNLLYFGKASEAMTYFSSIGCNPLIAMNPAEFLLDLANGN  414

Query  1729  INDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYETRVAETEKKKLMAPLP  1550
             INDVS+PSEL DKVQ  NS  E TRN GKPSPA+VHEYLV  YETRVAE EKKKLMAP+P
Sbjct  415   INDVSVPSELDDKVQMGNSDNE-TRN-GKPSPAVVHEYLVEAYETRVAENEKKKLMAPIP  472

Query  1549  VEEELKSKVRYLKREWGASWSEQYVLLFHRGIRERWHDYFSWLRITQVIATALILGMLWW  1370
             ++EE+K KV   KR+WGASW EQY +LF RGI+ER HDYFSWLRITQV++TA+ILG+LWW
Sbjct  473   LDEEVKLKVSSPKRQWGASWWEQYTILFCRGIKERRHDYFSWLRITQVLSTAIILGLLWW  532

Query  1369  QSGGDTPSQMQDQAGLLFFIAVFWGFFPVFTAIFTFPQEKAMLSKERAADMYRLSAYFAA  1190
             QS   +P  +QDQAGLLFFIAVFWGFFPVFTAIFTFPQE+AML+KERAADMYRLSAYF A
Sbjct  533   QSDSSSPKGLQDQAGLLFFIAVFWGFFPVFTAIFTFPQERAMLNKERAADMYRLSAYFLA  592

Query  1189  RTTSdlpldlllpliflLVVYFMAGLKQDASSFLLTAVTVFLCIVVAQGLGLAIGATLMD  1010
             RTTSDLPLDL+LP++FLLVVYFMAGL+  A+ F L+ +TVFLCIV AQGLGLAIGATLMD
Sbjct  593   RTTSDLPLDLILPVLFLLVVYFMAGLRMSAAPFFLSLLTVFLCIVAAQGLGLAIGATLMD  652

Query  1009  LKKATTLASVTVMTFMLAGGYFIKKVPGFIVWLRDLSFNYHTFKLLLKVQYEHKTNSVNG  830
             LKKATTLASVTVMTFMLAGGYF+KKVP F+ W+R +SFNYHT+KLLLKVQYEH ++ + G
Sbjct  653   LKKATTLASVTVMTFMLAGGYFVKKVPIFVAWIRYMSFNYHTYKLLLKVQYEHASSPIKG  712

Query  829   VQIDSGIKEVGALAAMAVSYRLLAYISLRRMKLQ  728
             ++IDSG+ EVGAL AM   YRLLAYISLR MKL 
Sbjct  713   MRIDSGLTEVGALVAMVFGYRLLAYISLRNMKLN  746



>ref|XP_004228604.1| PREDICTED: ABC transporter G family member 22-like [Solanum lycopersicum]
 ref|XP_010315863.1| PREDICTED: ABC transporter G family member 22-like [Solanum lycopersicum]
Length=749

 Score =   956 bits (2471),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 537/751 (72%), Positives = 607/751 (81%), Gaps = 40/751 (5%)
 Frame = -2

Query  2878  MEQTNSTSLLRTKSDQLVEaiaaakgsarARLPRLSAEFAGSGVPESVRMLSRKPSRRLM  2699
             M++ ++TSLLRTKSDQLVEAI+AA G      P       G G PE+   LSRK SRRL 
Sbjct  2     MDKPSTTSLLRTKSDQLVEAISAAMGGGTKSSPMNGDVAGGGGGPET---LSRKSSRRL-  57

Query  2698  ppspggggsgGTNSTHIRKSRSAQMKLDLDElssgsvlsrassasl--GFSFTGFSVRPD  2525
               +  G   GG N+THIRKSRSAQ+K DLDE+SSG+ LSRASSASL   FSFTGF+V  D
Sbjct  58    TGASPGRSGGGRNNTHIRKSRSAQLKFDLDEVSSGAALSRASSASLGLSFSFTGFTVPSD  117

Query  2524  ESADSKPFSDDENPEDLEAGTKKKRSIPAEPTFPIYLKFTEVSYKIVIKGVTFSEEKDIL  2345
             E AD KPFSDD++  +      +K  I AEPT PIYLKFTEV YK+VIKGVT + EK+IL
Sbjct  118   EIADMKPFSDDDDIAEDIEAGTRKMKIQAEPTLPIYLKFTEVCYKVVIKGVTSTREKEIL  177

Query  2344  NGISGAVDPGEVLALMGPSGCGKTTLLSLLGGRIRDPSAGSITYNQHPYSKLLKSRIGFV  2165
              GISG+VDPGEVLA+MGPSG GKTTLLSLLGGR+++P+ GSITYN+ PYSK LKSRIGFV
Sbjct  178   TGISGSVDPGEVLAMMGPSGSGKTTLLSLLGGRVKEPTGGSITYNEQPYSKHLKSRIGFV  237

Query  2164  TQDDILFPHLTVKETLIYAARLRLPRTLTKEEKDKRAMDVIYELGLDRCQDTMIGGSFVR  1985
             TQDDILFPHLTV+ETL YAARLRLP+ LTKEEK KRA+DVIYELGL+RCQDTMIGGSFVR
Sbjct  238   TQDDILFPHLTVRETLTYAARLRLPKKLTKEEKQKRAIDVIYELGLERCQDTMIGGSFVR  297

Query  1984  GVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILHEIAKAGKTVITTIHQ  1805
             GVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALR V+ILH+IA+AGKTVITTIHQ
Sbjct  298   GVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRTVEILHDIAEAGKTVITTIHQ  357

Query  1804  PSSRLFHk--------------------------------fdklilleflldLANGNIND  1721
             PSSRLFHK                                   +   EFLLDLANGN+ND
Sbjct  358   PSSRLFHKFDKLILLGKGSLLYFGKASEAMDYFSTIGCTPLISMNPAEFLLDLANGNLND  417

Query  1720  VSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYETRVAETEKKKLMAPLPVEE  1541
             VS+PSEL DKVQ  NS  E TRN GKPSPAIVHEYLV  YETRVAE+EKKKL+AP+ ++E
Sbjct  418   VSVPSELEDKVQIGNSDTE-TRN-GKPSPAIVHEYLVEAYETRVAESEKKKLLAPMMIDE  475

Query  1540  ELKSKVRYLKREWGASWSEQYVLLFHRGIRERWHDYFSWLRITQVIATALILGMLWWQSG  1361
             ELKSKV   KREWGASW  QY +LF RG++ER HDYFSWLRITQV+ATA+ILGMLWWQSG
Sbjct  476   ELKSKVVTSKREWGASWWTQYSILFWRGLKERRHDYFSWLRITQVVATAVILGMLWWQSG  535

Query  1360  GDTPSQMQDQAGLLFFIAVFWGFFPVFTAIFTFPQEKAMLSKERAADMYRLSAYFAARTT  1181
             GD+P  MQ+QAGLLFFIAVFWGFFPVFTAIFTFPQE+AML+KER+ADMYRLSAYF ARTT
Sbjct  536   GDSPKHMQEQAGLLFFIAVFWGFFPVFTAIFTFPQERAMLNKERSADMYRLSAYFLARTT  595

Query  1180  SdlpldlllpliflLVVYFMAGLKQDASSFLLTAVTVFLCIVVAQGLGLAIGATLMDLKK  1001
             SD+PLDL+LP++F+LVVYFMAGLK D  +F LT +T FLCIV AQGLGLAIGATLMDLKK
Sbjct  596   SDIPLDLILPVLFILVVYFMAGLKHDVCAFFLTVLTTFLCIVAAQGLGLAIGATLMDLKK  655

Query  1000  ATTLASVTVMTFMLAGGYFIKKVPGFIVWLRDLSFNYHTFKLLLKVQYEHKTNSVNGVQI  821
             ATTLASVTVMTFMLAGGYF+K+VP FI WLR LS+NY T+KLLLKVQY+ K + V+G+++
Sbjct  656   ATTLASVTVMTFMLAGGYFVKEVPVFISWLRYLSYNYQTYKLLLKVQYKEKNDWVDGIKV  715

Query  820   DSGIKEVGALAAMAVSYRLLAYISLRRMKLQ  728
              +G+KEV  L AM   YRLLAYISLRRMKL 
Sbjct  716   GNGVKEVSTLLAMVFGYRLLAYISLRRMKLH  746



>ref|XP_006348422.1| PREDICTED: ABC transporter G family member 22-like [Solanum tuberosum]
Length=751

 Score =   953 bits (2464),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 542/753 (72%), Positives = 612/753 (81%), Gaps = 42/753 (6%)
 Frame = -2

Query  2878  MEQTNSTSLLRTKSDQLVEaiaaakgsarARLPRLSAEFAGSGVPESVRMLSRKPSRRLM  2699
             M++ ++TSLLRTKSDQLVEAI+AA G      P ++ + AG G       LSRK SRRL 
Sbjct  2     MDRPSTTSLLRTKSDQLVEAISAAMGGGTKSSP-MNGDVAGGGGGSET--LSRKSSRRLT  58

Query  2698  ppspggggsgGTNSTHIRKSRSAQMKLDLDElssgsvlsrassasl--GFSFTGFSVRPD  2525
               SPG  G G  N+THIRKSRSAQ+K DLDE+SSG+ LSRASSASL   FSFTGF+V  D
Sbjct  59    GASPGRSGVGSKNNTHIRKSRSAQLKFDLDEVSSGAALSRASSASLGLSFSFTGFTVPSD  118

Query  2524  ESADSKPFSDDENPEDLE--AGTKKKRSIPAEPTFPIYLKFTEVSYKIVIKGVTFSEEKD  2351
             E AD KPFSDD++    +  AGT+K + I AEPT PIYLKFTEV YK+VIKGVT + EK+
Sbjct  119   EIADMKPFSDDDDDIPEDIEAGTRKMK-IQAEPTLPIYLKFTEVCYKVVIKGVTSTREKE  177

Query  2350  ILNGISGAVDPGEVLALMGPSGCGKTTLLSLLGGRIRDPSAGSITYNQHPYSKLLKSRIG  2171
             IL GISG+VDPGEVLA+MGPSG GKTTLLSLLGGR+++P+ GSITYN+ PYSK LKSRIG
Sbjct  178   ILTGISGSVDPGEVLAMMGPSGSGKTTLLSLLGGRVKEPTGGSITYNEQPYSKHLKSRIG  237

Query  2170  FVTQDDILFPHLTVKETLIYAARLRLPRTLTKEEKDKRAMDVIYELGLDRCQDTMIGGSF  1991
             FVTQDDILFPHLTV+ETL YAARLRLP+ LTKEEK KRA+DVIYELGL+RCQDTMIGGSF
Sbjct  238   FVTQDDILFPHLTVRETLTYAARLRLPKKLTKEEKQKRAIDVIYELGLERCQDTMIGGSF  297

Query  1990  VRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILHEIAKAGKTVITTI  1811
             VRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALR V+ILH+IA+AGKTVITTI
Sbjct  298   VRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRTVEILHDIAEAGKTVITTI  357

Query  1810  HQPSSRLFHkfdklilleflldL--------------------------------ANGNI  1727
             HQPSSRLFHKFDKLILL     L                                ANGN+
Sbjct  358   HQPSSRLFHKFDKLILLGKGSLLYFGKASEAMDYFSTIGCTPLIPMNPAEFLLDLANGNL  417

Query  1726  NDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYETRVAETEKKKLMAPLPV  1547
             NDVS+PSEL DKVQ  NS  E TRN GKPSPAIVHEYLV  YETRVAE+EKKKLMAP+ +
Sbjct  418   NDVSVPSELEDKVQIGNSDTE-TRN-GKPSPAIVHEYLVEAYETRVAESEKKKLMAPMMI  475

Query  1546  EEELKSKVRYLKREWGASWSEQYVLLFHRGIRERWHDYFSWLRITQVIATALILGMLWWQ  1367
             +EELKSKV   KREWGASW  QY +LF RG++ER HDYFSWLRITQV+ATA+ILGMLWWQ
Sbjct  476   DEELKSKVVTSKREWGASWWTQYSILFWRGLKERRHDYFSWLRITQVVATAVILGMLWWQ  535

Query  1366  SGGDTPSQMQDQAGLLFFIAVFWGFFPVFTAIFTFPQEKAMLSKERAADMYRLSAYFAAR  1187
             SGG +P  MQ+QAGLLFFIAVFWGFFPVFTAIFTFPQE+AML KER+ADMYRLSAYF AR
Sbjct  536   SGGGSPKHMQEQAGLLFFIAVFWGFFPVFTAIFTFPQERAMLDKERSADMYRLSAYFLAR  595

Query  1186  TTSdlpldlllpliflLVVYFMAGLKQDASSFLLTAVTVFLCIVVAQGLGLAIGATLMDL  1007
             TTSD+PLDL+LP++F+LVVYFMAGLK D  +F LT +T FLCIV AQGLGLAIGATLMDL
Sbjct  596   TTSDIPLDLILPVLFILVVYFMAGLKHDVCAFFLTVLTTFLCIVAAQGLGLAIGATLMDL  655

Query  1006  KKATTLASVTVMTFMLAGGYFIKKVPGFIVWLRDLSFNYHTFKLLLKVQYEHKTNSVNGV  827
             KKATTLASVTVMTFMLAGGYF+K+VP FI WLR LS+NY T+KLLLKVQY+ K + V+G+
Sbjct  656   KKATTLASVTVMTFMLAGGYFVKEVPVFISWLRYLSYNYQTYKLLLKVQYKEKNDWVDGI  715

Query  826   QIDSGIKEVGALAAMAVSYRLLAYISLRRMKLQ  728
             ++ +G++EV  L AM   YRLLAYISLRRMKL 
Sbjct  716   KVGNGVREVSTLLAMVFGYRLLAYISLRRMKLH  748



>ref|XP_006575266.1| PREDICTED: ABC transporter G family member 22 isoform X2 [Glycine 
max]
Length=782

 Score =   952 bits (2461),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 529/763 (69%), Positives = 609/763 (80%), Gaps = 54/763 (7%)
 Frame = -2

Query  2902  SCTVNQFQMEQTNSTSLLRTKSDQLVEaiaaakgsarARLPRLSAEFAGSGVPESVRMLS  2723
             SC + +  ME+ N TSL+RTKSDQLVE++ AA  S        S++ + +GV E    +S
Sbjct  33    SCIL-KVTMEKAN-TSLVRTKSDQLVESMVAALKSPA------SSDHSANGVVEGGGTIS  84

Query  2722  RKPSRRLMppspggggsgGTNSTHIRKSRSAQ---MKLDLDElssgsvlsrassasl--G  2558
             RK SRRL     G     G  +THIRKSRSAQ   MKL+LD++SSG+ LSRASSASL   
Sbjct  85    RKSSRRL----TGASPGRGGKNTHIRKSRSAQISQMKLELDDVSSGAALSRASSASLGLS  140

Query  2557  FSFTGFSVRPDESADSKPFSDDENPEDLEAGTKKKRSIPAEPTFPIYLKFTEVSYKIVIK  2378
             FSFTGF++ P+E ADSKPFSDD+ PED+E+G + K     EPT PIYLKFT+V+YKIVIK
Sbjct  141   FSFTGFTMPPEEIADSKPFSDDDIPEDIESGPRTK--FQTEPTLPIYLKFTDVTYKIVIK  198

Query  2377  GVTFSEEKDILNGISGAVDPGEVLALMGPSGCGKTTLLSLLGGRIRDP-SAGSITYNQHP  2201
             G+T +EEKDILNGI+G+V+PGEVLALMGPSG GKTTLL+LLGGR+  P S GSITYN  P
Sbjct  199   GMTTTEEKDILNGITGSVNPGEVLALMGPSGSGKTTLLNLLGGRLSHPISGGSITYNDQP  258

Query  2200  YSKLLKSRIGFVTQDDILFPHLTVKETLIYAARLRLPRTLTKEEKDKRAMDVIYELGLDR  2021
             YSK LKSRIGFVTQDD+LFPHLTVKETL YAARLRLP+T TKE+K+KRA+DVIYELGL+R
Sbjct  259   YSKFLKSRIGFVTQDDVLFPHLTVKETLTYAARLRLPKTYTKEQKEKRALDVIYELGLER  318

Query  2020  CQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILHEIA  1841
             CQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIV +L +IA
Sbjct  319   CQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVQMLQDIA  378

Query  1840  KAGKTVITTIHQPSSRLFHk--------------------------------fdklille  1757
             +AGKTV+TTIHQPSSRLFHK                                   +   E
Sbjct  379   EAGKTVVTTIHQPSSRLFHKFDKLILLGKGSLLYFGKASEAMTYFQSIGCSPLISMNPAE  438

Query  1756  flldLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYETRVAETE  1577
             FLLDLANGNINDVS+PSEL DKVQ  N++ E    NGKPSPA+VHEYLV  YETRVAETE
Sbjct  439   FLLDLANGNINDVSLPSELEDKVQMGNAEAETL--NGKPSPAVVHEYLVEAYETRVAETE  496

Query  1576  KKKLMAPLPVEEELKSKVRYLKREWGASWSEQYVLLFHRGIRERWHDYFSWLRITQVIAT  1397
             KK+LM P+P++E LK+KV   KR+WGASW EQY +LF RGI+ER HDYFSWLRITQV++T
Sbjct  497   KKRLMVPIPIDEALKTKVCSHKRQWGASWDEQYSILFWRGIKERRHDYFSWLRITQVLST  556

Query  1396  ALILGMLWWQSGGDTPSQMQDQAGLLFFIAVFWGFFPVFTAIFTFPQEKAMLSKERAADM  1217
             A+ILG+LWWQS    P  +QDQAGLLFFIAVFWGFFPVFTAIFTFPQE+AMLSKERAADM
Sbjct  557   AVILGLLWWQSDTKNPKDLQDQAGLLFFIAVFWGFFPVFTAIFTFPQERAMLSKERAADM  616

Query  1216  YRLSAYFAARTTSdlpldlllpliflLVVYFMAGLKQDASSFLLTAVTVFLCIVVAQGLG  1037
             YRLSAYF ARTTSDLPLDL+LP++FLLVVYFMAGL+   + F LT +TVFLCIV AQGLG
Sbjct  617   YRLSAYFLARTTSDLPLDLILPVLFLLVVYFMAGLRLSVAPFFLTILTVFLCIVAAQGLG  676

Query  1036  LAIGATLMDLKKATTLASVTVMTFMLAGGYFIKKVPGFIVWLRDLSFNYHTFKLLLKVQY  857
             LAIGATLMDLK+ATTLASVTVMTFMLAGG+F+++VP F  W+R +SFNYHT+KLLLKVQY
Sbjct  677   LAIGATLMDLKRATTLASVTVMTFMLAGGFFVQRVPIFFSWIRYMSFNYHTYKLLLKVQY  736

Query  856   EHKTNSVNGVQIDSGIKEVGALAAMAVSYRLLAYISLRRMKLQ  728
             EH +  +NG++IDSG  EV AL AM   YR LAY+SLRRMKLQ
Sbjct  737   EHISPVINGMRIDSGATEVAALIAMVFGYRFLAYLSLRRMKLQ  779



>ref|XP_003519092.1| PREDICTED: ABC transporter G family member 22 isoform X1 [Glycine 
max]
Length=743

 Score =   951 bits (2458),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 527/755 (70%), Positives = 605/755 (80%), Gaps = 53/755 (7%)
 Frame = -2

Query  2878  MEQTNSTSLLRTKSDQLVEaiaaakgsarARLPRLSAEFAGSGVPESVRMLSRKPSRRLM  2699
             ME+ N TSL+RTKSDQLVE++ AA  S        S++ + +GV E    +SRK SRRL 
Sbjct  1     MEKAN-TSLVRTKSDQLVESMVAALKSPA------SSDHSANGVVEGGGTISRKSSRRL-  52

Query  2698  ppspggggsgGTNSTHIRKSRSAQ---MKLDLDElssgsvlsrassasl--GFSFTGFSV  2534
                 G     G  +THIRKSRSAQ   MKL+LD++SSG+ LSRASSASL   FSFTGF++
Sbjct  53    ---TGASPGRGGKNTHIRKSRSAQISQMKLELDDVSSGAALSRASSASLGLSFSFTGFTM  109

Query  2533  RPDESADSKPFSDDENPEDLEAGTKKKRSIPAEPTFPIYLKFTEVSYKIVIKGVTFSEEK  2354
              P+E ADSKPFSDD+ PED+E+G + K     EPT PIYLKFT+V+YKIVIKG+T +EEK
Sbjct  110   PPEEIADSKPFSDDDIPEDIESGPRTK--FQTEPTLPIYLKFTDVTYKIVIKGMTTTEEK  167

Query  2353  DILNGISGAVDPGEVLALMGPSGCGKTTLLSLLGGRIRDP-SAGSITYNQHPYSKLLKSR  2177
             DILNGI+G+V+PGEVLALMGPSG GKTTLL+LLGGR+  P S GSITYN  PYSK LKSR
Sbjct  168   DILNGITGSVNPGEVLALMGPSGSGKTTLLNLLGGRLSHPISGGSITYNDQPYSKFLKSR  227

Query  2176  IGFVTQDDILFPHLTVKETLIYAARLRLPRTLTKEEKDKRAMDVIYELGLDRCQDTMIGG  1997
             IGFVTQDD+LFPHLTVKETL YAARLRLP+T TKE+K+KRA+DVIYELGL+RCQDTMIGG
Sbjct  228   IGFVTQDDVLFPHLTVKETLTYAARLRLPKTYTKEQKEKRALDVIYELGLERCQDTMIGG  287

Query  1996  SFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILHEIAKAGKTVIT  1817
             SFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIV +L +IA+AGKTV+T
Sbjct  288   SFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVQMLQDIAEAGKTVVT  347

Query  1816  TIHQPSSRLFHk--------------------------------fdklilleflldLANG  1733
             TIHQPSSRLFHK                                   +   EFLLDLANG
Sbjct  348   TIHQPSSRLFHKFDKLILLGKGSLLYFGKASEAMTYFQSIGCSPLISMNPAEFLLDLANG  407

Query  1732  NINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYETRVAETEKKKLMAPL  1553
             NINDVS+PSEL DKVQ  N++ E    NGKPSPA+VHEYLV  YETRVAETEKK+LM P+
Sbjct  408   NINDVSLPSELEDKVQMGNAEAETL--NGKPSPAVVHEYLVEAYETRVAETEKKRLMVPI  465

Query  1552  PVEEELKSKVRYLKREWGASWSEQYVLLFHRGIRERWHDYFSWLRITQVIATALILGMLW  1373
             P++E LK+KV   KR+WGASW EQY +LF RGI+ER HDYFSWLRITQV++TA+ILG+LW
Sbjct  466   PIDEALKTKVCSHKRQWGASWDEQYSILFWRGIKERRHDYFSWLRITQVLSTAVILGLLW  525

Query  1372  WQSGGDTPSQMQDQAGLLFFIAVFWGFFPVFTAIFTFPQEKAMLSKERAADMYRLSAYFA  1193
             WQS    P  +QDQAGLLFFIAVFWGFFPVFTAIFTFPQE+AMLSKERAADMYRLSAYF 
Sbjct  526   WQSDTKNPKDLQDQAGLLFFIAVFWGFFPVFTAIFTFPQERAMLSKERAADMYRLSAYFL  585

Query  1192  ARTTSdlpldlllpliflLVVYFMAGLKQDASSFLLTAVTVFLCIVVAQGLGLAIGATLM  1013
             ARTTSDLPLDL+LP++FLLVVYFMAGL+   + F LT +TVFLCIV AQGLGLAIGATLM
Sbjct  586   ARTTSDLPLDLILPVLFLLVVYFMAGLRLSVAPFFLTILTVFLCIVAAQGLGLAIGATLM  645

Query  1012  DLKKATTLASVTVMTFMLAGGYFIKKVPGFIVWLRDLSFNYHTFKLLLKVQYEHKTNSVN  833
             DLK+ATTLASVTVMTFMLAGG+F+++VP F  W+R +SFNYHT+KLLLKVQYEH +  +N
Sbjct  646   DLKRATTLASVTVMTFMLAGGFFVQRVPIFFSWIRYMSFNYHTYKLLLKVQYEHISPVIN  705

Query  832   GVQIDSGIKEVGALAAMAVSYRLLAYISLRRMKLQ  728
             G++IDSG  EV AL AM   YR LAY+SLRRMKLQ
Sbjct  706   GMRIDSGATEVAALIAMVFGYRFLAYLSLRRMKLQ  740



>ref|XP_007028065.1| White-brown-complex ABC transporter family isoform 2 [Theobroma 
cacao]
 gb|EOY08567.1| White-brown-complex ABC transporter family isoform 2 [Theobroma 
cacao]
Length=746

 Score =   950 bits (2456),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 542/753 (72%), Positives = 609/753 (81%), Gaps = 46/753 (6%)
 Frame = -2

Query  2878  MEQ-TNSTSLLRTKSDQLVEaiaaakgsarARLPRLSAEFAGSGVPESVRMLSRKPSRRL  2702
             ME+ TNST+L RTKSDQLVE +AAA      + P  S +    G  +S   LSRK SRRL
Sbjct  1     MEKPTNSTTLARTKSDQLVETLAAAF-----KSPTQSDQ--APGTSDSGGTLSRKSSRRL  53

Query  2701  MppspggggsgGTNSTHIRKSRSAQMKLDLDElssgsvlsrassasl--GFSFTGFSVRP  2528
             M  +  G  SGG+ +THIRKSRSAQMKLDL+ELSSG+ LSRASSASL   FSFTGF+V P
Sbjct  54    MMAASPGRSSGGSKNTHIRKSRSAQMKLDLEELSSGAALSRASSASLGLSFSFTGFTVPP  113

Query  2527  DESADSKPFSDDENPEDLEAGTKKKRSIPAEPTFPIYLKFTEVSYKIVIKGVTFSEEKDI  2348
             DE ADSKPFSDD+ PED+EAGT K +    EPT PIYLKFT+V+YK++IKG+T SEE+DI
Sbjct  114   DEIADSKPFSDDDIPEDIEAGTHKPK-FQTEPTLPIYLKFTDVTYKVIIKGMTTSEERDI  172

Query  2347  LNGISGAVDPGEVLALMGPSGCGKTTLLSLLGGRIRDPS-AGSITYNQHPYSKLLKSRIG  2171
             L+GISGAV+PGEVLALMGPSG GKTTLL+LLGGR+   S  GSITYN  PYSK LKSRIG
Sbjct  173   LSGISGAVNPGEVLALMGPSGSGKTTLLNLLGGRLNQSSVGGSITYNDQPYSKFLKSRIG  232

Query  2170  FVTQDDILFPHLTVKETLIYAARLRLPRTLTKEEKDKRAMDVIYELGLDRCQDTMIGGSF  1991
             FVTQDD+LFPHLTVKETL YAARLRLP+TLTK++K+KRA+DVIYELGL+RCQDTMIGGSF
Sbjct  233   FVTQDDVLFPHLTVKETLTYAARLRLPKTLTKQQKEKRAIDVIYELGLERCQDTMIGGSF  292

Query  1990  VRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILHEIAKAGKTVITTI  1811
             VRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALR V  L +IA+AGKTVITTI
Sbjct  293   VRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRTVQTLQDIAEAGKTVITTI  352

Query  1810  HQPSSRLFHk--------------------------------fdklilleflldLANGNI  1727
             HQPSSRLFHK                                   +   EFLLDLANGNI
Sbjct  353   HQPSSRLFHKFDKLILLGKGSLLYFGKASEAIVYFSSIGCSPLIAMNPAEFLLDLANGNI  412

Query  1726  NDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYETRVAETEKKKLMAPLPV  1547
             ND+S+PSEL DKVQ  NS+ E TRN GKP PA+VHEYLV  YE+RVAE EKKKLM PLP+
Sbjct  413   NDISVPSELEDKVQMENSEAE-TRN-GKPPPAVVHEYLVEAYESRVAENEKKKLMTPLPL  470

Query  1546  EEELKSKVRYLKREWGASWSEQYVLLFHRGIRERWHDYFSWLRITQVIATALILGMLWWQ  1367
             +EELK KV   KR+WGASW +QY +LF RGI+ER HDYFSWLRITQV++TA+ILG+LWWQ
Sbjct  471   DEELKLKVSSSKRQWGASWWQQYCILFCRGIKERRHDYFSWLRITQVLSTAIILGLLWWQ  530

Query  1366  SGGDTPSQMQDQAGLLFFIAVFWGFFPVFTAIFTFPQEKAMLSKERAADMYRLSAYFAAR  1187
             S   +P   QDQAGLLFFIAVFWGFFPVFTAIFTFPQE+AMLSKERAADMYRLSAYF AR
Sbjct  531   SDSKSPKGRQDQAGLLFFIAVFWGFFPVFTAIFTFPQERAMLSKERAADMYRLSAYFLAR  590

Query  1186  TTSdlpldlllpliflLVVYFMAGLKQDASSFLLTAVTVFLCIVVAQGLGLAIGATLMDL  1007
             TTSDLPLDL+LP++FLLVVYFMAGL+  AS F L+ +TVFLCIV AQGLGLAIGATLMDL
Sbjct  591   TTSDLPLDLILPVLFLLVVYFMAGLRVSASPFFLSMLTVFLCIVAAQGLGLAIGATLMDL  650

Query  1006  KKATTLASVTVMTFMLAGGYFIKKVPGFIVWLRDLSFNYHTFKLLLKVQYEHKTNSVNGV  827
             K+ATTLASVTVMTFMLAGGYF+KKVP FI W+R +SFNYHT+KLLLKVQY+     VNG+
Sbjct  651   KRATTLASVTVMTFMLAGGYFVKKVPVFISWIRHISFNYHTYKLLLKVQYQDIMPPVNGI  710

Query  826   QIDSGIKEVGALAAMAVSYRLLAYISLRRMKLQ  728
               DSG+KEVGAL AM   YRLLAY+SLRRMKL 
Sbjct  711   TTDSGLKEVGALVAMIFGYRLLAYLSLRRMKLH  743



>ref|XP_004497624.1| PREDICTED: ABC transporter G family member 22-like [Cicer arietinum]
Length=745

 Score =   950 bits (2456),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 524/753 (70%), Positives = 608/753 (81%), Gaps = 47/753 (6%)
 Frame = -2

Query  2878  MEQTNSTSLLRTKSDQLVEaiaaakgsarARLPRLSAEFAGSGVPESVRMLSRKPSRRLM  2699
             ME+ N   +LRTKSDQLVE++ AA      + P+ S++ + +GV E    LSRK SRR+ 
Sbjct  1     MEKGNMGGILRTKSDQLVESMMAAL-----KSPQ-SSDHSTNGV-EGSGGLSRKSSRRI-  52

Query  2698  ppspggggsgGTNSTHIRKSRSAQMKLDLDElssgsvlsrassasl--GFSFTGFSVRPD  2525
               +    G GG  +THIRKS SAQMK++LDELSSG+ LSRASSASL   FSFTGF++  D
Sbjct  53    --TAASPGRGGGKNTHIRKSMSAQMKIELDELSSGAALSRASSASLGLSFSFTGFTMHSD  110

Query  2524  ESADSKPFSDDEN-PEDLEAGTKKKRSIPAEPTFPIYLKFTEVSYKIVIKGVTFSEEKDI  2348
             + ADS+PFSDD+  PED+EAGT+ K     EPT PIYLKFT+V+YK+V+KG+T SEEKDI
Sbjct  111   QIADSRPFSDDDMIPEDIEAGTRTKTKFQTEPTLPIYLKFTDVTYKVVVKGMTSSEEKDI  170

Query  2347  LNGISGAVDPGEVLALMGPSGCGKTTLLSLLGGRIRDPS-AGSITYNQHPYSKLLKSRIG  2171
             LNGISG+V+PGEVLALMGPSG GKTTLL+LLGGR+   +  GSITYN   YSK LKSRIG
Sbjct  171   LNGISGSVNPGEVLALMGPSGSGKTTLLNLLGGRLSKTTIGGSITYNDQSYSKFLKSRIG  230

Query  2170  FVTQDDILFPHLTVKETLIYAARLRLPRTLTKEEKDKRAMDVIYELGLDRCQDTMIGGSF  1991
             FVTQDD+LFPHLTVKETL YAARLRLP TLTKE+K+KRA+DVIYELGL+RCQDTMIGGSF
Sbjct  231   FVTQDDVLFPHLTVKETLTYAARLRLPNTLTKEQKEKRALDVIYELGLERCQDTMIGGSF  290

Query  1990  VRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILHEIAKAGKTVITTI  1811
             VRGVSGGERKRVCIGNEIIINPS+LFLDEPTSGLDSTTAL+IV +L +IA+AGKTV+TTI
Sbjct  291   VRGVSGGERKRVCIGNEIIINPSILFLDEPTSGLDSTTALKIVQMLQDIAEAGKTVVTTI  350

Query  1810  HQPSSRLFHk--------------------------------fdklilleflldLANGNI  1727
             HQPSSRLFHK                                   +   EFLLDLANGNI
Sbjct  351   HQPSSRLFHKFDKLILLGKGSLLYFGKAAEAMNYFQSIGCSPLISMNPAEFLLDLANGNI  410

Query  1726  NDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYETRVAETEKKKLMAPLPV  1547
             NDVS+PSEL DKVQ  N++ E T N GKPSPA+VHEYLV  YE+RVAETEKKK+M  +P+
Sbjct  411   NDVSVPSELDDKVQMGNAEVETTYN-GKPSPAVVHEYLVEAYESRVAETEKKKIMVSVPL  469

Query  1546  EEELKSKVRYLKREWGASWSEQYVLLFHRGIRERWHDYFSWLRITQVIATALILGMLWWQ  1367
             +E LK+KV   KR+WGASW EQY +LF RGI+ER HDYFSWLRITQV++TA+ILG+LWWQ
Sbjct  470   DENLKAKVCSPKRQWGASWDEQYSILFWRGIKERRHDYFSWLRITQVLSTAVILGLLWWQ  529

Query  1366  SGGDTPSQMQDQAGLLFFIAVFWGFFPVFTAIFTFPQEKAMLSKERAADMYRLSAYFAAR  1187
             S    P  +QDQAGLLFFIAVFWGFFPVFTAIFTFPQE+AML+KERAADMYRLSAYF AR
Sbjct  530   SDAKNPKDLQDQAGLLFFIAVFWGFFPVFTAIFTFPQERAMLTKERAADMYRLSAYFLAR  589

Query  1186  TTSdlpldlllpliflLVVYFMAGLKQDASSFLLTAVTVFLCIVVAQGLGLAIGATLMDL  1007
             TTSDLPLDL+LP++F+LVVYFMAGL+   + F LT VTVFLCIV AQGLGLAIGATLMDL
Sbjct  590   TTSDLPLDLILPVLFILVVYFMAGLRLSVAPFFLTIVTVFLCIVAAQGLGLAIGATLMDL  649

Query  1006  KKATTLASVTVMTFMLAGGYFIKKVPGFIVWLRDLSFNYHTFKLLLKVQYEHKTNSVNGV  827
             K+ATTLASVTVMTFMLAGG+F++KVP FI W+R +SFNYHT+KLLLKVQYEH + S+NGV
Sbjct  650   KRATTLASVTVMTFMLAGGFFVQKVPIFISWIRYMSFNYHTYKLLLKVQYEHLSPSINGV  709

Query  826   QIDSGIKEVGALAAMAVSYRLLAYISLRRMKLQ  728
             +IDSG+ EV AL AM  +YR LAY+SLRRMKLQ
Sbjct  710   KIDSGLTEVAALVAMVFAYRFLAYLSLRRMKLQ  742



>ref|XP_007145759.1| hypothetical protein PHAVU_007G265300g [Phaseolus vulgaris]
 gb|ESW17753.1| hypothetical protein PHAVU_007G265300g [Phaseolus vulgaris]
Length=745

 Score =   948 bits (2450),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 528/755 (70%), Positives = 605/755 (80%), Gaps = 51/755 (7%)
 Frame = -2

Query  2878  MEQTNSTSLLRTKSDQLVEaiaaakgsarARLPRLSAEFAGSGVPESVRMLSRKPSRRLM  2699
             ME+ N TSL+RTKSDQLVE++ AA  S        S++ + +GV E    LSRK SRRL 
Sbjct  1     MEKAN-TSLVRTKSDQLVESMVAAMKSPP------SSDHSANGVGEGGGTLSRKSSRRL-  52

Query  2698  ppspggggsgGTNSTHIRKSRSAQ---MKLDLDElssgsvlsrassasl--GFSFTGFSV  2534
                   G  GG  +THIRKSRSAQ   MKL+ D+LSSG+ LSRASSASL   FSFTGF++
Sbjct  53    -TGASPGRGGGGKNTHIRKSRSAQISQMKLEFDDLSSGAALSRASSASLGLSFSFTGFTM  111

Query  2533  RPDESADSKPFSDDENPEDLEAGTKKKRSIPAEPTFPIYLKFTEVSYKIVIKGVTFSEEK  2354
              P+E ADSKPFSDD+ PED+EAG + K     EPT PI+LKFT+VSYK+V+KG+T +EEK
Sbjct  112   PPEEIADSKPFSDDDIPEDIEAGPRTK--FQTEPTLPIFLKFTDVSYKVVMKGMTTTEEK  169

Query  2353  DILNGISGAVDPGEVLALMGPSGCGKTTLLSLLGGRIRDP-SAGSITYNQHPYSKLLKSR  2177
             DILNGI+G+V+PGEVLALMGPSG GKTTLL+LLGGR+  P S GSITYN  PYSK LKSR
Sbjct  170   DILNGITGSVNPGEVLALMGPSGSGKTTLLNLLGGRLCHPISGGSITYNDEPYSKFLKSR  229

Query  2176  IGFVTQDDILFPHLTVKETLIYAARLRLPRTLTKEEKDKRAMDVIYELGLDRCQDTMIGG  1997
             IGFVTQDD+LFPHLTVKETL Y+ARLRLP+T TKE+K+KRA+DVIYELGL+RCQDTMIGG
Sbjct  230   IGFVTQDDVLFPHLTVKETLTYSARLRLPKTFTKEQKEKRALDVIYELGLERCQDTMIGG  289

Query  1996  SFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILHEIAKAGKTVIT  1817
             SFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIV +L +IA+AGKTV+T
Sbjct  290   SFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVQMLQDIAEAGKTVVT  349

Query  1816  TIHQPSSRLFHk--------------------------------fdklilleflldLANG  1733
             TIHQPSSRLFHK                                   +   EFLLDLANG
Sbjct  350   TIHQPSSRLFHKFDKLILLGKGSLLYFGKASETLTYFQSIGCSPLISMNPAEFLLDLANG  409

Query  1732  NINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYETRVAETEKKKLMAPL  1553
             NINDVS+PSEL D+VQ  N++ E    NGKPSPA+VHEYLV  YETRVAETEKKKLM P+
Sbjct  410   NINDVSLPSELEDRVQMENAEAETP--NGKPSPAVVHEYLVEAYETRVAETEKKKLMVPI  467

Query  1552  PVEEELKSKVRYLKREWGASWSEQYVLLFHRGIRERWHDYFSWLRITQVIATALILGMLW  1373
             P++E +KSKV   KR+WGASW EQY +LF RGI+ER HDYFSWLRITQV++TA+ILG+LW
Sbjct  468   PLDEAVKSKVCSHKRQWGASWDEQYSILFWRGIKERRHDYFSWLRITQVLSTAVILGLLW  527

Query  1372  WQSGGDTPSQMQDQAGLLFFIAVFWGFFPVFTAIFTFPQEKAMLSKERAADMYRLSAYFA  1193
             WQS    P  +QDQAGLLFFIAVFWGFFPVFTAIFTFPQE+AMLSKERAADMYRLSAYF 
Sbjct  528   WQSDTKNPKDLQDQAGLLFFIAVFWGFFPVFTAIFTFPQERAMLSKERAADMYRLSAYFL  587

Query  1192  ARTTSdlpldlllpliflLVVYFMAGLKQDASSFLLTAVTVFLCIVVAQGLGLAIGATLM  1013
             ARTTSDLPLDL+LP++FLLVVYFMAGLK   + F LT +TVFLCIV AQGLGLAIGATLM
Sbjct  588   ARTTSDLPLDLILPVLFLLVVYFMAGLKLSVAPFFLTILTVFLCIVAAQGLGLAIGATLM  647

Query  1012  DLKKATTLASVTVMTFMLAGGYFIKKVPGFIVWLRDLSFNYHTFKLLLKVQYEHKTNSVN  833
             DLK+ATTLASVTVMTFMLAGG+F+++VP F  W+R +SFNYHT+KLLLKVQYEH +  +N
Sbjct  648   DLKRATTLASVTVMTFMLAGGFFVQRVPIFFSWIRYMSFNYHTYKLLLKVQYEHISPIIN  707

Query  832   GVQIDSGIKEVGALAAMAVSYRLLAYISLRRMKLQ  728
             G++IDSG  EV AL AM   YR LAY+SLRRMKLQ
Sbjct  708   GIRIDSGATEVAALIAMVFGYRFLAYLSLRRMKLQ  742



>ref|XP_011094213.1| PREDICTED: ABC transporter G family member 22-like isoform X3 
[Sesamum indicum]
Length=736

 Score =   947 bits (2449),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 522/754 (69%), Positives = 595/754 (79%), Gaps = 59/754 (8%)
 Frame = -2

Query  2878  MEQTNS-TSLLRTKSDQLVEaiaaakgsarARLPRLSAEFAGSGVPESVRMLSRKPSRRL  2702
             ME+TNS +SL+RTKS + +            + P  SAE A     ES   LSRK SRRL
Sbjct  2     MEKTNSASSLIRTKSVETI-----------LKSPVSSAEAA-----ESSGGLSRKSSRRL  45

Query  2701  MppspggggsgGTNSTHIRKSRSAQMKLDLDElssgsvlsrassasl--GFSFTGFSVRP  2528
                +    G    N THIRKSRSAQMK +LD+L SG+ LSRASSASL   FSFTGF++ P
Sbjct  46    ---AAASPGRSSGNKTHIRKSRSAQMKFELDDLGSGAALSRASSASLGFSFSFTGFTMPP  102

Query  2527  DESADSKPFSDDE-NPEDLEAGTKKKRSIPAEPTFPIYLKFTEVSYKIVIKGVTFSEEKD  2351
             DE AD+KPFSDD+   EDLEAG  KK+ +  EPT PIYLKFT+V+YK+V+KG+T + EKD
Sbjct  103   DEIADTKPFSDDDIAAEDLEAGISKKK-LQTEPTLPIYLKFTDVTYKVVLKGMTSTVEKD  161

Query  2350  ILNGISGAVDPGEVLALMGPSGCGKTTLLSLLGGRIRDPS-AGSITYNQHPYSKLLKSRI  2174
             ILNGI+G+V PGEVLALMGPSG GKTTLLSLLGGR+R+ +  GSITYN   YSK LKSRI
Sbjct  162   ILNGITGSVSPGEVLALMGPSGSGKTTLLSLLGGRVRESTYGGSITYNDQSYSKSLKSRI  221

Query  2173  GFVTQDDILFPHLTVKETLIYAARLRLPRTLTKEEKDKRAMDVIYELGLDRCQDTMIGGS  1994
             GFVTQDD+LFPHLTVKETL YAARLRLPRTLTKEEKD+RA D+IYELGL+RC+DTMIGGS
Sbjct  222   GFVTQDDVLFPHLTVKETLTYAARLRLPRTLTKEEKDQRASDIIYELGLERCRDTMIGGS  281

Query  1993  FVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILHEIAKAGKTVITT  1814
             FVRGVSGGERKRVCIGNEII+NPSLLFLDEPTSGLDST ALRI++ LH IA+AGKTVITT
Sbjct  282   FVRGVSGGERKRVCIGNEIIVNPSLLFLDEPTSGLDSTIALRILETLHGIAEAGKTVITT  341

Query  1813  IHQPSSRLF--------------------------------HkfdklilleflldLANGN  1730
             IHQPSSRLF                                     +   EF+LDLANGN
Sbjct  342   IHQPSSRLFLKFDKLILLGKGSLLYFGKAAEAMVYFSSVGCSPLIAMNPAEFMLDLANGN  401

Query  1729  INDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYETRVAETEKKKLMAPLP  1550
             + D+S+PSEL D+VQT NS++E    NGK  PA+VHEYLV  YETRVAE EK+K+ +P+P
Sbjct  402   VTDISVPSELEDRVQTENSEDEI--KNGKMDPAVVHEYLVEAYETRVAENEKRKIRSPVP  459

Query  1549  VEEELKSKVRYLKREWGASWSEQYVLLFHRGIRERWHDYFSWLRITQVIATALILGMLWW  1370
             ++EE+KSKV   KREWGASW EQY +LF RG++ER HDYFSWLRITQV+ATA ILG+LWW
Sbjct  460   IDEEIKSKVCSAKREWGASWLEQYSILFWRGLKERKHDYFSWLRITQVLATATILGLLWW  519

Query  1369  QSGGDTPSQMQDQAGLLFFIAVFWGFFPVFTAIFTFPQEKAMLSKERAADMYRLSAYFAA  1190
             QSG D P ++QDQAGLLFFI+VFWGFFPVFTA+FTFPQE+AMLSKERA DMYRLSAYF A
Sbjct  520   QSGSDDPQKLQDQAGLLFFISVFWGFFPVFTAVFTFPQERAMLSKERAVDMYRLSAYFVA  579

Query  1189  RTTSdlpldlllpliflLVVYFMAGLKQDASSFLLTAVTVFLCIVVAQGLGLAIGATLMD  1010
             RTTSDLPLDL+LP++FLLVVYFMAGL+    SF LT VTVFLCI+ AQGLGLAIGATLMD
Sbjct  580   RTTSDLPLDLILPVLFLLVVYFMAGLRTTVGSFFLTVVTVFLCIIAAQGLGLAIGATLMD  639

Query  1009  LKKATTLASVTVMTFMLAGGYFIKKVPGFIVWLRDLSFNYHTFKLLLKVQYEHKTNSVNG  830
             LK+ATTLASVTVMTFMLAGGYF+K VP FI WLR LSFNYHT+KLLLKVQYEH T+S+NG
Sbjct  640   LKRATTLASVTVMTFMLAGGYFVKDVPTFISWLRYLSFNYHTYKLLLKVQYEHITHSING  699

Query  829   VQIDSGIKEVGALAAMAVSYRLLAYISLRRMKLQ  728
             V ID G KEVG LA M V YRLLAY+SLRRMKL 
Sbjct  700   VSIDKGYKEVGVLATMVVGYRLLAYLSLRRMKLH  733



>gb|EYU38702.1| hypothetical protein MIMGU_mgv1a001826mg [Erythranthe guttata]
Length=754

 Score =   944 bits (2441),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 528/756 (70%), Positives = 610/756 (81%), Gaps = 44/756 (6%)
 Frame = -2

Query  2878  MEQTNSTS-LLRTKSDQLVEaiaaakgsarARLP--RLSAEFAGSGVPESVRMLSRKPSR  2708
             ME+ NSTS L+RTKSDQLVE IAAA G+ R+ +     +A   G  +  S   LSRK SR
Sbjct  1     MEKANSTSGLIRTKSDQLVETIAAALGAMRSSISPGEAAASDGGGSMESSGGQLSRKSSR  60

Query  2707  RLMppspggggsgGTNSTHIRKSRSAQMKLDLDElssgsvlsrassasl--GFSFTGFSV  2534
             RL   +   G SGG  +THIRK+RSAQ+K D+D+L+SG+ LSRASSASL   FSFTGF+V
Sbjct  61    RL--TAASPGRSGGGKNTHIRKARSAQLKFDVDDLNSGAALSRASSASLGFSFSFTGFTV  118

Query  2533  RPDESADSKPFSDD-ENPEDLEAGTKKKRSIPAEPTFPIYLKFTEVSYKIVIKGVTFSEE  2357
              PDE +DSKPFSDD E  EDLEAG +KK+ +  EPT PIYLKF++V+YK+V+KG+T + E
Sbjct  119   PPDEISDSKPFSDDDEIHEDLEAGRQKKK-LQTEPTLPIYLKFSDVTYKVVLKGITSTVE  177

Query  2356  KDILNGISGAVDPGEVLALMGPSGCGKTTLLSLLGGRIRDPS-AGSITYNQHPYSKLLKS  2180
             K+ILNGI+G+VDPGEVLALMGPSG GKTTLLSLLGGR+  P   GS+TYN  P+SK LKS
Sbjct  178   KEILNGINGSVDPGEVLALMGPSGSGKTTLLSLLGGRVNQPGHGGSVTYNDKPFSKSLKS  237

Query  2179  RIGFVTQDDILFPHLTVKETLIYAARLRLPRTLTKEEKDKRAMDVIYELGLDRCQDTMIG  2000
             RIGFVTQDD+LFPHLTVKETL YAARLRLPR LTK+EK +RA DVIYELGL+ CQDTMIG
Sbjct  238   RIGFVTQDDVLFPHLTVKETLTYAARLRLPRRLTKDEKYQRAADVIYELGLENCQDTMIG  297

Query  1999  GSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILHEIAKAGKTVI  1820
             GSFVRGVSGGERKRVCIGNEI+INPSLLFLDEPTSGLDSTTALRIVD LH+IA+AGKTVI
Sbjct  298   GSFVRGVSGGERKRVCIGNEILINPSLLFLDEPTSGLDSTTALRIVDTLHDIAEAGKTVI  357

Query  1819  TTIHQPSSRLF--------------------------------HkfdklilleflldLAN  1736
             TTIHQPSSRLF                                  F  +   EF+LDLAN
Sbjct  358   TTIHQPSSRLFLKFDKLILLGKGSLLYFGKASEAMVYFSSIGCSPFIAMNPAEFMLDLAN  417

Query  1735  GNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYETRVAETEKKKLMAP  1556
             GN+ D+S+PSEL D+V   NS  EP   +GKP+PA+VHEYLV  YETRVAE EKK+L  P
Sbjct  418   GNVTDISVPSELEDRVLMGNSTAEP--KSGKPAPAVVHEYLVEAYETRVAENEKKRLQIP  475

Query  1555  LPVEEELKSKVRYLKREWGASWSEQYVLLFHRGIRERWHDYFSWLRITQVIATALILGML  1376
             + V++E+KS+V   KREWGASW EQY +LF RG++ER HDYFSWLR+TQV+ATA ILG+L
Sbjct  476   IAVDDEMKSQVCSAKREWGASWFEQYSILFWRGLKERRHDYFSWLRVTQVLATATILGLL  535

Query  1375  WWQSGGDTPSQMQDQAGLLFFIAVFWGFFPVFTAIFTFPQEKAMLSKERAADMYRLSAYF  1196
             WWQSG + P+++QDQAGLLFFIAVFWGFFPVFTAIFTFPQE+AMLSKERAADMYRLSAYF
Sbjct  536   WWQSGSNNPNELQDQAGLLFFIAVFWGFFPVFTAIFTFPQERAMLSKERAADMYRLSAYF  595

Query  1195  AARTTSdlpldlllpliflLVVYFMAGLKQDASSFLLTAVTVFLCIVVAQGLGLAIGATL  1016
              ARTTSDLPLDL+LP++FL+VVYFMAGL+ +  SF LT +TVFLCI+ AQGLGLAIGATL
Sbjct  596   VARTTSDLPLDLILPVLFLVVVYFMAGLRMNVGSFFLTVLTVFLCIIAAQGLGLAIGATL  655

Query  1015  MDLKKATTLASVTVMTFMLAGGYFIKKVPGFIVWLRDLSFNYHTFKLLLKVQYEHKTNSV  836
             MDLKKATTLASVTVMTFMLAGG+F+K VP FI WLR LSFNYHT+KLLLKVQYEH ++S+
Sbjct  656   MDLKKATTLASVTVMTFMLAGGFFVKDVPVFISWLRYLSFNYHTYKLLLKVQYEHISHSI  715

Query  835   NGVQIDSGIKEVGALAAMAVSYRLLAYISLRRMKLQ  728
             NGV+ID G  EVG LAAM V YRLLAY+SLRRMKLQ
Sbjct  716   NGVKIDDGYTEVGVLAAMVVGYRLLAYLSLRRMKLQ  751



>ref|XP_008241111.1| PREDICTED: ABC transporter G family member 22 isoform X1 [Prunus 
mume]
 ref|XP_008241112.1| PREDICTED: ABC transporter G family member 22 isoform X1 [Prunus 
mume]
 ref|XP_008241113.1| PREDICTED: ABC transporter G family member 22 isoform X1 [Prunus 
mume]
Length=749

 Score =   944 bits (2439),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 523/749 (70%), Positives = 598/749 (80%), Gaps = 44/749 (6%)
 Frame = -2

Query  2866  NSTSLLRTKSDQLVEaiaaakgsarARLPRLSAEFAGSGVPESVRMLSRKPSRRLMppsp  2687
             NS+ L RTKSDQLVE +AAA      + P      AGS    S   LSRK SRR+M  SP
Sbjct  6     NSSVLARTKSDQLVETVAAAF-----KSPPPGEAIAGSADGSST--LSRKSSRRVMGASP  58

Query  2686  ggggsgGTNSTHIRKSRSAQMKLDLDElssgsvlsrassasl--GFSFTGFSVRPDESAD  2513
             G G      +THIRKSRSAQMKLDLDE+SSG+ LSRASSASL   FSFTGF+V PD+ AD
Sbjct  59    GRGSGSVGKNTHIRKSRSAQMKLDLDEVSSGAALSRASSASLGFSFSFTGFTVPPDDIAD  118

Query  2512  SKPFSDDEN-PEDLEAGTKKKRSIPAEPTFPIYLKFTEVSYKIVIKGVTFSEEKDILNGI  2336
             SKPFSDD++ PEDLEAGT +K     EPT PIYLKFT+V+YKI++KG+  +EEKDILNGI
Sbjct  119   SKPFSDDDDIPEDLEAGTTRKPKFQTEPTLPIYLKFTDVTYKIILKGMRTTEEKDILNGI  178

Query  2335  SGAVDPGEVLALMGPSGCGKTTLLSLLGGR-IRDPSAGSITYNQHPYSKLLKSRIGFVTQ  2159
             +G+V PGEVLALMGPSG GKT+LL+LLGGR ++    GSITYN   YSK LKSRIGFVTQ
Sbjct  179   TGSVHPGEVLALMGPSGSGKTSLLNLLGGRAVQANVTGSITYNDQTYSKFLKSRIGFVTQ  238

Query  2158  DDILFPHLTVKETLIYAARLRLPRTLTKEEKDKRAMDVIYELGLDRCQDTMIGGSFVRGV  1979
             DD+LFPHLTVKETL YAA LRL +TLTKE+K+KRA+DVIYELGL+RCQDTMIGGSFVRGV
Sbjct  239   DDVLFPHLTVKETLTYAALLRLSKTLTKEQKEKRALDVIYELGLERCQDTMIGGSFVRGV  298

Query  1978  SGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILHEIAKAGKTVITTIHQPS  1799
             SGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIV +L +IA+AGKTV+TTIHQPS
Sbjct  299   SGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVQMLQDIAEAGKTVVTTIHQPS  358

Query  1798  SRLFHk--------------------------------fdklilleflldLANGNINDVS  1715
             SRLFHK                                   +   EFLLDLANGNINDVS
Sbjct  359   SRLFHKFDKLILLGKGSLLYFGKASEAMVYFSSIGCSPLIAMNPAEFLLDLANGNINDVS  418

Query  1714  IPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYETRVAETEKKKLMAPLPVEEEL  1535
             IPSEL DKVQ  NS+   TRN GKPSPA+VHEYLV  YETRVA+ EKKK+M PLP++++L
Sbjct  419   IPSELEDKVQMGNSEAADTRN-GKPSPAVVHEYLVEAYETRVADEEKKKIMVPLPLDDQL  477

Query  1534  KSKVRYLKREWGASWSEQYVLLFHRGIRERWHDYFSWLRITQVIATALILGMLWWQSGGD  1355
             K KV   KREWG SW EQ+ +LF RGI+ER HDYFSWLRITQV++TA+ILG+LWWQS  +
Sbjct  478   KLKVSISKREWGGSWWEQFSILFCRGIKERRHDYFSWLRITQVLSTAVILGLLWWQSDSN  537

Query  1354  TPSQMQDQAGLLFFIAVFWGFFPVFTAIFTFPQEKAMLSKERAADMYRLSAYFAARTTSd  1175
              P  ++DQAGLLFFIAVFWGFFPVFTAIFTFPQE+AML+KERAADMYRLSAYF ARTTSD
Sbjct  538   NPKGLEDQAGLLFFIAVFWGFFPVFTAIFTFPQERAMLTKERAADMYRLSAYFVARTTSD  597

Query  1174  lpldlllpliflLVVYFMAGLKQDASSFLLTAVTVFLCIVVAQGLGLAIGATLMDLKKAT  995
             LPLDLLLP++FL++VYFMAGL+  A +F L+ + VFLCIV AQGLGLAIGATLMDLK+AT
Sbjct  598   LPLDLLLPVLFLVIVYFMAGLRLSAETFFLSMLIVFLCIVAAQGLGLAIGATLMDLKRAT  657

Query  994   TLASVTVMTFMLAGGYFIKKVPGFIVWLRDLSFNYHTFKLLLKVQYEHKTNSVNGVQIDS  815
             TLASVTVMTFMLAGG+F+KKVP FI W+R +SFNYHT++LLLKVQYE  T ++NG+  D 
Sbjct  658   TLASVTVMTFMLAGGFFVKKVPVFISWIRYMSFNYHTYRLLLKVQYEAITPAINGLSTDC  717

Query  814   GIKEVGALAAMAVSYRLLAYISLRRMKLQ  728
             G+  VGAL AM   YRLLAY+SLRRMKLQ
Sbjct  718   GLTGVGALVAMVFGYRLLAYLSLRRMKLQ  746



>ref|XP_003535833.2| PREDICTED: ABC transporter G family member 22-like isoform X1 
[Glycine max]
 gb|KHN05752.1| ABC transporter G family member 22 [Glycine soja]
Length=778

 Score =   944 bits (2439),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 527/780 (68%), Positives = 608/780 (78%), Gaps = 58/780 (7%)
 Frame = -2

Query  2953  SHGVTVFFHAFHELARFSCTVNQFQMEQTNSTSLLRTKSDQLVEaiaaakgsarARLPRL  2774
             S G+   F         SC +    ME+ N TSL+RTKSDQL+E++ A   S        
Sbjct  16    SFGLIFHFRIIPSTKNNSCILEWVTMEKAN-TSLVRTKSDQLLESMVAGLKSPP------  68

Query  2773  SAEFAGSGVPESVRMLSRKPSRRLMppspggggsgGTNSTHIRKSRSAQ---MKLDLDEl  2603
             S++ + +GV +S     RK SR L     G     G  +THIRKSRSAQ   MKL+LD++
Sbjct  69    SSDHSANGVVDS-----RKSSRWL----TGASPGRGGKNTHIRKSRSAQISQMKLELDDV  119

Query  2602  ssgsvlsrassasl--GFSFTGFSVRPDESADSKPFSDDENPEDLEAGTKKKRSIPAEPT  2429
             SSG+ LSRASSASL   FSFTGF++ P+E ADSKPFSDD+ PED+EAG + K     EPT
Sbjct  120   SSGAALSRASSASLGLSFSFTGFTMPPEEIADSKPFSDDDIPEDIEAGPRTK--FQTEPT  177

Query  2428  FPIYLKFTEVSYKIVIKGVTFSEEKDILNGISGAVDPGEVLALMGPSGCGKTTLLSLLGG  2249
              PIYLKFT+V+YKIVIKG+T +EEKDILNGI+G+V+PGEVLALMGPSG GKTTLL+LLGG
Sbjct  178   LPIYLKFTDVTYKIVIKGMTTTEEKDILNGITGSVNPGEVLALMGPSGSGKTTLLNLLGG  237

Query  2248  RIRDP-SAGSITYNQHPYSKLLKSRIGFVTQDDILFPHLTVKETLIYAARLRLPRTLTKE  2072
             R+  P S GSITYN  PYSK LKSRIGFVTQDD+LFPHLTVKETL YAARLRLP+  TKE
Sbjct  238   RLSHPISGGSITYNDQPYSKFLKSRIGFVTQDDVLFPHLTVKETLTYAARLRLPKAYTKE  297

Query  2071  EKDKRAMDVIYELGLDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSG  1892
             +K+KRA+DVIYELGL+RCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSG
Sbjct  298   QKEKRALDVIYELGLERCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSG  357

Query  1891  LDSTTALRIVDILHEIAKAGKTVITTIHQPSSRLFHk-----------------------  1781
             LDSTTALRIV +L +IA+AGKTV+TTIHQPSSRLFHK                       
Sbjct  358   LDSTTALRIVQMLQDIAEAGKTVVTTIHQPSSRLFHKFDKLILLGKGSLLYFGKASETMT  417

Query  1780  ---------fdklilleflldLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAI  1628
                         +   EFLLDLANGNINDVS+PSEL DKVQ  N++ E    NGKPSPA+
Sbjct  418   YFQSIGCSPLISMNPAEFLLDLANGNINDVSLPSELEDKVQMGNAEAE--TQNGKPSPAV  475

Query  1627  VHEYLVGCYETRVAETEKKKLMAPLPVEEELKSKVRYLKREWGASWSEQYVLLFHRGIRE  1448
             VHEYLV  YETRVAETEKK+LM P+P++E LK+KV   KR+WGASW EQ+ +LF RGI+E
Sbjct  476   VHEYLVEAYETRVAETEKKRLMVPIPLDEALKTKVCSHKRQWGASWDEQFSILFWRGIKE  535

Query  1447  RWHDYFSWLRITQVIATALILGMLWWQSGGDTPSQMQDQAGLLFFIAVFWGFFPVFTAIF  1268
             R HDYFSWLRITQV++TA+ILG+LWWQS    P  +QDQAGLLFFIAVFWGFFPVFTAIF
Sbjct  536   RRHDYFSWLRITQVLSTAVILGLLWWQSDTKNPKDLQDQAGLLFFIAVFWGFFPVFTAIF  595

Query  1267  TFPQEKAMLSKERAADMYRLSAYFAARTTSdlpldlllpliflLVVYFMAGLKQDASSFL  1088
             TFPQE+AMLSKERAADMYRLSAYF ARTTSDLPLDL+LP++FLLVVYFMAGL+   + F 
Sbjct  596   TFPQERAMLSKERAADMYRLSAYFLARTTSDLPLDLILPVLFLLVVYFMAGLRLSVAPFF  655

Query  1087  LTAVTVFLCIVVAQGLGLAIGATLMDLKKATTLASVTVMTFMLAGGYFIKKVPGFIVWLR  908
             LT +TVFLCIV AQGLGLAIGATLMDLK+ATTLASVTVMTFMLAGG+F+++VP F  W+R
Sbjct  656   LTVLTVFLCIVAAQGLGLAIGATLMDLKRATTLASVTVMTFMLAGGFFVQRVPIFFSWIR  715

Query  907   DLSFNYHTFKLLLKVQYEHKTNSVNGVQIDSGIKEVGALAAMAVSYRLLAYISLRRMKLQ  728
              +SFNYHT+KLLLKVQYEH +  +NG++IDSG  EV AL AM   YR LAY+SLRRMKLQ
Sbjct  716   YMSFNYHTYKLLLKVQYEHISPVINGIRIDSGATEVAALIAMVFGYRFLAYLSLRRMKLQ  775



>ref|XP_008241114.1| PREDICTED: ABC transporter G family member 22 isoform X2 [Prunus 
mume]
Length=748

 Score =   943 bits (2438),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 521/748 (70%), Positives = 597/748 (80%), Gaps = 43/748 (6%)
 Frame = -2

Query  2866  NSTSLLRTKSDQLVEaiaaakgsarARLPRLSAEFAGSGVPESVRMLSRKPSRRLMppsp  2687
             NS+ L RTKSDQLVE +AAA      + P      AGS    S   LSRK SRR+M  SP
Sbjct  6     NSSVLARTKSDQLVETVAAAF-----KSPPPGEAIAGSADGSST--LSRKSSRRVMGASP  58

Query  2686  ggggsgGTNSTHIRKSRSAQMKLDLDElssgsvlsrassasl--GFSFTGFSVRPDESAD  2513
             G G      +THIRKSRSAQMKLDLDE+SSG+ LSRASSASL   FSFTGF+V PD+ AD
Sbjct  59    GRGSGSVGKNTHIRKSRSAQMKLDLDEVSSGAALSRASSASLGFSFSFTGFTVPPDDIAD  118

Query  2512  SKPFSDDENPEDLEAGTKKKRSIPAEPTFPIYLKFTEVSYKIVIKGVTFSEEKDILNGIS  2333
             SKPFSDD++ +DLEAGT +K     EPT PIYLKFT+V+YKI++KG+  +EEKDILNGI+
Sbjct  119   SKPFSDDDDIQDLEAGTTRKPKFQTEPTLPIYLKFTDVTYKIILKGMRTTEEKDILNGIT  178

Query  2332  GAVDPGEVLALMGPSGCGKTTLLSLLGGR-IRDPSAGSITYNQHPYSKLLKSRIGFVTQD  2156
             G+V PGEVLALMGPSG GKT+LL+LLGGR ++    GSITYN   YSK LKSRIGFVTQD
Sbjct  179   GSVHPGEVLALMGPSGSGKTSLLNLLGGRAVQANVTGSITYNDQTYSKFLKSRIGFVTQD  238

Query  2155  DILFPHLTVKETLIYAARLRLPRTLTKEEKDKRAMDVIYELGLDRCQDTMIGGSFVRGVS  1976
             D+LFPHLTVKETL YAA LRL +TLTKE+K+KRA+DVIYELGL+RCQDTMIGGSFVRGVS
Sbjct  239   DVLFPHLTVKETLTYAALLRLSKTLTKEQKEKRALDVIYELGLERCQDTMIGGSFVRGVS  298

Query  1975  GGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILHEIAKAGKTVITTIHQPSS  1796
             GGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIV +L +IA+AGKTV+TTIHQPSS
Sbjct  299   GGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVQMLQDIAEAGKTVVTTIHQPSS  358

Query  1795  RLFHk--------------------------------fdklilleflldLANGNINDVSI  1712
             RLFHK                                   +   EFLLDLANGNINDVSI
Sbjct  359   RLFHKFDKLILLGKGSLLYFGKASEAMVYFSSIGCSPLIAMNPAEFLLDLANGNINDVSI  418

Query  1711  PSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYETRVAETEKKKLMAPLPVEEELK  1532
             PSEL DKVQ  NS+   TRN GKPSPA+VHEYLV  YETRVA+ EKKK+M PLP++++LK
Sbjct  419   PSELEDKVQMGNSEAADTRN-GKPSPAVVHEYLVEAYETRVADEEKKKIMVPLPLDDQLK  477

Query  1531  SKVRYLKREWGASWSEQYVLLFHRGIRERWHDYFSWLRITQVIATALILGMLWWQSGGDT  1352
              KV   KREWG SW EQ+ +LF RGI+ER HDYFSWLRITQV++TA+ILG+LWWQS  + 
Sbjct  478   LKVSISKREWGGSWWEQFSILFCRGIKERRHDYFSWLRITQVLSTAVILGLLWWQSDSNN  537

Query  1351  PSQMQDQAGLLFFIAVFWGFFPVFTAIFTFPQEKAMLSKERAADMYRLSAYFAARTTSdl  1172
             P  ++DQAGLLFFIAVFWGFFPVFTAIFTFPQE+AML+KERAADMYRLSAYF ARTTSDL
Sbjct  538   PKGLEDQAGLLFFIAVFWGFFPVFTAIFTFPQERAMLTKERAADMYRLSAYFVARTTSDL  597

Query  1171  pldlllpliflLVVYFMAGLKQDASSFLLTAVTVFLCIVVAQGLGLAIGATLMDLKKATT  992
             PLDLLLP++FL++VYFMAGL+  A +F L+ + VFLCIV AQGLGLAIGATLMDLK+ATT
Sbjct  598   PLDLLLPVLFLVIVYFMAGLRLSAETFFLSMLIVFLCIVAAQGLGLAIGATLMDLKRATT  657

Query  991   LASVTVMTFMLAGGYFIKKVPGFIVWLRDLSFNYHTFKLLLKVQYEHKTNSVNGVQIDSG  812
             LASVTVMTFMLAGG+F+KKVP FI W+R +SFNYHT++LLLKVQYE  T ++NG+  D G
Sbjct  658   LASVTVMTFMLAGGFFVKKVPVFISWIRYMSFNYHTYRLLLKVQYEAITPAINGLSTDCG  717

Query  811   IKEVGALAAMAVSYRLLAYISLRRMKLQ  728
             +  VGAL AM   YRLLAY+SLRRMKLQ
Sbjct  718   LTGVGALVAMVFGYRLLAYLSLRRMKLQ  745



>ref|XP_007204637.1| hypothetical protein PRUPE_ppa001882mg [Prunus persica]
 gb|EMJ05836.1| hypothetical protein PRUPE_ppa001882mg [Prunus persica]
Length=748

 Score =   943 bits (2438),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 523/753 (69%), Positives = 599/753 (80%), Gaps = 44/753 (6%)
 Frame = -2

Query  2878  MEQTNSTSLL-RTKSDQLVEaiaaakgsarARLPRLSAEFAGSGVPESVRMLSRKPSRRL  2702
             ME+  S+S+L RTKSDQL E +AAA      + P L     GS    S   LSRK SRR+
Sbjct  1     MEKLPSSSVLPRTKSDQLAETVAAAF-----KSPPLGEAIVGSADGSST--LSRKSSRRM  53

Query  2701  MppspggggsgGTNSTHIRKSRSAQMKLDLDElssgsvlsrassasl--GFSFTGFSVRP  2528
             M  SPG G      +THIRKSRSAQMKLDLDE+SSG+ LSRASSASL   FSFTGF+V P
Sbjct  54    MGASPGRGSGSVGKNTHIRKSRSAQMKLDLDEVSSGAALSRASSASLGFSFSFTGFTVPP  113

Query  2527  DESADSKPFSDDENPEDLEAGTKKKRSIPAEPTFPIYLKFTEVSYKIVIKGVTFSEEKDI  2348
             D  ADSKPFSDD++ +DLEAGT +K     EPT PIYLKFT+V+YKI++KG+  SEEKDI
Sbjct  114   DNIADSKPFSDDDDIQDLEAGTTRKPKFQTEPTLPIYLKFTDVTYKIILKGMRTSEEKDI  173

Query  2347  LNGISGAVDPGEVLALMGPSGCGKTTLLSLLGGR-IRDPSAGSITYNQHPYSKLLKSRIG  2171
             LNGI+G+V PGEVLALMGPSG GKT+LL+LLGGR ++    GSITYN   YSK LKSRIG
Sbjct  174   LNGITGSVHPGEVLALMGPSGSGKTSLLNLLGGRAVQANVTGSITYNDQTYSKFLKSRIG  233

Query  2170  FVTQDDILFPHLTVKETLIYAARLRLPRTLTKEEKDKRAMDVIYELGLDRCQDTMIGGSF  1991
             FVTQDD+LFPHLTVKETL YAA LRL +TLTKE+K+KRA+DVIYELGL+RCQDTMIGGSF
Sbjct  234   FVTQDDVLFPHLTVKETLTYAALLRLSKTLTKEQKEKRALDVIYELGLERCQDTMIGGSF  293

Query  1990  VRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILHEIAKAGKTVITTI  1811
             VRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIV +L +IA+AGKTV+TTI
Sbjct  294   VRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVQMLQDIAEAGKTVVTTI  353

Query  1810  HQPSSRLFHk--------------------------------fdklilleflldLANGNI  1727
             HQPSSRLFHK                                   +   EFLLDLANGNI
Sbjct  354   HQPSSRLFHKFDKLILLGKGSLLYFGKASEAMVYFSSIGCSPLIAMNPAEFLLDLANGNI  413

Query  1726  NDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYETRVAETEKKKLMAPLPV  1547
             NDVSIPSEL DKVQ  NS+   TRN GKPSPA+VH+YLV  YETRVA+ EKKK+M PLP+
Sbjct  414   NDVSIPSELEDKVQMGNSEAADTRN-GKPSPAVVHDYLVEAYETRVADEEKKKIMVPLPL  472

Query  1546  EEELKSKVRYLKREWGASWSEQYVLLFHRGIRERWHDYFSWLRITQVIATALILGMLWWQ  1367
             ++ELK KV   KREWG SW EQ+ +LF RGI+ER HDYFSWLRITQV++TA+ILG+LWWQ
Sbjct  473   DDELKLKVSISKREWGGSWWEQFSILFCRGIKERRHDYFSWLRITQVLSTAVILGLLWWQ  532

Query  1366  SGGDTPSQMQDQAGLLFFIAVFWGFFPVFTAIFTFPQEKAMLSKERAADMYRLSAYFAAR  1187
             S  + P  ++DQAGLLFFIAVFWGFFPVFTAIFTFPQE+AML+KERAADMYRLSAYF AR
Sbjct  533   SDSNNPKGLEDQAGLLFFIAVFWGFFPVFTAIFTFPQERAMLTKERAADMYRLSAYFVAR  592

Query  1186  TTSdlpldlllpliflLVVYFMAGLKQDASSFLLTAVTVFLCIVVAQGLGLAIGATLMDL  1007
             TTSDLPLDLLLP++FL++VYFMAGL+  A +F L+ + VFLCIV AQGLGLAIGATLMDL
Sbjct  593   TTSDLPLDLLLPVLFLVIVYFMAGLRLSADTFFLSMLIVFLCIVAAQGLGLAIGATLMDL  652

Query  1006  KKATTLASVTVMTFMLAGGYFIKKVPGFIVWLRDLSFNYHTFKLLLKVQYEHKTNSVNGV  827
             K+ATTLASVTVMTFMLAGG+F+KKVP FI W+R +SFNYHT++LLLKVQYE  T ++NG+
Sbjct  653   KRATTLASVTVMTFMLAGGFFVKKVPVFISWIRYMSFNYHTYRLLLKVQYEAITPAINGL  712

Query  826   QIDSGIKEVGALAAMAVSYRLLAYISLRRMKLQ  728
               D G+  VGAL AM   YRLLAY+SLRRMKLQ
Sbjct  713   STDCGLTGVGALVAMVFGYRLLAYLSLRRMKLQ  745



>ref|XP_010110448.1| ABC transporter G family member 22 [Morus notabilis]
 gb|EXC26390.1| ABC transporter G family member 22 [Morus notabilis]
Length=761

 Score =   940 bits (2429),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 532/749 (71%), Positives = 598/749 (80%), Gaps = 43/749 (6%)
 Frame = -2

Query  2863  STSLLRTKSDQLVEaiaaakgsarARLPRLSAEFAGSGVPESVRMLSRKPSRRLMppsp-  2687
             S SL RTKSDQLVE +AAA  S  A    + A  A SG   S  +L RK SRR++  +  
Sbjct  16    SGSLARTKSDQLVEKVAAAFKSPPAAQNDIVA--ASSGEAGSGSLL-RKSSRRMVTAASP  72

Query  2686  -ggggsgGTNSTHIRKSRSAQMKLDLDElssgsvlsrassasl--GFSFTGFSVRPDESA  2516
                GG   + +THIRKSRSAQMK +LDE+SSG+ LSRASSASL   FSFTGF+V PDE A
Sbjct  73    GRSGGIAASKNTHIRKSRSAQMKFELDEVSSGAALSRASSASLGLSFSFTGFTVPPDEIA  132

Query  2515  DSKPFSDDENPEDLEAGTKKKRSIPAEPTFPIYLKFTEVSYKIVIKGVTFSEEKDILNGI  2336
             DSKPFSDD+NPEDLEAG +K +   +EPT PIYLKFT+V+YK+VIKG+  +EEKDILNGI
Sbjct  133   DSKPFSDDDNPEDLEAGVRKPQ-FQSEPTLPIYLKFTDVTYKVVIKGMRANEEKDILNGI  191

Query  2335  SGAVDPGEVLALMGPSGCGKTTLLSLLGGRIRDPS-AGSITYNQHPYSKLLKSRIGFVTQ  2159
             +GAV+PGEVLALMGPSG GKTTLL+LLGGR+  P+  GSITYN  PYSK LKSRIGFVTQ
Sbjct  192   TGAVNPGEVLALMGPSGSGKTTLLNLLGGRVIQPTVGGSITYNDQPYSKFLKSRIGFVTQ  251

Query  2158  DDILFPHLTVKETLIYAARLRLPRTLTKEEKDKRAMDVIYELGLDRCQDTMIGGSFVRGV  1979
             DD+LFPHLTVKETL Y A LRLP++LT+EEK+KRA+DVIYELGL+RCQDTMIGGSFVRGV
Sbjct  252   DDVLFPHLTVKETLTYTALLRLPKSLTREEKEKRAIDVIYELGLERCQDTMIGGSFVRGV  311

Query  1978  SGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILHEIAKAGKTVITTIHQPS  1799
             SGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIV +LH+IA+AGKTVITTIHQPS
Sbjct  312   SGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVQMLHDIAEAGKTVITTIHQPS  371

Query  1798  SRLFHk--------------------------------fdklilleflldLANGNINDVS  1715
             SRLFHK                                   +   EFLLDLANGNINDVS
Sbjct  372   SRLFHKFDKLILLGKGSLLYFGKASEAMVYFSSIGCSPLIAMNPAEFLLDLANGNINDVS  431

Query  1714  IPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYETRVAETEKKKLMAPLPVEEEL  1535
             +PSEL DKVQ  NS  + TRN GKPSPA+VHEYLV  YETRVA+ EKK LM PLP++EE+
Sbjct  432   LPSELEDKVQMENSDAD-TRN-GKPSPAVVHEYLVEAYETRVADKEKKNLMFPLPLDEEI  489

Query  1534  KSKVRYLKREWGASWSEQYVLLFHRGIRERWHDYFSWLRITQVIATALILGMLWWQSGGD  1355
             KSKV   KR WGASW EQY +LF RGI+ER HDYFSWLRITQV++TA+ILG+LWWQS G 
Sbjct  490   KSKVSNPKRGWGASWWEQYCILFWRGIKERRHDYFSWLRITQVLSTAIILGLLWWQSDGH  549

Query  1354  TPSQMQDQAGLLFFIAVFWGFFPVFTAIFTFPQEKAMLSKERAADMYRLSAYFAARTTSd  1175
             +    QDQAGLLFFIAVFWGFFPVFTAIF FPQE+AML+KERAADMYRLSAYF ARTTSD
Sbjct  550   SLRGRQDQAGLLFFIAVFWGFFPVFTAIFAFPQERAMLNKERAADMYRLSAYFLARTTSD  609

Query  1174  lpldlllpliflLVVYFMAGLKQDASSFLLTAVTVFLCIVVAQGLGLAIGATLMDLKKAT  995
             LPLDLLLP++FLLVVYFMAGL+  A  F L+ +TVFLCIV AQGLGLAIGATLMD+KKAT
Sbjct  610   LPLDLLLPILFLLVVYFMAGLRLSAGPFFLSMLTVFLCIVAAQGLGLAIGATLMDIKKAT  669

Query  994   TLASVTVMTFMLAGGYFIKKVPGFIVWLRDLSFNYHTFKLLLKVQYEHKTNSVNGVQIDS  815
             TLASVTVMTFMLAGG+F+ KVP FI W+R LSFNYHT+KLLLKV Y H T +VNG+QID 
Sbjct  670   TLASVTVMTFMLAGGFFVNKVPVFISWIRYLSFNYHTYKLLLKVHYGHITLAVNGLQIDC  729

Query  814   GIKEVGALAAMAVSYRLLAYISLRRMKLQ  728
             G  EV AL AM   YR LAY+SLR MKLQ
Sbjct  730   GSTEVFALVAMVFGYRFLAYLSLRMMKLQ  758



>ref|XP_002524100.1| ATP-binding cassette transporter, putative [Ricinus communis]
 gb|EEF38310.1| ATP-binding cassette transporter, putative [Ricinus communis]
Length=749

 Score =   939 bits (2427),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 517/752 (69%), Positives = 597/752 (79%), Gaps = 42/752 (6%)
 Frame = -2

Query  2878  MEQTNSTSLLRTKSDQLVEaiaaakgsarARLPRLSAEFAGSGVPESVRMLSRKPSRRLM  2699
             ME+T+ TSL+RTKSDQLVE +AAA  S     P   A  AG    ES   LSRK S+RLM
Sbjct  1     MEKTSVTSLVRTKSDQLVETLAAAFKSP----PTNEAAAAGGTSTESSGTLSRKSSKRLM  56

Query  2698  ppspggggsgGTNSTHIRKSRSAQMKLDLDElssgsvlsrassasl--GFSFTGFSVRPD  2525
               +  G  +G   +THIRK+RSAQMK DLD+L+SG+ LSRASSASL   FSFTGF+V  D
Sbjct  57    VAASPGRSNGSGKNTHIRKTRSAQMKFDLDDLNSGAALSRASSASLGLSFSFTGFAVPQD  116

Query  2524  ESADSKPFSDDENPEDLEAGTKKKRSIPAEPTFPIYLKFTEVSYKIVIKGVTFSEEKDIL  2345
             E AD+KPFSDD+ PEDLEAG +K +    EPT PIYLKFT+V+YK++IKG+  +EEKDIL
Sbjct  117   EIADTKPFSDDDIPEDLEAGMRKPK-FQTEPTLPIYLKFTDVTYKVIIKGIASTEEKDIL  175

Query  2344  NGISGAVDPGEVLALMGPSGCGKTTLLSLLGGR-IRDPSAGSITYNQHPYSKLLKSRIGF  2168
             NGISG+VDPG+VLALMGPSG GKT+LL+LL GR I     G+ITYN  PY K LKSRIGF
Sbjct  176   NGISGSVDPGQVLALMGPSGSGKTSLLNLLSGRLIHQTVGGTITYNDQPYCKNLKSRIGF  235

Query  2167  VTQDDILFPHLTVKETLIYAARLRLPRTLTKEEKDKRAMDVIYELGLDRCQDTMIGGSFV  1988
             VTQDD+LFPHLTVKETL YAARLRLP+TLT+E+K+KRA+DVIYELGL+RCQDTMIGGSFV
Sbjct  236   VTQDDVLFPHLTVKETLTYAARLRLPKTLTREQKEKRALDVIYELGLERCQDTMIGGSFV  295

Query  1987  RGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILHEIAKAGKTVITTIH  1808
             RGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIV +L +IA+AGKTV+TTIH
Sbjct  296   RGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVQMLQDIAEAGKTVVTTIH  355

Query  1807  QPSSRLFHk--------------------------------fdklilleflldLANGNIN  1724
             QPSSRLFHK                                   +   EFLLDLANGNIN
Sbjct  356   QPSSRLFHKFDKLILLGKGSLLYFGKASETMPYFSSIGCNPLIAMNPAEFLLDLANGNIN  415

Query  1723  DVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYETRVAETEKKKLMAPLPVE  1544
             DVS+PSEL D+VQ  NS  +    NGKPSP++VHEYLV  YETRVAE EKKK+M P+P++
Sbjct  416   DVSVPSELEDRVQMGNSDID--TGNGKPSPSVVHEYLVEAYETRVAEMEKKKIMVPIPLD  473

Query  1543  EELKSKVRYLKREWGASWSEQYVLLFHRGIRERWHDYFSWLRITQVIATALILGMLWWQS  1364
             EE+K KV   KR WGASW +Q+ +L  RGI+ER HDYFSWLRITQV++TA+ILG+LWWQS
Sbjct  474   EEVKLKVASPKRLWGASWWQQFTILLCRGIKERRHDYFSWLRITQVLSTAVILGLLWWQS  533

Query  1363  GGDTPSQMQDQAGLLFFIAVFWGFFPVFTAIFTFPQEKAMLSKERAADMYRLSAYFAART  1184
                +   +QDQ+GLLFFIAVFWGFFPVFTAIFTFPQE+AML+KERAADMYRLSAYF ART
Sbjct  534   NSRSLKGLQDQSGLLFFIAVFWGFFPVFTAIFTFPQERAMLNKERAADMYRLSAYFLART  593

Query  1183  TSdlpldlllpliflLVVYFMAGLKQDASSFLLTAVTVFLCIVVAQGLGLAIGATLMDLK  1004
             TSDLPLDL+LP++FLLVVYFMAGL+  A  F L+ +TVFLCIV AQGLGLAIGATLMDLK
Sbjct  594   TSDLPLDLILPVLFLLVVYFMAGLRMSAGPFFLSLLTVFLCIVAAQGLGLAIGATLMDLK  653

Query  1003  KATTLASVTVMTFMLAGGYFIKKVPGFIVWLRDLSFNYHTFKLLLKVQYEHKTNSVNGVQ  824
             KATTLASVTVMTFMLAGGYF+KKVP F+ W+R LSFNYHT+KLLLKVQYE  +  +NG++
Sbjct  654   KATTLASVTVMTFMLAGGYFVKKVPIFVAWIRYLSFNYHTYKLLLKVQYEDISPPINGIR  713

Query  823   IDSGIKEVGALAAMAVSYRLLAYISLRRMKLQ  728
             I +G+ EV AL AM   YRLLAYISLR+MK  
Sbjct  714   IGNGVTEVSALVAMVFGYRLLAYISLRKMKFN  745



>ref|XP_006481645.1| PREDICTED: ABC transporter G family member 22-like isoform X1 
[Citrus sinensis]
 ref|XP_006481646.1| PREDICTED: ABC transporter G family member 22-like isoform X2 
[Citrus sinensis]
Length=746

 Score =   937 bits (2422),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 506/748 (68%), Positives = 600/748 (80%), Gaps = 45/748 (6%)
 Frame = -2

Query  2866  NSTSLLRTKSDQLVEaiaaakgsarARLPRLSAEFAGSGVPESVRMLSRKPSRRLMppsp  2687
             +STSL RTKSDQLVE ++AA  S       +S+E AG+   +    LSRK SRR+M  + 
Sbjct  6     SSTSLARTKSDQLVETLSAAFKSP------VSSETAGAS--DGGGTLSRKSSRRMMTAAS  57

Query  2686  ggggsgGTNSTHIRKSRSAQMKLDLDElssgsvlsrassasl--GFSFTGFSVRPDESAD  2513
              G       +THIRKSRSAQ+KL+LDE+SSG+ LSRASSASL   FSFTGF++ PDE AD
Sbjct  58    PGRAGASGRNTHIRKSRSAQLKLELDEVSSGAALSRASSASLGLSFSFTGFTMPPDEIAD  117

Query  2512  SKPFSDDENPEDLEAGTKKKRSIPAEPTFPIYLKFTEVSYKIVIKGVTFSEEKDILNGIS  2333
             SKPFSDD+ PED+EAGT+++     EPT PIYLKFT+V+YK+++KG+T SEEKDILNGI+
Sbjct  118   SKPFSDDDIPEDIEAGTRERPKFQTEPTLPIYLKFTDVTYKVILKGMTSSEEKDILNGIT  177

Query  2332  GAVDPGEVLALMGPSGCGKTTLLSLLGGRIRDPS-AGSITYNQHPYSKLLKSRIGFVTQD  2156
             G+V+PGEVLALMGPSG GKTTLL+LL GR+ +P+  GSITYN HPYSK LKS+IGFVTQD
Sbjct  178   GSVNPGEVLALMGPSGSGKTTLLNLLSGRLMEPTVGGSITYNDHPYSKSLKSKIGFVTQD  237

Query  2155  DILFPHLTVKETLIYAARLRLPRTLTKEEKDKRAMDVIYELGLDRCQDTMIGGSFVRGVS  1976
             D+LFPHLTVKETL YAA LRLP TLTK++K+KRA+DVI ELGL+RCQDTMIGGSFVRGVS
Sbjct  238   DVLFPHLTVKETLTYAALLRLPNTLTKQQKEKRAIDVINELGLERCQDTMIGGSFVRGVS  297

Query  1975  GGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILHEIAKAGKTVITTIHQPSS  1796
             GGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALR V +L +IA+AGKTV+TTIHQPSS
Sbjct  298   GGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRTVQMLQDIAEAGKTVVTTIHQPSS  357

Query  1795  RLFHk--------------------------------fdklilleflldLANGNINDVSI  1712
             RLFHK                                   +   EFLLDLANGN++DVS+
Sbjct  358   RLFHKFDKLILLGKGSLLYFGKASEAMAYFSSIGCSPQIAMNPAEFLLDLANGNLHDVSV  417

Query  1711  PSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYETRVAETEKKKLMAPLPVEEELK  1532
             PSEL D+VQT NS+ +    NGKP+PAIVHEYLV  YETRVAE EKKKLMAP+P++EE+K
Sbjct  418   PSELQDRVQTENSENDTA--NGKPTPAIVHEYLVEAYETRVAENEKKKLMAPIPLDEEIK  475

Query  1531  SKVRYLKREWGASWSEQYVLLFHRGIRERWHDYFSWLRITQVIATALILGMLWWQSGGDT  1352
             +KV   KR WGASW +QY +LF RGI+E  HDYFSWLRITQV+ATA+ILG+LWWQS   +
Sbjct  476   AKVSSPKRNWGASWIQQYTILFRRGIKEHRHDYFSWLRITQVLATAVILGLLWWQSDSKS  535

Query  1351  PSQMQDQAGLLFFIAVFWGFFPVFTAIFTFPQEKAMLSKERAADMYRLSAYFAARTTSdl  1172
             P  ++DQAGLLFFIAVFW FFP+FTAIFTFPQE+AMLSKERAADMYRLSAYF ARTTSDL
Sbjct  536   PKGLEDQAGLLFFIAVFWSFFPIFTAIFTFPQERAMLSKERAADMYRLSAYFLARTTSDL  595

Query  1171  pldlllpliflLVVYFMAGLKQDASSFLLTAVTVFLCIVVAQGLGLAIGATLMDLKKATT  992
             PL+L+LP++FL++VYFMAGL+  A  F L+ +TVFL IV AQGLGLAIGA LMDLKKATT
Sbjct  596   PLNLVLPVLFLVIVYFMAGLRMGAGPFFLSMLTVFLSIVAAQGLGLAIGAILMDLKKATT  655

Query  991   LASVTVMTFMLAGGYFIKKVPGFIVWLRDLSFNYHTFKLLLKVQYEHKTNSVNGVQIDSG  812
             LASVT+MTFMLAGGYF+++VP FI W+R +SFNYHT+K+LLK+QY   + +VNG++ DS 
Sbjct  656   LASVTIMTFMLAGGYFVQEVPVFISWIRYMSFNYHTYKILLKIQYADISPTVNGMRTDSS  715

Query  811   IKEVGALAAMAVSYRLLAYISLRRMKLQ  728
              +EV AL AM   YRLLAY+SLR+MKL 
Sbjct  716   FREVCALVAMVFGYRLLAYLSLRKMKLH  743



>ref|XP_006430003.1| hypothetical protein CICLE_v10011143mg [Citrus clementina]
 gb|ESR43243.1| hypothetical protein CICLE_v10011143mg [Citrus clementina]
Length=746

 Score =   934 bits (2415),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 505/748 (68%), Positives = 600/748 (80%), Gaps = 45/748 (6%)
 Frame = -2

Query  2866  NSTSLLRTKSDQLVEaiaaakgsarARLPRLSAEFAGSGVPESVRMLSRKPSRRLMppsp  2687
             +STSL RTKSDQLVE ++AA  S       +S+E AG+   +    LSRK SRR++  + 
Sbjct  6     SSTSLARTKSDQLVETLSAAFKSP------VSSETAGAS--DGGGTLSRKSSRRMLTAAS  57

Query  2686  ggggsgGTNSTHIRKSRSAQMKLDLDElssgsvlsrassasl--GFSFTGFSVRPDESAD  2513
              G       +THIRKSRSAQ+KL+LDE+SSG+ LSRASSASL   FSFTGF++ PDE AD
Sbjct  58    PGRAGASGRNTHIRKSRSAQLKLELDEVSSGAALSRASSASLGLSFSFTGFTMPPDEIAD  117

Query  2512  SKPFSDDENPEDLEAGTKKKRSIPAEPTFPIYLKFTEVSYKIVIKGVTFSEEKDILNGIS  2333
             SKPFSDD+ PED+EAGT+++     EPT PIYLKFT+V+YK+++KG+T SEEKDILNGI+
Sbjct  118   SKPFSDDDIPEDIEAGTRERPKFQTEPTLPIYLKFTDVTYKVILKGMTSSEEKDILNGIT  177

Query  2332  GAVDPGEVLALMGPSGCGKTTLLSLLGGRIRDPS-AGSITYNQHPYSKLLKSRIGFVTQD  2156
             G+V+PGEVLALMGPSG GKTTLL+LL GR+ +P+  GSITYN HPYSK LKS+IGFVTQD
Sbjct  178   GSVNPGEVLALMGPSGSGKTTLLNLLSGRLMEPTVGGSITYNDHPYSKSLKSKIGFVTQD  237

Query  2155  DILFPHLTVKETLIYAARLRLPRTLTKEEKDKRAMDVIYELGLDRCQDTMIGGSFVRGVS  1976
             D+LFPHLTVKETL YAA LRLP TLTK++K+KRA+DVI ELGL+RCQDTMIGGSFVRGVS
Sbjct  238   DVLFPHLTVKETLTYAALLRLPNTLTKQQKEKRAIDVINELGLERCQDTMIGGSFVRGVS  297

Query  1975  GGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILHEIAKAGKTVITTIHQPSS  1796
             GGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALR V +L +IA+AGKTV+TTIHQPSS
Sbjct  298   GGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRTVQMLQDIAEAGKTVVTTIHQPSS  357

Query  1795  RLFHk--------------------------------fdklilleflldLANGNINDVSI  1712
             RLFHK                                   +   EFLLDLANGN++DVS+
Sbjct  358   RLFHKFDKLILLGKGSLLYFGKASEAMTYFSSIGCSPQIAMNPAEFLLDLANGNLHDVSV  417

Query  1711  PSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYETRVAETEKKKLMAPLPVEEELK  1532
             PSEL D+VQT NS+ +    NGKP+PAIVHEYLV  YETRVAE EKKKLMAP+P++EE+K
Sbjct  418   PSELQDRVQTENSENDTA--NGKPTPAIVHEYLVEAYETRVAENEKKKLMAPIPLDEEIK  475

Query  1531  SKVRYLKREWGASWSEQYVLLFHRGIRERWHDYFSWLRITQVIATALILGMLWWQSGGDT  1352
             +KV   KR WGASW +QY +LF RGI+E  HDYFSWLRITQV+ATA+ILG+LWWQS   +
Sbjct  476   AKVSSPKRNWGASWIQQYTILFRRGIKEHRHDYFSWLRITQVLATAVILGLLWWQSDSKS  535

Query  1351  PSQMQDQAGLLFFIAVFWGFFPVFTAIFTFPQEKAMLSKERAADMYRLSAYFAARTTSdl  1172
             P  ++DQAGLLFFIAVFW FFP+FTAIFTFPQE+AMLSKERAADMYRLSAYF ARTTSDL
Sbjct  536   PKGLEDQAGLLFFIAVFWSFFPIFTAIFTFPQERAMLSKERAADMYRLSAYFLARTTSDL  595

Query  1171  pldlllpliflLVVYFMAGLKQDASSFLLTAVTVFLCIVVAQGLGLAIGATLMDLKKATT  992
             PL+L+LP++FL++VYFMAGL+  A  F L+ +TVFL IV AQGLGLAIGA LMDLKKATT
Sbjct  596   PLNLVLPVLFLVIVYFMAGLRMGAGPFFLSMLTVFLSIVAAQGLGLAIGAILMDLKKATT  655

Query  991   LASVTVMTFMLAGGYFIKKVPGFIVWLRDLSFNYHTFKLLLKVQYEHKTNSVNGVQIDSG  812
             LASVT+MTFMLAGGYF+++VP FI W+R +SFN+HT+K+LLK+QY   +  VNG++ DSG
Sbjct  656   LASVTIMTFMLAGGYFVQEVPVFISWIRYMSFNFHTYKILLKIQYADISPIVNGMRTDSG  715

Query  811   IKEVGALAAMAVSYRLLAYISLRRMKLQ  728
              +EV AL AM   YRLLAY+SLR+MKL 
Sbjct  716   FREVCALVAMVFGYRLLAYLSLRKMKLH  743



>ref|XP_010653238.1| PREDICTED: ABC transporter G family member 22 isoform X1 [Vitis 
vinifera]
Length=748

 Score =   933 bits (2411),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 532/753 (71%), Positives = 609/753 (81%), Gaps = 44/753 (6%)
 Frame = -2

Query  2878  MEQTNSTS-LLRTKSDQLVEaiaaakgsarARLPRLSAEFAGSGVPESVRMLSRKPSRRL  2702
             ME+ NS+S ++RTKSDQLVE   A   +      R       +G  ES   LSRK SRR 
Sbjct  1     MERPNSSSGIMRTKSDQLVETAEAVAAAM-----RSPTSGEATGGAESGGTLSRKSSRRS  55

Query  2701  MppspggggsgGTNSTHIRKSRSAQMKLDLDElssgsvlsrassasl--GFSFTGFSVRP  2528
             M  +  G   G + +THIRKSRSAQ+KLDLDE+SSG+ LSRASSASL   FSFTGF+V P
Sbjct  56    MMSASPGRAGGNSKNTHIRKSRSAQIKLDLDEVSSGAALSRASSASLGFSFSFTGFTVPP  115

Query  2527  DESADSKPFSDDENPEDLEAGTKKKRSIPAEPTFPIYLKFTEVSYKIVIKGVTFSEEKDI  2348
             DE +D KPFSDD+ P+DLEAG +K+R I AEPT PIYLKF +V+YK+++KG+  + EK+I
Sbjct  116   DEISDFKPFSDDDTPDDLEAGMRKQR-IQAEPTLPIYLKFKDVTYKVILKGMRTNVEKEI  174

Query  2347  LNGISGAVDPGEVLALMGPSGCGKTTLLSLLGGRIRDPSAG-SITYNQHPYSKLLKSRIG  2171
             LNGI+G+V+PGEVLALMGPSG GKTTLL+LLGGR+  P+AG S+TYN  PYSK LKS+IG
Sbjct  175   LNGITGSVNPGEVLALMGPSGSGKTTLLNLLGGRLNQPTAGGSVTYNDQPYSKSLKSKIG  234

Query  2170  FVTQDDILFPHLTVKETLIYAARLRLPRTLTKEEKDKRAMDVIYELGLDRCQDTMIGGSF  1991
             FVTQDD+LFPHLTV+ETL YAARLRLP+TLTK++K+KRA+DVIYELGLDRCQDTMIGGSF
Sbjct  235   FVTQDDVLFPHLTVRETLTYAARLRLPKTLTKQQKEKRAVDVIYELGLDRCQDTMIGGSF  294

Query  1990  VRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILHEIAKAGKTVITTI  1811
             VRGVSGGERKRV IGNEIIINPSLLFLDEPTSGLDSTTALRIV +LH+IA+AGKTV+TTI
Sbjct  295   VRGVSGGERKRVSIGNEIIINPSLLFLDEPTSGLDSTTALRIVQMLHDIAEAGKTVLTTI  354

Query  1810  HQPSSRLFHk--------------------------------fdklilleflldLANGNI  1727
             HQPSSRLFHK                                   +   EFLLDLANGN+
Sbjct  355   HQPSSRLFHKFDKLILLGKGNLLYFGKASGTMEYFSSIGCSPLITMNPAEFLLDLANGNL  414

Query  1726  NDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYETRVAETEKKKLMAPLPV  1547
             NDVSIPSEL DKVQT +S+ E TRN GKPSPA VHEYLV  YETRVA+ EKKKLM P+P+
Sbjct  415   NDVSIPSELEDKVQTEHSETE-TRN-GKPSPADVHEYLVEAYETRVADQEKKKLMIPIPI  472

Query  1546  EEELKSKVRYLKREWGASWSEQYVLLFHRGIRERWHDYFSWLRITQVIATALILGMLWWQ  1367
             +EELKSKV   KREWGASW EQY +LF RG++ER HDYFSWLR+TQV +TA ILG+LWWQ
Sbjct  473   DEELKSKVCSPKREWGASWWEQYSILFRRGLKERRHDYFSWLRVTQVASTATILGLLWWQ  532

Query  1366  SGGDTPSQMQDQAGLLFFIAVFWGFFPVFTAIFTFPQEKAMLSKERAADMYRLSAYFAAR  1187
             S    P  +QDQAGLLFFIAVFWGFFPVFTAIFTFPQE+AMLSKERAADMYRLSAYF AR
Sbjct  533   SESTNPKGLQDQAGLLFFIAVFWGFFPVFTAIFTFPQERAMLSKERAADMYRLSAYFVAR  592

Query  1186  TTSdlpldlllpliflLVVYFMAGLKQDASSFLLTAVTVFLCIVVAQGLGLAIGATLMDL  1007
             TTSDLPLDL+LP++FL++VYFMAGL+ DA SF LT +TVFLCIV AQGLGLAIGATLMDL
Sbjct  593   TTSDLPLDLILPVLFLIIVYFMAGLRMDAGSFFLTMLTVFLCIVAAQGLGLAIGATLMDL  652

Query  1006  KKATTLASVTVMTFMLAGGYFIKKVPGFIVWLRDLSFNYHTFKLLLKVQYEHKTNSVNGV  827
             K+ATTLASVTVMTFMLAGGYF+KKVP FI W+R +SFNYHT+KLLLKVQYEH T +VNG+
Sbjct  653   KRATTLASVTVMTFMLAGGYFVKKVPIFISWIRYISFNYHTYKLLLKVQYEHITPNVNGM  712

Query  826   QIDSGIKEVGALAAMAVSYRLLAYISLRRMKLQ  728
             +ID G+KEV AL AM   YRLLAYISLRRMKL 
Sbjct  713   KIDGGLKEVSALVAMVFGYRLLAYISLRRMKLH  745



>gb|KEH41805.1| white-brown-complex ABC transporter family protein [Medicago 
truncatula]
Length=742

 Score =   928 bits (2398),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 510/753 (68%), Positives = 601/753 (80%), Gaps = 47/753 (6%)
 Frame = -2

Query  2878  MEQTNSTSLLRTKSDQLVEaiaaakgsarARLPRLSAEFAGSGVPESVRMLSRKPSRRLM  2699
             ME+ N+  + RT+SDQL E++ AA      + P+ S++ + +G  E    LSRK SRR+ 
Sbjct  1     MERGNTMGISRTQSDQLAESMVAAL-----KSPQ-SSDHSTNGALEGSGGLSRKSSRRI-  53

Query  2698  ppspggggsgGTNSTHIRKSRSAQMKLDLDElssgsvlsrassasl--GFSFTGFSVRPD  2525
               +    G GG+ ++HIRK+RSAQ+K+D DEL SG+ LSRASSASL   F FTGF++ PD
Sbjct  54    --TAASPGRGGSKNSHIRKTRSAQLKIDFDELGSGAALSRASSASLGLSFGFTGFTMPPD  111

Query  2524  ESADSKPFSDDEN-PEDLEAGTKKKRSIPAEPTFPIYLKFTEVSYKIVIKGVTFSEEKDI  2348
             + AD+KPFSDD+  PED+EAG + +     EPT PIYLKFT+V+YK+V+KG+T SEEKDI
Sbjct  112   QIADTKPFSDDDMIPEDIEAGPRARIKFQTEPTLPIYLKFTDVTYKVVLKGMTSSEEKDI  171

Query  2347  LNGISGAVDPGEVLALMGPSGCGKTTLLSLLGGRIRDPS-AGSITYNQHPYSKLLKSRIG  2171
             L GISG+V+PGEVLALMGPSG GKT+LL+LLGGRI  P+  GSITYN   YSK LKSRIG
Sbjct  172   LYGISGSVNPGEVLALMGPSGSGKTSLLNLLGGRISQPTIGGSITYNDQSYSKFLKSRIG  231

Query  2170  FVTQDDILFPHLTVKETLIYAARLRLPRTLTKEEKDKRAMDVIYELGLDRCQDTMIGGSF  1991
             FVTQDD+LFPHLTVKETL YAARLRLP+TLTKE+K++RA+DVIYELGL+RCQDTMIGGSF
Sbjct  232   FVTQDDVLFPHLTVKETLTYAARLRLPKTLTKEQKEQRALDVIYELGLERCQDTMIGGSF  291

Query  1990  VRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILHEIAKAGKTVITTI  1811
             VRGVSGGERKRVCIGNEIIINPS+LFLDEPTSGLDSTTAL+IV +L +IA+AGKTV+TTI
Sbjct  292   VRGVSGGERKRVCIGNEIIINPSILFLDEPTSGLDSTTALKIVQMLQDIAEAGKTVVTTI  351

Query  1810  HQPSSRLFHk--------------------------------fdklilleflldLANGNI  1727
             HQPSSRLFHK                                   +   EFLLDLANGNI
Sbjct  352   HQPSSRLFHKFDKLILLGKGSLLYFGKASEVMNYFQSIGCSPLISMNPAEFLLDLANGNI  411

Query  1726  NDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYETRVAETEKKKLMAPLPV  1547
             NDVS+PSEL DKVQ  N+  E    +GKPSPA VHEYLV  YE+RVAETEKKK+M  +P+
Sbjct  412   NDVSVPSELEDKVQIGNAAVE--TYHGKPSPADVHEYLVEAYESRVAETEKKKIMVSVPL  469

Query  1546  EEELKSKVRYLKREWGASWSEQYVLLFHRGIRERWHDYFSWLRITQVIATALILGMLWWQ  1367
             +E+LK+KV   KR+WGA W EQ+ +LF RGI+ER HDYFSWLRITQV++TA+ILG+LWWQ
Sbjct  470   DEDLKAKVVSAKRQWGARWDEQFSILFWRGIKERRHDYFSWLRITQVLSTAIILGLLWWQ  529

Query  1366  SGGDTPSQMQDQAGLLFFIAVFWGFFPVFTAIFTFPQEKAMLSKERAADMYRLSAYFAAR  1187
             S    P  +QDQAGLLFFIAVFWGFFPVFTAIFTFPQE+AML+KERAADMYRLSAYF AR
Sbjct  530   SDAKNPKDLQDQAGLLFFIAVFWGFFPVFTAIFTFPQERAMLNKERAADMYRLSAYFLAR  589

Query  1186  TTSdlpldlllpliflLVVYFMAGLKQDASSFLLTAVTVFLCIVVAQGLGLAIGATLMDL  1007
             TTSDLPLDL+LP++FLLVVYFMAGL+  A+ F LT +TVFLCI+ AQGLGLAIGATLMDL
Sbjct  590   TTSDLPLDLILPVLFLLVVYFMAGLRLSAAPFFLTILTVFLCIIAAQGLGLAIGATLMDL  649

Query  1006  KKATTLASVTVMTFMLAGGYFIKKVPGFIVWLRDLSFNYHTFKLLLKVQYEHKTNSVNGV  827
             K+ATTLASVTVMTFMLAGG+F++KVP FI W+R +SFNYHT+KLLLKVQYEH T  VNGV
Sbjct  650   KRATTLASVTVMTFMLAGGFFVQKVPIFISWIRYMSFNYHTYKLLLKVQYEHLTPIVNGV  709

Query  826   QIDSGIKEVGALAAMAVSYRLLAYISLRRMKLQ  728
             +ID G+ EV AL AM   YR LAY+SLRRMKLQ
Sbjct  710   KIDGGLTEVVALIAMVFGYRFLAYLSLRRMKLQ  742



>emb|CBI39105.3| unnamed protein product [Vitis vinifera]
Length=738

 Score =   927 bits (2397),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 527/743 (71%), Positives = 601/743 (81%), Gaps = 43/743 (6%)
 Frame = -2

Query  2851  LRTKSDQLVEaiaaakgsarARLPRLSAEFAGSGVPESVRMLSRKPSRRLMppspggggs  2672
             +RTKSDQLVE   A   +      R       +G  ES   LSRK SRR M  +  G   
Sbjct  1     MRTKSDQLVETAEAVAAAM-----RSPTSGEATGGAESGGTLSRKSSRRSMMSASPGRAG  55

Query  2671  gGTNSTHIRKSRSAQMKLDLDElssgsvlsrassasl--GFSFTGFSVRPDESADSKPFS  2498
             G + +THIRKSRSAQ+KLDLDE+SSG+ LSRASSASL   FSFTGF+V PDE +D KPFS
Sbjct  56    GNSKNTHIRKSRSAQIKLDLDEVSSGAALSRASSASLGFSFSFTGFTVPPDEISDFKPFS  115

Query  2497  DDENPEDLEAGTKKKRSIPAEPTFPIYLKFTEVSYKIVIKGVTFSEEKDILNGISGAVDP  2318
             DD+ P+DLEAG +K+R I AEPT PIYLKF +V+YK+++KG+  + EK+ILNGI+G+V+P
Sbjct  116   DDDTPDDLEAGMRKQR-IQAEPTLPIYLKFKDVTYKVILKGMRTNVEKEILNGITGSVNP  174

Query  2317  GEVLALMGPSGCGKTTLLSLLGGRIRDPSAG-SITYNQHPYSKLLKSRIGFVTQDDILFP  2141
             GEVLALMGPSG GKTTLL+LLGGR+  P+AG S+TYN  PYSK LKS+IGFVTQDD+LFP
Sbjct  175   GEVLALMGPSGSGKTTLLNLLGGRLNQPTAGGSVTYNDQPYSKSLKSKIGFVTQDDVLFP  234

Query  2140  HLTVKETLIYAARLRLPRTLTKEEKDKRAMDVIYELGLDRCQDTMIGGSFVRGVSGGERK  1961
             HLTV+ETL YAARLRLP+TLTK++K+KRA+DVIYELGLDRCQDTMIGGSFVRGVSGGERK
Sbjct  235   HLTVRETLTYAARLRLPKTLTKQQKEKRAVDVIYELGLDRCQDTMIGGSFVRGVSGGERK  294

Query  1960  RVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILHEIAKAGKTVITTIHQPSSRLFHk  1781
             RV IGNEIIINPSLLFLDEPTSGLDSTTALRIV +LH+IA+AGKTV+TTIHQPSSRLFHK
Sbjct  295   RVSIGNEIIINPSLLFLDEPTSGLDSTTALRIVQMLHDIAEAGKTVLTTIHQPSSRLFHK  354

Query  1780  --------------------------------fdklilleflldLANGNINDVSIPSELA  1697
                                                +   EFLLDLANGN+NDVSIPSEL 
Sbjct  355   FDKLILLGKGNLLYFGKASGTMEYFSSIGCSPLITMNPAEFLLDLANGNLNDVSIPSELE  414

Query  1696  DKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYETRVAETEKKKLMAPLPVEEELKSKVRY  1517
             DKVQT +S+ E TRN GKPSPA VHEYLV  YETRVA+ EKKKLM P+P++EELKSKV  
Sbjct  415   DKVQTEHSETE-TRN-GKPSPADVHEYLVEAYETRVADQEKKKLMIPIPIDEELKSKVCS  472

Query  1516  LKREWGASWSEQYVLLFHRGIRERWHDYFSWLRITQVIATALILGMLWWQSGGDTPSQMQ  1337
              KREWGASW EQY +LF RG++ER HDYFSWLR+TQV +TA ILG+LWWQS    P  +Q
Sbjct  473   PKREWGASWWEQYSILFRRGLKERRHDYFSWLRVTQVASTATILGLLWWQSESTNPKGLQ  532

Query  1336  DQAGLLFFIAVFWGFFPVFTAIFTFPQEKAMLSKERAADMYRLSAYFAARTTSdlpldll  1157
             DQAGLLFFIAVFWGFFPVFTAIFTFPQE+AMLSKERAADMYRLSAYF ARTTSDLPLDL+
Sbjct  533   DQAGLLFFIAVFWGFFPVFTAIFTFPQERAMLSKERAADMYRLSAYFVARTTSDLPLDLI  592

Query  1156  lpliflLVVYFMAGLKQDASSFLLTAVTVFLCIVVAQGLGLAIGATLMDLKKATTLASVT  977
             LP++FL++VYFMAGL+ DA SF LT +TVFLCIV AQGLGLAIGATLMDLK+ATTLASVT
Sbjct  593   LPVLFLIIVYFMAGLRMDAGSFFLTMLTVFLCIVAAQGLGLAIGATLMDLKRATTLASVT  652

Query  976   VMTFMLAGGYFIKKVPGFIVWLRDLSFNYHTFKLLLKVQYEHKTNSVNGVQIDSGIKEVG  797
             VMTFMLAGGYF+KKVP FI W+R +SFNYHT+KLLLKVQYEH T +VNG++ID G+KEV 
Sbjct  653   VMTFMLAGGYFVKKVPIFISWIRYISFNYHTYKLLLKVQYEHITPNVNGMKIDGGLKEVS  712

Query  796   ALAAMAVSYRLLAYISLRRMKLQ  728
             AL AM   YRLLAYISLRRMKL 
Sbjct  713   ALVAMVFGYRLLAYISLRRMKLH  735



>ref|XP_007028064.1| White-brown-complex ABC transporter family isoform 1 [Theobroma 
cacao]
 gb|EOY08566.1| White-brown-complex ABC transporter family isoform 1 [Theobroma 
cacao]
Length=824

 Score =   927 bits (2395),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 541/810 (67%), Positives = 608/810 (75%), Gaps = 96/810 (12%)
 Frame = -2

Query  2899  CTVNQFQMEQTNSTSLLRTKSDQLVEaiaaakgsarARLPRLSAEFAGSGVPESVRMLSR  2720
               VN    + TNST+L RTKSDQLVE +AAA      + P  S +    G  +S   LSR
Sbjct  22    AVVNSHMEKPTNSTTLARTKSDQLVETLAAAF-----KSPTQSDQ--APGTSDSGGTLSR  74

Query  2719  KPSRRLMppspggggsgGTNSTHIRKSRSAQMKLDLDElssgsvlsrassasl--GFSFT  2546
             K SRRLM  +  G  SGG+ +THIRKSRSAQMKLDL+ELSSG+ LSRASSASL   FSFT
Sbjct  75    KSSRRLMMAASPGRSSGGSKNTHIRKSRSAQMKLDLEELSSGAALSRASSASLGLSFSFT  134

Query  2545  GFSVRPDESADSKPFSDDENPEDLEAGTKKKRSIPAEPTFPIYLK---------------  2411
             GF+V PDE ADSKPFSDD+ PED+EAGT K +    EPT PIYLK               
Sbjct  135   GFTVPPDEIADSKPFSDDDIPEDIEAGTHKPK-FQTEPTLPIYLKARMGNCLKINAIHRT  193

Query  2410  ------------------------------------FTEVSYKIVIKGVTFSEEKDILNG  2339
                                                  T+V+YK++IKG+T SEE+DIL+G
Sbjct  194   WLAWSGSVLYRVSSYMTFMYKTLPSFQQMKKIAESGLTDVTYKVIIKGMTTSEERDILSG  253

Query  2338  ISGAVDPGEVLALMGPSGCGKTTLLSLLGGRIRDPS-AGSITYNQHPYSKLLKSRIGFVT  2162
             ISGAV+PGEVLALMGPSG GKTTLL+LLGGR+   S  GSITYN  PYSK LKSRIGFVT
Sbjct  254   ISGAVNPGEVLALMGPSGSGKTTLLNLLGGRLNQSSVGGSITYNDQPYSKFLKSRIGFVT  313

Query  2161  QDDILFPHLTVKETLIYAARLRLPRTLTKEEKDKRAMDVIYELGLDRCQDTMIGGSFVRG  1982
             QDD+LFPHLTVKETL YAARLRLP+TLTK++K+KRA+DVIYELGL+RCQDTMIGGSFVRG
Sbjct  314   QDDVLFPHLTVKETLTYAARLRLPKTLTKQQKEKRAIDVIYELGLERCQDTMIGGSFVRG  373

Query  1981  VSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILHEIAKAGKTVITTIHQP  1802
             VSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALR V  L +IA+AGKTVITTIHQP
Sbjct  374   VSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRTVQTLQDIAEAGKTVITTIHQP  433

Query  1801  SSRLFHk--------------------------------fdklilleflldLANGNINDV  1718
             SSRLFHK                                   +   EFLLDLANGNIND+
Sbjct  434   SSRLFHKFDKLILLGKGSLLYFGKASEAIVYFSSIGCSPLIAMNPAEFLLDLANGNINDI  493

Query  1717  SIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYETRVAETEKKKLMAPLPVEEE  1538
             S+PSEL DKVQ  NS+ E TRN GKP PA+VHEYLV  YE+RVAE EKKKLM PLP++EE
Sbjct  494   SVPSELEDKVQMENSEAE-TRN-GKPPPAVVHEYLVEAYESRVAENEKKKLMTPLPLDEE  551

Query  1537  LKSKVRYLKREWGASWSEQYVLLFHRGIRERWHDYFSWLRITQVIATALILGMLWWQSGG  1358
             LK KV   KR+WGASW +QY +LF RGI+ER HDYFSWLRITQV++TA+ILG+LWWQS  
Sbjct  552   LKLKVSSSKRQWGASWWQQYCILFCRGIKERRHDYFSWLRITQVLSTAIILGLLWWQSDS  611

Query  1357  DTPSQMQDQAGLLFFIAVFWGFFPVFTAIFTFPQEKAMLSKERAADMYRLSAYFAARTTS  1178
              +P   QDQAGLLFFIAVFWGFFPVFTAIFTFPQE+AMLSKERAADMYRLSAYF ARTTS
Sbjct  612   KSPKGRQDQAGLLFFIAVFWGFFPVFTAIFTFPQERAMLSKERAADMYRLSAYFLARTTS  671

Query  1177  dlpldlllpliflLVVYFMAGLKQDASSFLLTAVTVFLCIVVAQGLGLAIGATLMDLKKA  998
             DLPLDL+LP++FLLVVYFMAGL+  AS F L+ +TVFLCIV AQGLGLAIGATLMDLK+A
Sbjct  672   DLPLDLILPVLFLLVVYFMAGLRVSASPFFLSMLTVFLCIVAAQGLGLAIGATLMDLKRA  731

Query  997   TTLASVTVMTFMLAGGYFIKKVPGFIVWLRDLSFNYHTFKLLLKVQYEHKTNSVNGVQID  818
             TTLASVTVMTFMLAGGYF+KKVP FI W+R +SFNYHT+KLLLKVQY+     VNG+  D
Sbjct  732   TTLASVTVMTFMLAGGYFVKKVPVFISWIRHISFNYHTYKLLLKVQYQDIMPPVNGITTD  791

Query  817   SGIKEVGALAAMAVSYRLLAYISLRRMKLQ  728
             SG+KEVGAL AM   YRLLAY+SLRRMKL 
Sbjct  792   SGLKEVGALVAMIFGYRLLAYLSLRRMKLH  821



>ref|XP_004303381.1| PREDICTED: ABC transporter G family member 22-like [Fragaria 
vesca subsp. vesca]
Length=747

 Score =   924 bits (2388),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 517/753 (69%), Positives = 594/753 (79%), Gaps = 45/753 (6%)
 Frame = -2

Query  2878  MEQTNSTSLLRTKSDQLVEaiaaakgsarARLPRLSAEFAGSGVPESVRMLSRKPSRRLM  2699
             ME+ NS+ L RTKSDQLVE +AAA  S  +      A             LSRK SRR+M
Sbjct  1     MEKLNSSGLARTKSDQLVETVAAAFKSPTSSEAAAVAAEG------GSGTLSRKSSRRIM  54

Query  2698  ppspggggsgGTNSTHIRKSRSAQMKLDLDElssgsvlsrassasl--GFSFTGFSVRPD  2525
               SPG G      STHIRK+RSAQMK DLDE+ SG+ LSRASSASL   FSFTGF+V  D
Sbjct  55    GASPGRGSGSAKGSTHIRKTRSAQMKFDLDEVGSGAALSRASSASLGFSFSFTGFTVPAD  114

Query  2524  ESADSKPFSDDEN-PEDLEAGTKKKRSIPAEPTFPIYLKFTEVSYKIVIKGVTFSEEKDI  2348
             E ADSKPFSDD++ PEDLEAG +K +    EPT PIYLKFT+V+YK+++KG+  +EEKDI
Sbjct  115   EIADSKPFSDDDDIPEDLEAGNRKAK-FQTEPTMPIYLKFTDVTYKVILKGMRTNEEKDI  173

Query  2347  LNGISGAVDPGEVLALMGPSGCGKTTLLSLLGGRI-RDPSAGSITYNQHPYSKLLKSRIG  2171
             LNGI+G+V+PGEVLALMGPSG GKTTLL+LLGGR  +    GSI YN   YSK LKSRIG
Sbjct  174   LNGITGSVNPGEVLALMGPSGSGKTTLLNLLGGRTAKGNIGGSINYNDQIYSKNLKSRIG  233

Query  2170  FVTQDDILFPHLTVKETLIYAARLRLPRTLTKEEKDKRAMDVIYELGLDRCQDTMIGGSF  1991
             FVTQDD+LFPHLTV+ETL YAA LRLP+TLTKE+K+KRA+DVIYELGL+RCQDTMIGG+F
Sbjct  234   FVTQDDVLFPHLTVRETLTYAALLRLPKTLTKEQKEKRAVDVIYELGLERCQDTMIGGTF  293

Query  1990  VRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILHEIAKAGKTVITTI  1811
             VRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIV +L +IA+AGKTV+TTI
Sbjct  294   VRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVQMLQDIAEAGKTVVTTI  353

Query  1810  HQPSSRLFHk--------------------------------fdklilleflldLANGNI  1727
             HQPSSRLFHK                                   +   EFLLDLANGNI
Sbjct  354   HQPSSRLFHKFDKLILLGKGSLLYFGKASEAMVYFSSIGCSPLIAMNPAEFLLDLANGNI  413

Query  1726  NDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYETRVAETEKKKLMAPLPV  1547
             NDVS+PSEL DKVQ  NS E  TRN GKPSPA+VHEYLV  YETRVA+ EKKKLM P+P+
Sbjct  414   NDVSVPSELEDKVQMENS-EADTRN-GKPSPAVVHEYLVEAYETRVADEEKKKLMVPIPL  471

Query  1546  EEELKSKVRYLKREWGASWSEQYVLLFHRGIRERWHDYFSWLRITQVIATALILGMLWWQ  1367
             ++ELK K+ + KREWGASW EQ+ +LF RGI+ER HDYFSWLRITQV++TA+ILG+LWWQ
Sbjct  472   DDELKLKISFSKREWGASWWEQFSILFRRGIKERKHDYFSWLRITQVLSTAVILGLLWWQ  531

Query  1366  SGGDTPSQMQDQAGLLFFIAVFWGFFPVFTAIFTFPQEKAMLSKERAADMYRLSAYFAAR  1187
             S  +T   ++DQAGLLFFIAVFWGFFPVFTAIFTFPQE+AML+KERAADMYRLSAYF AR
Sbjct  532   SDSNTTKGLEDQAGLLFFIAVFWGFFPVFTAIFTFPQERAMLTKERAADMYRLSAYFVAR  591

Query  1186  TTSdlpldlllpliflLVVYFMAGLKQDASSFLLTAVTVFLCIVVAQGLGLAIGATLMDL  1007
             TTSDLPLDLLLP++FL+VVYFMAGL+  A +F L+ +TVFLCIV AQGLGLAIGATLMDL
Sbjct  592   TTSDLPLDLLLPVLFLVVVYFMAGLRLSAETFFLSMLTVFLCIVAAQGLGLAIGATLMDL  651

Query  1006  KKATTLASVTVMTFMLAGGYFIKKVPGFIVWLRDLSFNYHTFKLLLKVQYEHKTNSVNGV  827
             K+ATTLASVTVMTFMLAGG+F+KKVP FI W+R +SFNYHT+ LLLKVQ+E    ++NG 
Sbjct  652   KRATTLASVTVMTFMLAGGFFVKKVPVFISWIRYMSFNYHTYNLLLKVQFEDIRPTINGS  711

Query  826   QIDSGIKEVGALAAMAVSYRLLAYISLRRMKLQ  728
               D  +  VGAL AM   YRLLAY+SLRRMKLQ
Sbjct  712   STDCSLTAVGALVAMVFGYRLLAYLSLRRMKLQ  744



>ref|XP_009362643.1| PREDICTED: ABC transporter G family member 22-like isoform X2 
[Pyrus x bretschneideri]
Length=746

 Score =   918 bits (2372),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 505/754 (67%), Positives = 592/754 (79%), Gaps = 48/754 (6%)
 Frame = -2

Query  2878  MEQTNSTSLLRTKSDQLVEaiaaakgsarARLPRLSAEFAGSGVP--ESVRMLSRKPSRR  2705
             ME+ NS+ L RTKS+QLVE +AA           L +   G  +   E    LSRK SRR
Sbjct  1     MEEPNSSGLARTKSEQLVETVAA----------ELKSPLPGEAISTVEGGSTLSRKSSRR  50

Query  2704  LMppspggggsgGTNSTHIRKSRSAQMKLDLDElssgsvlsrassasl--GFSFTGFSVR  2531
             +M  SPG G      +THIRKSRSAQMKLD+DE+SSG+ LSRASSASL   FSFTGF+V 
Sbjct  51    MMGASPGRGSGSVGKNTHIRKSRSAQMKLDMDEISSGAALSRASSASLGFSFSFTGFTVP  110

Query  2530  PDESADSKPFSDDENPEDLEAGTKKKRSIPAEPTFPIYLKFTEVSYKIVIKGVTFSEEKD  2351
              D+ AD+KPFSDD++ + LEAG  +K     EPT P+YLKFT+V+YK++ KG+  +EEK 
Sbjct  111   ADDIADTKPFSDDDDLQYLEAGITRKPKFQTEPTLPLYLKFTDVTYKVIFKGMRTTEEKY  170

Query  2350  ILNGISGAVDPGEVLALMGPSGCGKTTLLSLLGGRIRDPS-AGSITYNQHPYSKLLKSRI  2174
             ILNGI+G V+PGEVLALMGPSG GKTTLL+LLGGR    +  GSITYN   YSK LKS+I
Sbjct  171   ILNGIAGLVNPGEVLALMGPSGSGKTTLLNLLGGRGSQANVGGSITYNDQTYSKYLKSKI  230

Query  2173  GFVTQDDILFPHLTVKETLIYAARLRLPRTLTKEEKDKRAMDVIYELGLDRCQDTMIGGS  1994
             GFVTQDD+LFPHLTVKETL YAA LRLP+TLTKE+K+KRA+DVI ELGL+RCQDTMIGGS
Sbjct  231   GFVTQDDVLFPHLTVKETLTYAALLRLPKTLTKEQKEKRAIDVICELGLERCQDTMIGGS  290

Query  1993  FVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILHEIAKAGKTVITT  1814
              VRGVSGGERKRVCIGNEI+INPSLLFLDEPTSGLDSTTALRI  +L +IA+AGKTV+TT
Sbjct  291   LVRGVSGGERKRVCIGNEILINPSLLFLDEPTSGLDSTTALRIGQMLQDIAEAGKTVVTT  350

Query  1813  IHQPSSRLFHk--------------------------------fdklilleflldLANGN  1730
             IHQPSSRLFHK                                   +   EFLLDLANGN
Sbjct  351   IHQPSSRLFHKFDKLILLGKGSLLYFGKASEAMVYFSSIGCSPLITMNPAEFLLDLANGN  410

Query  1729  INDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYETRVAETEKKKLMAPLP  1550
             +NDVS+PSEL D+VQ  NS+ + TRN GKPSPA+VHEYLV  YETRVA  EKKKLMAPLP
Sbjct  411   LNDVSVPSELEDEVQMGNSEADDTRN-GKPSPAVVHEYLVESYETRVANEEKKKLMAPLP  469

Query  1549  VEEELKSKVRYLKREWGASWSEQYVLLFHRGIRERWHDYFSWLRITQVIATALILGMLWW  1370
             ++EELKSK+ + KREWG SW EQ+ +LF RGI+ER HDYFSWLR TQV++TA++LG+LWW
Sbjct  470   IDEELKSKMSFSKREWGTSWWEQFSILFWRGIKERRHDYFSWLRFTQVLSTAIVLGLLWW  529

Query  1369  QSGGDTPSQMQDQAGLLFFIAVFWGFFPVFTAIFTFPQEKAMLSKERAADMYRLSAYFAA  1190
             QS  + P   +DQAGLLFFI+VFWGF PVFTAIFTFPQEKAML KER+ADMYRLSAYFA+
Sbjct  530   QSDANNPKGREDQAGLLFFISVFWGFLPVFTAIFTFPQEKAMLVKERSADMYRLSAYFAS  589

Query  1189  RTTSdlpldlllpliflLVVYFMAGLKQDASSFLLTAVTVFLCIVVAQGLGLAIGATLMD  1010
             RTTSDLPLDL+LP++FL+VVYFMAGL+  A +F L+ +TVFLCIV AQGLGLAIGATLMD
Sbjct  590   RTTSDLPLDLMLPVMFLVVVYFMAGLRLSAETFFLSMLTVFLCIVAAQGLGLAIGATLMD  649

Query  1009  LKKATTLASVTVMTFMLAGGYFIKKVPGFIVWLRDLSFNYHTFKLLLKVQYEHKTNSVNG  830
             LKKATTLASV VMTFMLAGG+F+K+VP FI W+R +SF+YHT+++LLKVQYEH T +V+G
Sbjct  650   LKKATTLASVIVMTFMLAGGFFVKEVPVFISWIRYMSFDYHTYRILLKVQYEHITPTVHG  709

Query  829   VQIDSGIKEVGALAAMAVSYRLLAYISLRRMKLQ  728
             +  D G+ EVGAL AM   YRLLAY+SLRRMKLQ
Sbjct  710   LTTDCGLTEVGALIAMVFGYRLLAYLSLRRMKLQ  743



>ref|XP_009362642.1| PREDICTED: ABC transporter G family member 22-like isoform X1 
[Pyrus x bretschneideri]
Length=747

 Score =   918 bits (2372),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 507/755 (67%), Positives = 593/755 (79%), Gaps = 49/755 (6%)
 Frame = -2

Query  2878  MEQTNSTSLLRTKSDQLVEaiaaakgsarARLPRLSAEFAGSGVP--ESVRMLSRKPSRR  2705
             ME+ NS+ L RTKS+QLVE +AA           L +   G  +   E    LSRK SRR
Sbjct  1     MEEPNSSGLARTKSEQLVETVAA----------ELKSPLPGEAISTVEGGSTLSRKSSRR  50

Query  2704  LMppspggggsgGTNSTHIRKSRSAQMKLDLDElssgsvlsrassasl--GFSFTGFSVR  2531
             +M  SPG G      +THIRKSRSAQMKLD+DE+SSG+ LSRASSASL   FSFTGF+V 
Sbjct  51    MMGASPGRGSGSVGKNTHIRKSRSAQMKLDMDEISSGAALSRASSASLGFSFSFTGFTVP  110

Query  2530  PDESADSKPFSDDEN-PEDLEAGTKKKRSIPAEPTFPIYLKFTEVSYKIVIKGVTFSEEK  2354
              D+ AD+KPFSDD++ PE LEAG  +K     EPT P+YLKFT+V+YK++ KG+  +EEK
Sbjct  111   ADDIADTKPFSDDDDLPEYLEAGITRKPKFQTEPTLPLYLKFTDVTYKVIFKGMRTTEEK  170

Query  2353  DILNGISGAVDPGEVLALMGPSGCGKTTLLSLLGGRIRDPS-AGSITYNQHPYSKLLKSR  2177
              ILNGI+G V+PGEVLALMGPSG GKTTLL+LLGGR    +  GSITYN   YSK LKS+
Sbjct  171   YILNGIAGLVNPGEVLALMGPSGSGKTTLLNLLGGRGSQANVGGSITYNDQTYSKYLKSK  230

Query  2176  IGFVTQDDILFPHLTVKETLIYAARLRLPRTLTKEEKDKRAMDVIYELGLDRCQDTMIGG  1997
             IGFVTQDD+LFPHLTVKETL YAA LRLP+TLTKE+K+KRA+DVI ELGL+RCQDTMIGG
Sbjct  231   IGFVTQDDVLFPHLTVKETLTYAALLRLPKTLTKEQKEKRAIDVICELGLERCQDTMIGG  290

Query  1996  SFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILHEIAKAGKTVIT  1817
             S VRGVSGGERKRVCIGNEI+INPSLLFLDEPTSGLDSTTALRI  +L +IA+AGKTV+T
Sbjct  291   SLVRGVSGGERKRVCIGNEILINPSLLFLDEPTSGLDSTTALRIGQMLQDIAEAGKTVVT  350

Query  1816  TIHQPSSRLFHk--------------------------------fdklilleflldLANG  1733
             TIHQPSSRLFHK                                   +   EFLLDLANG
Sbjct  351   TIHQPSSRLFHKFDKLILLGKGSLLYFGKASEAMVYFSSIGCSPLITMNPAEFLLDLANG  410

Query  1732  NINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYETRVAETEKKKLMAPL  1553
             N+NDVS+PSEL D+VQ  NS+ + TRN GKPSPA+VHEYLV  YETRVA  EKKKLMAPL
Sbjct  411   NLNDVSVPSELEDEVQMGNSEADDTRN-GKPSPAVVHEYLVESYETRVANEEKKKLMAPL  469

Query  1552  PVEEELKSKVRYLKREWGASWSEQYVLLFHRGIRERWHDYFSWLRITQVIATALILGMLW  1373
             P++EELKSK+ + KREWG SW EQ+ +LF RGI+ER HDYFSWLR TQV++TA++LG+LW
Sbjct  470   PIDEELKSKMSFSKREWGTSWWEQFSILFWRGIKERRHDYFSWLRFTQVLSTAIVLGLLW  529

Query  1372  WQSGGDTPSQMQDQAGLLFFIAVFWGFFPVFTAIFTFPQEKAMLSKERAADMYRLSAYFA  1193
             WQS  + P   +DQAGLLFFI+VFWGF PVFTAIFTFPQEKAML KER+ADMYRLSAYFA
Sbjct  530   WQSDANNPKGREDQAGLLFFISVFWGFLPVFTAIFTFPQEKAMLVKERSADMYRLSAYFA  589

Query  1192  ARTTSdlpldlllpliflLVVYFMAGLKQDASSFLLTAVTVFLCIVVAQGLGLAIGATLM  1013
             +RTTSDLPLDL+LP++FL+VVYFMAGL+  A +F L+ +TVFLCIV AQGLGLAIGATLM
Sbjct  590   SRTTSDLPLDLMLPVMFLVVVYFMAGLRLSAETFFLSMLTVFLCIVAAQGLGLAIGATLM  649

Query  1012  DLKKATTLASVTVMTFMLAGGYFIKKVPGFIVWLRDLSFNYHTFKLLLKVQYEHKTNSVN  833
             DLKKATTLASV VMTFMLAGG+F+K+VP FI W+R +SF+YHT+++LLKVQYEH T +V+
Sbjct  650   DLKKATTLASVIVMTFMLAGGFFVKEVPVFISWIRYMSFDYHTYRILLKVQYEHITPTVH  709

Query  832   GVQIDSGIKEVGALAAMAVSYRLLAYISLRRMKLQ  728
             G+  D G+ EVGAL AM   YRLLAY+SLRRMKLQ
Sbjct  710   GLTTDCGLTEVGALIAMVFGYRLLAYLSLRRMKLQ  744



>ref|XP_011047134.1| PREDICTED: ABC transporter G family member 22-like isoform X2 
[Populus euphratica]
Length=752

 Score =   914 bits (2362),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 516/752 (69%), Positives = 599/752 (80%), Gaps = 48/752 (6%)
 Frame = -2

Query  2878  MEQTNSTSLLRTKSDQLVEaiaaakgsarARLPRLSAEFAGSGVPESVRMLSRKPSRRLM  2699
             ME+ N TSL RTKS+QL E + AA  S    +    A   GSG       LS K S+RL 
Sbjct  10    MERAN-TSLARTKSEQLAETVEAAFKSP---MNSDGASEGGSG-----GTLSGKSSKRLT  60

Query  2698  ppspggggsgGTN-STHIRKSRSAQMKLDLDElssgsvlsrassasl--GFSFTGFSVRP  2528
               +  G  + G N STHIRKSRSAQMK +LD+++SG+ LSRASSASL   FSFTGF++ P
Sbjct  61    TAASPGRATSGGNKSTHIRKSRSAQMKFELDDVNSGAALSRASSASLGFSFSFTGFNMPP  120

Query  2527  DESADSKPFSDDENPEDLEAGTKKKRSIPAEPTFPIYLKFTEVSYKIVIKGVTFSEEKDI  2348
             DE ADS PFSDD+ PEDLEAG +K++    +P+ PIYLKF +V+YK++IKG+T +EEKDI
Sbjct  121   DEIADSMPFSDDDIPEDLEAGMRKQK-FQTDPSLPIYLKFRDVTYKVIIKGMTSTEEKDI  179

Query  2347  LNGISGAVDPGEVLALMGPSGCGKTTLLSLLGGRI-RDPSAGSITYNQHPYSKLLKSRIG  2171
             LNGISG+VDPGEVLALMGPSG GKTTLL+LLGGR+ + P  GSITYN  PYSK LKSRIG
Sbjct  180   LNGISGSVDPGEVLALMGPSGSGKTTLLNLLGGRLNQPPVGGSITYNDRPYSKFLKSRIG  239

Query  2170  FVTQDDILFPHLTVKETLIYAARLRLPRTLTKEEKDKRAMDVIYELGLDRCQDTMIGGSF  1991
             FVTQDDILFPHLTVKETL YAA LRLP+TLTK++K +RAMDVIYELGL+RCQDT+IGGSF
Sbjct  240   FVTQDDILFPHLTVKETLTYAALLRLPKTLTKQQKQRRAMDVIYELGLERCQDTVIGGSF  299

Query  1990  VRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILHEIAKAGKTVITTI  1811
             VRGVSGGERKRVCIGNEIIINPS+LFLDEPTSGLDSTTAL+ V +L ++A+ GKTV+TTI
Sbjct  300   VRGVSGGERKRVCIGNEIIINPSILFLDEPTSGLDSTTALKTVQLLQDMAEGGKTVVTTI  359

Query  1810  HQPSSRLFHk--------------------------------fdklilleflldLANGNI  1727
             HQPSSRLFHK                                   +   EFLLDLANGN+
Sbjct  360   HQPSSRLFHKFDKLILLGKGSLLYFGKSSAAMPYFSSIGCNPLIAMNPAEFLLDLANGNV  419

Query  1726  NDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYETRVAETEKKKLMAPLPV  1547
             NDVS+PSEL DKVQ  NS  +  + NGKPSPA+VHEYLV  YETRVA  EKKKLM P+P+
Sbjct  420   NDVSVPSELEDKVQIGNS--DAGKRNGKPSPAVVHEYLVEAYETRVAVKEKKKLMVPIPL  477

Query  1546  EEELKSKVRYLKREWGASWSEQYVLLFHRGIRERWHDYFSWLRITQVIATALILGMLWWQ  1367
             +EE+K+KV  LKR+WGASW +QY +LF RGI+ER HDYFSWLRITQV++TA+ILG+LWW 
Sbjct  478   DEEVKAKVSSLKRQWGASWWQQYTILFRRGIKERRHDYFSWLRITQVLSTAIILGLLWWN  537

Query  1366  SGGDTPSQMQDQAGLLFFIAVFWGFFPVFTAIFTFPQEKAMLSKERAADMYRLSAYFAAR  1187
             S  D+   +QDQAGLLFFIAVFWGFFPVFTAIFTFPQE+AMLSKERAADMYRLSAYF AR
Sbjct  538   SDTDSLKGLQDQAGLLFFIAVFWGFFPVFTAIFTFPQERAMLSKERAADMYRLSAYFLAR  597

Query  1186  TTSdlpldlllpliflLVVYFMAGLKQDASSFLLTAVTVFLCIVVAQGLGLAIGATLMDL  1007
             TTSDLPLDL+LP++FLLVVYFMAGL+  A+SF LT +TVFL IV AQGLGLAIGATLMDL
Sbjct  598   TTSDLPLDLILPVLFLLVVYFMAGLRMSAASFFLTMLTVFLSIVAAQGLGLAIGATLMDL  657

Query  1006  KKATTLASVTVMTFMLAGGYFIKKVPGFIVWLRDLSFNYHTFKLLLKVQYEHKTNSVNGV  827
             K+ATTLASVTVMTFMLAGGYF+K+VP F+ W+R +SFNYHT+KLLL VQY+H T  +NG+
Sbjct  658   KRATTLASVTVMTFMLAGGYFVKRVPVFVSWIRYMSFNYHTYKLLLNVQYKHMTPVLNGM  717

Query  826   QIDSGIKEVGALAAMAVSYRLLAYISLRRMKL  731
             +IDSG+ EV AL AM   YRLLAYISLRRMKL
Sbjct  718   RIDSGLAEVSALVAMVFGYRLLAYISLRRMKL  749



>ref|XP_011047133.1| PREDICTED: ABC transporter G family member 22-like isoform X1 
[Populus euphratica]
Length=753

 Score =   914 bits (2362),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 516/752 (69%), Positives = 599/752 (80%), Gaps = 48/752 (6%)
 Frame = -2

Query  2878  MEQTNSTSLLRTKSDQLVEaiaaakgsarARLPRLSAEFAGSGVPESVRMLSRKPSRRLM  2699
             ME+ N TSL RTKS+QL E + AA  S    +    A   GSG       LS K S+RL 
Sbjct  11    MERAN-TSLARTKSEQLAETVEAAFKSP---MNSDGASEGGSG-----GTLSGKSSKRLT  61

Query  2698  ppspggggsgGTN-STHIRKSRSAQMKLDLDElssgsvlsrassasl--GFSFTGFSVRP  2528
               +  G  + G N STHIRKSRSAQMK +LD+++SG+ LSRASSASL   FSFTGF++ P
Sbjct  62    TAASPGRATSGGNKSTHIRKSRSAQMKFELDDVNSGAALSRASSASLGFSFSFTGFNMPP  121

Query  2527  DESADSKPFSDDENPEDLEAGTKKKRSIPAEPTFPIYLKFTEVSYKIVIKGVTFSEEKDI  2348
             DE ADS PFSDD+ PEDLEAG +K++    +P+ PIYLKF +V+YK++IKG+T +EEKDI
Sbjct  122   DEIADSMPFSDDDIPEDLEAGMRKQK-FQTDPSLPIYLKFRDVTYKVIIKGMTSTEEKDI  180

Query  2347  LNGISGAVDPGEVLALMGPSGCGKTTLLSLLGGRI-RDPSAGSITYNQHPYSKLLKSRIG  2171
             LNGISG+VDPGEVLALMGPSG GKTTLL+LLGGR+ + P  GSITYN  PYSK LKSRIG
Sbjct  181   LNGISGSVDPGEVLALMGPSGSGKTTLLNLLGGRLNQPPVGGSITYNDRPYSKFLKSRIG  240

Query  2170  FVTQDDILFPHLTVKETLIYAARLRLPRTLTKEEKDKRAMDVIYELGLDRCQDTMIGGSF  1991
             FVTQDDILFPHLTVKETL YAA LRLP+TLTK++K +RAMDVIYELGL+RCQDT+IGGSF
Sbjct  241   FVTQDDILFPHLTVKETLTYAALLRLPKTLTKQQKQRRAMDVIYELGLERCQDTVIGGSF  300

Query  1990  VRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILHEIAKAGKTVITTI  1811
             VRGVSGGERKRVCIGNEIIINPS+LFLDEPTSGLDSTTAL+ V +L ++A+ GKTV+TTI
Sbjct  301   VRGVSGGERKRVCIGNEIIINPSILFLDEPTSGLDSTTALKTVQLLQDMAEGGKTVVTTI  360

Query  1810  HQPSSRLFHk--------------------------------fdklilleflldLANGNI  1727
             HQPSSRLFHK                                   +   EFLLDLANGN+
Sbjct  361   HQPSSRLFHKFDKLILLGKGSLLYFGKSSAAMPYFSSIGCNPLIAMNPAEFLLDLANGNV  420

Query  1726  NDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYETRVAETEKKKLMAPLPV  1547
             NDVS+PSEL DKVQ  NS  +  + NGKPSPA+VHEYLV  YETRVA  EKKKLM P+P+
Sbjct  421   NDVSVPSELEDKVQIGNS--DAGKRNGKPSPAVVHEYLVEAYETRVAVKEKKKLMVPIPL  478

Query  1546  EEELKSKVRYLKREWGASWSEQYVLLFHRGIRERWHDYFSWLRITQVIATALILGMLWWQ  1367
             +EE+K+KV  LKR+WGASW +QY +LF RGI+ER HDYFSWLRITQV++TA+ILG+LWW 
Sbjct  479   DEEVKAKVSSLKRQWGASWWQQYTILFRRGIKERRHDYFSWLRITQVLSTAIILGLLWWN  538

Query  1366  SGGDTPSQMQDQAGLLFFIAVFWGFFPVFTAIFTFPQEKAMLSKERAADMYRLSAYFAAR  1187
             S  D+   +QDQAGLLFFIAVFWGFFPVFTAIFTFPQE+AMLSKERAADMYRLSAYF AR
Sbjct  539   SDTDSLKGLQDQAGLLFFIAVFWGFFPVFTAIFTFPQERAMLSKERAADMYRLSAYFLAR  598

Query  1186  TTSdlpldlllpliflLVVYFMAGLKQDASSFLLTAVTVFLCIVVAQGLGLAIGATLMDL  1007
             TTSDLPLDL+LP++FLLVVYFMAGL+  A+SF LT +TVFL IV AQGLGLAIGATLMDL
Sbjct  599   TTSDLPLDLILPVLFLLVVYFMAGLRMSAASFFLTMLTVFLSIVAAQGLGLAIGATLMDL  658

Query  1006  KKATTLASVTVMTFMLAGGYFIKKVPGFIVWLRDLSFNYHTFKLLLKVQYEHKTNSVNGV  827
             K+ATTLASVTVMTFMLAGGYF+K+VP F+ W+R +SFNYHT+KLLL VQY+H T  +NG+
Sbjct  659   KRATTLASVTVMTFMLAGGYFVKRVPVFVSWIRYMSFNYHTYKLLLNVQYKHMTPVLNGM  718

Query  826   QIDSGIKEVGALAAMAVSYRLLAYISLRRMKL  731
             +IDSG+ EV AL AM   YRLLAYISLRRMKL
Sbjct  719   RIDSGLAEVSALVAMVFGYRLLAYISLRRMKL  750



>ref|XP_008392009.1| PREDICTED: ABC transporter G family member 22-like [Malus domestica]
Length=747

 Score =   914 bits (2361),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 502/759 (66%), Positives = 591/759 (78%), Gaps = 57/759 (8%)
 Frame = -2

Query  2878  MEQTNSTSLLRTKSDQLVEaiaaakgsarARLPRLSAEFAGSGVPESVRM------LSRK  2717
             ME+ NS+ L RTKS+QLVE               ++A F      ++  M      LSRK
Sbjct  1     MEKPNSSGLARTKSEQLVET--------------IAAAFKSPPSGDATSMVEGGSTLSRK  46

Query  2716  PSRRLMppspggggsgGTNSTHIRKSRSAQMKLDLDElssgsvlsrassasl--GFSFTG  2543
              SRR+M  SPG G      +THIRKSRSAQ+KLDLDE+ SG+ LSRASSASL   FSFTG
Sbjct  47    SSRRMMGASPGRGSGSAGKNTHIRKSRSAQLKLDLDEIGSGAALSRASSASLGFSFSFTG  106

Query  2542  FSVRPDESADSKPFSDDEN-PEDLEAGTKKKRSIPAEPTFPIYLKFTEVSYKIVIKGVTF  2366
             F+V  ++ ADSKPFSDD+   EDLEAG  +K     EPT P+YLKFT+V+YK++ KG+  
Sbjct  107   FTVPAEDIADSKPFSDDDXLREDLEAGITRKPKFQTEPTLPLYLKFTDVTYKVIFKGMRT  166

Query  2365  SEEKDILNGISGAVDPGEVLALMGPSGCGKTTLLSLLGGRIRDPSA-GSITYNQHPYSKL  2189
             +EEKDILNGI+G+V+PGEVLALMGPSG GKTTLL+LLGGR    +  GSITYN   YSK 
Sbjct  167   AEEKDILNGITGSVNPGEVLALMGPSGSGKTTLLNLLGGRGSQTNVRGSITYNDKIYSKY  226

Query  2188  LKSRIGFVTQDDILFPHLTVKETLIYAARLRLPRTLTKEEKDKRAMDVIYELGLDRCQDT  2009
             LKS+IGFVTQDD+LFPHLTVKETL YAA LRLP+ L K++K+KRA++VIYELGL+RCQDT
Sbjct  227   LKSKIGFVTQDDVLFPHLTVKETLTYAALLRLPKKLMKDQKEKRAIEVIYELGLERCQDT  286

Query  2008  MIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILHEIAKAGK  1829
             MIGGSFVRGVSGGERKRVCIGNEI+INPSLLFLDEPTSGLDSTTALRIV +L +IA+AGK
Sbjct  287   MIGGSFVRGVSGGERKRVCIGNEILINPSLLFLDEPTSGLDSTTALRIVQMLQDIAEAGK  346

Query  1828  TVITTIHQPSSRLFHk--------------------------------fdklilleflld  1745
             TV+TTIHQPSSRLFHK                                   +   EFLLD
Sbjct  347   TVVTTIHQPSSRLFHKFDKLILLGKGSLLYFGKASXAMVYFSSIGCSPLISMNPAEFLLD  406

Query  1744  LANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYETRVAETEKKKL  1565
             LANGN+NDVS+PSEL DKVQ  NS+   TRN GKPSPA+V EYLV CYETRVA+ EKKK+
Sbjct  407   LANGNLNDVSVPSELEDKVQMGNSEAADTRN-GKPSPAVVQEYLVECYETRVADKEKKKI  465

Query  1564  MAPLPVEEELKSKVRYLKREWGASWSEQYVLLFHRGIRERWHDYFSWLRITQVIATALIL  1385
             M PLP+++ELK K+ + KREWGASW EQ+ +LF RGI+ER HDYFSWLRITQVI+TA+IL
Sbjct  466   MVPLPLDDELKLKISFSKREWGASWWEQFSILFCRGIKERRHDYFSWLRITQVISTAIIL  525

Query  1384  GMLWWQSGGDTPSQMQDQAGLLFFIAVFWGFFPVFTAIFTFPQEKAMLSKERAADMYRLS  1205
             G+LWWQS  + P   +DQAGLLFF++VFWGF PVFTAIFTFPQE+AML KER+ADMYRLS
Sbjct  526   GLLWWQSDANDPKGREDQAGLLFFMSVFWGFLPVFTAIFTFPQERAMLMKERSADMYRLS  585

Query  1204  AYFAARTTSdlpldlllpliflLVVYFMAGLKQDASSFLLTAVTVFLCIVVAQGLGLAIG  1025
             AYF +RTTSDLPLDL+LP++FL+VVYFMAGL+  A +F L+ +TVFLCIV AQGLGLAIG
Sbjct  586   AYFVSRTTSDLPLDLMLPVLFLVVVYFMAGLRPSAETFFLSMLTVFLCIVAAQGLGLAIG  645

Query  1024  ATLMDLKKATTLASVTVMTFMLAGGYFIKKVPGFIVWLRDLSFNYHTFKLLLKVQYEHKT  845
             ATLMDLKKATTLASVTVMTFMLAGG+F+KKVP FI W+R +SF+YHT++LLLKVQYEH T
Sbjct  646   ATLMDLKKATTLASVTVMTFMLAGGFFVKKVPVFISWIRYMSFDYHTYRLLLKVQYEHIT  705

Query  844   NSVNGVQIDSGIKEVGALAAMAVSYRLLAYISLRRMKLQ  728
              +++G+  D G+ EV AL AM   YR LAY+SLRRMKLQ
Sbjct  706   PTIHGLSTDCGLTEVVALIAMVFGYRFLAYLSLRRMKLQ  744



>ref|XP_004494278.1| PREDICTED: ABC transporter G family member 22-like isoform X1 
[Cicer arietinum]
Length=737

 Score =   912 bits (2358),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 501/753 (67%), Positives = 584/753 (78%), Gaps = 53/753 (7%)
 Frame = -2

Query  2878  MEQTN-STSLLRTKSDQLVEaiaaakgsarARLPRLSAEFAGSGVPESVRMLSRKPSRRL  2702
             ME  N S  ++RT+SDQLVE++ A+      + P  S+E     V      L RK S+R 
Sbjct  1     MEDENYSKGIMRTQSDQLVESVVASL-----KSPPGSSESIRGVVEGGSGSLIRKSSKR-  54

Query  2701  MppspggggsgGTNSTHIRKSRSAQ--MKLDLDElssgsvlsrassaslGFSFTGFSVRP  2528
                      S    +THIRK+RSAQ  +K+DLD++SSG+ LSRASS  L FSFTGFS+  
Sbjct  55    --------ASPSGRNTHIRKARSAQTSLKVDLDDVSSGAALSRASSLGLSFSFTGFSIPL  106

Query  2527  DESADSKPFSDDENPEDLEAGTKKKRSIPAEPTFPIYLKFTEVSYKIVIKGVTFSEEKDI  2348
             DE + SKPFSDD+ PED+EAG  K +    EPT PIYLKFT+V+YK+VIKG+T S EKDI
Sbjct  107   DEISSSKPFSDDDIPEDIEAGIHKPK-FQTEPTLPIYLKFTDVTYKVVIKGMTTSVEKDI  165

Query  2347  LNGISGAVDPGEVLALMGPSGCGKTTLLSLLGGRIRDPS-AGSITYNQHPYSKLLKSRIG  2171
             L GISG V+PGEVLALMGPSG GKT+LL+LLG R   P+  GSITYN  PYSK LKSRIG
Sbjct  166   LKGISGCVNPGEVLALMGPSGSGKTSLLNLLGARSCQPTVGGSITYNDQPYSKFLKSRIG  225

Query  2170  FVTQDDILFPHLTVKETLIYAARLRLPRTLTKEEKDKRAMDVIYELGLDRCQDTMIGGSF  1991
             FVTQDD+LFPHLTVKETL YAARLRLP+TLT+++K+KRA+DVIYELGL+RCQDTMIGGSF
Sbjct  226   FVTQDDVLFPHLTVKETLTYAARLRLPKTLTRQQKEKRALDVIYELGLERCQDTMIGGSF  285

Query  1990  VRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILHEIAKAGKTVITTI  1811
             VRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIV +LH+IA+AGKT++TTI
Sbjct  286   VRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVQMLHDIAEAGKTIVTTI  345

Query  1810  HQPSSRLFHk--------------------------------fdklilleflldLANGNI  1727
             HQPSSRLFHK                                   +   EFLLDLANGN+
Sbjct  346   HQPSSRLFHKFDKLILLGKGNLLYFGKASEAMDYFGFIGCTPLIAMNPAEFLLDLANGNM  405

Query  1726  NDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYETRVAETEKKKLMAPLPV  1547
             ND+S+PSEL DKV   N + E +  NGKPS A+V +YLV  YETRVAETEKKKLM P+P+
Sbjct  406   NDISVPSELEDKVHMGNVEVETS--NGKPSAAVVQDYLVEAYETRVAETEKKKLMDPIPL  463

Query  1546  EEELKSKVRYLKREWGASWSEQYVLLFHRGIRERWHDYFSWLRITQVIATALILGMLWWQ  1367
             +EE+KSKV   KR+WGASW EQY +LF RG +ER H+YFSWLRITQV++TA+ILG+LWWQ
Sbjct  464   DEEVKSKVYSRKRQWGASWFEQYTILFSRGFKERRHEYFSWLRITQVLSTAVILGLLWWQ  523

Query  1366  SGGDTPSQMQDQAGLLFFIAVFWGFFPVFTAIFTFPQEKAMLSKERAADMYRLSAYFAAR  1187
             S    P  +QDQAGLLFFIAVFWGFFPVFTAIFTFPQE+AML+KERA DMYRLSAYF AR
Sbjct  524   SDASNPKGLQDQAGLLFFIAVFWGFFPVFTAIFTFPQERAMLNKERATDMYRLSAYFVAR  583

Query  1186  TTSdlpldlllpliflLVVYFMAGLKQDASSFLLTAVTVFLCIVVAQGLGLAIGATLMDL  1007
             TTSDLPLDL+LP++FL+VVYFM GL+     F L+ +TVFLC+V AQGLGLAIGATLMDL
Sbjct  584   TTSDLPLDLVLPVLFLIVVYFMTGLRLSVGPFFLSILTVFLCVVAAQGLGLAIGATLMDL  643

Query  1006  KKATTLASVTVMTFMLAGGYFIKKVPGFIVWLRDLSFNYHTFKLLLKVQYEHKTNSVNGV  827
             K+ATTLASVTVMTFMLAGG+F+KKVP FI W+R LSFNYHT+ LLLKVQYEH T S+NG+
Sbjct  644   KRATTLASVTVMTFMLAGGFFVKKVPIFISWIRYLSFNYHTYNLLLKVQYEHITPSINGI  703

Query  826   QIDSGIKEVGALAAMAVSYRLLAYISLRRMKLQ  728
             +IDSG  EV AL AM   YR+LAY SLR MK+Q
Sbjct  704   RIDSGYNEVVALIAMVFGYRILAYFSLRWMKIQ  736



>emb|CDP10560.1| unnamed protein product [Coffea canephora]
Length=724

 Score =   912 bits (2356),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 513/701 (73%), Positives = 583/701 (83%), Gaps = 39/701 (6%)
 Frame = -2

Query  2728  LSRKPSRRLMppspggggsgGTNSTHIRKSRSAQMKLDLDElssgsvlsrassasl--GF  2555
             LSRK S+RL  PSPG  GS    + HIRK  SAQMK DLD++SSG+ LSRASSASL   F
Sbjct  28    LSRKSSKRLAMPSPGRSGSSTGKNAHIRKWSSAQMKFDLDDVSSGAALSRASSASLGLSF  87

Query  2554  SFTGFSVRPDESADSKPFSDDENPEDLEAGTKKKRSIPAEPTFPIYLKFTEVSYKIVIKG  2375
             SFTGF++ P+E ADSKPFSDD+  +DLEAGT+KK+ I  EPT PIYLKFT+VSYKIVIKG
Sbjct  88    SFTGFTMPPEEIADSKPFSDDD-IQDLEAGTRKKK-IHTEPTLPIYLKFTDVSYKIVIKG  145

Query  2374  VTFSEEKDILNGISGAVDPGEVLALMGPSGCGKTTLLSLLGGRIRDPS-AGSITYNQHPY  2198
             VT + EKDILNGI+G+V+PGEVLALMGPSG GKTTLLSLLGGR+R  +  GS+TYN  PY
Sbjct  146   VTSTIEKDILNGITGSVNPGEVLALMGPSGSGKTTLLSLLGGRLRGATTGGSVTYNDQPY  205

Query  2197  SKLLKSRIGFVTQDDILFPHLTVKETLIYAARLRLPRTLTKEEKDKRAMDVIYELGLDRC  2018
             SK LKSRIGFVTQDD+LFPHLTVKETL +AA+LRLP  LTK++K++RA+DVIYELGL+RC
Sbjct  206   SKFLKSRIGFVTQDDVLFPHLTVKETLTFAAQLRLPSILTKQQKEQRAVDVIYELGLERC  265

Query  2017  QDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILHEIAK  1838
             QDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIV++L +IA+
Sbjct  266   QDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVELLQDIAE  325

Query  1837  AGKTVITTIHQPSSRLFHk--------------------------------fdklillef  1754
             AGKTVITTIHQPSSRLFHK                                   +   EF
Sbjct  326   AGKTVITTIHQPSSRLFHKFDKLILLGKGNLLYFGKAAEAMVYFSSVGCSPLIAMNPAEF  385

Query  1753  lldLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYETRVAETEK  1574
             LLDLANGN+NDVS+PSEL D+VQ  N++ E TRN G+PSP IVHEYLV  YETRVAE EK
Sbjct  386   LLDLANGNLNDVSVPSELEDRVQLGNTETE-TRN-GRPSPTIVHEYLVESYETRVAENEK  443

Query  1573  KKLMAPLPVEEELKSKVRYLKREWGASWSEQYVLLFHRGIRERWHDYFSWLRITQVIATA  1394
             KKL+ PL ++E +KS+V   KREWGASW EQY +LF RG++ER HDYFSWLRITQV+ATA
Sbjct  444   KKLLVPLQIDEAIKSQVCSKKREWGASWFEQYSILFWRGLKERRHDYFSWLRITQVLATA  503

Query  1393  LILGMLWWQSGGDTPSQMQDQAGLLFFIAVFWGFFPVFTAIFTFPQEKAMLSKERAADMY  1214
             +ILGMLWWQSG + P ++QDQAGLLFFI+VFWGFFPVFTAIFTFPQE+AMLSKERAADMY
Sbjct  504   VILGMLWWQSGSNNPKEVQDQAGLLFFISVFWGFFPVFTAIFTFPQERAMLSKERAADMY  563

Query  1213  RLSAYFAARTTSdlpldlllpliflLVVYFMAGLKQDASSFLLTAVTVFLCIVVAQGLGL  1034
             RLSAYF ARTTSD+PLDLLLP++FLLVVYFMAGL+ +A SF LT VTVFLCIV AQG GL
Sbjct  564   RLSAYFVARTTSDIPLDLLLPVLFLLVVYFMAGLRLNAGSFFLTVVTVFLCIVAAQGFGL  623

Query  1033  AIGATLMDLKKATTLASVTVMTFMLAGGYFIKKVPGFIVWLRDLSFNYHTFKLLLKVQYE  854
             AIGATLMDLKK+TTLASVTVMTFMLAGGYF+KKVP FI WL  LSFNYHT+KLLLKVQYE
Sbjct  624   AIGATLMDLKKSTTLASVTVMTFMLAGGYFVKKVPVFISWLSYLSFNYHTYKLLLKVQYE  683

Query  853   HKTNSVNGVQIDSGIKEVGALAAMAVSYRLLAYISLRRMKL  731
             H ++++ G++IDSG KEV  LAAM V YRLLAY+SLRRMKL
Sbjct  684   HISHTIEGIRIDSGFKEVSVLAAMVVGYRLLAYVSLRRMKL  724



>ref|XP_002309268.1| ABC transporter family protein [Populus trichocarpa]
 gb|EEE92791.1| ABC transporter family protein [Populus trichocarpa]
Length=743

 Score =   912 bits (2356),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 516/754 (68%), Positives = 598/754 (79%), Gaps = 52/754 (7%)
 Frame = -2

Query  2878  MEQTNSTSLLRTKSDQLVEaiaaakgsarARLPRLSAEFAGSGVPE--SVRMLSRKPSRR  2705
             ME+ N TSL RTKS+QL E + AA            +     GV E  S   LS K S+R
Sbjct  1     MERAN-TSLARTKSEQLAETVEAA----------FKSPMNNDGVSEGGSGGTLSGKSSKR  49

Query  2704  LMppspggggsgGTN-STHIRKSRSAQMKLDLDElssgsvlsrassasl--GFSFTGFSV  2534
             L   +  G  + G N +THIRKSRSAQMK +LD+++SG+ LSRASSASL   FSFTGF++
Sbjct  50    LTTAASPGRTTSGGNKNTHIRKSRSAQMKFELDDVNSGAALSRASSASLGFSFSFTGFNM  109

Query  2533  RPDESADSKPFSDDENPEDLEAGTKKKRSIPAEPTFPIYLKFTEVSYKIVIKGVTFSEEK  2354
              PDE ADS PFSDD+ PEDLEAG +K++    EP+ PIYLKF +V+YK++IKG+T +EEK
Sbjct  110   PPDEIADSMPFSDDDIPEDLEAGMRKQK-FQTEPSLPIYLKFRDVTYKVIIKGMTSTEEK  168

Query  2353  DILNGISGAVDPGEVLALMGPSGCGKTTLLSLLGGRIRDPS-AGSITYNQHPYSKLLKSR  2177
             DILNGISG+VDPGEVLALMGPSG GKTTLL+LLGGR+  P+  GSITYN  PYSK LKSR
Sbjct  169   DILNGISGSVDPGEVLALMGPSGSGKTTLLNLLGGRLNQPTVGGSITYNDGPYSKFLKSR  228

Query  2176  IGFVTQDDILFPHLTVKETLIYAARLRLPRTLTKEEKDKRAMDVIYELGLDRCQDTMIGG  1997
             IGFVTQDDILFPHLTVKETL YAA LRLP+TLTK++K KRAMDVIYELGL+RCQDT+IGG
Sbjct  229   IGFVTQDDILFPHLTVKETLTYAALLRLPKTLTKQQKQKRAMDVIYELGLERCQDTVIGG  288

Query  1996  SFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILHEIAKAGKTVIT  1817
             SFVRGVSGGERKRVCIGNEIIINPS+LFLDEPTSGLDSTTAL+ V +L ++A+ GKTV+T
Sbjct  289   SFVRGVSGGERKRVCIGNEIIINPSILFLDEPTSGLDSTTALKTVQLLQDMAEGGKTVVT  348

Query  1816  TIHQPSSRLFHk--------------------------------fdklilleflldLANG  1733
             TIHQPSSRLFHK                                   +   EFLLDLANG
Sbjct  349   TIHQPSSRLFHKFDKLILLGKGSLLYFGKSSEAMLYFSSIGCNPLIAMNPAEFLLDLANG  408

Query  1732  NINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYETRVAETEKKKLMAPL  1553
             NINDVS+PSEL DKVQ  NS  +  + NGKPSPA+VHEYLV  YETRVA  EKKKLM P+
Sbjct  409   NINDVSVPSELDDKVQIVNS--DAGKRNGKPSPAVVHEYLVEAYETRVAVKEKKKLMVPI  466

Query  1552  PVEEELKSKVRYLKREWGASWSEQYVLLFHRGIRERWHDYFSWLRITQVIATALILGMLW  1373
             P++EE+K+KV  LKR+WGASW +QY +LF RGI+ER HDYFSWLRITQV++TA+ILG+LW
Sbjct  467   PLDEEVKAKVSSLKRQWGASWWQQYTILFCRGIKERRHDYFSWLRITQVLSTAIILGLLW  526

Query  1372  WQSGGDTPSQMQDQAGLLFFIAVFWGFFPVFTAIFTFPQEKAMLSKERAADMYRLSAYFA  1193
             W S  ++   +QDQAGLLFFIAVFWGFFPVFTAIFTFPQE+AMLSKERAADMYRLSAYF 
Sbjct  527   WNSDTNSLKGLQDQAGLLFFIAVFWGFFPVFTAIFTFPQERAMLSKERAADMYRLSAYFL  586

Query  1192  ARTTSdlpldlllpliflLVVYFMAGLKQDASSFLLTAVTVFLCIVVAQGLGLAIGATLM  1013
             ARTTSDLPLDL+LP++FLLVVYFMAGL+  A+ F LT +TVFL I+ AQGLGLAIGATLM
Sbjct  587   ARTTSDLPLDLVLPVLFLLVVYFMAGLRMSAAPFFLTMLTVFLSIIAAQGLGLAIGATLM  646

Query  1012  DLKKATTLASVTVMTFMLAGGYFIKKVPGFIVWLRDLSFNYHTFKLLLKVQYEHKTNSVN  833
             DLK+ATTLASVTVMTFMLAGGYF+K+VP F+ W+R LSFNYHT+KLLLKVQY+H T  +N
Sbjct  647   DLKRATTLASVTVMTFMLAGGYFVKRVPVFVSWIRYLSFNYHTYKLLLKVQYKHMTPVLN  706

Query  832   GVQIDSGIKEVGALAAMAVSYRLLAYISLRRMKL  731
             G++IDSG+ EV AL AM   YRLLAYISLRRMKL
Sbjct  707   GMRIDSGLTEVSALVAMVFGYRLLAYISLRRMKL  740



>ref|XP_006604670.1| PREDICTED: ABC transporter G family member 22-like isoform X2 
[Glycine max]
Length=740

 Score =   910 bits (2352),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 500/752 (66%), Positives = 590/752 (78%), Gaps = 54/752 (7%)
 Frame = -2

Query  2878  MEQTNSTSLLRTKSDQLVEaiaaakgsarARLPRLSAEFAGSGVPESVRMLSRKPSRRLM  2699
             ME  +++SL RTKSDQL+E +A     +       SAE  G GV      LSRK S R+ 
Sbjct  5     MENASTSSLARTKSDQLLETVATTAEKSPP-----SAE--GGGV------LSRKSSWRM-  50

Query  2698  ppspggggsgGTNSTHIRKSRSAQMKLDLDElssgsvlsrassasl--GFSFTGFSVRPD  2525
               +    G GG  +T+IRK+RSAQ+K+++DE+ SG  LSRASSASL   FSFTGF++ PD
Sbjct  51    --TASSPGGGGGRNTYIRKARSAQLKVEVDEVGSGVALSRASSASLGLSFSFTGFTLPPD  108

Query  2524  ESADSKPFSDDENPEDLEAGTKKKRSIPAEPTFPIYLKFTEVSYKIVIKGVTFSEEKDIL  2345
             E ADSKPFSDD+ PED+EAGT K +    EPT PIYLKFT+V+YK+V+KG+T ++EKDIL
Sbjct  109   EIADSKPFSDDDIPEDIEAGTPKPK-FQTEPTLPIYLKFTDVTYKVVMKGITTTKEKDIL  167

Query  2344  NGISGAVDPGEVLALMGPSGCGKTTLLSLLGGR-IRDPSAGSITYNQHPYSKLLKSRIGF  2168
              GI+G+V+PGEVLALMGPSG GKT+LL+LLGGR I+    GSITYN  PYSK LKSRIGF
Sbjct  168   KGITGSVNPGEVLALMGPSGSGKTSLLNLLGGRLIQSTIGGSITYNDQPYSKFLKSRIGF  227

Query  2167  VTQDDILFPHLTVKETLIYAARLRLPRTLTKEEKDKRAMDVIYELGLDRCQDTMIGGSFV  1988
             VTQDD+LFPHLTVKETL YAARLRLP TLTKE+K+KRA++VI ELGL+RCQDTMIGGS+V
Sbjct  228   VTQDDVLFPHLTVKETLTYAARLRLPNTLTKEQKEKRALEVIDELGLERCQDTMIGGSYV  287

Query  1987  RGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILHEIAKAGKTVITTIH  1808
             RG+SGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIV +L +IA+AGKTV+TTIH
Sbjct  288   RGISGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVQMLQDIAEAGKTVVTTIH  347

Query  1807  QPSSRLFHk--------------------------------fdklilleflldLANGNIN  1724
             QPSSRLFHK                                   +   EFLLDLANGN+N
Sbjct  348   QPSSRLFHKFDKLILLGKGSLLYFGKASDAMDYFQFIGCAPLIAMNPAEFLLDLANGNVN  407

Query  1723  DVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYETRVAETEKKKLMAPLPVE  1544
             D+S+PSEL D VQ  N++ E    NGKPS ++V EYLV  Y++RVAE EK KLM P+P++
Sbjct  408   DISVPSELKDIVQVGNAEAETC--NGKPSASVVQEYLVEAYDSRVAEIEKTKLMVPVPLD  465

Query  1543  EELKSKVRYLKREWGASWSEQYVLLFHRGIRERWHDYFSWLRITQVIATALILGMLWWQS  1364
              ELKSKV   KR+WGASW EQ+ +LF RG +ER HDYFSWLRITQV+ATA+ILG+LWWQS
Sbjct  466   VELKSKVCSCKRQWGASWFEQFSILFSRGFKERRHDYFSWLRITQVLATAVILGLLWWQS  525

Query  1363  GGDTPSQMQDQAGLLFFIAVFWGFFPVFTAIFTFPQEKAMLSKERAADMYRLSAYFAART  1184
                TP  +QDQAGLLFFIAVFWGFFPVFTAIFTFPQE+AML+KER  DMYRLSAYF ART
Sbjct  526   DAKTPKGLQDQAGLLFFIAVFWGFFPVFTAIFTFPQERAMLTKERTTDMYRLSAYFVART  585

Query  1183  TSdlpldlllpliflLVVYFMAGLKQDASSFLLTAVTVFLCIVVAQGLGLAIGATLMDLK  1004
             TSDL LDL+LP+ FLL+VYFMA L+  +  F  + +TVFLCI+ AQGLGLAIGATLMDLK
Sbjct  586   TSDLLLDLVLPVFFLLLVYFMANLRLGSGRFFFSILTVFLCIIAAQGLGLAIGATLMDLK  645

Query  1003  KATTLASVTVMTFMLAGGYFIKKVPGFIVWLRDLSFNYHTFKLLLKVQYEHKTNSVNGVQ  824
             +ATTLASVTVMTFMLAGG+F+KKVP FI W+R +SFNYHT+KLLLKVQYEH T +++G++
Sbjct  646   RATTLASVTVMTFMLAGGFFVKKVPIFISWIRYISFNYHTYKLLLKVQYEHITPTIDGIR  705

Query  823   IDSGIKEVGALAAMAVSYRLLAYISLRRMKLQ  728
             IDSG +EV AL AM   YRLLAY+SLRRMKLQ
Sbjct  706   IDSGFREVAALTAMVFGYRLLAYLSLRRMKLQ  737



>ref|XP_003553629.1| PREDICTED: ABC transporter G family member 22-like isoform X1 
[Glycine max]
 ref|XP_006604671.1| PREDICTED: ABC transporter G family member 22-like isoform X3 
[Glycine max]
Length=736

 Score =   909 bits (2350),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 500/752 (66%), Positives = 590/752 (78%), Gaps = 54/752 (7%)
 Frame = -2

Query  2878  MEQTNSTSLLRTKSDQLVEaiaaakgsarARLPRLSAEFAGSGVPESVRMLSRKPSRRLM  2699
             ME  +++SL RTKSDQL+E +A     +       SAE  G GV      LSRK S R+ 
Sbjct  1     MENASTSSLARTKSDQLLETVATTAEKSPP-----SAE--GGGV------LSRKSSWRM-  46

Query  2698  ppspggggsgGTNSTHIRKSRSAQMKLDLDElssgsvlsrassasl--GFSFTGFSVRPD  2525
               +    G GG  +T+IRK+RSAQ+K+++DE+ SG  LSRASSASL   FSFTGF++ PD
Sbjct  47    --TASSPGGGGGRNTYIRKARSAQLKVEVDEVGSGVALSRASSASLGLSFSFTGFTLPPD  104

Query  2524  ESADSKPFSDDENPEDLEAGTKKKRSIPAEPTFPIYLKFTEVSYKIVIKGVTFSEEKDIL  2345
             E ADSKPFSDD+ PED+EAGT K +    EPT PIYLKFT+V+YK+V+KG+T ++EKDIL
Sbjct  105   EIADSKPFSDDDIPEDIEAGTPKPK-FQTEPTLPIYLKFTDVTYKVVMKGITTTKEKDIL  163

Query  2344  NGISGAVDPGEVLALMGPSGCGKTTLLSLLGGR-IRDPSAGSITYNQHPYSKLLKSRIGF  2168
              GI+G+V+PGEVLALMGPSG GKT+LL+LLGGR I+    GSITYN  PYSK LKSRIGF
Sbjct  164   KGITGSVNPGEVLALMGPSGSGKTSLLNLLGGRLIQSTIGGSITYNDQPYSKFLKSRIGF  223

Query  2167  VTQDDILFPHLTVKETLIYAARLRLPRTLTKEEKDKRAMDVIYELGLDRCQDTMIGGSFV  1988
             VTQDD+LFPHLTVKETL YAARLRLP TLTKE+K+KRA++VI ELGL+RCQDTMIGGS+V
Sbjct  224   VTQDDVLFPHLTVKETLTYAARLRLPNTLTKEQKEKRALEVIDELGLERCQDTMIGGSYV  283

Query  1987  RGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILHEIAKAGKTVITTIH  1808
             RG+SGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIV +L +IA+AGKTV+TTIH
Sbjct  284   RGISGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVQMLQDIAEAGKTVVTTIH  343

Query  1807  QPSSRLFHk--------------------------------fdklilleflldLANGNIN  1724
             QPSSRLFHK                                   +   EFLLDLANGN+N
Sbjct  344   QPSSRLFHKFDKLILLGKGSLLYFGKASDAMDYFQFIGCAPLIAMNPAEFLLDLANGNVN  403

Query  1723  DVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYETRVAETEKKKLMAPLPVE  1544
             D+S+PSEL D VQ  N++ E    NGKPS ++V EYLV  Y++RVAE EK KLM P+P++
Sbjct  404   DISVPSELKDIVQVGNAEAETC--NGKPSASVVQEYLVEAYDSRVAEIEKTKLMVPVPLD  461

Query  1543  EELKSKVRYLKREWGASWSEQYVLLFHRGIRERWHDYFSWLRITQVIATALILGMLWWQS  1364
              ELKSKV   KR+WGASW EQ+ +LF RG +ER HDYFSWLRITQV+ATA+ILG+LWWQS
Sbjct  462   VELKSKVCSCKRQWGASWFEQFSILFSRGFKERRHDYFSWLRITQVLATAVILGLLWWQS  521

Query  1363  GGDTPSQMQDQAGLLFFIAVFWGFFPVFTAIFTFPQEKAMLSKERAADMYRLSAYFAART  1184
                TP  +QDQAGLLFFIAVFWGFFPVFTAIFTFPQE+AML+KER  DMYRLSAYF ART
Sbjct  522   DAKTPKGLQDQAGLLFFIAVFWGFFPVFTAIFTFPQERAMLTKERTTDMYRLSAYFVART  581

Query  1183  TSdlpldlllpliflLVVYFMAGLKQDASSFLLTAVTVFLCIVVAQGLGLAIGATLMDLK  1004
             TSDL LDL+LP+ FLL+VYFMA L+  +  F  + +TVFLCI+ AQGLGLAIGATLMDLK
Sbjct  582   TSDLLLDLVLPVFFLLLVYFMANLRLGSGRFFFSILTVFLCIIAAQGLGLAIGATLMDLK  641

Query  1003  KATTLASVTVMTFMLAGGYFIKKVPGFIVWLRDLSFNYHTFKLLLKVQYEHKTNSVNGVQ  824
             +ATTLASVTVMTFMLAGG+F+KKVP FI W+R +SFNYHT+KLLLKVQYEH T +++G++
Sbjct  642   RATTLASVTVMTFMLAGGFFVKKVPIFISWIRYISFNYHTYKLLLKVQYEHITPTIDGIR  701

Query  823   IDSGIKEVGALAAMAVSYRLLAYISLRRMKLQ  728
             IDSG +EV AL AM   YRLLAY+SLRRMKLQ
Sbjct  702   IDSGFREVAALTAMVFGYRLLAYLSLRRMKLQ  733



>ref|XP_010036577.1| PREDICTED: ABC transporter G family member 22-like [Eucalyptus 
grandis]
 ref|XP_010036578.1| PREDICTED: ABC transporter G family member 22-like [Eucalyptus 
grandis]
 gb|KCW48184.1| hypothetical protein EUGRSUZ_K01911 [Eucalyptus grandis]
Length=759

 Score =   909 bits (2349),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 511/764 (67%), Positives = 600/764 (79%), Gaps = 59/764 (8%)
 Frame = -2

Query  2878  MEQTNSTSLLRTKSDQLVEaiaaakgsarARLPRLSAE------------FAGSGVPESV  2735
             ME+T+S  L RT SDQL+E + AA      + P  S+E                G  E+ 
Sbjct  1     MERTSSPGLARTISDQLLETVVAAF-----KSPTPSSEAPGGGGLPSGGSGGSVGSAEAG  55

Query  2734  RMLSRKPSRRLMppspggggsgGTNSTHIRKSRSAQM-KLDLDElssgsvlsrassasl-  2561
               LSRK SRRL+P SPG G +  + + HIRKSRSAQ+ KL+LDE+SSG+ LSRASSASL 
Sbjct  56    GTLSRKSSRRLIPASPGRGST--SRNAHIRKSRSAQLNKLELDEVSSGAALSRASSASLG  113

Query  2560  -GFSFTGFSVRPDESADSKPFSDDEN-PEDLEAGTKKKRSIPAEPTFPIYLKFTEVSYKI  2387
               FSFTGFS+ P+E ADSKPFSDD++ PEDLEAG ++ +   AEPT PIYLKFT+V+YK+
Sbjct  114   FSFSFTGFSMPPEEIADSKPFSDDDDIPEDLEAGMQRPK-FQAEPTLPIYLKFTDVTYKV  172

Query  2386  VIKGVTFSEEKDILNGISGAVDPGEVLALMGPSGCGKTTLLSLLGGRIRDPS-AGSITYN  2210
             ++KG+   +EKDILNGI+G+V+PGEVLALMGPSG GKTTLL+LLGGRI  P+  GSITYN
Sbjct  173   ILKGMKSKQEKDILNGITGSVNPGEVLALMGPSGSGKTTLLNLLGGRIMKPTVGGSITYN  232

Query  2209  QHPYSKLLKSRIGFVTQDDILFPHLTVKETLIYAARLRLPRTLTKEEKDKRAMDVIYELG  2030
               PYSK LKSRIGFVTQDD+LFPHLTVKETL YAA LRLP++L +EEK+KRA+DVIYELG
Sbjct  233   DQPYSKSLKSRIGFVTQDDVLFPHLTVKETLTYAALLRLPKSLKREEKEKRALDVIYELG  292

Query  2029  LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  1850
             L+RC+DTMIGGSFVRGVSGGERKRVCIGNEI+INPSLLFLDEPTSGLDSTTALRIV +LH
Sbjct  293   LERCEDTMIGGSFVRGVSGGERKRVCIGNEILINPSLLFLDEPTSGLDSTTALRIVQLLH  352

Query  1849  EIAKAGKTVITTIHQPSSRLFHk--------------------------------fdkli  1766
             +IA+AGKTV+TTIHQPSSRLFHK                                   + 
Sbjct  353   DIAEAGKTVVTTIHQPSSRLFHKFDKLILLGKGSLLYFGKASEVMIYFSSIGCSPLIAMN  412

Query  1765  lleflldLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYETRVA  1586
               EFLLDLANGN+N+VS+PSEL D+VQ    K      N KPSP  VHEYLV  YETRVA
Sbjct  413   PAEFLLDLANGNVNEVSVPSELEDRVQM--EKAVTQTRNAKPSPTDVHEYLVEAYETRVA  470

Query  1585  ETEKKKLMAPLPVEEELKSKVRYLKREWGASWSEQYVLLFHRGIRERWHDYFSWLRITQV  1406
             E EKKKL+ PLP++E LKSKV   KR WGASW +QY +LF RGI+ER H+YFSWLR+TQV
Sbjct  471   ENEKKKLLTPLPLDEVLKSKVASPKRNWGASWCQQYSILFCRGIKERRHEYFSWLRVTQV  530

Query  1405  IATALILGMLWWQSGGDTPSQMQDQAGLLFFIAVFWGFFPVFTAIFTFPQEKAMLSKERA  1226
             ++TA+ILG+LWWQS   +   +QDQAGLLFFIAVFWGFFPVFTAIFTFPQE+AMLSKERA
Sbjct  531   LSTAIILGLLWWQSDSSSARGLQDQAGLLFFIAVFWGFFPVFTAIFTFPQERAMLSKERA  590

Query  1225  ADMYRLSAYFAARTTSdlpldlllpliflLVVYFMAGLKQDASSFLLTAVTVFLCIVVAQ  1046
             ADMYRLSAYF ARTTSDLPLDL+LP++FLLVVYFMAGL  DA SF L+ + VFLCI+ AQ
Sbjct  591   ADMYRLSAYFLARTTSDLPLDLILPVLFLLVVYFMAGLTLDAGSFFLSLLAVFLCIIAAQ  650

Query  1045  GLGLAIGATLMDLKKATTLASVTVMTFMLAGGYFIKKVPGFIVWLRDLSFNYHTFKLLLK  866
             GLGLAIGATLMD+K+ATTLASVTVMTFMLAGG+F++ VP F+ W+R +SFNYHT+KLL+K
Sbjct  651   GLGLAIGATLMDMKRATTLASVTVMTFMLAGGFFVENVPVFVSWIRYMSFNYHTYKLLIK  710

Query  865   VQYEHKTNSVNGVQIDSGIKEVGALAAMAVSYRLLAYISLRRMK  734
             +QY+HK +SVNG+ ID+G+KEV AL  M   YRLLAYISLRRMK
Sbjct  711   IQYKHKASSVNGMIIDNGLKEVTALVIMVFGYRLLAYISLRRMK  754



>gb|KEH24294.1| white-brown-complex ABC transporter family protein [Medicago 
truncatula]
Length=732

 Score =   908 bits (2346),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 484/679 (71%), Positives = 559/679 (82%), Gaps = 38/679 (6%)
 Frame = -2

Query  2659  STHIRKSRSAQ--MKLDLDElssgsvlsrassaslGFSFTGFSVRPDESADSKPFSDDEN  2486
             +THIRK+RS Q  +K+DLDE++SG+ LSRASS  L FSFTGFSV  DE ++SKPFSD++ 
Sbjct  56    NTHIRKARSVQTSLKVDLDEVNSGAALSRASSLGLSFSFTGFSVPLDEISNSKPFSDEDI  115

Query  2485  PEDLEAGTKKKRSIPAEPTFPIYLKFTEVSYKIVIKGVTFSEEKDILNGISGAVDPGEVL  2306
             PED+EA   K +    EPT PIYLKFT+V+YKIVIKG+T + EKDIL GI+G V+PGEVL
Sbjct  116   PEDIEARIHKPK-FQTEPTLPIYLKFTDVTYKIVIKGMTTNVEKDILKGITGCVNPGEVL  174

Query  2305  ALMGPSGCGKTTLLSLLGGRIRDPS-AGSITYNQHPYSKLLKSRIGFVTQDDILFPHLTV  2129
             ALMGPSG GKT+LL+LLG R+  P+  GSITYN  PYSK LKSRIGFVTQDD+LFPHLTV
Sbjct  175   ALMGPSGGGKTSLLNLLGARLSQPNIGGSITYNDQPYSKFLKSRIGFVTQDDVLFPHLTV  234

Query  2128  KETLIYAARLRLPRTLTKEEKDKRAMDVIYELGLDRCQDTMIGGSFVRGVSGGERKRVCI  1949
             KETL YAARLRLP+TLTKE+K++RA+DVIYELGL+RCQDTMIGGSFVRGVSGGERKRVCI
Sbjct  235   KETLTYAARLRLPKTLTKEQKEQRALDVIYELGLERCQDTMIGGSFVRGVSGGERKRVCI  294

Query  1948  GNEIIINPSLLFLDEPTSGLDSTTALRIVDILHEIAKAGKTVITTIHQPSSRLFHk----  1781
             GNEIIINPSLLFLDEPTSGLDSTTALRIV +LH+IA+AGKT+ITTIHQPSSRLFHK    
Sbjct  295   GNEIIINPSLLFLDEPTSGLDSTTALRIVQMLHDIAEAGKTIITTIHQPSSRLFHKFDKL  354

Query  1780  ----------------------------fdklilleflldLANGNINDVSIPSELADKVQ  1685
                                            +   EFLLDLANGN+ D+S+PSEL DKV 
Sbjct  355   ILLGKGNLLYFGKASEAMDYFKLIGCNPLITMNPAEFLLDLANGNMIDISVPSELNDKVH  414

Query  1684  TWNSKEEPTRNNGKPSPAIVHEYLVGCYETRVAETEKKKLMAPLPVEEELKSKVRYLKRE  1505
               N++ E    NGKPS A++ EYLV  YETRVAETEKKKLM P+P++EE+KSKVR  KR+
Sbjct  415   MGNAETETF--NGKPSAAVIQEYLVEAYETRVAETEKKKLMVPIPLDEEVKSKVRSRKRQ  472

Query  1504  WGASWSEQYVLLFHRGIRERWHDYFSWLRITQVIATALILGMLWWQSGGDTPSQMQDQAG  1325
             WGASW EQ+++LF RG +ER HDYFSWLRITQV++TA+ILG+LWWQS    P  +QDQAG
Sbjct  473   WGASWIEQFLILFSRGFKERRHDYFSWLRITQVLSTAVILGLLWWQSDASNPKGLQDQAG  532

Query  1324  LLFFIAVFWGFFPVFTAIFTFPQEKAMLSKERAADMYRLSAYFAARTTSdlpldlllpli  1145
             LLFFIAVFWGFFPVFTAIFTFPQE+AML+KERA+DMYRLSAYF ARTTSDLPLDL+LP++
Sbjct  533   LLFFIAVFWGFFPVFTAIFTFPQERAMLNKERASDMYRLSAYFVARTTSDLPLDLVLPVL  592

Query  1144  flLVVYFMAGLKQDASSFLLTAVTVFLCIVVAQGLGLAIGATLMDLKKATTLASVTVMTF  965
             FLLVVYFMAGL+  A SF L+ +TVFLCIV AQGLGLAIGATLMDLK+ATTLASVTVMTF
Sbjct  593   FLLVVYFMAGLRLSAGSFFLSILTVFLCIVAAQGLGLAIGATLMDLKRATTLASVTVMTF  652

Query  964   MLAGGYFIKKVPGFIVWLRDLSFNYHTFKLLLKVQYEHKTNSVNGVQIDSGIKEVGALAA  785
             MLAGG+F+KKVP FI W+R LSFNYHT+KLLLKVQYEH T S+NG++IDSG+ EV AL A
Sbjct  653   MLAGGFFVKKVPIFISWIRYLSFNYHTYKLLLKVQYEHITPSINGMRIDSGMNEVVALIA  712

Query  784   MAVSYRLLAYISLRRMKLQ  728
             M   YRLLAY SLR MK+Q
Sbjct  713   MVFGYRLLAYFSLRWMKIQ  731



>ref|XP_004136536.1| PREDICTED: ABC transporter G family member 22-like [Cucumis sativus]
 gb|KGN59244.1| hypothetical protein Csa_3G784390 [Cucumis sativus]
Length=749

 Score =   906 bits (2341),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 507/754 (67%), Positives = 593/754 (79%), Gaps = 45/754 (6%)
 Frame = -2

Query  2878  MEQTNSTSLLRTKSDQLVEaiaaakgsarARLPRLSAEFAGSGVPESVRMLSRKPSRRLM  2699
             ME+T+S  L RTKSDQL+E +AAA      + P  S E  G         LSRK S++ +
Sbjct  1     MEKTSSLGLARTKSDQLLEKVAAAF-----KSPMSSTEANGVVGESGSTTLSRKSSKQTL  55

Query  2698  ppspggggsgGTN--STHIRKSRSAQMKLDLDElssgsvlsrassasl--GFSFTGFSVR  2531
                  G GSG     +THIRKSRSAQ+KLDLD+L SG+ LSRASSASL   FSFTGF++ 
Sbjct  56    TAPSPGRGSGSGGGRNTHIRKSRSAQLKLDLDDLGSGAALSRASSASLGLSFSFTGFTLP  115

Query  2530  PDESADSKPFSDDENPEDLEAGTKKKRSIPAEPTFPIYLKFTEVSYKIVIKGVTFSEEKD  2351
             PDE  D KPFSD++ PED+EAGT K R    EPT PI+LKF +V+YK++IKG+  + EK+
Sbjct  116   PDEIGDFKPFSDEDIPEDVEAGTCKTR-FQTEPTMPIHLKFKDVTYKVIIKGLRTNVEKE  174

Query  2350  ILNGISGAVDPGEVLALMGPSGCGKTTLLSLLGGRI-RDPSAGSITYNQHPYSKLLKSRI  2174
             ILNGI+G V+PGEVLALMGPSG GKTTLL+LLGGRI R  + GS+TYN  PY+K LKSRI
Sbjct  175   ILNGITGLVNPGEVLALMGPSGSGKTTLLNLLGGRIIRSTAGGSVTYNDQPYNKFLKSRI  234

Query  2173  GFVTQDDILFPHLTVKETLIYAARLRLPRTLTKEEKDKRAMDVIYELGLDRCQDTMIGGS  1994
             GFV Q+D+LFPHLTVKETL YAA LRLP TLTKE+K+KRA+DVIYELGL+RCQDTMIGGS
Sbjct  235   GFVMQEDVLFPHLTVKETLRYAALLRLPNTLTKEQKEKRAIDVIYELGLERCQDTMIGGS  294

Query  1993  FVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILHEIAKAGKTVITT  1814
             FVRGVSGGER+RV IGNEIIINPSLLFLDEPTSGLDSTTALRIV ILHEIA+AGKTV+TT
Sbjct  295   FVRGVSGGERRRVSIGNEIIINPSLLFLDEPTSGLDSTTALRIVQILHEIAEAGKTVVTT  354

Query  1813  IHQPSSRLFHk--------------------------------fdklilleflldLANGN  1730
             IHQPSSRLFHK                                   +   EFLLDLANGN
Sbjct  355   IHQPSSRLFHKFDKLILLGKGSLIYYGKAAEAMNYFASIGCSPLIAMNPAEFLLDLANGN  414

Query  1729  INDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYETRVAETEKKKLMAPLP  1550
             ++DVS+PSEL DKVQ  NS+ +  ++  +PSP +V EYLV  YETRVAE EK+K++ PL 
Sbjct  415   LSDVSVPSELEDKVQMENSEADSRQD--RPSPILVQEYLVEAYETRVAEKEKRKMLTPLT  472

Query  1549  VEEELKSKVRYLKREWGASWSEQYVLLFHRGIRERWHDYFSWLRITQVIATALILGMLWW  1370
             ++EELKSKV   +R+WGASW EQY +LF RGI+ER H+YFSWLRITQV+ATA+ILG+LWW
Sbjct  473   LDEELKSKVSNSRRQWGASWWEQYSILFRRGIKERRHEYFSWLRITQVLATAVILGLLWW  532

Query  1369  QSGGDTPSQMQDQAGLLFFIAVFWGFFPVFTAIFTFPQEKAMLSKERAADMYRLSAYFAA  1190
             QS   +P  +QDQAGLLFFIAVFWGFFPVFTAIFTFPQE+AMLSKERAADMYRLSAYF A
Sbjct  533   QSESKSPKGLQDQAGLLFFIAVFWGFFPVFTAIFTFPQERAMLSKERAADMYRLSAYFLA  592

Query  1189  RTTSdlpldlllpliflLVVYFMAGLKQDASSFLLTAVTVFLCIVVAQGLGLAIGATLMD  1010
             RTTSDLPLDLLLP++FLLVVYFMAGL+  A+ F LT VTVFL IV AQGLGLAIGATLMD
Sbjct  593   RTTSDLPLDLLLPILFLLVVYFMAGLRLSAAPFFLTMVTVFLSIVAAQGLGLAIGATLMD  652

Query  1009  LKKATTLASVTVMTFMLAGGYFIKKVPGFIVWLRDLSFNYHTFKLLLKVQYEHKTNSVNG  830
             +KKATTLASVTVMTFMLAGG+F++KVP F+ W+R +SFNYHT+KLLLKVQY +   +VNG
Sbjct  653   VKKATTLASVTVMTFMLAGGFFVQKVPVFVAWIRYVSFNYHTYKLLLKVQYNNIIPAVNG  712

Query  829   VQIDSGIKEVGALAAMAVSYRLLAYISLRRMKLQ  728
             +++D+G+ EV AL AM   YRLLAYISLRRM+L 
Sbjct  713   MKMDNGVVEVTALIAMVFGYRLLAYISLRRMRLH  746



>ref|XP_007163009.1| hypothetical protein PHAVU_001G198400g [Phaseolus vulgaris]
 gb|ESW35003.1| hypothetical protein PHAVU_001G198400g [Phaseolus vulgaris]
Length=736

 Score =   905 bits (2339),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 493/752 (66%), Positives = 585/752 (78%), Gaps = 54/752 (7%)
 Frame = -2

Query  2878  MEQTNSTSLLRTKSDQLVEaiaaakgsarARLPRLSAEFAGSGVPESVRMLSRKPSRRLM  2699
             ME  +++SL RT+S+ + E +A A      + P L AE  G        +LSRKPS+R+ 
Sbjct  1     MENASTSSLARTQSEDMAETVATACV----KSPPL-AEGGG--------LLSRKPSQRM-  46

Query  2698  ppspggggsgGTNSTHIRKSRSAQMKLDLDElssgsvlsrassasl--GFSFTGFSVRPD  2525
               +      GG  ++ IR++RSAQ+K+++DE+ SG  LSRASSASL   FSFTGF++ PD
Sbjct  47    --TTASPSGGGVRNSRIRRARSAQLKVEVDEVGSGVALSRASSASLGLSFSFTGFTLPPD  104

Query  2524  ESADSKPFSDDENPEDLEAGTKKKRSIPAEPTFPIYLKFTEVSYKIVIKGVTFSEEKDIL  2345
             E ADSKPFSDD+ PED+EAGT K +    E T PIYLKFT+V+YK+VIKG+T ++EKDIL
Sbjct  105   EIADSKPFSDDDIPEDIEAGTHKPK-FQTEHTLPIYLKFTDVTYKVVIKGITTTKEKDIL  163

Query  2344  NGISGAVDPGEVLALMGPSGCGKTTLLSLLGGR-IRDPSAGSITYNQHPYSKLLKSRIGF  2168
              GI+G+V+PGEVLALMGPSG GKT+LL+LLGGR I+    GSITYN  PYSK LKSRIGF
Sbjct  164   KGITGSVNPGEVLALMGPSGSGKTSLLNLLGGRLIQSTIGGSITYNDQPYSKFLKSRIGF  223

Query  2167  VTQDDILFPHLTVKETLIYAARLRLPRTLTKEEKDKRAMDVIYELGLDRCQDTMIGGSFV  1988
             VTQDD+LFPHLTVKETL YAARLRLP  LTKE+K+KRA+DVI ELGL+RCQDTMIGGS+V
Sbjct  224   VTQDDVLFPHLTVKETLTYAARLRLPNMLTKEQKEKRALDVIEELGLERCQDTMIGGSYV  283

Query  1987  RGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILHEIAKAGKTVITTIH  1808
             RGVSGGERKRVCIG+EIIINPSLLFLDEPTSGLDSTTALRIV +L +IA+AGKTV+ TIH
Sbjct  284   RGVSGGERKRVCIGSEIIINPSLLFLDEPTSGLDSTTALRIVQVLQDIAEAGKTVVITIH  343

Query  1807  QPSSRLFHk--------------------------------fdklilleflldLANGNIN  1724
             QPSSRLFHK                                   +   EFLLDLANGN+N
Sbjct  344   QPSSRLFHKFDKLILLGKGSLLYFGKASEAMDYFQFIGCAPLITMNPAEFLLDLANGNVN  403

Query  1723  DVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYETRVAETEKKKLMAPLPVE  1544
             D+S+PSEL D+VQ  N++ E    NGKPS ++V EYL   Y++RVAE EK KLM P+P++
Sbjct  404   DISVPSELKDRVQMGNAEVETC--NGKPSASVVQEYLEEAYDSRVAEIEKTKLMVPVPLD  461

Query  1543  EELKSKVRYLKREWGASWSEQYVLLFHRGIRERWHDYFSWLRITQVIATALILGMLWWQS  1364
             EELKSK+   KR+WG SW EQ+ +LF RG +ER HDYFSWLRITQV++TA+ILG+LWWQS
Sbjct  462   EELKSKIYSCKRQWGTSWVEQFSILFSRGFKERKHDYFSWLRITQVLSTAVILGLLWWQS  521

Query  1363  GGDTPSQMQDQAGLLFFIAVFWGFFPVFTAIFTFPQEKAMLSKERAADMYRLSAYFAART  1184
               + P  +QDQAGLLFFIAVFWGFFPVFTAIFTFPQE+AML+KER  DMYRLSAYF ART
Sbjct  522   DANNPKGLQDQAGLLFFIAVFWGFFPVFTAIFTFPQERAMLTKERTTDMYRLSAYFVART  581

Query  1183  TSdlpldlllpliflLVVYFMAGLKQDASSFLLTAVTVFLCIVVAQGLGLAIGATLMDLK  1004
             TSDL LDL+LP+ FLLVVYFMA L+  A  F L+ +TVFLCI+ AQGLGLAIGATLMDLK
Sbjct  582   TSDLLLDLVLPIFFLLVVYFMASLRLSAGRFFLSILTVFLCIIAAQGLGLAIGATLMDLK  641

Query  1003  KATTLASVTVMTFMLAGGYFIKKVPGFIVWLRDLSFNYHTFKLLLKVQYEHKTNSVNGVQ  824
             +ATTLASVTVMTFMLAGG+F++KVP FI W+R LSFNYHT+KLLLKVQYEH T ++NG+ 
Sbjct  642   RATTLASVTVMTFMLAGGFFVQKVPIFISWIRYLSFNYHTYKLLLKVQYEHVTRTINGIT  701

Query  823   IDSGIKEVGALAAMAVSYRLLAYISLRRMKLQ  728
             +DSG  EV AL AM   YRLLAYISLRRMKLQ
Sbjct  702   LDSGFTEVAALLAMVFGYRLLAYISLRRMKLQ  733



>ref|XP_003521505.1| PREDICTED: ABC transporter G family member 22-like isoform X1 
[Glycine max]
 ref|XP_006577105.1| PREDICTED: ABC transporter G family member 22-like isoform X2 
[Glycine max]
Length=740

 Score =   905 bits (2338),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 500/748 (67%), Positives = 585/748 (78%), Gaps = 51/748 (7%)
 Frame = -2

Query  2869  TNSTSLLRTKSDQLVEaiaaakgsarARLPRLSAEFAGSGVPESVRMLSRKPSRRLMpps  2690
             + S+SL RTKSDQL         +   + P  SAE  G+        LSRK S R+    
Sbjct  5     STSSSLARTKSDQLA---VETVATTAEKSPP-SAEGGGA--------LSRKSSWRMTAAP  52

Query  2689  pggggsgGTNSTHIRKSRSAQMKLDLDElssgsvlsrassasl--GFSFTGFSVRPDESA  2516
               GGG GG N T+IRK+RSAQ+K+++DE+ SG  LSRASSASL   FSFTGF++ PDE A
Sbjct  53    SPGGGGGGRN-TYIRKARSAQLKVEVDEVGSGVALSRASSASLGLSFSFTGFTLPPDEIA  111

Query  2515  DSKPFSDDENPEDLEAGTKKKRSIPAEPTFPIYLKFTEVSYKIVIKGVTFSEEKDILNGI  2336
             DSKPFSDD+ PED+EAGT K +    EPT PIYLKFT+V+YK+V+KG+T ++EKDIL GI
Sbjct  112   DSKPFSDDDIPEDIEAGTPKPK-FQTEPTLPIYLKFTDVTYKLVMKGITTTKEKDILKGI  170

Query  2335  SGAVDPGEVLALMGPSGCGKTTLLSLLGGR-IRDPSAGSITYNQHPYSKLLKSRIGFVTQ  2159
             +G+V+PGEVLALMGPSG GKT+LL+LLGGR I+    GSITYN  PYSK LKSRIGFVTQ
Sbjct  171   TGSVNPGEVLALMGPSGSGKTSLLNLLGGRLIQCTIGGSITYNDQPYSKFLKSRIGFVTQ  230

Query  2158  DDILFPHLTVKETLIYAARLRLPRTLTKEEKDKRAMDVIYELGLDRCQDTMIGGSFVRGV  1979
             DD+LFPHLTVKETL YAA LRLP TL KE+K+KRA++VI ELGL+RCQDTMIGGS+VRG+
Sbjct  231   DDVLFPHLTVKETLTYAALLRLPNTLRKEQKEKRALEVIEELGLERCQDTMIGGSYVRGI  290

Query  1978  SGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILHEIAKAGKTVITTIHQPS  1799
             SGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIV +L +IA+AGKTV+TTIHQPS
Sbjct  291   SGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVQMLQDIAEAGKTVVTTIHQPS  350

Query  1798  SRLFHk--------------------------------fdklilleflldLANGNINDVS  1715
             SRLFHK                                   +   EFLLDLANGN+ND+S
Sbjct  351   SRLFHKFDKLILLGKGSLLYFGKASDAMDYFQFIGCAPLIAMNPAEFLLDLANGNVNDIS  410

Query  1714  IPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYETRVAETEKKKLMAPLPVEEEL  1535
             +PSEL DKVQ  N++ E +  NGKPS ++V EYLV  Y++RVAE EK KLM P+P++EEL
Sbjct  411   VPSELKDKVQMGNAEAETS--NGKPSASVVQEYLVEAYDSRVAEIEKTKLMIPVPLDEEL  468

Query  1534  KSKVRYLKREWGASWSEQYVLLFHRGIRERWHDYFSWLRITQVIATALILGMLWWQSGGD  1355
             KSKV   KR+WGASW EQ+ +LF RG RER HDYFSWLRITQV+ATA+ILG+LWWQS   
Sbjct  469   KSKVCSCKRQWGASWFEQFSILFSRGFRERRHDYFSWLRITQVLATAVILGLLWWQSDAK  528

Query  1354  TPSQMQDQAGLLFFIAVFWGFFPVFTAIFTFPQEKAMLSKERAADMYRLSAYFAARTTSd  1175
             TP  +QDQAGLLFFIAVFWGFFPVFTAIFTFPQE+AML+KER  DMYRLSAYF ARTTSD
Sbjct  529   TPKGLQDQAGLLFFIAVFWGFFPVFTAIFTFPQERAMLTKERTTDMYRLSAYFVARTTSD  588

Query  1174  lpldlllpliflLVVYFMAGLKQDASSFLLTAVTVFLCIVVAQGLGLAIGATLMDLKKAT  995
             L LDL+LP+ FLLVVYFMA L+  +  F  + +TVFLCI+ AQGLGLAIGATLMDLK+AT
Sbjct  589   LLLDLVLPVFFLLVVYFMANLRLGSGRFFFSILTVFLCIIAAQGLGLAIGATLMDLKRAT  648

Query  994   TLASVTVMTFMLAGGYFIKKVPGFIVWLRDLSFNYHTFKLLLKVQYEHKTNSVNGVQIDS  815
             TLASVTVMTFMLAGG+F+KKVP FI W+R +SFNYHT+KLLLKVQYEH T +++G++IDS
Sbjct  649   TLASVTVMTFMLAGGFFVKKVPIFISWIRYISFNYHTYKLLLKVQYEHITPTIDGIRIDS  708

Query  814   GIKEVGALAAMAVSYRLLAYISLRRMKL  731
             G  EV AL AM   YRLLAY+SLRRMKL
Sbjct  709   GFTEVAALTAMVFGYRLLAYLSLRRMKL  736



>ref|XP_008442971.1| PREDICTED: ABC transporter G family member 22 isoform X2 [Cucumis 
melo]
Length=749

 Score =   904 bits (2336),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 508/754 (67%), Positives = 591/754 (78%), Gaps = 45/754 (6%)
 Frame = -2

Query  2878  MEQTNSTSLLRTKSDQLVEaiaaakgsarARLPRLSAEFAGSGVPESVRMLSRKPSRRLM  2699
             ME+T+S  L RTKSDQL+E +AAA      + P  S E  G         LSRK S++ +
Sbjct  1     MEKTSSLGLARTKSDQLLEKVAAAF-----KSPMSSTEANGVVGESGSTTLSRKSSKQTL  55

Query  2698  ppspggggsgGTN--STHIRKSRSAQMKLDLDElssgsvlsrassasl--GFSFTGFSVR  2531
                  G GSG     +THIRKSRSAQ+KLDLD+L SG+ LSRASSASL   FSFTGF++ 
Sbjct  56    TAPSPGRGSGSGGGRNTHIRKSRSAQLKLDLDDLGSGAALSRASSASLGLSFSFTGFTLP  115

Query  2530  PDESADSKPFSDDENPEDLEAGTKKKRSIPAEPTFPIYLKFTEVSYKIVIKGVTFSEEKD  2351
             PDE  D KPFSD++ PED EAGT K R    EPT PI+LKF +V+YK++IKG+  + EK+
Sbjct  116   PDEIGDFKPFSDEDIPEDAEAGTCKTR-FQTEPTMPIHLKFKDVTYKVIIKGLRTNVEKE  174

Query  2350  ILNGISGAVDPGEVLALMGPSGCGKTTLLSLLGGR-IRDPSAGSITYNQHPYSKLLKSRI  2174
             ILNGI+G V+PGEVLALMGPSG GKTTLL+LLGGR IR  + GSITYN   Y+K LKSRI
Sbjct  175   ILNGITGQVNPGEVLALMGPSGSGKTTLLNLLGGRLIRSTAGGSITYNDQSYNKFLKSRI  234

Query  2173  GFVTQDDILFPHLTVKETLIYAARLRLPRTLTKEEKDKRAMDVIYELGLDRCQDTMIGGS  1994
             GFV Q+D+LFPHLTVKETL YAA LRLP TLTKE+K+KRA+DVIYELGL+RCQDTMIGGS
Sbjct  235   GFVMQEDVLFPHLTVKETLRYAALLRLPNTLTKEQKEKRAIDVIYELGLERCQDTMIGGS  294

Query  1993  FVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILHEIAKAGKTVITT  1814
             FVRGVSGGER+RV IGNEIIINPSLLFLDEPTSGLDSTTALRIV ILHEIA+AGKTV+TT
Sbjct  295   FVRGVSGGERRRVSIGNEIIINPSLLFLDEPTSGLDSTTALRIVQILHEIAEAGKTVVTT  354

Query  1813  IHQPSSRLFHk--------------------------------fdklilleflldLANGN  1730
             IHQPSSRLFHK                                   +   EFLLDLANGN
Sbjct  355   IHQPSSRLFHKFDKLILLGKGSLIYYGKAAEAMNYFASIGCSPLIAMNPAEFLLDLANGN  414

Query  1729  INDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYETRVAETEKKKLMAPLP  1550
             ++DVS+PSEL DKVQ  NS+ +  ++  +PSP +V EYLV  YETRVAE EK+K++ PL 
Sbjct  415   LSDVSVPSELEDKVQMENSEADSRQD--RPSPTLVQEYLVEAYETRVAEKEKRKMLTPLT  472

Query  1549  VEEELKSKVRYLKREWGASWSEQYVLLFHRGIRERWHDYFSWLRITQVIATALILGMLWW  1370
             ++EELKSKV   +R+WGASW EQY +LF RGI+ER H+YFSWLRITQV+ATA+ILG+LWW
Sbjct  473   LDEELKSKVSSSRRQWGASWWEQYSILFRRGIKERRHEYFSWLRITQVLATAIILGLLWW  532

Query  1369  QSGGDTPSQMQDQAGLLFFIAVFWGFFPVFTAIFTFPQEKAMLSKERAADMYRLSAYFAA  1190
             QS   +P  +QDQAGLLFFIAVFWGFFPVFTAIFTFPQE+AMLSKERAADMYRLSAYF A
Sbjct  533   QSESRSPKGLQDQAGLLFFIAVFWGFFPVFTAIFTFPQERAMLSKERAADMYRLSAYFLA  592

Query  1189  RTTSdlpldlllpliflLVVYFMAGLKQDASSFLLTAVTVFLCIVVAQGLGLAIGATLMD  1010
             RTTSDLPLDLLLP++FLLVVYFMAGL+  A+ F LT VTVFL IV AQGLGLAIGATLMD
Sbjct  593   RTTSDLPLDLLLPILFLLVVYFMAGLRLSAAPFFLTMVTVFLSIVAAQGLGLAIGATLMD  652

Query  1009  LKKATTLASVTVMTFMLAGGYFIKKVPGFIVWLRDLSFNYHTFKLLLKVQYEHKTNSVNG  830
             +KKATTLASVTVMTFMLAGG+F++KVP F+ W+R LSFNYHT+KLLLKVQY +   +VNG
Sbjct  653   VKKATTLASVTVMTFMLAGGFFVQKVPVFVAWIRYLSFNYHTYKLLLKVQYNNIIPAVNG  712

Query  829   VQIDSGIKEVGALAAMAVSYRLLAYISLRRMKLQ  728
             +++D+G+ EV AL AM   YRLLAYISLRRM+L 
Sbjct  713   MKMDNGVVEVTALIAMVFGYRLLAYISLRRMRLH  746



>ref|XP_010557969.1| PREDICTED: ABC transporter G family member 22-like [Tarenaya 
hassleriana]
Length=750

 Score =   904 bits (2335),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 496/703 (71%), Positives = 572/703 (81%), Gaps = 41/703 (6%)
 Frame = -2

Query  2728  LSRKPSRRLMppspggggsgGTNSTHIRKSRSAQ-MKLDLDElssgsvlsrassasl--G  2558
             LSRK SRRL   SPG    GG  S HIRK+RS Q M+++ DE+S+G+ LSRASSASL   
Sbjct  50    LSRKSSRRLSAASPGRSYGGGGGS-HIRKARSGQLMRVEADEVSNGAALSRASSASLGLS  108

Query  2557  FSFTGFSVRPDESADSKPFSDDEN-PEDLEAGTKKKRSIPAEPTFPIYLKFTEVSYKIVI  2381
             FSFTGFS+ P+E +DSKPFSDDE   ED+EAG K+ +   AEPT PIYLKF++++YK+VI
Sbjct  109   FSFTGFSMPPEEISDSKPFSDDEMIHEDIEAGNKQPK-FQAEPTLPIYLKFSDITYKVVI  167

Query  2380  KGVTFSEEKDILNGISGAVDPGEVLALMGPSGCGKTTLLSLLGGRIRDPS-AGSITYNQH  2204
             KG+T SEEK+ILNGI+G+V PGEVLALMGPSG GKTTLLSLLGGR+  P   GS+TYN  
Sbjct  168   KGITSSEEKEILNGINGSVVPGEVLALMGPSGSGKTTLLSLLGGRLPQPCVGGSVTYNDK  227

Query  2203  PYSKLLKSRIGFVTQDDILFPHLTVKETLIYAARLRLPRTLTKEEKDKRAMDVIYELGLD  2024
             PYSK LKS+IGFVTQDD+LFPHLTVKETL YAARLRLP++LT+E+K+KRA++VI ELGL+
Sbjct  228   PYSKFLKSKIGFVTQDDVLFPHLTVKETLTYAARLRLPKSLTREQKEKRALEVIRELGLE  287

Query  2023  RCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILHEI  1844
             RCQDTMIGGSFVRGVSGGERKRV IGNEIIINPSLLFLDEPTSGLDSTTALR + +LH+I
Sbjct  288   RCQDTMIGGSFVRGVSGGERKRVSIGNEIIINPSLLFLDEPTSGLDSTTALRTIQMLHDI  347

Query  1843  AKAGKTVITTIHQPSSRLFHk--------------------------------fdklill  1760
             A+AGKTVITTIHQPSSRLFH+                                   +   
Sbjct  348   AEAGKTVITTIHQPSSRLFHRFDKLILLGKGSLLYFGKASEAMVYFSSIGCSPLIAMNPA  407

Query  1759  eflldLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYETRVAET  1580
             EFLLDLANGNIND+SIPSEL DKVQ  NS  E    +GKPSPA+VHEYLV  YETRVAE 
Sbjct  408   EFLLDLANGNINDISIPSELEDKVQVGNSGRE--TQDGKPSPAVVHEYLVEAYETRVAEE  465

Query  1579  EKKKLMAPLPVEEELKSKVRYLKREWGASWSEQYVLLFHRGIRERWHDYFSWLRITQVIA  1400
             EKKKLM P+P++EE+K+K+   KR+WGASW EQY +LF RGI+ER HDYFSWLRITQVI+
Sbjct  466   EKKKLMDPIPLDEEVKAKMMCPKRQWGASWWEQYSMLFCRGIKERRHDYFSWLRITQVIS  525

Query  1399  TALILGMLWWQSGGDTPSQMQDQAGLLFFIAVFWGFFPVFTAIFTFPQEKAMLSKERAAD  1220
             TA+ILG+LWWQS   TP  +QDQAGLLFFIAVFWGFFPVFTAIFTFPQE+AMLSKERAAD
Sbjct  526   TAVILGLLWWQSDARTPRGLQDQAGLLFFIAVFWGFFPVFTAIFTFPQERAMLSKERAAD  585

Query  1219  MYRLSAYFAARTTSdlpldlllpliflLVVYFMAGLKQDASSFLLTAVTVFLCIVVAQGL  1040
             MYRLSAYF ARTTSDLPLD++LP++FLLVVYFMAGL+     F L+ +TVFLCIV AQGL
Sbjct  586   MYRLSAYFLARTTSDLPLDMILPVLFLLVVYFMAGLRLSPDPFFLSMLTVFLCIVAAQGL  645

Query  1039  GLAIGATLMDLKKATTLASVTVMTFMLAGGYFIKKVPGFIVWLRDLSFNYHTFKLLLKVQ  860
             GLAIGATLMDLKKATTLASVTVMTFMLAGG+F+KKVP FI W+R +SFNYHT+KLLLKVQ
Sbjct  646   GLAIGATLMDLKKATTLASVTVMTFMLAGGFFVKKVPVFISWIRYISFNYHTYKLLLKVQ  705

Query  859   YEHKTNSVNGVQIDSGIKEVGALAAMAVSYRLLAYISLRRMKL  731
             Y+    S+NGV+ID+G+ EV AL AM   YR LAY+SLRRMK+
Sbjct  706   YQDLARSINGVRIDNGLTEVAALVAMIFGYRFLAYLSLRRMKI  748



>ref|XP_008442969.1| PREDICTED: ABC transporter G family member 22 isoform X1 [Cucumis 
melo]
 ref|XP_008442970.1| PREDICTED: ABC transporter G family member 22 isoform X1 [Cucumis 
melo]
Length=750

 Score =   899 bits (2324),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 508/755 (67%), Positives = 591/755 (78%), Gaps = 46/755 (6%)
 Frame = -2

Query  2878  MEQTNSTSLLRTKSDQLVEaiaaakgsarARLPRLSAEFAGSGVPESVRMLSRKPSRRLM  2699
             ME+T+S  L RTKSDQL+E +AAA      + P  S E  G         LSRK S++ +
Sbjct  1     MEKTSSLGLARTKSDQLLEKVAAAF-----KSPMSSTEANGVVGESGSTTLSRKSSKQTL  55

Query  2698  ppspggggsgGTN--STHIRKSRSAQMKLDLDElssgsvlsrassasl--GFSFTGFSVR  2531
                  G GSG     +THIRKSRSAQ+KLDLD+L SG+ LSRASSASL   FSFTGF++ 
Sbjct  56    TAPSPGRGSGSGGGRNTHIRKSRSAQLKLDLDDLGSGAALSRASSASLGLSFSFTGFTLP  115

Query  2530  PDESADSKPFSDDENP-EDLEAGTKKKRSIPAEPTFPIYLKFTEVSYKIVIKGVTFSEEK  2354
             PDE  D KPFSD++ P ED EAGT K R    EPT PI+LKF +V+YK++IKG+  + EK
Sbjct  116   PDEIGDFKPFSDEDIPAEDAEAGTCKTR-FQTEPTMPIHLKFKDVTYKVIIKGLRTNVEK  174

Query  2353  DILNGISGAVDPGEVLALMGPSGCGKTTLLSLLGGR-IRDPSAGSITYNQHPYSKLLKSR  2177
             +ILNGI+G V+PGEVLALMGPSG GKTTLL+LLGGR IR  + GSITYN   Y+K LKSR
Sbjct  175   EILNGITGQVNPGEVLALMGPSGSGKTTLLNLLGGRLIRSTAGGSITYNDQSYNKFLKSR  234

Query  2176  IGFVTQDDILFPHLTVKETLIYAARLRLPRTLTKEEKDKRAMDVIYELGLDRCQDTMIGG  1997
             IGFV Q+D+LFPHLTVKETL YAA LRLP TLTKE+K+KRA+DVIYELGL+RCQDTMIGG
Sbjct  235   IGFVMQEDVLFPHLTVKETLRYAALLRLPNTLTKEQKEKRAIDVIYELGLERCQDTMIGG  294

Query  1996  SFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILHEIAKAGKTVIT  1817
             SFVRGVSGGER+RV IGNEIIINPSLLFLDEPTSGLDSTTALRIV ILHEIA+AGKTV+T
Sbjct  295   SFVRGVSGGERRRVSIGNEIIINPSLLFLDEPTSGLDSTTALRIVQILHEIAEAGKTVVT  354

Query  1816  TIHQPSSRLFHk--------------------------------fdklilleflldLANG  1733
             TIHQPSSRLFHK                                   +   EFLLDLANG
Sbjct  355   TIHQPSSRLFHKFDKLILLGKGSLIYYGKAAEAMNYFASIGCSPLIAMNPAEFLLDLANG  414

Query  1732  NINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYETRVAETEKKKLMAPL  1553
             N++DVS+PSEL DKVQ  NS+ +  ++  +PSP +V EYLV  YETRVAE EK+K++ PL
Sbjct  415   NLSDVSVPSELEDKVQMENSEADSRQD--RPSPTLVQEYLVEAYETRVAEKEKRKMLTPL  472

Query  1552  PVEEELKSKVRYLKREWGASWSEQYVLLFHRGIRERWHDYFSWLRITQVIATALILGMLW  1373
              ++EELKSKV   +R+WGASW EQY +LF RGI+ER H+YFSWLRITQV+ATA+ILG+LW
Sbjct  473   TLDEELKSKVSSSRRQWGASWWEQYSILFRRGIKERRHEYFSWLRITQVLATAIILGLLW  532

Query  1372  WQSGGDTPSQMQDQAGLLFFIAVFWGFFPVFTAIFTFPQEKAMLSKERAADMYRLSAYFA  1193
             WQS   +P  +QDQAGLLFFIAVFWGFFPVFTAIFTFPQE+AMLSKERAADMYRLSAYF 
Sbjct  533   WQSESRSPKGLQDQAGLLFFIAVFWGFFPVFTAIFTFPQERAMLSKERAADMYRLSAYFL  592

Query  1192  ARTTSdlpldlllpliflLVVYFMAGLKQDASSFLLTAVTVFLCIVVAQGLGLAIGATLM  1013
             ARTTSDLPLDLLLP++FLLVVYFMAGL+  A+ F LT VTVFL IV AQGLGLAIGATLM
Sbjct  593   ARTTSDLPLDLLLPILFLLVVYFMAGLRLSAAPFFLTMVTVFLSIVAAQGLGLAIGATLM  652

Query  1012  DLKKATTLASVTVMTFMLAGGYFIKKVPGFIVWLRDLSFNYHTFKLLLKVQYEHKTNSVN  833
             D+KKATTLASVTVMTFMLAGG+F++KVP F+ W+R LSFNYHT+KLLLKVQY +   +VN
Sbjct  653   DVKKATTLASVTVMTFMLAGGFFVQKVPVFVAWIRYLSFNYHTYKLLLKVQYNNIIPAVN  712

Query  832   GVQIDSGIKEVGALAAMAVSYRLLAYISLRRMKLQ  728
             G+++D+G+ EV AL AM   YRLLAYISLRRM+L 
Sbjct  713   GMKMDNGVVEVTALIAMVFGYRLLAYISLRRMRLH  747



>ref|XP_008359521.1| PREDICTED: ABC transporter G family member 22-like [Malus domestica]
Length=747

 Score =   899 bits (2323),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 502/759 (66%), Positives = 590/759 (78%), Gaps = 57/759 (8%)
 Frame = -2

Query  2878  MEQTNSTSLLRTKSDQLVEaiaaakgsarARLPRLSAEFA------GSGVPESVRMLSRK  2717
             ME+ NS+ L RTKS+QLVE               ++AE         +   E    LSRK
Sbjct  1     MEKPNSSGLARTKSEQLVET--------------IAAELKSPPPGEATSTVEGGSTLSRK  46

Query  2716  PSRRLMppspggggsgGTNSTHIRKSRSAQMKLDLDElssgsvlsrassaslGFS--FTG  2543
              SRR+M  SPG G      +THIRKSRSAQMKLD+DE+SSG+ LSRASSASLGFS  FTG
Sbjct  47    SSRRMMGASPGRGSGSVGKNTHIRKSRSAQMKLDMDEISSGAALSRASSASLGFSLSFTG  106

Query  2542  FSVRPDESADSKPFSDDENPEDLE-AGTKKKRSIPAEPTFPIYLKFTEVSYKIVIKGVTF  2366
             F+V  D+ AD+KPFSDD++  +   AG  +K     EPT P+YLKFT+V+YK++ KG+  
Sbjct  107   FTVPADDIADTKPFSDDDDLPEDLEAGITRKPKFQTEPTLPLYLKFTDVTYKVIFKGMRT  166

Query  2365  SEEKDILNGISGAVDPGEVLALMGPSGCGKTTLLSLLGGRIRDPS-AGSITYNQHPYSKL  2189
             +EEK ILNGI+G V+PGEVLALMGPSG GKTTLL+LLGGR    +  GSITYN  PYSK 
Sbjct  167   TEEKYILNGIAGLVNPGEVLALMGPSGSGKTTLLNLLGGRGSQANVGGSITYNDQPYSKY  226

Query  2188  LKSRIGFVTQDDILFPHLTVKETLIYAARLRLPRTLTKEEKDKRAMDVIYELGLDRCQDT  2009
             LK +IGFVTQDD+LFPHLTVKETL YAA LRLP+TLTKE+K+KRA+DVI ELGL+RCQDT
Sbjct  227   LKRKIGFVTQDDVLFPHLTVKETLTYAALLRLPKTLTKEQKEKRAIDVICELGLERCQDT  286

Query  2008  MIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILHEIAKAGK  1829
             MIGGSFVRGVSGGERKRVCIGNEI+INPSLLFLDEPTSGLDSTTALRI  +L +IA+AGK
Sbjct  287   MIGGSFVRGVSGGERKRVCIGNEILINPSLLFLDEPTSGLDSTTALRIGQMLQDIAEAGK  346

Query  1828  TVITTIHQPSSRLFHk--------------------------------fdklilleflld  1745
             TV+TTIHQPSSRLFHK                                   +   EFLLD
Sbjct  347   TVVTTIHQPSSRLFHKFDKLILLGKGSLLYFGKASEAMVYFSCIGCSPLIAMNPAEFLLD  406

Query  1744  LANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYETRVAETEKKKL  1565
             LANGN+NDVS+PSEL DKVQ  +S+ + TRN GKPSPA+VHEYLV  YETRVA  EKKKL
Sbjct  407   LANGNLNDVSVPSELEDKVQMGSSEADDTRN-GKPSPAVVHEYLVESYETRVANEEKKKL  465

Query  1564  MAPLPVEEELKSKVRYLKREWGASWSEQYVLLFHRGIRERWHDYFSWLRITQVIATALIL  1385
             M PLP++EELKSK+ + KREWG SW EQ+ +LF RGI+ER HDYFSWLR TQV++TA+IL
Sbjct  466   MVPLPIDEELKSKMSFSKREWGTSWWEQFSILFWRGIKERRHDYFSWLRFTQVLSTAIIL  525

Query  1384  GMLWWQSGGDTPSQMQDQAGLLFFIAVFWGFFPVFTAIFTFPQEKAMLSKERAADMYRLS  1205
             G+LWWQS  + P   +DQAGLLFFI+VFWGF PVFTAIFTFPQE+AML KER+ADMYRLS
Sbjct  526   GLLWWQSDANNPKGREDQAGLLFFISVFWGFLPVFTAIFTFPQERAMLVKERSADMYRLS  585

Query  1204  AYFAARTTSdlpldlllpliflLVVYFMAGLKQDASSFLLTAVTVFLCIVVAQGLGLAIG  1025
             AYFA+RTTSDLPLDL+LP++FL+VVYFMAGL+  A +F L+ +TVFLCIV AQGLGLAIG
Sbjct  586   AYFASRTTSDLPLDLMLPVMFLVVVYFMAGLRPSAETFFLSVLTVFLCIVAAQGLGLAIG  645

Query  1024  ATLMDLKKATTLASVTVMTFMLAGGYFIKKVPGFIVWLRDLSFNYHTFKLLLKVQYEHKT  845
             ATLMDLKKATTLASVTVMTFMLAGG+F+K+VP FI W+R +SF+YHT+++LLKVQYEH T
Sbjct  646   ATLMDLKKATTLASVTVMTFMLAGGFFVKEVPVFISWIRYMSFDYHTYRILLKVQYEHIT  705

Query  844   NSVNGVQIDSGIKEVGALAAMAVSYRLLAYISLRRMKLQ  728
              +V+G+  D G+ E+GAL AM   YRLLAY+SLRRMKLQ
Sbjct  706   PTVHGLSTDRGLTEIGALIAMVFGYRLLAYLSLRRMKLQ  744



>ref|XP_010677592.1| PREDICTED: ABC transporter G family member 22 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010677594.1| PREDICTED: ABC transporter G family member 22 [Beta vulgaris 
subsp. vulgaris]
Length=745

 Score =   897 bits (2317),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 497/753 (66%), Positives = 589/753 (78%), Gaps = 45/753 (6%)
 Frame = -2

Query  2878  MEQTNST-SLLRTKSDQLVEaiaaakgsarARLPRLSAEFAGSGVPESVRMLSRKPSRRL  2702
             M++ NST  L+RTKSDQLVE +AAA  + ++             V  S     RK SRR+
Sbjct  2     MDKMNSTMGLVRTKSDQLVETVAAAMAAMKSSPSGEGTTGTTPTVDGS-----RKSSRRI  56

Query  2701  MppspggggsgGTNSTHIRKSRSAQMKLDLDElssgsvlsrassasl--GFSFTGFSVRP  2528
               P      S   N THIRK+RSAQ+KLD+D+LS+G+ LSRASSASL   FSFTGF+V P
Sbjct  57    TSPGGANSSSRHYN-THIRKTRSAQLKLDIDDLSNGAALSRASSASLGLSFSFTGFNVPP  115

Query  2527  DESADSKPFSDDENPEDLEAGTKKKRSIPAEPTFPIYLKFTEVSYKIVIKGVTFSEEKDI  2348
             ++  DSKPFSDD+ PED+EAG +KK+ I AEPT P+YLKF EV+YK++IKGVT + EK+I
Sbjct  116   EDIVDSKPFSDDDIPEDIEAGPRKKK-IDAEPTLPVYLKFKEVTYKVIIKGVTKTAEKEI  174

Query  2347  LNGISGAVDPGEVLALMGPSGCGKTTLLSLLGGRIRDPSAG-SITYNQHPYSKLLKSRIG  2171
             L+GI+G+V PGEVLALMGPSG GKTTLL++LGGR+  P AG S+TYN  PYSK LKSRIG
Sbjct  175   LHGITGSVHPGEVLALMGPSGSGKTTLLNVLGGRLTQPKAGGSVTYNDQPYSKYLKSRIG  234

Query  2170  FVTQDDILFPHLTVKETLIYAARLRLPRTLTKEEKDKRAMDVIYELGLDRCQDTMIGGSF  1991
             FVTQDD+L+ HLTV+ETL YAA LRLP+TLTK++K++RA+DVI ELGL+RCQDT+IGGSF
Sbjct  235   FVTQDDVLYAHLTVRETLTYAAYLRLPKTLTKQQKEQRALDVICELGLERCQDTLIGGSF  294

Query  1990  VRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILHEIAKAGKTVITTI  1811
             VRGVSGGERKRVCIGNEI+INPSLLFLDEPTSGLDSTTALR + +L +IA+ GK VITTI
Sbjct  295   VRGVSGGERKRVCIGNEILINPSLLFLDEPTSGLDSTTALRTIQVLQDIAEDGKAVITTI  354

Query  1810  HQPSSRLFHk--------------------------------fdklilleflldLANGNI  1727
             HQPSSRLFHK                                   +   EFLLDLANGNI
Sbjct  355   HQPSSRLFHKFDKLILLGKGSLLYFGKASQVMNYFSAIGCTPLISMNPAEFLLDLANGNI  414

Query  1726  NDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYETRVAETEKKKLMAPLPV  1547
             NDV++PSEL DKVQ  +   E  R N +PS A++HEYLV  YE+RVAE EK+KLMAPLP+
Sbjct  415   NDVTVPSELEDKVQIDDPGTE--RTNARPSAAVIHEYLVESYESRVAEKEKRKLMAPLPI  472

Query  1546  EEELKSKVRYLKREWGASWSEQYVLLFHRGIRERWHDYFSWLRITQVIATALILGMLWWQ  1367
             +EE KS +  +KR+WGASW +QY +LF RGI+ER H+YFSWLR+TQV+ATA+ILG+LWWQ
Sbjct  473   DEEFKSNLSSVKRKWGASWWQQYSILFRRGIKERKHEYFSWLRVTQVLATAVILGLLWWQ  532

Query  1366  SGGDTPSQMQDQAGLLFFIAVFWGFFPVFTAIFTFPQEKAMLSKERAADMYRLSAYFAAR  1187
             S   T   ++DQAGLLFFIAVFWGFFPVFTAIF FPQE+AML KERAADMYRLSAYF AR
Sbjct  533   SDSTTEKGLEDQAGLLFFIAVFWGFFPVFTAIFAFPQERAMLLKERAADMYRLSAYFLAR  592

Query  1186  TTSdlpldlllpliflLVVYFMAGLKQDASSFLLTAVTVFLCIVVAQGLGLAIGATLMDL  1007
             TTSDLPLDL+LP++FLLVVYFMAGL+ DA +F LT +TVFLCI+ AQGLGLAIGA+LMD+
Sbjct  593   TTSDLPLDLVLPVLFLLVVYFMAGLRLDAGTFFLTVLTVFLCIIAAQGLGLAIGASLMDI  652

Query  1006  KKATTLASVTVMTFMLAGGYFIKKVPGFIVWLRDLSFNYHTFKLLLKVQYEHKTNSVNGV  827
             KKATTL SVTVMTFMLAGGYF+KKVP FI W+R LSFNYHT++LLLKV YEH     N +
Sbjct  653   KKATTLGSVTVMTFMLAGGYFVKKVPIFISWIRYLSFNYHTYRLLLKVHYEHHIEPTNMM  712

Query  826   QIDSGIKEVGALAAMAVSYRLLAYISLRRMKLQ  728
               DSG++EVGAL AM   YRLLAYISLRRM+LQ
Sbjct  713   IFDSGLEEVGALIAMVFGYRLLAYISLRRMQLQ  745



>ref|XP_009348549.1| PREDICTED: ABC transporter G family member 22-like isoform X1 
[Pyrus x bretschneideri]
Length=747

 Score =   896 bits (2316),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 501/753 (67%), Positives = 591/753 (78%), Gaps = 45/753 (6%)
 Frame = -2

Query  2878  MEQTNSTSLLRTKSDQLVEaiaaakgsarARLPRLSAEFAGSGVPESVRMLSRKPSRRLM  2699
             ME+ NS+ L RTKS+QLVE IA+A  S     P   A    +   E    LSRK SRR+M
Sbjct  1     MEKPNSSGLARTKSEQLVETIASAFKSP----PSGDA----TSTVEGGSTLSRKSSRRMM  52

Query  2698  ppspggggsgGTNSTHIRKSRSAQMKLDLDElssgsvlsrassasl--GFSFTGFSVRPD  2525
               SPG G      +THIRKSRSAQM+LDLDE+ SG+ LSRASSASL   FSFTGF+V  +
Sbjct  53    GASPGRGSGSAGKNTHIRKSRSAQMRLDLDEIGSGAALSRASSASLGFSFSFTGFTVPAE  112

Query  2524  ESADSKPFSDDENPEDLE-AGTKKKRSIPAEPTFPIYLKFTEVSYKIVIKGVTFSEEKDI  2348
             + ADSKPFSDD++  +   AG  +K     EPT P+YLKFT+V+YK++ KG+  +EEKDI
Sbjct  113   DIADSKPFSDDDDLREDLEAGVTRKPKFQTEPTLPLYLKFTDVTYKVIFKGMRTAEEKDI  172

Query  2347  LNGISGAVDPGEVLALMGPSGCGKTTLLSLLGGRIRDPS-AGSITYNQHPYSKLLKSRIG  2171
             LNGI+G+V+PGEVLALMGPSG GKTTLL+LLGGR    +  GSITYN   YSK LKS+IG
Sbjct  173   LNGITGSVNPGEVLALMGPSGSGKTTLLNLLGGRGSQTNVGGSITYNDQTYSKHLKSKIG  232

Query  2170  FVTQDDILFPHLTVKETLIYAARLRLPRTLTKEEKDKRAMDVIYELGLDRCQDTMIGGSF  1991
             FVTQDD+LFPHLTVKETL YAA LRLP+ L K++K+KRA+++IYELGL+RCQDTMIGGSF
Sbjct  233   FVTQDDVLFPHLTVKETLTYAALLRLPKKLMKDQKEKRAIELIYELGLERCQDTMIGGSF  292

Query  1990  VRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILHEIAKAGKTVITTI  1811
             VRGVSGGERKRVCIGNEI+INPSLLFLDEPTSGLDSTTALRIV +L +IA+AGKTV+TTI
Sbjct  293   VRGVSGGERKRVCIGNEILINPSLLFLDEPTSGLDSTTALRIVQMLQDIAEAGKTVVTTI  352

Query  1810  HQPSSRLFHk--------------------------------fdklilleflldLANGNI  1727
             HQPSSRLFHK                                   +   EFLLDLANGN+
Sbjct  353   HQPSSRLFHKFDKLILLGKGSLLYFGKASEAMVYFSSIGCSPLISMNPAEFLLDLANGNL  412

Query  1726  NDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYETRVAETEKKKLMAPLPV  1547
             NDVS+PSEL DKVQ  NS+   TRN GKPSPA+V EYLV CYETRVA+ EKKK+M PLP+
Sbjct  413   NDVSVPSELEDKVQMGNSEAADTRN-GKPSPAVVQEYLVECYETRVADKEKKKIMVPLPL  471

Query  1546  EEELKSKVRYLKREWGASWSEQYVLLFHRGIRERWHDYFSWLRITQVIATALILGMLWWQ  1367
             ++ELK K+ + KREWGASW EQ+ +LF RGI+ER HDYFSWLRITQVI+TA+ILG+LWWQ
Sbjct  472   DDELKLKISFSKREWGASWWEQFSILFCRGIKERRHDYFSWLRITQVISTAIILGLLWWQ  531

Query  1366  SGGDTPSQMQDQAGLLFFIAVFWGFFPVFTAIFTFPQEKAMLSKERAADMYRLSAYFAAR  1187
             S  + P   +DQAGLLFF++VFWGF PVFTAIFTFPQE+AML KER+ADMYRLSAYF +R
Sbjct  532   SDANDPKGREDQAGLLFFMSVFWGFLPVFTAIFTFPQERAMLMKERSADMYRLSAYFVSR  591

Query  1186  TTSdlpldlllpliflLVVYFMAGLKQDASSFLLTAVTVFLCIVVAQGLGLAIGATLMDL  1007
             TTSDLPLDL+LP++FL+VVYFMAGL+  A +F L+ +TVFLCIV AQGLGLAIGATLMDL
Sbjct  592   TTSDLPLDLMLPVLFLVVVYFMAGLRSSAEAFFLSMLTVFLCIVAAQGLGLAIGATLMDL  651

Query  1006  KKATTLASVTVMTFMLAGGYFIKKVPGFIVWLRDLSFNYHTFKLLLKVQYEHKTNSVNGV  827
             KKATTLASV VMTFMLAGG+F+KKVP FI W+R LSF+YHT++LLLKVQYEH T +++G+
Sbjct  652   KKATTLASVIVMTFMLAGGFFVKKVPVFISWIRYLSFDYHTYRLLLKVQYEHITPTIHGL  711

Query  826   QIDSGIKEVGALAAMAVSYRLLAYISLRRMKLQ  728
               D G++EV AL AM   YR LAY+SLRRMKLQ
Sbjct  712   STDCGLREVVALIAMVFGYRFLAYLSLRRMKLQ  744



>gb|KHN43592.1| ABC transporter G family member 22 [Glycine soja]
Length=691

 Score =   894 bits (2311),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 472/679 (70%), Positives = 554/679 (82%), Gaps = 38/679 (6%)
 Frame = -2

Query  2659  STHIRKSRSAQMKLDLDElssgsvlsrassasl--GFSFTGFSVRPDESADSKPFSDDEN  2486
             +T+IRK+RSAQ+K+++DE+ SG  LSRASSASL   FSFTGF++ PDE ADSKPFSDD+ 
Sbjct  13    NTYIRKARSAQLKVEVDEVGSGVALSRASSASLGLSFSFTGFTLPPDEIADSKPFSDDDI  72

Query  2485  PEDLEAGTKKKRSIPAEPTFPIYLKFTEVSYKIVIKGVTFSEEKDILNGISGAVDPGEVL  2306
             PED+EAGT K +    EPT PIYLKFT+V+YK+V+KG+T ++EKDIL GI+G+V+PGEVL
Sbjct  73    PEDIEAGTPKPK-FQTEPTLPIYLKFTDVTYKVVMKGITTTKEKDILKGITGSVNPGEVL  131

Query  2305  ALMGPSGCGKTTLLSLLGGR-IRDPSAGSITYNQHPYSKLLKSRIGFVTQDDILFPHLTV  2129
             ALMGPSG GKT+LL+LLGGR I+    GSITYN  PYSK LKSRIGFVTQDD+LFPHLTV
Sbjct  132   ALMGPSGSGKTSLLNLLGGRLIQSTIGGSITYNDQPYSKFLKSRIGFVTQDDVLFPHLTV  191

Query  2128  KETLIYAARLRLPRTLTKEEKDKRAMDVIYELGLDRCQDTMIGGSFVRGVSGGERKRVCI  1949
             KETL YAARLRLP TLTKE+K+KRA++VI ELGL+RCQDTMIGGS+VRG+SGGERKRVCI
Sbjct  192   KETLTYAARLRLPNTLTKEQKEKRALEVIDELGLERCQDTMIGGSYVRGISGGERKRVCI  251

Query  1948  GNEIIINPSLLFLDEPTSGLDSTTALRIVDILHEIAKAGKTVITTIHQPSSRLFHk----  1781
             GNEIIINPSLLFLDEPTSGLDSTTALRIV +L +IA+AGKTV+TTIHQPSSRLFHK    
Sbjct  252   GNEIIINPSLLFLDEPTSGLDSTTALRIVQMLQDIAEAGKTVVTTIHQPSSRLFHKFDKL  311

Query  1780  ----------------------------fdklilleflldLANGNINDVSIPSELADKVQ  1685
                                            +   EFLLDLANGN+ND+S+PSEL D VQ
Sbjct  312   ILLGKGSLLYFGKASDAMDYFQFIGCAPLIAMNPAEFLLDLANGNVNDISVPSELKDIVQ  371

Query  1684  TWNSKEEPTRNNGKPSPAIVHEYLVGCYETRVAETEKKKLMAPLPVEEELKSKVRYLKRE  1505
               N++ E    NGKPS ++V EYLV  Y++RVAE EK KLM P+P++ ELKSKV   KR+
Sbjct  372   VGNAEAETC--NGKPSASVVQEYLVEAYDSRVAEIEKTKLMVPVPLDVELKSKVCSCKRQ  429

Query  1504  WGASWSEQYVLLFHRGIRERWHDYFSWLRITQVIATALILGMLWWQSGGDTPSQMQDQAG  1325
             WGASW EQ+ +LF RG +ER HDYFSWLRITQV+ATA+ILG+LWWQS   TP  +QDQAG
Sbjct  430   WGASWFEQFSILFSRGFKERRHDYFSWLRITQVLATAVILGLLWWQSDAKTPKGLQDQAG  489

Query  1324  LLFFIAVFWGFFPVFTAIFTFPQEKAMLSKERAADMYRLSAYFAARTTSdlpldlllpli  1145
             LLFFIAVFWGFFPVFTAIFTFPQE+AML+KER  DMYRLSAYF ARTTSDL LDL+LP+ 
Sbjct  490   LLFFIAVFWGFFPVFTAIFTFPQERAMLTKERTTDMYRLSAYFVARTTSDLLLDLVLPVF  549

Query  1144  flLVVYFMAGLKQDASSFLLTAVTVFLCIVVAQGLGLAIGATLMDLKKATTLASVTVMTF  965
             FLL+VYFMA L+  +  F  + +TVFLCI+ AQGLGLAIGATLMDLK+ATTLASVTVMTF
Sbjct  550   FLLLVYFMANLRLGSGRFFFSILTVFLCIIAAQGLGLAIGATLMDLKRATTLASVTVMTF  609

Query  964   MLAGGYFIKKVPGFIVWLRDLSFNYHTFKLLLKVQYEHKTNSVNGVQIDSGIKEVGALAA  785
             MLAGG+F+KKVP FI W+R +SFNYHT+KLLLKVQYEH T +++G++IDSG +EV AL A
Sbjct  610   MLAGGFFVKKVPIFISWIRYISFNYHTYKLLLKVQYEHITPTIDGIRIDSGFREVAALTA  669

Query  784   MAVSYRLLAYISLRRMKLQ  728
             M   YRLLAY+SLRRMKLQ
Sbjct  670   MVFGYRLLAYLSLRRMKLQ  688



>ref|XP_009796796.1| PREDICTED: ABC transporter G family member 22-like isoform X2 
[Nicotiana sylvestris]
Length=608

 Score =   890 bits (2299),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 455/605 (75%), Positives = 513/605 (85%), Gaps = 34/605 (6%)
 Frame = -2

Query  2446  IPAEPTFPIYLKFTEVSYKIVIKGVTFSEEKDILNGISGAVDPGEVLALMGPSGCGKTTL  2267
             I AEPT PIYLKFTEV YK+VIKGVT + EK+IL GISG+VDPGEVLA+MGPSG GKTTL
Sbjct  3     IQAEPTLPIYLKFTEVCYKVVIKGVTSTREKEILTGISGSVDPGEVLAMMGPSGSGKTTL  62

Query  2266  LSLLGGRIRDPSAGSITYNQHPYSKLLKSRIGFVTQDDILFPHLTVKETLIYAARLRLPR  2087
             LSLLGGRI++P+ GSITYN+ PYSKLLKSRIGFVTQDDILFPHLTV+ETL YAARLRLP+
Sbjct  63    LSLLGGRIKEPTGGSITYNEQPYSKLLKSRIGFVTQDDILFPHLTVRETLTYAARLRLPK  122

Query  2086  TLTKEEKDKRAMDVIYELGLDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLD  1907
             TLTKEEK+KRA+DVIYELGL+RCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLD
Sbjct  123   TLTKEEKEKRAIDVIYELGLERCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLD  182

Query  1906  EPTSGLDSTTALRIVDILHEIAKAGKTVITTIHQPSSRLFHk------------------  1781
             EPTSGLDSTTALR+V+ILH+IA+ GKTVITTIHQPSSRLFHK                  
Sbjct  183   EPTSGLDSTTALRMVEILHDIAETGKTVITTIHQPSSRLFHKFDKLILLGKGSLLYFGKA  242

Query  1780  --------------fdklilleflldLANGNINDVSIPSELADKVQTWNSKEEPTRNNGK  1643
                              +   EFLLDLANGN+NDVS+PSEL D+VQ  NS  E    NGK
Sbjct  243   SEAMVYFSAIGCSPLISMNPAEFLLDLANGNLNDVSVPSELEDRVQIGNSDRET--GNGK  300

Query  1642  PSPAIVHEYLVGCYETRVAETEKKKLMAPLPVEEELKSKVRYLKREWGASWSEQYVLLFH  1463
             P+P +VHEYLV  YET+VAE+EKKKLMAP+ ++EELKSKV  + REWGASW EQY +LF 
Sbjct  301   PTPIVVHEYLVEAYETQVAESEKKKLMAPMMIDEELKSKVFSINREWGASWCEQYSILFR  360

Query  1462  RGIRERWHDYFSWLRITQVIATALILGMLWWQSGGDTPSQMQDQAGLLFFIAVFWGFFPV  1283
             RG++ER +DYFSWLRITQVIATALILGMLWWQSGGD+P QM++Q+GLLFFIAVFWGFFPV
Sbjct  361   RGLKERRYDYFSWLRITQVIATALILGMLWWQSGGDSPKQMREQSGLLFFIAVFWGFFPV  420

Query  1282  FTAIFTFPQEKAMLSKERAADMYRLSAYFAARTTSdlpldlllpliflLVVYFMAGLKQD  1103
             FTAIFTFPQE+AML+KER+ADMYRLSAYF ARTTSD+PLDL+LP++FLLVVYFMAGLK +
Sbjct  421   FTAIFTFPQERAMLNKERSADMYRLSAYFLARTTSDIPLDLILPVLFLLVVYFMAGLKHE  480

Query  1102  ASSFLLTAVTVFLCIVVAQGLGLAIGATLMDLKKATTLASVTVMTFMLAGGYFIKKVPGF  923
             A +F LT +T FLCIV AQGLGLAIGATLMDLKKATTLASVTVMTFMLAGGYF+KKVP F
Sbjct  481   ADAFFLTVLTTFLCIVAAQGLGLAIGATLMDLKKATTLASVTVMTFMLAGGYFVKKVPVF  540

Query  922   IVWLRDLSFNYHTFKLLLKVQYEHKTNSVNGVQIDSGIKEVGALAAMAVSYRLLAYISLR  743
             I WLR LS+NY T+KLLLKVQY+ K + V+G+++ SG+KEV  L AM   YRLLAYISLR
Sbjct  541   ISWLRYLSYNYQTYKLLLKVQYKEKNDWVDGIKVGSGVKEVCILLAMVFGYRLLAYISLR  600

Query  742   RMKLQ  728
             RMKL 
Sbjct  601   RMKLH  605



>ref|XP_010491222.1| PREDICTED: ABC transporter G family member 22-like isoform X1 
[Camelina sativa]
Length=752

 Score =   889 bits (2297),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 499/754 (66%), Positives = 585/754 (78%), Gaps = 55/754 (7%)
 Frame = -2

Query  2863  STSLLRTKSDQLVEaiaaakgsarARLPRLSAEFAGSGVPESVR-------MLSRKPSRR  2705
             +T L RT+S+QL E++AAA      + P  S +   +G+P +          LSRK SRR
Sbjct  9     ATGLARTRSEQLYESVAAAI-----KSPHGSMD--ANGIPATAPAAVGGGGTLSRKSSRR  61

Query  2704  LMppspggggsgGTNSTHIRKSRSAQMKLDLDElssgsvlsrassasl--GFSFTGFSVR  2531
             LM  +  G   G    THIRKSRSAQ+KL+L+E+SSG+ LSRASSASL   FSFTGF++ 
Sbjct  62    LMMGASPGRSGGA--GTHIRKSRSAQLKLELEEVSSGAALSRASSASLGLSFSFTGFAMP  119

Query  2530  PDESADSKPFSDDEN-PEDLEAGTKKKRSIPAEPTFPIYLKFTEVSYKIVIKGVTFSEEK  2354
             P+E +DSKPFSDDE  PED+EAG KKK    AEPT PI+LKF EV+YK+VIK +T S EK
Sbjct  120   PEEISDSKPFSDDEMIPEDIEAG-KKKPKFQAEPTLPIFLKFKEVTYKVVIKKMTSSVEK  178

Query  2353  DILNGISGAVDPGEVLALMGPSGCGKTTLLSLLGGRI-RDPSAGSITYNQHPYSKLLKSR  2177
             +IL GI+G+V+PGEVLALMGPSG GKTTLLSLL GRI +  + GS+TYN  PYSK LKSR
Sbjct  179   EILTGITGSVNPGEVLALMGPSGSGKTTLLSLLAGRISQSATGGSVTYNDKPYSKFLKSR  238

Query  2176  IGFVTQDDILFPHLTVKETLIYAARLRLPRTLTKEEKDKRAMDVIYELGLDRCQDTMIGG  1997
             IGFVTQDD+LFPHLTVKETL YAARLRL +TLT+E+K++RA+DVI+ELGL+RCQDTMIGG
Sbjct  239   IGFVTQDDVLFPHLTVKETLTYAARLRLSKTLTREQKEQRALDVIHELGLERCQDTMIGG  298

Query  1996  SFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILHEIAKAGKTVIT  1817
             +FVRGVSGGERKRV IGNEIIINPSLL LDEPTSGLDSTTALR + +LH+I+ AGKTVIT
Sbjct  299   AFVRGVSGGERKRVSIGNEIIINPSLLLLDEPTSGLDSTTALRTIQMLHDISDAGKTVIT  358

Query  1816  TIHQPSSRLFHk--------------------------------fdklilleflldLANG  1733
             TIHQPSSRLFH+                                   +   EFLLDLANG
Sbjct  359   TIHQPSSRLFHRFDKLILLGRGSLLYFGKSSEALEYFSSIGCSPLIAMNPAEFLLDLANG  418

Query  1732  NINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYETRVAETEKKKLMAPL  1553
             NIND+S+PSEL D+VQ  NS  E     GKPSPA VHEYLV  YETRVAE EKKKLM P+
Sbjct  419   NINDISVPSELDDRVQVGNSGRE--TQTGKPSPAAVHEYLVEAYETRVAEQEKKKLMDPV  476

Query  1552  PVEEELKSKVRYLKREWGASWSEQYVLLFHRGIRERWHDYFSWLRITQVIATALILGMLW  1373
             P++EE K+K   LKREWGA W EQY +LF RG++ER H+YFSWLR+TQV++TA+ILG+LW
Sbjct  477   PLDEEAKAKSLRLKREWGAGWWEQYCILFCRGLKERRHEYFSWLRVTQVLSTAVILGLLW  536

Query  1372  WQSGGDTPSQMQDQAGLLFFIAVFWGFFPVFTAIFTFPQEKAMLSKERAADMYRLSAYFA  1193
             WQS   TP  +QDQAGLLFFIAVFWGFFPVFTAIF FPQE+AML+KERAADMY+LSAYF 
Sbjct  537   WQSDMRTPRGLQDQAGLLFFIAVFWGFFPVFTAIFAFPQERAMLNKERAADMYKLSAYFL  596

Query  1192  ARTTSdlpldlllpliflLVVYFMAGLKQDASSFLLTAVTVFLCIVVAQGLGLAIGATLM  1013
             ARTTSDLPLD +LP +FLLVVYFM GL+     F L+ +TVFLCI+ AQGLGLAIGA LM
Sbjct  597   ARTTSDLPLDFILPSLFLLVVYFMTGLRVSPYPFFLSMLTVFLCIIAAQGLGLAIGAVLM  656

Query  1012  DLKKATTLASVTVMTFMLAGGYFIKKVPGFIVWLRDLSFNYHTFKLLLKVQYEHKTNSVN  833
             DLKKATTLASVTVMTFMLAGG+F+KKVP FI W+R LSFNYHT+KLLLKVQY+    S+N
Sbjct  657   DLKKATTLASVTVMTFMLAGGFFVKKVPVFISWIRYLSFNYHTYKLLLKVQYQDLAESIN  716

Query  832   GVQIDSGIKEVGALAAMAVSYRLLAYISLRRMKL  731
             G++IDSG+ EV AL  M   YRLLAY+SLR+MK+
Sbjct  717   GMRIDSGLTEVVALIVMVFGYRLLAYLSLRQMKI  750



>ref|XP_010452592.1| PREDICTED: ABC transporter G family member 22 [Camelina sativa]
Length=752

 Score =   886 bits (2290),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 498/754 (66%), Positives = 584/754 (77%), Gaps = 55/754 (7%)
 Frame = -2

Query  2863  STSLLRTKSDQLVEaiaaakgsarARLPRLSAEFAGSGVPESV-------RMLSRKPSRR  2705
             +T L RT+S+QL E++AAA      + P  S +   +G+P +          LSRK SRR
Sbjct  9     ATGLARTRSEQLYESVAAAI-----KSPHGSMD--ANGIPATAPAAVGGGGTLSRKSSRR  61

Query  2704  LMppspggggsgGTNSTHIRKSRSAQMKLDLDElssgsvlsrassasl--GFSFTGFSVR  2531
             LM  +  G   G    THIRKSRSAQ+KL+L+E+SSG+ LSRASSASL   FSFTGF++ 
Sbjct  62    LMMGASPGRSGGA--GTHIRKSRSAQLKLELEEVSSGAALSRASSASLGLSFSFTGFAMP  119

Query  2530  PDESADSKPFSDDEN-PEDLEAGTKKKRSIPAEPTFPIYLKFTEVSYKIVIKGVTFSEEK  2354
             P+E +DSKPFSDDE  PED+EAG KK+    AEPT PI+LKF EV+YK+VIK +T S EK
Sbjct  120   PEEISDSKPFSDDEMIPEDIEAG-KKRPKFQAEPTLPIFLKFKEVTYKVVIKKMTSSVEK  178

Query  2353  DILNGISGAVDPGEVLALMGPSGCGKTTLLSLLGGRI-RDPSAGSITYNQHPYSKLLKSR  2177
             +IL GI+G+V+PGEVLALMGPSG GKTTLLSLL GRI +  + GS+TYN  PYSK LKSR
Sbjct  179   EILTGITGSVNPGEVLALMGPSGSGKTTLLSLLAGRISQSTTGGSVTYNDKPYSKFLKSR  238

Query  2176  IGFVTQDDILFPHLTVKETLIYAARLRLPRTLTKEEKDKRAMDVIYELGLDRCQDTMIGG  1997
             IGFVTQDD+LFPHLTVKETL YAARLRL +TLT+E+K++RA+DVI ELGL+RCQDTMIGG
Sbjct  239   IGFVTQDDVLFPHLTVKETLTYAARLRLSKTLTREQKEQRALDVIQELGLERCQDTMIGG  298

Query  1996  SFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILHEIAKAGKTVIT  1817
             +FVRGVSGGERKRV IGNEIIINPSLL LDEPTSGLDSTTALR + +LH+I+ AGKTVIT
Sbjct  299   AFVRGVSGGERKRVSIGNEIIINPSLLLLDEPTSGLDSTTALRTIQMLHDISDAGKTVIT  358

Query  1816  TIHQPSSRLFHk--------------------------------fdklilleflldLANG  1733
             TIHQPSSRLFH+                                   +   EFLLDLANG
Sbjct  359   TIHQPSSRLFHRFDKLILLGRGSLLYFGKSSEALDYFSSIGCSPLIAMNPAEFLLDLANG  418

Query  1732  NINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYETRVAETEKKKLMAPL  1553
             NIND+S+PSEL D+VQ  NS  E     GKPSPA VHEYLV  YETRVAE EKKKLM P+
Sbjct  419   NINDISVPSELDDRVQVGNSGRE--TQTGKPSPAAVHEYLVEAYETRVAEQEKKKLMDPV  476

Query  1552  PVEEELKSKVRYLKREWGASWSEQYVLLFHRGIRERWHDYFSWLRITQVIATALILGMLW  1373
             P++EE K+K   LKREWGA W EQY +LF RG++ER H+YFSWLR+TQV++TA+ILG+LW
Sbjct  477   PLDEEAKAKSLRLKREWGAGWWEQYCILFCRGLKERRHEYFSWLRVTQVLSTAVILGLLW  536

Query  1372  WQSGGDTPSQMQDQAGLLFFIAVFWGFFPVFTAIFTFPQEKAMLSKERAADMYRLSAYFA  1193
             WQS   TP  +QDQAGLLFFIAVFWGFFPVFTAIF FPQE+AML+KERAADMY+LSAYF 
Sbjct  537   WQSDIRTPRGLQDQAGLLFFIAVFWGFFPVFTAIFAFPQERAMLNKERAADMYKLSAYFL  596

Query  1192  ARTTSdlpldlllpliflLVVYFMAGLKQDASSFLLTAVTVFLCIVVAQGLGLAIGATLM  1013
             ARTTSDLPLD +LP +FLLVVYFM GL+     F L+ +TVFLCI+ AQGLGLAIGA LM
Sbjct  597   ARTTSDLPLDFILPSLFLLVVYFMTGLRVSPYPFFLSMLTVFLCIIAAQGLGLAIGAVLM  656

Query  1012  DLKKATTLASVTVMTFMLAGGYFIKKVPGFIVWLRDLSFNYHTFKLLLKVQYEHKTNSVN  833
             DLKKATTLASVTVMTFMLAGG+F+KKVP FI W+R LSFNYHT+KLLLKVQY+    S+N
Sbjct  657   DLKKATTLASVTVMTFMLAGGFFVKKVPVFISWIRYLSFNYHTYKLLLKVQYQDLAESIN  716

Query  832   GVQIDSGIKEVGALAAMAVSYRLLAYISLRRMKL  731
             G++IDSG+ EV AL  M   YRLLAY+SLR+MK+
Sbjct  717   GMRIDSGLTEVVALIVMVFGYRLLAYLSLRQMKI  750



>ref|XP_006287123.1| hypothetical protein CARUB_v10000295mg [Capsella rubella]
 gb|EOA20021.1| hypothetical protein CARUB_v10000295mg [Capsella rubella]
Length=752

 Score =   885 bits (2287),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 501/755 (66%), Positives = 584/755 (77%), Gaps = 57/755 (8%)
 Frame = -2

Query  2863  STSLLRTKSDQLVEaiaaakgsarARLPRLSAEFAGSGVPESVR-------MLSRKPSRR  2705
             ++ L RT+S+QL E +AAA      + P  S +   +GVP +          LSRK SRR
Sbjct  9     ASGLARTRSEQLYETVAAAM-----KSPHGSMD--ANGVPATAPAAVGGGGTLSRKSSRR  61

Query  2704  LMppspggggsgGTNSTHIRKSRSAQMKLDLDElssgsvlsrassasl--GFSFTGFSVR  2531
             LM  +  G   G    THIRKSRSAQ+KL+L+E+SSG+ LSRASSASL   FSFTGF++ 
Sbjct  62    LMMGASPGRSGGA--GTHIRKSRSAQLKLELEEVSSGAALSRASSASLGLSFSFTGFAMP  119

Query  2530  PDESADSKPFSDDEN-PEDLEAGTKKKRSIPAEPTFPIYLKFTEVSYKIVIKGVTFSEEK  2354
             P+E  D KPFSDDE  PED EAG KKK  + AEPT PI+LKF +V+YK+VIK +T S EK
Sbjct  120   PEEITDEKPFSDDEMIPEDNEAG-KKKPKLQAEPTLPIFLKFRDVTYKVVIKKMTSSVEK  178

Query  2353  DILNGISGAVDPGEVLALMGPSGCGKTTLLSLLGGRIRDPS-AGSITYNQHPYSKLLKSR  2177
             +IL+GI+G+V+PGEVLALMGPSG GKTTLLSLL GRI   S  GS+TYN  PYSK LKS+
Sbjct  179   EILSGITGSVNPGEVLALMGPSGSGKTTLLSLLAGRISQSSTGGSVTYNDKPYSKFLKSK  238

Query  2176  IGFVTQDDILFPHLTVKETLIYAARLRLPRTLTKEEKDKRAMDVIYELGLDRCQDTMIGG  1997
             IGFVTQDD+LFPHLTVKETL YAARLRLP+TLT+E+K++RA+DVI ELGL+RCQDTMIGG
Sbjct  239   IGFVTQDDVLFPHLTVKETLTYAARLRLPKTLTREQKEQRALDVIEELGLERCQDTMIGG  298

Query  1996  SFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILHEIAKAGKTVIT  1817
             +FVRGVSGGERKRV IGNEIIINPSLL LDEPTSGLDSTTALR + +LH+IA AGKTVIT
Sbjct  299   AFVRGVSGGERKRVSIGNEIIINPSLLLLDEPTSGLDSTTALRTIQMLHDIADAGKTVIT  358

Query  1816  TIHQPSSRLFHk--------------------------------fdklilleflldLANG  1733
             TIHQPSSRLFH+                                   +   EFLLDLANG
Sbjct  359   TIHQPSSRLFHRFDKLILLGRGSLLYFGKSAEALDYFSSIGCSPLIAMNPAEFLLDLANG  418

Query  1732  NINDVSIPSELADKVQTWNS-KEEPTRNNGKPSPAIVHEYLVGCYETRVAETEKKKLMAP  1556
             NIND+S+PSEL D+VQ  NS +E PT   GKPSPA VHEYLV  YETRVAE EKKKLM P
Sbjct  419   NINDISVPSELDDRVQVGNSGRETPT---GKPSPAAVHEYLVEAYETRVAEQEKKKLMDP  475

Query  1555  LPVEEELKSKVRYLKREWGASWSEQYVLLFHRGIRERWHDYFSWLRITQVIATALILGML  1376
              P++EE K+K   LKR WGA W EQY +LF RG++ER H+YFSWLR+TQV++TA+ILG+L
Sbjct  476   APLDEETKAKAMRLKRHWGAGWWEQYCILFCRGLKERRHEYFSWLRVTQVLSTAVILGLL  535

Query  1375  WWQSGGDTPSQMQDQAGLLFFIAVFWGFFPVFTAIFTFPQEKAMLSKERAADMYRLSAYF  1196
             WWQS   TP  +QDQAGLLFFIAVFWGFFPVFTAIF FPQE+AML+KERAADMYRLSAYF
Sbjct  536   WWQSDIRTPRGLQDQAGLLFFIAVFWGFFPVFTAIFAFPQERAMLNKERAADMYRLSAYF  595

Query  1195  AARTTSdlpldlllpliflLVVYFMAGLKQDASSFLLTAVTVFLCIVVAQGLGLAIGATL  1016
              ARTTSDLPLD +LP +FLLVVYFM GL+     F L+ +TVFLCI+ AQGLGLAIGA L
Sbjct  596   LARTTSDLPLDFILPSLFLLVVYFMTGLRLSPYPFFLSMLTVFLCIIAAQGLGLAIGAIL  655

Query  1015  MDLKKATTLASVTVMTFMLAGGYFIKKVPGFIVWLRDLSFNYHTFKLLLKVQYEHKTNSV  836
             MDLKKATTLASVTVMTFMLAGG+F+KKVP FI W+R LSFNYHT+KLLLKVQY+    S+
Sbjct  656   MDLKKATTLASVTVMTFMLAGGFFVKKVPVFISWIRYLSFNYHTYKLLLKVQYQDFAESI  715

Query  835   NGVQIDSGIKEVGALAAMAVSYRLLAYISLRRMKL  731
             NG++ID+G+ EV AL AM   YRLLAY+SLR+MK+
Sbjct  716   NGMRIDNGLTEVVALVAMIFGYRLLAYLSLRQMKI  750



>ref|XP_002873263.1| abc transporter family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49522.1| abc transporter family protein [Arabidopsis lyrata subsp. lyrata]
Length=750

 Score =   884 bits (2283),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 499/754 (66%), Positives = 581/754 (77%), Gaps = 55/754 (7%)
 Frame = -2

Query  2863  STSLLRTKSDQLVEaiaaakgsarARLPRLSAEFAGSGVPESVR-------MLSRKPSRR  2705
             ++ L RT+S+QL E +AAA      R P  S +   +GVP +          LSRK SRR
Sbjct  7     ASGLARTRSEQLYETVAAAI-----RSPHGSMD--ANGVPATAPAAVGGGGTLSRKSSRR  59

Query  2704  LMppspggggsgGTNSTHIRKSRSAQMKLDLDElssgsvlsrassasl--GFSFTGFSVR  2531
             LM  +  G   G    THIRKSRSAQ+KL+L+E+SSG+ LSRASSASL   FSFTGF++ 
Sbjct  60    LMMGASPGRSGGA--GTHIRKSRSAQLKLELEEVSSGAALSRASSASLGLSFSFTGFAMP  117

Query  2530  PDESADSKPFSDDEN-PEDLEAGTKKKRSIPAEPTFPIYLKFTEVSYKIVIKGVTFSEEK  2354
             P+E +DSKPFSD+E  PED+EAG KKK    AEPT PI+LKF +V+YK+VIK +T S EK
Sbjct  118   PEEISDSKPFSDEEMIPEDIEAG-KKKPKFQAEPTLPIFLKFRDVTYKVVIKKLTSSAEK  176

Query  2353  DILNGISGAVDPGEVLALMGPSGCGKTTLLSLLGGRIRDPS-AGSITYNQHPYSKLLKSR  2177
             +IL GISG+V PGEVLALMGPSG GKTTLLSLL GRI   S  GSITYN  PYSK LKS+
Sbjct  177   EILTGISGSVSPGEVLALMGPSGSGKTTLLSLLAGRISQSSTGGSITYNDKPYSKYLKSK  236

Query  2176  IGFVTQDDILFPHLTVKETLIYAARLRLPRTLTKEEKDKRAMDVIYELGLDRCQDTMIGG  1997
             IGFVTQDD+LFPHLTVKETL YAARLRLP+TLT+E+K +RA+DVI ELGL+RCQDTMIGG
Sbjct  237   IGFVTQDDVLFPHLTVKETLTYAARLRLPKTLTREQKKQRALDVIQELGLERCQDTMIGG  296

Query  1996  SFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILHEIAKAGKTVIT  1817
             +FVRGVSGGERKRV IGNEIIINPSLL LDEPTSGLDSTTALR + +LH+IA+AGKTVIT
Sbjct  297   AFVRGVSGGERKRVSIGNEIIINPSLLLLDEPTSGLDSTTALRTILMLHDIAEAGKTVIT  356

Query  1816  TIHQPSSRLFHk--------------------------------fdklilleflldLANG  1733
             TIHQPSSRLFH+                                   +   EFLLDLANG
Sbjct  357   TIHQPSSRLFHRFDKLILLGRGSLLYFGKSSEALDYFSSIGCSPLIAMNPAEFLLDLANG  416

Query  1732  NINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYETRVAETEKKKLMAPL  1553
             NIND+S+PSEL D+VQ  NS  E     GKPSP IVHEYLV  YETRVAE EKKKL+ P+
Sbjct  417   NINDISVPSELDDRVQVGNSGRE--TQTGKPSPTIVHEYLVEAYETRVAEQEKKKLLDPV  474

Query  1552  PVEEELKSKVRYLKREWGASWSEQYVLLFHRGIRERWHDYFSWLRITQVIATALILGMLW  1373
             P++EE K+K   LKR+WGA W EQY +LF RG++ER H+YFSWLR+TQV++TA+ILG+LW
Sbjct  475   PLDEEAKAKSTRLKRQWGAGWWEQYCILFCRGLKERRHEYFSWLRVTQVLSTAVILGLLW  534

Query  1372  WQSGGDTPSQMQDQAGLLFFIAVFWGFFPVFTAIFTFPQEKAMLSKERAADMYRLSAYFA  1193
             WQS   TP  +QDQAGLLFFIAVFWGFFPVFTAIF FPQE+AML+KERAADMYRLSAYF 
Sbjct  535   WQSDIRTPVGLQDQAGLLFFIAVFWGFFPVFTAIFAFPQERAMLNKERAADMYRLSAYFL  594

Query  1192  ARTTSdlpldlllpliflLVVYFMAGLKQDASSFLLTAVTVFLCIVVAQGLGLAIGATLM  1013
             ARTTSDLPLD +LP +FLLVVYFM GL+     F L+ + VFLCI+ AQGLGLAIGA LM
Sbjct  595   ARTTSDLPLDFILPSLFLLVVYFMTGLRISPYPFFLSILIVFLCIIAAQGLGLAIGAVLM  654

Query  1012  DLKKATTLASVTVMTFMLAGGYFIKKVPGFIVWLRDLSFNYHTFKLLLKVQYEHKTNSVN  833
             DLKKATTLASVTVMTFMLAGG+F+KKVP FI W+R LSFNYHT+KLLLKVQY+    S+N
Sbjct  655   DLKKATTLASVTVMTFMLAGGFFVKKVPVFISWIRYLSFNYHTYKLLLKVQYQDFAESIN  714

Query  832   GVQIDSGIKEVGALAAMAVSYRLLAYISLRRMKL  731
             G++ID+G+ EV AL  M   YRLLAY+SLR+MK+
Sbjct  715   GMRIDNGLTEVAALVVMIFGYRLLAYLSLRQMKI  748



>ref|NP_568169.1| ABC transporter G family member 22 [Arabidopsis thaliana]
 ref|NP_850781.2| ABC transporter G family member 22 [Arabidopsis thaliana]
 sp|Q93YS4.1|AB22G_ARATH RecName: Full=ABC transporter G family member 22; Short=ABC transporter 
ABCG.22; Short=AtABCG22; AltName: Full=White-brown 
complex homolog protein 23; Short=AtWBC23 [Arabidopsis thaliana]
 gb|AAL24135.1| putative ABC transporter protein [Arabidopsis thaliana]
 gb|AAM45116.1| putative ABC transporter protein [Arabidopsis thaliana]
 dbj|BAH20090.1| AT5G06530 [Arabidopsis thaliana]
 gb|AED91029.1| ABC transporter G family member 22 [Arabidopsis thaliana]
 gb|AED91030.1| ABC transporter G family member 22 [Arabidopsis thaliana]
Length=751

 Score =   884 bits (2283),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 499/754 (66%), Positives = 581/754 (77%), Gaps = 56/754 (7%)
 Frame = -2

Query  2863  STSLLRTKSDQLVEaiaaakgsarARLPRLSAEFAGSGVPESVR-------MLSRKPSRR  2705
             ++ L RT+S+QL E +AA       R P  S +   +GVP +          LSRK SRR
Sbjct  9     ASGLARTRSEQLYETVAADI-----RSPHGSMD--ANGVPATAPAAVGGGGTLSRKSSRR  61

Query  2704  LMppspggggsgGTNSTHIRKSRSAQMKLDLDElssgsvlsrassasl--GFSFTGFSVR  2531
             LM  SPG         THIRKSRSAQ+KL+L+E+SSG+ LSRASSASL   FSFTGF++ 
Sbjct  62    LMGMSPGRSSGA---GTHIRKSRSAQLKLELEEVSSGAALSRASSASLGLSFSFTGFAMP  118

Query  2530  PDESADSKPFSDDEN-PEDLEAGTKKKRSIPAEPTFPIYLKFTEVSYKIVIKGVTFSEEK  2354
             P+E +DSKPFSDDE  PED+EAG KKK    AEPT PI+LKF +V+YK+VIK +T S EK
Sbjct  119   PEEISDSKPFSDDEMIPEDIEAG-KKKPKFQAEPTLPIFLKFRDVTYKVVIKKLTSSVEK  177

Query  2353  DILNGISGAVDPGEVLALMGPSGCGKTTLLSLLGGRIRDPS-AGSITYNQHPYSKLLKSR  2177
             +IL GISG+V+PGEVLALMGPSG GKTTLLSLL GRI   S  GS+TYN  PYSK LKS+
Sbjct  178   EILTGISGSVNPGEVLALMGPSGSGKTTLLSLLAGRISQSSTGGSVTYNDKPYSKYLKSK  237

Query  2176  IGFVTQDDILFPHLTVKETLIYAARLRLPRTLTKEEKDKRAMDVIYELGLDRCQDTMIGG  1997
             IGFVTQDD+LFPHLTVKETL YAARLRLP+TLT+E+K +RA+DVI ELGL+RCQDTMIGG
Sbjct  238   IGFVTQDDVLFPHLTVKETLTYAARLRLPKTLTREQKKQRALDVIQELGLERCQDTMIGG  297

Query  1996  SFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILHEIAKAGKTVIT  1817
             +FVRGVSGGERKRV IGNEIIINPSLL LDEPTSGLDSTTALR + +LH+IA+AGKTVIT
Sbjct  298   AFVRGVSGGERKRVSIGNEIIINPSLLLLDEPTSGLDSTTALRTILMLHDIAEAGKTVIT  357

Query  1816  TIHQPSSRLFHk--------------------------------fdklilleflldLANG  1733
             TIHQPSSRLFH+                                   +   EFLLDLANG
Sbjct  358   TIHQPSSRLFHRFDKLILLGRGSLLYFGKSSEALDYFSSIGCSPLIAMNPAEFLLDLANG  417

Query  1732  NINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYETRVAETEKKKLMAPL  1553
             NIND+S+PSEL D+VQ  NS  E     GKPSPA VHEYLV  YETRVAE EKKKL+ P+
Sbjct  418   NINDISVPSELDDRVQVGNSGRE--TQTGKPSPAAVHEYLVEAYETRVAEQEKKKLLDPV  475

Query  1552  PVEEELKSKVRYLKREWGASWSEQYVLLFHRGIRERWHDYFSWLRITQVIATALILGMLW  1373
             P++EE K+K   LKR+WG  W EQY +LF RG++ER H+YFSWLR+TQV++TA+ILG+LW
Sbjct  476   PLDEEAKAKSTRLKRQWGTCWWEQYCILFCRGLKERRHEYFSWLRVTQVLSTAVILGLLW  535

Query  1372  WQSGGDTPSQMQDQAGLLFFIAVFWGFFPVFTAIFTFPQEKAMLSKERAADMYRLSAYFA  1193
             WQS   TP  +QDQAGLLFFIAVFWGFFPVFTAIF FPQE+AML+KERAADMYRLSAYF 
Sbjct  536   WQSDIRTPMGLQDQAGLLFFIAVFWGFFPVFTAIFAFPQERAMLNKERAADMYRLSAYFL  595

Query  1192  ARTTSdlpldlllpliflLVVYFMAGLKQDASSFLLTAVTVFLCIVVAQGLGLAIGATLM  1013
             ARTTSDLPLD +LP +FLLVVYFM GL+     F L+ +TVFLCI+ AQGLGLAIGA LM
Sbjct  596   ARTTSDLPLDFILPSLFLLVVYFMTGLRISPYPFFLSMLTVFLCIIAAQGLGLAIGAILM  655

Query  1012  DLKKATTLASVTVMTFMLAGGYFIKKVPGFIVWLRDLSFNYHTFKLLLKVQYEHKTNSVN  833
             DLKKATTLASVTVMTFMLAGG+F+KKVP FI W+R LSFNYHT+KLLLKVQY+    S+N
Sbjct  656   DLKKATTLASVTVMTFMLAGGFFVKKVPVFISWIRYLSFNYHTYKLLLKVQYQDFAVSIN  715

Query  832   GVQIDSGIKEVGALAAMAVSYRLLAYISLRRMKL  731
             G++ID+G+ EV AL  M   YRLLAY+SLR+MK+
Sbjct  716   GMRIDNGLTEVAALVVMIFGYRLLAYLSLRQMKI  749



>ref|XP_010423326.1| PREDICTED: ABC transporter G family member 22-like [Camelina 
sativa]
Length=752

 Score =   883 bits (2281),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 497/754 (66%), Positives = 582/754 (77%), Gaps = 55/754 (7%)
 Frame = -2

Query  2863  STSLLRTKSDQLVEaiaaakgsarARLPRLSAEFAGSGVPESV-------RMLSRKPSRR  2705
             +T L RT+S+QL E++AAA      + P  S +   +G+P +          LSRK SRR
Sbjct  9     ATGLARTRSEQLYESVAAAI-----KSPHGSMD--ANGIPATAPAAVGGGGTLSRKSSRR  61

Query  2704  LMppspggggsgGTNSTHIRKSRSAQMKLDLDElssgsvlsrassasl--GFSFTGFSVR  2531
             LM  +  G   G    THIRKSRSAQ+KL+L+E+SSG+ LSRASSASL   FSFTGF++ 
Sbjct  62    LMMGASPGRSGGA--GTHIRKSRSAQLKLELEEVSSGAALSRASSASLGLSFSFTGFAMP  119

Query  2530  PDESADSKPFSDDEN-PEDLEAGTKKKRSIPAEPTFPIYLKFTEVSYKIVIKGVTFSEEK  2354
             P+E +DSKPFSDDE  PED+EAG KK+    AEPT PI+LKF EV+YK+VIK +T S EK
Sbjct  120   PEEISDSKPFSDDEMIPEDIEAG-KKRPKFQAEPTLPIFLKFKEVTYKVVIKKMTSSVEK  178

Query  2353  DILNGISGAVDPGEVLALMGPSGCGKTTLLSLLGGRIRDPS-AGSITYNQHPYSKLLKSR  2177
             +IL GI+G+V+PGEVLALMGPSG GKTTLLSLL GRI   S  GS+TYN  PYSK LKSR
Sbjct  179   EILTGITGSVNPGEVLALMGPSGSGKTTLLSLLAGRISQSSTGGSVTYNDKPYSKFLKSR  238

Query  2176  IGFVTQDDILFPHLTVKETLIYAARLRLPRTLTKEEKDKRAMDVIYELGLDRCQDTMIGG  1997
             IGFVTQDD+LFPHLTVKETL YAARLRL +TLT+E+K++RA+DVI ELGL+RCQDTMIGG
Sbjct  239   IGFVTQDDVLFPHLTVKETLTYAARLRLSKTLTREQKEQRALDVIQELGLERCQDTMIGG  298

Query  1996  SFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILHEIAKAGKTVIT  1817
             +FVRGVSGGERKRV IGNEIIINPSLL LDEPTSGLDSTTALR + +LH+I+ AGKTVIT
Sbjct  299   AFVRGVSGGERKRVSIGNEIIINPSLLLLDEPTSGLDSTTALRTIQMLHDISDAGKTVIT  358

Query  1816  TIHQPSSRLFHk--------------------------------fdklilleflldLANG  1733
             TIHQPSSRLFH+                                   +   EFLLDLANG
Sbjct  359   TIHQPSSRLFHRFDKLILLGRGSLLYFGKSSEALDYFSSIGCSPLIAMNPAEFLLDLANG  418

Query  1732  NINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYETRVAETEKKKLMAPL  1553
             NIND+S+PSEL D+VQ  NS  E     GKPSPA VHEYLV  YETRVAE EKKKLM P+
Sbjct  419   NINDISVPSELDDRVQVGNSGRE--TQTGKPSPAAVHEYLVEAYETRVAEQEKKKLMDPV  476

Query  1552  PVEEELKSKVRYLKREWGASWSEQYVLLFHRGIRERWHDYFSWLRITQVIATALILGMLW  1373
             P+ EE K+K  +LKR+WGA W EQY +LF RG++ER H+YFSWLR+TQV++TA+ILG+LW
Sbjct  477   PLNEEAKAKSLHLKRQWGAGWWEQYCILFCRGLKERRHEYFSWLRVTQVLSTAVILGLLW  536

Query  1372  WQSGGDTPSQMQDQAGLLFFIAVFWGFFPVFTAIFTFPQEKAMLSKERAADMYRLSAYFA  1193
             WQS   T   +QDQAGLLFFIAVFWGFFPVFTAIF FPQE+AML+KERAADMY+LSAYF 
Sbjct  537   WQSDIRTSRGLQDQAGLLFFIAVFWGFFPVFTAIFAFPQERAMLNKERAADMYKLSAYFL  596

Query  1192  ARTTSdlpldlllpliflLVVYFMAGLKQDASSFLLTAVTVFLCIVVAQGLGLAIGATLM  1013
             ARTTSDLPLD +LP +FLLVVYFM GL+     F L+ +TVFLCI+ AQGLGLAIGA LM
Sbjct  597   ARTTSDLPLDFILPSLFLLVVYFMTGLRVSPYPFFLSMLTVFLCIIAAQGLGLAIGAVLM  656

Query  1012  DLKKATTLASVTVMTFMLAGGYFIKKVPGFIVWLRDLSFNYHTFKLLLKVQYEHKTNSVN  833
             DLKKATTLASVTVMTFMLAGG+F+KKVP FI W+R LSFNYHT+KLLLKVQY+    S+N
Sbjct  657   DLKKATTLASVTVMTFMLAGGFFVKKVPVFISWIRYLSFNYHTYKLLLKVQYQDLAESIN  716

Query  832   GVQIDSGIKEVGALAAMAVSYRLLAYISLRRMKL  731
             G++IDSG+ EV AL  M   YRLLAY+SLR+MK+
Sbjct  717   GMRIDSGLTEVVALIVMVFGYRLLAYLSLRQMKI  750



>ref|XP_009122262.1| PREDICTED: ABC transporter G family member 22 isoform X1 [Brassica 
rapa]
Length=755

 Score =   880 bits (2275),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 496/753 (66%), Positives = 583/753 (77%), Gaps = 50/753 (7%)
 Frame = -2

Query  2863  STSLLRTKSDQLVEaiaaakgsarARLPRLSAEFAGSGVPESV----RMLSRKPSRRLMp  2696
             ++ L RT+S+QL E +AAA  S       + A    +  P S+      LSRK SRRLM 
Sbjct  9     ASGLARTRSEQLYETLAAAIKSP---FGSMDANGVPATAPASIGGGRETLSRKSSRRLMM  65

Query  2695  pspggggsgGTNSTHIRKSRSAQMKLDLDElssgsvlsrassasl--GFSFTGFSVRPDE  2522
              +  G   G    THIRKSRSAQ+KL+L+E+SSG+ LSRASSASL   FSFTGF++ P+E
Sbjct  66    SASPGRSGGA--GTHIRKSRSAQLKLELEEVSSGAALSRASSASLGLSFSFTGFAMPPEE  123

Query  2521  SADSKPFSDDEN-PEDLEAGTKKKRSIPAEPTFPIYLKFTEVSYKIVIKGVTFSE--EKD  2351
              +DS PFSDDE  PED EAG KK R   AEPT PI+LKF EV+YK+ I+ +  S   +K+
Sbjct  124   ISDSNPFSDDEMIPEDNEAGNKKPR-FQAEPTLPIFLKFKEVTYKVSIRKLMTSAPVDKE  182

Query  2350  ILNGISGAVDPGEVLALMGPSGCGKTTLLSLLGGRI-RDPSAGSITYNQHPYSKLLKSRI  2174
             IL+GI+G+V PGEVLALMGPSG GKTTLLSLLGGRI +  S GS+TYN  PYSK LKS+I
Sbjct  183   ILSGINGSVSPGEVLALMGPSGSGKTTLLSLLGGRISQSASGGSVTYNDKPYSKYLKSKI  242

Query  2173  GFVTQDDILFPHLTVKETLIYAARLRLPRTLTKEEKDKRAMDVIYELGLDRCQDTMIGGS  1994
             GFVTQDD+LFPHLTVKETL YAARLRLP+TLT+E+K++RA++VI ELGL+RCQDTMIGG+
Sbjct  243   GFVTQDDVLFPHLTVKETLTYAARLRLPKTLTREQKEQRAIEVIQELGLERCQDTMIGGA  302

Query  1993  FVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILHEIAKAGKTVITT  1814
             FVRGVSGGERKRV IGNEIIINPSLL LDEPTSGLDSTTALR + +LH+IA+AGKTVITT
Sbjct  303   FVRGVSGGERKRVSIGNEIIINPSLLLLDEPTSGLDSTTALRTIQMLHDIAEAGKTVITT  362

Query  1813  IHQPSSRLFHk--------------------------------fdklilleflldLANGN  1730
             IHQPSSRLFH+                                   +   EFLLDLANGN
Sbjct  363   IHQPSSRLFHRFDKLILLGRGNLLYFGKSSEALVYFSSIGCSPLITMNPAEFLLDLANGN  422

Query  1729  INDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYETRVAETEKKKLMAPLP  1550
             IND+S+PSEL D+VQ  NS  EP    GKPSPA VHEYLV  YETRVAE EKKKL  P+P
Sbjct  423   INDISVPSELEDRVQVGNSGREP--QTGKPSPAAVHEYLVEAYETRVAEQEKKKLSDPVP  480

Query  1549  VEEELKSKVRYLKREWGASWSEQYVLLFHRGIRERWHDYFSWLRITQVIATALILGMLWW  1370
             ++EE K+KV  LKR+WGASW EQY +LF RG++ER H+YFSWLR+TQV++TA+ILG+LWW
Sbjct  481   LDEEAKAKVLRLKRQWGASWWEQYCILFSRGLKERRHEYFSWLRVTQVLSTAVILGLLWW  540

Query  1369  QSGGDTPSQMQDQAGLLFFIAVFWGFFPVFTAIFTFPQEKAMLSKERAADMYRLSAYFAA  1190
             QS   TP  +QDQAGLLFFIAVFWGFFPVFTAIF FPQE+AML+KERAADMYRLSAYF A
Sbjct  541   QSDIRTPRGLQDQAGLLFFIAVFWGFFPVFTAIFAFPQERAMLNKERAADMYRLSAYFLA  600

Query  1189  RTTSdlpldlllpliflLVVYFMAGLKQDASSFLLTAVTVFLCIVVAQGLGLAIGATLMD  1010
             RTTSDLPLD +LP +FLLVVYFM GL+     F L+ +TVFLCI+ +QGLGLAIGA LMD
Sbjct  601   RTTSDLPLDFILPSLFLLVVYFMTGLRLSPYPFFLSMLTVFLCIIASQGLGLAIGAILMD  660

Query  1009  LKKATTLASVTVMTFMLAGGYFIKKVPGFIVWLRDLSFNYHTFKLLLKVQYEHKTNSVNG  830
             LKKATTLASVTVMTFMLAGG+F+KKVP FI W+R LSFNYHT+KLLLKVQY+    S+NG
Sbjct  661   LKKATTLASVTVMTFMLAGGFFVKKVPVFISWIRYLSFNYHTYKLLLKVQYKDFAQSING  720

Query  829   VQIDSGIKEVGALAAMAVSYRLLAYISLRRMKL  731
             ++ID+G+ EV AL AM   YRLLAY+SLR+MK+
Sbjct  721   MRIDNGLTEVVALVAMIFGYRLLAYLSLRQMKI  753



>ref|XP_009122263.1| PREDICTED: ABC transporter G family member 22 isoform X2 [Brassica 
rapa]
Length=754

 Score =   879 bits (2272),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 494/752 (66%), Positives = 582/752 (77%), Gaps = 49/752 (7%)
 Frame = -2

Query  2863  STSLLRTKSDQLVEaiaaakgsarARLPRLSAEFAGSGVPESV----RMLSRKPSRRLMp  2696
             ++ L RT+S+QL E +AAA  S       + A    +  P S+      LSRK SRRLM 
Sbjct  9     ASGLARTRSEQLYETLAAAIKSP---FGSMDANGVPATAPASIGGGRETLSRKSSRRLMM  65

Query  2695  pspggggsgGTNSTHIRKSRSAQMKLDLDElssgsvlsrassasl--GFSFTGFSVRPDE  2522
              +  G   G    THIRKSRSAQ+KL+L+E+SSG+ LSRASSASL   FSFTGF++ P+E
Sbjct  66    SASPGRSGGA--GTHIRKSRSAQLKLELEEVSSGAALSRASSASLGLSFSFTGFAMPPEE  123

Query  2521  SADSKPFSDDENPEDLEAGTKKKRSIPAEPTFPIYLKFTEVSYKIVIKGVTFSE--EKDI  2348
              +DS PFSDDE  +D EAG KK R   AEPT PI+LKF EV+YK+ I+ +  S   +K+I
Sbjct  124   ISDSNPFSDDEMIQDNEAGNKKPR-FQAEPTLPIFLKFKEVTYKVSIRKLMTSAPVDKEI  182

Query  2347  LNGISGAVDPGEVLALMGPSGCGKTTLLSLLGGRI-RDPSAGSITYNQHPYSKLLKSRIG  2171
             L+GI+G+V PGEVLALMGPSG GKTTLLSLLGGRI +  S GS+TYN  PYSK LKS+IG
Sbjct  183   LSGINGSVSPGEVLALMGPSGSGKTTLLSLLGGRISQSASGGSVTYNDKPYSKYLKSKIG  242

Query  2170  FVTQDDILFPHLTVKETLIYAARLRLPRTLTKEEKDKRAMDVIYELGLDRCQDTMIGGSF  1991
             FVTQDD+LFPHLTVKETL YAARLRLP+TLT+E+K++RA++VI ELGL+RCQDTMIGG+F
Sbjct  243   FVTQDDVLFPHLTVKETLTYAARLRLPKTLTREQKEQRAIEVIQELGLERCQDTMIGGAF  302

Query  1990  VRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILHEIAKAGKTVITTI  1811
             VRGVSGGERKRV IGNEIIINPSLL LDEPTSGLDSTTALR + +LH+IA+AGKTVITTI
Sbjct  303   VRGVSGGERKRVSIGNEIIINPSLLLLDEPTSGLDSTTALRTIQMLHDIAEAGKTVITTI  362

Query  1810  HQPSSRLFHk--------------------------------fdklilleflldLANGNI  1727
             HQPSSRLFH+                                   +   EFLLDLANGNI
Sbjct  363   HQPSSRLFHRFDKLILLGRGNLLYFGKSSEALVYFSSIGCSPLITMNPAEFLLDLANGNI  422

Query  1726  NDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYETRVAETEKKKLMAPLPV  1547
             ND+S+PSEL D+VQ  NS  EP    GKPSPA VHEYLV  YETRVAE EKKKL  P+P+
Sbjct  423   NDISVPSELEDRVQVGNSGREP--QTGKPSPAAVHEYLVEAYETRVAEQEKKKLSDPVPL  480

Query  1546  EEELKSKVRYLKREWGASWSEQYVLLFHRGIRERWHDYFSWLRITQVIATALILGMLWWQ  1367
             +EE K+KV  LKR+WGASW EQY +LF RG++ER H+YFSWLR+TQV++TA+ILG+LWWQ
Sbjct  481   DEEAKAKVLRLKRQWGASWWEQYCILFSRGLKERRHEYFSWLRVTQVLSTAVILGLLWWQ  540

Query  1366  SGGDTPSQMQDQAGLLFFIAVFWGFFPVFTAIFTFPQEKAMLSKERAADMYRLSAYFAAR  1187
             S   TP  +QDQAGLLFFIAVFWGFFPVFTAIF FPQE+AML+KERAADMYRLSAYF AR
Sbjct  541   SDIRTPRGLQDQAGLLFFIAVFWGFFPVFTAIFAFPQERAMLNKERAADMYRLSAYFLAR  600

Query  1186  TTSdlpldlllpliflLVVYFMAGLKQDASSFLLTAVTVFLCIVVAQGLGLAIGATLMDL  1007
             TTSDLPLD +LP +FLLVVYFM GL+     F L+ +TVFLCI+ +QGLGLAIGA LMDL
Sbjct  601   TTSDLPLDFILPSLFLLVVYFMTGLRLSPYPFFLSMLTVFLCIIASQGLGLAIGAILMDL  660

Query  1006  KKATTLASVTVMTFMLAGGYFIKKVPGFIVWLRDLSFNYHTFKLLLKVQYEHKTNSVNGV  827
             KKATTLASVTVMTFMLAGG+F+KKVP FI W+R LSFNYHT+KLLLKVQY+    S+NG+
Sbjct  661   KKATTLASVTVMTFMLAGGFFVKKVPVFISWIRYLSFNYHTYKLLLKVQYKDFAQSINGM  720

Query  826   QIDSGIKEVGALAAMAVSYRLLAYISLRRMKL  731
             +ID+G+ EV AL AM   YRLLAY+SLR+MK+
Sbjct  721   RIDNGLTEVVALVAMIFGYRLLAYLSLRQMKI  752



>emb|CDX70095.1| BnaA10g24440D [Brassica napus]
Length=721

 Score =   879 bits (2271),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 483/704 (69%), Positives = 562/704 (80%), Gaps = 43/704 (6%)
 Frame = -2

Query  2728  LSRKPSRRLMppspggggsgGTNSTHIRKSRSAQMKLDLDElssgsvlsrassasl--GF  2555
             LSRK SRRLM  +  G   G    THIRKSRSAQ+KL+L+E+SSG+ LSRASSASL   F
Sbjct  21    LSRKSSRRLMMSASPGRSGGA--GTHIRKSRSAQLKLELEEVSSGAALSRASSASLGLSF  78

Query  2554  SFTGFSVRPDESADSKPFSDDEN-PEDLEAGTKKKRSIPAEPTFPIYLKFTEVSYKIVIK  2378
             SFTGF++ P+E +DSKPFSDDE  PED EAG KK R   AEPT PI+LKF EV+YK+ I+
Sbjct  79    SFTGFAMPPEEISDSKPFSDDEMIPEDNEAGNKKPR-FQAEPTLPIFLKFKEVTYKVSIR  137

Query  2377  GVTFSE--EKDILNGISGAVDPGEVLALMGPSGCGKTTLLSLLGGRI-RDPSAGSITYNQ  2207
              +  S   +K+IL+GI+G+V PGEVLALMGPSG GKTTLLSLLGGRI +  S GS+TYN 
Sbjct  138   KLMTSAPVDKEILSGINGSVSPGEVLALMGPSGSGKTTLLSLLGGRISQSASGGSVTYND  197

Query  2206  HPYSKLLKSRIGFVTQDDILFPHLTVKETLIYAARLRLPRTLTKEEKDKRAMDVIYELGL  2027
              PYSK LKS+IGFVTQDD+LFPHLTVKETL YAARLRLP+TLT+E+K++RA++VI ELGL
Sbjct  198   KPYSKYLKSKIGFVTQDDVLFPHLTVKETLTYAARLRLPKTLTREQKEQRAIEVIQELGL  257

Query  2026  DRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILHE  1847
             +RCQDTMIGG+FVRGVSGGERKRV IGNEIIINPSLL LDEPTSGLDSTTALR + +LH+
Sbjct  258   ERCQDTMIGGAFVRGVSGGERKRVSIGNEIIINPSLLLLDEPTSGLDSTTALRTIQMLHD  317

Query  1846  IAKAGKTVITTIHQPSSRLFHk--------------------------------fdklil  1763
             IA+AGKTVITTIHQPSSRLFH+                                   +  
Sbjct  318   IAEAGKTVITTIHQPSSRLFHRFDKLILLGRGNLLYFGKSSEALVYFSSIGCSPLITMNP  377

Query  1762  leflldLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYETRVAE  1583
              EFLLDLANGNIND+S+PSEL D+VQ  NS  EP    GKPSPA VHEYLV  YETRVAE
Sbjct  378   AEFLLDLANGNINDISVPSELEDRVQVGNSGREP--QTGKPSPAAVHEYLVEAYETRVAE  435

Query  1582  TEKKKLMAPLPVEEELKSKVRYLKREWGASWSEQYVLLFHRGIRERWHDYFSWLRITQVI  1403
              EKKKL  P+P++EE K+KV  LKR+WGASW EQY +LF RG++ER H+YFSWLR+TQV+
Sbjct  436   QEKKKLSDPVPLDEEAKAKVLRLKRQWGASWWEQYCILFSRGLKERRHEYFSWLRVTQVL  495

Query  1402  ATALILGMLWWQSGGDTPSQMQDQAGLLFFIAVFWGFFPVFTAIFTFPQEKAMLSKERAA  1223
             +TA+ILG+LWWQS   TP  +QDQAGLLFFIAVFWGFFPVFTAIF FPQE+AML+KERAA
Sbjct  496   STAVILGLLWWQSDIRTPRGLQDQAGLLFFIAVFWGFFPVFTAIFAFPQERAMLNKERAA  555

Query  1222  DMYRLSAYFAARTTSdlpldlllpliflLVVYFMAGLKQDASSFLLTAVTVFLCIVVAQG  1043
             DMYRLSAYF ARTTSDLPLD +LP +FLLVVYFM GL+     F L+ +TVFLCI+ +QG
Sbjct  556   DMYRLSAYFLARTTSDLPLDFILPSLFLLVVYFMTGLRLSPYPFFLSMLTVFLCIIASQG  615

Query  1042  LGLAIGATLMDLKKATTLASVTVMTFMLAGGYFIKKVPGFIVWLRDLSFNYHTFKLLLKV  863
             LGLAIGA LMDLKKATTLASVTVMTFMLAGG+F+KKVP FI W+R LSFNYHT+KLLLKV
Sbjct  616   LGLAIGAILMDLKKATTLASVTVMTFMLAGGFFVKKVPVFISWIRYLSFNYHTYKLLLKV  675

Query  862   QYEHKTNSVNGVQIDSGIKEVGALAAMAVSYRLLAYISLRRMKL  731
             QY+    S+NG++ID+G+ EV AL AM   YRLLAY+SLR+MK+
Sbjct  676   QYKDFAQSINGMRIDNGLTEVVALVAMIFGYRLLAYLSLRQMKI  719



>ref|XP_010248083.1| PREDICTED: ABC transporter G family member 22 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010248090.1| PREDICTED: ABC transporter G family member 22 isoform X1 [Nelumbo 
nucifera]
Length=754

 Score =   879 bits (2270),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 513/760 (68%), Positives = 591/760 (78%), Gaps = 52/760 (7%)
 Frame = -2

Query  2878  MEQTNSTSLLRTKSDQLVEaiaaakgsarARLPRLSAEFAGSGVPESVRMLSRKPS--RR  2705
             M+ T +T L RTKSDQL+E +A    S       LS+E       E+   LSRK S  +R
Sbjct  1     MDSTTTTGLPRTKSDQLLEIMARKSPSRG-----LSSEVIAEAA-ETASSLSRKSSFGKR  54

Query  2704  LMpps----pggggsgGTNSTHIRKSRSAQMKLDLDElssgsvlsrassasl--GFSFTG  2543
             +   S     GGGG GG   THIRKSRSAQ+KLDLDE+SSG+ LSRASSASL   FSFTG
Sbjct  55    MTAASPGRSGGGGGGGGGGRTHIRKSRSAQLKLDLDEVSSGAALSRASSASLGLSFSFTG  114

Query  2542  FSVRPDESADSKPFSD--DENPEDLEAGTKKKRSIPAEPTFPIYLKFTEVSYKIVIKGVT  2369
             F+V P++ AD + FSD  DE PED+EAG   ++ +  E T PIYLKFT+V+YK+++K V 
Sbjct  115   FTVPPEDIADLRGFSDIDDEIPEDIEAGASTRKKVTMEHTLPIYLKFTDVTYKVILKSVR  174

Query  2368  FSEEKDILNGISGAVDPGEVLALMGPSGCGKTTLLSLLGGRIRDPS-AGSITYNQHPYSK  2192
              + EKDILNGI+G+  PGEVLALMGPSG GKTTLL+LLGGR+ + +  GSITYN+ PYSK
Sbjct  175   TTVEKDILNGITGSASPGEVLALMGPSGSGKTTLLNLLGGRLNESAPGGSITYNEKPYSK  234

Query  2191  LLKSRIGFVTQDDILFPHLTVKETLIYAARLRLPRTLTKEEKDKRAMDVIYELGLDRCQD  2012
              LK RIGFVTQDD+LFPHLTVKETL YAA LRLP+ LTK++K++RAMDVIYELGL+RCQD
Sbjct  235   SLKRRIGFVTQDDVLFPHLTVKETLTYAALLRLPKMLTKQQKEERAMDVIYELGLERCQD  294

Query  2011  TMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILHEIAKAG  1832
             TMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIV +LH+IA+AG
Sbjct  295   TMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVQMLHDIAEAG  354

Query  1831  KTVITTIHQPSSRLFHk--------------------------------fdklillefll  1748
             KTVITTIHQPSSRLFHK                                   +   EFLL
Sbjct  355   KTVITTIHQPSSRLFHKFDKLILLGKGSLLYFGKASEAMVYFSSIGCSPLIAMNPAEFLL  414

Query  1747  dLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYETRVAETEKKK  1568
             DLANGNINDVS+PSEL DKVQ  N + E TRN GKPSP +VHEYLV  YETRVAE EKKK
Sbjct  415   DLANGNINDVSVPSELEDKVQMGNLETE-TRN-GKPSPVVVHEYLVEAYETRVAE-EKKK  471

Query  1567  LMAPLPVEEELKSKVRYLKREWGASWSEQYVLLFHRGIRERWHDYFSWLRITQVIATALI  1388
             L   + ++EELKSKV   +REWGASW +QY +LF RG++ER HDY SWLRITQV+ATA I
Sbjct  472   LTVSISIDEELKSKVSSPRREWGASWWQQYSILFWRGLKERRHDYLSWLRITQVLATATI  531

Query  1387  LGMLWWQSGGDTPSQMQDQAGLLFFIAVFWGFFPVFTAIFTFPQEKAMLSKERAADMYRL  1208
             LG+LWW+S   T   MQDQAGLLFFIAVFWGFFPVFTAIFTFPQE+AMLSKERA DMYRL
Sbjct  532   LGLLWWRSDSKTMKGMQDQAGLLFFIAVFWGFFPVFTAIFTFPQERAMLSKERAVDMYRL  591

Query  1207  SAYFAARTTSdlpldlllpliflLVVYFMAGLKQDASSFLLTAVTVFLCIVVAQGLGLAI  1028
             SAYF ARTTSDLPLDL LP++FLLVVYFMAGL+     F L+ +TVFLCIV AQGLGLAI
Sbjct  592   SAYFIARTTSDLPLDLFLPILFLLVVYFMAGLRLSVGPFFLSMLTVFLCIVAAQGLGLAI  651

Query  1027  GATLMDLKKATTLASVTVMTFMLAGGYFIKKVPGFIVWLRDLSFNYHTFKLLLKVQYEHK  848
             GATLMD+K+ATTLASVTVMTFMLAGG+F+K+VP FI W+R +SFNYHT++LLLKVQYEH 
Sbjct  652   GATLMDVKRATTLASVTVMTFMLAGGFFVKRVPVFISWIRYISFNYHTYRLLLKVQYEHI  711

Query  847   TNSVNGVQIDSGIKEVGALAAMAVSYRLLAYISLRRMKLQ  728
             T  VNG+++D+G+ EVGAL  M   YRLLAY+SLRRMKLQ
Sbjct  712   TPVVNGMKLDNGLWEVGALVTMVFGYRLLAYLSLRRMKLQ  751



>emb|CDX98933.1| BnaC09g49020D [Brassica napus]
Length=755

 Score =   878 bits (2268),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 494/753 (66%), Positives = 583/753 (77%), Gaps = 50/753 (7%)
 Frame = -2

Query  2863  STSLLRTKSDQLVEaiaaakgsarARLPRLSAEFAGSGVPESV----RMLSRKPSRRLMp  2696
             ++ L RT+S+QL E +AAA  S       + A    +  P S+      LSRK SRRLM 
Sbjct  9     ASGLARTRSEQLYETLAAAIKSP---FGSMDANGVPATAPASISGGRETLSRKSSRRLMM  65

Query  2695  pspggggsgGTNSTHIRKSRSAQMKLDLDElssgsvlsrassasl--GFSFTGFSVRPDE  2522
              +  G   G    THIRKSRSAQ+KL+L+E+SSG+ LSRASSASL   FSFTGF++ P+E
Sbjct  66    SASPGRSGGA--GTHIRKSRSAQLKLELEEVSSGAALSRASSASLGLSFSFTGFAMPPEE  123

Query  2521  SADSKPFSDDEN-PEDLEAGTKKKRSIPAEPTFPIYLKFTEVSYKIVIKGVTFSE--EKD  2351
              +DSKPFSDDE  P+D EAG KK +   AEPT PI+LKF EV+YK+ I+ +      EK+
Sbjct  124   ISDSKPFSDDEMIPDDNEAGNKKPK-FQAEPTLPIFLKFKEVTYKVSIRKLMTPSPVEKE  182

Query  2350  ILNGISGAVDPGEVLALMGPSGCGKTTLLSLLGGRI-RDPSAGSITYNQHPYSKLLKSRI  2174
             IL+GI+G+V PGEVLALMGPSG GKTTLLSLLGGRI +  + GSITYN  PYSK LKS+I
Sbjct  183   ILSGINGSVSPGEVLALMGPSGSGKTTLLSLLGGRISQSATGGSITYNDKPYSKYLKSKI  242

Query  2173  GFVTQDDILFPHLTVKETLIYAARLRLPRTLTKEEKDKRAMDVIYELGLDRCQDTMIGGS  1994
             GFVTQDD+LFPHLTVKETL YAARLRLP+TLT+E+K++RA++VI ELGL+RCQDTMIGG+
Sbjct  243   GFVTQDDVLFPHLTVKETLTYAARLRLPKTLTREQKEQRAIEVIQELGLERCQDTMIGGA  302

Query  1993  FVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILHEIAKAGKTVITT  1814
             FVRGVSGGERKRV IGNEIIINPSLL LDEPTSGLDSTTALR + +LH+IA+AGKTVITT
Sbjct  303   FVRGVSGGERKRVSIGNEIIINPSLLLLDEPTSGLDSTTALRTIQMLHDIAEAGKTVITT  362

Query  1813  IHQPSSRLFHk--------------------------------fdklilleflldLANGN  1730
             IHQPSSRLFH+                                   +   EFLLDLANGN
Sbjct  363   IHQPSSRLFHRFDKLILLGRGNLLYFGKSSEALVYFSSIGCSPLITMNPAEFLLDLANGN  422

Query  1729  INDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYETRVAETEKKKLMAPLP  1550
             IND+S+PSEL D+VQ  NS  EP    GKPSPA VHEYLV  YETRVAE EKKKL  P+P
Sbjct  423   INDISVPSELEDRVQVGNSGREP--QTGKPSPAAVHEYLVEAYETRVAEQEKKKLSDPVP  480

Query  1549  VEEELKSKVRYLKREWGASWSEQYVLLFHRGIRERWHDYFSWLRITQVIATALILGMLWW  1370
             ++EE K+K+  LKR+WGASW EQY +LF RG++ER H+YFSWLR+TQV++TA+ILG+LWW
Sbjct  481   LDEEAKAKLLRLKRQWGASWWEQYCILFSRGLKERRHEYFSWLRVTQVLSTAVILGLLWW  540

Query  1369  QSGGDTPSQMQDQAGLLFFIAVFWGFFPVFTAIFTFPQEKAMLSKERAADMYRLSAYFAA  1190
             QS   TP  +QDQAGLLFFIAVFWGFFPVFTAIF FPQE+AML+KERAADMYRLSAYF A
Sbjct  541   QSDIRTPRGLQDQAGLLFFIAVFWGFFPVFTAIFAFPQERAMLNKERAADMYRLSAYFLA  600

Query  1189  RTTSdlpldlllpliflLVVYFMAGLKQDASSFLLTAVTVFLCIVVAQGLGLAIGATLMD  1010
             RTTSDLPLD +LP +FLLVVYFM GL+     F L+ +TVFLCI+ +QGLGLAIGA LMD
Sbjct  601   RTTSDLPLDFILPSLFLLVVYFMTGLRLSPYPFFLSMLTVFLCIIASQGLGLAIGAILMD  660

Query  1009  LKKATTLASVTVMTFMLAGGYFIKKVPGFIVWLRDLSFNYHTFKLLLKVQYEHKTNSVNG  830
             LKKATTLASVTVMTFMLAGG+F+KKVP FI W+R LSFNYHT+KLLLKVQY+    S+NG
Sbjct  661   LKKATTLASVTVMTFMLAGGFFVKKVPVFISWIRYLSFNYHTYKLLLKVQYKDFAQSING  720

Query  829   VQIDSGIKEVGALAAMAVSYRLLAYISLRRMKL  731
             ++ID+G+ EV AL AM   YRLLAY+SLR+MK+
Sbjct  721   MRIDNGLTEVVALVAMIFGYRLLAYLSLRQMKI  753



>emb|CDY14079.1| BnaC02g01960D [Brassica napus]
Length=752

 Score =   878 bits (2268),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 498/753 (66%), Positives = 578/753 (77%), Gaps = 53/753 (7%)
 Frame = -2

Query  2863  STSLLRTKSDQLVEaiaaakgsarARL-----PRLSAEFAGSGVPESVRMLSRKPSRRLM  2699
             ++ L RT+S+QL E +AAA  S    +     P  +    GSG       LSRK SRRL+
Sbjct  9     ASGLARTRSEQLYETVAAAIKSPHGSMDANGVPATTPTITGSGG----GTLSRKSSRRLV  64

Query  2698  ppspggggsgGTNSTHIRKSRSAQMKLDLDElssgsvlsrassasl--GFSFTGFSVRPD  2525
               +  G   G    THIRKSRSAQ+KL+LDE+SSG+ LSRASSASL   FSFTGF++ PD
Sbjct  65    MGASPGRSGGA--GTHIRKSRSAQLKLELDEVSSGAALSRASSASLGLSFSFTGFAMPPD  122

Query  2524  ESADSKPFSDDEN-PEDLEAGTKKKRSIPAEPTFPIYLKFTEVSYKIVIKGVTFSEEKDI  2348
             E +DS PFSDDE  PED E    KK    AEPT PI+LKF EV+YK+VIK +T S EK+I
Sbjct  123   EISDSNPFSDDEMIPEDNE---NKKPKFQAEPTLPIFLKFKEVTYKVVIKKLTSSAEKEI  179

Query  2347  LNGISGAVDPGEVLALMGPSGCGKTTLLSLLGGRIRDPS-AGSITYNQHPYSKLLKSRIG  2171
             L+GI+G+V PGEVLALMGPSG GKTTLLSLLGGRI   +  GSITYN  PYSK LKS+IG
Sbjct  180   LSGINGSVSPGEVLALMGPSGSGKTTLLSLLGGRISQSAIGGSITYNDKPYSKYLKSKIG  239

Query  2170  FVTQDDILFPHLTVKETLIYAARLRLPRTLTKEEKDKRAMDVIYELGLDRCQDTMIGGSF  1991
             FVTQDD+LFPHLTVKETL YAARLRLP+TLT+E+K++RA+ VI ELGL+RCQDTMIGG+F
Sbjct  240   FVTQDDVLFPHLTVKETLTYAARLRLPKTLTREQKEQRAIGVIQELGLERCQDTMIGGAF  299

Query  1990  VRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILHEIAKAGKTVITTI  1811
             VRGVSGGERKRV IGNEIIINPSLL LDEPTSGLDSTTALRI+ +LH+IA+AGKTVITTI
Sbjct  300   VRGVSGGERKRVSIGNEIIINPSLLLLDEPTSGLDSTTALRIIQMLHDIAEAGKTVITTI  359

Query  1810  HQPSSRLFHk--------------------------------fdklilleflldLANGNI  1727
             HQPSSRLFH+                                   +   EFLLDLANGNI
Sbjct  360   HQPSSRLFHRFDKLILLGRGNLLYFGKSSEALDYFSSIGCSPLIAMNPAEFLLDLANGNI  419

Query  1726  NDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYETRVAETEKKKLMAPLPV  1547
             ND+S+PSEL D+VQ  NS  EP    GKPSPA+VHEYLV  YETRV E EKKKL  P+P+
Sbjct  420   NDISVPSELEDRVQVGNSDREP--RTGKPSPAVVHEYLVEAYETRVTEQEKKKLTDPVPL  477

Query  1546  -EEELKSKVRYLKREWGASWSEQYVLLFHRGIRERWHDYFSWLRITQVIATALILGMLWW  1370
              EEE K+KV  LKR+WGASW EQY +LF RG++ER H+YFSWLR+TQV++TA+ILG+LWW
Sbjct  478   GEEEAKAKVLRLKRQWGASWWEQYCILFARGLKERRHEYFSWLRVTQVLSTAVILGLLWW  537

Query  1369  QSGGDTPSQMQDQAGLLFFIAVFWGFFPVFTAIFTFPQEKAMLSKERAADMYRLSAYFAA  1190
             +S   TP  +QDQAGLLFFIAVFWGFFPVFTAIF FPQE+AML+KERAADMYRLSAYF A
Sbjct  538   RSDIRTPRGLQDQAGLLFFIAVFWGFFPVFTAIFAFPQERAMLNKERAADMYRLSAYFLA  597

Query  1189  RTTSdlpldlllpliflLVVYFMAGLKQDASSFLLTAVTVFLCIVVAQGLGLAIGATLMD  1010
             RTTSDLPLD +LP +FLLVVYFM GL+     F L+ +TVFLCI+ AQGLGLAIGA LMD
Sbjct  598   RTTSDLPLDFILPSLFLLVVYFMTGLRLSPYPFFLSMLTVFLCIIAAQGLGLAIGAILMD  657

Query  1009  LKKATTLASVTVMTFMLAGGYFIKKVPGFIVWLRDLSFNYHTFKLLLKVQYEHKTNSVNG  830
             LKKATTLASVTVMTFMLAGG+F+K+VP FI W+R LSFNYHT+KLLLKVQY+    S+NG
Sbjct  658   LKKATTLASVTVMTFMLAGGFFVKEVPVFISWIRYLSFNYHTYKLLLKVQYQDFAQSING  717

Query  829   VQIDSGIKEVGALAAMAVSYRLLAYISLRRMKL  731
              +ID G+ EV AL  M   YRLLAY+SLR+MK+
Sbjct  718   TKIDDGLTEVVALVVMIFGYRLLAYLSLRQMKI  750



>ref|XP_011094211.1| PREDICTED: ABC transporter G family member 22-like isoform X1 
[Sesamum indicum]
Length=643

 Score =   873 bits (2255),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 451/619 (73%), Positives = 510/619 (82%), Gaps = 37/619 (6%)
 Frame = -2

Query  2482  EDLEAGTKKKRSIPAEPTFPIYLKFTEVSYKIVIKGVTFSEEKDILNGISGAVDPGEVLA  2303
             EDLEAG  KK+ +  EPT PIYLKFT+V+YK+V+KG+T + EKDILNGI+G+V PGEVLA
Sbjct  25    EDLEAGISKKK-LQTEPTLPIYLKFTDVTYKVVLKGMTSTVEKDILNGITGSVSPGEVLA  83

Query  2302  LMGPSGCGKTTLLSLLGGRIRDPS-AGSITYNQHPYSKLLKSRIGFVTQDDILFPHLTVK  2126
             LMGPSG GKTTLLSLLGGR+R+ +  GSITYN   YSK LKSRIGFVTQDD+LFPHLTVK
Sbjct  84    LMGPSGSGKTTLLSLLGGRVRESTYGGSITYNDQSYSKSLKSRIGFVTQDDVLFPHLTVK  143

Query  2125  ETLIYAARLRLPRTLTKEEKDKRAMDVIYELGLDRCQDTMIGGSFVRGVSGGERKRVCIG  1946
             ETL YAARLRLPRTLTKEEKD+RA D+IYELGL+RC+DTMIGGSFVRGVSGGERKRVCIG
Sbjct  144   ETLTYAARLRLPRTLTKEEKDQRASDIIYELGLERCRDTMIGGSFVRGVSGGERKRVCIG  203

Query  1945  NEIIINPSLLFLDEPTSGLDSTTALRIVDILHEIAKAGKTVITTIHQPSSRLF-------  1787
             NEII+NPSLLFLDEPTSGLDST ALRI++ LH IA+AGKTVITTIHQPSSRLF       
Sbjct  204   NEIIVNPSLLFLDEPTSGLDSTIALRILETLHGIAEAGKTVITTIHQPSSRLFLKFDKLI  263

Query  1786  -------------------------HkfdklilleflldLANGNINDVSIPSELADKVQT  1682
                                           +   EF+LDLANGN+ D+S+PSEL D+VQT
Sbjct  264   LLGKGSLLYFGKAAEAMVYFSSVGCSPLIAMNPAEFMLDLANGNVTDISVPSELEDRVQT  323

Query  1681  WNSKEEPTRNNGKPSPAIVHE-YLVGCYETRVAETEKKKLMAPLPVEEELKSKVRYLKRE  1505
              NS++E    NGK  PA+VHE YLV  YETRVAE EK+K+ +P+P++EE+KSKV   KRE
Sbjct  324   ENSEDEI--KNGKMDPAVVHEQYLVEAYETRVAENEKRKIRSPVPIDEEIKSKVCSAKRE  381

Query  1504  WGASWSEQYVLLFHRGIRERWHDYFSWLRITQVIATALILGMLWWQSGGDTPSQMQDQAG  1325
             WGASW EQY +LF RG++ER HDYFSWLRITQV+ATA ILG+LWWQSG D P ++QDQAG
Sbjct  382   WGASWLEQYSILFWRGLKERKHDYFSWLRITQVLATATILGLLWWQSGSDDPQKLQDQAG  441

Query  1324  LLFFIAVFWGFFPVFTAIFTFPQEKAMLSKERAADMYRLSAYFAARTTSdlpldlllpli  1145
             LLFFI+VFWGFFPVFTA+FTFPQE+AMLSKERA DMYRLSAYF ARTTSDLPLDL+LP++
Sbjct  442   LLFFISVFWGFFPVFTAVFTFPQERAMLSKERAVDMYRLSAYFVARTTSDLPLDLILPVL  501

Query  1144  flLVVYFMAGLKQDASSFLLTAVTVFLCIVVAQGLGLAIGATLMDLKKATTLASVTVMTF  965
             FLLVVYFMAGL+    SF LT VTVFLCI+ AQGLGLAIGATLMDLK+ATTLASVTVMTF
Sbjct  502   FLLVVYFMAGLRTTVGSFFLTVVTVFLCIIAAQGLGLAIGATLMDLKRATTLASVTVMTF  561

Query  964   MLAGGYFIKKVPGFIVWLRDLSFNYHTFKLLLKVQYEHKTNSVNGVQIDSGIKEVGALAA  785
             MLAGGYF+K VP FI WLR LSFNYHT+KLLLKVQYEH T+S+NGV ID G KEVG LA 
Sbjct  562   MLAGGYFVKDVPTFISWLRYLSFNYHTYKLLLKVQYEHITHSINGVSIDKGYKEVGVLAT  621

Query  784   MAVSYRLLAYISLRRMKLQ  728
             M V YRLLAY+SLRRMKL 
Sbjct  622   MVVGYRLLAYLSLRRMKLH  640



>ref|XP_006399125.1| hypothetical protein EUTSA_v10012760mg [Eutrema salsugineum]
 gb|ESQ40578.1| hypothetical protein EUTSA_v10012760mg [Eutrema salsugineum]
Length=755

 Score =   869 bits (2246),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 492/757 (65%), Positives = 578/757 (76%), Gaps = 58/757 (8%)
 Frame = -2

Query  2863  STSLLRTKSDQLVEaiaaakgsarARLPRLSAEFAGSGVPESV---------RMLSRKPS  2711
             ++ L RT+S+QL E +AAA      + P  S +   +GVP +            LSRK S
Sbjct  9     ASGLARTRSEQLYETVAAAI-----KSPHGSMD--ANGVPATAPASIGGGGGGTLSRKSS  61

Query  2710  RRLMppspggggsgGTNSTHIRKSRSAQMKLDLDElssgsvlsrassasl--GFSFTGFS  2537
             RRLM  +  G   G    THIRKSRSAQ+K +L+E+SSG+ LSRASSASL   FSFTGF+
Sbjct  62    RRLMMGASPGRSGGA--GTHIRKSRSAQLKFELEEVSSGAALSRASSASLGLSFSFTGFA  119

Query  2536  VRPDESADSKPFSDDEN-PEDLEAGTKKKRSIPAEPTFPIYLKFTEVSYKIVIKGVTF-S  2363
             + P+E +DSKPFSDDE  PED+EAG KKK    AEPT PI+LKF E++YK+ IK +T  S
Sbjct  120   MPPEEISDSKPFSDDEMIPEDIEAG-KKKPKFQAEPTLPIFLKFKEITYKVAIKKMTSKS  178

Query  2362  EEKDILNGISGAVDPGEVLALMGPSGCGKTTLLSLLGGRI-RDPSAGSITYNQHPYSKLL  2186
              EK+IL+GISG+VDPGEVLALMGPSG GKT+LLSLLGGRI R  + GS+TYN  PYSK L
Sbjct  179   GEKEILSGISGSVDPGEVLALMGPSGSGKTSLLSLLGGRISRSSTGGSVTYNDKPYSKYL  238

Query  2185  KSRIGFVTQDDILFPHLTVKETLIYAARLRLPRTLTKEEKDKRAMDVIYELGLDRCQDTM  2006
             KS+IGFVTQDD+LFPHLTVKETL YAARLRLP+TLT+E+K++RA +VI ELGL+RCQDTM
Sbjct  239   KSKIGFVTQDDVLFPHLTVKETLTYAARLRLPKTLTREQKEQRAFEVIQELGLERCQDTM  298

Query  2005  IGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILHEIAKAGKT  1826
             IGG+FVRGVSGGERKRV IGNEIIINPSLL LDEPTSGLDSTTALR + +L +IA+AGKT
Sbjct  299   IGGAFVRGVSGGERKRVSIGNEIIINPSLLLLDEPTSGLDSTTALRTIQMLLDIAEAGKT  358

Query  1825  VITTIHQPSSRLFHk--------------------------------fdklilleflldL  1742
             VITTIHQPSSRLFH+                                   +   EFLLDL
Sbjct  359   VITTIHQPSSRLFHRFDKLILLGKGNLLYFGKSSEALVYFSSIGCSPLIAMNPAEFLLDL  418

Query  1741  ANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYETRVAETEKKKLM  1562
             ANGN ND+S+PSEL D+VQ  NS  E     GKPSP  VHEYLV  YETRVAE  KKKL 
Sbjct  419   ANGNTNDISVPSELEDRVQVGNSGRE--NQTGKPSPVAVHEYLVEAYETRVAEQAKKKLT  476

Query  1561  APLPVEEELKSKVRYLKREWGASWSEQYVLLFHRGIRERWHDYFSWLRITQVIATALILG  1382
              P+P++EE K+K   LKR+WG SW EQY +LF RG++ER H+YFSWLR+TQV++TA+ILG
Sbjct  477   DPVPLDEEAKAKDFRLKRQWGTSWWEQYCILFSRGLKERRHEYFSWLRVTQVLSTAVILG  536

Query  1381  MLWWQSGGDTPSQMQDQAGLLFFIAVFWGFFPVFTAIFTFPQEKAMLSKERAADMYRLSA  1202
             +LWWQS   TP  +QDQAGLLFFIAVFWGFFPVFTAIF FPQE+AML+KERAADMYRLSA
Sbjct  537   LLWWQSDIRTPRGLQDQAGLLFFIAVFWGFFPVFTAIFAFPQERAMLNKERAADMYRLSA  596

Query  1201  YFAARTTSdlpldlllpliflLVVYFMAGLKQDASSFLLTAVTVFLCIVVAQGLGLAIGA  1022
             YF ARTTSDLPLD +LP +FLLVVYFM GL+     F L+ +TVFLCI+ AQGLGLAIGA
Sbjct  597   YFLARTTSDLPLDFILPTLFLLVVYFMTGLRLSPYPFFLSMLTVFLCIIAAQGLGLAIGA  656

Query  1021  TLMDLKKATTLASVTVMTFMLAGGYFIKKVPGFIVWLRDLSFNYHTFKLLLKVQYEHKTN  842
              LMDLKKATTLASVTVMTFMLAGG+F+KKVP FI W+R LSFNYHT+KLLLKVQY+    
Sbjct  657   ILMDLKKATTLASVTVMTFMLAGGFFVKKVPVFISWIRYLSFNYHTYKLLLKVQYQDFAQ  716

Query  841   SVNGVQIDSGIKEVGALAAMAVSYRLLAYISLRRMKL  731
             S+NG++ID+G+ EV AL  M   YR LAY+SLR+MK+
Sbjct  717   SINGMRIDNGLTEVVALVVMIFGYRFLAYLSLRQMKI  753



>emb|CDY04991.1| BnaAnng01730D [Brassica napus]
Length=718

 Score =   866 bits (2237),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 478/703 (68%), Positives = 553/703 (79%), Gaps = 44/703 (6%)
 Frame = -2

Query  2728  LSRKPSRRLMppspggggsgGTNSTHIRKSRSAQMKLDLDElssgsvlsrassasl--GF  2555
             LSRK SRRLM     G   G    THIRKSRSAQ+KL+LDE+SSG+ LSRASSASL   F
Sbjct  21    LSRKSSRRLMMGVSPGRSGGA--GTHIRKSRSAQLKLELDEVSSGAALSRASSASLGLSF  78

Query  2554  SFTGFSVRPDESADSKPFSDDEN-PEDLEAGTKKKRSIPAEPTFPIYLKFTEVSYKIVIK  2378
             SFTGF++ P+E +DS PFSDDE  PED E    KK    AEPT PI+LKF EV+YK+VIK
Sbjct  79    SFTGFAMPPEEISDSNPFSDDEMIPEDNE---NKKPKFQAEPTLPIFLKFKEVTYKVVIK  135

Query  2377  GVTFSEEKDILNGISGAVDPGEVLALMGPSGCGKTTLLSLLGGRIRDPS-AGSITYNQHP  2201
              +T S EK+IL+GI+G+V PGEVLALMGPSG GKTTLLSLLGGRI   +  GSITYN  P
Sbjct  136   KLTSSVEKEILSGINGSVSPGEVLALMGPSGSGKTTLLSLLGGRISQSAIGGSITYNDKP  195

Query  2200  YSKLLKSRIGFVTQDDILFPHLTVKETLIYAARLRLPRTLTKEEKDKRAMDVIYELGLDR  2021
             YSK LKS+IGFVTQDD+LFPHLTVKETL YAARLRLP+TLT+E+K++RA+ VI ELGL+R
Sbjct  196   YSKHLKSKIGFVTQDDVLFPHLTVKETLTYAARLRLPKTLTREQKEQRAIGVIQELGLER  255

Query  2020  CQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILHEIA  1841
             CQDTMIGG+FVRGVSGGERKRV IGNEIIINPSLL LDEPTSGLDSTTALR + +LH+IA
Sbjct  256   CQDTMIGGAFVRGVSGGERKRVSIGNEIIINPSLLLLDEPTSGLDSTTALRTIQMLHDIA  315

Query  1840  KAGKTVITTIHQPSSRLFHk--------------------------------fdklille  1757
             +AGKTVITTIHQPSSRLFH+                                   +   E
Sbjct  316   EAGKTVITTIHQPSSRLFHRFDKLILLGRGNLLYFGKSSEALDYFSSIGCSPLIAMNPAE  375

Query  1756  flldLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYETRVAETE  1577
             FLLDLANGNIND+S+PSEL D+VQ  NS  E    +GKPSPA+VHEYLV  YE RV E E
Sbjct  376   FLLDLANGNINDISVPSELEDRVQVGNSDRE--SRSGKPSPAVVHEYLVEAYEARVTEQE  433

Query  1576  KKKLMAPLPV-EEELKSKVRYLKREWGASWSEQYVLLFHRGIRERWHDYFSWLRITQVIA  1400
             KKKL  P+P+ EEE ++KV  L R+WGASW EQY +LF RG++ER H+YFSWLR+ QV++
Sbjct  434   KKKLTDPVPLGEEEARAKVLRLNRQWGASWWEQYCILFSRGLKERRHEYFSWLRVIQVLS  493

Query  1399  TALILGMLWWQSGGDTPSQMQDQAGLLFFIAVFWGFFPVFTAIFTFPQEKAMLSKERAAD  1220
             TA+ILG+LWWQS   TP  +QDQAGLLFFIAVFWGFFPVFTAIF FPQE+AML+KERAAD
Sbjct  494   TAVILGLLWWQSDIRTPGGLQDQAGLLFFIAVFWGFFPVFTAIFAFPQERAMLNKERAAD  553

Query  1219  MYRLSAYFAARTTSdlpldlllpliflLVVYFMAGLKQDASSFLLTAVTVFLCIVVAQGL  1040
             MYRLSAYF ARTTSDLPLD +LP +FLLVVYFM GL+     F L+ +TVFLCI+ AQGL
Sbjct  554   MYRLSAYFLARTTSDLPLDFILPSLFLLVVYFMTGLRLSPYPFFLSMLTVFLCIIAAQGL  613

Query  1039  GLAIGATLMDLKKATTLASVTVMTFMLAGGYFIKKVPGFIVWLRDLSFNYHTFKLLLKVQ  860
             GLAIGA LMDL+KATTLASVTVMTFMLAGG+F+KKVP FI W+R LSFNYHT+KLLLKVQ
Sbjct  614   GLAIGAILMDLQKATTLASVTVMTFMLAGGFFVKKVPVFISWIRYLSFNYHTYKLLLKVQ  673

Query  859   YEHKTNSVNGVQIDSGIKEVGALAAMAVSYRLLAYISLRRMKL  731
             Y+    S+NG++ID+G+ EV AL  M   YRLLAY+SLR+MK+
Sbjct  674   YQDFAQSINGMRIDNGLTEVVALVVMIFGYRLLAYLSLRQMKI  716



>ref|XP_009125649.1| PREDICTED: ABC transporter G family member 22-like [Brassica 
rapa]
Length=752

 Score =   865 bits (2235),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 492/753 (65%), Positives = 574/753 (76%), Gaps = 53/753 (7%)
 Frame = -2

Query  2863  STSLLRTKSDQLVEaiaaakgsarARL-----PRLSAEFAGSGVPESVRMLSRKPSRRLM  2699
             ++ L RT+S+QL E +AAA  S    +     P  +    GSG       LSRK SRRLM
Sbjct  9     ASGLARTRSEQLYETVAAAIKSPHGSMDANAVPATAPATTGSGG----GTLSRKSSRRLM  64

Query  2698  ppspggggsgGTNSTHIRKSRSAQMKLDLDElssgsvlsrassasl--GFSFTGFSVRPD  2525
                  G   G    THIRKSRSAQ+KL+LDE+SSG+ LSRASSASL   FSFTGF++ P+
Sbjct  65    MGVSPGRSGGA--GTHIRKSRSAQLKLELDEVSSGAALSRASSASLGLSFSFTGFAMPPE  122

Query  2524  ESADSKPFSDDEN-PEDLEAGTKKKRSIPAEPTFPIYLKFTEVSYKIVIKGVTFSEEKDI  2348
             E +DS PFSDDE  PED E    KK    AEPT PI+LKF EV+YK+VIK +T S EK+I
Sbjct  123   EISDSNPFSDDEMIPEDNE---NKKPKFQAEPTLPIFLKFKEVTYKVVIKKLTSSVEKEI  179

Query  2347  LNGISGAVDPGEVLALMGPSGCGKTTLLSLLGGRIRDPS-AGSITYNQHPYSKLLKSRIG  2171
             L+GI+G+V PGEVLALMGPSG GKTTLLSLLGGRI   +  GSITYN  PYSK LKS+IG
Sbjct  180   LSGINGSVSPGEVLALMGPSGSGKTTLLSLLGGRISQSAIGGSITYNDKPYSKHLKSKIG  239

Query  2170  FVTQDDILFPHLTVKETLIYAARLRLPRTLTKEEKDKRAMDVIYELGLDRCQDTMIGGSF  1991
             FVTQDD+LFPHLTVKETL YAARLRLP+TLT+E+K++RA+ VI ELGL+RCQDTMIGG+F
Sbjct  240   FVTQDDVLFPHLTVKETLTYAARLRLPKTLTREQKEQRAIGVIQELGLERCQDTMIGGAF  299

Query  1990  VRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILHEIAKAGKTVITTI  1811
             VRGVSGGE KRV IGNEIIINPSLL LDEPTSGLDSTTALR + +LH+IA+AGKTVITTI
Sbjct  300   VRGVSGGEGKRVSIGNEIIINPSLLLLDEPTSGLDSTTALRTIQMLHDIAEAGKTVITTI  359

Query  1810  HQPSSRLFHk--------------------------------fdklilleflldLANGNI  1727
             HQPSSRLFH+                                   +   EFLLDLANGNI
Sbjct  360   HQPSSRLFHRFDKLILLGRGNLLYFGKSSEALDYFSSIGCSPLIAMNPAEFLLDLANGNI  419

Query  1726  NDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYETRVAETEKKKLMAPLPV  1547
             ND+S+PSEL D+VQ  NS  E    +GKPSPA+VHEYLV  YE RV E EKKKL  P+P+
Sbjct  420   NDISVPSELEDRVQVGNSDRE--SRSGKPSPAVVHEYLVEAYEARVTEQEKKKLTDPVPL  477

Query  1546  -EEELKSKVRYLKREWGASWSEQYVLLFHRGIRERWHDYFSWLRITQVIATALILGMLWW  1370
              EEE ++KV  L R+WGASW EQY +LF RG++ER H+YFSWLR+ QV++TA+ILG+LWW
Sbjct  478   GEEEARAKVLRLNRQWGASWWEQYCILFSRGLKERRHEYFSWLRVIQVLSTAVILGLLWW  537

Query  1369  QSGGDTPSQMQDQAGLLFFIAVFWGFFPVFTAIFTFPQEKAMLSKERAADMYRLSAYFAA  1190
             QS   TP  +QDQAGLLFFIAVFWGFFPVFTAIF FPQE+AML+KERAADMYRLSAYF A
Sbjct  538   QSDIRTPGGLQDQAGLLFFIAVFWGFFPVFTAIFAFPQERAMLNKERAADMYRLSAYFLA  597

Query  1189  RTTSdlpldlllpliflLVVYFMAGLKQDASSFLLTAVTVFLCIVVAQGLGLAIGATLMD  1010
             RTTSDLPLD +LP +FLLVVYFM GL+     F L+ +TVFLCI+ AQGLGLAIGA LMD
Sbjct  598   RTTSDLPLDFILPSLFLLVVYFMTGLRLSPYPFFLSMLTVFLCIIAAQGLGLAIGAILMD  657

Query  1009  LKKATTLASVTVMTFMLAGGYFIKKVPGFIVWLRDLSFNYHTFKLLLKVQYEHKTNSVNG  830
             L+KATTLASVTVMTFMLAGG+F+KKVP FI W+R LSFNYHT+KLLLKVQY+    S+NG
Sbjct  658   LQKATTLASVTVMTFMLAGGFFVKKVPVFISWIRYLSFNYHTYKLLLKVQYQDFAQSING  717

Query  829   VQIDSGIKEVGALAAMAVSYRLLAYISLRRMKL  731
             ++ID+G+ EV AL  M   YRLLAY+SLR+MK+
Sbjct  718   MRIDNGLTEVVALVVMIFGYRLLAYLSLRQMKI  750



>ref|XP_008790027.1| PREDICTED: ABC transporter G family member 22 isoform X3 [Phoenix 
dactylifera]
Length=736

 Score =   864 bits (2233),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 466/677 (69%), Positives = 543/677 (80%), Gaps = 39/677 (6%)
 Frame = -2

Query  2653  HIRKSRSAQMKLDLDElssgsvlsrassasl--GFSFTGFSVRPDES-ADSKPFSDDENP  2483
             HIRKSRSAQ+KLDL+++SS + LSRASSASL   FSFTGF+  P++  AD +PFSDD+N 
Sbjct  59    HIRKSRSAQLKLDLEDVSSSAALSRASSASLGFSFSFTGFTAPPEDIIADVRPFSDDDNA  118

Query  2482  EDLEAGTKKKRSIPAEPTFPIYLKFTEVSYKIVIKGVTFSEEKDILNGISGAVDPGEVLA  2303
              D EAG ++KR I +EPT PIYLKFTEV YK+++KGVT S EK+ILN I+G+  PGEVLA
Sbjct  119   VDPEAGGRRKRLI-SEPTLPIYLKFTEVRYKVILKGVTTSTEKEILNSITGSASPGEVLA  177

Query  2302  LMGPSGCGKTTLLSLLGGRIRDPS-AGSITYNQHPYSKLLKSRIGFVTQDDILFPHLTVK  2126
             LMGPSG GKTTLLSLLGGRI   +  GSITYN  PY+K LK RIGFVTQDD+LF HLTV+
Sbjct  178   LMGPSGSGKTTLLSLLGGRISGNTIEGSITYNDEPYNKSLKRRIGFVTQDDVLFAHLTVR  237

Query  2125  ETLIYAARLRLPRTLTKEEKDKRAMDVIYELGLDRCQDTMIGGSFVRGVSGGERKRVCIG  1946
             ETL Y A LRLP+T+TK++K+ RAMDVIYELGL+RCQDTMIGGSFVRGVSGGERKRVCIG
Sbjct  238   ETLTYTALLRLPKTMTKQQKEGRAMDVIYELGLERCQDTMIGGSFVRGVSGGERKRVCIG  297

Query  1945  NEIIINPSLLFLDEPTSGLDSTTALRIVDILHEIAKAGKTVITTIHQPSSRLFHk-----  1781
             NEIIINPSLLFLDEPTSGLDSTTALR V +LH+IA+AGKTV+TTIHQPSSRLFHK     
Sbjct  298   NEIIINPSLLFLDEPTSGLDSTTALRTVQMLHDIAEAGKTVVTTIHQPSSRLFHKFDKLI  357

Query  1780  ---------------------------fdklilleflldLANGNINDVSIPSELADKVQT  1682
                                           +   EFLLDLANGNI+DVS+PSEL D+VQT
Sbjct  358   LLGKGSLLYFGKASEAMVYFSSIGCSPLIAMNPAEFLLDLANGNISDVSVPSELDDRVQT  417

Query  1681  WNSKEEPTRNNGKPSPAIVHEYLVGCYETRVAETEKKKLMAPLPVEEELKSKVRYLKREW  1502
              N   + TRN+ KPS   VHEYLV  YETRVA+ EKKKL+ PLP+ E+LK  +   KR+W
Sbjct  418   ENLGSD-TRND-KPSSKDVHEYLVEAYETRVADKEKKKLLQPLPISEDLKVTISSPKRDW  475

Query  1501  GASWSEQYVLLFHRGIRERWHDYFSWLRITQVIATALILGMLWWQSGGDTPSQMQDQAGL  1322
             GASW +QY +LF RG++ER HDY SW+RITQVIATA+ILG+LWW S   TP  +QDQAGL
Sbjct  476   GASWWQQYSILFRRGLKERRHDYLSWMRITQVIATAIILGLLWWHSDSTTPKGLQDQAGL  535

Query  1321  LFFIAVFWGFFPVFTAIFTFPQEKAMLSKERAADMYRLSAYFAARTTSdlpldlllplif  1142
             LFFIAVFWGFFPVFTAIFTFPQE+AML+KERA DMYRLSAYF ARTTSDLPLDL LP+IF
Sbjct  536   LFFIAVFWGFFPVFTAIFTFPQERAMLNKERAVDMYRLSAYFMARTTSDLPLDLFLPIIF  595

Query  1141  lLVVYFMAGLKQDASSFLLTAVTVFLCIVVAQGLGLAIGATLMDLKKATTLASVTVMTFM  962
             L++VYFMAGL+Q    F L+ +TVFL I+ AQGLGLAIGATLMD+KKATTLASVTVMTFM
Sbjct  596   LIIVYFMAGLRQSTEPFFLSMLTVFLSIIAAQGLGLAIGATLMDIKKATTLASVTVMTFM  655

Query  961   LAGGYFIKKVPGFIVWLRDLSFNYHTFKLLLKVQYEHKTNSVNGVQIDSGIKEVGALAAM  782
             LAGG+F+K+VP FI W+R +SFNYHT++LLLKVQY+H   S   + +D+G+KEVGA+ AM
Sbjct  656   LAGGFFVKRVPAFISWVRYISFNYHTYRLLLKVQYDHIPRSSYVINLDNGVKEVGAMIAM  715

Query  781   AVSYRLLAYISLRRMKL  731
                YRLLAYISLRRMK+
Sbjct  716   VFGYRLLAYISLRRMKI  732



>ref|XP_008790010.1| PREDICTED: ABC transporter G family member 22 isoform X1 [Phoenix 
dactylifera]
Length=744

 Score =   863 bits (2230),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 466/677 (69%), Positives = 543/677 (80%), Gaps = 39/677 (6%)
 Frame = -2

Query  2653  HIRKSRSAQMKLDLDElssgsvlsrassasl--GFSFTGFSVRPDES-ADSKPFSDDENP  2483
             HIRKSRSAQ+KLDL+++SS + LSRASSASL   FSFTGF+  P++  AD +PFSDD+N 
Sbjct  67    HIRKSRSAQLKLDLEDVSSSAALSRASSASLGFSFSFTGFTAPPEDIIADVRPFSDDDNA  126

Query  2482  EDLEAGTKKKRSIPAEPTFPIYLKFTEVSYKIVIKGVTFSEEKDILNGISGAVDPGEVLA  2303
              D EAG ++KR I +EPT PIYLKFTEV YK+++KGVT S EK+ILN I+G+  PGEVLA
Sbjct  127   VDPEAGGRRKRLI-SEPTLPIYLKFTEVRYKVILKGVTTSTEKEILNSITGSASPGEVLA  185

Query  2302  LMGPSGCGKTTLLSLLGGRIRDPS-AGSITYNQHPYSKLLKSRIGFVTQDDILFPHLTVK  2126
             LMGPSG GKTTLLSLLGGRI   +  GSITYN  PY+K LK RIGFVTQDD+LF HLTV+
Sbjct  186   LMGPSGSGKTTLLSLLGGRISGNTIEGSITYNDEPYNKSLKRRIGFVTQDDVLFAHLTVR  245

Query  2125  ETLIYAARLRLPRTLTKEEKDKRAMDVIYELGLDRCQDTMIGGSFVRGVSGGERKRVCIG  1946
             ETL Y A LRLP+T+TK++K+ RAMDVIYELGL+RCQDTMIGGSFVRGVSGGERKRVCIG
Sbjct  246   ETLTYTALLRLPKTMTKQQKEGRAMDVIYELGLERCQDTMIGGSFVRGVSGGERKRVCIG  305

Query  1945  NEIIINPSLLFLDEPTSGLDSTTALRIVDILHEIAKAGKTVITTIHQPSSRLFHk-----  1781
             NEIIINPSLLFLDEPTSGLDSTTALR V +LH+IA+AGKTV+TTIHQPSSRLFHK     
Sbjct  306   NEIIINPSLLFLDEPTSGLDSTTALRTVQMLHDIAEAGKTVVTTIHQPSSRLFHKFDKLI  365

Query  1780  ---------------------------fdklilleflldLANGNINDVSIPSELADKVQT  1682
                                           +   EFLLDLANGNI+DVS+PSEL D+VQT
Sbjct  366   LLGKGSLLYFGKASEAMVYFSSIGCSPLIAMNPAEFLLDLANGNISDVSVPSELDDRVQT  425

Query  1681  WNSKEEPTRNNGKPSPAIVHEYLVGCYETRVAETEKKKLMAPLPVEEELKSKVRYLKREW  1502
              N   + TRN+ KPS   VHEYLV  YETRVA+ EKKKL+ PLP+ E+LK  +   KR+W
Sbjct  426   ENLGSD-TRND-KPSSKDVHEYLVEAYETRVADKEKKKLLQPLPISEDLKVTISSPKRDW  483

Query  1501  GASWSEQYVLLFHRGIRERWHDYFSWLRITQVIATALILGMLWWQSGGDTPSQMQDQAGL  1322
             GASW +QY +LF RG++ER HDY SW+RITQVIATA+ILG+LWW S   TP  +QDQAGL
Sbjct  484   GASWWQQYSILFRRGLKERRHDYLSWMRITQVIATAIILGLLWWHSDSTTPKGLQDQAGL  543

Query  1321  LFFIAVFWGFFPVFTAIFTFPQEKAMLSKERAADMYRLSAYFAARTTSdlpldlllplif  1142
             LFFIAVFWGFFPVFTAIFTFPQE+AML+KERA DMYRLSAYF ARTTSDLPLDL LP+IF
Sbjct  544   LFFIAVFWGFFPVFTAIFTFPQERAMLNKERAVDMYRLSAYFMARTTSDLPLDLFLPIIF  603

Query  1141  lLVVYFMAGLKQDASSFLLTAVTVFLCIVVAQGLGLAIGATLMDLKKATTLASVTVMTFM  962
             L++VYFMAGL+Q    F L+ +TVFL I+ AQGLGLAIGATLMD+KKATTLASVTVMTFM
Sbjct  604   LIIVYFMAGLRQSTEPFFLSMLTVFLSIIAAQGLGLAIGATLMDIKKATTLASVTVMTFM  663

Query  961   LAGGYFIKKVPGFIVWLRDLSFNYHTFKLLLKVQYEHKTNSVNGVQIDSGIKEVGALAAM  782
             LAGG+F+K+VP FI W+R +SFNYHT++LLLKVQY+H   S   + +D+G+KEVGA+ AM
Sbjct  664   LAGGFFVKRVPAFISWVRYISFNYHTYRLLLKVQYDHIPRSSYVINLDNGVKEVGAMIAM  723

Query  781   AVSYRLLAYISLRRMKL  731
                YRLLAYISLRRMK+
Sbjct  724   VFGYRLLAYISLRRMKI  740



>ref|XP_010519981.1| PREDICTED: LOW QUALITY PROTEIN: ABC transporter G family member 
22 [Tarenaya hassleriana]
Length=743

 Score =   862 bits (2228),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 490/749 (65%), Positives = 573/749 (77%), Gaps = 54/749 (7%)
 Frame = -2

Query  2860  TSLLRTKSDQLVEaiaaakgsarARLPRLSAEFAGSGVPESVRMLSRKPSRRLMppspgg  2681
             + L RT+S+QL+E++AAA  S+      + A    +  P     LSRK SRRLM  +   
Sbjct  10    SGLARTRSEQLLESLAAAFKSSSHG--SMDANGLTTAAPPG-GTLSRKSSRRLMMGTAAS  66

Query  2680  ggsgGTNSTHIRKSRSAQMKLDLDElssgsvlsrassasl--GFSFTGFSVRPDESADSK  2507
                  +  + I+K RS Q+K+++DE+SSG+ LSRASSASL   FSFTGFS+ P+E +DSK
Sbjct  67    SP---SGGSSIKKGRSGQLKMEVDEVSSGAALSRASSASLGLSFSFTGFSMPPEEISDSK  123

Query  2506  PFSDDEN---PEDLEAGTKKKRSIPAEPTFPIYLKFTEVSYKIVIKGVTFSEEKDILNGI  2336
             PFSDD++   PED   G K+ R   AEPT PIYLKFT+V+YK+VIKG+T SEEK+ILNGI
Sbjct  124   PFSDDDDEMIPEDDGGGNKQPR-FQAEPTLPIYLKFTDVAYKVVIKGITSSEEKEILNGI  182

Query  2335  SGAVDPGEVLALMGPSGCGKTTLLSLLGGRIRDPS-AGSITYNQHPYSKLLKSRIGFVTQ  2159
             SG VDPGEVLALMGPSG GKTTLLSLL GR+  PS  GS+TYN  PYSK LKS+IGFVTQ
Sbjct  183   SGNVDPGEVLALMGPSGSGKTTLLSLLSGRLPQPSVGGSVTYNDKPYSKFLKSKIGFVTQ  242

Query  2158  DDILFPHLTVKETLIYAARLRLPRTLTKEEKDKRAMDVIYELGLDRCQDTMIGGSFVRGV  1979
             DD+LFPHLTVKETL Y ARLRL ++LT+E+K+KRA+DVI ELGL+RCQDTMIGGSFVRGV
Sbjct  243   DDVLFPHLTVKETLTYXARLRLSKSLTREQKEKRALDVIQELGLERCQDTMIGGSFVRGV  302

Query  1978  SGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILHEIAKAGKTVITTIHQPS  1799
             SGGERKRV IGNEIIINPSLLFLDEPTSGLDSTTALRI+ +LH+IA+AGKTVITTIHQPS
Sbjct  303   SGGERKRVSIGNEIIINPSLLFLDEPTSGLDSTTALRIIQMLHDIAEAGKTVITTIHQPS  362

Query  1798  SRLFHk--------------------------------fdklilleflldLANGNINDVS  1715
             SRLFH+                                   +   EFLLDLANGNIND+S
Sbjct  363   SRLFHRFDKLILLGRGSLLYFGKATEVMVYFSSIGCSPLISMNPAEFLLDLANGNINDIS  422

Query  1714  IPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYETRVAETEKKKLMAPLPVEEEL  1535
             +PSEL D+VQ  NS  +    N KPSPA+VHEYLV  YETRV E EKKKL  P+ ++EEL
Sbjct  423   VPSELEDRVQVGNSGRD--IQNSKPSPALVHEYLVEAYETRVTEQEKKKLTEPVQLDEEL  480

Query  1534  KSKVRYLKREWGASWSEQYVLLFHRGIRERWHDYFSWLRITQVIATALILGMLWWQSGGD  1355
             K+K+   KR +   W E      H    ER HDYFSWLRITQVI+TA+ILG+LWWQS   
Sbjct  481   KAKIACPKRTFSIIWYEH----VHG---ERRHDYFSWLRITQVISTAVILGLLWWQSDSR  533

Query  1354  TPSQMQDQAGLLFFIAVFWGFFPVFTAIFTFPQEKAMLSKERAADMYRLSAYFAARTTSd  1175
             TP  +QDQAGLLFFIAVFWGFFPVFTAIFTFPQE+AMLSKERAADMYRLSAYF ARTTSD
Sbjct  534   TPRGLQDQAGLLFFIAVFWGFFPVFTAIFTFPQERAMLSKERAADMYRLSAYFLARTTSD  593

Query  1174  lpldlllpliflLVVYFMAGLKQDASSFLLTAVTVFLCIVVAQGLGLAIGATLMDLKKAT  995
             LPLD++LP++FLLVVYFMAGL+     F  + +TVFLCI+ AQGLGLAIGATLMDLKKAT
Sbjct  594   LPLDMILPVLFLLVVYFMAGLRLSPGPFFFSMLTVFLCIIAAQGLGLAIGATLMDLKKAT  653

Query  994   TLASVTVMTFMLAGGYFIKKVPGFIVWLRDLSFNYHTFKLLLKVQYEHKTNSVNGVQIDS  815
             TLASVTVMTFMLAGG+F+KKVP FI W+R +SFNYHT+KLLLKVQY+    S+NGV+ID+
Sbjct  654   TLASVTVMTFMLAGGFFVKKVPVFISWIRYISFNYHTYKLLLKVQYQDLAGSINGVRIDN  713

Query  814   GIKEVGALAAMAVSYRLLAYISLRRMKLQ  728
             GI EV AL AM   YR LAY+SLRRMK++
Sbjct  714   GITEVAALVAMIFGYRFLAYVSLRRMKIR  742



>ref|XP_011042541.1| PREDICTED: ABC transporter G family member 22 isoform X2 [Populus 
euphratica]
Length=693

 Score =   860 bits (2222),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 479/683 (70%), Positives = 548/683 (80%), Gaps = 46/683 (7%)
 Frame = -2

Query  2878  MEQTNSTSLLRTKSDQLVEaiaaakgsarARLPRLSAEFAGSGVPESVRMLSRKPSRRLM  2699
             ME+ N TSL RT+S+QLVE +AAA  S         ++ +  G       LSRK S+RLM
Sbjct  1     MEKEN-TSLARTRSEQLVETVAAAFKSPSNNEANAVSDASSGGT------LSRKSSKRLM  53

Query  2698  ppspggggsgGTN-STHIRKSRSAQMKLDLDElssgsvlsrassasl--GFSFTGFSVRP  2528
               +  G  + G N +THIRKSRSAQMK DLD++SSG+ LSRASSASL   FSFTGF++ P
Sbjct  54    MAASPGRSTSGGNKNTHIRKSRSAQMKFDLDDVSSGAALSRASSASLGFSFSFTGFNMPP  113

Query  2527  DESADSKPFSDDENPEDLEAGTKKKRSIPAEPTFPIYLKFTEVSYKIVIKGVTFSEEKDI  2348
             DE ADSKPFSDD+ PEDLEAGT+K +    EPT PIYLKFT+V+YK++IKG+T +EEKDI
Sbjct  114   DEIADSKPFSDDDIPEDLEAGTRKPK-FQTEPTLPIYLKFTDVTYKVIIKGMTSTEEKDI  172

Query  2347  LNGISGAVDPGEVLALMGPSGCGKTTLLSLLGGRIRDPS-AGSITYNQHPYSKLLKSRIG  2171
             LNGISG+VDPGEVLALMGPSG GKTTLL+L+GGR+   +  G++TYN  PYSK LKSRIG
Sbjct  173   LNGISGSVDPGEVLALMGPSGSGKTTLLNLIGGRLNQTTVGGALTYNDQPYSKFLKSRIG  232

Query  2170  FVTQDDILFPHLTVKETLIYAARLRLPRTLTKEEKDKRAMDVIYELGLDRCQDTMIGGSF  1991
             FVTQDD+LFPHLTVKETL YAA LRLP+TLT+E+K KRA+DVIYELGL+RCQDTMIGGSF
Sbjct  233   FVTQDDVLFPHLTVKETLTYAALLRLPKTLTEEQKQKRAIDVIYELGLERCQDTMIGGSF  292

Query  1990  VRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILHEIAKAGKTVITTI  1811
             VRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIV +L +IA+ GKTV+TTI
Sbjct  293   VRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVQLLQDIAEGGKTVVTTI  352

Query  1810  HQPSSRLFHk--------------------------------fdklilleflldLANGNI  1727
             HQPSSRLFHK                                   +   EFLLDLANGNI
Sbjct  353   HQPSSRLFHKFDKLILLGKGSLLYFGKASEAMLYFSSIGCNPLIAMNPAEFLLDLANGNI  412

Query  1726  NDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYETRVAETEKKKLMAPLPV  1547
             NDVS+PSEL DKVQ WNS  E    NGKPSPA+VHEYLV  YETR A+ EKKKLM P+P+
Sbjct  413   NDVSVPSELEDKVQIWNSDAE--MRNGKPSPAVVHEYLVEAYETRAADKEKKKLMVPIPL  470

Query  1546  EEELKSKVRYLKREWGASWSEQYVLLFHRGIRERWHDYFSWLRITQVIATALILGMLWWQ  1367
             +EE+KSKV   KR+WGASW EQY +LF RGI+ER HDYFSWLRITQV++TA+ILG+LWW+
Sbjct  471   DEEVKSKVSSRKRQWGASWWEQYTILFCRGIKERRHDYFSWLRITQVLSTAIILGLLWWK  530

Query  1366  SGGDTPSQMQDQAGLLFFIAVFWGFFPVFTAIFTFPQEKAMLSKERAADMYRLSAYFAAR  1187
             S   +P  +QDQAGLLFFIAVFWGFFPVFTAIFTFPQE+AMLSKERAADMYRLSAYF AR
Sbjct  531   SDSSSPKGLQDQAGLLFFIAVFWGFFPVFTAIFTFPQERAMLSKERAADMYRLSAYFLAR  590

Query  1186  TTSdlpldlllpliflLVVYFMAGLKQDASSFLLTAVTVFLCIVVAQGLGLAIGATLMDL  1007
             TTSDLPLDL+LP++FLLVVYFMAGL+  A+ F LT +TVFLCIV AQGLGLAIGATLMDL
Sbjct  591   TTSDLPLDLILPVLFLLVVYFMAGLRLSAAPFFLTVLTVFLCIVAAQGLGLAIGATLMDL  650

Query  1006  KKATTLASVTVMTFMLAGGYFIK  938
             K+ATTLASVTVMTFMLAGGYF+K
Sbjct  651   KRATTLASVTVMTFMLAGGYFVK  673



>ref|XP_008790019.1| PREDICTED: ABC transporter G family member 22 isoform X2 [Phoenix 
dactylifera]
Length=743

 Score =   858 bits (2218),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 466/677 (69%), Positives = 543/677 (80%), Gaps = 40/677 (6%)
 Frame = -2

Query  2653  HIRKSRSAQMKLDLDElssgsvlsrassasl--GFSFTGFSVRPDES-ADSKPFSDDENP  2483
             HIRKSRSAQ+KLDL+++SS + LSRASSASL   FSFTGF+  P++  AD +PFSDD+N 
Sbjct  67    HIRKSRSAQLKLDLEDVSSSAALSRASSASLGFSFSFTGFTAPPEDIIADVRPFSDDDN-  125

Query  2482  EDLEAGTKKKRSIPAEPTFPIYLKFTEVSYKIVIKGVTFSEEKDILNGISGAVDPGEVLA  2303
              D EAG ++KR I +EPT PIYLKFTEV YK+++KGVT S EK+ILN I+G+  PGEVLA
Sbjct  126   VDPEAGGRRKRLI-SEPTLPIYLKFTEVRYKVILKGVTTSTEKEILNSITGSASPGEVLA  184

Query  2302  LMGPSGCGKTTLLSLLGGRIRDPS-AGSITYNQHPYSKLLKSRIGFVTQDDILFPHLTVK  2126
             LMGPSG GKTTLLSLLGGRI   +  GSITYN  PY+K LK RIGFVTQDD+LF HLTV+
Sbjct  185   LMGPSGSGKTTLLSLLGGRISGNTIEGSITYNDEPYNKSLKRRIGFVTQDDVLFAHLTVR  244

Query  2125  ETLIYAARLRLPRTLTKEEKDKRAMDVIYELGLDRCQDTMIGGSFVRGVSGGERKRVCIG  1946
             ETL Y A LRLP+T+TK++K+ RAMDVIYELGL+RCQDTMIGGSFVRGVSGGERKRVCIG
Sbjct  245   ETLTYTALLRLPKTMTKQQKEGRAMDVIYELGLERCQDTMIGGSFVRGVSGGERKRVCIG  304

Query  1945  NEIIINPSLLFLDEPTSGLDSTTALRIVDILHEIAKAGKTVITTIHQPSSRLFHk-----  1781
             NEIIINPSLLFLDEPTSGLDSTTALR V +LH+IA+AGKTV+TTIHQPSSRLFHK     
Sbjct  305   NEIIINPSLLFLDEPTSGLDSTTALRTVQMLHDIAEAGKTVVTTIHQPSSRLFHKFDKLI  364

Query  1780  ---------------------------fdklilleflldLANGNINDVSIPSELADKVQT  1682
                                           +   EFLLDLANGNI+DVS+PSEL D+VQT
Sbjct  365   LLGKGSLLYFGKASEAMVYFSSIGCSPLIAMNPAEFLLDLANGNISDVSVPSELDDRVQT  424

Query  1681  WNSKEEPTRNNGKPSPAIVHEYLVGCYETRVAETEKKKLMAPLPVEEELKSKVRYLKREW  1502
              N   + TRN+ KPS   VHEYLV  YETRVA+ EKKKL+ PLP+ E+LK  +   KR+W
Sbjct  425   ENLGSD-TRND-KPSSKDVHEYLVEAYETRVADKEKKKLLQPLPISEDLKVTISSPKRDW  482

Query  1501  GASWSEQYVLLFHRGIRERWHDYFSWLRITQVIATALILGMLWWQSGGDTPSQMQDQAGL  1322
             GASW +QY +LF RG++ER HDY SW+RITQVIATA+ILG+LWW S   TP  +QDQAGL
Sbjct  483   GASWWQQYSILFRRGLKERRHDYLSWMRITQVIATAIILGLLWWHSDSTTPKGLQDQAGL  542

Query  1321  LFFIAVFWGFFPVFTAIFTFPQEKAMLSKERAADMYRLSAYFAARTTSdlpldlllplif  1142
             LFFIAVFWGFFPVFTAIFTFPQE+AML+KERA DMYRLSAYF ARTTSDLPLDL LP+IF
Sbjct  543   LFFIAVFWGFFPVFTAIFTFPQERAMLNKERAVDMYRLSAYFMARTTSDLPLDLFLPIIF  602

Query  1141  lLVVYFMAGLKQDASSFLLTAVTVFLCIVVAQGLGLAIGATLMDLKKATTLASVTVMTFM  962
             L++VYFMAGL+Q    F L+ +TVFL I+ AQGLGLAIGATLMD+KKATTLASVTVMTFM
Sbjct  603   LIIVYFMAGLRQSTEPFFLSMLTVFLSIIAAQGLGLAIGATLMDIKKATTLASVTVMTFM  662

Query  961   LAGGYFIKKVPGFIVWLRDLSFNYHTFKLLLKVQYEHKTNSVNGVQIDSGIKEVGALAAM  782
             LAGG+F+K+VP FI W+R +SFNYHT++LLLKVQY+H   S   + +D+G+KEVGA+ AM
Sbjct  663   LAGGFFVKRVPAFISWVRYISFNYHTYRLLLKVQYDHIPRSSYVINLDNGVKEVGAMIAM  722

Query  781   AVSYRLLAYISLRRMKL  731
                YRLLAYISLRRMK+
Sbjct  723   VFGYRLLAYISLRRMKI  739



>ref|XP_010917903.1| PREDICTED: ABC transporter G family member 22 isoform X1 [Elaeis 
guineensis]
Length=744

 Score =   858 bits (2216),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 463/677 (68%), Positives = 540/677 (80%), Gaps = 39/677 (6%)
 Frame = -2

Query  2653  HIRKSRSAQMKLDLDElssgsvlsrassasl--GFSFTGFSVRPDE-SADSKPFSDDENP  2483
             HIRKSRSAQ+KLDL+++SSG+ LSRASSASL   FSFTGF+  P++  AD +PFSDD+N 
Sbjct  67    HIRKSRSAQLKLDLEDVSSGAALSRASSASLGFSFSFTGFTAPPEDIVADLRPFSDDDNA  126

Query  2482  EDLEAGTKKKRSIPAEPTFPIYLKFTEVSYKIVIKGVTFSEEKDILNGISGAVDPGEVLA  2303
              D EAG  +KR I +EPT PIYLKFTEV YK+++KGVT S EKDIL+GI+G+  PGEVLA
Sbjct  127   IDPEAGGTQKRLI-SEPTLPIYLKFTEVRYKVILKGVTTSTEKDILHGITGSASPGEVLA  185

Query  2302  LMGPSGCGKTTLLSLLGGRIR-DPSAGSITYNQHPYSKLLKSRIGFVTQDDILFPHLTVK  2126
             LMGPSG GKTTLLSLLGGRI  +   GSITYN   Y+K LK RIGFVTQDD+LF HLTV+
Sbjct  186   LMGPSGSGKTTLLSLLGGRISGNILEGSITYNDEQYNKSLKRRIGFVTQDDVLFAHLTVR  245

Query  2125  ETLIYAARLRLPRTLTKEEKDKRAMDVIYELGLDRCQDTMIGGSFVRGVSGGERKRVCIG  1946
             ETL Y A LRLP+T+T+++K++RAMDVIYELGL+RCQDTMIGGSFVRGVSGGERKRVCIG
Sbjct  246   ETLTYTALLRLPKTMTRQQKEERAMDVIYELGLERCQDTMIGGSFVRGVSGGERKRVCIG  305

Query  1945  NEIIINPSLLFLDEPTSGLDSTTALRIVDILHEIAKAGKTVITTIHQPSSRLFHk-----  1781
             NEIIINPSLLFLDEPTSGLDSTTALR + +LH+IA+AGKTV+TTIHQPSSRLFHK     
Sbjct  306   NEIIINPSLLFLDEPTSGLDSTTALRTIQMLHDIAEAGKTVVTTIHQPSSRLFHKFDKLI  365

Query  1780  ---------------------------fdklilleflldLANGNINDVSIPSELADKVQT  1682
                                           +   EFLLDLANGNI+DVS+PSEL D+VQ 
Sbjct  366   LLGRGSLLYFGKASEALVYFSSVGCSPLIAMNPAEFLLDLANGNISDVSVPSELDDRVQM  425

Query  1681  WNSKEEPTRNNGKPSPAIVHEYLVGCYETRVAETEKKKLMAPLPVEEELKSKVRYLKREW  1502
              N    P   N KPSP  VHEYLV  YETRVA+ EKKKL+ PLP+ E+LK+ +   KR+W
Sbjct  426   ENLGSHP--RNDKPSPKDVHEYLVEAYETRVADKEKKKLLQPLPISEDLKATIASPKRDW  483

Query  1501  GASWSEQYVLLFHRGIRERWHDYFSWLRITQVIATALILGMLWWQSGGDTPSQMQDQAGL  1322
             GASW +Q+ +LF RG++ER HDY SW+RITQVIATA+ILG+LWW S G T    QDQAGL
Sbjct  484   GASWWQQFSILFWRGLKERRHDYLSWMRITQVIATAIILGLLWWHSDGTTSKGQQDQAGL  543

Query  1321  LFFIAVFWGFFPVFTAIFTFPQEKAMLSKERAADMYRLSAYFAARTTSdlpldlllplif  1142
             LFFIAVFWGFFPVFTAIFTFPQE+AML+KERA DMYRLSAYF ARTTSDLPLDL LP+IF
Sbjct  544   LFFIAVFWGFFPVFTAIFTFPQERAMLNKERAVDMYRLSAYFMARTTSDLPLDLFLPIIF  603

Query  1141  lLVVYFMAGLKQDASSFLLTAVTVFLCIVVAQGLGLAIGATLMDLKKATTLASVTVMTFM  962
             L++VYFMAGL+Q    F L+ + VFL I+ AQGLGLAIGATLMD+KKATTLASVTVMTFM
Sbjct  604   LIIVYFMAGLRQSIEPFFLSMLIVFLSIIAAQGLGLAIGATLMDIKKATTLASVTVMTFM  663

Query  961   LAGGYFIKKVPGFIVWLRDLSFNYHTFKLLLKVQYEHKTNSVNGVQIDSGIKEVGALAAM  782
             LAGG+F+ +VP FI W+R +SFNYHT++LLLKVQY+H  +S+N   ID+G KEVGA+ AM
Sbjct  664   LAGGFFVARVPAFISWVRYISFNYHTYRLLLKVQYDHTPSSLNVTDIDNGTKEVGAMVAM  723

Query  781   AVSYRLLAYISLRRMKL  731
                YRLLAYISLRRMK+
Sbjct  724   VFGYRLLAYISLRRMKI  740



>gb|KDO70704.1| hypothetical protein CISIN_1g0045372mg, partial [Citrus sinensis]
 gb|KDO70705.1| hypothetical protein CISIN_1g0045372mg, partial [Citrus sinensis]
Length=619

 Score =   851 bits (2199),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 432/618 (70%), Positives = 509/618 (82%), Gaps = 35/618 (6%)
 Frame = -2

Query  2482  EDLEAGTKKKRSIPAEPTFPIYLKFTEVSYKIVIKGVTFSEEKDILNGISGAVDPGEVLA  2303
             ED+EAGT+++     EPT PIYLKFT+V+YK+++KG+T SEEKDILNGI+G+V+PGEVLA
Sbjct  1     EDIEAGTRERPKFQTEPTLPIYLKFTDVTYKVILKGMTSSEEKDILNGITGSVNPGEVLA  60

Query  2302  LMGPSGCGKTTLLSLLGGRIRDPS-AGSITYNQHPYSKLLKSRIGFVTQDDILFPHLTVK  2126
             LMGPSG GKTTLL+LL GR+ +P+  GSITYN HPYSK LKS+IGFVTQDD+LFPHLTVK
Sbjct  61    LMGPSGSGKTTLLNLLSGRLMEPTVGGSITYNDHPYSKSLKSKIGFVTQDDVLFPHLTVK  120

Query  2125  ETLIYAARLRLPRTLTKEEKDKRAMDVIYELGLDRCQDTMIGGSFVRGVSGGERKRVCIG  1946
             ETL YAA LRLP TLTK++K+KRA+DVI ELGL+RCQDTMIGGSFVRGVSGGERKRVCIG
Sbjct  121   ETLTYAALLRLPNTLTKQQKEKRAIDVINELGLERCQDTMIGGSFVRGVSGGERKRVCIG  180

Query  1945  NEIIINPSLLFLDEPTSGLDSTTALRIVDILHEIAKAGKTVITTIHQPSSRLFHk-----  1781
             NEIIINPSLLFLDEPTSGLDSTTALRIV +L +IA+AGKTV+TTIHQPSSRLFHK     
Sbjct  181   NEIIINPSLLFLDEPTSGLDSTTALRIVQMLQDIAEAGKTVVTTIHQPSSRLFHKFDKLI  240

Query  1780  ---------------------------fdklilleflldLANGNINDVSIPSELADKVQT  1682
                                           +   EFLLDLANGN++DVS+PSEL D+VQT
Sbjct  241   LLGKGSLLYFGKASEAMAYFSSIGCSPQIAMNPAEFLLDLANGNLHDVSVPSELQDRVQT  300

Query  1681  WNSKEEPTRNNGKPSPAIVHEYLVGCYETRVAETEKKKLMAPLPVEEELKSKVRYLKREW  1502
              NS+ +    NGKP+PAIVHEYLV  YETRVAE EKKKLMAP+P++EE+K+KV   KR W
Sbjct  301   ENSENDTA--NGKPTPAIVHEYLVEAYETRVAENEKKKLMAPIPLDEEIKAKVSSPKRNW  358

Query  1501  GASWSEQYVLLFHRGIRERWHDYFSWLRITQVIATALILGMLWWQSGGDTPSQMQDQAGL  1322
             GASW +QY +LF RGI+E  HDYFSWLRITQV+ATA+ILG+LWWQS   +P  ++DQAGL
Sbjct  359   GASWIQQYTILFRRGIKEHRHDYFSWLRITQVLATAVILGLLWWQSDSKSPKGLEDQAGL  418

Query  1321  LFFIAVFWGFFPVFTAIFTFPQEKAMLSKERAADMYRLSAYFAARTTSdlpldlllplif  1142
             LFFIAVFW FFP+FTAIFTFPQE+AMLSKERAADMYRLSAYF ARTTSDLPL+L+LP++F
Sbjct  419   LFFIAVFWSFFPIFTAIFTFPQERAMLSKERAADMYRLSAYFLARTTSDLPLNLVLPVLF  478

Query  1141  lLVVYFMAGLKQDASSFLLTAVTVFLCIVVAQGLGLAIGATLMDLKKATTLASVTVMTFM  962
             L++VYFMAGL+  A  F L+ +TVFL IV AQGLGLAIGA LMDLKKATTLASVT+MTFM
Sbjct  479   LVIVYFMAGLRMGAGPFFLSMLTVFLSIVAAQGLGLAIGAILMDLKKATTLASVTIMTFM  538

Query  961   LAGGYFIKKVPGFIVWLRDLSFNYHTFKLLLKVQYEHKTNSVNGVQIDSGIKEVGALAAM  782
             LAGGYF+++VP FI W+R +SFN+HT+K+LLK+QY   +  VNG++ DSG +EV AL AM
Sbjct  539   LAGGYFVQEVPVFISWIRYMSFNFHTYKILLKIQYADISPIVNGMRTDSGFREVCALVAM  598

Query  781   AVSYRLLAYISLRRMKLQ  728
                YRLLAY+SLR+MKL 
Sbjct  599   VFGYRLLAYLSLRKMKLH  616



>gb|KHG09828.1| ABC transporter G family member 22 [Gossypium arboreum]
Length=609

 Score =   850 bits (2195),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 438/603 (73%), Positives = 499/603 (83%), Gaps = 35/603 (6%)
 Frame = -2

Query  2437  EPTFPIYLKFTEVSYKIVIKGVTFSEEKDILNGISGAVDPGEVLALMGPSGCGKTTLLSL  2258
             EPT PIYLKFT+V+YK++IKG+T  EE+DILNGI+GAV+PGEVLALMGPSG GKTTLL+L
Sbjct  6     EPTLPIYLKFTDVTYKVIIKGMTSCEERDILNGITGAVNPGEVLALMGPSGSGKTTLLNL  65

Query  2257  LGGR-IRDPSAGSITYNQHPYSKLLKSRIGFVTQDDILFPHLTVKETLIYAARLRLPRTL  2081
             LGGR I+    GSITYN  PYSK LKSRIGFVTQDD+LFPHLTVKETL+YAARLRLP+ L
Sbjct  66    LGGRLIQSTVGGSITYNDQPYSKFLKSRIGFVTQDDVLFPHLTVKETLMYAARLRLPKVL  125

Query  2080  TKEEKDKRAMDVIYELGLDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEP  1901
             T+++K+KRA+DVIYELGL+RCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEP
Sbjct  126   TRQQKEKRAVDVIYELGLERCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEP  185

Query  1900  TSGLDSTTALRIVDILHEIAKAGKTVITTIHQPSSRLFHk--------------------  1781
             TSGLDSTTALR +  L +IA+ GKTVITTIHQPSSRLFHK                    
Sbjct  186   TSGLDSTTALRTIQTLQDIAEVGKTVITTIHQPSSRLFHKFDKLILLGKGSLLYFGKASE  245

Query  1780  ------------fdklilleflldLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPS  1637
                            +   EFLLDLANGN+ D+S+PSEL DKVQ  NS+ E    NGKP 
Sbjct  246   AIVYFSSIGCSPLIAMNPAEFLLDLANGNLTDISVPSELEDKVQMENSETE--TGNGKPP  303

Query  1636  PAIVHEYLVGCYETRVAETEKKKLMAPLPVEEELKSKVRYLKREWGASWSEQYVLLFHRG  1457
             PA+VHEYLV  YE+RVA+TEKKKLMAPLP+++ELKSKV   KR+WGASW +QY +LF RG
Sbjct  304   PAVVHEYLVEAYESRVADTEKKKLMAPLPLDDELKSKVSSSKRQWGASWWQQYCILFCRG  363

Query  1456  IRERWHDYFSWLRITQVIATALILGMLWWQSGGDTPSQMQDQAGLLFFIAVFWGFFPVFT  1277
             I+ER HDYFSWLRITQV++TA+ILG+LWWQS   T    QDQAGLLFFIAVFWGFFPVFT
Sbjct  364   IKERKHDYFSWLRITQVLSTAIILGLLWWQSDSKTIRGRQDQAGLLFFIAVFWGFFPVFT  423

Query  1276  AIFTFPQEKAMLSKERAADMYRLSAYFAARTTSdlpldlllpliflLVVYFMAGLKQDAS  1097
             AIFTFPQE+AML KERAADMYRLSAYF ARTTSDLPLDL+LP++FLLVVYFMAGL+  AS
Sbjct  424   AIFTFPQERAMLGKERAADMYRLSAYFLARTTSDLPLDLILPVLFLLVVYFMAGLRLSAS  483

Query  1096  SFLLTAVTVFLCIVVAQGLGLAIGATLMDLKKATTLASVTVMTFMLAGGYFIKKVPGFIV  917
              F L+ +TVFLCIV AQGLGLAIGATLMDLK+ATTLASVTVMTFMLAGGYF+KKVP FI 
Sbjct  484   HFFLSMLTVFLCIVAAQGLGLAIGATLMDLKRATTLASVTVMTFMLAGGYFVKKVPVFIS  543

Query  916   WLRDLSFNYHTFKLLLKVQYEHKTNSVNGVQIDSGIKEVGALAAMAVSYRLLAYISLRRM  737
             W+R +SFNYHT+KLLLKVQY+    +VNG++ DSG+KEVGAL AM   YR LAY+SLR+M
Sbjct  544   WIRYMSFNYHTYKLLLKVQYQDIMPTVNGIKTDSGLKEVGALVAMIFGYRFLAYLSLRKM  603

Query  736   KLQ  728
             +L 
Sbjct  604   QLH  606



>gb|AIU41652.1| ABC transporter family protein [Hevea brasiliensis]
Length=738

 Score =   850 bits (2196),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 479/689 (70%), Positives = 548/689 (80%), Gaps = 59/689 (9%)
 Frame = -2

Query  2878  MEQTNSTSLLRTKSDQLVEaiaaakgsarARLPRLSAEF-------AGSGVPESVRMLSR  2720
             ME+T+++SL+RTKSDQLVE               ++A+F        G GV E    LSR
Sbjct  1     MEKTSASSLVRTKSDQLVET--------------VAADFKSPPTNEVGGGVLEGSGTLSR  46

Query  2719  KPSRRLMppspggggsgGTNSTHIRKSRSAQMKLDLDElssgsvlsrassasl--GFSFT  2546
             K S+R +  +  G   GG  +THIRKS SAQMK DLD++SSG+ LSRASSASL   FSFT
Sbjct  47    KSSKRQIMAASPGRSGGGGKNTHIRKSWSAQMKFDLDDVSSGAALSRASSASLGLSFSFT  106

Query  2545  GFSVRPDESADSKPFSDDENPEDLEAGTKKKRSIPAEPTFPIYLKFTEVSYKIVIKGVTF  2366
             GF+V PDE ADSK FSDD+ PEDLEAGT+K +    EPT PI+LKFT+V+YK++IKG+T 
Sbjct  107   GFTVPPDEIADSKSFSDDDIPEDLEAGTRKPK-FQTEPTLPIFLKFTDVTYKLIIKGMTS  165

Query  2365  SEEKDILNGISGAVDPGEVLALMGPSGCGKTTLLSLLGGRIRDPS-AGSITYNQHPYSKL  2189
             +EEK ILNGI+G+V+PG+VLALMGPSG GKTTLL+LLGGR+  P   GSITYN  PYSK 
Sbjct  166   TEEKYILNGITGSVNPGQVLALMGPSGSGKTTLLNLLGGRLIQPGVGGSITYNDQPYSKF  225

Query  2188  LKSRIGFVTQDDILFPHLTVKETLIYAARLRLPRTLTKEEKDKRAMDVIYELGLDRCQDT  2009
             LKSRIGFVTQDD+LFPHLTVKETL YAA LRLP+TLTKE+K+KRA+DVIYELGL+RCQDT
Sbjct  226   LKSRIGFVTQDDVLFPHLTVKETLTYAALLRLPKTLTKEQKEKRAIDVIYELGLERCQDT  285

Query  2008  MIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILHEIAKAGK  1829
             MIGGSFVRGVSGGERKRVCIGNEIIINPS+LFLDEPTSGLDSTTALRIV +L +IA+AGK
Sbjct  286   MIGGSFVRGVSGGERKRVCIGNEIIINPSVLFLDEPTSGLDSTTALRIVQMLQDIAEAGK  345

Query  1828  TVITTIHQPSSRLFHk--------------------------------fdklilleflld  1745
             TVITTIHQPSSRLFHK                                   +   EFLL+
Sbjct  346   TVITTIHQPSSRLFHKFDKLILLGKGSLLYFGKASEAMPYFSSVGCNPLIAMNPAEFLLE  405

Query  1744  LANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYETRVAETEKKKL  1565
             LANGNINDVS+PSEL D+VQ  NS  E TR NGKPSPA+VH+YLV  YETRVAE EKKKL
Sbjct  406   LANGNINDVSVPSELEDRVQMENSDNE-TR-NGKPSPAVVHDYLVEAYETRVAENEKKKL  463

Query  1564  MAPLPVEEELKSKVRYLKREWGASWSEQYVLLFHRGIRERWHDYFSWLRITQVIATALIL  1385
             M P+P++EE+K KV   KR+WGASW EQY LLF RGI+ER HDYFSWLRITQV++TA+IL
Sbjct  464   MVPIPLDEEVKLKVSSPKRQWGASWWEQYTLLFCRGIKERRHDYFSWLRITQVLSTAIIL  523

Query  1384  GMLWWQSGGDTPSQMQDQAGLLFFIAVFWGFFPVFTAIFTFPQEKAMLSKERAADMYRLS  1205
             G+LWWQS   +P  +QDQAGLLFFIAVFWGFFPVFTAIFTFPQE+AML+KERAADMYRLS
Sbjct  524   GLLWWQSESSSPKGLQDQAGLLFFIAVFWGFFPVFTAIFTFPQERAMLNKERAADMYRLS  583

Query  1204  AYFAARTTSdlpldlllpliflLVVYFMAGLKQDASSFLLTAVTVFLCIVVAQGLGLAIG  1025
             AYF ARTTSDLPLDLLLP++FL+VVYFMAGL+  A  F L+ +TVFLCIV AQGLGLAIG
Sbjct  584   AYFLARTTSDLPLDLLLPVLFLVVVYFMAGLRMSAGPFFLSLLTVFLCIVAAQGLGLAIG  643

Query  1024  ATLMDLKKATTLASVTVMTFMLAGGYFIK  938
             ATLMDLKKATTLASVTVMTFMLAGGYF+K
Sbjct  644   ATLMDLKKATTLASVTVMTFMLAGGYFVK  672



>ref|XP_011094212.1| PREDICTED: ABC transporter G family member 22-like isoform X2 
[Sesamum indicum]
Length=600

 Score =   843 bits (2178),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 435/595 (73%), Positives = 492/595 (83%), Gaps = 36/595 (6%)
 Frame = -2

Query  2410  FTEVSYKIVIKGVTFSEEKDILNGISGAVDPGEVLALMGPSGCGKTTLLSLLGGRIRDPS  2231
             FT+V+YK+V+KG+T + EKDILNGI+G+V PGEVLALMGPSG GKTTLLSLLGGR+R+ +
Sbjct  5     FTDVTYKVVLKGMTSTVEKDILNGITGSVSPGEVLALMGPSGSGKTTLLSLLGGRVREST  64

Query  2230  -AGSITYNQHPYSKLLKSRIGFVTQDDILFPHLTVKETLIYAARLRLPRTLTKEEKDKRA  2054
               GSITYN   YSK LKSRIGFVTQDD+LFPHLTVKETL YAARLRLPRTLTKEEKD+RA
Sbjct  65    YGGSITYNDQSYSKSLKSRIGFVTQDDVLFPHLTVKETLTYAARLRLPRTLTKEEKDQRA  124

Query  2053  MDVIYELGLDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTA  1874
              D+IYELGL+RC+DTMIGGSFVRGVSGGERKRVCIGNEII+NPSLLFLDEPTSGLDST A
Sbjct  125   SDIIYELGLERCRDTMIGGSFVRGVSGGERKRVCIGNEIIVNPSLLFLDEPTSGLDSTIA  184

Query  1873  LRIVDILHEIAKAGKTVITTIHQPSSRLF-------------------------------  1787
             LRI++ LH IA+AGKTVITTIHQPSSRLF                               
Sbjct  185   LRILETLHGIAEAGKTVITTIHQPSSRLFLKFDKLILLGKGSLLYFGKAAEAMVYFSSVG  244

Query  1786  -HkfdklilleflldLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHE-YL  1613
                   +   EF+LDLANGN+ D+S+PSEL D+VQT NS++E    NGK  PA+VHE YL
Sbjct  245   CSPLIAMNPAEFMLDLANGNVTDISVPSELEDRVQTENSEDEI--KNGKMDPAVVHEQYL  302

Query  1612  VGCYETRVAETEKKKLMAPLPVEEELKSKVRYLKREWGASWSEQYVLLFHRGIRERWHDY  1433
             V  YETRVAE EK+K+ +P+P++EE+KSKV   KREWGASW EQY +LF RG++ER HDY
Sbjct  303   VEAYETRVAENEKRKIRSPVPIDEEIKSKVCSAKREWGASWLEQYSILFWRGLKERKHDY  362

Query  1432  FSWLRITQVIATALILGMLWWQSGGDTPSQMQDQAGLLFFIAVFWGFFPVFTAIFTFPQE  1253
             FSWLRITQV+ATA ILG+LWWQSG D P ++QDQAGLLFFI+VFWGFFPVFTA+FTFPQE
Sbjct  363   FSWLRITQVLATATILGLLWWQSGSDDPQKLQDQAGLLFFISVFWGFFPVFTAVFTFPQE  422

Query  1252  KAMLSKERAADMYRLSAYFAARTTSdlpldlllpliflLVVYFMAGLKQDASSFLLTAVT  1073
             +AMLSKERA DMYRLSAYF ARTTSDLPLDL+LP++FLLVVYFMAGL+    SF LT VT
Sbjct  423   RAMLSKERAVDMYRLSAYFVARTTSDLPLDLILPVLFLLVVYFMAGLRTTVGSFFLTVVT  482

Query  1072  VFLCIVVAQGLGLAIGATLMDLKKATTLASVTVMTFMLAGGYFIKKVPGFIVWLRDLSFN  893
             VFLCI+ AQGLGLAIGATLMDLK+ATTLASVTVMTFMLAGGYF+K VP FI WLR LSFN
Sbjct  483   VFLCIIAAQGLGLAIGATLMDLKRATTLASVTVMTFMLAGGYFVKDVPTFISWLRYLSFN  542

Query  892   YHTFKLLLKVQYEHKTNSVNGVQIDSGIKEVGALAAMAVSYRLLAYISLRRMKLQ  728
             YHT+KLLLKVQYEH T+S+NGV ID G KEVG LA M V YRLLAY+SLRRMKL 
Sbjct  543   YHTYKLLLKVQYEHITHSINGVSIDKGYKEVGVLATMVVGYRLLAYLSLRRMKLH  597



>ref|XP_006588894.1| PREDICTED: ABC transporter G family member 22-like isoform X2 
[Glycine max]
Length=705

 Score =   845 bits (2183),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 481/710 (68%), Positives = 553/710 (78%), Gaps = 58/710 (8%)
 Frame = -2

Query  2953  SHGVTVFFHAFHELARFSCTVNQFQMEQTNSTSLLRTKSDQLVEaiaaakgsarARLPRL  2774
             S G+   F         SC +    ME+ N TSL+RTKSDQL+E++ A   S        
Sbjct  16    SFGLIFHFRIIPSTKNNSCILEWVTMEKAN-TSLVRTKSDQLLESMVAGLKSPP------  68

Query  2773  SAEFAGSGVPESVRMLSRKPSRRLMppspggggsgGTNSTHIRKSRSAQ---MKLDLDEl  2603
             S++ + +GV +S     RK SR L     G     G  +THIRKSRSAQ   MKL+LD++
Sbjct  69    SSDHSANGVVDS-----RKSSRWL----TGASPGRGGKNTHIRKSRSAQISQMKLELDDV  119

Query  2602  ssgsvlsrassasl--GFSFTGFSVRPDESADSKPFSDDENPEDLEAGTKKKRSIPAEPT  2429
             SSG+ LSRASSASL   FSFTGF++ P+E ADSKPFSDD+ PED+EAG + K     EPT
Sbjct  120   SSGAALSRASSASLGLSFSFTGFTMPPEEIADSKPFSDDDIPEDIEAGPRTK--FQTEPT  177

Query  2428  FPIYLKFTEVSYKIVIKGVTFSEEKDILNGISGAVDPGEVLALMGPSGCGKTTLLSLLGG  2249
              PIYLKFT+V+YKIVIKG+T +EEKDILNGI+G+V+PGEVLALMGPSG GKTTLL+LLGG
Sbjct  178   LPIYLKFTDVTYKIVIKGMTTTEEKDILNGITGSVNPGEVLALMGPSGSGKTTLLNLLGG  237

Query  2248  RIRDP-SAGSITYNQHPYSKLLKSRIGFVTQDDILFPHLTVKETLIYAARLRLPRTLTKE  2072
             R+  P S GSITYN  PYSK LKSRIGFVTQDD+LFPHLTVKETL YAARLRLP+  TKE
Sbjct  238   RLSHPISGGSITYNDQPYSKFLKSRIGFVTQDDVLFPHLTVKETLTYAARLRLPKAYTKE  297

Query  2071  EKDKRAMDVIYELGLDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSG  1892
             +K+KRA+DVIYELGL+RCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSG
Sbjct  298   QKEKRALDVIYELGLERCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSG  357

Query  1891  LDSTTALRIVDILHEIAKAGKTVITTIHQPSSRLFHk-----------------------  1781
             LDSTTALRIV +L +IA+AGKTV+TTIHQPSSRLFHK                       
Sbjct  358   LDSTTALRIVQMLQDIAEAGKTVVTTIHQPSSRLFHKFDKLILLGKGSLLYFGKASETMT  417

Query  1780  ---------fdklilleflldLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAI  1628
                         +   EFLLDLANGNINDVS+PSEL DKVQ  N++ E    NGKPSPA+
Sbjct  418   YFQSIGCSPLISMNPAEFLLDLANGNINDVSLPSELEDKVQMGNAEAE--TQNGKPSPAV  475

Query  1627  VHEYLVGCYETRVAETEKKKLMAPLPVEEELKSKVRYLKREWGASWSEQYVLLFHRGIRE  1448
             VHEYLV  YETRVAETEKK+LM P+P++E LK+KV   KR+WGASW EQ+ +LF RGI+E
Sbjct  476   VHEYLVEAYETRVAETEKKRLMVPIPLDEALKTKVCSHKRQWGASWDEQFSILFWRGIKE  535

Query  1447  RWHDYFSWLRITQVIATALILGMLWWQSGGDTPSQMQDQAGLLFFIAVFWGFFPVFTAIF  1268
             R HDYFSWLRITQV++TA+ILG+LWWQS    P  +QDQAGLLFFIAVFWGFFPVFTAIF
Sbjct  536   RRHDYFSWLRITQVLSTAVILGLLWWQSDTKNPKDLQDQAGLLFFIAVFWGFFPVFTAIF  595

Query  1267  TFPQEKAMLSKERAADMYRLSAYFAARTTSdlpldlllpliflLVVYFMAGLKQDASSFL  1088
             TFPQE+AMLSKERAADMYRLSAYF ARTTSDLPLDL+LP++FLLVVYFMAGL+   + F 
Sbjct  596   TFPQERAMLSKERAADMYRLSAYFLARTTSDLPLDLILPVLFLLVVYFMAGLRLSVAPFF  655

Query  1087  LTAVTVFLCIVVAQGLGLAIGATLMDLKKATTLASVTVMTFMLAGGYFIK  938
             LT +TVFLCIV AQGLGLAIGATLMDLK+ATTLASVTVMTFMLAGG+F++
Sbjct  656   LTVLTVFLCIVAAQGLGLAIGATLMDLKRATTLASVTVMTFMLAGGFFVQ  705



>ref|XP_009412321.1| PREDICTED: ABC transporter G family member 22-like isoform X1 
[Musa acuminata subsp. malaccensis]
Length=744

 Score =   838 bits (2166),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 456/678 (67%), Positives = 536/678 (79%), Gaps = 39/678 (6%)
 Frame = -2

Query  2653  HIRKSRSAQMKLDLDElssgsvlsrassasl--GFSFTGFSVRPDES-ADSKPFSDDENP  2483
             H RKSRS Q+KLDL+++SSG+ LSRASSASL   FSFTGF+  P++  AD + FSDD+N 
Sbjct  67    HSRKSRSGQLKLDLEDVSSGAALSRASSASLGFSFSFTGFTAPPEDIIADLRSFSDDDNG  126

Query  2482  EDLEAGTKKKRSIPAEPTFPIYLKFTEVSYKIVIKGVTFSEEKDILNGISGAVDPGEVLA  2303
             +D EAG  KK+ I +EPT PIY+KFTEV YK+++KGVT + EKDILNGI+G+  PGE+LA
Sbjct  127   KDPEAGHMKKKII-SEPTVPIYIKFTEVRYKVILKGVTTTTEKDILNGITGSASPGELLA  185

Query  2302  LMGPSGCGKTTLLSLLGGRIR-DPSAGSITYNQHPYSKLLKSRIGFVTQDDILFPHLTVK  2126
             LMGPSG GKTTLLSLLGGRIR +   G+ITYN  PY+K LK RIGFVTQDD+LF HLTV+
Sbjct  186   LMGPSGSGKTTLLSLLGGRIRGNLVEGTITYNDEPYTKSLKRRIGFVTQDDVLFAHLTVR  245

Query  2125  ETLIYAARLRLPRTLTKEEKDKRAMDVIYELGLDRCQDTMIGGSFVRGVSGGERKRVCIG  1946
             ETL YAA LRLP  +++++K++RAMDVIYELGL+RCQDTMIGGSFVRGVSGGERKRV IG
Sbjct  246   ETLTYAALLRLPNKMSRQQKEERAMDVIYELGLERCQDTMIGGSFVRGVSGGERKRVSIG  305

Query  1945  NEIIINPSLLFLDEPTSGLDSTTALRIVDILHEIAKAGKTVITTIHQPSSRLFHk-----  1781
             NEIIINPSLL LDEPTSGLDSTTALRI+ +L +IA+AG+TV+TTIHQPSSRLFH+     
Sbjct  306   NEIIINPSLLLLDEPTSGLDSTTALRIMQVLRDIAEAGRTVLTTIHQPSSRLFHRFDKLI  365

Query  1780  ---------------------------fdklilleflldLANGNINDVSIPSELADKVQT  1682
                                           +   EFLLDLANGN ND+SIPSEL DKVQ 
Sbjct  366   LLGKGSLLYFGKASEALVYFSSIGCSPLIAMNPAEFLLDLANGNTNDISIPSELEDKVQI  425

Query  1681  WNSKEEPTRNNGKPSPAIVHEYLVGCYETRVAETEKKKLMAPLPVEEELKSKVRYLKREW  1502
              N   +  RN+ KPSP  VHEYLV  YETRVA  EKKKLMAPLP+ E+LK  V   +R+W
Sbjct  426   ENLGSD-IRND-KPSPKDVHEYLVEAYETRVAVKEKKKLMAPLPISEDLKVTVSSPRRDW  483

Query  1501  GASWSEQYVLLFHRGIRERWHDYFSWLRITQVIATALILGMLWWQSGGDTPSQMQDQAGL  1322
             GASW +QY +LF RG++ER HDY SW+RITQVIATA+ILG+LWW S   TP  +QDQAGL
Sbjct  484   GASWLQQYSILFWRGLKERRHDYLSWMRITQVIATAVILGLLWWHSDSTTPKGLQDQAGL  543

Query  1321  LFFIAVFWGFFPVFTAIFTFPQEKAMLSKERAADMYRLSAYFAARTTSdlpldlllplif  1142
             LFFIAVFWGFFPVFTAIFTFPQE+AML+KERA DMYRLSAYF ARTTSDLPLDL LP+IF
Sbjct  544   LFFIAVFWGFFPVFTAIFTFPQERAMLNKERAVDMYRLSAYFMARTTSDLPLDLFLPIIF  603

Query  1141  lLVVYFMAGLKQDASSFLLTAVTVFLCIVVAQGLGLAIGATLMDLKKATTLASVTVMTFM  962
             LL+VYFMA L+Q   +F LT + VFL IV AQGLGLAIGA+LMD+KKATTLASVTVMTFM
Sbjct  604   LLIVYFMAALRQSVEAFFLTMLIVFLSIVAAQGLGLAIGASLMDVKKATTLASVTVMTFM  663

Query  961   LAGGYFIKKVPGFIVWLRDLSFNYHTFKLLLKVQYEHKTNSVNGVQIDSGIKEVGALAAM  782
             LAGG+F+K+VP FI W+R +SFNYHT++LLLKVQY+    S+N   +++G+ EVGA+ AM
Sbjct  664   LAGGFFVKRVPVFISWVRYMSFNYHTYRLLLKVQYDQAPLSLNVTHLNNGVIEVGAMIAM  723

Query  781   AVSYRLLAYISLRRMKLQ  728
                YRLLAYISLRRM L 
Sbjct  724   VFGYRLLAYISLRRMNLH  741



>ref|XP_004161297.1| PREDICTED: ABC transporter G family member 22-like [Cucumis sativus]
Length=620

 Score =   832 bits (2149),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 434/618 (70%), Positives = 504/618 (82%), Gaps = 36/618 (6%)
 Frame = -2

Query  2482  EDLEAGTKKKRSIPAEPTFPIYLKFTEVSYKIVIKGVTFSEEKDILNGISGAVDPGEVLA  2303
             ED+EAGT K R    EPT PI+LKF +V+YK++IKG+  + EK+ILNGI+G V+PGEVLA
Sbjct  3     EDVEAGTCKTR-FQTEPTMPIHLKFKDVTYKVIIKGLRTNVEKEILNGITGLVNPGEVLA  61

Query  2302  LMGPSGCGKTTLLSLLGGRI-RDPSAGSITYNQHPYSKLLKSRIGFVTQDDILFPHLTVK  2126
             LMGPSG GKTTLL+LLGGRI R  + GS+TYN  PY+K LKSRIGFV Q+D+LFPHLTVK
Sbjct  62    LMGPSGSGKTTLLNLLGGRIIRSTAGGSVTYNDQPYNKFLKSRIGFVMQEDVLFPHLTVK  121

Query  2125  ETLIYAARLRLPRTLTKEEKDKRAMDVIYELGLDRCQDTMIGGSFVRGVSGGERKRVCIG  1946
             E L YAA LRLP TLTKE+K+KRA+DVIYELGL+RCQDTMIGGSFVRGVSGGER+RV IG
Sbjct  122   EALRYAALLRLPNTLTKEQKEKRAIDVIYELGLERCQDTMIGGSFVRGVSGGERRRVSIG  181

Query  1945  NEIIINPSLLFLDEPTSGLDSTTALRIVDILHEIAKAGKTVITTIHQPSSRLFHk-----  1781
             NEIIINPSLLFLDEPTSGLDSTTALRIV ILHEIA+AGKTV+TTIHQPSSRLFHK     
Sbjct  182   NEIIINPSLLFLDEPTSGLDSTTALRIVQILHEIAEAGKTVVTTIHQPSSRLFHKFDKLI  241

Query  1780  ---------------------------fdklilleflldLANGNINDVSIPSELADKVQT  1682
                                           +   EFLLDLANGN++DVS+PSEL DKVQ 
Sbjct  242   LLGKGSLIYYGKAAEAMNYFASIGCSPLIAMNPAEFLLDLANGNLSDVSVPSELEDKVQM  301

Query  1681  WNSKEEPTRNNGKPSPAIVHEYLVGCYETRVAETEKKKLMAPLPVEEELKSKVRYLKREW  1502
              NS+ +  ++  +PSP +V EYLV  YETRVAE EK+K++ PL ++EELKSKV   +R+W
Sbjct  302   ENSEADSRQD--RPSPILVQEYLVEAYETRVAEKEKRKMLTPLTLDEELKSKVSNSRRQW  359

Query  1501  GASWSEQYVLLFHRGIRERWHDYFSWLRITQVIATALILGMLWWQSGGDTPSQMQDQAGL  1322
             GASW EQY +LF RGI+ER H+YFSWLRITQV+ATA+ILG+LWWQS   +P  +QDQAGL
Sbjct  360   GASWWEQYSILFRRGIKERRHEYFSWLRITQVLATAVILGLLWWQSESKSPKGLQDQAGL  419

Query  1321  LFFIAVFWGFFPVFTAIFTFPQEKAMLSKERAADMYRLSAYFAARTTSdlpldlllplif  1142
             LFFIAVFWGFFPVFTAIFTFPQE+AMLSKERAADMYRLSAYF ARTTSDLPLDLLLP++F
Sbjct  420   LFFIAVFWGFFPVFTAIFTFPQERAMLSKERAADMYRLSAYFLARTTSDLPLDLLLPILF  479

Query  1141  lLVVYFMAGLKQDASSFLLTAVTVFLCIVVAQGLGLAIGATLMDLKKATTLASVTVMTFM  962
             LLVVYFMAGL+  A+ F LT VTVFL IV AQGLGLAIGATLMD+KKATTLASVTVMTFM
Sbjct  480   LLVVYFMAGLRLSAAPFFLTMVTVFLSIVAAQGLGLAIGATLMDVKKATTLASVTVMTFM  539

Query  961   LAGGYFIKKVPGFIVWLRDLSFNYHTFKLLLKVQYEHKTNSVNGVQIDSGIKEVGALAAM  782
             LAGG+F++KVP F+ W+R +SFNYHT+KLLLKVQY +   +VNG+++D+G+ EV AL AM
Sbjct  540   LAGGFFVQKVPVFVAWIRYVSFNYHTYKLLLKVQYNNIIPAVNGMKMDNGVVEVTALIAM  599

Query  781   AVSYRLLAYISLRRMKLQ  728
                YRLLAYISLRRM+L 
Sbjct  600   VFGYRLLAYISLRRMRLH  617



>ref|XP_010653240.1| PREDICTED: ABC transporter G family member 22 isoform X3 [Vitis 
vinifera]
Length=599

 Score =   829 bits (2141),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 440/596 (74%), Positives = 500/596 (84%), Gaps = 35/596 (6%)
 Frame = -2

Query  2416  LKFTEVSYKIVIKGVTFSEEKDILNGISGAVDPGEVLALMGPSGCGKTTLLSLLGGRIRD  2237
             + F +V+YK+++KG+  + EK+ILNGI+G+V+PGEVLALMGPSG GKTTLL+LLGGR+  
Sbjct  3     IMFKDVTYKVILKGMRTNVEKEILNGITGSVNPGEVLALMGPSGSGKTTLLNLLGGRLNQ  62

Query  2236  PSAG-SITYNQHPYSKLLKSRIGFVTQDDILFPHLTVKETLIYAARLRLPRTLTKEEKDK  2060
             P+AG S+TYN  PYSK LKS+IGFVTQDD+LFPHLTV+ETL YAARLRLP+TLTK++K+K
Sbjct  63    PTAGGSVTYNDQPYSKSLKSKIGFVTQDDVLFPHLTVRETLTYAARLRLPKTLTKQQKEK  122

Query  2059  RAMDVIYELGLDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDST  1880
             RA+DVIYELGLDRCQDTMIGGSFVRGVSGGERKRV IGNEIIINPSLLFLDEPTSGLDST
Sbjct  123   RAVDVIYELGLDRCQDTMIGGSFVRGVSGGERKRVSIGNEIIINPSLLFLDEPTSGLDST  182

Query  1879  TALRIVDILHEIAKAGKTVITTIHQPSSRLFHk---------------------------  1781
             TALRIV +LH+IA+AGKTV+TTIHQPSSRLFHK                           
Sbjct  183   TALRIVQMLHDIAEAGKTVLTTIHQPSSRLFHKFDKLILLGKGNLLYFGKASGTMEYFSS  242

Query  1780  -----fdklilleflldLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEY  1616
                     +   EFLLDLANGN+NDVSIPSEL DKVQT +S+ E TRN GKPSPA VHEY
Sbjct  243   IGCSPLITMNPAEFLLDLANGNLNDVSIPSELEDKVQTEHSETE-TRN-GKPSPADVHEY  300

Query  1615  LVGCYETRVAETEKKKLMAPLPVEEELKSKVRYLKREWGASWSEQYVLLFHRGIRERWHD  1436
             LV  YETRVA+ EKKKLM P+P++EELKSKV   KREWGASW EQY +LF RG++ER HD
Sbjct  301   LVEAYETRVADQEKKKLMIPIPIDEELKSKVCSPKREWGASWWEQYSILFRRGLKERRHD  360

Query  1435  YFSWLRITQVIATALILGMLWWQSGGDTPSQMQDQAGLLFFIAVFWGFFPVFTAIFTFPQ  1256
             YFSWLR+TQV +TA ILG+LWWQS    P  +QDQAGLLFFIAVFWGFFPVFTAIFTFPQ
Sbjct  361   YFSWLRVTQVASTATILGLLWWQSESTNPKGLQDQAGLLFFIAVFWGFFPVFTAIFTFPQ  420

Query  1255  EKAMLSKERAADMYRLSAYFAARTTSdlpldlllpliflLVVYFMAGLKQDASSFLLTAV  1076
             E+AMLSKERAADMYRLSAYF ARTTSDLPLDL+LP++FL++VYFMAGL+ DA SF LT +
Sbjct  421   ERAMLSKERAADMYRLSAYFVARTTSDLPLDLILPVLFLIIVYFMAGLRMDAGSFFLTML  480

Query  1075  TVFLCIVVAQGLGLAIGATLMDLKKATTLASVTVMTFMLAGGYFIKKVPGFIVWLRDLSF  896
             TVFLCIV AQGLGLAIGATLMDLK+ATTLASVTVMTFMLAGGYF+KKVP FI W+R +SF
Sbjct  481   TVFLCIVAAQGLGLAIGATLMDLKRATTLASVTVMTFMLAGGYFVKKVPIFISWIRYISF  540

Query  895   NYHTFKLLLKVQYEHKTNSVNGVQIDSGIKEVGALAAMAVSYRLLAYISLRRMKLQ  728
             NYHT+KLLLKVQYEH T +VNG++ID G+KEV AL AM   YRLLAYISLRRMKL 
Sbjct  541   NYHTYKLLLKVQYEHITPNVNGMKIDGGLKEVSALVAMVFGYRLLAYISLRRMKLH  596



>ref|XP_008241115.1| PREDICTED: ABC transporter G family member 22 isoform X3 [Prunus 
mume]
 ref|XP_008241116.1| PREDICTED: ABC transporter G family member 22 isoform X3 [Prunus 
mume]
Length=603

 Score =   828 bits (2139),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/594 (72%), Positives = 490/594 (82%), Gaps = 34/594 (6%)
 Frame = -2

Query  2410  FTEVSYKIVIKGVTFSEEKDILNGISGAVDPGEVLALMGPSGCGKTTLLSLLGGR-IRDP  2234
             FT+V+YKI++KG+  +EEKDILNGI+G+V PGEVLALMGPSG GKT+LL+LLGGR ++  
Sbjct  8     FTDVTYKIILKGMRTTEEKDILNGITGSVHPGEVLALMGPSGSGKTSLLNLLGGRAVQAN  67

Query  2233  SAGSITYNQHPYSKLLKSRIGFVTQDDILFPHLTVKETLIYAARLRLPRTLTKEEKDKRA  2054
               GSITYN   YSK LKSRIGFVTQDD+LFPHLTVKETL YAA LRL +TLTKE+K+KRA
Sbjct  68    VTGSITYNDQTYSKFLKSRIGFVTQDDVLFPHLTVKETLTYAALLRLSKTLTKEQKEKRA  127

Query  2053  MDVIYELGLDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTA  1874
             +DVIYELGL+RCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTA
Sbjct  128   LDVIYELGLERCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTA  187

Query  1873  LRIVDILHEIAKAGKTVITTIHQPSSRLFHk-----------------------------  1781
             LRIV +L +IA+AGKTV+TTIHQPSSRLFHK                             
Sbjct  188   LRIVQMLQDIAEAGKTVVTTIHQPSSRLFHKFDKLILLGKGSLLYFGKASEAMVYFSSIG  247

Query  1780  ---fdklilleflldLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLV  1610
                   +   EFLLDLANGNINDVSIPSEL DKVQ  NS+   TRN GKPSPA+VHEYLV
Sbjct  248   CSPLIAMNPAEFLLDLANGNINDVSIPSELEDKVQMGNSEAADTRN-GKPSPAVVHEYLV  306

Query  1609  GCYETRVAETEKKKLMAPLPVEEELKSKVRYLKREWGASWSEQYVLLFHRGIRERWHDYF  1430
               YETRVA+ EKKK+M PLP++++LK KV   KREWG SW EQ+ +LF RGI+ER HDYF
Sbjct  307   EAYETRVADEEKKKIMVPLPLDDQLKLKVSISKREWGGSWWEQFSILFCRGIKERRHDYF  366

Query  1429  SWLRITQVIATALILGMLWWQSGGDTPSQMQDQAGLLFFIAVFWGFFPVFTAIFTFPQEK  1250
             SWLRITQV++TA+ILG+LWWQS  + P  ++DQAGLLFFIAVFWGFFPVFTAIFTFPQE+
Sbjct  367   SWLRITQVLSTAVILGLLWWQSDSNNPKGLEDQAGLLFFIAVFWGFFPVFTAIFTFPQER  426

Query  1249  AMLSKERAADMYRLSAYFAARTTSdlpldlllpliflLVVYFMAGLKQDASSFLLTAVTV  1070
             AML+KERAADMYRLSAYF ARTTSDLPLDLLLP++FL++VYFMAGL+  A +F L+ + V
Sbjct  427   AMLTKERAADMYRLSAYFVARTTSDLPLDLLLPVLFLVIVYFMAGLRLSAETFFLSMLIV  486

Query  1069  FLCIVVAQGLGLAIGATLMDLKKATTLASVTVMTFMLAGGYFIKKVPGFIVWLRDLSFNY  890
             FLCIV AQGLGLAIGATLMDLK+ATTLASVTVMTFMLAGG+F+KKVP FI W+R +SFNY
Sbjct  487   FLCIVAAQGLGLAIGATLMDLKRATTLASVTVMTFMLAGGFFVKKVPVFISWIRYMSFNY  546

Query  889   HTFKLLLKVQYEHKTNSVNGVQIDSGIKEVGALAAMAVSYRLLAYISLRRMKLQ  728
             HT++LLLKVQYE  T ++NG+  D G+  VGAL AM   YRLLAY+SLRRMKLQ
Sbjct  547   HTYRLLLKVQYEAITPAINGLSTDCGLTGVGALVAMVFGYRLLAYLSLRRMKLQ  600



>ref|XP_004494279.1| PREDICTED: ABC transporter G family member 22-like isoform X2 
[Cicer arietinum]
Length=693

 Score =   821 bits (2120),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 456/709 (64%), Positives = 543/709 (77%), Gaps = 53/709 (7%)
 Frame = -2

Query  2878  MEQTN-STSLLRTKSDQLVEaiaaakgsarARLPRLSAEFAGSGVPESVRMLSRKPSRRL  2702
             ME  N S  ++RT+SDQLVE++ A+      + P  S+E     V      L RK S+R 
Sbjct  1     MEDENYSKGIMRTQSDQLVESVVASL-----KSPPGSSESIRGVVEGGSGSLIRKSSKR-  54

Query  2701  MppspggggsgGTNSTHIRKSRSAQ--MKLDLDElssgsvlsrassaslGFSFTGFSVRP  2528
                      S    +THIRK+RSAQ  +K+DLD++SSG+ LSRASS  L FSFTGFS+  
Sbjct  55    --------ASPSGRNTHIRKARSAQTSLKVDLDDVSSGAALSRASSLGLSFSFTGFSIPL  106

Query  2527  DESADSKPFSDDENPEDLEAGTKKKRSIPAEPTFPIYLKFTEVSYKIVIKGVTFSEEKDI  2348
             DE + SKPFSDD+ PED+EAG  K +    EPT PIYLKFT+V+YK+VIKG+T S EKDI
Sbjct  107   DEISSSKPFSDDDIPEDIEAGIHKPK-FQTEPTLPIYLKFTDVTYKVVIKGMTTSVEKDI  165

Query  2347  LNGISGAVDPGEVLALMGPSGCGKTTLLSLLGGRIRDPS-AGSITYNQHPYSKLLKSRIG  2171
             L GISG V+PGEVLALMGPSG GKT+LL+LLG R   P+  GSITYN  PYSK LKSRIG
Sbjct  166   LKGISGCVNPGEVLALMGPSGSGKTSLLNLLGARSCQPTVGGSITYNDQPYSKFLKSRIG  225

Query  2170  FVTQDDILFPHLTVKETLIYAARLRLPRTLTKEEKDKRAMDVIYELGLDRCQDTMIGGSF  1991
             FVTQDD+LFPHLTVKETL YAARLRLP+TLT+++K+KRA+DVIYELGL+RCQDTMIGGSF
Sbjct  226   FVTQDDVLFPHLTVKETLTYAARLRLPKTLTRQQKEKRALDVIYELGLERCQDTMIGGSF  285

Query  1990  VRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILHEIAKAGKTVITTI  1811
             VRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIV +LH+IA+AGKT++TTI
Sbjct  286   VRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVQMLHDIAEAGKTIVTTI  345

Query  1810  HQPSSRLFHk--------------------------------fdklilleflldLANGNI  1727
             HQPSSRLFHK                                   +   EFLLDLANGN+
Sbjct  346   HQPSSRLFHKFDKLILLGKGNLLYFGKASEAMDYFGFIGCTPLIAMNPAEFLLDLANGNM  405

Query  1726  NDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYETRVAETEKKKLMAPLPV  1547
             ND+S+PSEL DKV   N + E +  NGKPS A+V +YLV  YETRVAETEKKKLM P+P+
Sbjct  406   NDISVPSELEDKVHMGNVEVETS--NGKPSAAVVQDYLVEAYETRVAETEKKKLMDPIPL  463

Query  1546  EEELKSKVRYLKREWGASWSEQYVLLFHRGIRERWHDYFSWLRITQVIATALILGMLWWQ  1367
             +EE+KSKV   KR+WGASW EQY +LF RG +ER H+YFSWLRITQV++TA+ILG+LWWQ
Sbjct  464   DEEVKSKVYSRKRQWGASWFEQYTILFSRGFKERRHEYFSWLRITQVLSTAVILGLLWWQ  523

Query  1366  SGGDTPSQMQDQAGLLFFIAVFWGFFPVFTAIFTFPQEKAMLSKERAADMYRLSAYFAAR  1187
             S    P  +QDQAGLLFFIAVFWGFFPVFTAIFTFPQE+AML+KERA DMYRLSAYF AR
Sbjct  524   SDASNPKGLQDQAGLLFFIAVFWGFFPVFTAIFTFPQERAMLNKERATDMYRLSAYFVAR  583

Query  1186  TTSdlpldlllpliflLVVYFMAGLKQDASSFLLTAVTVFLCIVVAQGLGLAIGATLMDL  1007
             TTSDLPLDL+LP++FL+VVYFM GL+     F L+ +TVFLC+V AQGLGLAIGATLMDL
Sbjct  584   TTSDLPLDLVLPVLFLIVVYFMTGLRLSVGPFFLSILTVFLCVVAAQGLGLAIGATLMDL  643

Query  1006  KKATTLASVTVMTFMLAGGYFIKKVPGFIVWLRDLSFNYHTFKLLLKVQ  860
             K+ATTLASVTVMTFMLAGG+F+K    +++ +  +  N+  ++L++ V+
Sbjct  644   KRATTLASVTVMTFMLAGGFFVKVNFNYLIDIHIVDVNFVHYQLIIIVK  692



>gb|KEH41804.1| white-brown-complex ABC transporter family protein [Medicago 
truncatula]
Length=580

 Score =   813 bits (2101),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 423/582 (73%), Positives = 481/582 (83%), Gaps = 35/582 (6%)
 Frame = -2

Query  2374  VTFSEEKDILNGISGAVDPGEVLALMGPSGCGKTTLLSLLGGRIRDPS-AGSITYNQHPY  2198
             +T SEEKDIL GISG+V+PGEVLALMGPSG GKT+LL+LLGGRI  P+  GSITYN   Y
Sbjct  1     MTSSEEKDILYGISGSVNPGEVLALMGPSGSGKTSLLNLLGGRISQPTIGGSITYNDQSY  60

Query  2197  SKLLKSRIGFVTQDDILFPHLTVKETLIYAARLRLPRTLTKEEKDKRAMDVIYELGLDRC  2018
             SK LKSRIGFVTQDD+LFPHLTVKETL YAARLRLP+TLTKE+K++RA+DVIYELGL+RC
Sbjct  61    SKFLKSRIGFVTQDDVLFPHLTVKETLTYAARLRLPKTLTKEQKEQRALDVIYELGLERC  120

Query  2017  QDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILHEIAK  1838
             QDTMIGGSFVRGVSGGERKRVCIGNEIIINPS+LFLDEPTSGLDSTTAL+IV +L +IA+
Sbjct  121   QDTMIGGSFVRGVSGGERKRVCIGNEIIINPSILFLDEPTSGLDSTTALKIVQMLQDIAE  180

Query  1837  AGKTVITTIHQPSSRLFHk--------------------------------fdklillef  1754
             AGKTV+TTIHQPSSRLFHK                                   +   EF
Sbjct  181   AGKTVVTTIHQPSSRLFHKFDKLILLGKGSLLYFGKASEVMNYFQSIGCSPLISMNPAEF  240

Query  1753  lldLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYETRVAETEK  1574
             LLDLANGNINDVS+PSEL DKVQ  N+  E    +GKPSPA VHEYLV  YE+RVAETEK
Sbjct  241   LLDLANGNINDVSVPSELEDKVQIGNAAVETY--HGKPSPADVHEYLVEAYESRVAETEK  298

Query  1573  KKLMAPLPVEEELKSKVRYLKREWGASWSEQYVLLFHRGIRERWHDYFSWLRITQVIATA  1394
             KK+M  +P++E+LK+KV   KR+WGA W EQ+ +LF RGI+ER HDYFSWLRITQV++TA
Sbjct  299   KKIMVSVPLDEDLKAKVVSAKRQWGARWDEQFSILFWRGIKERRHDYFSWLRITQVLSTA  358

Query  1393  LILGMLWWQSGGDTPSQMQDQAGLLFFIAVFWGFFPVFTAIFTFPQEKAMLSKERAADMY  1214
             +ILG+LWWQS    P  +QDQAGLLFFIAVFWGFFPVFTAIFTFPQE+AML+KERAADMY
Sbjct  359   IILGLLWWQSDAKNPKDLQDQAGLLFFIAVFWGFFPVFTAIFTFPQERAMLNKERAADMY  418

Query  1213  RLSAYFAARTTSdlpldlllpliflLVVYFMAGLKQDASSFLLTAVTVFLCIVVAQGLGL  1034
             RLSAYF ARTTSDLPLDL+LP++FLLVVYFMAGL+  A+ F LT +TVFLCI+ AQGLGL
Sbjct  419   RLSAYFLARTTSDLPLDLILPVLFLLVVYFMAGLRLSAAPFFLTILTVFLCIIAAQGLGL  478

Query  1033  AIGATLMDLKKATTLASVTVMTFMLAGGYFIKKVPGFIVWLRDLSFNYHTFKLLLKVQYE  854
             AIGATLMDLK+ATTLASVTVMTFMLAGG+F++KVP FI W+R +SFNYHT+KLLLKVQYE
Sbjct  479   AIGATLMDLKRATTLASVTVMTFMLAGGFFVQKVPIFISWIRYMSFNYHTYKLLLKVQYE  538

Query  853   HKTNSVNGVQIDSGIKEVGALAAMAVSYRLLAYISLRRMKLQ  728
             H T  VNGV+ID G+ EV AL AM   YR LAY+SLRRMKLQ
Sbjct  539   HLTPIVNGVKIDGGLTEVVALIAMVFGYRFLAYLSLRRMKLQ  580



>ref|XP_006604672.1| PREDICTED: ABC transporter G family member 22-like isoform X4 
[Glycine max]
Length=604

 Score =   813 bits (2100),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 417/597 (70%), Positives = 486/597 (81%), Gaps = 35/597 (6%)
 Frame = -2

Query  2419  YLKFTEVSYKIVIKGVTFSEEKDILNGISGAVDPGEVLALMGPSGCGKTTLLSLLGGR-I  2243
             Y  FT+V+YK+V+KG+T ++EKDIL GI+G+V+PGEVLALMGPSG GKT+LL+LLGGR I
Sbjct  7     YSMFTDVTYKVVMKGITTTKEKDILKGITGSVNPGEVLALMGPSGSGKTSLLNLLGGRLI  66

Query  2242  RDPSAGSITYNQHPYSKLLKSRIGFVTQDDILFPHLTVKETLIYAARLRLPRTLTKEEKD  2063
             +    GSITYN  PYSK LKSRIGFVTQDD+LFPHLTVKETL YAARLRLP TLTKE+K+
Sbjct  67    QSTIGGSITYNDQPYSKFLKSRIGFVTQDDVLFPHLTVKETLTYAARLRLPNTLTKEQKE  126

Query  2062  KRAMDVIYELGLDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDS  1883
             KRA++VI ELGL+RCQDTMIGGS+VRG+SGGERKRVCIGNEIIINPSLLFLDEPTSGLDS
Sbjct  127   KRALEVIDELGLERCQDTMIGGSYVRGISGGERKRVCIGNEIIINPSLLFLDEPTSGLDS  186

Query  1882  TTALRIVDILHEIAKAGKTVITTIHQPSSRLFHk--------------------------  1781
             TTALRIV +L +IA+AGKTV+TTIHQPSSRLFHK                          
Sbjct  187   TTALRIVQMLQDIAEAGKTVVTTIHQPSSRLFHKFDKLILLGKGSLLYFGKASDAMDYFQ  246

Query  1780  ------fdklilleflldLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHE  1619
                      +   EFLLDLANGN+ND+S+PSEL D VQ  N++ E    NGKPS ++V E
Sbjct  247   FIGCAPLIAMNPAEFLLDLANGNVNDISVPSELKDIVQVGNAEAETC--NGKPSASVVQE  304

Query  1618  YLVGCYETRVAETEKKKLMAPLPVEEELKSKVRYLKREWGASWSEQYVLLFHRGIRERWH  1439
             YLV  Y++RVAE EK KLM P+P++ ELKSKV   KR+WGASW EQ+ +LF RG +ER H
Sbjct  305   YLVEAYDSRVAEIEKTKLMVPVPLDVELKSKVCSCKRQWGASWFEQFSILFSRGFKERRH  364

Query  1438  DYFSWLRITQVIATALILGMLWWQSGGDTPSQMQDQAGLLFFIAVFWGFFPVFTAIFTFP  1259
             DYFSWLRITQV+ATA+ILG+LWWQS   TP  +QDQAGLLFFIAVFWGFFPVFTAIFTFP
Sbjct  365   DYFSWLRITQVLATAVILGLLWWQSDAKTPKGLQDQAGLLFFIAVFWGFFPVFTAIFTFP  424

Query  1258  QEKAMLSKERAADMYRLSAYFAARTTSdlpldlllpliflLVVYFMAGLKQDASSFLLTA  1079
             QE+AML+KER  DMYRLSAYF ARTTSDL LDL+LP+ FLL+VYFMA L+  +  F  + 
Sbjct  425   QERAMLTKERTTDMYRLSAYFVARTTSDLLLDLVLPVFFLLLVYFMANLRLGSGRFFFSI  484

Query  1078  VTVFLCIVVAQGLGLAIGATLMDLKKATTLASVTVMTFMLAGGYFIKKVPGFIVWLRDLS  899
             +TVFLCI+ AQGLGLAIGATLMDLK+ATTLASVTVMTFMLAGG+F+KKVP FI W+R +S
Sbjct  485   LTVFLCIIAAQGLGLAIGATLMDLKRATTLASVTVMTFMLAGGFFVKKVPIFISWIRYIS  544

Query  898   FNYHTFKLLLKVQYEHKTNSVNGVQIDSGIKEVGALAAMAVSYRLLAYISLRRMKLQ  728
             FNYHT+KLLLKVQYEH T +++G++IDSG +EV AL AM   YRLLAY+SLRRMKLQ
Sbjct  545   FNYHTYKLLLKVQYEHITPTIDGIRIDSGFREVAALTAMVFGYRLLAYLSLRRMKLQ  601



>gb|KEH24295.1| white-brown-complex ABC transporter family protein [Medicago 
truncatula]
Length=581

 Score =   811 bits (2095),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/582 (73%), Positives = 482/582 (83%), Gaps = 35/582 (6%)
 Frame = -2

Query  2374  VTFSEEKDILNGISGAVDPGEVLALMGPSGCGKTTLLSLLGGRIRDPS-AGSITYNQHPY  2198
             +T + EKDIL GI+G V+PGEVLALMGPSG GKT+LL+LLG R+  P+  GSITYN  PY
Sbjct  1     MTTNVEKDILKGITGCVNPGEVLALMGPSGGGKTSLLNLLGARLSQPNIGGSITYNDQPY  60

Query  2197  SKLLKSRIGFVTQDDILFPHLTVKETLIYAARLRLPRTLTKEEKDKRAMDVIYELGLDRC  2018
             SK LKSRIGFVTQDD+LFPHLTVKETL YAARLRLP+TLTKE+K++RA+DVIYELGL+RC
Sbjct  61    SKFLKSRIGFVTQDDVLFPHLTVKETLTYAARLRLPKTLTKEQKEQRALDVIYELGLERC  120

Query  2017  QDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILHEIAK  1838
             QDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIV +LH+IA+
Sbjct  121   QDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVQMLHDIAE  180

Query  1837  AGKTVITTIHQPSSRLFHk--------------------------------fdklillef  1754
             AGKT+ITTIHQPSSRLFHK                                   +   EF
Sbjct  181   AGKTIITTIHQPSSRLFHKFDKLILLGKGNLLYFGKASEAMDYFKLIGCNPLITMNPAEF  240

Query  1753  lldLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYETRVAETEK  1574
             LLDLANGN+ D+S+PSEL DKV   N++ E    NGKPS A++ EYLV  YETRVAETEK
Sbjct  241   LLDLANGNMIDISVPSELNDKVHMGNAETETF--NGKPSAAVIQEYLVEAYETRVAETEK  298

Query  1573  KKLMAPLPVEEELKSKVRYLKREWGASWSEQYVLLFHRGIRERWHDYFSWLRITQVIATA  1394
             KKLM P+P++EE+KSKVR  KR+WGASW EQ+++LF RG +ER HDYFSWLRITQV++TA
Sbjct  299   KKLMVPIPLDEEVKSKVRSRKRQWGASWIEQFLILFSRGFKERRHDYFSWLRITQVLSTA  358

Query  1393  LILGMLWWQSGGDTPSQMQDQAGLLFFIAVFWGFFPVFTAIFTFPQEKAMLSKERAADMY  1214
             +ILG+LWWQS    P  +QDQAGLLFFIAVFWGFFPVFTAIFTFPQE+AML+KERA+DMY
Sbjct  359   VILGLLWWQSDASNPKGLQDQAGLLFFIAVFWGFFPVFTAIFTFPQERAMLNKERASDMY  418

Query  1213  RLSAYFAARTTSdlpldlllpliflLVVYFMAGLKQDASSFLLTAVTVFLCIVVAQGLGL  1034
             RLSAYF ARTTSDLPLDL+LP++FLLVVYFMAGL+  A SF L+ +TVFLCIV AQGLGL
Sbjct  419   RLSAYFVARTTSDLPLDLVLPVLFLLVVYFMAGLRLSAGSFFLSILTVFLCIVAAQGLGL  478

Query  1033  AIGATLMDLKKATTLASVTVMTFMLAGGYFIKKVPGFIVWLRDLSFNYHTFKLLLKVQYE  854
             AIGATLMDLK+ATTLASVTVMTFMLAGG+F+KKVP FI W+R LSFNYHT+KLLLKVQYE
Sbjct  479   AIGATLMDLKRATTLASVTVMTFMLAGGFFVKKVPIFISWIRYLSFNYHTYKLLLKVQYE  538

Query  853   HKTNSVNGVQIDSGIKEVGALAAMAVSYRLLAYISLRRMKLQ  728
             H T S+NG++IDSG+ EV AL AM   YRLLAY SLR MK+Q
Sbjct  539   HITPSINGMRIDSGMNEVVALIAMVFGYRLLAYFSLRWMKIQ  580



>ref|XP_011047135.1| PREDICTED: ABC transporter G family member 22-like isoform X3 
[Populus euphratica]
Length=685

 Score =   815 bits (2105),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 470/683 (69%), Positives = 543/683 (80%), Gaps = 48/683 (7%)
 Frame = -2

Query  2878  MEQTNSTSLLRTKSDQLVEaiaaakgsarARLPRLSAEFAGSGVPESVRMLSRKPSRRLM  2699
             ME+ N TSL RTKS+QL E + AA  S    +    A   GSG       LS K S+RL 
Sbjct  11    MERAN-TSLARTKSEQLAETVEAAFKSP---MNSDGASEGGSG-----GTLSGKSSKRLT  61

Query  2698  ppspggggsgGTN-STHIRKSRSAQMKLDLDElssgsvlsrassasl--GFSFTGFSVRP  2528
               +  G  + G N STHIRKSRSAQMK +LD+++SG+ LSRASSASL   FSFTGF++ P
Sbjct  62    TAASPGRATSGGNKSTHIRKSRSAQMKFELDDVNSGAALSRASSASLGFSFSFTGFNMPP  121

Query  2527  DESADSKPFSDDENPEDLEAGTKKKRSIPAEPTFPIYLKFTEVSYKIVIKGVTFSEEKDI  2348
             DE ADS PFSDD+ PEDLEAG +K++    +P+ PIYLKF +V+YK++IKG+T +EEKDI
Sbjct  122   DEIADSMPFSDDDIPEDLEAGMRKQK-FQTDPSLPIYLKFRDVTYKVIIKGMTSTEEKDI  180

Query  2347  LNGISGAVDPGEVLALMGPSGCGKTTLLSLLGGRI-RDPSAGSITYNQHPYSKLLKSRIG  2171
             LNGISG+VDPGEVLALMGPSG GKTTLL+LLGGR+ + P  GSITYN  PYSK LKSRIG
Sbjct  181   LNGISGSVDPGEVLALMGPSGSGKTTLLNLLGGRLNQPPVGGSITYNDRPYSKFLKSRIG  240

Query  2170  FVTQDDILFPHLTVKETLIYAARLRLPRTLTKEEKDKRAMDVIYELGLDRCQDTMIGGSF  1991
             FVTQDDILFPHLTVKETL YAA LRLP+TLTK++K +RAMDVIYELGL+RCQDT+IGGSF
Sbjct  241   FVTQDDILFPHLTVKETLTYAALLRLPKTLTKQQKQRRAMDVIYELGLERCQDTVIGGSF  300

Query  1990  VRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILHEIAKAGKTVITTI  1811
             VRGVSGGERKRVCIGNEIIINPS+LFLDEPTSGLDSTTAL+ V +L ++A+ GKTV+TTI
Sbjct  301   VRGVSGGERKRVCIGNEIIINPSILFLDEPTSGLDSTTALKTVQLLQDMAEGGKTVVTTI  360

Query  1810  HQPSSRLFHk--------------------------------fdklilleflldLANGNI  1727
             HQPSSRLFHK                                   +   EFLLDLANGN+
Sbjct  361   HQPSSRLFHKFDKLILLGKGSLLYFGKSSAAMPYFSSIGCNPLIAMNPAEFLLDLANGNV  420

Query  1726  NDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYETRVAETEKKKLMAPLPV  1547
             NDVS+PSEL DKVQ  NS  +  + NGKPSPA+VHEYLV  YETRVA  EKKKLM P+P+
Sbjct  421   NDVSVPSELEDKVQIGNS--DAGKRNGKPSPAVVHEYLVEAYETRVAVKEKKKLMVPIPL  478

Query  1546  EEELKSKVRYLKREWGASWSEQYVLLFHRGIRERWHDYFSWLRITQVIATALILGMLWWQ  1367
             +EE+K+KV  LKR+WGASW +QY +LF RGI+ER HDYFSWLRITQV++TA+ILG+LWW 
Sbjct  479   DEEVKAKVSSLKRQWGASWWQQYTILFRRGIKERRHDYFSWLRITQVLSTAIILGLLWWN  538

Query  1366  SGGDTPSQMQDQAGLLFFIAVFWGFFPVFTAIFTFPQEKAMLSKERAADMYRLSAYFAAR  1187
             S  D+   +QDQAGLLFFIAVFWGFFPVFTAIFTFPQE+AMLSKERAADMYRLSAYF AR
Sbjct  539   SDTDSLKGLQDQAGLLFFIAVFWGFFPVFTAIFTFPQERAMLSKERAADMYRLSAYFLAR  598

Query  1186  TTSdlpldlllpliflLVVYFMAGLKQDASSFLLTAVTVFLCIVVAQGLGLAIGATLMDL  1007
             TTSDLPLDL+LP++FLLVVYFMAGL+  A+SF LT +TVFL IV AQGLGLAIGATLMDL
Sbjct  599   TTSDLPLDLILPVLFLLVVYFMAGLRMSAASFFLTMLTVFLSIVAAQGLGLAIGATLMDL  658

Query  1006  KKATTLASVTVMTFMLAGGYFIK  938
             K+ATTLASVTVMTFMLAGGYF+K
Sbjct  659   KRATTLASVTVMTFMLAGGYFVK  681



>ref|XP_009348556.1| PREDICTED: ABC transporter G family member 22-like isoform X2 
[Pyrus x bretschneideri]
Length=600

 Score =   811 bits (2094),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/594 (70%), Positives = 488/594 (82%), Gaps = 34/594 (6%)
 Frame = -2

Query  2410  FTEVSYKIVIKGVTFSEEKDILNGISGAVDPGEVLALMGPSGCGKTTLLSLLGGRIRDPS  2231
             FT+V+YK++ KG+  +EEKDILNGI+G+V+PGEVLALMGPSG GKTTLL+LLGGR    +
Sbjct  5     FTDVTYKVIFKGMRTAEEKDILNGITGSVNPGEVLALMGPSGSGKTTLLNLLGGRGSQTN  64

Query  2230  -AGSITYNQHPYSKLLKSRIGFVTQDDILFPHLTVKETLIYAARLRLPRTLTKEEKDKRA  2054
               GSITYN   YSK LKS+IGFVTQDD+LFPHLTVKETL YAA LRLP+ L K++K+KRA
Sbjct  65    VGGSITYNDQTYSKHLKSKIGFVTQDDVLFPHLTVKETLTYAALLRLPKKLMKDQKEKRA  124

Query  2053  MDVIYELGLDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTA  1874
             +++IYELGL+RCQDTMIGGSFVRGVSGGERKRVCIGNEI+INPSLLFLDEPTSGLDSTTA
Sbjct  125   IELIYELGLERCQDTMIGGSFVRGVSGGERKRVCIGNEILINPSLLFLDEPTSGLDSTTA  184

Query  1873  LRIVDILHEIAKAGKTVITTIHQPSSRLFHk-----------------------------  1781
             LRIV +L +IA+AGKTV+TTIHQPSSRLFHK                             
Sbjct  185   LRIVQMLQDIAEAGKTVVTTIHQPSSRLFHKFDKLILLGKGSLLYFGKASEAMVYFSSIG  244

Query  1780  ---fdklilleflldLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLV  1610
                   +   EFLLDLANGN+NDVS+PSEL DKVQ  NS+   TRN GKPSPA+V EYLV
Sbjct  245   CSPLISMNPAEFLLDLANGNLNDVSVPSELEDKVQMGNSEAADTRN-GKPSPAVVQEYLV  303

Query  1609  GCYETRVAETEKKKLMAPLPVEEELKSKVRYLKREWGASWSEQYVLLFHRGIRERWHDYF  1430
              CYETRVA+ EKKK+M PLP+++ELK K+ + KREWGASW EQ+ +LF RGI+ER HDYF
Sbjct  304   ECYETRVADKEKKKIMVPLPLDDELKLKISFSKREWGASWWEQFSILFCRGIKERRHDYF  363

Query  1429  SWLRITQVIATALILGMLWWQSGGDTPSQMQDQAGLLFFIAVFWGFFPVFTAIFTFPQEK  1250
             SWLRITQVI+TA+ILG+LWWQS  + P   +DQAGLLFF++VFWGF PVFTAIFTFPQE+
Sbjct  364   SWLRITQVISTAIILGLLWWQSDANDPKGREDQAGLLFFMSVFWGFLPVFTAIFTFPQER  423

Query  1249  AMLSKERAADMYRLSAYFAARTTSdlpldlllpliflLVVYFMAGLKQDASSFLLTAVTV  1070
             AML KER+ADMYRLSAYF +RTTSDLPLDL+LP++FL+VVYFMAGL+  A +F L+ +TV
Sbjct  424   AMLMKERSADMYRLSAYFVSRTTSDLPLDLMLPVLFLVVVYFMAGLRSSAEAFFLSMLTV  483

Query  1069  FLCIVVAQGLGLAIGATLMDLKKATTLASVTVMTFMLAGGYFIKKVPGFIVWLRDLSFNY  890
             FLCIV AQGLGLAIGATLMDLKKATTLASV VMTFMLAGG+F+KKVP FI W+R LSF+Y
Sbjct  484   FLCIVAAQGLGLAIGATLMDLKKATTLASVIVMTFMLAGGFFVKKVPVFISWIRYLSFDY  543

Query  889   HTFKLLLKVQYEHKTNSVNGVQIDSGIKEVGALAAMAVSYRLLAYISLRRMKLQ  728
             HT++LLLKVQYEH T +++G+  D G++EV AL AM   YR LAY+SLRRMKLQ
Sbjct  544   HTYRLLLKVQYEHITPTIHGLSTDCGLREVVALIAMVFGYRFLAYLSLRRMKLQ  597



>ref|XP_009362644.1| PREDICTED: ABC transporter G family member 22-like isoform X3 
[Pyrus x bretschneideri]
Length=611

 Score =   811 bits (2095),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/594 (71%), Positives = 487/594 (82%), Gaps = 34/594 (6%)
 Frame = -2

Query  2410  FTEVSYKIVIKGVTFSEEKDILNGISGAVDPGEVLALMGPSGCGKTTLLSLLGGRIRDPS  2231
             FT+V+YK++ KG+  +EEK ILNGI+G V+PGEVLALMGPSG GKTTLL+LLGGR    +
Sbjct  16    FTDVTYKVIFKGMRTTEEKYILNGIAGLVNPGEVLALMGPSGSGKTTLLNLLGGRGSQAN  75

Query  2230  -AGSITYNQHPYSKLLKSRIGFVTQDDILFPHLTVKETLIYAARLRLPRTLTKEEKDKRA  2054
               GSITYN   YSK LKS+IGFVTQDD+LFPHLTVKETL YAA LRLP+TLTKE+K+KRA
Sbjct  76    VGGSITYNDQTYSKYLKSKIGFVTQDDVLFPHLTVKETLTYAALLRLPKTLTKEQKEKRA  135

Query  2053  MDVIYELGLDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTA  1874
             +DVI ELGL+RCQDTMIGGS VRGVSGGERKRVCIGNEI+INPSLLFLDEPTSGLDSTTA
Sbjct  136   IDVICELGLERCQDTMIGGSLVRGVSGGERKRVCIGNEILINPSLLFLDEPTSGLDSTTA  195

Query  1873  LRIVDILHEIAKAGKTVITTIHQPSSRLFHk-----------------------------  1781
             LRI  +L +IA+AGKTV+TTIHQPSSRLFHK                             
Sbjct  196   LRIGQMLQDIAEAGKTVVTTIHQPSSRLFHKFDKLILLGKGSLLYFGKASEAMVYFSSIG  255

Query  1780  ---fdklilleflldLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLV  1610
                   +   EFLLDLANGN+NDVS+PSEL D+VQ  NS+ + TRN GKPSPA+VHEYLV
Sbjct  256   CSPLITMNPAEFLLDLANGNLNDVSVPSELEDEVQMGNSEADDTRN-GKPSPAVVHEYLV  314

Query  1609  GCYETRVAETEKKKLMAPLPVEEELKSKVRYLKREWGASWSEQYVLLFHRGIRERWHDYF  1430
               YETRVA  EKKKLMAPLP++EELKSK+ + KREWG SW EQ+ +LF RGI+ER HDYF
Sbjct  315   ESYETRVANEEKKKLMAPLPIDEELKSKMSFSKREWGTSWWEQFSILFWRGIKERRHDYF  374

Query  1429  SWLRITQVIATALILGMLWWQSGGDTPSQMQDQAGLLFFIAVFWGFFPVFTAIFTFPQEK  1250
             SWLR TQV++TA++LG+LWWQS  + P   +DQAGLLFFI+VFWGF PVFTAIFTFPQEK
Sbjct  375   SWLRFTQVLSTAIVLGLLWWQSDANNPKGREDQAGLLFFISVFWGFLPVFTAIFTFPQEK  434

Query  1249  AMLSKERAADMYRLSAYFAARTTSdlpldlllpliflLVVYFMAGLKQDASSFLLTAVTV  1070
             AML KER+ADMYRLSAYFA+RTTSDLPLDL+LP++FL+VVYFMAGL+  A +F L+ +TV
Sbjct  435   AMLVKERSADMYRLSAYFASRTTSDLPLDLMLPVMFLVVVYFMAGLRLSAETFFLSMLTV  494

Query  1069  FLCIVVAQGLGLAIGATLMDLKKATTLASVTVMTFMLAGGYFIKKVPGFIVWLRDLSFNY  890
             FLCIV AQGLGLAIGATLMDLKKATTLASV VMTFMLAGG+F+K+VP FI W+R +SF+Y
Sbjct  495   FLCIVAAQGLGLAIGATLMDLKKATTLASVIVMTFMLAGGFFVKEVPVFISWIRYMSFDY  554

Query  889   HTFKLLLKVQYEHKTNSVNGVQIDSGIKEVGALAAMAVSYRLLAYISLRRMKLQ  728
             HT+++LLKVQYEH T +V+G+  D G+ EVGAL AM   YRLLAY+SLRRMKLQ
Sbjct  555   HTYRILLKVQYEHITPTVHGLTTDCGLTEVGALIAMVFGYRLLAYLSLRRMKLQ  608



>ref|XP_007028066.1| White-brown-complex ABC transporter family isoform 3 [Theobroma 
cacao]
 gb|EOY08568.1| White-brown-complex ABC transporter family isoform 3 [Theobroma 
cacao]
Length=671

 Score =   812 bits (2097),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 481/684 (70%), Positives = 540/684 (79%), Gaps = 67/684 (10%)
 Frame = -2

Query  2878  MEQ-TNSTSLLRTKSDQLVEaiaaakgsarARLPRLSAEFAGSGVPESVRMLSRKPSRRL  2702
             ME+ TNST+L RTKSDQLVE +AAA      + P  S +    G  +S   LSRK SRRL
Sbjct  1     MEKPTNSTTLARTKSDQLVETLAAAF-----KSPTQSDQ--APGTSDSGGTLSRKSSRRL  53

Query  2701  MppspggggsgGTNSTHIRKSRSAQMKLDLDElssgsvlsrassasl--GFSFTGFSVRP  2528
             M  +  G  SGG+ +THIRKSRSAQMKLDL+ELSSG+ LSRASSASL   FSFTGF+V P
Sbjct  54    MMAASPGRSSGGSKNTHIRKSRSAQMKLDLEELSSGAALSRASSASLGLSFSFTGFTVPP  113

Query  2527  DESADSKPFSDDENPEDLEAGTKKKRSIPAEPTFPIYLKFTEVSYKIVIKGVTFSEEKDI  2348
             DE ADSKPFSDD+ PED+EAGT K +    EPT PIYLKFT+V+YK++IKG+T SEE+DI
Sbjct  114   DEIADSKPFSDDDIPEDIEAGTHKPK-FQTEPTLPIYLKFTDVTYKVIIKGMTTSEERDI  172

Query  2347  LNGISGAVDPGEVLALMGPSGCGKTTLLSLLGGRIRDPS-AGSITYNQHPYSKLLKSRIG  2171
             L+GISGAV+PGEVLALMGPSG GKTTLL+LLGGR+   S  GSITYN  PYSK LKSRIG
Sbjct  173   LSGISGAVNPGEVLALMGPSGSGKTTLLNLLGGRLNQSSVGGSITYNDQPYSKFLKSRIG  232

Query  2170  FVTQDDILFPHLTVKETLIYAARLRLPRTLTKEEKDKRAMDVIYELGLDRCQDTMIGGSF  1991
             FVTQDD+LFPHLTVKETL YAARLRLP+TLTK++K+KRA+DVIYELGL+RCQDTMIGGSF
Sbjct  233   FVTQDDVLFPHLTVKETLTYAARLRLPKTLTKQQKEKRAIDVIYELGLERCQDTMIGGSF  292

Query  1990  VRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILHEIAKAGKTVITTI  1811
             VRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALR V  L +IA+AGKTVITTI
Sbjct  293   VRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRTVQTLQDIAEAGKTVITTI  352

Query  1810  HQPSSRLFHk--------------------------------fdklilleflldLANGNI  1727
             HQPSSRLFHK                                   +   EFLLDLANGNI
Sbjct  353   HQPSSRLFHKFDKLILLGKGSLLYFGKASEAIVYFSSIGCSPLIAMNPAEFLLDLANGNI  412

Query  1726  NDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYETRVAETEKKKLMAPLPV  1547
             ND+S+PSEL DKVQ  NS+ E TR NGKP PA+VHEYLV  YE+RVAE EKKKLM PLP+
Sbjct  413   NDISVPSELEDKVQMENSEAE-TR-NGKPPPAVVHEYLVEAYESRVAENEKKKLMTPLPL  470

Query  1546  EEELKSKVRYLKREWGASWSEQYVLLFHRGIRERWHDYFSWLRITQVIATALILGMLWWQ  1367
             +EELK KV   KR+WGASW +QY +LF RGI+ER HDYFSWLRITQV++TA+ILG+LWWQ
Sbjct  471   DEELKLKVSSSKRQWGASWWQQYCILFCRGIKERRHDYFSWLRITQVLSTAIILGLLWWQ  530

Query  1366  SGGDTPSQMQDQAGLLFFIAVFWGFFPVFTAIFTFPQEKAMLSKERAADMYRLSAYFAAR  1187
             S   +P   QDQAGLLFFIAVFWGFFPVFTAIFTFPQE+AMLSKERAADMYRLSAYF AR
Sbjct  531   SDSKSPKGRQDQAGLLFFIAVFWGFFPVFTAIFTFPQERAMLSKERAADMYRLSAYFLAR  590

Query  1186  TTSdlpldlllpliflLVVYFMAGLKQDASSFLLTAVTVFLCIVVAQGLGLAIGATLMDL  1007
             TTSDLPLDL+LP++FLLVVYFMAGL+                     GLGLAIGATLMDL
Sbjct  591   TTSDLPLDLILPVLFLLVVYFMAGLR---------------------GLGLAIGATLMDL  629

Query  1006  KKATTLASVTVMTFMLAGGYFIKK  935
             K+ATTLASVTVMTFMLAGGYF+K+
Sbjct  630   KRATTLASVTVMTFMLAGGYFVKE  653



>gb|EEC74548.1| hypothetical protein OsI_10084 [Oryza sativa Indica Group]
Length=771

 Score =   815 bits (2106),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 433/682 (63%), Positives = 520/682 (76%), Gaps = 47/682 (7%)
 Frame = -2

Query  2653  HIRKSRSAQMKLDLDElssgsvlsrassasl---GFSFTGFSVRPDE---SADSKPFSDD  2492
             HIRKSRSAQ+KL++++L S       +S++     F+FTGF+  P +   SA+  PFSDD
Sbjct  91    HIRKSRSAQLKLEMEDLVSSGAALSRASSASLGFSFTFTGFTPPPQDTMSSAELHPFSDD  150

Query  2491  ENPEDLEAGTKKKRSIPAEPTFPIYLKFTEVSYKIVIKGVTFSEEKDILNGISGAVDPGE  2312
             +N  D+EAGT +K+ +  EPT PIYLKF EV YK+ +KG      ++IL+GISG+  PGE
Sbjct  151   DNTMDIEAGTPRKK-LMTEPTLPIYLKFAEVKYKVAVKGT----PREILSGISGSAAPGE  205

Query  2311  VLALMGPSGCGKTTLLSLLGGRIRDPS--AGSITYNQHPYSKLLKSRIGFVTQDDILFPH  2138
             VLALMGPSG GKTTLLS+LGGR+  P    G ++YN  PY K L  RIGFVTQDD+LF H
Sbjct  206   VLALMGPSGSGKTTLLSILGGRVAGPGDVEGCVSYNDEPYCKSLNRRIGFVTQDDVLFTH  265

Query  2137  LTVKETLIYAARLRLPRTLTKEEKDKRAMDVIYELGLDRCQDTMIGGSFVRGVSGGERKR  1958
             LTVKETL YAA LRLPRT+T++EK++R MD+IYELGL+RCQDTMIGGSFVRGVSGGERKR
Sbjct  266   LTVKETLTYAALLRLPRTMTRQEKEERTMDIIYELGLERCQDTMIGGSFVRGVSGGERKR  325

Query  1957  VCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILHEIAKAGKTVITTIHQPSSRLFHk-  1781
             VCIGNEIIINPSLLFLDEPTSGLDSTTALRI+ +LH+IA+ GKTVITTIHQPSSRLFHK 
Sbjct  326   VCIGNEIIINPSLLFLDEPTSGLDSTTALRIIQLLHDIAEDGKTVITTIHQPSSRLFHKF  385

Query  1780  -------------------------------fdklilleflldLANGNINDVSIPSELAD  1694
                                               +   EFLLDLANGN  DVS+PSEL D
Sbjct  386   DKLILLGRGSLLYFGKASEAMPYFQSIGCTPLIAMNPAEFLLDLANGNTTDVSVPSELDD  445

Query  1693  KVQTWNSK-EEPTRNNGKPSPAIVHEYLVGCYETRVAETEKKKLMAPLPVEEELKSKVRY  1517
             KV   N   +  T+N+ KPS   VHEYLV  YE RVA   KK+L+ PLP+ +++K+ +  
Sbjct  446   KVHMENQNLQTNTKNDYKPSAQDVHEYLVDAYENRVAYKAKKQLLDPLPISDDMKTTITS  505

Query  1516  LKREWGASWSEQYVLLFHRGIRERWHDYFSWLRITQVIATALILGMLWWQSGGDTPSQMQ  1337
              KREWG SW +QY +LF RGI+ER HDY SW+RITQVIAT++ILG+LWW S   TP  +Q
Sbjct  506   SKREWGTSWWQQYSILFCRGIKERRHDYLSWMRITQVIATSVILGLLWWHSDPSTPKGLQ  565

Query  1336  DQAGLLFFIAVFWGFFPVFTAIFTFPQEKAMLSKERAADMYRLSAYFAARTTSdlpldll  1157
             DQAGLLFFIAVFWGFFPVFTAIFTFPQE+AML+KERAADMY+LSAYF ARTTSDLPLDL 
Sbjct  566   DQAGLLFFIAVFWGFFPVFTAIFTFPQERAMLNKERAADMYKLSAYFLARTTSDLPLDLF  625

Query  1156  lpliflLVVYFMAGLKQDASSFLLTAVTVFLCIVVAQGLGLAIGATLMDLKKATTLASVT  977
             LP+IF+++VYFMAGLK  A+ F L+ +TVFL I+ AQGLGLAIGA+L+D+KKATTLASVT
Sbjct  626   LPVIFMVIVYFMAGLKATAAHFFLSMLTVFLSIIAAQGLGLAIGASLLDIKKATTLASVT  685

Query  976   VMTFMLAGGYFIKKVPGFIVWLRDLSFNYHTFKLLLKVQYEHKTNS-VNGVQIDSGIKEV  800
             VMTFMLAGG+F+KKVP FI WLR LSFNYHT++LLLKVQY    +  +N + +D+G+ EV
Sbjct  686   VMTFMLAGGFFVKKVPPFISWLRYLSFNYHTYRLLLKVQYHPVPDILINAIPLDNGVTEV  745

Query  799   GALAAMAVSYRLLAYISLRRMK  734
              AL AM + YR+LAY+SLRR K
Sbjct  746   VALVAMIIGYRVLAYMSLRRTK  767



>ref|NP_001049014.1| Os03g0157400 [Oryza sativa Japonica Group]
 gb|ABF94064.1| ABC transporter family protein, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF10928.1| Os03g0157400 [Oryza sativa Japonica Group]
Length=771

 Score =   813 bits (2099),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 431/682 (63%), Positives = 520/682 (76%), Gaps = 47/682 (7%)
 Frame = -2

Query  2653  HIRKSRSAQMKLDLDElssgsvlsrassasl---GFSFTGFSVRPDE---SADSKPFSDD  2492
             HIRKSRSAQ+KL++++L S       +S++     F+FTGF+  P +   SA+  PFSDD
Sbjct  91    HIRKSRSAQLKLEMEDLVSSGAALSRASSASLGFSFTFTGFTPPPQDTMSSAELHPFSDD  150

Query  2491  ENPEDLEAGTKKKRSIPAEPTFPIYLKFTEVSYKIVIKGVTFSEEKDILNGISGAVDPGE  2312
             +N  D+EAGT +K+ +  EPT PIYLKF EV YK+ +KG      ++IL+GISG+  PGE
Sbjct  151   DNTMDIEAGTPRKK-LMTEPTLPIYLKFAEVKYKVAVKGT----PREILSGISGSAAPGE  205

Query  2311  VLALMGPSGCGKTTLLSLLGGRIRDPS--AGSITYNQHPYSKLLKSRIGFVTQDDILFPH  2138
             VLALMGPSG GKTTLLS+LGGR+  P    G ++YN  PY K L  RIGFVTQDD+LF H
Sbjct  206   VLALMGPSGSGKTTLLSILGGRVAGPGDVEGCVSYNDEPYCKSLNRRIGFVTQDDVLFTH  265

Query  2137  LTVKETLIYAARLRLPRTLTKEEKDKRAMDVIYELGLDRCQDTMIGGSFVRGVSGGERKR  1958
             LTVKETL YAA LRLPRT+T++EK++R +D+IYELGL+RCQDTMIGGSFVRGVSGGERKR
Sbjct  266   LTVKETLTYAALLRLPRTMTRQEKEERTIDIIYELGLERCQDTMIGGSFVRGVSGGERKR  325

Query  1957  VCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILHEIAKAGKTVITTIHQPSSRLFHk-  1781
             VCIGNEIIINPSLLFLDEPTSGLDSTTALRI+ +LH+IA+ GKTVITTIHQPSSRLFHK 
Sbjct  326   VCIGNEIIINPSLLFLDEPTSGLDSTTALRIIQLLHDIAEDGKTVITTIHQPSSRLFHKF  385

Query  1780  -------------------------------fdklilleflldLANGNINDVSIPSELAD  1694
                                               +   EFLLDLANGN  DVS+PSEL D
Sbjct  386   DKLILLGRGSLLYFGKASEAMPYFQSIGCTPLIAMNPAEFLLDLANGNTTDVSVPSELDD  445

Query  1693  KVQTWNSK-EEPTRNNGKPSPAIVHEYLVGCYETRVAETEKKKLMAPLPVEEELKSKVRY  1517
             KV   N   +  T+N+ KPS   VHEYLV  YE RVA   KK+L+ PLP+ +++K+ +  
Sbjct  446   KVHMENQNLQTNTKNDYKPSAQDVHEYLVDAYENRVAYKAKKQLLDPLPISDDMKTTITS  505

Query  1516  LKREWGASWSEQYVLLFHRGIRERWHDYFSWLRITQVIATALILGMLWWQSGGDTPSQMQ  1337
              KREWG SW +QY +LF RGI+ER HDY SW+RITQVIAT++ILG+LWW S   TP  +Q
Sbjct  506   SKREWGTSWWQQYSILFCRGIKERRHDYLSWMRITQVIATSVILGLLWWHSDPSTPKGLQ  565

Query  1336  DQAGLLFFIAVFWGFFPVFTAIFTFPQEKAMLSKERAADMYRLSAYFAARTTSdlpldll  1157
             DQAGLLFFIAVFWGFFPVFTAIFTFPQE+AML+KERAADMY+LSAYF ARTTSDLPLDL 
Sbjct  566   DQAGLLFFIAVFWGFFPVFTAIFTFPQERAMLNKERAADMYKLSAYFLARTTSDLPLDLF  625

Query  1156  lpliflLVVYFMAGLKQDASSFLLTAVTVFLCIVVAQGLGLAIGATLMDLKKATTLASVT  977
             LP+IF+++VYFMAGLK  A+ F L+ +TVFL I+ AQGLGLAIGA+L+D+KKATTLASVT
Sbjct  626   LPVIFMVIVYFMAGLKATAAHFFLSMLTVFLSIIAAQGLGLAIGASLLDIKKATTLASVT  685

Query  976   VMTFMLAGGYFIKKVPGFIVWLRDLSFNYHTFKLLLKVQYEHKTNS-VNGVQIDSGIKEV  800
             VMTFMLAGG+F+K+VP FI WLR LSFNYHT++LLLKVQY    +  +N + +D+G+ EV
Sbjct  686   VMTFMLAGGFFVKRVPPFISWLRYLSFNYHTYRLLLKVQYHPVPDILINAIPLDNGVTEV  745

Query  799   GALAAMAVSYRLLAYISLRRMK  734
              AL AM + YR+LAY+SLRR K
Sbjct  746   VALVAMIIGYRVLAYMSLRRTK  767



>ref|XP_010503972.1| PREDICTED: ABC transporter G family member 27-like isoform X1 
[Camelina sativa]
Length=746

 Score =   811 bits (2096),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 432/679 (64%), Positives = 520/679 (77%), Gaps = 37/679 (5%)
 Frame = -2

Query  2659  STHIRKSRSAQMKLDLDEls--sgsvlsrassaslGFSFTGFSVRPDESADSKPFSDDEN  2486
             +THIRK++SA   LDL  L+  +    + ++S  + FSFTGF+V  +E   S+  S+++ 
Sbjct  67    NTHIRKAKSAHPALDLAGLTGGAALSRASSASHGISFSFTGFTVPHEEIIASERCSNEDF  126

Query  2485  PEDLEAGTKKKRSIPAEPTFPIYLKFTEVSYKIVIKGVTFSEEKDILNGISGAVDPGEVL  2306
              ED+EA T       AEPTFPIYLKF +++YK+  KG+T S EK ILNGISG+  PGE+L
Sbjct  127   LEDIEAATSSVVKFQAEPTFPIYLKFIDITYKVTTKGMTSSSEKSILNGISGSAYPGELL  186

Query  2305  ALMGPSGCGKTTLLSLLGGRIRDPS-AGSITYNQHPYSKLLKSRIGFVTQDDILFPHLTV  2129
             ALMGPSG GKTTLL+  GGR    + +G ++YN  PYSK LK+RIGFVTQ+D+LFPHLTV
Sbjct  187   ALMGPSGSGKTTLLNFFGGRFNQQNVSGLVSYNDKPYSKHLKTRIGFVTQEDVLFPHLTV  246

Query  2128  KETLIYAARLRLPRTLTKEEKDKRAMDVIYELGLDRCQDTMIGGSFVRGVSGGERKRVCI  1949
              ETL Y ARLRLP+TLTK+EK++RA+ VI ELGL+RCQ TMIGGSFVRGVSGGERKRV I
Sbjct  247   IETLTYTARLRLPKTLTKQEKEQRAVSVIQELGLERCQGTMIGGSFVRGVSGGERKRVSI  306

Query  1948  GNEIIINPSLLFLDEPTSGLDSTTALRIVDILHEIAKAGKTVITTIHQPSSRLFHkfdkl  1769
             GNEI+ NPSLL LDEPTS LDSTTAL+IV +L  IAKAGKTV+TTIHQPSSRLFH+FDKL
Sbjct  307   GNEIMTNPSLLLLDEPTSSLDSTTALKIVQMLQSIAKAGKTVVTTIHQPSSRLFHRFDKL  366

Query  1768  illeflldL--------------------------------ANGNINDVSIPSELADKVQ  1685
             ++L     L                                ANGN+ND+SIPS L  K++
Sbjct  367   VVLSRGSLLYFGKASDAMSYFSSIGCSPLLAMNPAEFLLDLANGNMNDISIPSALKKKMK  426

Query  1684  TWNSKEEPTRNNGKPSPAIVHEYLVGCYETRVAETEKKKLMAPLPVEEELKSKVRYLKRE  1505
               NS  E    + KP+P IV+EYL   Y+T+++  EKKKLMAP+P+EEE+K  +   KRE
Sbjct  427   MENSCSEI--RSSKPTPTIVYEYLEEAYKTQISVVEKKKLMAPVPLEEEVKLMITCPKRE  484

Query  1504  WGASWSEQYVLLFHRGIRERWHDYFSWLRITQVIATALILGMLWWQSGGDTPSQMQDQAG  1325
             WG SW EQY LL  RGI+ER HDYFSWLR+TQV++TA+ILG+LWWQS    P  +QDQ G
Sbjct  485   WGLSWWEQYCLLSLRGIKERRHDYFSWLRVTQVLSTAIILGLLWWQSDIHHPKGLQDQVG  544

Query  1324  LLFFIAVFWGFFPVFTAIFTFPQEKAMLSKERAADMYRLSAYFAARTTSdlpldlllpli  1145
             LLFFIAVFWGFFPVFTAIFTFPQE+AMLSKER ++MYRLSAYF ARTTSDLPLDL+LP++
Sbjct  545   LLFFIAVFWGFFPVFTAIFTFPQERAMLSKERESNMYRLSAYFVARTTSDLPLDLILPVL  604

Query  1144  flLVVYFMAGLKQDASSFLLTAVTVFLCIVVAQGLGLAIGATLMDLKKATTLASVTVMTF  965
             FL+VVYFMAGL+  A SF L+ +TVFLCIV AQGLGLAIGA+LMDLKKATTLASVTVMTF
Sbjct  605   FLVVVYFMAGLRLSAESFFLSVLTVFLCIVAAQGLGLAIGASLMDLKKATTLASVTVMTF  664

Query  964   MLAGGYFIKKVPGFIVWLRDLSFNYHTFKLLLKVQYEHKTNSVNGVQIDSGIKEVGALAA  785
             MLAGGYF+KKVP FI W+R +SFNYHT+KLL+KVQY+    +VNG +I+SGIKEV AL A
Sbjct  665   MLAGGYFVKKVPVFIAWIRFMSFNYHTYKLLVKVQYQEIMENVNGEEIESGIKEVSALVA  724

Query  784   MAVSYRLLAYISLRRMKLQ  728
             M + YRLLAY+SLRRMKL 
Sbjct  725   MIIGYRLLAYLSLRRMKLH  743



>dbj|BAK06297.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=771

 Score =   812 bits (2098),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 433/683 (63%), Positives = 525/683 (77%), Gaps = 49/683 (7%)
 Frame = -2

Query  2656  THIRKSRSAQMKLDLDElssgsvlsrassasl---GFSFTGFSVRPDE---SADSKPFSD  2495
             +HIRKSRSAQ+KLD+++L S       +S++     F+FTGF+  P +   SA+  PFSD
Sbjct  92    SHIRKSRSAQLKLDMEDLVSSGAALSRASSASLGFSFTFTGFTPPPQDMMSSAELAPFSD  151

Query  2494  DENPEDLEAG-TKKKRSIPAEPTFPIYLKFTEVSYKIVIKGVTFSEEKDILNGISGAVDP  2318
             D+   DLEA  T +++S+ AEPT PIYLKF+EV Y++ +KG      ++IL+GISG+  P
Sbjct  152   DD--VDLEAADTTRRKSLMAEPTLPIYLKFSEVKYRVAVKGT----PREILSGISGSASP  205

Query  2317  GEVLALMGPSGCGKTTLLSLLGGRIRDPSAGSITYNQHPYSKLLKSRIGFVTQDDILFPH  2138
             GEVLA+MGPSG GKTTLLS+LGGR    + G I+YN  P+ K LK RIGFVTQDD+LF H
Sbjct  206   GEVLAMMGPSGSGKTTLLSMLGGRA-TAADGCISYNDEPFGKSLKRRIGFVTQDDVLFTH  264

Query  2137  LTVKETLIYAARLRLPRTLTKEEKDKRAMDVIYELGLDRCQDTMIGGSFVRGVSGGERKR  1958
             LTVKETL YAA LRLPRT+T+E+K +RAMD+IYELGL+RCQDTMIGGSFVRGVSGGERKR
Sbjct  265   LTVKETLTYAALLRLPRTMTREQKKERAMDIIYELGLERCQDTMIGGSFVRGVSGGERKR  324

Query  1957  VCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILHEIAKAGKTVITTIHQPSSRLFHk-  1781
             VCIGNEIIINPSLLFLDEPTSGLDSTTALRIV +LH+IA+ GKTV+TTIHQPSSRLFHK 
Sbjct  325   VCIGNEIIINPSLLFLDEPTSGLDSTTALRIVQLLHDIAETGKTVVTTIHQPSSRLFHKF  384

Query  1780  -------------------------------fdklilleflldLANGNINDVSIPSELAD  1694
                                               +   EFLLDLANGN NDVS+PSEL D
Sbjct  385   DKLILLGRGSLLYFGKTAEAMPYFSSIGCNPLIAMNPAEFLLDLANGNTNDVSVPSELDD  444

Query  1693  KVQTWNSKEEPTRN--NGKPSPAIVHEYLVGCYETRVAETEKKKLMAPLPVEEELKSKVR  1520
             K+   N   + T +  N +PS   VHEYLV  YE RVA  EKKKL+APLP+ +++K+ + 
Sbjct  445   KLHMENQNLQDTNSKINLRPSAQDVHEYLVDAYEHRVAYKEKKKLLAPLPISDDMKATIT  504

Query  1519  YLKREWGASWSEQYVLLFHRGIRERWHDYFSWLRITQVIATALILGMLWWQSGGDTPSQM  1340
               KREWG +W +QY +LF RG++ER HDY SW+RITQVIAT++ILG+LWW+S   TP  +
Sbjct  505   SSKREWGTNWCQQYSILFCRGLKERRHDYLSWMRITQVIATSIILGLLWWRSDPTTPKGL  564

Query  1339  QDQAGLLFFIAVFWGFFPVFTAIFTFPQEKAMLSKERAADMYRLSAYFAARTTSdlpldl  1160
             QDQAGLLFFIAVFWGFFPVFTAIFTFPQE+AML+KERA DMY+LSAYF ARTTSDLPLDL
Sbjct  565   QDQAGLLFFIAVFWGFFPVFTAIFTFPQERAMLNKERAVDMYKLSAYFLARTTSDLPLDL  624

Query  1159  llpliflLVVYFMAGLKQDASSFLLTAVTVFLCIVVAQGLGLAIGATLMDLKKATTLASV  980
              LP+IF+++VYFMAGLK  A  F L+ +TVFL I+ AQGLGLAIGATL+D+KKATTLASV
Sbjct  625   FLPVIFMVIVYFMAGLKASAMHFFLSMLTVFLSIIAAQGLGLAIGATLLDIKKATTLASV  684

Query  979   TVMTFMLAGGYFIKKVPGFIVWLRDLSFNYHTFKLLLKVQYEHKTNSV-NGVQIDSGIKE  803
             TVMTFMLAGG+F+K+VP FI WLR LSFNYHT++LLLKVQY+   + +   V +D+G+ E
Sbjct  685   TVMTFMLAGGFFVKRVPPFISWLRYLSFNYHTYRLLLKVQYDPVPDILMTSVPLDNGVTE  744

Query  802   VGALAAMAVSYRLLAYISLRRMK  734
             VGAL AM + YR+LAY+SLRR+K
Sbjct  745   VGALVAMIIGYRVLAYLSLRRVK  767



>ref|XP_004494280.1| PREDICTED: ABC transporter G family member 22-like isoform X3 
[Cicer arietinum]
 ref|XP_004494281.1| PREDICTED: ABC transporter G family member 22-like isoform X4 
[Cicer arietinum]
 ref|XP_004494282.1| PREDICTED: ABC transporter G family member 22-like isoform X5 
[Cicer arietinum]
 ref|XP_004494283.1| PREDICTED: ABC transporter G family member 22-like isoform X6 
[Cicer arietinum]
Length=581

 Score =   803 bits (2074),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/582 (71%), Positives = 474/582 (81%), Gaps = 35/582 (6%)
 Frame = -2

Query  2374  VTFSEEKDILNGISGAVDPGEVLALMGPSGCGKTTLLSLLGGRIRDPS-AGSITYNQHPY  2198
             +T S EKDIL GISG V+PGEVLALMGPSG GKT+LL+LLG R   P+  GSITYN  PY
Sbjct  1     MTTSVEKDILKGISGCVNPGEVLALMGPSGSGKTSLLNLLGARSCQPTVGGSITYNDQPY  60

Query  2197  SKLLKSRIGFVTQDDILFPHLTVKETLIYAARLRLPRTLTKEEKDKRAMDVIYELGLDRC  2018
             SK LKSRIGFVTQDD+LFPHLTVKETL YAARLRLP+TLT+++K+KRA+DVIYELGL+RC
Sbjct  61    SKFLKSRIGFVTQDDVLFPHLTVKETLTYAARLRLPKTLTRQQKEKRALDVIYELGLERC  120

Query  2017  QDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILHEIAK  1838
             QDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIV +LH+IA+
Sbjct  121   QDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVQMLHDIAE  180

Query  1837  AGKTVITTIHQPSSRLFHk--------------------------------fdklillef  1754
             AGKT++TTIHQPSSRLFHK                                   +   EF
Sbjct  181   AGKTIVTTIHQPSSRLFHKFDKLILLGKGNLLYFGKASEAMDYFGFIGCTPLIAMNPAEF  240

Query  1753  lldLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYETRVAETEK  1574
             LLDLANGN+ND+S+PSEL DKV   N + E +  NGKPS A+V +YLV  YETRVAETEK
Sbjct  241   LLDLANGNMNDISVPSELEDKVHMGNVEVETS--NGKPSAAVVQDYLVEAYETRVAETEK  298

Query  1573  KKLMAPLPVEEELKSKVRYLKREWGASWSEQYVLLFHRGIRERWHDYFSWLRITQVIATA  1394
             KKLM P+P++EE+KSKV   KR+WGASW EQY +LF RG +ER H+YFSWLRITQV++TA
Sbjct  299   KKLMDPIPLDEEVKSKVYSRKRQWGASWFEQYTILFSRGFKERRHEYFSWLRITQVLSTA  358

Query  1393  LILGMLWWQSGGDTPSQMQDQAGLLFFIAVFWGFFPVFTAIFTFPQEKAMLSKERAADMY  1214
             +ILG+LWWQS    P  +QDQAGLLFFIAVFWGFFPVFTAIFTFPQE+AML+KERA DMY
Sbjct  359   VILGLLWWQSDASNPKGLQDQAGLLFFIAVFWGFFPVFTAIFTFPQERAMLNKERATDMY  418

Query  1213  RLSAYFAARTTSdlpldlllpliflLVVYFMAGLKQDASSFLLTAVTVFLCIVVAQGLGL  1034
             RLSAYF ARTTSDLPLDL+LP++FL+VVYFM GL+     F L+ +TVFLC+V AQGLGL
Sbjct  419   RLSAYFVARTTSDLPLDLVLPVLFLIVVYFMTGLRLSVGPFFLSILTVFLCVVAAQGLGL  478

Query  1033  AIGATLMDLKKATTLASVTVMTFMLAGGYFIKKVPGFIVWLRDLSFNYHTFKLLLKVQYE  854
             AIGATLMDLK+ATTLASVTVMTFMLAGG+F+KKVP FI W+R LSFNYHT+ LLLKVQYE
Sbjct  479   AIGATLMDLKRATTLASVTVMTFMLAGGFFVKKVPIFISWIRYLSFNYHTYNLLLKVQYE  538

Query  853   HKTNSVNGVQIDSGIKEVGALAAMAVSYRLLAYISLRRMKLQ  728
             H T S+NG++IDSG  EV AL AM   YR+LAY SLR MK+Q
Sbjct  539   HITPSINGIRIDSGYNEVVALIAMVFGYRILAYFSLRWMKIQ  580



>ref|XP_006403815.1| hypothetical protein EUTSA_v10010138mg [Eutrema salsugineum]
 gb|ESQ45268.1| hypothetical protein EUTSA_v10010138mg [Eutrema salsugineum]
Length=770

 Score =   809 bits (2090),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/679 (63%), Positives = 521/679 (77%), Gaps = 38/679 (6%)
 Frame = -2

Query  2659  STHIRKSRSAQMKLDLDEls--sgsvlsrassaslGFSFTGFSVRPDES-ADSKPFSDDE  2489
             +THIRK++SA   LDL  L+  +    + ++S  L FSFTGF+V  +E  A  K  S+D+
Sbjct  90    NTHIRKAKSAHPALDLARLTGGAALSRASSASLGLSFSFTGFAVPHEEIIASEKSCSNDD  149

Query  2488  NPEDLEAGTKKKRSIPAEPTFPIYLKFTEVSYKIVIKGVTFSEEKDILNGISGAVDPGEV  2309
               E +EA T     + AEPTFPIYLKF +++YK+  KG+  S EK ILNGISG+  PGE+
Sbjct  150   ISEVIEAATSSVVKLQAEPTFPIYLKFIDITYKVTTKGMASSSEKSILNGISGSAYPGEL  209

Query  2308  LALMGPSGCGKTTLLSLLGGRIRDPS-AGSITYNQHPYSKLLKSRIGFVTQDDILFPHLT  2132
             LAL+GPSG GKTTLL+LLGGR    +  GS++YN  PYSK LK+R+GFVTQDD+LF HLT
Sbjct  210   LALIGPSGSGKTTLLNLLGGRFNQHNIGGSVSYNDKPYSKHLKTRVGFVTQDDVLFTHLT  269

Query  2131  VKETLIYAARLRLPRTLTKEEKDKRAMDVIYELGLDRCQDTMIGGSFVRGVSGGERKRVC  1952
             VKETL Y A LRLP+ LTK++K++RA+ VI ELGL+RCQDTMIGGSFVRGVSGGERKRVC
Sbjct  270   VKETLTYTALLRLPKNLTKQQKEQRALSVIQELGLERCQDTMIGGSFVRGVSGGERKRVC  329

Query  1951  IGNEIIINPSLLFLDEPTSGLDSTTALRIVDILHEIAKAGKTVITTIHQPSSRLFHkfdk  1772
             IGNEII NPSLLFLDEPTS LDSTTAL+IV +L  IAKAGKT++TTIHQPSSRLFH+FDK
Sbjct  330   IGNEIITNPSLLFLDEPTSSLDSTTALKIVQMLQSIAKAGKTIVTTIHQPSSRLFHRFDK  389

Query  1771  lilleflldL--------------------------------ANGNINDVSIPSELADKV  1688
             L++L     L                                ANGN+ND+SIPS L +K+
Sbjct  390   LVVLSRGSLLYFGKASEAMSFFTSVGCSPLLAMNPAEFLLDLANGNMNDISIPSTLKEKM  449

Query  1687  QTWNSKEEPTRNNGKPSPAIVHEYLVGCYETRVAETEKKKLMAPLPVEEELKSKVRYLKR  1508
             +  NS  +    + KP+P +V+EYL   Y+T +A  EKKKL+AP+P++EE+K  +   KR
Sbjct  450   KNENSCSKII--SSKPTPTVVYEYLEEAYKTHIAVMEKKKLLAPVPLDEEVKVMITCPKR  507

Query  1507  EWGASWSEQYVLLFHRGIRERWHDYFSWLRITQVIATALILGMLWWQSGGDTPSQMQDQA  1328
             EWG SW EQY +L  RG +ER HDYFSWLR+TQV++TA+ILG+LWWQS  + P  +QDQ 
Sbjct  508   EWGLSWWEQYCILSLRGFKERRHDYFSWLRVTQVLSTAIILGLLWWQSDIEHPKGLQDQV  567

Query  1327  GLLFFIAVFWGFFPVFTAIFTFPQEKAMLSKERAADMYRLSAYFAARTTSdlpldlllpl  1148
             GLLFFIAVFWGFFPVFTAIFTFPQE+AMLSKER ++MYRLSAYF ARTTSDLPLDL+LP+
Sbjct  568   GLLFFIAVFWGFFPVFTAIFTFPQERAMLSKERESNMYRLSAYFMARTTSDLPLDLILPV  627

Query  1147  iflLVVYFMAGLKQDASSFLLTAVTVFLCIVVAQGLGLAIGATLMDLKKATTLASVTVMT  968
             +FL+VVYFMAGL+  A SF L+ +TVFLCIV AQGLGLAIGA+ MDLKKATTLASVTVMT
Sbjct  628   LFLVVVYFMAGLRLRAESFFLSVLTVFLCIVAAQGLGLAIGASFMDLKKATTLASVTVMT  687

Query  967   FMLAGGYFIKKVPGFIVWLRDLSFNYHTFKLLLKVQYEHKTNSVNGVQIDSGIKEVGALA  788
             FMLAGGYF+KKVP FI W+R +SFNYHT+KLL+KVQYE    +VNG +I+SG++EV AL 
Sbjct  688   FMLAGGYFVKKVPVFIAWIRFMSFNYHTYKLLVKVQYEEIMQNVNGEEIESGLQEVSALV  747

Query  787   AMAVSYRLLAYISLRRMKL  731
             AM + YRLLAYISLRRMKL
Sbjct  748   AMIIGYRLLAYISLRRMKL  766



>gb|KDO70706.1| hypothetical protein CISIN_1g0045372mg [Citrus sinensis]
Length=583

 Score =   801 bits (2070),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/582 (71%), Positives = 479/582 (82%), Gaps = 35/582 (6%)
 Frame = -2

Query  2374  VTFSEEKDILNGISGAVDPGEVLALMGPSGCGKTTLLSLLGGRIRDPS-AGSITYNQHPY  2198
             +T SEEKDILNGI+G+V+PGEVLALMGPSG GKTTLL+LL GR+ +P+  GSITYN HPY
Sbjct  1     MTSSEEKDILNGITGSVNPGEVLALMGPSGSGKTTLLNLLSGRLMEPTVGGSITYNDHPY  60

Query  2197  SKLLKSRIGFVTQDDILFPHLTVKETLIYAARLRLPRTLTKEEKDKRAMDVIYELGLDRC  2018
             SK LKS+IGFVTQDD+LFPHLTVKETL YAA LRLP TLTK++K+KRA+DVI ELGL+RC
Sbjct  61    SKSLKSKIGFVTQDDVLFPHLTVKETLTYAALLRLPNTLTKQQKEKRAIDVINELGLERC  120

Query  2017  QDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILHEIAK  1838
             QDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIV +L +IA+
Sbjct  121   QDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVQMLQDIAE  180

Query  1837  AGKTVITTIHQPSSRLFHk--------------------------------fdklillef  1754
             AGKTV+TTIHQPSSRLFHK                                   +   EF
Sbjct  181   AGKTVVTTIHQPSSRLFHKFDKLILLGKGSLLYFGKASEAMAYFSSIGCSPQIAMNPAEF  240

Query  1753  lldLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYETRVAETEK  1574
             LLDLANGN++DVS+PSEL D+VQT NS+ +    NGKP+PAIVHEYLV  YETRVAE EK
Sbjct  241   LLDLANGNLHDVSVPSELQDRVQTENSENDTA--NGKPTPAIVHEYLVEAYETRVAENEK  298

Query  1573  KKLMAPLPVEEELKSKVRYLKREWGASWSEQYVLLFHRGIRERWHDYFSWLRITQVIATA  1394
             KKLMAP+P++EE+K+KV   KR WGASW +QY +LF RGI+E  HDYFSWLRITQV+ATA
Sbjct  299   KKLMAPIPLDEEIKAKVSSPKRNWGASWIQQYTILFRRGIKEHRHDYFSWLRITQVLATA  358

Query  1393  LILGMLWWQSGGDTPSQMQDQAGLLFFIAVFWGFFPVFTAIFTFPQEKAMLSKERAADMY  1214
             +ILG+LWWQS   +P  ++DQAGLLFFIAVFW FFP+FTAIFTFPQE+AMLSKERAADMY
Sbjct  359   VILGLLWWQSDSKSPKGLEDQAGLLFFIAVFWSFFPIFTAIFTFPQERAMLSKERAADMY  418

Query  1213  RLSAYFAARTTSdlpldlllpliflLVVYFMAGLKQDASSFLLTAVTVFLCIVVAQGLGL  1034
             RLSAYF ARTTSDLPL+L+LP++FL++VYFMAGL+  A  F L+ +TVFL IV AQGLGL
Sbjct  419   RLSAYFLARTTSDLPLNLVLPVLFLVIVYFMAGLRMGAGPFFLSMLTVFLSIVAAQGLGL  478

Query  1033  AIGATLMDLKKATTLASVTVMTFMLAGGYFIKKVPGFIVWLRDLSFNYHTFKLLLKVQYE  854
             AIGA LMDLKKATTLASVT+MTFMLAGGYF+++VP FI W+R +SFN+HT+K+LLK+QY 
Sbjct  479   AIGAILMDLKKATTLASVTIMTFMLAGGYFVQEVPVFISWIRYMSFNFHTYKILLKIQYA  538

Query  853   HKTNSVNGVQIDSGIKEVGALAAMAVSYRLLAYISLRRMKLQ  728
               +  VNG++ DSG +EV AL AM   YRLLAY+SLR+MKL 
Sbjct  539   DISPIVNGMRTDSGFREVCALVAMVFGYRLLAYLSLRKMKLH  580



>dbj|BAJ88390.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=771

 Score =   808 bits (2087),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 432/683 (63%), Positives = 523/683 (77%), Gaps = 49/683 (7%)
 Frame = -2

Query  2656  THIRKSRSAQMKLDLDElssgsvlsrassasl---GFSFTGFSVRPDE---SADSKPFSD  2495
             +HIRKSRSAQ+KLD+++L S       +S++     F+FTGF+  P +   SA+  PFSD
Sbjct  92    SHIRKSRSAQLKLDMEDLVSSGAALSRASSASLGFSFTFTGFTPPPQDMMSSAELAPFSD  151

Query  2494  DENPEDLEAG-TKKKRSIPAEPTFPIYLKFTEVSYKIVIKGVTFSEEKDILNGISGAVDP  2318
             D+   DLEA  T +++S+ AEPT PIYLKF+EV Y++ +KG      ++IL+GISG   P
Sbjct  152   DD--VDLEAADTTRRKSLMAEPTLPIYLKFSEVKYRVAVKGT----PREILSGISGPASP  205

Query  2317  GEVLALMGPSGCGKTTLLSLLGGRIRDPSAGSITYNQHPYSKLLKSRIGFVTQDDILFPH  2138
             GEVLA+MGPSG GKTTLLS+LGGR    + G I+YN  P+ K LK RIGFVTQDD+LF H
Sbjct  206   GEVLAMMGPSGSGKTTLLSMLGGRA-TAADGCISYNDEPFGKSLKRRIGFVTQDDVLFTH  264

Query  2137  LTVKETLIYAARLRLPRTLTKEEKDKRAMDVIYELGLDRCQDTMIGGSFVRGVSGGERKR  1958
             LTVKETL YAA LRLPRT+T+E+K +RAMD+IYELGL+RCQDTMIGGSFVRGVSGG RKR
Sbjct  265   LTVKETLTYAALLRLPRTMTREQKKERAMDIIYELGLERCQDTMIGGSFVRGVSGGGRKR  324

Query  1957  VCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILHEIAKAGKTVITTIHQPSSRLFHk-  1781
             VCIGNEIIINPSLLFLDEPTSGLDSTTALRIV +LH+IA+ GKTV+TTIHQPSSRLFHK 
Sbjct  325   VCIGNEIIINPSLLFLDEPTSGLDSTTALRIVQLLHDIAETGKTVVTTIHQPSSRLFHKF  384

Query  1780  -------------------------------fdklilleflldLANGNINDVSIPSELAD  1694
                                               +   EFLLDLANGN NDVS+PSEL D
Sbjct  385   DKLILLGRGSLLYFGKTAEAMPYFSSIGCNPLIAMNPAEFLLDLANGNTNDVSVPSELDD  444

Query  1693  KVQTWNSKEEPTRN--NGKPSPAIVHEYLVGCYETRVAETEKKKLMAPLPVEEELKSKVR  1520
             K+   N   + T +  N +PS   VHEYLV  YE RVA  EKKKL+APLP+ +++K+ + 
Sbjct  445   KLHMENQNLQDTNSKINLRPSAQDVHEYLVDAYEHRVAYKEKKKLLAPLPISDDMKATIT  504

Query  1519  YLKREWGASWSEQYVLLFHRGIRERWHDYFSWLRITQVIATALILGMLWWQSGGDTPSQM  1340
               KREWG +W +QY +LF RG++ER HDY SW+RITQVIAT++ILG+LWW+S   TP  +
Sbjct  505   SSKREWGTNWCQQYSILFCRGLKERRHDYLSWMRITQVIATSIILGLLWWRSDPTTPKGL  564

Query  1339  QDQAGLLFFIAVFWGFFPVFTAIFTFPQEKAMLSKERAADMYRLSAYFAARTTSdlpldl  1160
             QDQAGLLFFIAVFWGFFPVFTAIFTFPQE+AML+KERA DMY+LSAYF ARTTSDLPLDL
Sbjct  565   QDQAGLLFFIAVFWGFFPVFTAIFTFPQERAMLNKERAVDMYKLSAYFLARTTSDLPLDL  624

Query  1159  llpliflLVVYFMAGLKQDASSFLLTAVTVFLCIVVAQGLGLAIGATLMDLKKATTLASV  980
              LP+IF+++VYFMAGLK  A  F L+ +TVFL I+ AQGLGLAIGATL+D+KKATTLASV
Sbjct  625   FLPVIFMVIVYFMAGLKASAMHFFLSMLTVFLSIIAAQGLGLAIGATLLDIKKATTLASV  684

Query  979   TVMTFMLAGGYFIKKVPGFIVWLRDLSFNYHTFKLLLKVQYEHKTNSV-NGVQIDSGIKE  803
             TVMTFMLAGG+F+K+VP FI WLR LSFNYHT++LLLKVQY+   + +   V +D+G+ E
Sbjct  685   TVMTFMLAGGFFVKRVPPFISWLRYLSFNYHTYRLLLKVQYDPVPDILMTSVPLDNGVTE  744

Query  802   VGALAAMAVSYRLLAYISLRRMK  734
             VGAL AM + YR+LAY+SLRR+K
Sbjct  745   VGALVAMIIGYRVLAYLSLRRVK  767



>ref|XP_004985644.1| PREDICTED: ABC transporter G family member 22-like isoform X1 
[Setaria italica]
Length=759

 Score =   807 bits (2085),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 431/683 (63%), Positives = 519/683 (76%), Gaps = 45/683 (7%)
 Frame = -2

Query  2659  STHIRKSRSAQMKLDLDElssgsvlsrassasl---GFSFTGFSVRPD--ESADSKPFSD  2495
             ++HIRKSRSAQ+KLD+++L S S     +S++     F+FTGF+  P    SAD   FSD
Sbjct  77    NSHIRKSRSAQLKLDVEDLVSNSAALSRASSASLGFSFTFTGFTPPPQYMHSADPATFSD  136

Query  2494  DENPEDLEAGTKKKRSIPAEPTFPIYLKFTEVSYKIVIKGVTFSEEKDILNGISGAVDPG  2315
             D+ P D+EAGT++++ +  EPT PIYLKFTEV Y++  KG      ++IL GISG+  PG
Sbjct  137   DDTPMDIEAGTRRRKKLMTEPTMPIYLKFTEVKYRVAAKG----SPREILGGISGSASPG  192

Query  2314  EVLALMGPSGCGKTTLLSLLGGRIRDPSA-GSITYNQHPYSKLLKSRIGFVTQDDILFPH  2138
             EVLALMGPSG GKTTLLS+LGGR    +  G I+YN  PY K LK RIGFVTQDD+LF H
Sbjct  193   EVLALMGPSGSGKTTLLSILGGRAGGGAVEGCISYNDEPYCKSLKRRIGFVTQDDVLFTH  252

Query  2137  LTVKETLIYAARLRLPRTLTKEEKDKRAMDVIYELGLDRCQDTMIGGSFVRGVSGGERKR  1958
             LTVKETL YAA LRLPRT+T+++K +RAMD+IYELGL+RCQDTMIGGSFVRGVSGGERKR
Sbjct  253   LTVKETLTYAALLRLPRTMTRQQKKERAMDIIYELGLERCQDTMIGGSFVRGVSGGERKR  312

Query  1957  VCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILHEIAKAGKTVITTIHQPSSRLFHk-  1781
             VCIGNEI+INPSLLFLDEPTSGLDSTTALRIV +LH+IA+ GKTVITTIHQPSSRLFH  
Sbjct  313   VCIGNEILINPSLLFLDEPTSGLDSTTALRIVQLLHDIAEDGKTVITTIHQPSSRLFHNF  372

Query  1780  -------------------------------fdklilleflldLANGNINDVSIPSELAD  1694
                                               +   EFLLDLANGN NDVS+PSEL D
Sbjct  373   DKLILLGKGSLLYFGKASEAMPYFQSIGCTPLFAMNPAEFLLDLANGNTNDVSVPSELDD  432

Query  1693  KVQTWNSKEEP--TRNNGKPSPAIVHEYLVGCYETRVAETEKKKLMAPLPVEEELKSKVR  1520
             KV   N   E   ++N+ +PS   VHEYLV  YETRVA  EKKKL+APLP+ ++LK+ + 
Sbjct  433   KVHMENHNLENNNSKNDCRPSAQDVHEYLVDAYETRVAFKEKKKLLAPLPISDDLKATIT  492

Query  1519  YLKREWGASWSEQYVLLFHRGIRERWHDYFSWLRITQVIATALILGMLWWQSGGDTPSQM  1340
               KREWG SW +QY +LF RGI+ER HDY SW+RITQVIAT++ILG+LWW+S   T   +
Sbjct  493   SSKREWGTSWWQQYSILFCRGIKERRHDYLSWMRITQVIATSVILGLLWWRSDPRTLKGL  552

Query  1339  QDQAGLLFFIAVFWGFFPVFTAIFTFPQEKAMLSKERAADMYRLSAYFAARTTSdlpldl  1160
             +DQAGLLFFIAVFWGFFPVFTAIFTFPQE+AML+KERA DMY+LSAYF ARTTSDLPLDL
Sbjct  553   EDQAGLLFFIAVFWGFFPVFTAIFTFPQERAMLNKERAVDMYKLSAYFLARTTSDLPLDL  612

Query  1159  llpliflLVVYFMAGLKQDASSFLLTAVTVFLCIVVAQGLGLAIGATLMDLKKATTLASV  980
              LP++F+++VYFMAGLK  A+ F L+ +TVFL I+ AQGLGL IGA+L+D+KKATTLASV
Sbjct  613   FLPVVFMVIVYFMAGLKATATHFFLSMLTVFLSIIAAQGLGLVIGASLLDIKKATTLASV  672

Query  979   TVMTFMLAGGYFIKKVPGFIVWLRDLSFNYHTFKLLLKVQYEHKTNSVNGVQ-IDSGIKE  803
             TVMTFMLAGG+F+K VP FI WLR LSFNYHT++LLLKVQY+     +   + +D+G  E
Sbjct  673   TVMTFMLAGGFFVKTVPPFISWLRYLSFNYHTYRLLLKVQYDPVPEILTTTKHMDNGATE  732

Query  802   VGALAAMAVSYRLLAYISLRRMK  734
             V AL AM + YR+LAY+SLRR+ 
Sbjct  733   VAALVAMIIGYRVLAYLSLRRVN  755



>ref|XP_010553410.1| PREDICTED: ABC transporter G family member 27-like isoform X1 
[Tarenaya hassleriana]
 ref|XP_010553411.1| PREDICTED: ABC transporter G family member 27-like isoform X1 
[Tarenaya hassleriana]
Length=736

 Score =   806 bits (2081),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 433/677 (64%), Positives = 528/677 (78%), Gaps = 42/677 (6%)
 Frame = -2

Query  2659  STHIRKSRSAQMKLDLDElssgsvlsrassaslGFSFTGFSVRPDESADSKPFSDDENPE  2480
             +T+IRK++SAQ  LD     +    + ++S  L FSFTGF++ P+E  DS PFSDD+ PE
Sbjct  66    NTYIRKAKSAQPALD----GAALSRASSASLGLSFSFTGFTMPPEEIIDSNPFSDDDIPE  121

Query  2479  DLEAGTKKKRSIPAEPTFPIYLKFTEVSYKIVIKGVTFSEEKDILNGISGAVDPGEVLAL  2300
             D+EAG  + +    EPT PIYLKF +++YK V KG+  S EK ILNGI+G+  PG+++AL
Sbjct  122   DVEAGHDELK-FQTEPTLPIYLKFIDITYK-VTKGMK-SSEKTILNGITGSAYPGDLVAL  178

Query  2299  MGPSGCGKTTLLSLLGGRIRDPS-AGSITYNQHPYSKLLKSRIGFVTQDDILFPHLTVKE  2123
             MGPSG GKTTLL+LLGGR+   +  GSI+YN  PYSK LKSR+GFVTQDD+LFPHLTV+E
Sbjct  179   MGPSGSGKTTLLNLLGGRLNQQNVGGSISYNDKPYSKHLKSRMGFVTQDDVLFPHLTVRE  238

Query  2122  TLIYAARLRLPRTLTKEEKDKRAMDVIYELGLDRCQDTMIGGSFVRGVSGGERKRVCIGN  1943
             TL Y A LRLP+TLTK +K++RA+ VI ELGL+RCQDTMIGGSFVRG+SGGERKRVCIGN
Sbjct  239   TLTYTALLRLPQTLTKHQKEQRALSVIQELGLERCQDTMIGGSFVRGISGGERKRVCIGN  298

Query  1942  EIIINPSLLFLDEPTSGLDSTTALRIVDILHEIAKAGKTVITTIHQPSSRLFHk------  1781
             EI+INPS+LFLDEPTS LDSTTAL+IV +L  IA+AGKT++TTIHQPSSRLFH+      
Sbjct  299   EIMINPSILFLDEPTSSLDSTTALKIVQMLQSIAEAGKTIVTTIHQPSSRLFHRFDKLIM  358

Query  1780  --------------------------fdklilleflldLANGNINDVSIPSELADKVQTW  1679
                                          +   EFLLDLANGN+ND+SIPS+L +  QT 
Sbjct  359   LSRGSLLYFGKASQAMSYFSSLGCYPLLTMNPAEFLLDLANGNMNDISIPSDLGNNEQTE  418

Query  1678  NSKEEPTRNNGKPSPAIVHEYLVGCYETRVAETEKKKLMAPLPVEEELKSKVRYLKREWG  1499
             NS       + KP+PA V+E+LV  Y+T++A  EKKK+M P+P++EE+K  +  LKR+WG
Sbjct  419   NSYT--VIRSSKPTPAAVYEFLVEAYQTQLAVVEKKKIMTPVPLDEEVKLMISCLKRDWG  476

Query  1498  ASWSEQYVLLFHRGIRERWHDYFSWLRITQVIATALILGMLWWQSGGDTPSQMQDQAGLL  1319
              +W EQY +LF RGI+ER HDYFSWLRITQV++TA+ILG+LWWQS    P  +QDQ GLL
Sbjct  477   LNWWEQYSILFLRGIKERRHDYFSWLRITQVLSTAIILGLLWWQSDSHHPKGLQDQVGLL  536

Query  1318  FFIAVFWGFFPVFTAIFTFPQEKAMLSKERAADMYRLSAYFAARTTSdlpldlllplifl  1139
             FFIAVFWGFFPVFTAIFTFPQE+AML+KER ++MYRLSAYF ARTTSDLPLDL+LP++FL
Sbjct  537   FFIAVFWGFFPVFTAIFTFPQERAMLTKERESNMYRLSAYFLARTTSDLPLDLILPVLFL  596

Query  1138  LVVYFMAGLKQDASSFLLTAVTVFLCIVVAQGLGLAIGATLMDLKKATTLASVTVMTFML  959
             +VVYFMAGL+  + SF L+ +TVFLCIV AQGLGLAIGATLMDLKKATTLASVTVMTFML
Sbjct  597   VVVYFMAGLRPKSESFFLSVLTVFLCIVAAQGLGLAIGATLMDLKKATTLASVTVMTFML  656

Query  958   AGGYFIKKVPGFIVWLRDLSFNYHTFKLLLKVQYEHKTNSVNGVQIDSGIKEVGALAAMA  779
             AGGYF+KKVP FI W+R +SFNYHT+KLLLKVQY+    +VNG QI++G+KEVGAL  M 
Sbjct  657   AGGYFVKKVPIFIAWIRYMSFNYHTYKLLLKVQYQQIMQNVNGEQIENGLKEVGALVVMI  716

Query  778   VSYRLLAYISLRRMKLQ  728
               YRLLAY+SLRRMKLQ
Sbjct  717   FGYRLLAYLSLRRMKLQ  733



>ref|XP_006430004.1| hypothetical protein CICLE_v10011143mg [Citrus clementina]
 gb|ESR43244.1| hypothetical protein CICLE_v10011143mg [Citrus clementina]
Length=583

 Score =   800 bits (2065),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/582 (70%), Positives = 478/582 (82%), Gaps = 35/582 (6%)
 Frame = -2

Query  2374  VTFSEEKDILNGISGAVDPGEVLALMGPSGCGKTTLLSLLGGRIRDPS-AGSITYNQHPY  2198
             +T SEEKDILNGI+G+V+PGEVLALMGPSG GKTTLL+LL GR+ +P+  GSITYN HPY
Sbjct  1     MTSSEEKDILNGITGSVNPGEVLALMGPSGSGKTTLLNLLSGRLMEPTVGGSITYNDHPY  60

Query  2197  SKLLKSRIGFVTQDDILFPHLTVKETLIYAARLRLPRTLTKEEKDKRAMDVIYELGLDRC  2018
             SK LKS+IGFVTQDD+LFPHLTVKETL YAA LRLP TLTK++K+KRA+DVI ELGL+RC
Sbjct  61    SKSLKSKIGFVTQDDVLFPHLTVKETLTYAALLRLPNTLTKQQKEKRAIDVINELGLERC  120

Query  2017  QDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILHEIAK  1838
             QDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALR V +L +IA+
Sbjct  121   QDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRTVQMLQDIAE  180

Query  1837  AGKTVITTIHQPSSRLFHk--------------------------------fdklillef  1754
             AGKTV+TTIHQPSSRLFHK                                   +   EF
Sbjct  181   AGKTVVTTIHQPSSRLFHKFDKLILLGKGSLLYFGKASEAMTYFSSIGCSPQIAMNPAEF  240

Query  1753  lldLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYETRVAETEK  1574
             LLDLANGN++DVS+PSEL D+VQT NS+ +    NGKP+PAIVHEYLV  YETRVAE EK
Sbjct  241   LLDLANGNLHDVSVPSELQDRVQTENSENDTA--NGKPTPAIVHEYLVEAYETRVAENEK  298

Query  1573  KKLMAPLPVEEELKSKVRYLKREWGASWSEQYVLLFHRGIRERWHDYFSWLRITQVIATA  1394
             KKLMAP+P++EE+K+KV   KR WGASW +QY +LF RGI+E  HDYFSWLRITQV+ATA
Sbjct  299   KKLMAPIPLDEEIKAKVSSPKRNWGASWIQQYTILFRRGIKEHRHDYFSWLRITQVLATA  358

Query  1393  LILGMLWWQSGGDTPSQMQDQAGLLFFIAVFWGFFPVFTAIFTFPQEKAMLSKERAADMY  1214
             +ILG+LWWQS   +P  ++DQAGLLFFIAVFW FFP+FTAIFTFPQE+AMLSKERAADMY
Sbjct  359   VILGLLWWQSDSKSPKGLEDQAGLLFFIAVFWSFFPIFTAIFTFPQERAMLSKERAADMY  418

Query  1213  RLSAYFAARTTSdlpldlllpliflLVVYFMAGLKQDASSFLLTAVTVFLCIVVAQGLGL  1034
             RLSAYF ARTTSDLPL+L+LP++FL++VYFMAGL+  A  F L+ +TVFL IV AQGLGL
Sbjct  419   RLSAYFLARTTSDLPLNLVLPVLFLVIVYFMAGLRMGAGPFFLSMLTVFLSIVAAQGLGL  478

Query  1033  AIGATLMDLKKATTLASVTVMTFMLAGGYFIKKVPGFIVWLRDLSFNYHTFKLLLKVQYE  854
             AIGA LMDLKKATTLASVT+MTFMLAGGYF+++VP FI W+R +SFN+HT+K+LLK+QY 
Sbjct  479   AIGAILMDLKKATTLASVTIMTFMLAGGYFVQEVPVFISWIRYMSFNFHTYKILLKIQYA  538

Query  853   HKTNSVNGVQIDSGIKEVGALAAMAVSYRLLAYISLRRMKLQ  728
               +  VNG++ DSG +EV AL AM   YRLLAY+SLR+MKL 
Sbjct  539   DISPIVNGMRTDSGFREVCALVAMVFGYRLLAYLSLRKMKLH  580



>ref|XP_010515694.1| PREDICTED: ABC transporter G family member 27 [Camelina sativa]
Length=743

 Score =   805 bits (2080),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 431/679 (63%), Positives = 519/679 (76%), Gaps = 37/679 (5%)
 Frame = -2

Query  2659  STHIRKSRSAQMKLDLDEls--sgsvlsrassaslGFSFTGFSVRPDESADSKPFSDDEN  2486
             +THIRK++SA   LDL  L+  +    + ++S  + FSFTGF+V  +E   S+  S+++ 
Sbjct  64    NTHIRKAKSAHPALDLAGLTGGAALSRASSASHGISFSFTGFTVPHEEIIASERCSNEDI  123

Query  2485  PEDLEAGTKKKRSIPAEPTFPIYLKFTEVSYKIVIKGVTFSEEKDILNGISGAVDPGEVL  2306
              ED+EA T       AEPTFPIYLKF +++YK+  KG+T S EK ILNGISG+  PGE+L
Sbjct  124   LEDIEAATNNVVKFQAEPTFPIYLKFIDITYKVTTKGMTSSSEKSILNGISGSAYPGELL  183

Query  2305  ALMGPSGCGKTTLLSLLGGRIRDPSAGS-ITYNQHPYSKLLKSRIGFVTQDDILFPHLTV  2129
             ALMGPSG GKTTLL++LGGR    + G  + YN  PYSK LK+RIGFVTQDD LFPHLTV
Sbjct  184   ALMGPSGSGKTTLLNVLGGRFDQQNIGGLVNYNDKPYSKHLKTRIGFVTQDDALFPHLTV  243

Query  2128  KETLIYAARLRLPRTLTKEEKDKRAMDVIYELGLDRCQDTMIGGSFVRGVSGGERKRVCI  1949
             KETL Y ARLRLPR LTK+EK++RA+ VI ELGL+R   TMIGGSFVRGVSGGERKRVCI
Sbjct  244   KETLTYTARLRLPRILTKQEKEQRAVSVIQELGLERYIITMIGGSFVRGVSGGERKRVCI  303

Query  1948  GNEIIINPSLLFLDEPTSGLDSTTALRIVDILHEIAKAGKTVITTIHQPSSRLFHkfdkl  1769
             GNEI+ NPSLL LDEPTS LDSTTAL+IV +L  IAKAGKTV+TTIHQPSSRLFH+FDKL
Sbjct  304   GNEIMTNPSLLLLDEPTSSLDSTTALKIVQMLQSIAKAGKTVVTTIHQPSSRLFHRFDKL  363

Query  1768  illeflldL--------------------------------ANGNINDVSIPSELADKVQ  1685
             ++L     L                                ANGN+ND+SIPS L +K++
Sbjct  364   VVLSRGSLLYFGKASDAMSYFSSIGCSPLLAMNPAEFLLDLANGNMNDISIPSALKEKMK  423

Query  1684  TWNSKEEPTRNNGKPSPAIVHEYLVGCYETRVAETEKKKLMAPLPVEEELKSKVRYLKRE  1505
               NS  +    + KP+P IV+EYL   Y+T+++  EKKKLMAP+P++EE+K  +   KRE
Sbjct  424   MENSCSKI--RSSKPTPTIVYEYLEEAYKTQISVVEKKKLMAPVPLDEEVKLMITCPKRE  481

Query  1504  WGASWSEQYVLLFHRGIRERWHDYFSWLRITQVIATALILGMLWWQSGGDTPSQMQDQAG  1325
             WG SW EQY LL  RGI+ER HDYFSWLR+TQV++TA+ILG+LWWQS    P  +QDQ G
Sbjct  482   WGLSWWEQYCLLSLRGIKERRHDYFSWLRVTQVLSTAIILGLLWWQSDIHHPKGLQDQVG  541

Query  1324  LLFFIAVFWGFFPVFTAIFTFPQEKAMLSKERAADMYRLSAYFAARTTSdlpldlllpli  1145
             LLFFIAVFWGFFPVFTAIFTFPQE+AMLSKER ++MYRLSAYF ARTTSDLPLDL+LP++
Sbjct  542   LLFFIAVFWGFFPVFTAIFTFPQERAMLSKERESNMYRLSAYFVARTTSDLPLDLILPVL  601

Query  1144  flLVVYFMAGLKQDASSFLLTAVTVFLCIVVAQGLGLAIGATLMDLKKATTLASVTVMTF  965
             FL+VVYFMAGL+  A SF L+ +TVFLCIV AQGLGLAIGA+LMDLKKATTLASVTVMTF
Sbjct  602   FLVVVYFMAGLRLSAESFFLSVLTVFLCIVAAQGLGLAIGASLMDLKKATTLASVTVMTF  661

Query  964   MLAGGYFIKKVPGFIVWLRDLSFNYHTFKLLLKVQYEHKTNSVNGVQIDSGIKEVGALAA  785
             MLAGG+F+KKVP FI W+R +SFNYHT+KLL+KVQY+    +VNG +I+SGIKEV AL A
Sbjct  662   MLAGGFFVKKVPVFIAWIRFMSFNYHTYKLLVKVQYQDIMENVNGEEIESGIKEVSALVA  721

Query  784   MAVSYRLLAYISLRRMKLQ  728
             M + YRLLAY+SLRRMKL 
Sbjct  722   MIIGYRLLAYLSLRRMKLH  740



>ref|XP_006649428.1| PREDICTED: ABC transporter G family member 22-like [Oryza brachyantha]
Length=668

 Score =   803 bits (2073),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/647 (65%), Positives = 497/647 (77%), Gaps = 44/647 (7%)
 Frame = -2

Query  2557  FSFTGFSVRPDE---SADSKPFSDDENPEDLEAGTKKKRSIPAEPTFPIYLKFTEVSYKI  2387
             F+FTGF+  P +   SA+  PFSDDEN  D+EAGT +K+ +  EPT PIYLKF EV YK+
Sbjct  23    FTFTGFTPPPQDITSSAELPPFSDDENTMDIEAGTPRKK-LMTEPTLPIYLKFAEVKYKV  81

Query  2386  VIKGVTFSEEKDILNGISGAVDPGEVLALMGPSGCGKTTLLSLLGGRIRDPSA--GSITY  2213
              +KG      ++IL GISG+  PGEVLALMGPSG GKTTLLS+LGGR+    A  G ++Y
Sbjct  82    AVKGT----PREILTGISGSAAPGEVLALMGPSGSGKTTLLSILGGRVTGAGAVEGCVSY  137

Query  2212  NQHPYSKLLKSRIGFVTQDDILFPHLTVKETLIYAARLRLPRTLTKEEKDKRAMDVIYEL  2033
             N  PY K LK RIGFVTQDD+LF HLTVKETL YAA LRLPRT+T+++K++R MD+IYEL
Sbjct  138   NDEPYGKSLKRRIGFVTQDDVLFTHLTVKETLTYAALLRLPRTMTRQQKEERTMDIIYEL  197

Query  2032  GLDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDIL  1853
             GL+RCQDTMIGGSFVRGVSGGERKRVCIGNEII+NPSLLFLDEPTSGLDSTTALRI+ +L
Sbjct  198   GLERCQDTMIGGSFVRGVSGGERKRVCIGNEIIVNPSLLFLDEPTSGLDSTTALRIIQLL  257

Query  1852  HEIAKAGKTVITTIHQPSSRLFHk--------------------------------fdkl  1769
             H+IA+ GKTVITTIHQPSSRLFHK                                   +
Sbjct  258   HDIAEDGKTVITTIHQPSSRLFHKFDKLILLGRGSLLYFGKASEAMPYFQSIGCTPLIAM  317

Query  1768  illeflldLANGNINDVSIPSELADKVQTWNSK-EEPTRNNGKPSPAIVHEYLVGCYETR  1592
                EFLLDLANGN  DVS+PSEL DKV   N   +  T+N+ KPS   VHEYLV  YE R
Sbjct  318   NPAEFLLDLANGNTTDVSVPSELDDKVHMENQNPQNNTKNDYKPSAQDVHEYLVDAYENR  377

Query  1591  VAETEKKKLMAPLPVEEELKSKVRYLKREWGASWSEQYVLLFHRGIRERWHDYFSWLRIT  1412
             VA  EK KL+ PLP+ ++LK+ +   KREWG SW +QY +LF RGI+ER HDY SW+RIT
Sbjct  378   VAYKEKNKLLDPLPISDDLKATITSSKREWGTSWWQQYSILFCRGIKERRHDYLSWMRIT  437

Query  1411  QVIATALILGMLWWQSGGDTPSQMQDQAGLLFFIAVFWGFFPVFTAIFTFPQEKAMLSKE  1232
             QVIAT++ILG+LWW S   TP  +QDQAGLLFFIAVFWGFFPVFTAIFTFPQE+AML+KE
Sbjct  438   QVIATSVILGLLWWHSDPSTPKDLQDQAGLLFFIAVFWGFFPVFTAIFTFPQERAMLNKE  497

Query  1231  RAADMYRLSAYFAARTTSdlpldlllpliflLVVYFMAGLKQDASSFLLTAVTVFLCIVV  1052
             RAADMY+LSAYF ARTTSDLPLDL LPLIF+++VYFMAGLK  A+ F  + +TVFL I+ 
Sbjct  498   RAADMYKLSAYFLARTTSDLPLDLFLPLIFMVIVYFMAGLKATAAHFFFSVLTVFLSIIA  557

Query  1051  AQGLGLAIGATLMDLKKATTLASVTVMTFMLAGGYFIKKVPGFIVWLRDLSFNYHTFKLL  872
             AQGLGLAIGATL+D+KKATTLASVTVMTFMLAGG+F+K+VP FI WLR +SFNYHT++LL
Sbjct  558   AQGLGLAIGATLLDIKKATTLASVTVMTFMLAGGFFVKRVPPFISWLRYVSFNYHTYRLL  617

Query  871   LKVQYEHKTNS-VNGVQIDSGIKEVGALAAMAVSYRLLAYISLRRMK  734
             LKVQY    +  +N + +D+G+ EV AL AM + YR+LAY+SLRR K
Sbjct  618   LKVQYHPVPDFLINAIPLDNGVTEVAALVAMIIGYRVLAYVSLRRTK  664



>ref|XP_010426848.1| PREDICTED: ABC transporter G family member 27-like isoform X2 
[Camelina sativa]
Length=743

 Score =   805 bits (2078),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 430/679 (63%), Positives = 519/679 (76%), Gaps = 37/679 (5%)
 Frame = -2

Query  2659  STHIRKSRSAQMKLDLDEls--sgsvlsrassaslGFSFTGFSVRPDESADSKPFSDDEN  2486
             +THIRK++SA   LDL  L+  +    + ++S  + FSFTGF+V  +E   S+  S+++ 
Sbjct  64    NTHIRKAKSAHPALDLAGLTGGAALSRASSASHGISFSFTGFTVPHEEIIASERCSNEDF  123

Query  2485  PEDLEAGTKKKRSIPAEPTFPIYLKFTEVSYKIVIKGVTFSEEKDILNGISGAVDPGEVL  2306
              ED+EA T       AEPTFPIYLKF +++YK+  KG+T S EK ILNGISG+  PGE+L
Sbjct  124   LEDIEAATSSVVKFQAEPTFPIYLKFIDITYKVTTKGMTSSSEKSILNGISGSAYPGELL  183

Query  2305  ALMGPSGCGKTTLLSLLGGRIRDPSAGS-ITYNQHPYSKLLKSRIGFVTQDDILFPHLTV  2129
             ALMGPSG GKTTLL++LGGR    + G  ++YN  PYSK LK+RIGFVTQ+D+LFPHLTV
Sbjct  184   ALMGPSGSGKTTLLNVLGGRFDQQNIGGLVSYNDKPYSKHLKTRIGFVTQEDVLFPHLTV  243

Query  2128  KETLIYAARLRLPRTLTKEEKDKRAMDVIYELGLDRCQDTMIGGSFVRGVSGGERKRVCI  1949
              ETL Y ARLRLP+TLTK+EK++RA+ +I ELGL+RCQ TMIGGSFVRGVSGGERKRV I
Sbjct  244   IETLTYTARLRLPKTLTKQEKEQRAVSMIQELGLERCQGTMIGGSFVRGVSGGERKRVSI  303

Query  1948  GNEIIINPSLLFLDEPTSGLDSTTALRIVDILHEIAKAGKTVITTIHQPSSRLFHkfdkl  1769
             G EI+ NPSLL LDEPTS LDSTTAL+IV +L  IAKAGKTV+TTIHQPSSRLFH+FDKL
Sbjct  304   GIEIMTNPSLLLLDEPTSSLDSTTALKIVQMLQSIAKAGKTVVTTIHQPSSRLFHRFDKL  363

Query  1768  illeflldL--------------------------------ANGNINDVSIPSELADKVQ  1685
             ++L     L                                ANGN+ND+SIPS L +K++
Sbjct  364   VVLSRGSLLYFGKASEAMSYFSSIGCSPLLAMNPAEFLLDLANGNMNDISIPSALKEKMK  423

Query  1684  TWNSKEEPTRNNGKPSPAIVHEYLVGCYETRVAETEKKKLMAPLPVEEELKSKVRYLKRE  1505
               NS  E    + KP+P IV+EYL   Y+T+++  EKKKLMAP+P++EE+K  +   KRE
Sbjct  424   MENSCSEI--RSSKPTPTIVYEYLEEAYKTQISVVEKKKLMAPVPLDEEVKLMITCPKRE  481

Query  1504  WGASWSEQYVLLFHRGIRERWHDYFSWLRITQVIATALILGMLWWQSGGDTPSQMQDQAG  1325
             WG SW EQY LL  RGI+ER HDYFSWLR+TQV++TA+ILG+LWWQS    P  +QDQ G
Sbjct  482   WGLSWWEQYCLLSLRGIKERRHDYFSWLRVTQVLSTAIILGLLWWQSDIHHPKGLQDQVG  541

Query  1324  LLFFIAVFWGFFPVFTAIFTFPQEKAMLSKERAADMYRLSAYFAARTTSdlpldlllpli  1145
             LLFFIAVFWGFFPVFTAIFTFPQE AMLSKER ++MYRLSAYF ARTTSDLPLDL+LP++
Sbjct  542   LLFFIAVFWGFFPVFTAIFTFPQEIAMLSKERESNMYRLSAYFVARTTSDLPLDLILPVL  601

Query  1144  flLVVYFMAGLKQDASSFLLTAVTVFLCIVVAQGLGLAIGATLMDLKKATTLASVTVMTF  965
             FL+VVYFMAGL+  A SF L+ +TVFLCIV AQGLGLAIGA+LMDLKKATTLASVTVMTF
Sbjct  602   FLVVVYFMAGLRLSAESFFLSVLTVFLCIVAAQGLGLAIGASLMDLKKATTLASVTVMTF  661

Query  964   MLAGGYFIKKVPGFIVWLRDLSFNYHTFKLLLKVQYEHKTNSVNGVQIDSGIKEVGALAA  785
             MLAGGYF+KKVP FI W+R +SFNYHT+KLL+KVQY+    +VNG +I SGIKEV AL A
Sbjct  662   MLAGGYFVKKVPNFIAWIRFMSFNYHTYKLLVKVQYQEIMENVNGEEIGSGIKEVSALVA  721

Query  784   MAVSYRLLAYISLRRMKLQ  728
             M + YRLLAY+SLRRMKL 
Sbjct  722   MIIGYRLLAYLSLRRMKLH  740



>ref|XP_002876135.1| abc transporter family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH52394.1| abc transporter family protein [Arabidopsis lyrata subsp. lyrata]
Length=752

 Score =   804 bits (2077),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 431/688 (63%), Positives = 519/688 (75%), Gaps = 46/688 (7%)
 Frame = -2

Query  2659  STHIRKSRSAQMKLDLDEls--sgsvlsrassaslGFSFTGFSVRPDESADSKPFSDDEN  2486
             +THIRK++SA   LDL  L+  +    + ++S  L FSFTGF+V  +E   S+  S+D+ 
Sbjct  62    NTHIRKAKSAHPALDLGSLTGGAALSRASSASLGLSFSFTGFTVPHEEIIASEQCSNDDI  121

Query  2485  PEDLEAGTKKKRSIPAEPTFPIYLKFTEVSYKIVIKGVTFSEEKDILNGISGAVDPGEVL  2306
              ED+EA T       AEPTFPIYLKF +++YK+  KG+T S EK ILNGISG+  PGE+L
Sbjct  122   LEDIEAATSTVVKFQAEPTFPIYLKFIDITYKVTTKGMTSSSEKSILNGISGSAYPGELL  181

Query  2305  ALMGPSGCGKTTLLSLLGGRIRDPSA-GSITYNQHPYSKLLKSRIGFVTQDDILFPHLTV  2129
             ALMGPSG GKTTLL+ LGGR    +  G ++YN  PYSK LK+RIGFVTQDD+LFPHLTV
Sbjct  182   ALMGPSGSGKTTLLNALGGRFNQQNIRGFVSYNDKPYSKHLKTRIGFVTQDDVLFPHLTV  241

Query  2128  KETLIYAARLRLPRTLTKEEKDKRAMDVIYELGLDRCQDTMIGGSFVRGVSGGERKRVCI  1949
             KETL Y A LRLP+TLTK+EK++RA+ VI ELGL+RCQDTMIGGSFVRGVSGGERKRVCI
Sbjct  242   KETLTYTALLRLPKTLTKQEKEQRAVSVIQELGLERCQDTMIGGSFVRGVSGGERKRVCI  301

Query  1948  GNEIIINPSLLFLDEPTSGLDSTTALRIVDILHEIAKAGKTVITTIHQPSSRLFHkfdkl  1769
             GNEI+ NPSLL LDEPTS LDSTTAL+IV +L  IAKAGKT++TTIHQPSSRLFH+FDKL
Sbjct  302   GNEIMTNPSLLLLDEPTSSLDSTTALKIVQMLQSIAKAGKTIVTTIHQPSSRLFHRFDKL  361

Query  1768  illeflldL--------------------------------ANGNINDVSIPSELADKVQ  1685
             ++L     L                                ANGN+ND+SIPS L +K++
Sbjct  362   VVLSRGSLLYFGKASEAMSYFSSIGCSPLLAMNPAEFLLDLANGNMNDISIPSTLKEKMK  421

Query  1684  TWNSKEEPTRNNGKPSPAIVH---------EYLVGCYETRVAETEKKKLMAPLPVEEELK  1532
               NS  E    + KP   +++         +YL   Y+T++A  EK KLM P+P++EE+K
Sbjct  422   MGNSCSE--MGSSKPKLYVINANCDVDAETQYLEEAYKTQIAIMEKMKLMTPVPLDEEVK  479

Query  1531  SKVRYLKREWGASWSEQYVLLFHRGIRERWHDYFSWLRITQVIATALILGMLWWQSGGDT  1352
               +   KREWG SW EQY LL  RGI+ER HDYFSWLR+TQV++TA+ILG+LWWQS    
Sbjct  480   LMITCPKREWGLSWWEQYCLLSLRGIKERRHDYFSWLRVTQVLSTAIILGLLWWQSDIQH  539

Query  1351  PSQMQDQAGLLFFIAVFWGFFPVFTAIFTFPQEKAMLSKERAADMYRLSAYFAARTTSdl  1172
             P  +QDQ GLLFFIAVFWGFFPVFTAIFTFPQE+AMLSKER ++MYRLSAYF ARTTSDL
Sbjct  540   PKGLQDQVGLLFFIAVFWGFFPVFTAIFTFPQERAMLSKERESNMYRLSAYFVARTTSDL  599

Query  1171  pldlllpliflLVVYFMAGLKQDASSFLLTAVTVFLCIVVAQGLGLAIGATLMDLKKATT  992
             PLDL+LP++FL+VVYFMAGL+  A SF L+ +TVFLCIV AQGLGLAIGA+LMDLKKATT
Sbjct  600   PLDLILPVLFLVVVYFMAGLRLRAESFFLSVLTVFLCIVAAQGLGLAIGASLMDLKKATT  659

Query  991   LASVTVMTFMLAGGYFIKKVPGFIVWLRDLSFNYHTFKLLLKVQYEHKTNSVNGVQIDSG  812
             LASVTVMTFMLAGGYF+KKVP FI W+R +SFNYHT+KLL+KVQYE    +VNG +I+SG
Sbjct  660   LASVTVMTFMLAGGYFVKKVPFFIAWIRFMSFNYHTYKLLVKVQYEEIMQNVNGEEIESG  719

Query  811   IKEVGALAAMAVSYRLLAYISLRRMKLQ  728
             +KEV AL AM + YRL+AYISLRRMKL 
Sbjct  720   LKEVSALVAMIIGYRLVAYISLRRMKLH  747



>ref|XP_006604673.1| PREDICTED: ABC transporter G family member 22-like isoform X5 
[Glycine max]
Length=586

 Score =   797 bits (2059),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 410/585 (70%), Positives = 476/585 (81%), Gaps = 35/585 (6%)
 Frame = -2

Query  2383  IKGVTFSEEKDILNGISGAVDPGEVLALMGPSGCGKTTLLSLLGGR-IRDPSAGSITYNQ  2207
             +KG+T ++EKDIL GI+G+V+PGEVLALMGPSG GKT+LL+LLGGR I+    GSITYN 
Sbjct  1     MKGITTTKEKDILKGITGSVNPGEVLALMGPSGSGKTSLLNLLGGRLIQSTIGGSITYND  60

Query  2206  HPYSKLLKSRIGFVTQDDILFPHLTVKETLIYAARLRLPRTLTKEEKDKRAMDVIYELGL  2027
              PYSK LKSRIGFVTQDD+LFPHLTVKETL YAARLRLP TLTKE+K+KRA++VI ELGL
Sbjct  61    QPYSKFLKSRIGFVTQDDVLFPHLTVKETLTYAARLRLPNTLTKEQKEKRALEVIDELGL  120

Query  2026  DRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILHE  1847
             +RCQDTMIGGS+VRG+SGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIV +L +
Sbjct  121   ERCQDTMIGGSYVRGISGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVQMLQD  180

Query  1846  IAKAGKTVITTIHQPSSRLFHk--------------------------------fdklil  1763
             IA+AGKTV+TTIHQPSSRLFHK                                   +  
Sbjct  181   IAEAGKTVVTTIHQPSSRLFHKFDKLILLGKGSLLYFGKASDAMDYFQFIGCAPLIAMNP  240

Query  1762  leflldLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYETRVAE  1583
              EFLLDLANGN+ND+S+PSEL D VQ  N++ E    NGKPS ++V EYLV  Y++RVAE
Sbjct  241   AEFLLDLANGNVNDISVPSELKDIVQVGNAEAETC--NGKPSASVVQEYLVEAYDSRVAE  298

Query  1582  TEKKKLMAPLPVEEELKSKVRYLKREWGASWSEQYVLLFHRGIRERWHDYFSWLRITQVI  1403
              EK KLM P+P++ ELKSKV   KR+WGASW EQ+ +LF RG +ER HDYFSWLRITQV+
Sbjct  299   IEKTKLMVPVPLDVELKSKVCSCKRQWGASWFEQFSILFSRGFKERRHDYFSWLRITQVL  358

Query  1402  ATALILGMLWWQSGGDTPSQMQDQAGLLFFIAVFWGFFPVFTAIFTFPQEKAMLSKERAA  1223
             ATA+ILG+LWWQS   TP  +QDQAGLLFFIAVFWGFFPVFTAIFTFPQE+AML+KER  
Sbjct  359   ATAVILGLLWWQSDAKTPKGLQDQAGLLFFIAVFWGFFPVFTAIFTFPQERAMLTKERTT  418

Query  1222  DMYRLSAYFAARTTSdlpldlllpliflLVVYFMAGLKQDASSFLLTAVTVFLCIVVAQG  1043
             DMYRLSAYF ARTTSDL LDL+LP+ FLL+VYFMA L+  +  F  + +TVFLCI+ AQG
Sbjct  419   DMYRLSAYFVARTTSDLLLDLVLPVFFLLLVYFMANLRLGSGRFFFSILTVFLCIIAAQG  478

Query  1042  LGLAIGATLMDLKKATTLASVTVMTFMLAGGYFIKKVPGFIVWLRDLSFNYHTFKLLLKV  863
             LGLAIGATLMDLK+ATTLASVTVMTFMLAGG+F+KKVP FI W+R +SFNYHT+KLLLKV
Sbjct  479   LGLAIGATLMDLKRATTLASVTVMTFMLAGGFFVKKVPIFISWIRYISFNYHTYKLLLKV  538

Query  862   QYEHKTNSVNGVQIDSGIKEVGALAAMAVSYRLLAYISLRRMKLQ  728
             QYEH T +++G++IDSG +EV AL AM   YRLLAY+SLRRMKLQ
Sbjct  539   QYEHITPTIDGIRIDSGFREVAALTAMVFGYRLLAYLSLRRMKLQ  583



>ref|XP_006292375.1| hypothetical protein CARUB_v10018588mg [Capsella rubella]
 gb|EOA25273.1| hypothetical protein CARUB_v10018588mg [Capsella rubella]
Length=743

 Score =   803 bits (2074),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/679 (63%), Positives = 515/679 (76%), Gaps = 37/679 (5%)
 Frame = -2

Query  2659  STHIRKSRSAQMKLDLDEls--sgsvlsrassaslGFSFTGFSVRPDESADSKPFSDDEN  2486
             +THIRKS+SA   LD   L+  +    + ++S  + FSFTGF+V  +E   S+  S+++ 
Sbjct  64    NTHIRKSKSAHPALDHGGLTGGAALSRASSASLGISFSFTGFTVPQEEMIASERCSNEDI  123

Query  2485  PEDLEAGTKKKRSIPAEPTFPIYLKFTEVSYKIVIKGVTFSEEKDILNGISGAVDPGEVL  2306
              E+ EA T       AEPTFPIYLKF +++YK+  K +  S EK ILNGISG+  PGE+L
Sbjct  124   LEESEAATSSVSKFQAEPTFPIYLKFIDITYKVTKKRMASSSEKSILNGISGSAYPGELL  183

Query  2305  ALMGPSGCGKTTLLSLLGGRIRDPSAGS-ITYNQHPYSKLLKSRIGFVTQDDILFPHLTV  2129
             ALMGPSG GKTTLL++LGGR    + G  ++YN  PY K LK+RIGFVTQDD+LFPHLTV
Sbjct  184   ALMGPSGSGKTTLLNVLGGRFNQQNIGGLVSYNDKPYFKHLKTRIGFVTQDDVLFPHLTV  243

Query  2128  KETLIYAARLRLPRTLTKEEKDKRAMDVIYELGLDRCQDTMIGGSFVRGVSGGERKRVCI  1949
             KETL Y ARLRLP+TLT +EK++RA+ VI ELGL+RCQDTMIGGSFV GVSGGERKRVCI
Sbjct  244   KETLTYTARLRLPKTLTTQEKEQRAVSVIQELGLERCQDTMIGGSFVCGVSGGERKRVCI  303

Query  1948  GNEIIINPSLLFLDEPTSGLDSTTALRIVDILHEIAKAGKTVITTIHQPSSRLFHkfdkl  1769
             GNEI+ NPSLL LDEPTS LDSTTAL+IV +L  IAKAGKTV+TTIHQPSSRLFH+FDKL
Sbjct  304   GNEIMNNPSLLLLDEPTSSLDSTTALKIVQMLQSIAKAGKTVVTTIHQPSSRLFHRFDKL  363

Query  1768  illeflldL--------------------------------ANGNINDVSIPSELADKVQ  1685
             ++L     L                                ANGN+ND+S PS L +K++
Sbjct  364   VVLSRGSLLYFGKASEAMPYFSSIGCSPLFAMNPAEFLLDLANGNMNDISTPSALKEKMK  423

Query  1684  TWNSKEEPTRNNGKPSPAIVHEYLVGCYETRVAETEKKKLMAPLPVEEELKSKVRYLKRE  1505
               NS  E    + KP+P +V+EYL   Y+T++A  EKKKL+AP+P++EE+K  +   KRE
Sbjct  424   MGNSFSEI--RSSKPTPTVVYEYLEEAYKTKIAVVEKKKLVAPVPLDEEVKLMITCPKRE  481

Query  1504  WGASWSEQYVLLFHRGIRERWHDYFSWLRITQVIATALILGMLWWQSGGDTPSQMQDQAG  1325
             WG SW EQY LL  RGI+ER HDYFSWLR+TQV++TA+ILG LWWQS    P  +QDQ G
Sbjct  482   WGLSWWEQYCLLSLRGIKERRHDYFSWLRVTQVLSTAIILGSLWWQSDIQHPKGLQDQVG  541

Query  1324  LLFFIAVFWGFFPVFTAIFTFPQEKAMLSKERAADMYRLSAYFAARTTSdlpldlllpli  1145
             LLFFIAVFWGFFPVFTAIFTFPQE+AMLSKER ++MYRLSAYF ARTTSDLPLDL+LP+ 
Sbjct  542   LLFFIAVFWGFFPVFTAIFTFPQERAMLSKERESNMYRLSAYFVARTTSDLPLDLILPVF  601

Query  1144  flLVVYFMAGLKQDASSFLLTAVTVFLCIVVAQGLGLAIGATLMDLKKATTLASVTVMTF  965
             FL+VVYFMAGL+  A SF L+ +TVFLCIV AQGLGLAIGA+LMDLKKATTLASVTVMTF
Sbjct  602   FLVVVYFMAGLRLSAKSFFLSVLTVFLCIVAAQGLGLAIGASLMDLKKATTLASVTVMTF  661

Query  964   MLAGGYFIKKVPGFIVWLRDLSFNYHTFKLLLKVQYEHKTNSVNGVQIDSGIKEVGALAA  785
             MLAGGYF+KKVP FI W+R +SFNYHT+KLL+KVQYE    +VNG +I+SG+KEV AL A
Sbjct  662   MLAGGYFVKKVPNFIAWIRFMSFNYHTYKLLVKVQYEEIMKNVNGEEIESGVKEVSALVA  721

Query  784   MAVSYRLLAYISLRRMKLQ  728
             M V YRLLAY+SLRRMKL 
Sbjct  722   MIVGYRLLAYLSLRRMKLH  740



>ref|XP_010491223.1| PREDICTED: ABC transporter G family member 22-like isoform X2 
[Camelina sativa]
Length=692

 Score =   799 bits (2064),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 456/691 (66%), Positives = 533/691 (77%), Gaps = 55/691 (8%)
 Frame = -2

Query  2863  STSLLRTKSDQLVEaiaaakgsarARLPRLSAEFAGSGVPESVRM-------LSRKPSRR  2705
             +T L RT+S+QL E++AAA      + P  S +   +G+P +          LSRK SRR
Sbjct  9     ATGLARTRSEQLYESVAAAI-----KSPHGSMD--ANGIPATAPAAVGGGGTLSRKSSRR  61

Query  2704  LMppspggggsgGTNSTHIRKSRSAQMKLDLDElssgsvlsrassasl--GFSFTGFSVR  2531
             LM  +  G   G    THIRKSRSAQ+KL+L+E+SSG+ LSRASSASL   FSFTGF++ 
Sbjct  62    LMMGASPGRSGGA--GTHIRKSRSAQLKLELEEVSSGAALSRASSASLGLSFSFTGFAMP  119

Query  2530  PDESADSKPFSDDEN-PEDLEAGTKKKRSIPAEPTFPIYLKFTEVSYKIVIKGVTFSEEK  2354
             P+E +DSKPFSDDE  PED+EAG KKK    AEPT PI+LKF EV+YK+VIK +T S EK
Sbjct  120   PEEISDSKPFSDDEMIPEDIEAG-KKKPKFQAEPTLPIFLKFKEVTYKVVIKKMTSSVEK  178

Query  2353  DILNGISGAVDPGEVLALMGPSGCGKTTLLSLLGGRI-RDPSAGSITYNQHPYSKLLKSR  2177
             +IL GI+G+V+PGEVLALMGPSG GKTTLLSLL GRI +  + GS+TYN  PYSK LKSR
Sbjct  179   EILTGITGSVNPGEVLALMGPSGSGKTTLLSLLAGRISQSATGGSVTYNDKPYSKFLKSR  238

Query  2176  IGFVTQDDILFPHLTVKETLIYAARLRLPRTLTKEEKDKRAMDVIYELGLDRCQDTMIGG  1997
             IGFVTQDD+LFPHLTVKETL YAARLRL +TLT+E+K++RA+DVI+ELGL+RCQDTMIGG
Sbjct  239   IGFVTQDDVLFPHLTVKETLTYAARLRLSKTLTREQKEQRALDVIHELGLERCQDTMIGG  298

Query  1996  SFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILHEIAKAGKTVIT  1817
             +FVRGVSGGERKRV IGNEIIINPSLL LDEPTSGLDSTTALR + +LH+I+ AGKTVIT
Sbjct  299   AFVRGVSGGERKRVSIGNEIIINPSLLLLDEPTSGLDSTTALRTIQMLHDISDAGKTVIT  358

Query  1816  TIHQPSSRLFHk--------------------------------fdklilleflldLANG  1733
             TIHQPSSRLFH+                                   +   EFLLDLANG
Sbjct  359   TIHQPSSRLFHRFDKLILLGRGSLLYFGKSSEALEYFSSIGCSPLIAMNPAEFLLDLANG  418

Query  1732  NINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYETRVAETEKKKLMAPL  1553
             NIND+S+PSEL D+VQ  NS  E     GKPSPA VHEYLV  YETRVAE EKKKLM P+
Sbjct  419   NINDISVPSELDDRVQVGNSGRE--TQTGKPSPAAVHEYLVEAYETRVAEQEKKKLMDPV  476

Query  1552  PVEEELKSKVRYLKREWGASWSEQYVLLFHRGIRERWHDYFSWLRITQVIATALILGMLW  1373
             P++EE K+K   LKREWGA W EQY +LF RG++ER H+YFSWLR+TQV++TA+ILG+LW
Sbjct  477   PLDEEAKAKSLRLKREWGAGWWEQYCILFCRGLKERRHEYFSWLRVTQVLSTAVILGLLW  536

Query  1372  WQSGGDTPSQMQDQAGLLFFIAVFWGFFPVFTAIFTFPQEKAMLSKERAADMYRLSAYFA  1193
             WQS   TP  +QDQAGLLFFIAVFWGFFPVFTAIF FPQE+AML+KERAADMY+LSAYF 
Sbjct  537   WQSDMRTPRGLQDQAGLLFFIAVFWGFFPVFTAIFAFPQERAMLNKERAADMYKLSAYFL  596

Query  1192  ARTTSdlpldlllpliflLVVYFMAGLKQDASSFLLTAVTVFLCIVVAQGLGLAIGATLM  1013
             ARTTSDLPLD +LP +FLLVVYFM GL+     F L+ +TVFLCI+ AQGLGLAIGA LM
Sbjct  597   ARTTSDLPLDFILPSLFLLVVYFMTGLRVSPYPFFLSMLTVFLCIIAAQGLGLAIGAVLM  656

Query  1012  DLKKATTLASVTVMTFMLAGGYFIKKVPGFI  920
             DLKKATTLASVTVMTFMLAGG+F+K  P F+
Sbjct  657   DLKKATTLASVTVMTFMLAGGFFVKASPLFL  687



>ref|XP_003562060.1| PREDICTED: ABC transporter G family member 22-like [Brachypodium 
distachyon]
Length=756

 Score =   798 bits (2062),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 429/684 (63%), Positives = 520/684 (76%), Gaps = 48/684 (7%)
 Frame = -2

Query  2656  THIRKSRSAQMKLDLDElssgsvlsrassasl---GFSFTGFSVRPDESADSK--PFSDD  2492
             +HIRKSRSAQ+K D++EL S       +S++     F+FTGF+  P  S  S+  PFSDD
Sbjct  74    SHIRKSRSAQLKFDVEELVSSGAALSRASSASLGFSFTFTGFTPPPAHSVSSELAPFSDD  133

Query  2491  E-NPEDLEAGTKKKRSIPAEPTFPIYLKFTEVSYKIVIKGVTFSEEKDILNGISGAVDPG  2315
             + +  D+EA T++K+ +  EPT PIYLKF EV + + +KG      ++IL GISG+  PG
Sbjct  134   DLHAIDIEASTRRKK-LMTEPTLPIYLKFAEVKFSVAVKGT----PREILGGISGSACPG  188

Query  2314  EVLALMGPSGCGKTTLLSLLGGRIRDPSA--GSITYNQHPYSKLLKSRIGFVTQDDILFP  2141
             EVLALMGPSG GKTTLLS+LGGR     A  G ++YN  P+ K LK RIGFVTQDD+LF 
Sbjct  189   EVLALMGPSGSGKTTLLSMLGGRPTGAGAAEGCVSYNDEPFGKSLKRRIGFVTQDDVLFT  248

Query  2140  HLTVKETLIYAARLRLPRTLTKEEKDKRAMDVIYELGLDRCQDTMIGGSFVRGVSGGERK  1961
             HLTVKETL YAA LRLPRT+T+++K +RAMD+IYELGL+RCQDTMIGGSFVRGVSGGERK
Sbjct  249   HLTVKETLTYAALLRLPRTMTRQQKRERAMDIIYELGLERCQDTMIGGSFVRGVSGGERK  308

Query  1960  RVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILHEIAKAGKTVITTIHQPSSRLFHk  1781
             RVCIGNEIIINPSLLFLDEPTSGLDSTTALRIV +LH+IA+ GKTV+TTIHQPSSRLFHK
Sbjct  309   RVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVQLLHDIAETGKTVMTTIHQPSSRLFHK  368

Query  1780  --------------------------------fdklilleflldLANGNINDVSIPSELA  1697
                                                +   EFLLDLANGN ND+S+PSEL 
Sbjct  369   FDKLILLGKGSLLYFGKTSEAMPYFQSIGCSPLIAMNPAEFLLDLANGNTNDISVPSELD  428

Query  1696  DKVQTWNSKEEPT--RNNGKPSPAIVHEYLVGCYETRVAETEKKKLMAPLPVEEELKSKV  1523
             DKV   N   + T  + + +PS   VHEYLV  YE+RVA  EKKKL+ PLP+ +++K+ +
Sbjct  429   DKVHMENQNLQNTNSKTDYRPSAQDVHEYLVDAYESRVAYKEKKKLLEPLPISDDMKTII  488

Query  1522  RYLKREWGASWSEQYVLLFHRGIRERWHDYFSWLRITQVIATALILGMLWWQSGGDTPSQ  1343
                KREWG SW +QY +LF RG++ER HDY SW+RITQVIAT++ILG+LWW+S   TP  
Sbjct  489   TSSKREWGTSWWQQYSILFCRGLKERRHDYLSWMRITQVIATSIILGLLWWRSDPTTPKG  548

Query  1342  MQDQAGLLFFIAVFWGFFPVFTAIFTFPQEKAMLSKERAADMYRLSAYFAARTTSdlpld  1163
             +QDQAGLLFFIAVFWGFFPVFTAIFTFPQE+AML+KERAADMY+LSAYF ARTTSDLPLD
Sbjct  549   LQDQAGLLFFIAVFWGFFPVFTAIFTFPQERAMLNKERAADMYKLSAYFLARTTSDLPLD  608

Query  1162  lllpliflLVVYFMAGLKQDASSFLLTAVTVFLCIVVAQGLGLAIGATLMDLKKATTLAS  983
             L LP+IF+++VYFMAGLK  A+ F L+ +TVFL I+ AQGLGLAIGATL+D+KKATTLAS
Sbjct  609   LFLPVIFMVIVYFMAGLKASATHFFLSMLTVFLSIIAAQGLGLAIGATLLDIKKATTLAS  668

Query  982   VTVMTFMLAGGYFIKKVPGFIVWLRDLSFNYHTFKLLLKVQYEHKTNSV-NGVQIDSGIK  806
             VTVMTFMLAGG+F+K+VP FI WLR LSFNYHT++LLLKVQY+   + +   V +D+G  
Sbjct  669   VTVMTFMLAGGFFVKRVPPFISWLRYLSFNYHTYRLLLKVQYDPVPDILMTSVPLDNGQT  728

Query  805   EVGALAAMAVSYRLLAYISLRRMK  734
             EVGAL  M + YR+LAY+SLRR+K
Sbjct  729   EVGALVVMIIGYRVLAYLSLRRVK  752



>emb|CDY23205.1| BnaA04g05540D [Brassica napus]
Length=735

 Score =   797 bits (2059),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/681 (63%), Positives = 514/681 (75%), Gaps = 47/681 (7%)
 Frame = -2

Query  2659  STHIRKSRSAQMKLDLDEls--sgsvlsrassaslGFSFTGFSVRPDES--ADSKPFSDD  2492
             +THIRK+R+    LDL  L+       + ++S  L FSFTGF+V  +E      +  S+D
Sbjct  62    NTHIRKART----LDLGRLTGGEALSRASSASLGLSFSFTGFAVPHEEEIIPSERSCSND  117

Query  2491  ENPEDLEAGTKKKRSIPAEPTFPIYLKFTEVSYKIVIKGVTFSEEKDILNGISGAVDPGE  2312
             +N ED+EA T     +  EPTFPIYLKF +++YK+  K +T S EK ILNGISG+  PGE
Sbjct  118   DNLEDIEAATSSVVKLQEEPTFPIYLKFIDITYKVTCKAMTSSSEKSILNGISGSAYPGE  177

Query  2311  VLALMGPSGCGKTTLLSLLGGRI-RDPSAGSITYNQHPYSKLLKSRIGFVTQDDILFPHL  2135
             +LALMGPSG GKTTLL++LGGR  +  ++GS++YN  PYSK LK+RIGFVTQDD+LFPHL
Sbjct  178   ILALMGPSGSGKTTLLNVLGGRFNQQNTSGSVSYNDKPYSKHLKTRIGFVTQDDVLFPHL  237

Query  2134  TVKETLIYAARLRLPRTLTKEEKDKRAMDVIYELGLDRCQDTMIGGSFVRGVSGGERKRV  1955
             TVKETL Y A LRLP+TLTK+EK++RA+ VI ELGL+RCQDTMIGGSFVRGVSGGERKRV
Sbjct  238   TVKETLTYTALLRLPKTLTKQEKEQRAVSVIQELGLERCQDTMIGGSFVRGVSGGERKRV  297

Query  1954  CIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILHEIAKAGKTVITTIHQPSSRLFHkfd  1775
             CIGNEI+ NPSLLFLDEPTS LDSTTAL+IV +L  IAKAGKT++TTIHQPSSRLFH+FD
Sbjct  298   CIGNEIMTNPSLLFLDEPTSSLDSTTALKIVQMLQSIAKAGKTIVTTIHQPSSRLFHRFD  357

Query  1774  klilleflldL--------------------------------ANGNINDVSIPSELADK  1691
             KL++L     L                                ANGN+ND+SIPS L + 
Sbjct  358   KLVVLSRGSLLYFGKASEAMPYFSSIGCSPLLSMNPAEFLLDLANGNMNDISIPSALKEG  417

Query  1690  VQTWNSKEEPTRNNGKPSPAIVHEYLVGCYETRVAETEKKKLMAPLPVEEELKSKVRYLK  1511
                  SK  P     K +P  V+EYL   Y+T++   EKKKLM P+P++EE+K  +   K
Sbjct  418   SSC--SKIRPP----KSTPTAVYEYLEEAYKTQIEVMEKKKLMEPVPLDEEVKLMITCPK  471

Query  1510  REWGASWSEQYVLLFHRGIRERWHDYFSWLRITQVIATALILGMLWWQSGGDTPSQMQDQ  1331
             REWG SW +QY +L  RG +ER HDYFSWLR+TQV++TA+ILG+LWWQS    P  +QDQ
Sbjct  472   REWGLSWWDQYCILSLRGFKERKHDYFSWLRVTQVLSTAIILGLLWWQSDIQHPKGLQDQ  531

Query  1330  AGLLFFIAVFWGFFPVFTAIFTFPQEKAMLSKERAADMYRLSAYFAARTTSdlpldlllp  1151
              GLLFFIAVFWGFFPVFTAIFTFPQE+AMLSKER ++MYRLSAYF ARTTSDLPLDL+LP
Sbjct  532   VGLLFFIAVFWGFFPVFTAIFTFPQERAMLSKERESNMYRLSAYFVARTTSDLPLDLILP  591

Query  1150  liflLVVYFMAGLKQDASSFLLTAVTVFLCIVVAQGLGLAIGATLMDLKKATTLASVTVM  971
             ++FL+VVYFMAGL+  A SF L+ +TVFLCIV AQGLGLAIGA+LMDLKKATTLASVTVM
Sbjct  592   VLFLVVVYFMAGLRLRAESFFLSVLTVFLCIVAAQGLGLAIGASLMDLKKATTLASVTVM  651

Query  970   TFMLAGGYFIKKVPGFIVWLRDLSFNYHTFKLLLKVQYEHKTNSVNGVQIDSGIKEVGAL  791
             TFMLAGGYF+KKVP FI W+R +SFNYHT+KLL+KVQYE     VNG +I SG+KEV AL
Sbjct  652   TFMLAGGYFVKKVPMFIAWIRYMSFNYHTYKLLVKVQYEEIMQDVNGEEIVSGLKEVSAL  711

Query  790   AAMAVSYRLLAYISLRRMKLQ  728
              AM + YRLLAY+SLRRMKL 
Sbjct  712   VAMIIGYRLLAYLSLRRMKLH  732



>ref|XP_009139468.1| PREDICTED: ABC transporter G family member 27 [Brassica rapa]
Length=735

 Score =   796 bits (2056),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 426/681 (63%), Positives = 516/681 (76%), Gaps = 47/681 (7%)
 Frame = -2

Query  2659  STHIRKSRSAQMKLDLDEls--sgsvlsrassaslGFSFTGFSVRPDES--ADSKPFSDD  2492
             +THIRK+++    LDL  L+       + ++S  L FSFTGF+V  +E      +  S+D
Sbjct  62    NTHIRKAKT----LDLGRLTGGEALSRASSASLGLSFSFTGFAVPHEEEIIPSERSCSND  117

Query  2491  ENPEDLEAGTKKKRSIPAEPTFPIYLKFTEVSYKIVIKGVTFSEEKDILNGISGAVDPGE  2312
             +N ED+EA T     +P EPTFPIYLKF +++YK+  K +T S EK ILNGISG+  PGE
Sbjct  118   DNLEDIEAATSSVVKLPEEPTFPIYLKFIDITYKVTCKAMTSSSEKSILNGISGSAYPGE  177

Query  2311  VLALMGPSGCGKTTLLSLLGGRI-RDPSAGSITYNQHPYSKLLKSRIGFVTQDDILFPHL  2135
             +LALMGPSG GKTTLL++LGGR  +  ++GS++YN  P+SK LKSRIGFVTQDD+LFPHL
Sbjct  178   LLALMGPSGSGKTTLLNVLGGRFNQQNTSGSVSYNDKPFSKHLKSRIGFVTQDDVLFPHL  237

Query  2134  TVKETLIYAARLRLPRTLTKEEKDKRAMDVIYELGLDRCQDTMIGGSFVRGVSGGERKRV  1955
             TVKETL Y A LRLP+TLTK+EK++RA+ VI ELGL+RCQDTMIGGSFVRGVSGGERKRV
Sbjct  238   TVKETLTYTALLRLPKTLTKQEKEQRAVSVIQELGLERCQDTMIGGSFVRGVSGGERKRV  297

Query  1954  CIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILHEIAKAGKTVITTIHQPSSRLFHkfd  1775
             CIGNEI+ NPSLLFLDEPTS LDSTTAL+IV +L  IAKAGKT++TTIHQPSSRLFH+FD
Sbjct  298   CIGNEIMTNPSLLFLDEPTSCLDSTTALKIVQMLQSIAKAGKTIVTTIHQPSSRLFHRFD  357

Query  1774  klilleflldL--------------------------------ANGNINDVSIPSELADK  1691
             KL++L     L                                ANGN+ND+SIPS L + 
Sbjct  358   KLVVLSRGSLLYFGKASEAMPYFSSIGCSPLLSMNPAEFLLDLANGNMNDISIPSALKE-  416

Query  1690  VQTWNSKEEPTRNNGKPSPAIVHEYLVGCYETRVAETEKKKLMAPLPVEEELKSKVRYLK  1511
             V + +    P     K +P  V+EYL   Y+T++   EKKKLM P+P++EE+K  +   K
Sbjct  417   VSSCSKIRPP-----KSTPTAVYEYLEEAYKTQIEAKEKKKLMEPVPLDEEVKLMITCPK  471

Query  1510  REWGASWSEQYVLLFHRGIRERWHDYFSWLRITQVIATALILGMLWWQSGGDTPSQMQDQ  1331
             REWG SW +QY +L  RG +ER HDYFSWLR+TQV++TA+ILG+LWWQS    P  +QDQ
Sbjct  472   REWGLSWWDQYCILSLRGFKERKHDYFSWLRVTQVLSTAIILGLLWWQSDIQHPKGLQDQ  531

Query  1330  AGLLFFIAVFWGFFPVFTAIFTFPQEKAMLSKERAADMYRLSAYFAARTTSdlpldlllp  1151
              GLLFFIAVFWGFFPVFTAIFTFPQE+AMLSKER +++YRLSAYF ARTTSDLPLDL+LP
Sbjct  532   VGLLFFIAVFWGFFPVFTAIFTFPQERAMLSKERESNIYRLSAYFVARTTSDLPLDLILP  591

Query  1150  liflLVVYFMAGLKQDASSFLLTAVTVFLCIVVAQGLGLAIGATLMDLKKATTLASVTVM  971
             ++FL+VVYFMAGL+  A SF L+ +TVFLCIV AQGLGLAIGA+LMDLKKATTLASVTVM
Sbjct  592   VLFLVVVYFMAGLRLRAESFFLSVLTVFLCIVAAQGLGLAIGASLMDLKKATTLASVTVM  651

Query  970   TFMLAGGYFIKKVPGFIVWLRDLSFNYHTFKLLLKVQYEHKTNSVNGVQIDSGIKEVGAL  791
             TFMLAGGYF+KKVP FI W+R +SFNYHT+KLL+KVQYE     VNG +I SG+KEV AL
Sbjct  652   TFMLAGGYFVKKVPMFIAWIRYMSFNYHTYKLLVKVQYEEIMQDVNGEEIVSGLKEVSAL  711

Query  790   AAMAVSYRLLAYISLRRMKLQ  728
              AM + YRLLAY+SLRRMKL 
Sbjct  712   VAMIIGYRLLAYLSLRRMKLH  732



>ref|NP_001031843.1| ABC transporter G family member 22 [Arabidopsis thaliana]
 gb|AED91031.1| ABC transporter G family member 22 [Arabidopsis thaliana]
Length=691

 Score =   794 bits (2050),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 458/694 (66%), Positives = 531/694 (77%), Gaps = 56/694 (8%)
 Frame = -2

Query  2863  STSLLRTKSDQLVEaiaaakgsarARLPRLSAEFAGSGVPESVRM-------LSRKPSRR  2705
             ++ L RT+S+QL E +AA       R P  S +   +GVP +          LSRK SRR
Sbjct  9     ASGLARTRSEQLYETVAADI-----RSPHGSMD--ANGVPATAPAAVGGGGTLSRKSSRR  61

Query  2704  LMppspggggsgGTNSTHIRKSRSAQMKLDLDElssgsvlsrassasl--GFSFTGFSVR  2531
             LM  SPG         THIRKSRSAQ+KL+L+E+SSG+ LSRASSASL   FSFTGF++ 
Sbjct  62    LMGMSPGRSSGA---GTHIRKSRSAQLKLELEEVSSGAALSRASSASLGLSFSFTGFAMP  118

Query  2530  PDESADSKPFSDDEN-PEDLEAGTKKKRSIPAEPTFPIYLKFTEVSYKIVIKGVTFSEEK  2354
             P+E +DSKPFSDDE  PED+EAG KKK    AEPT PI+LKF +V+YK+VIK +T S EK
Sbjct  119   PEEISDSKPFSDDEMIPEDIEAG-KKKPKFQAEPTLPIFLKFRDVTYKVVIKKLTSSVEK  177

Query  2353  DILNGISGAVDPGEVLALMGPSGCGKTTLLSLLGGRIRDPS-AGSITYNQHPYSKLLKSR  2177
             +IL GISG+V+PGEVLALMGPSG GKTTLLSLL GRI   S  GS+TYN  PYSK LKS+
Sbjct  178   EILTGISGSVNPGEVLALMGPSGSGKTTLLSLLAGRISQSSTGGSVTYNDKPYSKYLKSK  237

Query  2176  IGFVTQDDILFPHLTVKETLIYAARLRLPRTLTKEEKDKRAMDVIYELGLDRCQDTMIGG  1997
             IGFVTQDD+LFPHLTVKETL YAARLRLP+TLT+E+K +RA+DVI ELGL+RCQDTMIGG
Sbjct  238   IGFVTQDDVLFPHLTVKETLTYAARLRLPKTLTREQKKQRALDVIQELGLERCQDTMIGG  297

Query  1996  SFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILHEIAKAGKTVIT  1817
             +FVRGVSGGERKRV IGNEIIINPSLL LDEPTSGLDSTTALR + +LH+IA+AGKTVIT
Sbjct  298   AFVRGVSGGERKRVSIGNEIIINPSLLLLDEPTSGLDSTTALRTILMLHDIAEAGKTVIT  357

Query  1816  TIHQPSSRLFHk--------------------------------fdklilleflldLANG  1733
             TIHQPSSRLFH+                                   +   EFLLDLANG
Sbjct  358   TIHQPSSRLFHRFDKLILLGRGSLLYFGKSSEALDYFSSIGCSPLIAMNPAEFLLDLANG  417

Query  1732  NINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYETRVAETEKKKLMAPL  1553
             NIND+S+PSEL D+VQ  NS  E     GKPSPA VHEYLV  YETRVAE EKKKL+ P+
Sbjct  418   NINDISVPSELDDRVQVGNSGRE--TQTGKPSPAAVHEYLVEAYETRVAEQEKKKLLDPV  475

Query  1552  PVEEELKSKVRYLKREWGASWSEQYVLLFHRGIRERWHDYFSWLRITQVIATALILGMLW  1373
             P++EE K+K   LKR+WG  W EQY +LF RG++ER H+YFSWLR+TQV++TA+ILG+LW
Sbjct  476   PLDEEAKAKSTRLKRQWGTCWWEQYCILFCRGLKERRHEYFSWLRVTQVLSTAVILGLLW  535

Query  1372  WQSGGDTPSQMQDQAGLLFFIAVFWGFFPVFTAIFTFPQEKAMLSKERAADMYRLSAYFA  1193
             WQS   TP  +QDQAGLLFFIAVFWGFFPVFTAIF FPQE+AML+KERAADMYRLSAYF 
Sbjct  536   WQSDIRTPMGLQDQAGLLFFIAVFWGFFPVFTAIFAFPQERAMLNKERAADMYRLSAYFL  595

Query  1192  ARTTSdlpldlllpliflLVVYFMAGLKQDASSFLLTAVTVFLCIVVAQGLGLAIGATLM  1013
             ARTTSDLPLD +LP +FLLVVYFM GL+     F L+ +TVFLCI+ AQGLGLAIGA LM
Sbjct  596   ARTTSDLPLDFILPSLFLLVVYFMTGLRISPYPFFLSMLTVFLCIIAAQGLGLAIGAILM  655

Query  1012  DLKKATTLASVTVMTFMLAGGYFIKKVPGFIVWL  911
             DLKKATTLASVTVMTFMLAGG+F+K  P F+ +L
Sbjct  656   DLKKATTLASVTVMTFMLAGGFFVKASPLFLDFL  689



>ref|XP_008664823.1| PREDICTED: uncharacterized protein LOC100216600 isoform X1 [Zea 
mays]
Length=753

 Score =   795 bits (2053),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 439/688 (64%), Positives = 519/688 (75%), Gaps = 51/688 (7%)
 Frame = -2

Query  2665  TNSTHIRKSRSAQMKLDLDElssgsvlsrassasl---GFSFTGFS--VRPDESADSKPF  2501
              N++HIRKSRSAQ+KLD+++L S       +S++     F+FTGF+  ++   SAD   F
Sbjct  69    NNNSHIRKSRSAQLKLDVEDLVSSGAALSRASSASLGFSFTFTGFTPPLQHMCSADPPSF  128

Query  2500  SDDENPEDLEAGTKKKRSIPAEPTFPIYLKFTEVSYKIVIKGVTFSEEKDILNGISGAVD  2321
             SDDENP D+EAGT++K+ +  EPT PIYLKF EV Y++  KG      ++IL GISG+  
Sbjct  129   SDDENPVDIEAGTRRKKLV-TEPTLPIYLKFAEVKYRVAGKG----SPREILGGISGSAS  183

Query  2320  PGEVLALMGPSGCGKTTLLSLLGGRIRDPSA--GSITYNQHPYSKLLKSRIGFVTQDDIL  2147
             PGEVLALMGPSG GKTTLLS+LGGR     A  G I+YN  P+SK LK RIGFVTQDD+L
Sbjct  184   PGEVLALMGPSGSGKTTLLSILGGRAAAGGAVDGCISYNDEPFSKSLKRRIGFVTQDDVL  243

Query  2146  FPHLTVKETLIYAARLRLPRTLTKEEKDKRAMDVIYELGLDRCQDTMIGGSFVRGVSGGE  1967
             F HLTVKETL YAA LRLPRT+T+++K +RAMD+I+ELGL+RCQDTMIGGSFVRGVSGGE
Sbjct  244   FAHLTVKETLTYAALLRLPRTMTQQQKKERAMDIIHELGLERCQDTMIGGSFVRGVSGGE  303

Query  1966  RKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILHEIAKAGKTVITTIHQPSSRLF  1787
             RKRVCIGNEI+INPSLLFLDEPTSGLDSTTALRIV +LH+IA+ GKTVITTIHQPSSRLF
Sbjct  304   RKRVCIGNEILINPSLLFLDEPTSGLDSTTALRIVQLLHDIAEDGKTVITTIHQPSSRLF  363

Query  1786  Hk--------------------------------fdklilleflldLANGNINDVSIPSE  1703
             HK                                   +   EFLLDLANGN  DVS+PSE
Sbjct  364   HKFDKLILLGKGSLLYFGKASEAMPYFQSIGCAPLIAMNPAEFLLDLANGNTTDVSVPSE  423

Query  1702  LADKVQTWNSKEEPTRNNGK----PSPAIVHEYLVGCYETRVAETEKKKLMAPLPVEEEL  1535
             L DKV   N   E   NN K    PS   VHEYLV  YETRVA  EKKKL+APLP+ ++L
Sbjct  424   LDDKVHMENHNLE--NNNSKIDYRPSAQDVHEYLVDAYETRVAFKEKKKLLAPLPISDDL  481

Query  1534  KSKVRYLKREWGASWSEQYVLLFHRGIRERWHDYFSWLRITQVIATALILGMLWWQSGGD  1355
             K+ +   KREWG SW +QY +LF RGI+ER HDY SW+RITQVIAT++ILG+LWW S   
Sbjct  482   KATITSSKREWGTSWWQQYSILFCRGIKERRHDYLSWMRITQVIATSVILGLLWWHSDPS  541

Query  1354  TPSQMQDQAGLLFFIAVFWGFFPVFTAIFTFPQEKAMLSKERAADMYRLSAYFAARTTSd  1175
             T   ++DQAGLLFFIAVFWGFFPVFTAIFTFPQE+AML+KERA DMY+LSAYF ARTTSD
Sbjct  542   TLKGLEDQAGLLFFIAVFWGFFPVFTAIFTFPQERAMLNKERAVDMYKLSAYFLARTTSD  601

Query  1174  lpldlllpliflLVVYFMAGLKQDASSFLLTAVTVFLCIVVAQGLGLAIGATLMDLKKAT  995
             LPLDL LP+IF+++VYFMAGLK  A+ F L+ +TVFL I+ AQGLGLAIGATL+D+KKAT
Sbjct  602   LPLDLFLPIIFMVIVYFMAGLKATATHFFLSMLTVFLSIIAAQGLGLAIGATLLDIKKAT  661

Query  994   TLASVTVMTFMLAGGYFIKKVPGFIVWLRDLSFNYHTFKLLLKVQYEHKTNSVNGV-QID  818
             TLASVTVMTFMLAGG+F+K VP FI WLR LSFNYHT++LLLKVQY+   + +     +D
Sbjct  662   TLASVTVMTFMLAGGFFVKSVPPFISWLRYLSFNYHTYRLLLKVQYDPVPDILTTTRHMD  721

Query  817   SGIKEVGALAAMAVSYRLLAYISLRRMK  734
             SG  EV AL AM + YR+LAY+SLRR K
Sbjct  722   SGGTEVAALVAMVIGYRVLAYLSLRRAK  749



>gb|EMS65761.1| ABC transporter G family member 22 [Triticum urartu]
Length=685

 Score =   790 bits (2040),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/632 (66%), Positives = 493/632 (78%), Gaps = 43/632 (7%)
 Frame = -2

Query  2521  SADSKPFSDDENPEDLEA-GTKKKRSIPAEPTFPIYLKFTEVSYKIVIKGVTFSEEKDIL  2345
             SA+  PFSDD+   DLEA G  +++S+ AEPT PIYLKF EV Y++ +KG      ++IL
Sbjct  57    SAELAPFSDDD--VDLEAAGATRRKSLMAEPTLPIYLKFAEVKYRVAVKGT----PREIL  110

Query  2344  NGISGAVDPGEVLALMGPSGCGKTTLLSLLGGRIRDPSAGSITYNQHPYSKLLKSRIGFV  2165
             +GISG+  PGEVLA+MGPSG GKTTLLS+LGGR    + G I+YN  P+ K LK RIGFV
Sbjct  111   SGISGSASPGEVLAMMGPSGSGKTTLLSMLGGRA-TAADGCISYNDEPFGKSLKRRIGFV  169

Query  2164  TQDDILFPHLTVKETLIYAARLRLPRTLTKEEKDKRAMDVIYELGLDRCQDTMIGGSFVR  1985
             TQDD+LF HLTVKETL YAA LRLPRT+T+E+K +RAMD+IYELGL+RCQDTMIGGSFVR
Sbjct  170   TQDDVLFTHLTVKETLTYAALLRLPRTMTREQKKERAMDIIYELGLERCQDTMIGGSFVR  229

Query  1984  GVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILHEIAKAGKTVITTIHQ  1805
             GVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIV +LH+IA+ GKTVITTIHQ
Sbjct  230   GVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVQLLHDIAETGKTVITTIHQ  289

Query  1804  PSSRLFHk--------------------------------fdklilleflldLANGNIND  1721
             PSSRLFHK                                   +   EFLLDLANGN ND
Sbjct  290   PSSRLFHKFDKLILLGRGSLLYFGKTAEAMPYFSSIGCNPLIAMNPAEFLLDLANGNTND  349

Query  1720  VSIPSELADKVQTWNSKEEPTRN--NGKPSPAIVHEYLVGCYETRVAETEKKKLMAPLPV  1547
             VS+PSEL DKV   N   + T +  N +PS   VHEYLV  YE RVA  EKKKL+APLP+
Sbjct  350   VSVPSELDDKVHMENQNLQDTNSKINLRPSAQDVHEYLVDAYEHRVAYKEKKKLLAPLPI  409

Query  1546  EEELKSKVRYLKREWGASWSEQYVLLFHRGIRERWHDYFSWLRITQVIATALILGMLWWQ  1367
              +++K+ +   KREWG +W +QY +LF RG++ER HDY SW+RITQVIAT++ILG+LWW+
Sbjct  410   SDDMKATITSSKREWGTNWCQQYSILFCRGLKERRHDYLSWMRITQVIATSVILGLLWWR  469

Query  1366  SGGDTPSQMQDQAGLLFFIAVFWGFFPVFTAIFTFPQEKAMLSKERAADMYRLSAYFAAR  1187
             S   TP  +QDQAGLLFFIAVFWGFFPVFTAIFTFPQE+AML+KERAADMY+LSAYF AR
Sbjct  470   SDPTTPKGLQDQAGLLFFIAVFWGFFPVFTAIFTFPQERAMLNKERAADMYKLSAYFLAR  529

Query  1186  TTSdlpldlllpliflLVVYFMAGLKQDASSFLLTAVTVFLCIVVAQGLGLAIGATLMDL  1007
             TTSDLPLDL LP+IF+++VYFMAGLK  A  F L+ +TVFL I+ AQGLGLAIGATL+D+
Sbjct  530   TTSDLPLDLFLPVIFMVIVYFMAGLKASAMRFFLSMLTVFLSIIAAQGLGLAIGATLLDI  589

Query  1006  KKATTLASVTVMTFMLAGGYFIKKVPGFIVWLRDLSFNYHTFKLLLKVQYEHKTNSV-NG  830
             KKATTLASVTVMTFMLAGG+F+K+VP FI WLR LSFNYHT++LLLKVQY+   + +   
Sbjct  590   KKATTLASVTVMTFMLAGGFFVKRVPPFISWLRYLSFNYHTYRLLLKVQYDPVPDILMTS  649

Query  829   VQIDSGIKEVGALAAMAVSYRLLAYISLRRMK  734
             V +D+G+ EVGAL AM + YR+LAY+SLRR+K
Sbjct  650   VPLDNGVTEVGALVAMIIGYRVLAYLSLRRVK  681



>ref|XP_009388615.1| PREDICTED: ABC transporter G family member 22-like isoform X1 
[Musa acuminata subsp. malaccensis]
Length=786

 Score =   793 bits (2048),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 427/677 (63%), Positives = 523/677 (77%), Gaps = 39/677 (6%)
 Frame = -2

Query  2653  HIRKSRSAQMKLDLDElssgsvlsrassasl--GFSFTGFSVRPDE-SADSKPFSDDENP  2483
             H+R +RS  MK+D ++  SG  LSRASSASL   FSFTGF+  P++  +D    +  +  
Sbjct  111   HLRSTRSGHMKVDCEDGGSGGSLSRASSASLGFSFSFTGFTALPEDIVSDITALTGGDKG  170

Query  2482  EDLEAGTKKKRSIPAEPTFPIYLKFTEVSYKIVIKGVTFSEEKDILNGISGAVDPGEVLA  2303
              DLE G  +KR + +E T+PIY+KFTEV YK++++G+T + EKDIL GI+G+  PGE+LA
Sbjct  171   IDLEPGRSRKR-LMSETTYPIYVKFTEVRYKVILRGITRTNEKDILQGITGSAKPGELLA  229

Query  2302  LMGPSGCGKTTLLSLLGGRIRDPSA-GSITYNQHPYSKLLKSRIGFVTQDDILFPHLTVK  2126
             LMGPSG GKTTLLSLL GR  D    GSITYN  PY+K LKSRIGFVTQDD+LF HLTV+
Sbjct  230   LMGPSGSGKTTLLSLLSGRTADNVVQGSITYNDEPYAKSLKSRIGFVTQDDVLFAHLTVR  289

Query  2125  ETLIYAARLRLPRTLTKEEKDKRAMDVIYELGLDRCQDTMIGGSFVRGVSGGERKRVCIG  1946
             ETL YAA LRLPRT+T+++K++RAM+VIYELGL+RCQDT+IGGSFVRGVSGGERKRVCIG
Sbjct  290   ETLTYAALLRLPRTMTRKQKEERAMNVIYELGLERCQDTIIGGSFVRGVSGGERKRVCIG  349

Query  1945  NEIIINPSLLFLDEPTSGLDSTTALRIVDILHEIAKAGKTVITTIHQPSSRLFHk-----  1781
             NEII+NPSLLFLDEPTSGLDSTTALR + +L++IA++GKTV+TTIHQPSSRLFH+     
Sbjct  350   NEIIMNPSLLFLDEPTSGLDSTTALRTIQVLNDIAESGKTVVTTIHQPSSRLFHRFDKLI  409

Query  1780  ---------------------------fdklilleflldLANGNINDVSIPSELADKVQT  1682
                                           +   EFLLDLANGNINDV++PSEL +KVQ+
Sbjct  410   LLGRGSLLFFGRASKAMAYFASIGCVPLIAMNPAEFLLDLANGNINDVTLPSELEEKVQS  469

Query  1681  WNSKEEPTRNNGKPSPAIVHEYLVGCYETRVAETEKKKLMAPLPVEEELKSKVRYLKREW  1502
              N     +  N KPSP  VHEYLV  YETRVA+ +KKKL+APLP+ E++K  +   KR+W
Sbjct  470   RNLGG--STRNAKPSPEDVHEYLVETYETRVADKQKKKLLAPLPISEDMKITLSSTKRDW  527

Query  1501  GASWSEQYVLLFHRGIRERWHDYFSWLRITQVIATALILGMLWWQSGGDTPSQMQDQAGL  1322
             GASW +QY +LF RG++ER HDY SW+RITQV+A A+ILG+LWW S   T    +DQAGL
Sbjct  528   GASWWQQYSILFWRGLKERRHDYLSWMRITQVLAIAVILGLLWWHSNIATQIGQEDQAGL  587

Query  1321  LFFIAVFWGFFPVFTAIFTFPQEKAMLSKERAADMYRLSAYFAARTTSdlpldlllplif  1142
             LFFI+VFWGFFPVFTAIFTFPQE+AML+KERA DMYRLSAYF ARTTSDLPLDLLLP+IF
Sbjct  588   LFFISVFWGFFPVFTAIFTFPQERAMLNKERAVDMYRLSAYFIARTTSDLPLDLLLPIIF  647

Query  1141  lLVVYFMAGLKQDASSFLLTAVTVFLCIVVAQGLGLAIGATLMDLKKATTLASVTVMTFM  962
             LL+VYFMAGL+     F L+ + VFL IV AQGLGLAIGA+ M++K+ATTLASVTVMTFM
Sbjct  648   LLIVYFMAGLRLSIEHFFLSMLVVFLSIVAAQGLGLAIGASFMNIKQATTLASVTVMTFM  707

Query  961   LAGGYFIKKVPGFIVWLRDLSFNYHTFKLLLKVQYEHKTNSVNGVQIDSGIKEVGALAAM  782
             LAGG+F+K+VP FI WLR +SFNYH+++LLLKVQY+H    +N   +D+G+ EV A+ AM
Sbjct  708   LAGGFFVKRVPAFISWLRFISFNYHSYRLLLKVQYDHVPPHLNVNHLDNGVMEVAAMIAM  767

Query  781   AVSYRLLAYISLRRMKL  731
               +YR LAY+SLRRMKL
Sbjct  768   VFAYRFLAYVSLRRMKL  784



>ref|XP_009405790.1| PREDICTED: ABC transporter G family member 22-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009405791.1| PREDICTED: ABC transporter G family member 22-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009405793.1| PREDICTED: ABC transporter G family member 22-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009405794.1| PREDICTED: ABC transporter G family member 22-like [Musa acuminata 
subsp. malaccensis]
Length=735

 Score =   791 bits (2042),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 416/676 (62%), Positives = 520/676 (77%), Gaps = 39/676 (6%)
 Frame = -2

Query  2653  HIRKSRSAQMKLDLDEl--ssgsvlsrassaslGFSFTGFSVRPDESADSKPFSDDENPE  2480
             H+RK+ S  MK+D +++   +    + ++S S  +SFTGF+  P E +D+  F ++EN  
Sbjct  62    HLRKTWSGHMKMDSEDVGSEASLSRASSASLSFSYSFTGFTALP-EVSDTAAFGNNENEI  120

Query  2479  DLEAGTKKKRSIPAEPTFPIYLKFTEVSYKIVIKGVTFSEEKDILNGISGAVDPGEVLAL  2300
             DLE   + ++S+ +EPT PIYLKFTEV Y +V+KG+T + EK+IL+GI+G+V PGE+LAL
Sbjct  121   DLEI-QETRKSLMSEPTLPIYLKFTEVRYSVVLKGITTTTEKEILHGITGSVRPGELLAL  179

Query  2299  MGPSGCGKTTLLSLLGGRIR-DPSAGSITYNQHPYSKLLKSRIGFVTQDDILFPHLTVKE  2123
             MGPSG GKTTLLSLLGGRI  +   GS+TYN  PY+K LK R+GFV QDD+LF HLTV+E
Sbjct  180   MGPSGSGKTTLLSLLGGRITANIIQGSVTYNDEPYTKSLKGRMGFVAQDDVLFAHLTVRE  239

Query  2122  TLIYAARLRLPRTLTKEEKDKRAMDVIYELGLDRCQDTMIGGSFVRGVSGGERKRVCIGN  1943
             TL YAA LRLPRT+T+E+K+ RAMD IYELGL+RCQ+T+IGG FVRGVSGGERKRVCIGN
Sbjct  240   TLTYAALLRLPRTMTREQKEDRAMDAIYELGLERCQNTIIGGPFVRGVSGGERKRVCIGN  299

Query  1942  EIIINPSLLFLDEPTSGLDSTTALRIVDILHEIAKAGKTVITTIHQPSSRLFHk------  1781
             EIIINPSLLFLDEPTSGLDSTTALRI+ +LH IAK GKTV+TTIHQPSSRLFH+      
Sbjct  300   EIIINPSLLFLDEPTSGLDSTTALRIIQVLHGIAKLGKTVVTTIHQPSSRLFHRFDKLIL  359

Query  1780  --------------------------fdklilleflldLANGNINDVSIPSELADKVQTW  1679
                                          +   EFLLDLA+GNINDV++PS L  KVQ+ 
Sbjct  360   LGKGSLLYFGKASKAIKYFSSIGCSPLIAMNPAEFLLDLASGNINDVTVPSVLESKVQSK  419

Query  1678  NSKEEPTRNNGKPSPAIVHEYLVGCYETRVAETEKKKLMAPLPVEEELKSKVRYLKREWG  1499
              S  E    NGKPSP  VHEYLV  YE RVA+ + +K++ PLP+ E+LK+ +   KR+WG
Sbjct  420   ES--ESNTRNGKPSPEDVHEYLVEAYEDRVADKQMRKILMPLPISEDLKATLSSQKRDWG  477

Query  1498  ASWSEQYVLLFHRGIRERWHDYFSWLRITQVIATALILGMLWWQSGGDTPSQMQDQAGLL  1319
             ASW +QY +LF RG+ ER HDY SW+RITQV+A A+ILG+LWW+S   T   ++DQAGLL
Sbjct  478   ASWWQQYSILFWRGLNERRHDYLSWMRITQVLAIAVILGLLWWKSSSTTTRGLEDQAGLL  537

Query  1318  FFIAVFWGFFPVFTAIFTFPQEKAMLSKERAADMYRLSAYFAARTTSdlpldlllplifl  1139
             FFI+VFWGFFPVFTAIFTFPQE+AML+KERA DMY+LSAYF ARTTSDLPLDL+LP+IFL
Sbjct  538   FFISVFWGFFPVFTAIFTFPQERAMLTKERAVDMYKLSAYFMARTTSDLPLDLILPIIFL  597

Query  1138  LVVYFMAGLKQDASSFLLTAVTVFLCIVVAQGLGLAIGATLMDLKKATTLASVTVMTFML  959
             L+VYFMAGL++    F LT + VFL I+ AQGLGL IGA+LMD+KKATTL SVTVMTFML
Sbjct  598   LIVYFMAGLRRSIEHFFLTMLVVFLSIIAAQGLGLVIGASLMDIKKATTLGSVTVMTFML  657

Query  958   AGGYFIKKVPGFIVWLRDLSFNYHTFKLLLKVQYEHKTNSVNGVQIDSGIKEVGALAAMA  779
             AGG+F+++VP FI WLR +SFNYHT++LLLKVQY+H  +S+N   +D+G+KE+ AL  M 
Sbjct  658   AGGFFVRRVPVFISWLRYVSFNYHTYRLLLKVQYDHVPSSLNVTHLDNGVKEITALTVMV  717

Query  778   VSYRLLAYISLRRMKL  731
             ++YR++AY+ LRRMKL
Sbjct  718   LTYRIMAYVFLRRMKL  733



>sp|Q9FT51.1|AB27G_ARATH RecName: Full=ABC transporter G family member 27; Short=ABC transporter 
ABCG.27; Short=AtABCG27; AltName: Full=Probable white-brown 
complex homolog protein 28; Short=AtWBC28 [Arabidopsis 
thaliana]
 emb|CAC07922.1| ABC transporter-like protein [Arabidopsis thaliana]
Length=737

 Score =   790 bits (2039),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/679 (63%), Positives = 515/679 (76%), Gaps = 41/679 (6%)
 Frame = -2

Query  2659  STHIRKSRSAQMKLDLDEls--sgsvlsrassaslGFSFTGFSVRPDESADSKPFSDDEN  2486
             +THIRK++SA   LDL  L+  +    + ++S  L FSFTGF+V  +E   S+  S+D+ 
Sbjct  62    NTHIRKAKSAHPALDLAGLTGGAALSRASSASLGLSFSFTGFTVPHEEIIASERCSNDDI  121

Query  2485  PEDLEAGTKKKRSIPAEPTFPIYLKFTEVSYKIVIKGVTFSEEKDILNGISGAVDPGEVL  2306
              ED+EA T       AEPTFPIYLKF +++YK+  KG+T S EK ILNGISG+  PGE+L
Sbjct  122   LEDIEAATSSVVKFQAEPTFPIYLKFIDITYKVTTKGMTSSSEKSILNGISGSAYPGELL  181

Query  2305  ALMGPSGCGKTTLLSLLGGRIRDPS-AGSITYNQHPYSKLLKSRIGFVTQDDILFPHLTV  2129
             ALMGPSG GKTTLL+ LGGR    +  GS++YN  PYSK LK+RIGFVTQDD+LFPHLTV
Sbjct  182   ALMGPSGSGKTTLLNALGGRFNQQNIGGSVSYNDKPYSKHLKTRIGFVTQDDVLFPHLTV  241

Query  2128  KETLIYAARLRLPRTLTKEEKDKRAMDVIYELGLDRCQDTMIGGSFVRGVSGGERKRVCI  1949
             KETL Y A LRLP+TLT++EK++RA  VI ELGL+RCQDTMIGGSFVRGVSGGERKRVCI
Sbjct  242   KETLTYTALLRLPKTLTEQEKEQRAASVIQELGLERCQDTMIGGSFVRGVSGGERKRVCI  301

Query  1948  GNEIIINPSLLFLDEPTSGLDSTTALRIVDILHEIAKAGKTVITTIHQPSSRLFHkfdkl  1769
             GNEI+ NPSLL LDEPTS LDSTTAL+IV +LH IAKAGKT++TTIHQPSSRLFH+FDKL
Sbjct  302   GNEIMTNPSLLLLDEPTSSLDSTTALKIVQMLHCIAKAGKTIVTTIHQPSSRLFHRFDKL  361

Query  1768  illeflldL--------------------------------ANGNINDVSIPSELADKVQ  1685
             ++L     L                                 NGN+ND+S+PS L +K++
Sbjct  362   VVLSRGSLLYFGKASEAMSYFSSIGCSPLLAMNPAEFLLDLVNGNMNDISVPSALKEKMK  421

Query  1684  TWNSKEEPTRNNGKPSPAIVHEYLVGCYETRVAETEKKKLMAPLPVEEELKSKVRYLKRE  1505
                 + E    N K    +  +YL   Y+T++A  EK KLMAP+P++EE+K  +   KRE
Sbjct  422   II--RLELYVRNVKCD--VETQYLEEAYKTQIAVMEKMKLMAPVPLDEEVKLMITCPKRE  477

Query  1504  WGASWSEQYVLLFHRGIRERWHDYFSWLRITQVIATALILGMLWWQSGGDTPSQMQDQAG  1325
             WG SW EQY LL  RGI+ER HDYFSWLR+TQV++TA+ILG+LWWQS  D  SQ   ++G
Sbjct  478   WGLSWWEQYCLLSLRGIKERRHDYFSWLRVTQVLSTAIILGLLWWQS--DITSQRPTRSG  535

Query  1324  LLFFIAVFWGFFPVFTAIFTFPQEKAMLSKERAADMYRLSAYFAARTTSdlpldlllpli  1145
             LLFFIAVFWGFFPVFTAIFTFPQE+AMLSKER ++MYRLSAYF ARTTSDLPLDL+LP++
Sbjct  536   LLFFIAVFWGFFPVFTAIFTFPQERAMLSKERESNMYRLSAYFVARTTSDLPLDLILPVL  595

Query  1144  flLVVYFMAGLKQDASSFLLTAVTVFLCIVVAQGLGLAIGATLMDLKKATTLASVTVMTF  965
             FL+VVYFMAGL+  A SF L+ +TVFLCIV AQGLGLAIGA+LMDLKKATTLASVTVMTF
Sbjct  596   FLVVVYFMAGLRLRAESFFLSVLTVFLCIVAAQGLGLAIGASLMDLKKATTLASVTVMTF  655

Query  964   MLAGGYFIKKVPGFIVWLRDLSFNYHTFKLLLKVQYEHKTNSVNGVQIDSGIKEVGALAA  785
             MLAGGYF+KKVP FI W+R +SFNYHT+KLL+KVQYE    SVNG +I+SG+KEV AL A
Sbjct  656   MLAGGYFVKKVPFFIAWIRFMSFNYHTYKLLVKVQYEEIMESVNGEEIESGLKEVSALVA  715

Query  784   MAVSYRLLAYISLRRMKLQ  728
             M + YRL+AY SLRRMKL 
Sbjct  716   MIIGYRLVAYFSLRRMKLH  734



>ref|XP_009388622.1| PREDICTED: ABC transporter G family member 22-like isoform X2 
[Musa acuminata subsp. malaccensis]
Length=782

 Score =   791 bits (2043),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 452/773 (58%), Positives = 557/773 (72%), Gaps = 61/773 (8%)
 Frame = -2

Query  2929  HAFHELARFSCTVNQFQMEQTNSTSLLRTKSDQLVEaiaaakgsarARLPRLSAEFAGSG  2750
             H+F E  R  C     +M+ + +  + RTKSDQL          A  R P LS   +   
Sbjct  29    HSFSEELR--CV----EMD-SAAGGIARTKSDQL--------EMAPPRPPTLSPTPSAES  73

Query  2749  VP----ESVRMLSRKPSRRLMppspggggsgGTNSTHIRKSRSAQMKLDLDElssgsvls  2582
             +P         LSRK S   +     G         H+R +RS  MK+D ++  SG  LS
Sbjct  74    MPVADANGGPSLSRKSS---LGKKLVGSSPATKAGHHLRSTRSGHMKVDCEDGGSGGSLS  130

Query  2581  rassasl--GFSFTGFSVRPDE-SADSKPFSDDENPEDLEAGTKKKRSIPAEPTFPIYLK  2411
             RASSASL   FSFTGF+  P++  +D    +  +   DLE G  +KR + +E T+PIY+K
Sbjct  131   RASSASLGFSFSFTGFTALPEDIVSDITALTGGDKGIDLEPGRSRKR-LMSETTYPIYVK  189

Query  2410  FTEVSYKIVIKGVTFSEEKDILNGISGAVDPGEVLALMGPSGCGKTTLLSLLGGRIRDPS  2231
             FTEV YK++++G+T + EKDIL GI+G+  PGE+LALMGPSG GKTTLLSLL GR  D  
Sbjct  190   FTEVRYKVILRGITRTNEKDILQGITGSAKPGELLALMGPSGSGKTTLLSLLSGRTADNV  249

Query  2230  A-GSITYNQHPYSKLLKSRIGFVTQDDILFPHLTVKETLIYAARLRLPRTLTKEEKDKRA  2054
               GSITYN  PY+K LKSRIGFVTQDD+LF HLTV+ETL YAA LRLPRT+T+++K++RA
Sbjct  250   VQGSITYNDEPYAKSLKSRIGFVTQDDVLFAHLTVRETLTYAALLRLPRTMTRKQKEERA  309

Query  2053  MDVIYELGLDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTA  1874
             M+VIYELGL+RCQDT+IGGSFVRGVSGGERKRVCIGNEII+NPSLLFLDEPTSGLDSTTA
Sbjct  310   MNVIYELGLERCQDTIIGGSFVRGVSGGERKRVCIGNEIIMNPSLLFLDEPTSGLDSTTA  369

Query  1873  LRIVDILHEIAKAGKTVITTIHQPSSRLFHk-----------------------------  1781
             LR + +L++IA++GKTV+TTIHQPSSRLFH+                             
Sbjct  370   LRTIQVLNDIAESGKTVVTTIHQPSSRLFHRFDKLILLGRGSLLFFGRASKAMAYFASIG  429

Query  1780  ---fdklilleflldLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLV  1610
                   +   EFLLDLANGNINDV++PSEL +KVQ+ N     +  N KPSP  VHEYLV
Sbjct  430   CVPLIAMNPAEFLLDLANGNINDVTLPSELEEKVQSRNLGG--STRNAKPSPEDVHEYLV  487

Query  1609  GCYETRVAETEKKKLMAPLPVEEELKSKVRYLKREWGASWSEQYVLLFHRGIRERWHDYF  1430
               YETRVA+ +KKKL+APLP+ E++K  +   KR+WGASW +QY +LF RG++ER HDY 
Sbjct  488   ETYETRVADKQKKKLLAPLPISEDMKITLSSTKRDWGASWWQQYSILFWRGLKERRHDYL  547

Query  1429  SWLRITQVIATALILGMLWWQSGGDTPSQMQDQAGLLFFIAVFWGFFPVFTAIFTFPQEK  1250
             SW+RITQV+A A+ILG+LWW S   T    +DQAGLLFFI+VFWGFFPVFTAIFTFPQE+
Sbjct  548   SWMRITQVLAIAVILGLLWWHSNIATQIGQEDQAGLLFFISVFWGFFPVFTAIFTFPQER  607

Query  1249  AMLSKERAADMYRLSAYFAARTTSdlpldlllpliflLVVYFMAGLKQDASSFLLTAVTV  1070
             AML+KERA DMYRLSAYF ARTTSDLPLDLLLP+IFLL+VYFMAGL+     F L+ + V
Sbjct  608   AMLNKERAVDMYRLSAYFIARTTSDLPLDLLLPIIFLLIVYFMAGLRLSIEHFFLSMLVV  667

Query  1069  FLCIVVAQGLGLAIGATLMDLKKATTLASVTVMTFMLAGGYFIKKVPGFIVWLRDLSFNY  890
             FL IV AQGLGLAIGA+ M++K+ATTLASVTVMTFMLAGG+F+K+VP FI WLR +SFNY
Sbjct  668   FLSIVAAQGLGLAIGASFMNIKQATTLASVTVMTFMLAGGFFVKRVPAFISWLRFISFNY  727

Query  889   HTFKLLLKVQYEHKTNSVNGVQIDSGIKEVGALAAMAVSYRLLAYISLRRMKL  731
             H+++LLLKVQY+H    +N   +D+G+ EV A+ AM  +YR LAY+SLRRMKL
Sbjct  728   HSYRLLLKVQYDHVPPHLNVNHLDNGVMEVAAMIAMVFAYRFLAYVSLRRMKL  780



>ref|XP_002465834.1| hypothetical protein SORBIDRAFT_01g046620 [Sorghum bicolor]
 gb|EER92832.1| hypothetical protein SORBIDRAFT_01g046620 [Sorghum bicolor]
Length=763

 Score =   790 bits (2041),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 450/748 (60%), Positives = 541/748 (72%), Gaps = 59/748 (8%)
 Frame = -2

Query  2848  RTKSDQLVEaiaaakgsarARLPRLSAEFAGSGVPESVRMLSRKPSRRLMppspggggsg  2669
             RTKS+QL    + +      R P  SAE   S +P     LSRKPS             G
Sbjct  28    RTKSEQLAPLQSLS------RTP--SAETVLS-MPADATSLSRKPS--FGRKRRSASVGG  76

Query  2668  GTNSTHIRKSRSAQMKLDLDElssgsvlsrassasl---GFSFTGFSVRPDESADSKPFS  2498
             G N THIRKSRSAQ+KLD+++L S       +S++     F+FTGF+          P  
Sbjct  77    GNNRTHIRKSRSAQLKLDVEDLVSSGAALSRASSASLGFSFTFTGFTSPLQHMCSPDPPP  136

Query  2497  DDENPE----DLEAGTKKKRSIPAEPTFPIYLKFTEVSYKIVIKGVTFSEEKDILNGISG  2330
                + +    D+EAGT++K+ +  EPT PIYLKF EV Y++  KG      ++IL GISG
Sbjct  137   PFSDDDDSPMDIEAGTRRKK-LMTEPTLPIYLKFAEVKYRVAGKG----SPREILGGISG  191

Query  2329  AVDPGEVLALMGPSGCGKTTLLSLLGGRIRDPSA-GSITYNQHPYSKLLKSRIGFVTQDD  2153
             +  PGEVLALMGPSG GKTTLLS+LGGR    +  GSI+YN  PYSK LK RIGFVTQDD
Sbjct  192   SASPGEVLALMGPSGSGKTTLLSILGGRAGSGAVEGSISYNDEPYSKSLKRRIGFVTQDD  251

Query  2152  ILFPHLTVKETLIYAARLRLPRTLTKEEKDKRAMDVIYELGLDRCQDTMIGGSFVRGVSG  1973
             +LF HLTVKETL YAA LRLPRT+T+++K +RAMD+IYELGL+RCQDTMIGGSF+RGVSG
Sbjct  252   VLFTHLTVKETLTYAALLRLPRTMTQQQKKERAMDIIYELGLERCQDTMIGGSFIRGVSG  311

Query  1972  GERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILHEIAKAGKTVITTIHQPSSR  1793
             GERKRVCIGNEI+INPSLLFLDEPTSGLDSTTALRIV +LH+IA+ GKTVITTIHQPSSR
Sbjct  312   GERKRVCIGNEILINPSLLFLDEPTSGLDSTTALRIVQLLHDIAEDGKTVITTIHQPSSR  371

Query  1792  LFHk--------------------------------fdklilleflldLANGNINDVSIP  1709
             LFHK                                   +   EFLLDLANGN NDVS+P
Sbjct  372   LFHKFDKLILLGKGSLLYFGKASEAMPYFQSIGCTPLIAMNPAEFLLDLANGNTNDVSVP  431

Query  1708  SELADKVQTWNSKEEP--TRNNGKPSPAIVHEYLVGCYETRVAETEKKKLMAPLPVEEEL  1535
             SEL DKV   N   E   ++N+ +PS   VHEYLV  YETRVA  EKKKL+APLP+ ++L
Sbjct  432   SELDDKVHMENHNLENNNSKNDHRPSAQDVHEYLVDAYETRVAFKEKKKLLAPLPICDDL  491

Query  1534  KSKVRYLKREWGASWSEQYVLLFHRGIRERWHDYFSWLRITQVIATALILGMLWWQSGGD  1355
             K+ +   KREWG SW +QY +LF RGI+ER HDY SW+RITQVIAT++ILG+LWW+S   
Sbjct  492   KATITSSKREWGTSWWQQYSILFCRGIKERRHDYLSWMRITQVIATSIILGLLWWRSDPS  551

Query  1354  TPSQMQDQAGLLFFIAVFWGFFPVFTAIFTFPQEKAMLSKERAADMYRLSAYFAARTTSd  1175
             T   ++DQAGLLFFIAVFWGFFPVFTAIFTFPQE+AML+KERA DMY+LSAYF ARTTSD
Sbjct  552   TLKGLEDQAGLLFFIAVFWGFFPVFTAIFTFPQERAMLNKERAVDMYKLSAYFLARTTSD  611

Query  1174  lpldlllpliflLVVYFMAGLKQDASSFLLTAVTVFLCIVVAQGLGLAIGATLMDLKKAT  995
             LPLDL LP+IF+++VYFMAGLK  A+ F L+ +TVFL I+ AQGLGL IGATL+D+KKAT
Sbjct  612   LPLDLFLPVIFMVIVYFMAGLKATATHFFLSVLTVFLSIIAAQGLGLVIGATLLDIKKAT  671

Query  994   TLASVTVMTFMLAGGYFIKKVPGFIVWLRDLSFNYHTFKLLLKVQYEHKTNSVNGVQ-ID  818
             TLASVTVMTFMLAGG+F+K+VP FI WLR LSFNYHT++LLLKVQY+   + +   + +D
Sbjct  672   TLASVTVMTFMLAGGFFVKRVPPFISWLRYLSFNYHTYRLLLKVQYDPVPDILTTTKHMD  731

Query  817   SGIKEVGALAAMAVSYRLLAYISLRRMK  734
             +G  EV AL AM + YR+LAY+SLRR+K
Sbjct  732   NGATEVAALVAMIIGYRVLAYLSLRRVK  759



>gb|KEH41808.1| white-brown-complex ABC transporter family protein [Medicago 
truncatula]
Length=587

 Score =   783 bits (2022),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/598 (68%), Positives = 475/598 (79%), Gaps = 46/598 (8%)
 Frame = -2

Query  2416  LKFTEVSYKIVIKGVTFSEEKDILNGISGAVDPGEVLALMGPSGCGKTTLLSLLGGRIRD  2237
             ++FT+V+YK+V+KG+T S +KDILNGISG+V+PGEVLA+MGPSG GKTTLL LLGGR+  
Sbjct  1     MQFTDVTYKVVLKGMTSSGKKDILNGISGSVNPGEVLAMMGPSGSGKTTLLKLLGGRLNH  60

Query  2236  --PSAGSITYNQHPYSKLLKSRIGFVTQDDILFPHLTVKETLIYAARLRLPRTLTKEEKD  2063
                + GSITYN   YSK LKSRIGFVTQDD+LF HLTVKETL Y ARLRLP+TLTKE+K+
Sbjct  61    HPTNGGSITYNDKIYSKFLKSRIGFVTQDDVLFTHLTVKETLTYTARLRLPKTLTKEQKE  120

Query  2062  KRAMDVIYELGLDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDS  1883
             KRA+DVIYELGL+RCQ+TMIG SFV G+SGGERKRVCIGNEIIINPS+LFLDEPTSGLDS
Sbjct  121   KRALDVIYELGLERCQNTMIGDSFVPGLSGGERKRVCIGNEIIINPSILFLDEPTSGLDS  180

Query  1882  TTALRIVDILHEIAKAGKTVITTIHQPSSRLFHk--------------------------  1781
             TTAL+IV +L ++AKAGKTV+TTIHQPSSRLFHK                          
Sbjct  181   TTALKIVQMLQDMAKAGKTVVTTIHQPSSRLFHKFDKLILLGKGSSLYFGKASESMNYFQ  240

Query  1780  ------fdklilleflldLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHE  1619
                      +   EFLLDLANGNINDVS+PSEL DKVQT           G  + A+VHE
Sbjct  241   SIGCSPLISMNPAEFLLDLANGNINDVSVPSELKDKVQT-----------GNEASAVVHE  289

Query  1618  YLVGCYETRVAETEKKKLMAPLPVEEELKSKV-RYLKREWGASWSEQYVLLFHRGIRERW  1442
             YLV  +E+R+AETEKKK++  +P +E LK KV    KR+WGASW EQ+ +LF RGI+ER 
Sbjct  290   YLVEAFESRLAETEKKKIIVSVPQDEALKIKVCSSPKRQWGASWDEQFSILFCRGIKERK  349

Query  1441  HDYFSWLRITQVIATALILGMLWWQSGGDTPSQMQDQAGLLFFIAVFWGFFPVFTAIFTF  1262
             HDYFSWLRITQV++TA+ILG LWWQS  + P  +QDQAGLLFFI VFWG  PVFTAIFTF
Sbjct  350   HDYFSWLRITQVLSTAIILGSLWWQSDAENPKDLQDQAGLLFFITVFWGLIPVFTAIFTF  409

Query  1261  PQEKAMLSKERAADMYRLSAYFAARTTSdlpldlllpliflLVVYFMAGLKQDASSFLLT  1082
             PQE+AML+KERAADMYRLSAYF ARTTSDLPLDL+L ++FLLVVYFMAGL+  A+SF LT
Sbjct  410   PQERAMLNKERAADMYRLSAYFLARTTSDLPLDLILSVLFLLVVYFMAGLRLSAASFFLT  469

Query  1081  AVTVFLCIVVAQGLGLAIGATLMDLKKATTLASVTVMTFMLAGGYFIKKVPGFIVWLRDL  902
              +TVFLCI+ AQGLGLAIGA LMD K ATTL SVTVM FMLAGG+F++KVP FI W+R +
Sbjct  470   ILTVFLCIIAAQGLGLAIGAVLMDSKSATTLGSVTVMIFMLAGGFFVQKVPIFISWIRYM  529

Query  901   SFNYHTFKLLLKVQYEHKTNSVNGVQIDSGIKEVGALAAMAVSYRLLAYISLRRMKLQ  728
             SFNYHT+KLLLKVQYEH T  VNG++IDSG+ EV AL AM   YR LAY+SLRRMKLQ
Sbjct  530   SFNYHTYKLLLKVQYEHLTPIVNGIKIDSGLTEVAALIAMVFGYRFLAYLSLRRMKLQ  587



>ref|NP_190799.2| ABC transporter G family member 27 [Arabidopsis thaliana]
 gb|AEE78930.1| ABC transporter G family member 27 [Arabidopsis thaliana]
Length=784

 Score =   790 bits (2040),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 428/679 (63%), Positives = 515/679 (76%), Gaps = 41/679 (6%)
 Frame = -2

Query  2659  STHIRKSRSAQMKLDLDEls--sgsvlsrassaslGFSFTGFSVRPDESADSKPFSDDEN  2486
             +THIRK++SA   LDL  L+  +    + ++S  L FSFTGF+V  +E   S+  S+D+ 
Sbjct  109   NTHIRKAKSAHPALDLAGLTGGAALSRASSASLGLSFSFTGFTVPHEEIIASERCSNDDI  168

Query  2485  PEDLEAGTKKKRSIPAEPTFPIYLKFTEVSYKIVIKGVTFSEEKDILNGISGAVDPGEVL  2306
              ED+EA T       AEPTFPIYLKF +++YK+  KG+T S EK ILNGISG+  PGE+L
Sbjct  169   LEDIEAATSSVVKFQAEPTFPIYLKFIDITYKVTTKGMTSSSEKSILNGISGSAYPGELL  228

Query  2305  ALMGPSGCGKTTLLSLLGGRIRDPS-AGSITYNQHPYSKLLKSRIGFVTQDDILFPHLTV  2129
             ALMGPSG GKTTLL+ LGGR    +  GS++YN  PYSK LK+RIGFVTQDD+LFPHLTV
Sbjct  229   ALMGPSGSGKTTLLNALGGRFNQQNIGGSVSYNDKPYSKHLKTRIGFVTQDDVLFPHLTV  288

Query  2128  KETLIYAARLRLPRTLTKEEKDKRAMDVIYELGLDRCQDTMIGGSFVRGVSGGERKRVCI  1949
             KETL Y A LRLP+TLT++EK++RA  VI ELGL+RCQDTMIGGSFVRGVSGGERKRVCI
Sbjct  289   KETLTYTALLRLPKTLTEQEKEQRAASVIQELGLERCQDTMIGGSFVRGVSGGERKRVCI  348

Query  1948  GNEIIINPSLLFLDEPTSGLDSTTALRIVDILHEIAKAGKTVITTIHQPSSRLFHkfdkl  1769
             GNEI+ NPSLL LDEPTS LDSTTAL+IV +LH IAKAGKT++TTIHQPSSRLFH+FDKL
Sbjct  349   GNEIMTNPSLLLLDEPTSSLDSTTALKIVQMLHCIAKAGKTIVTTIHQPSSRLFHRFDKL  408

Query  1768  illeflldL--------------------------------ANGNINDVSIPSELADKVQ  1685
             ++L     L                                 NGN+ND+S+PS L +K++
Sbjct  409   VVLSRGSLLYFGKASEAMSYFSSIGCSPLLAMNPAEFLLDLVNGNMNDISVPSALKEKMK  468

Query  1684  TWNSKEEPTRNNGKPSPAIVHEYLVGCYETRVAETEKKKLMAPLPVEEELKSKVRYLKRE  1505
                 + E    N K    +  +YL   Y+T++A  EK KLMAP+P++EE+K  +   KRE
Sbjct  469   II--RLELYVRNVKCD--VETQYLEEAYKTQIAVMEKMKLMAPVPLDEEVKLMITCPKRE  524

Query  1504  WGASWSEQYVLLFHRGIRERWHDYFSWLRITQVIATALILGMLWWQSGGDTPSQMQDQAG  1325
             WG SW EQY LL  RGI+ER HDYFSWLR+TQV++TA+ILG+LWWQS  D  SQ   ++G
Sbjct  525   WGLSWWEQYCLLSLRGIKERRHDYFSWLRVTQVLSTAIILGLLWWQS--DITSQRPTRSG  582

Query  1324  LLFFIAVFWGFFPVFTAIFTFPQEKAMLSKERAADMYRLSAYFAARTTSdlpldlllpli  1145
             LLFFIAVFWGFFPVFTAIFTFPQE+AMLSKER ++MYRLSAYF ARTTSDLPLDL+LP++
Sbjct  583   LLFFIAVFWGFFPVFTAIFTFPQERAMLSKERESNMYRLSAYFVARTTSDLPLDLILPVL  642

Query  1144  flLVVYFMAGLKQDASSFLLTAVTVFLCIVVAQGLGLAIGATLMDLKKATTLASVTVMTF  965
             FL+VVYFMAGL+  A SF L+ +TVFLCIV AQGLGLAIGA+LMDLKKATTLASVTVMTF
Sbjct  643   FLVVVYFMAGLRLRAESFFLSVLTVFLCIVAAQGLGLAIGASLMDLKKATTLASVTVMTF  702

Query  964   MLAGGYFIKKVPGFIVWLRDLSFNYHTFKLLLKVQYEHKTNSVNGVQIDSGIKEVGALAA  785
             MLAGGYF+KKVP FI W+R +SFNYHT+KLL+KVQYE    SVNG +I+SG+KEV AL A
Sbjct  703   MLAGGYFVKKVPFFIAWIRFMSFNYHTYKLLVKVQYEEIMESVNGEEIESGLKEVSALVA  762

Query  784   MAVSYRLLAYISLRRMKLQ  728
             M + YRL+AY SLRRMKL 
Sbjct  763   MIIGYRLVAYFSLRRMKLH  781



>ref|XP_008664829.1| PREDICTED: uncharacterized protein LOC100216600 isoform X2 [Zea 
mays]
Length=752

 Score =   788 bits (2034),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 438/688 (64%), Positives = 518/688 (75%), Gaps = 52/688 (8%)
 Frame = -2

Query  2665  TNSTHIRKSRSAQMKLDLDElssgsvlsrassasl---GFSFTGFS--VRPDESADSKPF  2501
              N++HIRKSRSAQ+KLD+++L S       +S++     F+FTGF+  ++   SAD   F
Sbjct  69    NNNSHIRKSRSAQLKLDVEDLVSSGAALSRASSASLGFSFTFTGFTPPLQHMCSADPPSF  128

Query  2500  SDDENPEDLEAGTKKKRSIPAEPTFPIYLKFTEVSYKIVIKGVTFSEEKDILNGISGAVD  2321
             SDDEN  D+EAGT++K+ +  EPT PIYLKF EV Y++  KG      ++IL GISG+  
Sbjct  129   SDDEN-LDIEAGTRRKKLV-TEPTLPIYLKFAEVKYRVAGKG----SPREILGGISGSAS  182

Query  2320  PGEVLALMGPSGCGKTTLLSLLGGRIRDPSA--GSITYNQHPYSKLLKSRIGFVTQDDIL  2147
             PGEVLALMGPSG GKTTLLS+LGGR     A  G I+YN  P+SK LK RIGFVTQDD+L
Sbjct  183   PGEVLALMGPSGSGKTTLLSILGGRAAAGGAVDGCISYNDEPFSKSLKRRIGFVTQDDVL  242

Query  2146  FPHLTVKETLIYAARLRLPRTLTKEEKDKRAMDVIYELGLDRCQDTMIGGSFVRGVSGGE  1967
             F HLTVKETL YAA LRLPRT+T+++K +RAMD+I+ELGL+RCQDTMIGGSFVRGVSGGE
Sbjct  243   FAHLTVKETLTYAALLRLPRTMTQQQKKERAMDIIHELGLERCQDTMIGGSFVRGVSGGE  302

Query  1966  RKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILHEIAKAGKTVITTIHQPSSRLF  1787
             RKRVCIGNEI+INPSLLFLDEPTSGLDSTTALRIV +LH+IA+ GKTVITTIHQPSSRLF
Sbjct  303   RKRVCIGNEILINPSLLFLDEPTSGLDSTTALRIVQLLHDIAEDGKTVITTIHQPSSRLF  362

Query  1786  Hk--------------------------------fdklilleflldLANGNINDVSIPSE  1703
             HK                                   +   EFLLDLANGN  DVS+PSE
Sbjct  363   HKFDKLILLGKGSLLYFGKASEAMPYFQSIGCAPLIAMNPAEFLLDLANGNTTDVSVPSE  422

Query  1702  LADKVQTWNSKEEPTRNNGK----PSPAIVHEYLVGCYETRVAETEKKKLMAPLPVEEEL  1535
             L DKV   N   E   NN K    PS   VHEYLV  YETRVA  EKKKL+APLP+ ++L
Sbjct  423   LDDKVHMENHNLE--NNNSKIDYRPSAQDVHEYLVDAYETRVAFKEKKKLLAPLPISDDL  480

Query  1534  KSKVRYLKREWGASWSEQYVLLFHRGIRERWHDYFSWLRITQVIATALILGMLWWQSGGD  1355
             K+ +   KREWG SW +QY +LF RGI+ER HDY SW+RITQVIAT++ILG+LWW S   
Sbjct  481   KATITSSKREWGTSWWQQYSILFCRGIKERRHDYLSWMRITQVIATSVILGLLWWHSDPS  540

Query  1354  TPSQMQDQAGLLFFIAVFWGFFPVFTAIFTFPQEKAMLSKERAADMYRLSAYFAARTTSd  1175
             T   ++DQAGLLFFIAVFWGFFPVFTAIFTFPQE+AML+KERA DMY+LSAYF ARTTSD
Sbjct  541   TLKGLEDQAGLLFFIAVFWGFFPVFTAIFTFPQERAMLNKERAVDMYKLSAYFLARTTSD  600

Query  1174  lpldlllpliflLVVYFMAGLKQDASSFLLTAVTVFLCIVVAQGLGLAIGATLMDLKKAT  995
             LPLDL LP+IF+++VYFMAGLK  A+ F L+ +TVFL I+ AQGLGLAIGATL+D+KKAT
Sbjct  601   LPLDLFLPIIFMVIVYFMAGLKATATHFFLSMLTVFLSIIAAQGLGLAIGATLLDIKKAT  660

Query  994   TLASVTVMTFMLAGGYFIKKVPGFIVWLRDLSFNYHTFKLLLKVQYEHKTNSVNGV-QID  818
             TLASVTVMTFMLAGG+F+K VP FI WLR LSFNYHT++LLLKVQY+   + +     +D
Sbjct  661   TLASVTVMTFMLAGGFFVKSVPPFISWLRYLSFNYHTYRLLLKVQYDPVPDILTTTRHMD  720

Query  817   SGIKEVGALAAMAVSYRLLAYISLRRMK  734
             SG  EV AL AM + YR+LAY+SLRR K
Sbjct  721   SGGTEVAALVAMVIGYRVLAYLSLRRAK  748



>ref|XP_006430002.1| hypothetical protein CICLE_v10011143mg [Citrus clementina]
 gb|ESR43242.1| hypothetical protein CICLE_v10011143mg [Citrus clementina]
Length=650

 Score =   783 bits (2021),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 432/642 (67%), Positives = 511/642 (80%), Gaps = 45/642 (7%)
 Frame = -2

Query  2866  NSTSLLRTKSDQLVEaiaaakgsarARLPRLSAEFAGSGVPESVRMLSRKPSRRLMppsp  2687
             +STSL RTKSDQLVE ++AA  S       +S+E AG+   +    LSRK SRR++  + 
Sbjct  6     SSTSLARTKSDQLVETLSAAFKSP------VSSETAGAS--DGGGTLSRKSSRRMLTAAS  57

Query  2686  ggggsgGTNSTHIRKSRSAQMKLDLDElssgsvlsrassasl--GFSFTGFSVRPDESAD  2513
              G       +THIRKSRSAQ+KL+LDE+SSG+ LSRASSASL   FSFTGF++ PDE AD
Sbjct  58    PGRAGASGRNTHIRKSRSAQLKLELDEVSSGAALSRASSASLGLSFSFTGFTMPPDEIAD  117

Query  2512  SKPFSDDENPEDLEAGTKKKRSIPAEPTFPIYLKFTEVSYKIVIKGVTFSEEKDILNGIS  2333
             SKPFSDD+ PED+EAGT+++     EPT PIYLKFT+V+YK+++KG+T SEEKDILNGI+
Sbjct  118   SKPFSDDDIPEDIEAGTRERPKFQTEPTLPIYLKFTDVTYKVILKGMTSSEEKDILNGIT  177

Query  2332  GAVDPGEVLALMGPSGCGKTTLLSLLGGRIRDPS-AGSITYNQHPYSKLLKSRIGFVTQD  2156
             G+V+PGEVLALMGPSG GKTTLL+LL GR+ +P+  GSITYN HPYSK LKS+IGFVTQD
Sbjct  178   GSVNPGEVLALMGPSGSGKTTLLNLLSGRLMEPTVGGSITYNDHPYSKSLKSKIGFVTQD  237

Query  2155  DILFPHLTVKETLIYAARLRLPRTLTKEEKDKRAMDVIYELGLDRCQDTMIGGSFVRGVS  1976
             D+LFPHLTVKETL YAA LRLP TLTK++K+KRA+DVI ELGL+RCQDTMIGGSFVRGVS
Sbjct  238   DVLFPHLTVKETLTYAALLRLPNTLTKQQKEKRAIDVINELGLERCQDTMIGGSFVRGVS  297

Query  1975  GGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILHEIAKAGKTVITTIHQPSS  1796
             GGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALR V +L +IA+AGKTV+TTIHQPSS
Sbjct  298   GGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRTVQMLQDIAEAGKTVVTTIHQPSS  357

Query  1795  RLFHk--------------------------------fdklilleflldLANGNINDVSI  1712
             RLFHK                                   +   EFLLDLANGN++DVS+
Sbjct  358   RLFHKFDKLILLGKGSLLYFGKASEAMTYFSSIGCSPQIAMNPAEFLLDLANGNLHDVSV  417

Query  1711  PSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYETRVAETEKKKLMAPLPVEEELK  1532
             PSEL D+VQT NS+ +    NGKP+PAIVHEYLV  YETRVAE EKKKLMAP+P++EE+K
Sbjct  418   PSELQDRVQTENSENDTA--NGKPTPAIVHEYLVEAYETRVAENEKKKLMAPIPLDEEIK  475

Query  1531  SKVRYLKREWGASWSEQYVLLFHRGIRERWHDYFSWLRITQVIATALILGMLWWQSGGDT  1352
             +KV   KR WGASW +QY +LF RGI+E  HDYFSWLRITQV+ATA+ILG+LWWQS   +
Sbjct  476   AKVSSPKRNWGASWIQQYTILFRRGIKEHRHDYFSWLRITQVLATAVILGLLWWQSDSKS  535

Query  1351  PSQMQDQAGLLFFIAVFWGFFPVFTAIFTFPQEKAMLSKERAADMYRLSAYFAARTTSdl  1172
             P  ++DQAGLLFFIAVFW FFP+FTAIFTFPQE+AMLSKERAADMYRLSAYF ARTTSDL
Sbjct  536   PKGLEDQAGLLFFIAVFWSFFPIFTAIFTFPQERAMLSKERAADMYRLSAYFLARTTSDL  595

Query  1171  pldlllpliflLVVYFMAGLKQDASSFLLTAVTVFLCIVVAQ  1046
             PL+L+LP++FL++VYFMAGL+  A  F L+ +TVFL IV AQ
Sbjct  596   PLNLVLPVLFLVIVYFMAGLRMGAGPFFLSMLTVFLSIVAAQ  637



>emb|CDX95330.1| BnaC04g28280D [Brassica napus]
Length=738

 Score =   785 bits (2028),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 434/755 (57%), Positives = 536/755 (71%), Gaps = 58/755 (8%)
 Frame = -2

Query  2881  QMEQTNSTSLLRTKSDQLVEaiaaakgsarARLPRLSAEFAGSGVPESVRMLSRKPSRRL  2702
             +M  ++S+ L++ KS+ L EA           L   S +F+  G         RK   R 
Sbjct  2     EMGTSSSSGLVKAKSETLAEA-----------LKSSSLDFSNGGGSSH----GRKQHVRA  46

Query  2701  MppspggggsgGTNSTHIRKSRSAQMKLDLDEls--sgsvlsrassaslGFSFTGFSVRP  2528
                    G S    +THIRK+++    LDL  L+       + ++S  L FSFTGF+V  
Sbjct  47    SSSPSQSGSSNYRRNTHIRKAKT----LDLGRLTGGEALSRATSASLGLSFSFTGFAVPH  102

Query  2527  DES--ADSKPFSDDENPEDLEAGTKKKRSIPAEPTFPIYLKFTEVSYKIVIKGVTFSEEK  2354
             +E      +  S+++N ED+EA T     +  EPTFPIYLKF +++YK+  K +T S EK
Sbjct  103   EEEIIPSEQSCSNEDNLEDIEAATSNVVKLQEEPTFPIYLKFIDITYKVTCKAMTSSSEK  162

Query  2353  DILNGISGAVDPGEVLALMGPSGCGKTTLLSLLGGRIRDPS-AGSITYNQHPYSKLLKSR  2177
              ILNGISG+  PGE+LALMGPSG GKTTLL++LGGRI   +  GS++YN  PYSK LK+R
Sbjct  163   SILNGISGSAYPGEILALMGPSGSGKTTLLNVLGGRINHQNMGGSVSYNDKPYSKHLKTR  222

Query  2176  IGFVTQDDILFPHLTVKETLIYAARLRLPRTLTKEEKDKRAMDVIYELGLDRCQDTMIGG  1997
             IGFVTQDD+LFPHLTVKETL Y A LRLP+TLTK++K++RA+++I EL L+RCQDTMIGG
Sbjct  223   IGFVTQDDVLFPHLTVKETLTYTALLRLPKTLTKQQKEQRAINIIQELSLERCQDTMIGG  282

Query  1996  SFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILHEIAKAGKTVIT  1817
             SFVRGVSGGERKRVCIGNEI+ NPSLLFLDEPTS LDSTTAL+IV +L  IAKAGKT++T
Sbjct  283   SFVRGVSGGERKRVCIGNEIMTNPSLLFLDEPTSSLDSTTALKIVQMLQSIAKAGKTIVT  342

Query  1816  TIHQPSSRLFHkfdklilleflldL--------------------------------ANG  1733
             TIHQPSSRLFH+FDKL++L     L                                ANG
Sbjct  343   TIHQPSSRLFHRFDKLVVLSRGSLLYFGKASEAMSYFSSIGCSPLLSMNPAEFLLDLANG  402

Query  1732  NINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYETRVAETEKKKLMAPL  1553
             N+ND+SIPS L ++ +    + +    N         +YL   Y+T++   EKKKLM P+
Sbjct  403   NMNDISIPSALKEETKMEKQRYKLYHINCDVDAET--QYLEEAYKTQIEVKEKKKLMEPV  460

Query  1552  PVEEELKSKVRYLKREWGASWSEQYVLLFHRGIRERWHDYFSWLRITQVIATALILGMLW  1373
             P++EE+K  +   KREWG SW +QY +L  RG +ER HDYFSWLR+TQV++TA+ILG+LW
Sbjct  461   PLDEEVKLMITCPKREWGLSWWDQYCILSLRGFKERKHDYFSWLRVTQVLSTAIILGLLW  520

Query  1372  WQSGGDTPSQMQDQAGLLFFIAVFWGFFPVFTAIFTFPQEKAMLSKERAADMYRLSAYFA  1193
             WQS    P  +QDQ GLLFFIAVFWGFFPVFTAIFTFPQE+AMLSKER ++MYRLSAYF 
Sbjct  521   WQSDIQHPKGLQDQVGLLFFIAVFWGFFPVFTAIFTFPQERAMLSKERESNMYRLSAYFV  580

Query  1192  ARTTSdlpldlllpliflLVVYFMAGLKQDASSFLLTAVTVFLCIVVAQGLGLAIGATLM  1013
             ARTTSDLPLDL+LP++FL+VVYFMAGL+  A SF L+ +TVFLCIV AQGLGLAIGA+LM
Sbjct  581   ARTTSDLPLDLILPVLFLVVVYFMAGLRLRAESFFLSVLTVFLCIVAAQGLGLAIGASLM  640

Query  1012  DLKKATTLASVTVMTFMLAGGYFIKKVPGFIVWLRDLSFNYHTFKLLLKVQYEHKTNSVN  833
             DLKKATTLASVTVMTFMLAGGYF+KKVP FI W+R +SFNYHT+KLL+KVQYE     VN
Sbjct  641   DLKKATTLASVTVMTFMLAGGYFVKKVPMFIAWIRYMSFNYHTYKLLVKVQYEQIMQDVN  700

Query  832   GVQIDSGIKEVGALAAMAVSYRLLAYISLRRMKLQ  728
             G +I +G+KEV AL AM + YRLLAY+SLRRMKL 
Sbjct  701   GEEIVNGLKEVSALVAMIIGYRLLAYLSLRRMKLH  735



>ref|XP_006373817.1| hypothetical protein POPTR_0016s06620g [Populus trichocarpa]
 gb|ERP51614.1| hypothetical protein POPTR_0016s06620g [Populus trichocarpa]
Length=720

 Score =   783 bits (2022),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 450/647 (70%), Positives = 514/647 (79%), Gaps = 46/647 (7%)
 Frame = -2

Query  2878  MEQTNSTSLLRTKSDQLVEaiaaakgsarARLPRLSAEFAGSGVPESVRMLSRKPSRRLM  2699
             ME+ N TSL RT+S+QLVE +AAA  S        + E  G     S   LSRK S+RLM
Sbjct  1     MEKEN-TSLARTRSEQLVETVAAAFKSPS------NNEAIGVSDGSSGGTLSRKSSKRLM  53

Query  2698  ppspggggsgGTN-STHIRKSRSAQMKLDLDElssgsvlsrassasl--GFSFTGFSVRP  2528
               +  G  + G N +THIRKSRSAQMK DLD++SSG+ LSRASSASL   FSFTGF++ P
Sbjct  54    MAASPGRSTSGGNKNTHIRKSRSAQMKFDLDDVSSGAALSRASSASLGFSFSFTGFNMPP  113

Query  2527  DESADSKPFSDDENPEDLEAGTKKKRSIPAEPTFPIYLKFTEVSYKIVIKGVTFSEEKDI  2348
             DE ADSKPFSDD+ PEDLEAGT+K +    EPT PIYLKFT+V+YK++IKG+T +EEKDI
Sbjct  114   DEIADSKPFSDDDIPEDLEAGTRKPK-FQTEPTLPIYLKFTDVTYKVIIKGMTSTEEKDI  172

Query  2347  LNGISGAVDPGEVLALMGPSGCGKTTLLSLLGGRIRDPS-AGSITYNQHPYSKLLKSRIG  2171
             L GISG+VDPGEVLALMGPSG GKTTLL+L+GGR+   +  GS+TYN  PYSK LKSRIG
Sbjct  173   LYGISGSVDPGEVLALMGPSGSGKTTLLNLIGGRLNQTTVGGSLTYNDQPYSKFLKSRIG  232

Query  2170  FVTQDDILFPHLTVKETLIYAARLRLPRTLTKEEKDKRAMDVIYELGLDRCQDTMIGGSF  1991
             FVTQDD+LFPHLTVKETL YAA LRLP+TLTKE+K KRA+DVIYELGL+RCQDTMIGGSF
Sbjct  233   FVTQDDVLFPHLTVKETLTYAALLRLPKTLTKEQKQKRAIDVIYELGLERCQDTMIGGSF  292

Query  1990  VRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILHEIAKAGKTVITTI  1811
             VRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIV +L +IA+ GKTV+TTI
Sbjct  293   VRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVQLLQDIAEGGKTVVTTI  352

Query  1810  HQPSSRLFHk--------------------------------fdklilleflldLANGNI  1727
             HQPSSRLFHK                                   +   EFLLDLANGNI
Sbjct  353   HQPSSRLFHKFDKLILLGKGSLLYFGKASEAMLYFSSIGCNPLIAMNPAEFLLDLANGNI  412

Query  1726  NDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYETRVAETEKKKLMAPLPV  1547
             NDVS+PSEL DKVQ  NS+ E TR NGKPSPA+VHEYLV  YETRVA+ EKKKLM P+P+
Sbjct  413   NDVSVPSELEDKVQIGNSEAE-TR-NGKPSPAVVHEYLVEAYETRVADKEKKKLMVPIPL  470

Query  1546  EEELKSKVRYLKREWGASWSEQYVLLFHRGIRERWHDYFSWLRITQVIATALILGMLWWQ  1367
             +EE+KSKV   KR+WGASW EQY +LF RGI+ER HDYFSWLRITQV++TA+ILG+LWW+
Sbjct  471   DEEVKSKVSSRKRQWGASWWEQYTILFCRGIKERRHDYFSWLRITQVLSTAIILGLLWWK  530

Query  1366  SGGDTPSQMQDQAGLLFFIAVFWGFFPVFTAIFTFPQEKAMLSKERAADMYRLSAYFAAR  1187
             S   +P  +QDQAGLLFFIAVFWGFFPVFTAIFTFPQE+AMLSKERAADMYRLSAYF AR
Sbjct  531   SDSSSPKGLQDQAGLLFFIAVFWGFFPVFTAIFTFPQERAMLSKERAADMYRLSAYFLAR  590

Query  1186  TTSdlpldlllpliflLVVYFMAGLKQDASSFLLTAVTVFLCIVVAQ  1046
             TTSDLPLDL+LP++FLLVVYFMAGL+  A+ F LT +TVFLCIV AQ
Sbjct  591   TTSDLPLDLILPVLFLLVVYFMAGLRLSAAPFFLTMLTVFLCIVAAQ  637


 Score = 56.2 bits (134),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 34/53 (64%), Gaps = 0/53 (0%)
 Frame = -1

Query  1040  RISYWGHTNGFEEGNNSGLCYCHDLYVGWRILYKESTRVHSMASGSFLQLSHI  882
             R SYWG+ +G +EG+NSG  YC DL+ GWR+  +ES+ +  +      QL H+
Sbjct  668   RTSYWGYPDGLKEGHNSGFSYCDDLHAGWRVFCEESSSICILDPLYVFQLPHL  720



>ref|XP_004985645.1| PREDICTED: ABC transporter G family member 22-like isoform X2 
[Setaria italica]
Length=733

 Score =   782 bits (2019),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 422/682 (62%), Positives = 506/682 (74%), Gaps = 67/682 (10%)
 Frame = -2

Query  2662  NSTHIRKSRSAQMKLDLDElssgsvlsrassasl---GFSFTGFSVRPD--ESADSKPFS  2498
              ++HIRKSRSAQ+KLD+++L S S     +S++     F+FTGF+  P    SAD   FS
Sbjct  76    GNSHIRKSRSAQLKLDVEDLVSNSAALSRASSASLGFSFTFTGFTPPPQYMHSADPATFS  135

Query  2497  DDENPEDLEAGTKKKRSIPAEPTFPIYLKFTEVSYKIVIKGVTFSEEKDILNGISGAVDP  2318
             DD+ P D+EAGT++++ +  EPT PIYLKFTEV Y++  KG      ++IL GISG+  P
Sbjct  136   DDDTPMDIEAGTRRRKKLMTEPTMPIYLKFTEVKYRVAAKG----SPREILGGISGSASP  191

Query  2317  GEVLALMGPSGCGKTTLLSLLGGRIRDPSA-GSITYNQHPYSKLLKSRIGFVTQDDILFP  2141
             GEVLALMGPSG GKTTLLS+LGGR    +  G I+YN  PY K LK RIGFVTQDD+LF 
Sbjct  192   GEVLALMGPSGSGKTTLLSILGGRAGGGAVEGCISYNDEPYCKSLKRRIGFVTQDDVLFT  251

Query  2140  HLTVKETLIYAARLRLPRTLTKEEKDKRAMDVIYELGLDRCQDTMIGGSFVRGVSGGERK  1961
             HLTVKETL YAA LRLPRT+T+++K +RAMD+IYELGL+RCQDTMIGGSFVRGVSGGERK
Sbjct  252   HLTVKETLTYAALLRLPRTMTRQQKKERAMDIIYELGLERCQDTMIGGSFVRGVSGGERK  311

Query  1960  RVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILHEIAKAGKTVITTIHQPSSRLFHk  1781
             RVCIGNEI+INPSLLFLDEPTSGLDSTTALRIV +LH+IA+ GKTVITTIHQPSSRLFH 
Sbjct  312   RVCIGNEILINPSLLFLDEPTSGLDSTTALRIVQLLHDIAEDGKTVITTIHQPSSRLFHN  371

Query  1780  --------------------------------fdklilleflldLANGNINDVSIPSELA  1697
                                                +   EFLLDLANGN NDVS+PSEL 
Sbjct  372   FDKLILLGKGSLLYFGKASEAMPYFQSIGCTPLFAMNPAEFLLDLANGNTNDVSVPSELD  431

Query  1696  DKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYETRVAETEKKKLMAPLPVEEELKSKVRY  1517
             DK                        YLV  YETRVA  EKKKL+APLP+ ++LK+ +  
Sbjct  432   DK------------------------YLVDAYETRVAFKEKKKLLAPLPISDDLKATITS  467

Query  1516  LKREWGASWSEQYVLLFHRGIRERWHDYFSWLRITQVIATALILGMLWWQSGGDTPSQMQ  1337
              KREWG SW +QY +LF RGI+ER HDY SW+RITQVIAT++ILG+LWW+S   T   ++
Sbjct  468   SKREWGTSWWQQYSILFCRGIKERRHDYLSWMRITQVIATSVILGLLWWRSDPRTLKGLE  527

Query  1336  DQAGLLFFIAVFWGFFPVFTAIFTFPQEKAMLSKERAADMYRLSAYFAARTTSdlpldll  1157
             DQAGLLFFIAVFWGFFPVFTAIFTFPQE+AML+KERA DMY+LSAYF ARTTSDLPLDL 
Sbjct  528   DQAGLLFFIAVFWGFFPVFTAIFTFPQERAMLNKERAVDMYKLSAYFLARTTSDLPLDLF  587

Query  1156  lpliflLVVYFMAGLKQDASSFLLTAVTVFLCIVVAQGLGLAIGATLMDLKKATTLASVT  977
             LP++F+++VYFMAGLK  A+ F L+ +TVFL I+ AQGLGL IGA+L+D+KKATTLASVT
Sbjct  588   LPVVFMVIVYFMAGLKATATHFFLSMLTVFLSIIAAQGLGLVIGASLLDIKKATTLASVT  647

Query  976   VMTFMLAGGYFIKKVPGFIVWLRDLSFNYHTFKLLLKVQYEHKTNSVNGVQ-IDSGIKEV  800
             VMTFMLAGG+F+K VP FI WLR LSFNYHT++LLLKVQY+     +   + +D+G  EV
Sbjct  648   VMTFMLAGGFFVKTVPPFISWLRYLSFNYHTYRLLLKVQYDPVPEILTTTKHMDNGATEV  707

Query  799   GALAAMAVSYRLLAYISLRRMK  734
              AL AM + YR+LAY+SLRR+ 
Sbjct  708   AALVAMIIGYRVLAYLSLRRVN  729



>gb|KDO70707.1| hypothetical protein CISIN_1g0045372mg, partial [Citrus sinensis]
Length=567

 Score =   764 bits (1972),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/548 (71%), Positives = 455/548 (83%), Gaps = 35/548 (6%)
 Frame = -2

Query  2482  EDLEAGTKKKRSIPAEPTFPIYLKFTEVSYKIVIKGVTFSEEKDILNGISGAVDPGEVLA  2303
             ED+EAGT+++     EPT PIYLKFT+V+YK+++KG+T SEEKDILNGI+G+V+PGEVLA
Sbjct  1     EDIEAGTRERPKFQTEPTLPIYLKFTDVTYKVILKGMTSSEEKDILNGITGSVNPGEVLA  60

Query  2302  LMGPSGCGKTTLLSLLGGRIRDPS-AGSITYNQHPYSKLLKSRIGFVTQDDILFPHLTVK  2126
             LMGPSG GKTTLL+LL GR+ +P+  GSITYN HPYSK LKS+IGFVTQDD+LFPHLTVK
Sbjct  61    LMGPSGSGKTTLLNLLSGRLMEPTVGGSITYNDHPYSKSLKSKIGFVTQDDVLFPHLTVK  120

Query  2125  ETLIYAARLRLPRTLTKEEKDKRAMDVIYELGLDRCQDTMIGGSFVRGVSGGERKRVCIG  1946
             ETL YAA LRLP TLTK++K+KRA+DVI ELGL+RCQDTMIGGSFVRGVSGGERKRVCIG
Sbjct  121   ETLTYAALLRLPNTLTKQQKEKRAIDVINELGLERCQDTMIGGSFVRGVSGGERKRVCIG  180

Query  1945  NEIIINPSLLFLDEPTSGLDSTTALRIVDILHEIAKAGKTVITTIHQPSSRLFHk-----  1781
             NEIIINPSLLFLDEPTSGLDSTTALRIV +L +IA+AGKTV+TTIHQPSSRLFHK     
Sbjct  181   NEIIINPSLLFLDEPTSGLDSTTALRIVQMLQDIAEAGKTVVTTIHQPSSRLFHKFDKLI  240

Query  1780  ---------------------------fdklilleflldLANGNINDVSIPSELADKVQT  1682
                                           +   EFLLDLANGN++DVS+PSEL D+VQT
Sbjct  241   LLGKGSLLYFGKASEAMAYFSSIGCSPQIAMNPAEFLLDLANGNLHDVSVPSELQDRVQT  300

Query  1681  WNSKEEPTRNNGKPSPAIVHEYLVGCYETRVAETEKKKLMAPLPVEEELKSKVRYLKREW  1502
              NS+ +    NGKP+PAIVHEYLV  YETRVAE EKKKLMAP+P++EE+K+KV   KR W
Sbjct  301   ENSENDTA--NGKPTPAIVHEYLVEAYETRVAENEKKKLMAPIPLDEEIKAKVSSPKRNW  358

Query  1501  GASWSEQYVLLFHRGIRERWHDYFSWLRITQVIATALILGMLWWQSGGDTPSQMQDQAGL  1322
             GASW +QY +LF RGI+E  HDYFSWLRITQV+ATA+ILG+LWWQS   +P  ++DQAGL
Sbjct  359   GASWIQQYTILFRRGIKEHRHDYFSWLRITQVLATAVILGLLWWQSDSKSPKGLEDQAGL  418

Query  1321  LFFIAVFWGFFPVFTAIFTFPQEKAMLSKERAADMYRLSAYFAARTTSdlpldlllplif  1142
             LFFIAVFW FFP+FTAIFTFPQE+AMLSKERAADMYRLSAYF ARTTSDLPL+L+LP++F
Sbjct  419   LFFIAVFWSFFPIFTAIFTFPQERAMLSKERAADMYRLSAYFLARTTSDLPLNLVLPVLF  478

Query  1141  lLVVYFMAGLKQDASSFLLTAVTVFLCIVVAQGLGLAIGATLMDLKKATTLASVTVMTFM  962
             L++VYFMAGL+  A  F L+ +TVFL IV AQGLGLAIGA LMDLKKATTLASVT+MTFM
Sbjct  479   LVIVYFMAGLRMGAGPFFLSMLTVFLSIVAAQGLGLAIGAILMDLKKATTLASVTIMTFM  538

Query  961   LAGGYFIK  938
             LAGGYF++
Sbjct  539   LAGGYFVQ  546



>ref|XP_007163008.1| hypothetical protein PHAVU_001G198400g [Phaseolus vulgaris]
 gb|ESW35002.1| hypothetical protein PHAVU_001G198400g [Phaseolus vulgaris]
Length=558

 Score =   758 bits (1958),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/557 (70%), Positives = 447/557 (80%), Gaps = 35/557 (6%)
 Frame = -2

Query  2299  MGPSGCGKTTLLSLLGGR-IRDPSAGSITYNQHPYSKLLKSRIGFVTQDDILFPHLTVKE  2123
             MGPSG GKT+LL+LLGGR I+    GSITYN  PYSK LKSRIGFVTQDD+LFPHLTVKE
Sbjct  1     MGPSGSGKTSLLNLLGGRLIQSTIGGSITYNDQPYSKFLKSRIGFVTQDDVLFPHLTVKE  60

Query  2122  TLIYAARLRLPRTLTKEEKDKRAMDVIYELGLDRCQDTMIGGSFVRGVSGGERKRVCIGN  1943
             TL YAARLRLP  LTKE+K+KRA+DVI ELGL+RCQDTMIGGS+VRGVSGGERKRVCIG+
Sbjct  61    TLTYAARLRLPNMLTKEQKEKRALDVIEELGLERCQDTMIGGSYVRGVSGGERKRVCIGS  120

Query  1942  EIIINPSLLFLDEPTSGLDSTTALRIVDILHEIAKAGKTVITTIHQPSSRLFHk------  1781
             EIIINPSLLFLDEPTSGLDSTTALRIV +L +IA+AGKTV+ TIHQPSSRLFHK      
Sbjct  121   EIIINPSLLFLDEPTSGLDSTTALRIVQVLQDIAEAGKTVVITIHQPSSRLFHKFDKLIL  180

Query  1780  --------------------------fdklilleflldLANGNINDVSIPSELADKVQTW  1679
                                          +   EFLLDLANGN+ND+S+PSEL D+VQ  
Sbjct  181   LGKGSLLYFGKASEAMDYFQFIGCAPLITMNPAEFLLDLANGNVNDISVPSELKDRVQMG  240

Query  1678  NSKEEPTRNNGKPSPAIVHEYLVGCYETRVAETEKKKLMAPLPVEEELKSKVRYLKREWG  1499
             N++ E    NGKPS ++V EYL   Y++RVAE EK KLM P+P++EELKSK+   KR+WG
Sbjct  241   NAEVETC--NGKPSASVVQEYLEEAYDSRVAEIEKTKLMVPVPLDEELKSKIYSCKRQWG  298

Query  1498  ASWSEQYVLLFHRGIRERWHDYFSWLRITQVIATALILGMLWWQSGGDTPSQMQDQAGLL  1319
              SW EQ+ +LF RG +ER HDYFSWLRITQV++TA+ILG+LWWQS  + P  +QDQAGLL
Sbjct  299   TSWVEQFSILFSRGFKERKHDYFSWLRITQVLSTAVILGLLWWQSDANNPKGLQDQAGLL  358

Query  1318  FFIAVFWGFFPVFTAIFTFPQEKAMLSKERAADMYRLSAYFAARTTSdlpldlllplifl  1139
             FFIAVFWGFFPVFTAIFTFPQE+AML+KER  DMYRLSAYF ARTTSDL LDL+LP+ FL
Sbjct  359   FFIAVFWGFFPVFTAIFTFPQERAMLTKERTTDMYRLSAYFVARTTSDLLLDLVLPIFFL  418

Query  1138  LVVYFMAGLKQDASSFLLTAVTVFLCIVVAQGLGLAIGATLMDLKKATTLASVTVMTFML  959
             LVVYFMA L+  A  F L+ +TVFLCI+ AQGLGLAIGATLMDLK+ATTLASVTVMTFML
Sbjct  419   LVVYFMASLRLSAGRFFLSILTVFLCIIAAQGLGLAIGATLMDLKRATTLASVTVMTFML  478

Query  958   AGGYFIKKVPGFIVWLRDLSFNYHTFKLLLKVQYEHKTNSVNGVQIDSGIKEVGALAAMA  779
             AGG+F++KVP FI W+R LSFNYHT+KLLLKVQYEH T ++NG+ +DSG  EV AL AM 
Sbjct  479   AGGFFVQKVPIFISWIRYLSFNYHTYKLLLKVQYEHVTRTINGITLDSGFTEVAALLAMV  538

Query  778   VSYRLLAYISLRRMKLQ  728
               YRLLAYISLRRMKLQ
Sbjct  539   FGYRLLAYISLRRMKLQ  555



>gb|EPS59306.1| hypothetical protein M569_15501, partial [Genlisea aurea]
Length=582

 Score =   755 bits (1950),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/597 (68%), Positives = 473/597 (79%), Gaps = 52/597 (9%)
 Frame = -2

Query  2413  KFTEVSYKIVIKGVTFSEEKDILNGISGAVDPGEVLALMGPSGCGKTTLLSLLGGRIRDP  2234
             +FT+VSYK+V++    +EEK+ILNGI+G+VDPGE+LALMGPSGCGKTTLLSLLGGRI   
Sbjct  1     QFTDVSYKVVVR----TEEKEILNGITGSVDPGEILALMGPSGCGKTTLLSLLGGRISSS  56

Query  2233  SAGS----ITYNQHPYSKLLKSRIGFVTQDDILFPHLTVKETLIYAARLRLPRTLTKEEK  2066
               G     ITYN+ PYSK L SRIGFV+QDD+LFPHLTVKETLIYAARLRLP +LT EEK
Sbjct  57    EGGGGGGSITYNRRPYSKSLNSRIGFVSQDDVLFPHLTVKETLIYAARLRLPPSLTYEEK  116

Query  2065  DKRAMDVIYELGLDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLD  1886
              +RA+D+I++L L+RCQDTMIGGSFVRGVSGGERKRVCIGNEI+INPSLL LDEPTSGLD
Sbjct  117   VRRAVDIIHQLRLERCQDTMIGGSFVRGVSGGERKRVCIGNEILINPSLLLLDEPTSGLD  176

Query  1885  STTALRIVDILHEIAKAGKTVITTIHQPSSRL----------------FHkfdklil---  1763
             ST ALR+V+ L ++A+AGKTVITTIHQPSSRL                +H      +   
Sbjct  177   STMALRLVETLQDMAEAGKTVITTIHQPSSRLLLKFDKLILLGKGCLLYHGKTSEAMPYF  236

Query  1762  -------------leflldLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVH  1622
                           EF+LDLANGN+ D+S+PSEL D+VQT NS+ E         P++VH
Sbjct  237   SSIGCSPLIPMNPAEFMLDLANGNVTDISVPSELEDRVQTGNSEVETI-------PSLVH  289

Query  1621  EYLVGCYETRVAETEKKKLMAPLPVEEELKSKVRYLKREWGASWSEQYVLLFHRGIRERW  1442
             EYLV  YET  A+ E  KL  P     E +SK    +REWGA+W EQ  +LF RG++ER 
Sbjct  290   EYLVEAYETSAAKNESTKLETPSDERIESRSK----RREWGATWWEQCSILFCRGLKERR  345

Query  1441  HDYFSWLRITQVIATALILGMLWWQSGGDTPSQMQDQAGLLFFIAVFWGFFPVFTAIFTF  1262
             HDYFSWLRITQV+ATA ILG+LWWQSGGD P ++QDQAGLLFFIAVFWGFFPVFTAIFTF
Sbjct  346   HDYFSWLRITQVLATAAILGLLWWQSGGDKPERIQDQAGLLFFIAVFWGFFPVFTAIFTF  405

Query  1261  PQEKAMLSKERAADMYRLSAYFAARTTSdlpldlllpliflLVVYFMAGLKQDASSFLLT  1082
             PQE+AML+KERAADMYRLSAYFAARTT+DLPLDL LPL+FLLVVYFMAGL+ DA+SF  T
Sbjct  406   PQERAMLNKERAADMYRLSAYFAARTTTDLPLDLFLPLLFLLVVYFMAGLRLDAASFFFT  465

Query  1081  AVTVFLCIVVAQGLGLAIGATLMDLKKATTLASVTVMTFMLAGGYFIKKVPGFIVWLRDL  902
              + VFLCI+ AQGLGLAIGATLM+LKKATTLASVTVMTFMLAGG+F+ KVP FI WLR L
Sbjct  466   VLIVFLCIIAAQGLGLAIGATLMELKKATTLASVTVMTFMLAGGFFVTKVPNFISWLRYL  525

Query  901   SFNYHTFKLLLKVQYEHKTNSVNGVQIDSG-IKEVGALAAMAVSYRLLAYISLRRMK  734
             SFNYHT+KLLLKVQY H T S+NG+ I++G  KEVGAL +M V YRLLAY+SLRRMK
Sbjct  526   SFNYHTYKLLLKVQYGHVTRSINGITIENGWYKEVGALVSMVVGYRLLAYLSLRRMK  582



>ref|XP_010426847.1| PREDICTED: ABC transporter G family member 27-like isoform X1 
[Camelina sativa]
Length=597

 Score =   753 bits (1945),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/596 (66%), Positives = 467/596 (78%), Gaps = 35/596 (6%)
 Frame = -2

Query  2416  LKFTEVSYKIVIKGVTFSEEKDILNGISGAVDPGEVLALMGPSGCGKTTLLSLLGGRIRD  2237
             ++F +++YK+  KG+T S EK ILNGISG+  PGE+LALMGPSG GKTTLL++LGGR   
Sbjct  1     MQFIDITYKVTTKGMTSSSEKSILNGISGSAYPGELLALMGPSGSGKTTLLNVLGGRFDQ  60

Query  2236  PSAGS-ITYNQHPYSKLLKSRIGFVTQDDILFPHLTVKETLIYAARLRLPRTLTKEEKDK  2060
              + G  ++YN  PYSK LK+RIGFVTQ+D+LFPHLTV ETL Y ARLRLP+TLTK+EK++
Sbjct  61    QNIGGLVSYNDKPYSKHLKTRIGFVTQEDVLFPHLTVIETLTYTARLRLPKTLTKQEKEQ  120

Query  2059  RAMDVIYELGLDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDST  1880
             RA+ +I ELGL+RCQ TMIGGSFVRGVSGGERKRV IG EI+ NPSLL LDEPTS LDST
Sbjct  121   RAVSMIQELGLERCQGTMIGGSFVRGVSGGERKRVSIGIEIMTNPSLLLLDEPTSSLDST  180

Query  1879  TALRIVDILHEIAKAGKTVITTIHQPSSRLFHk---------------------------  1781
             TAL+IV +L  IAKAGKTV+TTIHQPSSRLFH+                           
Sbjct  181   TALKIVQMLQSIAKAGKTVVTTIHQPSSRLFHRFDKLVVLSRGSLLYFGKASEAMSYFSS  240

Query  1780  -----fdklilleflldLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEY  1616
                     +   EFLLDLANGN+ND+SIPS L +K++  NS  E    + KP+P IV+EY
Sbjct  241   IGCSPLLAMNPAEFLLDLANGNMNDISIPSALKEKMKMENSCSEI--RSSKPTPTIVYEY  298

Query  1615  LVGCYETRVAETEKKKLMAPLPVEEELKSKVRYLKREWGASWSEQYVLLFHRGIRERWHD  1436
             L   Y+T+++  EKKKLMAP+P++EE+K  +   KREWG SW EQY LL  RGI+ER HD
Sbjct  299   LEEAYKTQISVVEKKKLMAPVPLDEEVKLMITCPKREWGLSWWEQYCLLSLRGIKERRHD  358

Query  1435  YFSWLRITQVIATALILGMLWWQSGGDTPSQMQDQAGLLFFIAVFWGFFPVFTAIFTFPQ  1256
             YFSWLR+TQV++TA+ILG+LWWQS    P  +QDQ GLLFFIAVFWGFFPVFTAIFTFPQ
Sbjct  359   YFSWLRVTQVLSTAIILGLLWWQSDIHHPKGLQDQVGLLFFIAVFWGFFPVFTAIFTFPQ  418

Query  1255  EKAMLSKERAADMYRLSAYFAARTTSdlpldlllpliflLVVYFMAGLKQDASSFLLTAV  1076
             E AMLSKER ++MYRLSAYF ARTTSDLPLDL+LP++FL+VVYFMAGL+  A SF L+ +
Sbjct  419   EIAMLSKERESNMYRLSAYFVARTTSDLPLDLILPVLFLVVVYFMAGLRLSAESFFLSVL  478

Query  1075  TVFLCIVVAQGLGLAIGATLMDLKKATTLASVTVMTFMLAGGYFIKKVPGFIVWLRDLSF  896
             TVFLCIV AQGLGLAIGA+LMDLKKATTLASVTVMTFMLAGGYF+KKVP FI W+R +SF
Sbjct  479   TVFLCIVAAQGLGLAIGASLMDLKKATTLASVTVMTFMLAGGYFVKKVPNFIAWIRFMSF  538

Query  895   NYHTFKLLLKVQYEHKTNSVNGVQIDSGIKEVGALAAMAVSYRLLAYISLRRMKLQ  728
             NYHT+KLL+KVQY+    +VNG +I SGIKEV AL AM + YRLLAY+SLRRMKL 
Sbjct  539   NYHTYKLLVKVQYQEIMENVNGEEIGSGIKEVSALVAMIIGYRLLAYLSLRRMKLH  594



>ref|XP_010917904.1| PREDICTED: ABC transporter G family member 22 isoform X2 [Elaeis 
guineensis]
Length=692

 Score =   751 bits (1938),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 415/602 (69%), Positives = 479/602 (80%), Gaps = 39/602 (6%)
 Frame = -2

Query  2653  HIRKSRSAQMKLDLDElssgsvlsrassasl--GFSFTGFSVRPDE-SADSKPFSDDENP  2483
             HIRKSRSAQ+KLDL+++SSG+ LSRASSASL   FSFTGF+  P++  AD +PFSDD+N 
Sbjct  67    HIRKSRSAQLKLDLEDVSSGAALSRASSASLGFSFSFTGFTAPPEDIVADLRPFSDDDNA  126

Query  2482  EDLEAGTKKKRSIPAEPTFPIYLKFTEVSYKIVIKGVTFSEEKDILNGISGAVDPGEVLA  2303
              D EAG  +KR I +EPT PIYLKFTEV YK+++KGVT S EKDIL+GI+G+  PGEVLA
Sbjct  127   IDPEAGGTQKRLI-SEPTLPIYLKFTEVRYKVILKGVTTSTEKDILHGITGSASPGEVLA  185

Query  2302  LMGPSGCGKTTLLSLLGGRIR-DPSAGSITYNQHPYSKLLKSRIGFVTQDDILFPHLTVK  2126
             LMGPSG GKTTLLSLLGGRI  +   GSITYN   Y+K LK RIGFVTQDD+LF HLTV+
Sbjct  186   LMGPSGSGKTTLLSLLGGRISGNILEGSITYNDEQYNKSLKRRIGFVTQDDVLFAHLTVR  245

Query  2125  ETLIYAARLRLPRTLTKEEKDKRAMDVIYELGLDRCQDTMIGGSFVRGVSGGERKRVCIG  1946
             ETL Y A LRLP+T+T+++K++RAMDVIYELGL+RCQDTMIGGSFVRGVSGGERKRVCIG
Sbjct  246   ETLTYTALLRLPKTMTRQQKEERAMDVIYELGLERCQDTMIGGSFVRGVSGGERKRVCIG  305

Query  1945  NEIIINPSLLFLDEPTSGLDSTTALRIVDILHEIAKAGKTVITTIHQPSSRLFHk-----  1781
             NEIIINPSLLFLDEPTSGLDSTTALR + +LH+IA+AGKTV+TTIHQPSSRLFHK     
Sbjct  306   NEIIINPSLLFLDEPTSGLDSTTALRTIQMLHDIAEAGKTVVTTIHQPSSRLFHKFDKLI  365

Query  1780  ---------------------------fdklilleflldLANGNINDVSIPSELADKVQT  1682
                                           +   EFLLDLANGNI+DVS+PSEL D+VQ 
Sbjct  366   LLGRGSLLYFGKASEALVYFSSVGCSPLIAMNPAEFLLDLANGNISDVSVPSELDDRVQM  425

Query  1681  WNSKEEPTRNNGKPSPAIVHEYLVGCYETRVAETEKKKLMAPLPVEEELKSKVRYLKREW  1502
              N    P   N KPSP  VHEYLV  YETRVA+ EKKKL+ PLP+ E+LK+ +   KR+W
Sbjct  426   ENLGSHP--RNDKPSPKDVHEYLVEAYETRVADKEKKKLLQPLPISEDLKATIASPKRDW  483

Query  1501  GASWSEQYVLLFHRGIRERWHDYFSWLRITQVIATALILGMLWWQSGGDTPSQMQDQAGL  1322
             GASW +Q+ +LF RG++ER HDY SW+RITQVIATA+ILG+LWW S G T    QDQAGL
Sbjct  484   GASWWQQFSILFWRGLKERRHDYLSWMRITQVIATAIILGLLWWHSDGTTSKGQQDQAGL  543

Query  1321  LFFIAVFWGFFPVFTAIFTFPQEKAMLSKERAADMYRLSAYFAARTTSdlpldlllplif  1142
             LFFIAVFWGFFPVFTAIFTFPQE+AML+KERA DMYRLSAYF ARTTSDLPLDL LP+IF
Sbjct  544   LFFIAVFWGFFPVFTAIFTFPQERAMLNKERAVDMYRLSAYFMARTTSDLPLDLFLPIIF  603

Query  1141  lLVVYFMAGLKQDASSFLLTAVTVFLCIVVAQGLGLAIGATLMDLKKATTLASVTVMTFM  962
             L++VYFMAGL+Q    F L+ + VFL I+ AQGLGLAIGATLMD+KKATTLASVTVMTFM
Sbjct  604   LIIVYFMAGLRQSIEPFFLSMLIVFLSIIAAQGLGLAIGATLMDIKKATTLASVTVMTFM  663

Query  961   LA  956
             LA
Sbjct  664   LA  665



>ref|XP_010503974.1| PREDICTED: ABC transporter G family member 27-like isoform X3 
[Camelina sativa]
Length=583

 Score =   745 bits (1923),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/582 (67%), Positives = 457/582 (79%), Gaps = 35/582 (6%)
 Frame = -2

Query  2374  VTFSEEKDILNGISGAVDPGEVLALMGPSGCGKTTLLSLLGGRIRDPS-AGSITYNQHPY  2198
             +T S EK ILNGISG+  PGE+LALMGPSG GKTTLL+  GGR    + +G ++YN  PY
Sbjct  1     MTSSSEKSILNGISGSAYPGELLALMGPSGSGKTTLLNFFGGRFNQQNVSGLVSYNDKPY  60

Query  2197  SKLLKSRIGFVTQDDILFPHLTVKETLIYAARLRLPRTLTKEEKDKRAMDVIYELGLDRC  2018
             SK LK+RIGFVTQ+D+LFPHLTV ETL Y ARLRLP+TLTK+EK++RA+ VI ELGL+RC
Sbjct  61    SKHLKTRIGFVTQEDVLFPHLTVIETLTYTARLRLPKTLTKQEKEQRAVSVIQELGLERC  120

Query  2017  QDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILHEIAK  1838
             Q TMIGGSFVRGVSGGERKRV IGNEI+ NPSLL LDEPTS LDSTTAL+IV +L  IAK
Sbjct  121   QGTMIGGSFVRGVSGGERKRVSIGNEIMTNPSLLLLDEPTSSLDSTTALKIVQMLQSIAK  180

Query  1837  AGKTVITTIHQPSSRLFHk--------------------------------fdklillef  1754
             AGKTV+TTIHQPSSRLFH+                                   +   EF
Sbjct  181   AGKTVVTTIHQPSSRLFHRFDKLVVLSRGSLLYFGKASDAMSYFSSIGCSPLLAMNPAEF  240

Query  1753  lldLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYETRVAETEK  1574
             LLDLANGN+ND+SIPS L  K++  NS  E    + KP+P IV+EYL   Y+T+++  EK
Sbjct  241   LLDLANGNMNDISIPSALKKKMKMENSCSEI--RSSKPTPTIVYEYLEEAYKTQISVVEK  298

Query  1573  KKLMAPLPVEEELKSKVRYLKREWGASWSEQYVLLFHRGIRERWHDYFSWLRITQVIATA  1394
             KKLMAP+P+EEE+K  +   KREWG SW EQY LL  RGI+ER HDYFSWLR+TQV++TA
Sbjct  299   KKLMAPVPLEEEVKLMITCPKREWGLSWWEQYCLLSLRGIKERRHDYFSWLRVTQVLSTA  358

Query  1393  LILGMLWWQSGGDTPSQMQDQAGLLFFIAVFWGFFPVFTAIFTFPQEKAMLSKERAADMY  1214
             +ILG+LWWQS    P  +QDQ GLLFFIAVFWGFFPVFTAIFTFPQE+AMLSKER ++MY
Sbjct  359   IILGLLWWQSDIHHPKGLQDQVGLLFFIAVFWGFFPVFTAIFTFPQERAMLSKERESNMY  418

Query  1213  RLSAYFAARTTSdlpldlllpliflLVVYFMAGLKQDASSFLLTAVTVFLCIVVAQGLGL  1034
             RLSAYF ARTTSDLPLDL+LP++FL+VVYFMAGL+  A SF L+ +TVFLCIV AQGLGL
Sbjct  419   RLSAYFVARTTSDLPLDLILPVLFLVVVYFMAGLRLSAESFFLSVLTVFLCIVAAQGLGL  478

Query  1033  AIGATLMDLKKATTLASVTVMTFMLAGGYFIKKVPGFIVWLRDLSFNYHTFKLLLKVQYE  854
             AIGA+LMDLKKATTLASVTVMTFMLAGGYF+KKVP FI W+R +SFNYHT+KLL+KVQY+
Sbjct  479   AIGASLMDLKKATTLASVTVMTFMLAGGYFVKKVPVFIAWIRFMSFNYHTYKLLVKVQYQ  538

Query  853   HKTNSVNGVQIDSGIKEVGALAAMAVSYRLLAYISLRRMKLQ  728
                 +VNG +I+SGIKEV AL AM + YRLLAY+SLRRMKL 
Sbjct  539   EIMENVNGEEIESGIKEVSALVAMIIGYRLLAYLSLRRMKLH  580



>gb|KFK40221.1| hypothetical protein AALP_AA3G346400 [Arabis alpina]
Length=610

 Score =   745 bits (1924),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/617 (65%), Positives = 469/617 (76%), Gaps = 53/617 (9%)
 Frame = -2

Query  2482  EDLEAGTKKKRSIPAEPTFPIYLKFTEVSYKIVIKGVTFSEEKDILNGISGAVDPGEVLA  2303
             ED+EAG  K +    EPT PI+LKF EV+YK+ IK +T      IL+GISG+V+PGEVLA
Sbjct  12    EDIEAGNMKPK-FQDEPTLPIFLKFREVTYKVSIKKLT------ILSGISGSVNPGEVLA  64

Query  2302  LMGPSGCGKTTLLSLLGGRIRDPS-AGSITYNQHPYSKLLKSRIGFVTQDDILFPHLTVK  2126
             LMGPSG GKTTLLSLLGGR+   S  GS+TYN  PYSKLLKS+IGFVTQDD+LFPHLTVK
Sbjct  65    LMGPSGSGKTTLLSLLGGRVSQSSIGGSVTYNDKPYSKLLKSKIGFVTQDDVLFPHLTVK  124

Query  2125  ETLIYAARLRLPRTLTKEEKDKRAMDVIYELGLDRCQDTMIGGSFVRGVSGGERKRVCIG  1946
             ETL YAARL LP+TLT+++K++RA+DV+ ELGL+RCQDTMIGG+FVRGVSGGERKRV IG
Sbjct  125   ETLTYAARLCLPKTLTRQQKEQRALDVMQELGLERCQDTMIGGAFVRGVSGGERKRVSIG  184

Query  1945  NEIIINPSLLFLDEPTSGLDSTTALRIVDILHEIAKAGKTVITTIHQPSSRLFHk-----  1781
             NEIIINPSLLFLDEPTSGLDSTTAL+ + +LH+IAKAGKTVITTIHQPSSRLFH      
Sbjct  185   NEIIINPSLLFLDEPTSGLDSTTALKTIQMLHDIAKAGKTVITTIHQPSSRLFHGFDKLI  244

Query  1780  ---------------------------fdklilleflldLANGNINDVSIPSELADKVQT  1682
                                           +   EFLLDLANGNIND+S+PSEL D+VQ 
Sbjct  245   LLGRGNLLYFGKSSEAMDYFSSIGCSPLIAMNPAEFLLDLANGNINDISVPSELEDRVQN  304

Query  1681  WNSKEEPTRNNGKPSPAIVHEYLVGCYETRVAETEKKKLMAPLPVEEELKSKVRYLKREW  1502
              NS  E       P    V EYLV  YE       KKKL+ P+P++EE K KV   KR  
Sbjct  305   GNSGRESLTEKSFP----VQEYLVEAYE-------KKKLLDPVPLDEEAKGKVLRGKR--  351

Query  1501  GASWSEQYVLLFHRGIRERWHDYFSWLRITQVIATALILGMLWWQSGGDTPSQMQDQAGL  1322
             GASW EQY +LF RG +ER H+YFSWL  TQV++TA++LG+LWW+S   TP  +QDQAGL
Sbjct  352   GASWWEQYCILFSRGFKERRHEYFSWLPFTQVLSTAVVLGLLWWRSDIRTPRGLQDQAGL  411

Query  1321  LFFIAVFWGFFPVFTAIFTFPQEKAMLSKERAADMYRLSAYFAARTTSdlpldlllplif  1142
             +FFIAVFWGFFPVFTAIF FPQE+AML+KERAADMY+LSAYF ARTTSDLPLD +LP +F
Sbjct  412   VFFIAVFWGFFPVFTAIFAFPQERAMLNKERAADMYKLSAYFMARTTSDLPLDFILPTLF  471

Query  1141  lLVVYFMAGLKQDASSFLLTAVTVFLCIVVAQGLGLAIGATLMDLKKATTLASVTVMTFM  962
             LLVVYFM  L+     F LT +TVFLCI+ AQGLGLAIGA LMD+KKA+TLASV VMTFM
Sbjct  472   LLVVYFMTDLRVSPYPFFLTFLTVFLCILAAQGLGLAIGAILMDIKKASTLASVIVMTFM  531

Query  961   LAGGYFIKKVPGFIVWLRDLSFNYHTFKLLLKVQYEHKTNSVNGVQIDSGIKEVGALAAM  782
             LAGG+F+ KVP FI W+R +SFNYHT+KLLLKVQY     S+NGV+ID+G+ EV AL  M
Sbjct  532   LAGGFFVSKVPVFISWVRYISFNYHTYKLLLKVQYRGVATSINGVRIDNGLTEVVALVVM  591

Query  781   AVSYRLLAYISLRRMKL  731
                YRLLAY+SLRRMK+
Sbjct  592   IFGYRLLAYLSLRRMKI  608



>ref|XP_010553412.1| PREDICTED: ABC transporter G family member 27-like isoform X2 
[Tarenaya hassleriana]
Length=597

 Score =   741 bits (1914),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/595 (66%), Positives = 474/595 (80%), Gaps = 37/595 (6%)
 Frame = -2

Query  2413  KFTEVSYKIVIKGVTFSEEKDILNGISGAVDPGEVLALMGPSGCGKTTLLSLLGGRIRDP  2234
             +F +++YK V KG+  S EK ILNGI+G+  PG+++ALMGPSG GKTTLL+LLGGR+   
Sbjct  4     RFIDITYK-VTKGMK-SSEKTILNGITGSAYPGDLVALMGPSGSGKTTLLNLLGGRLNQQ  61

Query  2233  S-AGSITYNQHPYSKLLKSRIGFVTQDDILFPHLTVKETLIYAARLRLPRTLTKEEKDKR  2057
             +  GSI+YN  PYSK LKSR+GFVTQDD+LFPHLTV+ETL Y A LRLP+TLTK +K++R
Sbjct  62    NVGGSISYNDKPYSKHLKSRMGFVTQDDVLFPHLTVRETLTYTALLRLPQTLTKHQKEQR  121

Query  2056  AMDVIYELGLDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTT  1877
             A+ VI ELGL+RCQDTMIGGSFVRG+SGGERKRVCIGNEI+INPS+LFLDEPTS LDSTT
Sbjct  122   ALSVIQELGLERCQDTMIGGSFVRGISGGERKRVCIGNEIMINPSILFLDEPTSSLDSTT  181

Query  1876  ALRIVDILHEIAKAGKTVITTIHQPSSRLFHk----------------------------  1781
             AL+IV +L  IA+AGKT++TTIHQPSSRLFH+                            
Sbjct  182   ALKIVQMLQSIAEAGKTIVTTIHQPSSRLFHRFDKLIMLSRGSLLYFGKASQAMSYFSSL  241

Query  1780  ----fdklilleflldLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYL  1613
                    +   EFLLDLANGN+ND+SIPS+L +  QT NS       + KP+PA V+E+L
Sbjct  242   GCYPLLTMNPAEFLLDLANGNMNDISIPSDLGNNEQTENSYT--VIRSSKPTPAAVYEFL  299

Query  1612  VGCYETRVAETEKKKLMAPLPVEEELKSKVRYLKREWGASWSEQYVLLFHRGIRERWHDY  1433
             V  Y+T++A  EKKK+M P+P++EE+K  +  LKR+WG +W EQY +LF RGI+ER HDY
Sbjct  300   VEAYQTQLAVVEKKKIMTPVPLDEEVKLMISCLKRDWGLNWWEQYSILFLRGIKERRHDY  359

Query  1432  FSWLRITQVIATALILGMLWWQSGGDTPSQMQDQAGLLFFIAVFWGFFPVFTAIFTFPQE  1253
             FSWLRITQV++TA+ILG+LWWQS    P  +QDQ GLLFFIAVFWGFFPVFTAIFTFPQE
Sbjct  360   FSWLRITQVLSTAIILGLLWWQSDSHHPKGLQDQVGLLFFIAVFWGFFPVFTAIFTFPQE  419

Query  1252  KAMLSKERAADMYRLSAYFAARTTSdlpldlllpliflLVVYFMAGLKQDASSFLLTAVT  1073
             +AML+KER ++MYRLSAYF ARTTSDLPLDL+LP++FL+VVYFMAGL+  + SF L+ +T
Sbjct  420   RAMLTKERESNMYRLSAYFLARTTSDLPLDLILPVLFLVVVYFMAGLRPKSESFFLSVLT  479

Query  1072  VFLCIVVAQGLGLAIGATLMDLKKATTLASVTVMTFMLAGGYFIKKVPGFIVWLRDLSFN  893
             VFLCIV AQGLGLAIGATLMDLKKATTLASVTVMTFMLAGGYF+KKVP FI W+R +SFN
Sbjct  480   VFLCIVAAQGLGLAIGATLMDLKKATTLASVTVMTFMLAGGYFVKKVPIFIAWIRYMSFN  539

Query  892   YHTFKLLLKVQYEHKTNSVNGVQIDSGIKEVGALAAMAVSYRLLAYISLRRMKLQ  728
             YHT+KLLLKVQY+    +VNG QI++G+KEVGAL  M   YRLLAY+SLRRMKLQ
Sbjct  540   YHTYKLLLKVQYQQIMQNVNGEQIENGLKEVGALVVMIFGYRLLAYLSLRRMKLQ  594



>dbj|BAB11402.1| ABC transporter-like protein [Arabidopsis thaliana]
Length=567

 Score =   730 bits (1885),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/557 (69%), Positives = 443/557 (80%), Gaps = 36/557 (6%)
 Frame = -2

Query  2482  EDLEAGTKKKRSIPAEPTFPIYLKFTEVSYKIVIKGVTFSEEKDILNGISGAVDPGEVLA  2303
             ED+EAG KKK    AEPT PI+LKF +V+YK+VIK +T S EK+IL GISG+V+PGEVLA
Sbjct  12    EDIEAG-KKKPKFQAEPTLPIFLKFRDVTYKVVIKKLTSSVEKEILTGISGSVNPGEVLA  70

Query  2302  LMGPSGCGKTTLLSLLGGRIRDPS-AGSITYNQHPYSKLLKSRIGFVTQDDILFPHLTVK  2126
             LMGPSG GKTTLLSLL GRI   S  GS+TYN  PYSK LKS+IGFVTQDD+LFPHLTVK
Sbjct  71    LMGPSGSGKTTLLSLLAGRISQSSTGGSVTYNDKPYSKYLKSKIGFVTQDDVLFPHLTVK  130

Query  2125  ETLIYAARLRLPRTLTKEEKDKRAMDVIYELGLDRCQDTMIGGSFVRGVSGGERKRVCIG  1946
             ETL YAARLRLP+TLT+E+K +RA+DVI ELGL+RCQDTMIGG+FVRGVSGGERKRV IG
Sbjct  131   ETLTYAARLRLPKTLTREQKKQRALDVIQELGLERCQDTMIGGAFVRGVSGGERKRVSIG  190

Query  1945  NEIIINPSLLFLDEPTSGLDSTTALRIVDILHEIAKAGKTVITTIHQPSSRLFHk-----  1781
             NEIIINPSLL LDEPTSGLDSTTALR + +LH+IA+AGKTVITTIHQPSSRLFH+     
Sbjct  191   NEIIINPSLLLLDEPTSGLDSTTALRTILMLHDIAEAGKTVITTIHQPSSRLFHRFDKLI  250

Query  1780  ---------------------------fdklilleflldLANGNINDVSIPSELADKVQT  1682
                                           +   EFLLDLANGNIND+S+PSEL D+VQ 
Sbjct  251   LLGRGSLLYFGKSSEALDYFSSIGCSPLIAMNPAEFLLDLANGNINDISVPSELDDRVQV  310

Query  1681  WNSKEEPTRNNGKPSPAIVHEYLVGCYETRVAETEKKKLMAPLPVEEELKSKVRYLKREW  1502
              NS  E     GKPSPA VHEYLV  YETRVAE EKKKL+ P+P++EE K+K   LKR+W
Sbjct  311   GNSGRE--TQTGKPSPAAVHEYLVEAYETRVAEQEKKKLLDPVPLDEEAKAKSTRLKRQW  368

Query  1501  GASWSEQYVLLFHRGIRERWHDYFSWLRITQVIATALILGMLWWQSGGDTPSQMQDQAGL  1322
             G  W EQY +LF RG++ER H+YFSWLR+TQV++TA+ILG+LWWQS   TP  +QDQAGL
Sbjct  369   GTCWWEQYCILFCRGLKERRHEYFSWLRVTQVLSTAVILGLLWWQSDIRTPMGLQDQAGL  428

Query  1321  LFFIAVFWGFFPVFTAIFTFPQEKAMLSKERAADMYRLSAYFAARTTSdlpldlllplif  1142
             LFFIAVFWGFFPVFTAIF FPQE+AML+KERAADMYRLSAYF ARTTSDLPLD +LP +F
Sbjct  429   LFFIAVFWGFFPVFTAIFAFPQERAMLNKERAADMYRLSAYFLARTTSDLPLDFILPSLF  488

Query  1141  lLVVYFMAGLKQDASSFLLTAVTVFLCIVVAQGLGLAIGATLMDLKKATTLASVTVMTFM  962
             LLVVYFM GL+     F L+ +TVFLCI+ AQGLGLAIGA LMDLKKATTLASVTVMTFM
Sbjct  489   LLVVYFMTGLRISPYPFFLSMLTVFLCIIAAQGLGLAIGAILMDLKKATTLASVTVMTFM  548

Query  961   LAGGYFIKKVPGFIVWL  911
             LAGG+F+K  P F+ +L
Sbjct  549   LAGGFFVKASPLFLDFL  565



>ref|XP_006854611.1| hypothetical protein AMTR_s00030p00144980 [Amborella trichopoda]
 gb|ERN16078.1| hypothetical protein AMTR_s00030p00144980 [Amborella trichopoda]
Length=756

 Score =   730 bits (1884),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 403/706 (57%), Positives = 502/706 (71%), Gaps = 77/706 (11%)
 Frame = -2

Query  2644  KSRSAQMKLDLDEls------------sgsvlsrassaslGFSFTGFSVRPD--------  2525
             KSRSAQ++ D+DE+             +    + ++S  L F  +G ++ PD        
Sbjct  56    KSRSAQIRGDIDEVINGVNGSSIEDVGATVSRASSASLGLSFCLSGIAMPPDNILSDIGR  115

Query  2524  --------ESADSKPFSDDENPEDLEAGTKKKRSIPAEPTFPIYLKFTEVSYKIVIKGVT  2369
                     E    +  SD E  +DLE+G   K  I +EPT+PI LKFT+V Y++   G  
Sbjct  116   LNRSDYVQEEVTEETGSDWE--KDLESGNHNK--IKSEPTYPISLKFTDVKYQV---GKN  168

Query  2368  FSEEKDILNGISGAVDPGEVLALMGPSGCGKTTLLSLLGGRIRD-PSAGSITYNQHPYSK  2192
               EEK IL+G++G+  PGEVLALMGPSG GKTTLL+LL GR+      G+ITYN  PYSK
Sbjct  169   GGEEKYILHGVTGSAQPGEVLALMGPSGGGKTTLLNLLSGRVEKIVPRGTITYNDLPYSK  228

Query  2191  LLKSRIGFVTQDDILFPHLTVKETLIYAARLRLPRTLTKEEKDKRAMDVIYELGLDRCQD  2012
              LK RIGFV QDDI+F HLTVKETL YAA LRLPRTL+K++K++RAMDVI +LGL+RCQD
Sbjct  229   SLKRRIGFVLQDDIVFSHLTVKETLTYAALLRLPRTLSKQQKEERAMDVIMKLGLERCQD  288

Query  2011  TMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILHEIAKAG  1832
             T+IGG+F RG+SGGERKRVCIGNEI++NPSLLFLDEPTSGLDSTTALRI+ ILH+IA+AG
Sbjct  289   TLIGGAFTRGISGGERKRVCIGNEILLNPSLLFLDEPTSGLDSTTALRIIQILHDIAEAG  348

Query  1831  KTVITTIHQPSSRLFHk--------------------------------fdklillefll  1748
             KTV+ TIHQPSSRLFHK                                   +   EFL+
Sbjct  349   KTVVITIHQPSSRLFHKFDKLILLGKGSLLYSGKALEAMVYFNSIGCSPLIAMNPAEFLI  408

Query  1747  dLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYETRVAETEKKK  1568
             DLANGNIND SIPSEL DKV   +S+ E    + KPSP+ VHEYLV  YETRVA+ EKKK
Sbjct  409   DLANGNINDKSIPSELEDKVLLESSRVEIV--DAKPSPSDVHEYLVEAYETRVADCEKKK  466

Query  1567  LMAPLPVEEELKSKVRYLK-REWGASWSEQYVLLFHRGIRERWHDYFSWLRITQVIATAL  1391
             ++ P   +++  +    L+ REW ASW +Q+ +LF R +++R HD+ SW+R+TQV++TA+
Sbjct  467   VLKPAQTDDDWNNSHAVLRSREWRASWWQQFTILFCRSLKQRRHDHLSWMRVTQVLSTAI  526

Query  1390  ILGMLWWQSGGDTPSQMQDQAGLLFFIAVFWGFFPVFTAIFTFPQEKAMLSKERAADMYR  1211
             ILG+LWW S   +  ++QDQAGLLFFIAVFWGFFPVFTAIFTFPQE+AML+KERA D Y+
Sbjct  527   ILGLLWWHSDNSSTKEVQDQAGLLFFIAVFWGFFPVFTAIFTFPQERAMLAKERAVDTYK  586

Query  1210  LSAYFAARTTSdlpldlllpliflLVVYFMAGLKQDASSFLLTAVTVFLCIVVAQGLGLA  1031
             LSAYF AR TSDLPLD++LP+IFLL+VYFM GLK   S+F L+ +T+FL IV AQGLGL 
Sbjct  587   LSAYFMARITSDLPLDMILPVIFLLIVYFMVGLKASTSAFFLSMITLFLSIVAAQGLGLV  646

Query  1030  IGATLMDLKKATTLASVTVMTFMLAGGYFIKKVPGFIVWLRDLSFNYHTFKLLLKVQY--  857
             IGA+LMD KKATTLASV VMTFMLAGG+F++ VP FI W+R +SFNYHT++LLLK+QY  
Sbjct  647   IGASLMDAKKATTLASVVVMTFMLAGGFFVQNVPSFISWIRYISFNYHTYRLLLKIQYSC  706

Query  856   ----EHKTNSVNGVQIDSGIKEVGALAAMAVSYRLLAYISLRRMKL  731
                   K+ S+ G+ +DSG +E  A+ AM   YR LAYISLRRMKL
Sbjct  707   SGSNSCKSFSIKGITLDSGGREACAMIAMVFGYRFLAYISLRRMKL  752



>ref|XP_010503973.1| PREDICTED: ABC transporter G family member 27-like isoform X2 
[Camelina sativa]
Length=725

 Score =   719 bits (1856),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 403/681 (59%), Positives = 486/681 (71%), Gaps = 62/681 (9%)
 Frame = -2

Query  2659  STHIRKSRSAQMKLDLDEls--sgsvlsrassaslGFSFTGFSVRPDESADSKPFSDDEN  2486
             +THIRK++SA   LDL  L+  +    + ++S  + FSFTGF+V  +E   S+  S+++ 
Sbjct  67    NTHIRKAKSAHPALDLAGLTGGAALSRASSASHGISFSFTGFTVPHEEIIASERCSNEDF  126

Query  2485  PEDLEAGTKKKRSIPAEPTFPIYLKFTEVSYKIVIKGVTFSEEKDILNGISGAVDPGEVL  2306
              ED+EA T       AEPTFPIYLK            +  S     L+    A+D     
Sbjct  127   LEDIEAATSSVVKFQAEPTFPIYLK----------SSLGGSTTICWLSATCEALDQ----  172

Query  2305  ALMGPSGCGKTTLLSLLGGRIR---DPSAGSITYNQHPYSKLLKSRIGFVTQDDILFPHL  2135
                      K     + G   R      +G ++YN  PYSK LK+RIGFVTQ+D+LFPHL
Sbjct  173   ---------KVHRYHIQGNDQRFNQQNVSGLVSYNDKPYSKHLKTRIGFVTQEDVLFPHL  223

Query  2134  TVKETLIYAARLRLPRTLTKEEKDKRAMDVIYELGLDRCQDTMIGGSFVRGVSGGERKRV  1955
             TV ETL Y ARLRLP+TLTK+EK++RA+ VI ELGL+RCQ TMIGGSFVRGVSGGERKRV
Sbjct  224   TVIETLTYTARLRLPKTLTKQEKEQRAVSVIQELGLERCQGTMIGGSFVRGVSGGERKRV  283

Query  1954  CIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILHEIAKAGKTVITTIHQPSSRLFHkfd  1775
              IGNEI+ NPSLL LDEPTS LDSTTAL+IV +L  IAKAGKTV+TTIHQPSSRLFH+FD
Sbjct  284   SIGNEIMTNPSLLLLDEPTSSLDSTTALKIVQMLQSIAKAGKTVVTTIHQPSSRLFHRFD  343

Query  1774  klilleflldL--------------------------------ANGNINDVSIPSELADK  1691
             KL++L     L                                ANGN+ND+SIPS L  K
Sbjct  344   KLVVLSRGSLLYFGKASDAMSYFSSIGCSPLLAMNPAEFLLDLANGNMNDISIPSALKKK  403

Query  1690  VQTWNSKEEPTRNNGKPSPAIVHEYLVGCYETRVAETEKKKLMAPLPVEEELKSKVRYLK  1511
             ++  NS  E    + KP+P IV+EYL   Y+T+++  EKKKLMAP+P+EEE+K  +   K
Sbjct  404   MKMENSCSEI--RSSKPTPTIVYEYLEEAYKTQISVVEKKKLMAPVPLEEEVKLMITCPK  461

Query  1510  REWGASWSEQYVLLFHRGIRERWHDYFSWLRITQVIATALILGMLWWQSGGDTPSQMQDQ  1331
             REWG SW EQY LL  RGI+ER HDYFSWLR+TQV++TA+ILG+LWWQS    P  +QDQ
Sbjct  462   REWGLSWWEQYCLLSLRGIKERRHDYFSWLRVTQVLSTAIILGLLWWQSDIHHPKGLQDQ  521

Query  1330  AGLLFFIAVFWGFFPVFTAIFTFPQEKAMLSKERAADMYRLSAYFAARTTSdlpldlllp  1151
              GLLFFIAVFWGFFPVFTAIFTFPQE+AMLSKER ++MYRLSAYF ARTTSDLPLDL+LP
Sbjct  522   VGLLFFIAVFWGFFPVFTAIFTFPQERAMLSKERESNMYRLSAYFVARTTSDLPLDLILP  581

Query  1150  liflLVVYFMAGLKQDASSFLLTAVTVFLCIVVAQGLGLAIGATLMDLKKATTLASVTVM  971
             ++FL+VVYFMAGL+  A SF L+ +TVFLCIV AQGLGLAIGA+LMDLKKATTLASVTVM
Sbjct  582   VLFLVVVYFMAGLRLSAESFFLSVLTVFLCIVAAQGLGLAIGASLMDLKKATTLASVTVM  641

Query  970   TFMLAGGYFIKKVPGFIVWLRDLSFNYHTFKLLLKVQYEHKTNSVNGVQIDSGIKEVGAL  791
             TFMLAGGYF+KKVP FI W+R +SFNYHT+KLL+KVQY+    +VNG +I+SGIKEV AL
Sbjct  642   TFMLAGGYFVKKVPVFIAWIRFMSFNYHTYKLLVKVQYQEIMENVNGEEIESGIKEVSAL  701

Query  790   AAMAVSYRLLAYISLRRMKLQ  728
              AM + YRLLAY+SLRRMKL 
Sbjct  702   VAMIIGYRLLAYLSLRRMKLH  722



>ref|XP_010244004.1| PREDICTED: ABC transporter G family member 22-like isoform X3 
[Nelumbo nucifera]
Length=797

 Score =   713 bits (1841),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/619 (62%), Positives = 466/619 (75%), Gaps = 46/619 (7%)
 Frame = -2

Query  2452  RSIPAEPTFPIYLKFTEVSYKIVIKGVTFSE-EKDILNGISGAVDPGEVLALMGPSGCGK  2276
             + I  EPT PI LKF +V YK+ + G   S+ EK IL+G++G+V PGEVLALMGPSG GK
Sbjct  178   KKIQIEPTLPICLKFQDVRYKVALNGRRSSDAEKYILHGVTGSVHPGEVLALMGPSGGGK  237

Query  2275  TTLLSLLGGRIR-DPSAGSITYNQHPYSKLLKSRIGFVTQDDILFPHLTVKETLIYAARL  2099
             TTLL+LL GR++ D  + SITYN  PYSK LK RIGFV QDD+ FPHLTVKETL YAA L
Sbjct  238   TTLLNLLSGRVKTDDVSCSITYNDQPYSKSLKRRIGFVMQDDVAFPHLTVKETLTYAALL  297

Query  2098  RLPRTLTKEEKDKRAMDVIYELGLDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSL  1919
             RLP TLTK++K++RAM+VI EL L+RCQ+T+IGGSFVRG+SGGERKRVCIGNEI++NPSL
Sbjct  298   RLPNTLTKQQKEERAMNVISELDLERCQNTIIGGSFVRGISGGERKRVCIGNEILLNPSL  357

Query  1918  LFLDEPTSGLDSTTALRIVDILHEIAKAGKTVITTIHQPSSRLFHkfdklilleflldL-  1742
             LFLDEPTSGLDSTTALRIV +LH IAKAGKTV+TTIHQPSSRLF+KFDKLILL     L 
Sbjct  358   LFLDEPTSGLDSTTALRIVQMLHNIAKAGKTVVTTIHQPSSRLFNKFDKLILLSRGNSLY  417

Query  1741  -------------------------------ANGNINDVSIPSELADKVQTWNSKEEPTR  1655
                                            ANGNIND SIPS L DK+      + P +
Sbjct  418   FGKASEAMLYFSSIGCSPLIVMNPAEFLIDLANGNINDKSIPSVLEDKILL--GSQFPEK  475

Query  1654  NNGKPSPAIVHEYLVGCYETRVAETEKKKLMAPLPVEEELKSKVRYLKREWGASWSEQYV  1475
              +G+PSP  VHEYLVG YETRVA  EK+KL+ P+ V+ E + +      +WGASW EQY 
Sbjct  476   QDGRPSPVDVHEYLVGAYETRVANIEKQKLLKPVMVDSESEIQGMSHSIDWGASWWEQYS  535

Query  1474  LLFHRGIRERWHDYFSWLRITQVIATALILGMLWWQSGGDTPSQMQDQAGLLFFIAVFWG  1295
             +LF RG++ER H+Y S LR+TQV++TA+I+G+LWW S   +P ++QDQAGLLFFI+VFWG
Sbjct  536   ILFRRGLKERRHEYLSCLRVTQVVSTAIIIGLLWWHSDASSPKRLQDQAGLLFFISVFWG  595

Query  1294  FFPVFTAIFTFPQEKAMLSKERAADMYRLSAYFAARTTSdlpldlllpliflLVVYFMAG  1115
             FFPVFTAIFTFPQE+AML+KERA  MY+LSAYF AR  SDLPLDL+LP++FL++VYFM G
Sbjct  596   FFPVFTAIFTFPQERAMLAKERAVGMYKLSAYFIARNASDLPLDLILPIVFLVIVYFMVG  655

Query  1114  LKQDASSFLLTAVTVFLCIVVAQGLGLAIGATLMDLKKATTLASVTVMTFMLAGGYFIKK  935
             LKQ  S+F L+ +T+FL IV AQGLGLAIGA  MD+KKATTLASV VMTFMLAGG+F++K
Sbjct  656   LKQTFSAFSLSMLTLFLTIVSAQGLGLAIGAAFMDVKKATTLASVLVMTFMLAGGFFVQK  715

Query  934   VPGFIVWLRDLSFNYHTFKLLLKVQYE-----HKTNS-----VNGVQIDSGIKEVGALAA  785
             VP F+ W+R +S NYHT++LLLK+QY      H + +     + G++ID G KE GA+  
Sbjct  716   VPSFMSWIRYISINYHTYRLLLKIQYSCSGSGHGSAACDSPFIKGLKIDDGGKEAGAMIT  775

Query  784   MAVSYRLLAYISLRRMKLQ  728
             M   YRLLAY+ LR +KL+
Sbjct  776   MIFGYRLLAYLFLRGIKLR  794



>ref|XP_010244001.1| PREDICTED: ABC transporter G family member 22-like isoform X1 
[Nelumbo nucifera]
Length=801

 Score =   713 bits (1841),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/619 (62%), Positives = 466/619 (75%), Gaps = 46/619 (7%)
 Frame = -2

Query  2452  RSIPAEPTFPIYLKFTEVSYKIVIKGVTFSE-EKDILNGISGAVDPGEVLALMGPSGCGK  2276
             + I  EPT PI LKF +V YK+ + G   S+ EK IL+G++G+V PGEVLALMGPSG GK
Sbjct  182   KKIQIEPTLPICLKFQDVRYKVALNGRRSSDAEKYILHGVTGSVHPGEVLALMGPSGGGK  241

Query  2275  TTLLSLLGGRIR-DPSAGSITYNQHPYSKLLKSRIGFVTQDDILFPHLTVKETLIYAARL  2099
             TTLL+LL GR++ D  + SITYN  PYSK LK RIGFV QDD+ FPHLTVKETL YAA L
Sbjct  242   TTLLNLLSGRVKTDDVSCSITYNDQPYSKSLKRRIGFVMQDDVAFPHLTVKETLTYAALL  301

Query  2098  RLPRTLTKEEKDKRAMDVIYELGLDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSL  1919
             RLP TLTK++K++RAM+VI EL L+RCQ+T+IGGSFVRG+SGGERKRVCIGNEI++NPSL
Sbjct  302   RLPNTLTKQQKEERAMNVISELDLERCQNTIIGGSFVRGISGGERKRVCIGNEILLNPSL  361

Query  1918  LFLDEPTSGLDSTTALRIVDILHEIAKAGKTVITTIHQPSSRLFHkfdklilleflldL-  1742
             LFLDEPTSGLDSTTALRIV +LH IAKAGKTV+TTIHQPSSRLF+KFDKLILL     L 
Sbjct  362   LFLDEPTSGLDSTTALRIVQMLHNIAKAGKTVVTTIHQPSSRLFNKFDKLILLSRGNSLY  421

Query  1741  -------------------------------ANGNINDVSIPSELADKVQTWNSKEEPTR  1655
                                            ANGNIND SIPS L DK+      + P +
Sbjct  422   FGKASEAMLYFSSIGCSPLIVMNPAEFLIDLANGNINDKSIPSVLEDKILL--GSQFPEK  479

Query  1654  NNGKPSPAIVHEYLVGCYETRVAETEKKKLMAPLPVEEELKSKVRYLKREWGASWSEQYV  1475
              +G+PSP  VHEYLVG YETRVA  EK+KL+ P+ V+ E + +      +WGASW EQY 
Sbjct  480   QDGRPSPVDVHEYLVGAYETRVANIEKQKLLKPVMVDSESEIQGMSHSIDWGASWWEQYS  539

Query  1474  LLFHRGIRERWHDYFSWLRITQVIATALILGMLWWQSGGDTPSQMQDQAGLLFFIAVFWG  1295
             +LF RG++ER H+Y S LR+TQV++TA+I+G+LWW S   +P ++QDQAGLLFFI+VFWG
Sbjct  540   ILFRRGLKERRHEYLSCLRVTQVVSTAIIIGLLWWHSDASSPKRLQDQAGLLFFISVFWG  599

Query  1294  FFPVFTAIFTFPQEKAMLSKERAADMYRLSAYFAARTTSdlpldlllpliflLVVYFMAG  1115
             FFPVFTAIFTFPQE+AML+KERA  MY+LSAYF AR  SDLPLDL+LP++FL++VYFM G
Sbjct  600   FFPVFTAIFTFPQERAMLAKERAVGMYKLSAYFIARNASDLPLDLILPIVFLVIVYFMVG  659

Query  1114  LKQDASSFLLTAVTVFLCIVVAQGLGLAIGATLMDLKKATTLASVTVMTFMLAGGYFIKK  935
             LKQ  S+F L+ +T+FL IV AQGLGLAIGA  MD+KKATTLASV VMTFMLAGG+F++K
Sbjct  660   LKQTFSAFSLSMLTLFLTIVSAQGLGLAIGAAFMDVKKATTLASVLVMTFMLAGGFFVQK  719

Query  934   VPGFIVWLRDLSFNYHTFKLLLKVQYE-----HKTNS-----VNGVQIDSGIKEVGALAA  785
             VP F+ W+R +S NYHT++LLLK+QY      H + +     + G++ID G KE GA+  
Sbjct  720   VPSFMSWIRYISINYHTYRLLLKIQYSCSGSGHGSAACDSPFIKGLKIDDGGKEAGAMIT  779

Query  784   MAVSYRLLAYISLRRMKLQ  728
             M   YRLLAY+ LR +KL+
Sbjct  780   MIFGYRLLAYLFLRGIKLR  798



>gb|KDO70708.1| hypothetical protein CISIN_1g0045372mg, partial [Citrus sinensis]
Length=513

 Score =   701 bits (1808),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/514 (70%), Positives = 421/514 (82%), Gaps = 35/514 (7%)
 Frame = -2

Query  2482  EDLEAGTKKKRSIPAEPTFPIYLKFTEVSYKIVIKGVTFSEEKDILNGISGAVDPGEVLA  2303
             ED+EAGT+++     EPT PIYLKFT+V+YK+++KG+T SEEKDILNGI+G+V+PGEVLA
Sbjct  1     EDIEAGTRERPKFQTEPTLPIYLKFTDVTYKVILKGMTSSEEKDILNGITGSVNPGEVLA  60

Query  2302  LMGPSGCGKTTLLSLLGGRIRDPS-AGSITYNQHPYSKLLKSRIGFVTQDDILFPHLTVK  2126
             LMGPSG GKTTLL+LL GR+ +P+  GSITYN HPYSK LKS+IGFVTQDD+LFPHLTVK
Sbjct  61    LMGPSGSGKTTLLNLLSGRLMEPTVGGSITYNDHPYSKSLKSKIGFVTQDDVLFPHLTVK  120

Query  2125  ETLIYAARLRLPRTLTKEEKDKRAMDVIYELGLDRCQDTMIGGSFVRGVSGGERKRVCIG  1946
             ETL YAA LRLP TLTK++K+KRA+DVI ELGL+RCQDTMIGGSFVRGVSGGERKRVCIG
Sbjct  121   ETLTYAALLRLPNTLTKQQKEKRAIDVINELGLERCQDTMIGGSFVRGVSGGERKRVCIG  180

Query  1945  NEIIINPSLLFLDEPTSGLDSTTALRIVDILHEIAKAGKTVITTIHQPSSRLFHk-----  1781
             NEIIINPSLLFLDEPTSGLDSTTALRIV +L +IA+AGKTV+TTIHQPSSRLFHK     
Sbjct  181   NEIIINPSLLFLDEPTSGLDSTTALRIVQMLQDIAEAGKTVVTTIHQPSSRLFHKFDKLI  240

Query  1780  ---------------------------fdklilleflldLANGNINDVSIPSELADKVQT  1682
                                           +   EFLLDLANGN++DVS+PSEL D+VQT
Sbjct  241   LLGKGSLLYFGKASEAMAYFSSIGCSPQIAMNPAEFLLDLANGNLHDVSVPSELQDRVQT  300

Query  1681  WNSKEEPTRNNGKPSPAIVHEYLVGCYETRVAETEKKKLMAPLPVEEELKSKVRYLKREW  1502
              NS+ +    NGKP+PAIVHEYLV  YETRVAE EKKKLMAP+P++EE+K+KV   KR W
Sbjct  301   ENSENDTA--NGKPTPAIVHEYLVEAYETRVAENEKKKLMAPIPLDEEIKAKVSSPKRNW  358

Query  1501  GASWSEQYVLLFHRGIRERWHDYFSWLRITQVIATALILGMLWWQSGGDTPSQMQDQAGL  1322
             GASW +QY +LF RGI+E  HDYFSWLRITQV+ATA+ILG+LWWQS   +P  ++DQAGL
Sbjct  359   GASWIQQYTILFRRGIKEHRHDYFSWLRITQVLATAVILGLLWWQSDSKSPKGLEDQAGL  418

Query  1321  LFFIAVFWGFFPVFTAIFTFPQEKAMLSKERAADMYRLSAYFAARTTSdlpldlllplif  1142
             LFFIAVFW FFP+FTAIFTFPQE+AMLSKERAADMYRLSAYF ARTTSDLPL+L+LP++F
Sbjct  419   LFFIAVFWSFFPIFTAIFTFPQERAMLSKERAADMYRLSAYFLARTTSDLPLNLVLPVLF  478

Query  1141  lLVVYFMAGLKQDASSFLLTAVTVFLCIVVAQGL  1040
             L++VYFMAGL+  A  F L+ +TVFL IV AQ L
Sbjct  479   LVIVYFMAGLRMGAGPFFLSMLTVFLSIVAAQAL  512



>gb|KDO70709.1| hypothetical protein CISIN_1g0045372mg, partial [Citrus sinensis]
 gb|KDO70710.1| hypothetical protein CISIN_1g0045372mg, partial [Citrus sinensis]
Length=523

 Score =   698 bits (1801),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/512 (70%), Positives = 420/512 (82%), Gaps = 35/512 (7%)
 Frame = -2

Query  2482  EDLEAGTKKKRSIPAEPTFPIYLKFTEVSYKIVIKGVTFSEEKDILNGISGAVDPGEVLA  2303
             ED+EAGT+++     EPT PIYLKFT+V+YK+++KG+T SEEKDILNGI+G+V+PGEVLA
Sbjct  1     EDIEAGTRERPKFQTEPTLPIYLKFTDVTYKVILKGMTSSEEKDILNGITGSVNPGEVLA  60

Query  2302  LMGPSGCGKTTLLSLLGGRIRDPS-AGSITYNQHPYSKLLKSRIGFVTQDDILFPHLTVK  2126
             LMGPSG GKTTLL+LL GR+ +P+  GSITYN HPYSK LKS+IGFVTQDD+LFPHLTVK
Sbjct  61    LMGPSGSGKTTLLNLLSGRLMEPTVGGSITYNDHPYSKSLKSKIGFVTQDDVLFPHLTVK  120

Query  2125  ETLIYAARLRLPRTLTKEEKDKRAMDVIYELGLDRCQDTMIGGSFVRGVSGGERKRVCIG  1946
             ETL YAA LRLP TLTK++K+KRA+DVI ELGL+RCQDTMIGGSFVRGVSGGERKRVCIG
Sbjct  121   ETLTYAALLRLPNTLTKQQKEKRAIDVINELGLERCQDTMIGGSFVRGVSGGERKRVCIG  180

Query  1945  NEIIINPSLLFLDEPTSGLDSTTALRIVDILHEIAKAGKTVITTIHQPSSRLFHk-----  1781
             NEIIINPSLLFLDEPTSGLDSTTALRIV +L +IA+AGKTV+TTIHQPSSRLFHK     
Sbjct  181   NEIIINPSLLFLDEPTSGLDSTTALRIVQMLQDIAEAGKTVVTTIHQPSSRLFHKFDKLI  240

Query  1780  ---------------------------fdklilleflldLANGNINDVSIPSELADKVQT  1682
                                           +   EFLLDLANGN++DVS+PSEL D+VQT
Sbjct  241   LLGKGSLLYFGKASEAMAYFSSIGCSPQIAMNPAEFLLDLANGNLHDVSVPSELQDRVQT  300

Query  1681  WNSKEEPTRNNGKPSPAIVHEYLVGCYETRVAETEKKKLMAPLPVEEELKSKVRYLKREW  1502
              NS+ +    NGKP+PAIVHEYLV  YETRVAE EKKKLMAP+P++EE+K+KV   KR W
Sbjct  301   ENSENDTA--NGKPTPAIVHEYLVEAYETRVAENEKKKLMAPIPLDEEIKAKVSSPKRNW  358

Query  1501  GASWSEQYVLLFHRGIRERWHDYFSWLRITQVIATALILGMLWWQSGGDTPSQMQDQAGL  1322
             GASW +QY +LF RGI+E  HDYFSWLRITQV+ATA+ILG+LWWQS   +P  ++DQAGL
Sbjct  359   GASWIQQYTILFRRGIKEHRHDYFSWLRITQVLATAVILGLLWWQSDSKSPKGLEDQAGL  418

Query  1321  LFFIAVFWGFFPVFTAIFTFPQEKAMLSKERAADMYRLSAYFAARTTSdlpldlllplif  1142
             LFFIAVFW FFP+FTAIFTFPQE+AMLSKERAADMYRLSAYF ARTTSDLPL+L+LP++F
Sbjct  419   LFFIAVFWSFFPIFTAIFTFPQERAMLSKERAADMYRLSAYFLARTTSDLPLNLVLPVLF  478

Query  1141  lLVVYFMAGLKQDASSFLLTAVTVFLCIVVAQ  1046
             L++VYFMAGL+  A  F L+ +TVFL IV AQ
Sbjct  479   LVIVYFMAGLRMGAGPFFLSMLTVFLSIVAAQ  510



>ref|XP_010247278.1| PREDICTED: ABC transporter G family member 22-like [Nelumbo nucifera]
Length=782

 Score =   707 bits (1825),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/698 (56%), Positives = 497/698 (71%), Gaps = 60/698 (9%)
 Frame = -2

Query  2653  HIRKSRSAQMKLDLD-----------ElssgsvlsrassaslGFSFTGFSVRPDESADSK  2507
             H  +S S Q+ +D+D           E+SS    + +S+    FS TG ++  D+ +D +
Sbjct  86    HKTRSSSTQINVDIDGLVGNATGSFSEMSSMHSSTASSNHLGFFSITGDTILSDDISDIQ  145

Query  2506  PFSD--------DENPEDLEAGTKKK--RSIPAEPTFPIYLKFTEVSYKIVIKGVTFSEE  2357
               ++        D+ P   E   K    + I   PT PI+LKF +V YK+V+     S+ 
Sbjct  146   RLNNTKRNANAVDDFPSSFEEDKKSCGWKKIETVPTLPIFLKFQDVKYKVVLNKRRSSDA  205

Query  2356  KD-ILNGISGAVDPGEVLALMGPSGCGKTTLLSLLGGRIR-DPSAGSITYNQHPYSKLLK  2183
             ++ IL+GI+G+V PGEVLALMGPSG GKTTLL+LL GR+  + +A SITYN  PYSK LK
Sbjct  206   QNYILHGITGSVQPGEVLALMGPSGGGKTTLLNLLSGRVTTNDAASSITYNDQPYSKSLK  265

Query  2182  SRIGFVTQDDILFPHLTVKETLIYAARLRLPRTLTKEEKDKRAMDVIYELGLDRCQDTMI  2003
              RIGFV QDD++FPHLTVKETL YAA LRLP+TLTK++K++R M+V+ EL L+RCQ+T+I
Sbjct  266   RRIGFVMQDDVVFPHLTVKETLTYAALLRLPKTLTKQQKEERVMNVLRELDLERCQNTII  325

Query  2002  GGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILHEIAKAGKTV  1823
             GG+FVRG+SGGERKRVCIGNEI++NPSLLFLDEPTSGLDSTTALRIV +L  IAKAGKTV
Sbjct  326   GGAFVRGISGGERKRVCIGNEILLNPSLLFLDEPTSGLDSTTALRIVQMLQSIAKAGKTV  385

Query  1822  ITTIHQPSSRLFHk--------------------------------fdklilleflldLA  1739
             +TTIHQPSSRLF+K                                   +   EFL+DLA
Sbjct  386   VTTIHQPSSRLFNKFDKLILLGRGNTLYFGKASEAMQYFSSIGCSPLIAMNPAEFLIDLA  445

Query  1738  NGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYETRVAETEKKKLMA  1559
             NGN+ND S+PS L DKV   +   E  + NG+ SP  VH+YLV  YETRVA  EK+ L+ 
Sbjct  446   NGNVNDKSVPSLLEDKVLFRHRNSE--KQNGRLSPTDVHQYLVDAYETRVARKEKRMLLK  503

Query  1558  PLPVEEELKSKVRYLKREWGASWSEQYVLLFHRGIRERWHDYFSWLRITQVIATALILGM  1379
                V+ E++S  R   REWGASW EQ+ +LF RG++ER H+Y S +R+TQVI+TA+I+G+
Sbjct  504   HAAVDGEIES--RSNSREWGASWWEQFSILFRRGLKERRHEYLSCVRVTQVISTAIIVGL  561

Query  1378  LWWQSGGDTPSQMQDQAGLLFFIAVFWGFFPVFTAIFTFPQEKAMLSKERAADMYRLSAY  1199
             LWW S   +P  +QDQAGLLFFI+VFWGFFPVFT+IF FPQEKAML KERA  MY+LSAY
Sbjct  562   LWWNSDAASPKGLQDQAGLLFFISVFWGFFPVFTSIFAFPQEKAMLGKERAVGMYKLSAY  621

Query  1198  FAARTTSdlpldlllpliflLVVYFMAGLKQDASSFLLTAVTVFLCIVVAQGLGLAIGAT  1019
             F AR  SDLPLDL+LP++F+++VYFM GLK   S+F L+ +TVFL +V AQGLGLAIGA 
Sbjct  622   FIARNASDLPLDLILPIVFMVIVYFMVGLKHSISTFSLSMLTVFLSVVAAQGLGLAIGAA  681

Query  1018  LMDLKKATTLASVTVMTFMLAGGYFIKKVPGFIVWLRDLSFNYHTFKLLLKVQYEH-KTN  842
              MD+KKATTLASV +MTFMLAGG+F++KVP F++W+R +SFNYHT++LLLK+QYE   + 
Sbjct  682   FMDVKKATTLASVLIMTFMLAGGFFVQKVPSFMLWIRYISFNYHTYRLLLKIQYESFDSP  741

Query  841   SVNGVQIDSGIKEVGALAAMAVSYRLLAYISLRRMKLQ  728
              +  ++ D+G KEVGA+ AM   YRLLAYI LR MKL+
Sbjct  742   FIRQIKTDNGGKEVGAMIAMIFGYRLLAYIFLRGMKLR  779



>ref|XP_002263430.1| PREDICTED: ABC transporter G family member 22-like [Vitis vinifera]
Length=775

 Score =   707 bits (1824),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/649 (58%), Positives = 473/649 (73%), Gaps = 59/649 (9%)
 Frame = -2

Query  2533  RPDESADSKPFSDDENPEDLEAGTKKKRSIPAEPTFPIYLKFTEVSYKIVIKGVTFSEEK  2354
             R  +SA  +  S  E  +D   G +K  S   +PT PIYLKF +V YK+V KG   S+EK
Sbjct  136   RQKDSATRQSRSAHEKDQD-SCGWRKTNS---KPTLPIYLKFEDVKYKVVTKGGKSSDEK  191

Query  2353  DILNGISGAVDPGEVLALMGPSGCGKTTLLSLLGGRIRDPSAGSITYNQHPYSKLLKSRI  2174
              IL+GI+G+VDPGEVLALMGPSG GKTTLL+LL G+++  S G ITYN  PY+K LK RI
Sbjct  192   HILHGITGSVDPGEVLALMGPSGGGKTTLLNLLSGKVKTNS-GRITYNDQPYAKTLKHRI  250

Query  2173  GFVTQDDILFPHLTVKETLIYAARLRLPRTLTKEEKDKRAMDVIYELGLDRCQDTMIGGS  1994
             GFV QDDI+FPHLTVKETL YAA LRLP TLT+++K +R MD+I EL L+RCQ+T+IGG+
Sbjct  251   GFVLQDDIVFPHLTVKETLTYAALLRLPNTLTRQQKKERVMDIISELDLERCQNTIIGGA  310

Query  1993  FVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILHEIAKAGKTVITT  1814
              VRG+SGGERKRVCIGNEI++NPSLLFLDEPTSGLDSTTALRI+ +L   A+AGKTV+TT
Sbjct  311   LVRGISGGERKRVCIGNEILLNPSLLFLDEPTSGLDSTTALRILQMLQNTAEAGKTVVTT  370

Query  1813  IHQPSSRLFHk--------------------------------fdklilleflldLANGN  1730
             IHQPSSRLF                                   + +   EFL+DLANGN
Sbjct  371   IHQPSSRLFSMFDKLVLLGKGNSLYFGKASEAMLYFSSIGCSPLEAMNPAEFLIDLANGN  430

Query  1729  INDVSIPSELADKVQTWNSKEEPTRNN-----GKPSPAIVHEYLVGCYETRVAETEKKKL  1565
             I++ S+PSEL DK         P R N     GKPSP  VHEYLVG YE RVA  EK KL
Sbjct  431   ISNKSVPSELEDKYS-------PGRQNFENEEGKPSPGEVHEYLVGAYEERVANLEKMKL  483

Query  1564  MAPLPVEEELKSKVRYLKREWGASWSEQYVLLFHRGIRERWHDYFSWLRITQVIATALIL  1385
             ++P+ ++   + + R    EWGA+W +Q+ +LF RG++ER H+Y + LRITQVI+TA+IL
Sbjct  484   LSPVLIDSVSEMQRRENSPEWGANWWQQFSILFRRGLKERRHEYLNGLRITQVISTAVIL  543

Query  1384  GMLWWQSGGDTPSQMQDQAGLLFFIAVFWGFFPVFTAIFTFPQEKAMLSKERAADMYRLS  1205
             G+LWW S   +P ++QDQAGLLFFI+VFWGF P+FTAIFTFPQE+AML KER+ DMYRLS
Sbjct  544   GLLWWHSDASSPKKLQDQAGLLFFISVFWGFLPLFTAIFTFPQERAMLVKERSVDMYRLS  603

Query  1204  AYFAARTTSdlpldlllpliflLVVYFMAGLKQDASSFLLTAVTVFLCIVVAQGLGLAIG  1025
             AYF AR TSDLPLDL+LP++F+L+VYFMAGLK   ++F LT +TVFL I+ +QGLG+ IG
Sbjct  604   AYFVARNTSDLPLDLILPILFMLIVYFMAGLKPSFAAFSLTMLTVFLSILASQGLGMTIG  663

Query  1024  ATLMDLKKATTLASVTVMTFMLAGGYFIKKVPGFIVWLRDLSFNYHTFKLLLKVQY----  857
             A LMD+KKATTLAS+T+MTFML+GG+FI++ P FI W R +SFNYHT++LLLK+QY    
Sbjct  664   AALMDVKKATTLASITLMTFMLSGGFFIQEFPSFISWARHISFNYHTYRLLLKIQYSCSN  723

Query  856   ----EHKTNS--VNGVQIDSGIKEVGALAAMAVSYRLLAYISLRRMKLQ  728
                 E   NS  + G++++    E+GA+ AM + YRLLAYI LRRMKL+
Sbjct  724   SNYEEGPCNSPFIRGLKLNRSGMELGAMVAMCIGYRLLAYIFLRRMKLR  772



>ref|XP_010244002.1| PREDICTED: ABC transporter G family member 22-like isoform X2 
[Nelumbo nucifera]
Length=800

 Score =   707 bits (1824),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/619 (61%), Positives = 465/619 (75%), Gaps = 47/619 (8%)
 Frame = -2

Query  2452  RSIPAEPTFPIYLKFTEVSYKIVIKGVTFSE-EKDILNGISGAVDPGEVLALMGPSGCGK  2276
             + I  EPT PI LKF +V YK+ + G   S+ EK IL+G++G+V PGEVLALMGPSG GK
Sbjct  182   KKIQIEPTLPICLKFQDVRYKVALNGRRSSDAEKYILHGVTGSVHPGEVLALMGPSGGGK  241

Query  2275  TTLLSLLGGRIR-DPSAGSITYNQHPYSKLLKSRIGFVTQDDILFPHLTVKETLIYAARL  2099
             TTLL+LL GR++ D  + SITYN  PYSK LK RIGFV QDD+ FPHLTVKETL YAA L
Sbjct  242   TTLLNLLSGRVKTDDVSCSITYNDQPYSKSLKRRIGFVMQDDVAFPHLTVKETLTYAALL  301

Query  2098  RLPRTLTKEEKDKRAMDVIYELGLDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSL  1919
             RLP TLTK++K++RAM+VI EL L+RCQ+T+IGGSFVRG+SGGERKRVCIGNEI++NPSL
Sbjct  302   RLPNTLTKQQKEERAMNVISELDLERCQNTIIGGSFVRGISGGERKRVCIGNEILLNPSL  361

Query  1918  LFLDEPTSGLDSTTALRIVDILHEIAKAGKTVITTIHQPSSRLFHkfdklilleflldL-  1742
             LFLDEPTSGLDSTTALRIV +LH IAKAGKTV+TTIHQPSSRLF+KFDKLILL     L 
Sbjct  362   LFLDEPTSGLDSTTALRIVQMLHNIAKAGKTVVTTIHQPSSRLFNKFDKLILLSRGNSLY  421

Query  1741  -------------------------------ANGNINDVSIPSELADKVQTWNSKEEPTR  1655
                                            ANGNIND SIPS L DK+      + P +
Sbjct  422   FGKASEAMLYFSSIGCSPLIVMNPAEFLIDLANGNINDKSIPSVLEDKILL--GSQFPEK  479

Query  1654  NNGKPSPAIVHEYLVGCYETRVAETEKKKLMAPLPVEEELKSKVRYLKREWGASWSEQYV  1475
              +G+PSP  VHEYLVG YETRVA  EK+KL+ P+ V+ E + +      +WGASW EQY 
Sbjct  480   QDGRPSPVDVHEYLVGAYETRVANIEKQKLLKPVMVDSESEIQGMSHSIDWGASWWEQYS  539

Query  1474  LLFHRGIRERWHDYFSWLRITQVIATALILGMLWWQSGGDTPSQMQDQAGLLFFIAVFWG  1295
             +LF RG++ER H+Y S LR+TQV++TA+I+G+LWW S   +P ++QDQAGLLFFI+VFWG
Sbjct  540   ILFRRGLKERRHEYLSCLRVTQVVSTAIIIGLLWWHSDASSPKRLQDQAGLLFFISVFWG  599

Query  1294  FFPVFTAIFTFPQEKAMLSKERAADMYRLSAYFAARTTSdlpldlllpliflLVVYFMAG  1115
             FFPVFTAIFTFPQE+AML+KERA  MY+LSAYF AR  SDLPLDL+LP++FL++VYFM G
Sbjct  600   FFPVFTAIFTFPQERAMLAKERAVGMYKLSAYFIARNASDLPLDLILPIVFLVIVYFMVG  659

Query  1114  LKQDASSFLLTAVTVFLCIVVAQGLGLAIGATLMDLKKATTLASVTVMTFMLAGGYFIKK  935
             LKQ  S+F L+ +T+FL IV AQGLGLAIGA  MD+KKATTLASV VMTFMLAGG+F+ +
Sbjct  660   LKQTFSAFSLSMLTLFLTIVSAQGLGLAIGAAFMDVKKATTLASVLVMTFMLAGGFFV-Q  718

Query  934   VPGFIVWLRDLSFNYHTFKLLLKVQYE-----HKTNS-----VNGVQIDSGIKEVGALAA  785
             VP F+ W+R +S NYHT++LLLK+QY      H + +     + G++ID G KE GA+  
Sbjct  719   VPSFMSWIRYISINYHTYRLLLKIQYSCSGSGHGSAACDSPFIKGLKIDDGGKEAGAMIT  778

Query  784   MAVSYRLLAYISLRRMKLQ  728
             M   YRLLAY+ LR +KL+
Sbjct  779   MIFGYRLLAYLFLRGIKLR  797



>ref|XP_006381927.1| hypothetical protein POPTR_0006s21400g [Populus trichocarpa]
 gb|ERP59724.1| hypothetical protein POPTR_0006s21400g [Populus trichocarpa]
Length=538

 Score =   695 bits (1793),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/512 (73%), Positives = 425/512 (83%), Gaps = 35/512 (7%)
 Frame = -2

Query  2374  VTFSEEKDILNGISGAVDPGEVLALMGPSGCGKTTLLSLLGGRIRDPS-AGSITYNQHPY  2198
             +T +EEKDILNGISG+VDPGEVLALMGPSG GKTTLL+LLGGR+  P+  GSITYN  PY
Sbjct  1     MTSTEEKDILNGISGSVDPGEVLALMGPSGSGKTTLLNLLGGRLNQPTVGGSITYNDGPY  60

Query  2197  SKLLKSRIGFVTQDDILFPHLTVKETLIYAARLRLPRTLTKEEKDKRAMDVIYELGLDRC  2018
             SK LKSRIGFVTQDDILFPHLTVKETL YAA LRLP+TLTK++K KRAMDVIYELGL+RC
Sbjct  61    SKFLKSRIGFVTQDDILFPHLTVKETLTYAALLRLPKTLTKQQKQKRAMDVIYELGLERC  120

Query  2017  QDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILHEIAK  1838
             QDT+IGGSFVRGVSGGERKRVCIGNEIIINPS+LFLDEPTSGLDSTTAL+ V +L ++A+
Sbjct  121   QDTVIGGSFVRGVSGGERKRVCIGNEIIINPSILFLDEPTSGLDSTTALKTVQLLQDMAE  180

Query  1837  AGKTVITTIHQPSSRLFHk--------------------------------fdklillef  1754
              GKTV+TTIHQPSSRLFHK                                   +   EF
Sbjct  181   GGKTVVTTIHQPSSRLFHKFDKLILLGKGSLLYFGKSSEAMLYFSSIGCNPLIAMNPAEF  240

Query  1753  lldLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYETRVAETEK  1574
             LLDLANGNINDVS+PSEL DKVQ  NS  +  + NGKPSPA+VHEYLV  YETRVA  EK
Sbjct  241   LLDLANGNINDVSVPSELDDKVQIVNS--DAGKRNGKPSPAVVHEYLVEAYETRVAVKEK  298

Query  1573  KKLMAPLPVEEELKSKVRYLKREWGASWSEQYVLLFHRGIRERWHDYFSWLRITQVIATA  1394
             KKLM P+P++EE+K+KV  LKR+WGASW +QY +LF RGI+ER HDYFSWLRITQV++TA
Sbjct  299   KKLMVPIPLDEEVKAKVSSLKRQWGASWWQQYTILFCRGIKERRHDYFSWLRITQVLSTA  358

Query  1393  LILGMLWWQSGGDTPSQMQDQAGLLFFIAVFWGFFPVFTAIFTFPQEKAMLSKERAADMY  1214
             +ILG+LWW S  ++   +QDQAGLLFFIAVFWGFFPVFTAIFTFPQE+AMLSKERAADMY
Sbjct  359   IILGLLWWNSDTNSLKGLQDQAGLLFFIAVFWGFFPVFTAIFTFPQERAMLSKERAADMY  418

Query  1213  RLSAYFAARTTSdlpldlllpliflLVVYFMAGLKQDASSFLLTAVTVFLCIVVAQGLGL  1034
             RLSAYF ARTTSDLPLDL+LP++FLLVVYFMAGL+  A+ F LT +TVFL I+ AQGLGL
Sbjct  419   RLSAYFLARTTSDLPLDLVLPVLFLLVVYFMAGLRMSAAPFFLTMLTVFLSIIAAQGLGL  478

Query  1033  AIGATLMDLKKATTLASVTVMTFMLAGGYFIK  938
             AIGATLMDLK+ATTLASVTVMTFMLAGGYF+K
Sbjct  479   AIGATLMDLKRATTLASVTVMTFMLAGGYFVK  510



>emb|CBI35490.3| unnamed protein product [Vitis vinifera]
Length=776

 Score =   701 bits (1809),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/650 (58%), Positives = 473/650 (73%), Gaps = 60/650 (9%)
 Frame = -2

Query  2533  RPDESADSKPFSDDENPEDLEAGTKKKRSIPAEPTFPIYLKFTEVSYKIVIKGVTFSEEK  2354
             R  +SA  +  S  E  +D   G +K  S   +PT PIYLKF +V YK+V KG   S+EK
Sbjct  136   RQKDSATRQSRSAHEKDQD-SCGWRKTNS---KPTLPIYLKFEDVKYKVVTKGGKSSDEK  191

Query  2353  DILNGISGAVDPGEVLALMGPSGCGKTTLLSLLGGRIRDPSAGSITYNQHPYSKLLK-SR  2177
              IL+GI+G+VDPGEVLALMGPSG GKTTLL+LL G+++  S G ITYN  PY+K LK SR
Sbjct  192   HILHGITGSVDPGEVLALMGPSGGGKTTLLNLLSGKVKTNS-GRITYNDQPYAKTLKHSR  250

Query  2176  IGFVTQDDILFPHLTVKETLIYAARLRLPRTLTKEEKDKRAMDVIYELGLDRCQDTMIGG  1997
             IGFV QDDI+FPHLTVKETL YAA LRLP TLT+++K +R MD+I EL L+RCQ+T+IGG
Sbjct  251   IGFVLQDDIVFPHLTVKETLTYAALLRLPNTLTRQQKKERVMDIISELDLERCQNTIIGG  310

Query  1996  SFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILHEIAKAGKTVIT  1817
             + VRG+SGGERKRVCIGNEI++NPSLLFLDEPTSGLDSTTALRI+ +L   A+AGKTV+T
Sbjct  311   ALVRGISGGERKRVCIGNEILLNPSLLFLDEPTSGLDSTTALRILQMLQNTAEAGKTVVT  370

Query  1816  TIHQPSSRLFHk--------------------------------fdklilleflldLANG  1733
             TIHQPSSRLF                                   + +   EFL+DLANG
Sbjct  371   TIHQPSSRLFSMFDKLVLLGKGNSLYFGKASEAMLYFSSIGCSPLEAMNPAEFLIDLANG  430

Query  1732  NINDVSIPSELADKVQTWNSKEEPTRNN-----GKPSPAIVHEYLVGCYETRVAETEKKK  1568
             NI++ S+PSEL DK         P R N     GKPSP  VHEYLVG YE RVA  EK K
Sbjct  431   NISNKSVPSELEDKYS-------PGRQNFENEEGKPSPGEVHEYLVGAYEERVANLEKMK  483

Query  1567  LMAPLPVEEELKSKVRYLKREWGASWSEQYVLLFHRGIRERWHDYFSWLRITQVIATALI  1388
             L++P+ ++   + + R    EWGA+W +Q+ +LF RG++ER H+Y + LRITQVI+TA+I
Sbjct  484   LLSPVLIDSVSEMQRRENSPEWGANWWQQFSILFRRGLKERRHEYLNGLRITQVISTAVI  543

Query  1387  LGMLWWQSGGDTPSQMQDQAGLLFFIAVFWGFFPVFTAIFTFPQEKAMLSKERAADMYRL  1208
             LG+LWW S   +P ++QDQA LLFFI+VFWGF P+FTAIFTFPQE+AML KER+ DMYRL
Sbjct  544   LGLLWWHSDASSPKKLQDQARLLFFISVFWGFLPLFTAIFTFPQERAMLVKERSVDMYRL  603

Query  1207  SAYFAARTTSdlpldlllpliflLVVYFMAGLKQDASSFLLTAVTVFLCIVVAQGLGLAI  1028
             SAYF AR TSDLPLDL+LP++F+L+VYFMAGLK   ++F LT +TVFL I+ +QGLG+ I
Sbjct  604   SAYFVARNTSDLPLDLILPILFMLIVYFMAGLKPSFAAFSLTMLTVFLSILASQGLGMTI  663

Query  1027  GATLMDLKKATTLASVTVMTFMLAGGYFIKKVPGFIVWLRDLSFNYHTFKLLLKVQY---  857
             GA LMD+KKATTLAS+T+MTFML+GG+FI++ P FI W R +SFNYHT++LLLK+QY   
Sbjct  664   GAALMDVKKATTLASITLMTFMLSGGFFIQEFPSFISWARHISFNYHTYRLLLKIQYSCS  723

Query  856   -----EHKTNS--VNGVQIDSGIKEVGALAAMAVSYRLLAYISLRRMKLQ  728
                  E   NS  + G++++    E+GA+ AM + YRLLAYI LRRMKL+
Sbjct  724   NSNYEEGPCNSPFIRGLKLNRSGMELGAMVAMCIGYRLLAYIFLRRMKLR  773



>ref|XP_010653239.1| PREDICTED: ABC transporter G family member 22 isoform X2 [Vitis 
vinifera]
Length=668

 Score =   692 bits (1785),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/597 (68%), Positives = 466/597 (78%), Gaps = 44/597 (7%)
 Frame = -2

Query  2878  MEQTNSTS-LLRTKSDQLVEaiaaakgsarARLPRLSAEFAGSGVPESVRMLSRKPSRRL  2702
             ME+ NS+S ++RTKSDQLVE   A   +      R       +G  ES   LSRK SRR 
Sbjct  1     MERPNSSSGIMRTKSDQLVETAEAVAAAM-----RSPTSGEATGGAESGGTLSRKSSRRS  55

Query  2701  MppspggggsgGTNSTHIRKSRSAQMKLDLDElssgsvlsrassasl--GFSFTGFSVRP  2528
             M  +  G   G + +THIRKSRSAQ+KLDLDE+SSG+ LSRASSASL   FSFTGF+V P
Sbjct  56    MMSASPGRAGGNSKNTHIRKSRSAQIKLDLDEVSSGAALSRASSASLGFSFSFTGFTVPP  115

Query  2527  DESADSKPFSDDENPEDLEAGTKKKRSIPAEPTFPIYLKFTEVSYKIVIKGVTFSEEKDI  2348
             DE +D KPFSDD+ P+DLEAG +K+R I AEPT PIYLKF +V+YK+++KG+  + EK+I
Sbjct  116   DEISDFKPFSDDDTPDDLEAGMRKQR-IQAEPTLPIYLKFKDVTYKVILKGMRTNVEKEI  174

Query  2347  LNGISGAVDPGEVLALMGPSGCGKTTLLSLLGGRIRDPSAG-SITYNQHPYSKLLKSRIG  2171
             LNGI+G+V+PGEVLALMGPSG GKTTLL+LLGGR+  P+AG S+TYN  PYSK LKS+IG
Sbjct  175   LNGITGSVNPGEVLALMGPSGSGKTTLLNLLGGRLNQPTAGGSVTYNDQPYSKSLKSKIG  234

Query  2170  FVTQDDILFPHLTVKETLIYAARLRLPRTLTKEEKDKRAMDVIYELGLDRCQDTMIGGSF  1991
             FVTQDD+LFPHLTV+ETL YAARLRLP+TLTK++K+KRA+DVIYELGLDRCQDTMIGGSF
Sbjct  235   FVTQDDVLFPHLTVRETLTYAARLRLPKTLTKQQKEKRAVDVIYELGLDRCQDTMIGGSF  294

Query  1990  VRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILHEIAKAGKTVITTI  1811
             VRGVSGGERKRV IGNEIIINPSLLFLDEPTSGLDSTTALRIV +LH+IA+AGKTV+TTI
Sbjct  295   VRGVSGGERKRVSIGNEIIINPSLLFLDEPTSGLDSTTALRIVQMLHDIAEAGKTVLTTI  354

Query  1810  HQPSSRLFHk--------------------------------fdklilleflldLANGNI  1727
             HQPSSRLFHK                                   +   EFLLDLANGN+
Sbjct  355   HQPSSRLFHKFDKLILLGKGNLLYFGKASGTMEYFSSIGCSPLITMNPAEFLLDLANGNL  414

Query  1726  NDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYETRVAETEKKKLMAPLPV  1547
             NDVSIPSEL DKVQT +S+ E TR NGKPSPA VHEYLV  YETRVA+ EKKKLM P+P+
Sbjct  415   NDVSIPSELEDKVQTEHSETE-TR-NGKPSPADVHEYLVEAYETRVADQEKKKLMIPIPI  472

Query  1546  EEELKSKVRYLKREWGASWSEQYVLLFHRGIRERWHDYFSWLRITQVIATALILGMLWWQ  1367
             +EELKSKV   KREWGASW EQY +LF RG++ER HDYFSWLR+TQV +TA ILG+LWWQ
Sbjct  473   DEELKSKVCSPKREWGASWWEQYSILFRRGLKERRHDYFSWLRVTQVASTATILGLLWWQ  532

Query  1366  SGGDTPSQMQDQAGLLFFIAVFWGFFPVFTAIFTFPQEKAMLSKERAADMYRLSAYF  1196
             S    P  +QDQAGLLFFIAVFWGFFPVFTAIFTFPQE+AMLSKERAADM     +F
Sbjct  533   SESTNPKGLQDQAGLLFFIAVFWGFFPVFTAIFTFPQERAMLSKERAADMPENGCWF  589


 Score = 91.7 bits (226),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 42/86 (49%), Positives = 53/86 (62%), Gaps = 0/86 (0%)
 Frame = -1

Query  1115  AQTGCLFFLVNCSHCFPLYCSSSRIRISYWGHTNGFEEGNNSGLCYCHDLYVGWRILYKE  936
              + GC FF  N +H FPL+CS S    SYW HTNG +EGNN G   C DL+VGW I  +E
Sbjct  583   PENGCWFFFPNHAHSFPLHCSGSGTWASYWSHTNGLKEGNNFGFSNCDDLHVGWWIFCEE  642

Query  935   STRVHSMASGSFLQLSHIQTPLKGAI  858
             S+ +H M      QL H+QT  +GA+
Sbjct  643   SSNIHIMDPLHLFQLPHLQTSSQGAV  668



>gb|ABR17189.1| unknown [Picea sitchensis]
Length=819

 Score =   688 bits (1775),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/730 (54%), Positives = 496/730 (68%), Gaps = 94/730 (13%)
 Frame = -2

Query  2659  STHIRKSRSAQMKLDLD------ElssgsvlsrassaslGFSFTGFSVRPDESADSKPFS  2498
             S HI K +S Q++++ +      E  + S  S A+S  L FS  G  V P  + DS   +
Sbjct  97    SGHIPKWKSGQLRIEDELTNAFFEEVALSRASSATSHGLSFSIAGPVVAP--AGDSGLIN  154

Query  2497  D---------------DENPEDLEAGTKKKRSIPA-EPTFPIYLKFTEVSYKIVIKG---  2375
             D               +   +D+E        +P  +P  PI LKF EV YK++++G   
Sbjct  155   DLQEARLHASVALKKKETESKDVEMTVNLDSELPQRDPPLPICLKFLEVQYKVILQGKPT  214

Query  2374  ----VTFSE----EKDILNGISGAVDPGEVLALMGPSGCGKTTLLSLLGGRIRDPSAGSI  2219
                  +++E    EKDIL G+SG++ PGE+LA+MGPSG GKTTL++LLGGRI+   +GSI
Sbjct  215   SILTSSWTEPIFFEKDILYGVSGSIAPGEMLAMMGPSGSGKTTLINLLGGRIQQNVSGSI  274

Query  2218  TYNQHPYSKLLKSRIGFVTQDDILFPHLTVKETLIYAARLRLPRTLTKEEKDKRAMDVIY  2039
             TYN  PYSK LK RIGFVTQDD+LFPHLTV+ETL Y A LRLPRTLTK ++++RA +V+ 
Sbjct  275   TYNDQPYSKALKRRIGFVTQDDVLFPHLTVRETLTYTALLRLPRTLTKHQREQRAQEVVR  334

Query  2038  ELGLDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVD  1859
             ELGL+RCQDT+IGG+FVRG+SGGERKRVCIG EI+I+PSLLFLDEPTSGLDSTTALRIV 
Sbjct  335   ELGLERCQDTIIGGNFVRGISGGERKRVCIGCEILIDPSLLFLDEPTSGLDSTTALRIVQ  394

Query  1858  ILHEIAKAGKTVITTIHQPSSRLFHkf--------------------------------d  1775
             +LH+IA+AG+TV++TIHQPSSRLFHKF                                 
Sbjct  395   MLHDIARAGRTVVSTIHQPSSRLFHKFDKLILLGEGHSIYFGKASDAMEYFSSVGFSPFL  454

Query  1774  klilleflldLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAI-----VHEYLV  1610
              +   +FLLDLANGNI+D+S+P+EL +      S  E   N+G   P       V EYL+
Sbjct  455   AMNPADFLLDLANGNIHDISVPAELEN-----TSHAEAEDNHGDKFPRSLSSHDVLEYLI  509

Query  1609  GCYETRVAETEKKKLMAPLPVEEELKSKVRYLKREWGASWSEQYVLLFHRGIRERWHDYF  1430
               YET VA  EK KL+    V ++LKS V   KREWGA+W +Q+ +LF RG++ER H+Y 
Sbjct  510   EAYETNVAPMEKAKLITLNEVTDDLKSSVSA-KREWGATWWDQFSILFVRGLKERRHEYL  568

Query  1429  SWLRITQVIATALILGMLWWQSGGDTPSQMQDQAGLLFFIAVFWGFFPVFTAIFTFPQEK  1250
             S+LRI QV  TALILG+LWWQS  DTP  +QDQ GL+FFIAVFWGFFPVFTAIFTFPQE+
Sbjct  569   SFLRIAQVFLTALILGLLWWQSNIDTPKGLQDQIGLIFFIAVFWGFFPVFTAIFTFPQER  628

Query  1249  AMLSKERAADMYRLSAYFAARTTSdlpldlllpliflLVVYFMAGLKQDASSFLLTAVTV  1070
             AMLSKERA DMYRLSAYF AR  SDLPLDL LP+ FLL+VYFMA L+   ++FLLT +T 
Sbjct  629   AMLSKERAVDMYRLSAYFMARILSDLPLDLFLPIGFLLIVYFMAHLRMTVTAFLLTMLTT  688

Query  1069  FLCIVVAQGLGLAIGATLMDLKKATTLASVTVMTFMLAGGYFIKKVPGFIVWLRDLSFNY  890
             FL IV +QGLGLAIGA  MDLKKATTLASVT+M FMLAGG+F+++V  FI W+R LSFNY
Sbjct  689   FLSIVASQGLGLAIGAAFMDLKKATTLASVTMMAFMLAGGFFVQRVHPFIKWIRYLSFNY  748

Query  889   HTFKLLLKVQYEHK----------------TNSVNGVQIDSGIKEVGALAAMAVSYRLLA  758
             +T+K+LLK+QY+                  ++S+ G+ +D GIKE   +  M   YRLLA
Sbjct  749   YTYKILLKIQYDADQLYDCSSPSGCKSIATSSSLRGIPLDGGIKEATVMLIMVFGYRLLA  808

Query  757   YISLRRMKLQ  728
             Y SL RMKL+
Sbjct  809   YFSLLRMKLR  818



>ref|XP_010911944.1| PREDICTED: ABC transporter G family member 22-like, partial [Elaeis 
guineensis]
Length=653

 Score =   679 bits (1751),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/647 (56%), Positives = 469/647 (72%), Gaps = 56/647 (9%)
 Frame = -2

Query  2527  DESADSKPFSDDEN--PEDLEAGTKKKRSIPAEPTFPIYLKFTEVSYKIVIK-GVTFSEE  2357
             DE+ D  P S  +   PE  E        +  EPT PIYLKF++VSY+I++K G + S  
Sbjct  11    DEAVDESPISYKKGLVPEIWE-------QMQMEPTLPIYLKFSDVSYQILVKVGKSPSAT  63

Query  2356  KDILNGISGAVDPGEVLALMGPSGCGKTTLLSLLGGRIR-DPSAGSITYNQHPYSKLLKS  2180
             K IL G++G+V PGEVLALMGPSG GKTTLL+LL GR+      G ITYN  PYSK LK 
Sbjct  64    KYILKGVTGSVFPGEVLALMGPSGGGKTTLLNLLSGRVNIKGHGGIITYNDQPYSKWLKK  123

Query  2179  RIGFVTQDDILFPHLTVKETLIYAARLRLPRTLTKEEKDKRAMDVIYELGLDRCQDTMIG  2000
             RIGFV QDD++FPHLTV+ETL YAA LRLP+TLTK++K++RAM+VI ELGL+ CQD +IG
Sbjct  124   RIGFVLQDDVVFPHLTVRETLTYAALLRLPKTLTKQQKEERAMNVISELGLESCQDMIIG  183

Query  1999  GSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILHEIAKAGKTVI  1820
             G  VRG+SGGERKRVCIGNEI+++PSL+FLDEPTSGLDSTTALRI  +LH++A AGKTV+
Sbjct  184   GPLVRGISGGERKRVCIGNEILLDPSLIFLDEPTSGLDSTTALRITQMLHKMAHAGKTVV  243

Query  1819  TTIHQPSSRLFHk--------------------------------fdklilleflldLAN  1736
             TTIHQPSSRLF+K                                   +   EFL+DLAN
Sbjct  244   TTIHQPSSRLFNKFDKLILLGKGSSFYFGKASEAMLYFSSIGCSPLIAMNPAEFLIDLAN  303

Query  1735  GNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYETRVAETEKKKLMAP  1556
             GN+ND SIPSEL D     +  +E      +PSP  +HEYL+  YETRVA+ EK+KL+ P
Sbjct  304   GNMNDKSIPSELKDTF--LHGSQEFKHQEQRPSPVDIHEYLLDSYETRVAQIEKQKLLRP  361

Query  1555  LPVEEELKSKVRYLKREWGASWSEQYVLLFHRGIRERWHDYFSWLRITQVIATALILGML  1376
             +P++     +V    +  GA+W +QY +LF RG+++R HDY  W+R+TQV+ATA+I+G+L
Sbjct  362   VPIDTIRDMQVGSSLKNSGATWWQQYYILFWRGLKQRCHDYLCWIRVTQVLATAVIVGLL  421

Query  1375  WWQSGGDTPSQMQDQAGLLFFIAVFWGFFPVFTAIFTFPQEKAMLSKERAADMYRLSAYF  1196
             WW+    TP ++QDQAG+LFFI+VFWGFFPVFTAIFTF QE+A+L KE + +MY+LSAYF
Sbjct  422   WWRPDASTPKKIQDQAGVLFFISVFWGFFPVFTAIFTFSQERALLVKEMSVNMYKLSAYF  481

Query  1195  AARTTSdlpldlllpliflLVVYFMAGLKQDASSFLLTAVTVFLCIVVAQGLGLAIGATL  1016
              AR  SDLPLDL+LP++FLL+VYFM GLK D + FLL+ +T+ L I+ AQGLGLAIGA L
Sbjct  482   MARNMSDLPLDLILPIMFLLIVYFMVGLKPDFTVFLLSMLTIVLSIIAAQGLGLAIGAAL  541

Query  1015  MDLKKATTLASVTVMTFMLAGGYFIKKVPGFIVWLRDLSFNYHTFKLLLKVQY-----EH  851
             MD+KKATTLASV +MTFMLAGG+F+++VP F+ W+R LSFNYHT++LLLK+QY     ++
Sbjct  542   MDVKKATTLASVIIMTFMLAGGFFVQRVPFFMSWIRYLSFNYHTYRLLLKIQYSCSSLDN  601

Query  850   KTNS------VNGVQIDSGIKEVGALAAMAVSYRLLAYISLRRMKLQ  728
               NS      + G+++ +G  E GA+ AM   YRLLAYI L++M+L+
Sbjct  602   SGNSPCNSTFIKGLRLHNGGMEAGAMIAMIFGYRLLAYIFLKKMRLR  648



>gb|EMT07325.1| ABC transporter G family member 22 [Aegilops tauschii]
Length=607

 Score =   671 bits (1730),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/517 (68%), Positives = 410/517 (79%), Gaps = 35/517 (7%)
 Frame = -2

Query  2179  RIGFVTQDDILFPHLTVKETLIYAARLRLPRTLTKEEKDKRAMDVIYELGLDRCQDTMIG  2000
             +IGFVTQDD+LF HLTVKETL YAA LRLPRT+T+E+K +RAMD+IYELGL+RCQDTMIG
Sbjct  87    KIGFVTQDDVLFTHLTVKETLTYAALLRLPRTMTREQKKERAMDIIYELGLERCQDTMIG  146

Query  1999  GSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILHEIAKAGKTVI  1820
             GSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIV +LH+IA+ GKTVI
Sbjct  147   GSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVQLLHDIAETGKTVI  206

Query  1819  TTIHQPSSRLFHk--------------------------------fdklilleflldLAN  1736
             TTIHQPSSRLFHK                                   +   EFLLDLAN
Sbjct  207   TTIHQPSSRLFHKFDKLILLGRGSLLYFGKTAEAMPYFSSIGCNPLIAMNPAEFLLDLAN  266

Query  1735  GNINDVSIPSELADKVQTWNSKEEPTRN--NGKPSPAIVHEYLVGCYETRVAETEKKKLM  1562
             GN NDVS+PSEL DKV   N   + T +  N +PS   VHEYLV  YE RVA  EKKKL+
Sbjct  267   GNTNDVSVPSELDDKVHMENQNLQDTNSKINLRPSAQDVHEYLVDAYEHRVAYKEKKKLL  326

Query  1561  APLPVEEELKSKVRYLKREWGASWSEQYVLLFHRGIRERWHDYFSWLRITQVIATALILG  1382
             APLP+ +++K+ +   KREWG +W +QY +LF RG++ER HDY SW+RITQVIAT++ILG
Sbjct  327   APLPISDDMKATITSSKREWGTNWCQQYSILFCRGLKERRHDYLSWMRITQVIATSIILG  386

Query  1381  MLWWQSGGDTPSQMQDQAGLLFFIAVFWGFFPVFTAIFTFPQEKAMLSKERAADMYRLSA  1202
             +LWW S   TP  +QDQAGLLFFIAVFWGFFPVFTAIFTFPQE+AML+KERAADMY+LSA
Sbjct  387   LLWWHSDPTTPKGLQDQAGLLFFIAVFWGFFPVFTAIFTFPQERAMLNKERAADMYKLSA  446

Query  1201  YFAARTTSdlpldlllpliflLVVYFMAGLKQDASSFLLTAVTVFLCIVVAQGLGLAIGA  1022
             YF ARTTSDLPLDL LP+IF+++VYFMAGLK  A  F L+ +TVFL I+ AQGLGLAIGA
Sbjct  447   YFLARTTSDLPLDLFLPVIFMVIVYFMAGLKASAMRFFLSMLTVFLSIIAAQGLGLAIGA  506

Query  1021  TLMDLKKATTLASVTVMTFMLAGGYFIKKVPGFIVWLRDLSFNYHTFKLLLKVQYEHKTN  842
             TL+D+KKATTLASVTVMTFMLAGG+F+K+VP FI WLR LSFNYHT++LLLKVQY+   +
Sbjct  507   TLLDIKKATTLASVTVMTFMLAGGFFVKRVPPFISWLRYLSFNYHTYRLLLKVQYDPVPD  566

Query  841   SV-NGVQIDSGIKEVGALAAMAVSYRLLAYISLRRMK  734
              +   V +D+G+ EVGAL AM + YR+LAY+SLRR+K
Sbjct  567   ILMTSVPLDNGVTEVGALVAMIIGYRVLAYLSLRRVK  603



>ref|XP_009799080.1| PREDICTED: ABC transporter G family member 22-like isoform X1 
[Nicotiana sylvestris]
 ref|XP_009799081.1| PREDICTED: ABC transporter G family member 22-like isoform X1 
[Nicotiana sylvestris]
Length=766

 Score =   672 bits (1733),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/611 (60%), Positives = 452/611 (74%), Gaps = 41/611 (7%)
 Frame = -2

Query  2452  RSIPAEPTFPIYLKFTEVSYKIVIKGVTFSE-EKDILNGISGAVDPGEVLALMGPSGCGK  2276
             R I  E T  I LKF +V Y + +KG   S+ EK IL G+SG+  PGEVLALMGPSG GK
Sbjct  158   RRIQIETTLRIRLKFQDVKYTVALKGEKHSDAEKCILQGVSGSACPGEVLALMGPSGGGK  217

Query  2275  TTLLSLLGGRIRDPSAGSITYNQHPYSKLLKSRIGFVTQDDILFPHLTVKETLIYAARLR  2096
             TTLL LL G++++ S G ITYN  PY+K LK RIGFV QDD++FPHLTVKETLIYAA LR
Sbjct  218   TTLLKLLSGKVKNDS-GMITYNDQPYNKSLKQRIGFVMQDDVVFPHLTVKETLIYAALLR  276

Query  2095  LPRTLTKEEKDKRAMDVIYELGLDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLL  1916
             LP TL+KE+K +RA++VI ELGL+RCQDT+IGG+FVRG+SGGERKRVCIGNEI++NPSLL
Sbjct  277   LPNTLSKEQKKERAINVINELGLERCQDTIIGGTFVRGISGGERKRVCIGNEILLNPSLL  336

Query  1915  FLDEPTSGLDSTTALRIVDILHEIAKAGKTVITTIHQPSSRLFHk---------------  1781
             FLDEPTSGLDSTTALRIV +LH IA+AGKTV+TTIHQPSSRLF +               
Sbjct  337   FLDEPTSGLDSTTALRIVQMLHNIARAGKTVVTTIHQPSSRLFSRFDRLILLGQGCSLYS  396

Query  1780  -----------------fdklilleflldLANGNINDVSIPSELADKVQTWNSKEEPTRN  1652
                                 +   EFL+DLANGNI D SIPS+L +K    N   + ++N
Sbjct  397   GKASEAMLYFSTIGCSPLIAMNPAEFLIDLANGNIKDKSIPSDLENKFLPGNHHFK-SKN  455

Query  1651  NGKPSPAIVHEYLVGCYETRVAETEKKKLMAPLPVEEELKSKVRYLK--REWGASWSEQY  1478
              G PS A VHEY VG YE+R A  EK KL+    +EE+  S+V+ L   R+ GA+W++Q+
Sbjct  456   EG-PSSADVHEYFVGAYESRFANEEKIKLLNHRLIEED--SEVQSLPNLRDSGATWNQQF  512

Query  1477  VLLFHRGIRERWHDYFSWLRITQVIATALILGMLWWQSGGDTPSQMQDQAGLLFFIAVFW  1298
              +LF RGI+ER H+YFS LRI QVIATA+I+G+LWW S   +P +M DQAGLLFFI+VFW
Sbjct  513   SILFTRGIKERSHEYFSSLRIIQVIATAIIVGLLWWHSDTSSPKKMADQAGLLFFISVFW  572

Query  1297  GFFPVFTAIFTFPQEKAMLSKERAADMYRLSAYFAARTTSdlpldlllpliflLVVYFMA  1118
              FFP+FTAIFTFPQE+AML KER+ +MY+LSAYF AR T+DL LDL+LP+IFL++VYFM 
Sbjct  573   AFFPLFTAIFTFPQERAMLVKERSVNMYKLSAYFIARVTTDLLLDLVLPVIFLVIVYFMV  632

Query  1117  GLKQDASSFLLTAVTVFLCIVVAQGLGLAIGATLMDLKKATTLASVTVMTFMLAGGYFIK  938
             GLK    +F LT VTV L I+ AQGLGLAIGA  MD+KKATT ASVT+MTFML+GG+F+K
Sbjct  633   GLKLTFPAFSLTLVTVLLSIIAAQGLGLAIGAAFMDVKKATTFASVTLMTFMLSGGFFVK  692

Query  937   KVPGFIVWLRDLSFNYHTFKLLLKVQYEHKTNSVNG-VQIDSGIKEVGALAAMAVSYRLL  761
             +VP FI W+R +S NYHT++LLLK+QY     S  G V  +SG  EVGA+  M + YRLL
Sbjct  693   EVPRFISWVRYISINYHTYRLLLKIQYNSLGCSTYGSVVPESGGVEVGAMLVMIIGYRLL  752

Query  760   AYISLRRMKLQ  728
             AY  L++MKL+
Sbjct  753   AYFLLKKMKLR  763



>gb|AAM51832.1|AC105730_6 Putative ABC transporter [Oryza sativa Japonica Group]
Length=695

 Score =   665 bits (1717),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/577 (62%), Positives = 432/577 (75%), Gaps = 46/577 (8%)
 Frame = -2

Query  2653  HIRKSRSAQMKLDLDElssgsvlsrassasl---GFSFTGFSVRPDE---SADSKPFSDD  2492
             HIRKSRSAQ+KL++++L S       +S++     F+FTGF+  P +   SA+  PFSDD
Sbjct  87    HIRKSRSAQLKLEMEDLVSSGAALSRASSASLGFSFTFTGFTPPPQDTMSSAELHPFSDD  146

Query  2491  ENPEDLEAGTKKKRSIPAEPTFPIYLKFTEVSYKIVIKGVTFSEEKDILNGISGAVDPGE  2312
             +N  D+EAGT +K+ +  EPT PIYLKF EV YK+ +KG      ++IL+GISG+  PGE
Sbjct  147   DNTMDIEAGTPRKK-LMTEPTLPIYLKFAEVKYKVAVKGT----PREILSGISGSAAPGE  201

Query  2311  VLALMGPSGCGKTTLLSLLGGRIRDPS--AGSITYNQHPYSKLLKSRIGFVTQDDILFPH  2138
             VLALMGPSG GKTTLLS+LGGR+  P    G ++YN  PY K L  RIGFVTQDD+LF H
Sbjct  202   VLALMGPSGSGKTTLLSILGGRVAGPGDVEGCVSYNDEPYCKSLNRRIGFVTQDDVLFTH  261

Query  2137  LTVKETLIYAARLRLPRTLTKEEKDKRAMDVIYELGLDRCQDTMIGGSFVRGVSGGERKR  1958
             LTVKETL YAA LRLPRT+T++EK++R +D+IYELGL+RCQDTMIGGSFVRGVSGGERKR
Sbjct  262   LTVKETLTYAALLRLPRTMTRQEKEERTIDIIYELGLERCQDTMIGGSFVRGVSGGERKR  321

Query  1957  VCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILHEIAKAGKTVITTIHQPSSRLFHk-  1781
             VCIGNEIIINPSLLFLDEPTSGLDSTTALRI+ +LH+IA+ GKTVITTIHQPSSRLFHK 
Sbjct  322   VCIGNEIIINPSLLFLDEPTSGLDSTTALRIIQLLHDIAEDGKTVITTIHQPSSRLFHKF  381

Query  1780  -------------------------------fdklilleflldLANGNINDVSIPSELAD  1694
                                               +   EFLLDLANGN  DVS+PSEL D
Sbjct  382   DKLILLGRGSLLYFGKASEAMPYFQSIGCTPLIAMNPAEFLLDLANGNTTDVSVPSELDD  441

Query  1693  KVQTWNSK-EEPTRNNGKPSPAIVHEYLVGCYETRVAETEKKKLMAPLPVEEELKSKVRY  1517
             KV   N   +  T+N+ KPS   VHEYLV  YE RVA   KK+L+ PLP+ +++K+ +  
Sbjct  442   KVHMENQNLQTNTKNDYKPSAQDVHEYLVDAYENRVAYKAKKQLLDPLPISDDMKTTITS  501

Query  1516  LKREWGASWSEQYVLLFHRGIRERWHDYFSWLRITQVIATALILGMLWWQSGGDTPSQMQ  1337
              KREWG SW +QY +LF RGI+ER HDY SW+RITQVIAT++ILG+LWW S   TP  +Q
Sbjct  502   SKREWGTSWWQQYSILFCRGIKERRHDYLSWMRITQVIATSVILGLLWWHSDPSTPKGLQ  561

Query  1336  DQAGLLFFIAVFWGFFPVFTAIFTFPQEKAMLSKERAADMYRLSAYFAARTTSdlpldll  1157
             DQAGLLFFIAVFWGFFPVFTAIFTFPQE+AML+KERAADMY+LSAYF ARTTSDLPLDL 
Sbjct  562   DQAGLLFFIAVFWGFFPVFTAIFTFPQERAMLNKERAADMYKLSAYFLARTTSDLPLDLF  621

Query  1156  lpliflLVVYFMAGLKQDASSFLLTAVTVFLCIVVAQ  1046
             LP+IF+++VYFMAGLK  A+ F L+ +TVFL I+ AQ
Sbjct  622   LPVIFMVIVYFMAGLKATAAHFFLSMLTVFLSIIAAQ  658



>ref|XP_002526137.1| ATP-binding cassette transporter, putative [Ricinus communis]
 gb|EEF36213.1| ATP-binding cassette transporter, putative [Ricinus communis]
Length=675

 Score =   664 bits (1712),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/599 (59%), Positives = 444/599 (74%), Gaps = 29/599 (5%)
 Frame = -2

Query  2494  DENP-EDLEAGTKKKRSIPAEPTFPIYLKFTEVSYKIVIKGVTFSEEKDILNGISGAVDP  2318
             D++P ED     +KK  I  EPT PI LKF +V YK        + EK ILNGISG+ +P
Sbjct  93    DQSPSEDPVFCLQKKMQI--EPTLPIALKFQDVKYKA-------NAEKHILNGISGSANP  143

Query  2317  GEVLALMGPSGCGKTTLLSLLGGRIRDPSAGSITYNQHPYSKLLKSRIGFVTQDDILFPH  2138
             GEVLALMGPSG GKTTLL+LL GRI + + G+ITYN  PY+K LK R GFVTQDD++F H
Sbjct  144   GEVLALMGPSGSGKTTLLNLLSGRI-NFNGGAITYNCRPYTKSLKRRFGFVTQDDVVFSH  202

Query  2137  LTVKETLIYAARLRLPRTLTKEEKDKRAMDVIYELGLDRCQDTMIGGSFVRGVSGGERKR  1958
             LTVKETL YAA LRLP+ LT+E+K +RAM+VI EL L+R QDT IGG FVRG+SGGERKR
Sbjct  203   LTVKETLTYAALLRLPKNLTREQKKERAMNVISELDLERSQDTAIGGKFVRGISGGERKR  262

Query  1957  VCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILHEIAKAGKTVITTIHQPSSRLFHkf  1778
             VCIG+EI++NPSLLFLDEPTSGLDSTTALRIV IL  +AK GKTV+TTIHQPSS      
Sbjct  263   VCIGHEILLNPSLLFLDEPTSGLDSTTALRIVQILQNMAKDGKTVVTTIHQPSSSC---S  319

Query  1777  dklilleflldLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYE  1598
               +   EFL+DLANGN+N+ S P EL DK    N   +     G PSPA VHEYL+  YE
Sbjct  320   VTMNPAEFLIDLANGNVNEKSFPLELEDKFFLENKTTK-----GLPSPADVHEYLLEAYE  374

Query  1597  TRVAETEKKKLMAPLPVEEELKSKVRYLKREWGASWSEQYVLLFHRGIRERWHDYFSWLR  1418
              +VA  EK K + P  ++ E++   +    EWG +W EQ+ +L  R  +ER H+YFS++R
Sbjct  375   AKVARMEKTKFIRPAAIDGEVQIVGKLNPWEWGTTWLEQFFVLVSRSFKERRHEYFSFMR  434

Query  1417  ITQVIATALILGMLWWQSGGDTPSQMQDQAGLLFFIAVFWGFFPVFTAIFTFPQEKAMLS  1238
             +TQV+ATA+I+G+LWW+S   +P  ++DQAGLLFFI+VFWGFFP+FTAIFTFPQE+AML+
Sbjct  435   VTQVVATAIIIGLLWWRSDASSPQDLEDQAGLLFFISVFWGFFPLFTAIFTFPQERAMLA  494

Query  1237  KERAADMYRLSAYFAARTTSdlpldlllpliflLVVYFMAGLKQDASSFLLTAVTVFLCI  1058
             KERA  MYRLSAYFAAR  SDLPLDL++P +F+L+VYFM GLK   ++F LT +TVFL I
Sbjct  495   KERAVGMYRLSAYFAARNISDLPLDLIMPTVFMLIVYFMVGLKMSFTAFSLTTLTVFLSI  554

Query  1057  VVAQGLGLAIGATLMDLKKATTLASVTVMTFMLAGGYFIKKVPGFIVWLRDLSFNYHTFK  878
             V +QGLGL IGA  MD+KKA+TLAS+ +MTFML+GG+F++ VP F+ W+R +SFNYHT++
Sbjct  555   VASQGLGLTIGAAFMDVKKASTLASIIIMTFMLSGGFFLQDVPSFMSWIRYVSFNYHTYR  614

Query  877   LLLKVQYEHKTNS----------VNGVQIDSGIKEVGALAAMAVSYRLLAYISLRRMKL  731
             LLLK+QY    +S          +  +++  G KEV A+  M V+YRLLAY+ LR++ L
Sbjct  615   LLLKIQYSFLDSSPGLSSPQSPLITDLRLVHGRKEVAAMMVMIVAYRLLAYLFLRKISL  673



>ref|XP_011101660.1| PREDICTED: ABC transporter G family member 22-like [Sesamum indicum]
 ref|XP_011101668.1| PREDICTED: ABC transporter G family member 22-like [Sesamum indicum]
Length=768

 Score =   660 bits (1702),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/618 (58%), Positives = 438/618 (71%), Gaps = 51/618 (8%)
 Frame = -2

Query  2452  RSIPAEPTFPIYLKFTEVSYKIVIKGVTFSE-EKDILNGISGAVDPGEVLALMGPSGCGK  2276
             R I  EP F IYLKF +V++K+ +KG   S  EK IL G+SG+V PGEVLALMGPSG GK
Sbjct  156   RKIQIEPPFRIYLKFEDVNHKVKLKGNRNSGVEKSILQGVSGSVCPGEVLALMGPSGGGK  215

Query  2275  TTLLSLLGGRIRDPSAGSITYNQHPYSKLLKSRIGFVTQDDILFPHLTVKETLIYAARLR  2096
             TTLL++L GR+++ S G+ITYN   Y+  LK RIGFV QDDI FPHLTV+ETL Y+A LR
Sbjct  216   TTLLNVLSGRVKN-SGGTITYNDQLYTTSLKHRIGFVLQDDIAFPHLTVRETLTYSALLR  274

Query  2095  LPRTLTKEEKDKRAMDVIYELGLDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLL  1916
             LP TL++E+K  RAM VI ELGL+RCQ+TMIGG+FVRGVSGGERKRVCIGNEI++NPSLL
Sbjct  275   LPNTLSREQKKARAMSVISELGLERCQNTMIGGTFVRGVSGGERKRVCIGNEILLNPSLL  334

Query  1915  FLDEPTSGLDSTTALRIVDILHEIAKAGKTVITTIHQPSSRLFHk---------------  1781
             FLDEPTSGLDSTTALRI+ +L  IA+AGKTV+TTIHQPSSRLF K               
Sbjct  335   FLDEPTSGLDSTTALRIIQMLRNIAQAGKTVVTTIHQPSSRLFSKFDKLILLSNGCSLYF  394

Query  1780  -----------------fdklilleflldLANGNINDVSIPSELADKVQTWNSKEEPTRN  1652
                                 +   EFL+DLANGNI D SIPSEL DK        E    
Sbjct  395   GKASEAMLYFSSIGCSPLTAMTPAEFLIDLANGNIKDKSIPSELEDKFLPGGECFEC--K  452

Query  1651  NGKPSPAIVHEYLVGCYETRVAETEKKKLMAPLPVEEELKSKVRYLKREWGASWSEQYVL  1472
             +G PSP  VHEYL+G YE R +  EK ++  P+ + +  +S       EWGA+WS Q+ +
Sbjct  453   DGGPSPVDVHEYLLGAYELRASNMEKIRIGRPVIITQNRRSA-----EEWGATWSAQFSI  507

Query  1471  LFHRGIRERWHDYFSWLRITQVIATALILGMLWWQSGGDTPSQMQDQAGLLFFIAVFWGF  1292
             LF RG++ER H+Y S +R+ QVI+TA+I+G+LWW S   +  ++QDQAGLLFFI+VFW F
Sbjct  508   LFQRGLKERRHEYLSTVRVVQVISTAVIVGLLWWNSDASSTMRVQDQAGLLFFISVFWAF  567

Query  1291  FPVFTAIFTFPQEKAMLSKERAADMYRLSAYFAARTTSdlpldlllpliflLVVYFMAGL  1112
             FPVFTAIFTFPQE+ ML+KER+  MY+LSAY  AR TSDLPLDLLLP++FL ++YFM GL
Sbjct  568   FPVFTAIFTFPQERTMLAKERSVGMYKLSAYLIARNTSDLPLDLLLPIVFLTIIYFMVGL  627

Query  1111  KQDASSFLLTAVTVFLCIVVAQGLGLAIGATLMDLKKATTLASVTVMTFMLAGGYFIKKV  932
             K    +F LT +++FL I+ AQGLGLAIGA  MD+KKATTLAS+TVM FML+GG+FIKKV
Sbjct  628   KLTLPAFFLTLLSIFLSIIAAQGLGLAIGAAFMDVKKATTLASITVMAFMLSGGFFIKKV  687

Query  931   PGFIVWLRDLSFNYHTFKLLLKVQYEHKTNSVNGVQIDS----------GIKEVGALAAM  782
             P F+ W+R +S NYHT++LLLKVQY         V  DS          G  E  A+ AM
Sbjct  688   PRFMSWIRYVSLNYHTYRLLLKVQYSCVGGPPRSVICDSAFIKAERLGYGGTEAAAILAM  747

Query  781   AVSYRLLAYISLRRMKLQ  728
              + YR+L YI LRRMKL+
Sbjct  748   IIGYRMLTYILLRRMKLR  765



>ref|XP_007200734.1| hypothetical protein PRUPE_ppa021401mg, partial [Prunus persica]
 gb|EMJ01933.1| hypothetical protein PRUPE_ppa021401mg, partial [Prunus persica]
Length=637

 Score =   653 bits (1684),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/616 (56%), Positives = 447/616 (73%), Gaps = 52/616 (8%)
 Frame = -2

Query  2527  DESADSKPFSDDENPEDLEAGTKKKRSIPAEPTFPIYLKFTEVSYKIVIKGVTFSEEKDI  2348
             D ++ +K  S +E   D + G    R +  + T PIYLKF +V YK+  K V  S  + I
Sbjct  23    DNTSTAKSTSTEEGGPDADKG----RKLHVDSTLPIYLKFEDVKYKVAAKSVKSSNAEYI  78

Query  2347  LNGISGAVDPGEVLALMGPSGCGKTTLLSLLGGRIRDPSAGSITYNQHPYSKLLKSRIGF  2168
             L+GISG+V PGEVLALMGPSG GKTTLL+LL GR++  ++G+ITYN  PY+K LK RIG+
Sbjct  79    LHGISGSVLPGEVLALMGPSGGGKTTLLNLLSGRVK-LNSGTITYNDQPYAKSLKRRIGY  137

Query  2167  VTQDDILFPHLTVKETLIYAARLRLPRTLTKEEKDKRAMDVIYELGLDRCQDTMIGGSFV  1988
             V QDD+LFPHLTVKETL YAA LRLP TLT+ +K++RAMDVI ELGL+RCQDT+IGG+FV
Sbjct  138   VMQDDLLFPHLTVKETLTYAALLRLPITLTRNQKEERAMDVINELGLERCQDTLIGGTFV  197

Query  1987  RGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILHEIAKAGKTVITTIH  1808
             RGVSGGERKRVCIGNEI++NPSLLFLDEPTSGLDST ALR + +LH IAKAGKTV+TTIH
Sbjct  198   RGVSGGERKRVCIGNEILLNPSLLFLDEPTSGLDSTAALRTLQMLHIIAKAGKTVVTTIH  257

Query  1807  QPSSRLFHk--------------------------------fdklilleflldLANGNIN  1724
             QPSSR+F+K                                   +   EFL+DLANGN N
Sbjct  258   QPSSRIFNKFDKLILLGRGSSLYFGKASEAMMYFSSIGCAPLIAMNPAEFLIDLANGNTN  317

Query  1723  DVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYETRVAETEKKKLMAPLPVE  1544
             + S+P+EL D+                PS   +HE+LV   + R+ + EK KL++ +  E
Sbjct  318   EKSLPTELEDR---------------GPSAVDIHEFLVEANQIRLGKMEKAKLLSSVLTE  362

Query  1543  EELKSKVRYLKREWGASWSEQYVLLFHRGIRERWHDYFSWLRITQVIATALILGMLWWQS  1364
              E K +     RE  A+W EQ+++L  RG++ER H+Y S LR+ QVI+TA+I+G+LWWQS
Sbjct  363   GESKMQRMSYSRESKATWCEQFLILCRRGLKERRHEYLSCLRVVQVISTAIIIGLLWWQS  422

Query  1363  GGDTPSQMQDQAGLLFFIAVFWGFFPVFTAIFTFPQEKAMLSKERAADMYRLSAYFAART  1184
                +P ++QDQAGLLFFI+VFW FFP+FTA+FTFPQE+A+++KER+ +MY+LSAYF AR 
Sbjct  423   DASSPRRVQDQAGLLFFISVFWAFFPMFTAVFTFPQERAIVAKERSVEMYKLSAYFLARN  482

Query  1183  TSdlpldlllpliflLVVYFMAGLKQDASSFLLTAVTVFLCIVVAQGLGLAIGATLMDLK  1004
              SDLPLDLLLP++FL++VY MAGLK   SSF  T +T+FL IV +QGLGL+IGA  +D+K
Sbjct  483   ISDLPLDLLLPIVFLVIVYLMAGLKLRFSSFFQTMLTIFLSIVASQGLGLSIGAAFIDVK  542

Query  1003  KATTLASVTVMTFMLAGGYFIKKVPGFIVWLRDLSFNYHTFKLLLKVQYEHKTNSVNGVQ  824
             KATTLAS+ VMTFML+GG+FI+KVP  + W+R +SFNYHT++LLLK+Q+  ++  +N ++
Sbjct  543   KATTLASIIVMTFMLSGGFFIQKVPSMVSWIRYISFNYHTYRLLLKIQFACQSPFINELR  602

Query  823   IDSGIKEVGALAAMAV  776
             +DSG+ EVGA+  M +
Sbjct  603   LDSGVMEVGAMMVMII  618



>ref|XP_009599779.1| PREDICTED: ABC transporter G family member 22-like [Nicotiana 
tomentosiformis]
Length=753

 Score =   657 bits (1694),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/608 (59%), Positives = 443/608 (73%), Gaps = 42/608 (7%)
 Frame = -2

Query  2452  RSIPAEPTFPIYLKFTEVSYKIVIKGVTFSE-EKDILNGISGAVDPGEVLALMGPSGCGK  2276
             R I  EPT  I LKF +V Y + +KG   S+ EK IL G+SG+  PGEVLALMGPSG GK
Sbjct  152   RRIQIEPTLRIRLKFQDVKYTVALKGEKHSDAEKCILQGVSGSACPGEVLALMGPSGGGK  211

Query  2275  TTLLSLLGGRIRDPSAGSITYNQHPYSKLLKSRIGFVTQDDILFPHLTVKETLIYAARLR  2096
             TTLL LL G++++ S G ITYN  PY+K LK RIGFV QDD++FPHLTVKETL YAA LR
Sbjct  212   TTLLKLLSGKVKNDS-GMITYNDQPYNKSLKQRIGFVLQDDVVFPHLTVKETLTYAALLR  270

Query  2095  LPRTLTKEEKDKRAMDVIYELGLDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLL  1916
             LP TL+KE+K +RA+ VI ELGL+RCQDT+IGG+FVRG+SGGERKRVCIGNEI++NPSLL
Sbjct  271   LPNTLSKEQKKERAISVINELGLERCQDTIIGGAFVRGISGGERKRVCIGNEILLNPSLL  330

Query  1915  FLDEPTSGLDSTTALRIVDILHEIAKAGKTVITTIHQPSSRLFHk---------------  1781
             FLDEPTSGLDSTTALRIV +LH IA+AGKTV+TTIHQPSSRLF                 
Sbjct  331   FLDEPTSGLDSTTALRIVQMLHNIARAGKTVVTTIHQPSSRLFSTFDKLILLGQGCSLYS  390

Query  1780  -----------------fdklilleflldLANGNINDVSIPSELADKVQTWNSKEEPTRN  1652
                                 +   EFL+DLANGNI D SIPS+L +K    N   + ++N
Sbjct  391   GKASEAMLYFSSIGCSPLIAMNPAEFLIDLANGNIKDKSIPSDLENKYLPGNHHFK-SKN  449

Query  1651  NGKPSPAIVHEYLVGCYETRVAETEKKKLMAPLPVEEELKSKVRYLKREWGASWSEQYVL  1472
              G  S A VHEY VG YE+RVA  EK KL+    +EE+ + +     R+ GA+W++Q+ +
Sbjct  450   EG-LSSAEVHEYFVGAYESRVANKEKTKLLNHRLIEEDSEVQSWPKLRDSGATWNQQFSI  508

Query  1471  LFHRGIRERWHDYFSWLRITQVIATALILGMLWWQSGGDTPSQMQDQAGLLFFIAVFWGF  1292
             LF RGI+ER H+YFS LRI QV+ATA+I+G+LWW S   +P  + DQ GLLFFI+VFW F
Sbjct  509   LFTRGIKERSHEYFSSLRIIQVLATAIIVGLLWWHSDTSSPKMVADQEGLLFFISVFWAF  568

Query  1291  FPVFTAIFTFPQEKAMLSKERAADMYRLSAYFAARTTSdlpldlllpliflLVVYFMAGL  1112
             FP+F AIFTFPQE+AML KER+ +MY+LSAYF AR T+DL LDL+LP+IFL++VYFM GL
Sbjct  569   FPLFAAIFTFPQERAMLVKERSVNMYKLSAYFVARITTDLLLDLVLPVIFLVIVYFMVGL  628

Query  1111  KQDASSFLLTAVTVFLCIVVAQGLGLAIGATLMDLKKATTLASVTVMTFMLAGGYFIKKV  932
             K    +F LT VTV L I+ AQGLGLAIGA  MD+KKATT ASVT+MTFML+GG+F+++V
Sbjct  629   KLTFPAFSLTLVTVLLSIIAAQGLGLAIGAAFMDVKKATTFASVTLMTFMLSGGFFVQEV  688

Query  931   PGFIVWLRDLSFNYHTFKLLLKVQYEHKTNSVNGVQIDSGIKEVGALAAMAVSYRLLAYI  752
             P FI W+R +S NYHT++LLLK+QY    +S  G     G+ EVGA+  M + YRLLAY 
Sbjct  689   PRFISWVRYISINYHTYRLLLKIQYNSLGSSKYG-----GV-EVGAMLVMIIGYRLLAYF  742

Query  751   SLRRMKLQ  728
              L++MKL+
Sbjct  743   LLKKMKLR  750



>ref|XP_006362828.1| PREDICTED: ABC transporter G family member 22-like [Solanum tuberosum]
Length=760

 Score =   650 bits (1676),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/606 (58%), Positives = 446/606 (74%), Gaps = 36/606 (6%)
 Frame = -2

Query  2446  IPAEPTFPIYLKFTEVSYKIVIKGVTFSE-EKDILNGISGAVDPGEVLALMGPSGCGKTT  2270
             I  EPT  I LKF +V Y + +KGV  S+ EK IL G+SG+  PGE+LALMGPSG GKTT
Sbjct  155   IQIEPTLRIRLKFQDVKYTVALKGVENSDTEKCILQGVSGSACPGEILALMGPSGGGKTT  214

Query  2269  LLSLLGGRIRDPSAGSITYNQHPYSKLLKSRIGFVTQDDILFPHLTVKETLIYAARLRLP  2090
             LL LL G++++   G+IT+N  PY+K LK RIGFV QDD++FPHLTVKETL YAA LRLP
Sbjct  215   LLKLLSGKVKN-DCGTITFNDQPYNKSLKQRIGFVLQDDVVFPHLTVKETLTYAALLRLP  273

Query  2089  RTLTKEEKDKRAMDVIYELGLDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFL  1910
              TL+KE+K +RA+ VI ELGL+RCQDT+IGG+FVRGVSGGERKRVCIGNEI++NPSLLFL
Sbjct  274   NTLSKEQKKERAIGVINELGLERCQDTIIGGAFVRGVSGGERKRVCIGNEILLNPSLLFL  333

Query  1909  DEPTSGLDSTTALRIVDILHEIAKAGKTVITTIHQPSSRLFHk-----------------  1781
             DEPTSGLDSTTALRI+ +L   A+AGKTV+TTIHQPSSRLF +                 
Sbjct  334   DEPTSGLDSTTALRIMQMLRNTARAGKTVVTTIHQPSSRLFSRFDKLILLGQGSSLYFGK  393

Query  1780  ---------------fdklilleflldLANGNINDVSIPSELADKVQTWNSKEEPTRNNG  1646
                               +   EFL+DLANGNI + SIPS+L DK+   N   +  +N G
Sbjct  394   ASEAMLYFSSIGCSPLIAMNPAEFLIDLANGNITEKSIPSDLEDKLLPGNHHFK-MQNEG  452

Query  1645  KPSPAIVHEYLVGCYETRVAETEKKKLMAPLPVEEELKSKVRYLKREWGASWSEQYVLLF  1466
              PSPA VHEY VG YE+RVA  EK KL+    +EE+ + +     R+ GA+W +Q+ +LF
Sbjct  453   -PSPADVHEYFVGAYESRVANIEKLKLLKHGLIEEDSEVQNWPNSRDSGATWCQQFTILF  511

Query  1465  HRGIRERWHDYFSWLRITQVIATALILGMLWWQSGGDTPSQMQDQAGLLFFIAVFWGFFP  1286
              R ++ER H+YFS LRITQVIATA+I+G+LWW S    P ++ DQAGLLFFI+VFWGFFP
Sbjct  512   GRSLKERNHEYFSCLRITQVIATAIIVGLLWWNSDTSFPKRISDQAGLLFFISVFWGFFP  571

Query  1285  VFTAIFTFPQEKAMLSKERAADMYRLSAYFAARTTSdlpldlllpliflLVVYFMAGLKQ  1106
             +FTAIFTFPQE+AML KER+ +MY+LSAYF AR T+DL LDL+LP+ FL++VYFM GLK 
Sbjct  572   LFTAIFTFPQERAMLVKERSVNMYKLSAYFIARITTDLLLDLVLPVTFLVIVYFMVGLKL  631

Query  1105  DASSFLLTAVTVFLCIVVAQGLGLAIGATLMDLKKATTLASVTVMTFMLAGGYFIKKVPG  926
               ++F LT +T+ L I+ AQGLGLAIGA  MD+KKATT ASV +MTFML+GG+F+++VP 
Sbjct  632   TFNAFSLTLLTILLSIIAAQGLGLAIGAAFMDVKKATTFASVILMTFMLSGGFFVQEVPA  691

Query  925   FIVWLRDLSFNYHTFKLLLKVQYEHKTNSVNGVQIDSGIKEVGALAAMAVSYRLLAYISL  746
             F+ W+R +S NYHT++LLLK+Q++   NS  G   DS   EVGA+  M + YR+LAY  L
Sbjct  692   FMSWVRYISINYHTYRLLLKIQFKSLRNSKYGSVDDSSGVEVGAMLVMVIGYRVLAYFFL  751

Query  745   RRMKLQ  728
             R+MKL+
Sbjct  752   RKMKLR  757



>ref|XP_010320061.1| PREDICTED: ABC transporter G family member 22-like isoform X2 
[Solanum lycopersicum]
Length=722

 Score =   648 bits (1671),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/604 (58%), Positives = 443/604 (73%), Gaps = 36/604 (6%)
 Frame = -2

Query  2446  IPAEPTFPIYLKFTEVSYKIVIKGVTFSE-EKDILNGISGAVDPGEVLALMGPSGCGKTT  2270
             I  EPT  I LKF +V Y + +KGV  S+ EK IL G+SG+  PGE+LALMGPSG GKTT
Sbjct  117   IQIEPTLRIRLKFQDVKYTVALKGVENSDTEKCILQGVSGSACPGEILALMGPSGGGKTT  176

Query  2269  LLSLLGGRIRDPSAGSITYNQHPYSKLLKSRIGFVTQDDILFPHLTVKETLIYAARLRLP  2090
             LL LL G++++ S G+IT+N  PY+K LK RIGFV QDD++FPHLTVKETL YAA LRLP
Sbjct  177   LLKLLSGKVKNDS-GTITFNDQPYNKSLKQRIGFVLQDDVVFPHLTVKETLTYAALLRLP  235

Query  2089  RTLTKEEKDKRAMDVIYELGLDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFL  1910
              TL+KE+K +RA+ VI ELGL+RCQDT+IGG+FVRGVSGGERKRVCIGNEI++NPSLLFL
Sbjct  236   NTLSKEQKKERAIGVINELGLERCQDTIIGGAFVRGVSGGERKRVCIGNEILLNPSLLFL  295

Query  1909  DEPTSGLDSTTALRIVDILHEIAKAGKTVITTIHQPSSRLFHk-----------------  1781
             DEPTSGLDSTTALRI+ +L  IA+AGKTV+TTIHQPSSRLF +                 
Sbjct  296   DEPTSGLDSTTALRIMQMLRNIARAGKTVVTTIHQPSSRLFSRFDKLILLGQGSSLYFGK  355

Query  1780  ---------------fdklilleflldLANGNINDVSIPSELADKVQTWNSKEEPTRNNG  1646
                               +   EFL+DLANGNI + SIPSEL +K+          + N 
Sbjct  356   ASEAMLYFSSIGCSPLIAMNPAEFLIDLANGNITEKSIPSELKEKLLP--GHHHFKKQNE  413

Query  1645  KPSPAIVHEYLVGCYETRVAETEKKKLMAPLPVEEELKSKVRYLKREWGASWSEQYVLLF  1466
              PSPA VHEY VG YE+RVA  EK KL+    +EE+ + +     R+ GA+W +Q+ +LF
Sbjct  414   GPSPADVHEYFVGAYESRVANIEKLKLLKHGLIEEDSEVQSWPNLRDSGATWCQQFTILF  473

Query  1465  HRGIRERWHDYFSWLRITQVIATALILGMLWWQSGGDTPSQMQDQAGLLFFIAVFWGFFP  1286
              R ++ER H+YFS LRITQVIATA+++G+LWW S    P ++ DQAGLLFF++VFWGFFP
Sbjct  474   GRSLKERNHEYFSSLRITQVIATAIVVGLLWWNSDTSFPERISDQAGLLFFVSVFWGFFP  533

Query  1285  VFTAIFTFPQEKAMLSKERAADMYRLSAYFAARTTSdlpldlllpliflLVVYFMAGLKQ  1106
             +FTAIFTFPQE+AML KER+ +MY+LSAYF AR T+DL LDL+LP+ FLL+VYFM GLK 
Sbjct  534   LFTAIFTFPQERAMLVKERSVNMYKLSAYFIARITTDLLLDLVLPVTFLLIVYFMVGLKL  593

Query  1105  DASSFLLTAVTVFLCIVVAQGLGLAIGATLMDLKKATTLASVTVMTFMLAGGYFIKKVPG  926
               ++F LT +T+ L I+ AQGLGLAIGA  MD+KKATT ASV +MTFML+GG+F+++VP 
Sbjct  594   TFNAFCLTLLTILLSIIAAQGLGLAIGAAFMDVKKATTFASVILMTFMLSGGFFVQEVPA  653

Query  925   FIVWLRDLSFNYHTFKLLLKVQYEHKTNSVNGVQIDSGIKEVGALAAMAVSYRLLAYISL  746
             F+ W+R +S NYHT++LLLK+Q++   NS  G   DS   EVGA+  M + YR+LAY  L
Sbjct  654   FMSWVRYISINYHTYRLLLKIQFKSLRNSKYGSVDDSSGVEVGAMLVMVIGYRVLAYFLL  713

Query  745   RRMK  734
             R+MK
Sbjct  714   RKMK  717



>tpg|DAA43438.1| TPA: hypothetical protein ZEAMMB73_582925 [Zea mays]
Length=879

 Score =   653 bits (1685),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/519 (67%), Positives = 404/519 (78%), Gaps = 39/519 (8%)
 Frame = -2

Query  2179  RIGFVTQDDILFPHLTVKETLIYAARLRLPRTLTKEEKDKRAMDVIYELGLDRCQDTMIG  2000
             RIGFVTQDD+LF HLTVKETL YAA LRLPRT+T+++K +RAMD+I+ELGL+RCQDTMIG
Sbjct  359   RIGFVTQDDVLFAHLTVKETLTYAALLRLPRTMTQQQKKERAMDIIHELGLERCQDTMIG  418

Query  1999  GSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILHEIAKAGKTVI  1820
             GSFVRGVSGGERKRVCIGNEI+INPSLLFLDEPTSGLDSTTALRIV +LH+IA+ GKTVI
Sbjct  419   GSFVRGVSGGERKRVCIGNEILINPSLLFLDEPTSGLDSTTALRIVQLLHDIAEDGKTVI  478

Query  1819  TTIHQPSSRLFHk--------------------------------fdklilleflldLAN  1736
             TTIHQPSSRLFHK                                   +   EFLLDLAN
Sbjct  479   TTIHQPSSRLFHKFDKLILLGKGSLLYFGKASEAMPYFQSIGCAPLIAMNPAEFLLDLAN  538

Query  1735  GNINDVSIPSELADKVQTWNSKEEPTRNNGK----PSPAIVHEYLVGCYETRVAETEKKK  1568
             GN  DVS+PSEL DKV   N   E   NN K    PS   VHEYLV  YETRVA  EKKK
Sbjct  539   GNTTDVSVPSELDDKVHMENHNLE--NNNSKIDYRPSAQDVHEYLVDAYETRVAFKEKKK  596

Query  1567  LMAPLPVEEELKSKVRYLKREWGASWSEQYVLLFHRGIRERWHDYFSWLRITQVIATALI  1388
             L+APLP+ ++LK+ +   KREWG SW +QY +LF RGI+ER HDY SW+RITQVIAT++I
Sbjct  597   LLAPLPISDDLKATITSSKREWGTSWWQQYSILFCRGIKERRHDYLSWMRITQVIATSVI  656

Query  1387  LGMLWWQSGGDTPSQMQDQAGLLFFIAVFWGFFPVFTAIFTFPQEKAMLSKERAADMYRL  1208
             LG+LWW S   T   ++DQAGLLFFIAVFWGFFPVFTAIFTFPQE+AML+KERA DMY+L
Sbjct  657   LGLLWWHSDPSTLKGLEDQAGLLFFIAVFWGFFPVFTAIFTFPQERAMLNKERAVDMYKL  716

Query  1207  SAYFAARTTSdlpldlllpliflLVVYFMAGLKQDASSFLLTAVTVFLCIVVAQGLGLAI  1028
             SAYF ARTTSDLPLDL LP+IF+++VYFMAGLK  A+ F L+ +TVFL I+ AQGLGLAI
Sbjct  717   SAYFLARTTSDLPLDLFLPIIFMVIVYFMAGLKATATHFFLSMLTVFLSIIAAQGLGLAI  776

Query  1027  GATLMDLKKATTLASVTVMTFMLAGGYFIKKVPGFIVWLRDLSFNYHTFKLLLKVQYEHK  848
             GATL+D+KKATTLASVTVMTFMLAGG+F+K VP FI WLR LSFNYHT++LLLKVQY+  
Sbjct  777   GATLLDIKKATTLASVTVMTFMLAGGFFVKSVPPFISWLRYLSFNYHTYRLLLKVQYDPV  836

Query  847   TNSVNGVQ-IDSGIKEVGALAAMAVSYRLLAYISLRRMK  734
              + +   + +DSG  EV AL AM + YR+LAY+SLRR K
Sbjct  837   PDILTTTRHMDSGGTEVAALVAMVIGYRVLAYLSLRRAK  875


 Score =   135 bits (340),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 90/181 (50%), Positives = 116/181 (64%), Gaps = 25/181 (14%)
 Frame = -2

Query  2665  TNSTHIRKSRSAQMKLDLDElssgsvlsrassasl---GFSFTGFS--VRPDESADSKPF  2501
              N++HIRKSRSAQ+KLD+++L S       +S++     F+FTGF+  ++   SAD   F
Sbjct  69    NNNSHIRKSRSAQLKLDVEDLVSSGAALSRASSASLGFSFTFTGFTPPLQHMCSADPPSF  128

Query  2500  SDDENPEDLEAGTKKKRSIPAEPTFPIYLK-------------FTEVSYKIVIKGVTFSE  2360
             SDDENP D+EAGT++K+ +  EPT PIYLK             F EV Y++  KG     
Sbjct  129   SDDENPVDIEAGTRRKKLV-TEPTLPIYLKRKSFVSKRRRAWQFAEVKYRVAGKG----S  183

Query  2359  EKDILNGISGAVDPGEVLALMGPSGCGKTTLLSLLGGRIRDPSA--GSITYNQHPYSKLL  2186
              ++IL GISG+  PGEVLALMGPSG GKTTLLS+LGGR     A  G I+YN  P+SK L
Sbjct  184   PREILGGISGSASPGEVLALMGPSGSGKTTLLSILGGRAAAGGAVDGCISYNDEPFSKSL  243

Query  2185  K  2183
             K
Sbjct  244   K  244



>ref|XP_004237766.1| PREDICTED: ABC transporter G family member 22-like isoform X1 
[Solanum lycopersicum]
Length=726

 Score =   647 bits (1668),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/604 (58%), Positives = 443/604 (73%), Gaps = 36/604 (6%)
 Frame = -2

Query  2446  IPAEPTFPIYLKFTEVSYKIVIKGVTFSE-EKDILNGISGAVDPGEVLALMGPSGCGKTT  2270
             I  EPT  I LKF +V Y + +KGV  S+ EK IL G+SG+  PGE+LALMGPSG GKTT
Sbjct  121   IQIEPTLRIRLKFQDVKYTVALKGVENSDTEKCILQGVSGSACPGEILALMGPSGGGKTT  180

Query  2269  LLSLLGGRIRDPSAGSITYNQHPYSKLLKSRIGFVTQDDILFPHLTVKETLIYAARLRLP  2090
             LL LL G++++ S G+IT+N  PY+K LK RIGFV QDD++FPHLTVKETL YAA LRLP
Sbjct  181   LLKLLSGKVKNDS-GTITFNDQPYNKSLKQRIGFVLQDDVVFPHLTVKETLTYAALLRLP  239

Query  2089  RTLTKEEKDKRAMDVIYELGLDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFL  1910
              TL+KE+K +RA+ VI ELGL+RCQDT+IGG+FVRGVSGGERKRVCIGNEI++NPSLLFL
Sbjct  240   NTLSKEQKKERAIGVINELGLERCQDTIIGGAFVRGVSGGERKRVCIGNEILLNPSLLFL  299

Query  1909  DEPTSGLDSTTALRIVDILHEIAKAGKTVITTIHQPSSRLFHk-----------------  1781
             DEPTSGLDSTTALRI+ +L  IA+AGKTV+TTIHQPSSRLF +                 
Sbjct  300   DEPTSGLDSTTALRIMQMLRNIARAGKTVVTTIHQPSSRLFSRFDKLILLGQGSSLYFGK  359

Query  1780  ---------------fdklilleflldLANGNINDVSIPSELADKVQTWNSKEEPTRNNG  1646
                               +   EFL+DLANGNI + SIPSEL +K+          + N 
Sbjct  360   ASEAMLYFSSIGCSPLIAMNPAEFLIDLANGNITEKSIPSELKEKLLP--GHHHFKKQNE  417

Query  1645  KPSPAIVHEYLVGCYETRVAETEKKKLMAPLPVEEELKSKVRYLKREWGASWSEQYVLLF  1466
              PSPA VHEY VG YE+RVA  EK KL+    +EE+ + +     R+ GA+W +Q+ +LF
Sbjct  418   GPSPADVHEYFVGAYESRVANIEKLKLLKHGLIEEDSEVQSWPNLRDSGATWCQQFTILF  477

Query  1465  HRGIRERWHDYFSWLRITQVIATALILGMLWWQSGGDTPSQMQDQAGLLFFIAVFWGFFP  1286
              R ++ER H+YFS LRITQVIATA+++G+LWW S    P ++ DQAGLLFF++VFWGFFP
Sbjct  478   GRSLKERNHEYFSSLRITQVIATAIVVGLLWWNSDTSFPERISDQAGLLFFVSVFWGFFP  537

Query  1285  VFTAIFTFPQEKAMLSKERAADMYRLSAYFAARTTSdlpldlllpliflLVVYFMAGLKQ  1106
             +FTAIFTFPQE+AML KER+ +MY+LSAYF AR T+DL LDL+LP+ FLL+VYFM GLK 
Sbjct  538   LFTAIFTFPQERAMLVKERSVNMYKLSAYFIARITTDLLLDLVLPVTFLLIVYFMVGLKL  597

Query  1105  DASSFLLTAVTVFLCIVVAQGLGLAIGATLMDLKKATTLASVTVMTFMLAGGYFIKKVPG  926
               ++F LT +T+ L I+ AQGLGLAIGA  MD+KKATT ASV +MTFML+GG+F+++VP 
Sbjct  598   TFNAFCLTLLTILLSIIAAQGLGLAIGAAFMDVKKATTFASVILMTFMLSGGFFVQEVPA  657

Query  925   FIVWLRDLSFNYHTFKLLLKVQYEHKTNSVNGVQIDSGIKEVGALAAMAVSYRLLAYISL  746
             F+ W+R +S NYHT++LLLK+Q++   NS  G   DS   EVGA+  M + YR+LAY  L
Sbjct  658   FMSWVRYISINYHTYRLLLKIQFKSLRNSKYGSVDDSSGVEVGAMLVMVIGYRVLAYFLL  717

Query  745   RRMK  734
             R+MK
Sbjct  718   RKMK  721



>ref|XP_009415591.1| PREDICTED: ABC transporter G family member 22-like [Musa acuminata 
subsp. malaccensis]
Length=659

 Score =   639 bits (1649),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/615 (57%), Positives = 450/615 (73%), Gaps = 52/615 (8%)
 Frame = -2

Query  2428  FPIYLKFTEVSYKIVIKGVTFSEEKD-ILNGISGAVDPGEVLALMGPSGCGKTTLLSLLG  2252
             FPIYLKF++V YK    G T S   + IL G++G+V+PGEVLALMGPSG GKTTLL+LL 
Sbjct  47    FPIYLKFSDVGYKFADNGGTSSVAMNYILQGVTGSVEPGEVLALMGPSGGGKTTLLNLLS  106

Query  2251  GR--IRDPSAGSITYNQHPYSKLLKSRIGFVTQDDILFPHLTVKETLIYAARLRLPRTLT  2078
             G+  I+D   G ITYN  PYSK LK RIGFV QDD++FP+LTV+ETL YAA LRLP+TLT
Sbjct  107   GKMTIKD-HGGLITYNDQPYSKWLKRRIGFVLQDDVVFPNLTVRETLTYAALLRLPKTLT  165

Query  2077  KEEKDKRAMDVIYELGLDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPT  1898
             K++K++RA++VI++LGL+RCQDT+IGG++ RG+SGGERKRVCIGNEI+++PSLLFLDEPT
Sbjct  166   KQQKEERAINVIHDLGLERCQDTIIGGAYTRGISGGERKRVCIGNEILLDPSLLFLDEPT  225

Query  1897  SGLDSTTALRIVDILHEIAKAGKTVITTIHQPSSRLFHkfdklil---------------  1763
             SGLDSTTALRI  +LH IA AGKTV+TTIHQPSSRLF+ FDKLIL               
Sbjct  226   SGLDSTTALRIAQMLHNIALAGKTVVTTIHQPSSRLFNMFDKLILLGRGSSLYFGKTSEA  285

Query  1762  -----------------leflldLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSP  1634
                               EFL+DLANGNIND S+P EL  +     + E   R++   S 
Sbjct  286   MLYFSSIGCSPLIPMNPAEFLIDLANGNINDKSVPLELQQRRFLCKTPEIEGRSS---SS  342

Query  1633  AIVHEYLVGCYETRVAETEKKKLMAPLPVEEE--LKSKVRYLKREWGASWSEQYVLLFHR  1460
               +HEYLVG YETRVA  EK+KL+ P P++    ++ +      E    W EQ  +LF R
Sbjct  343   MDIHEYLVGAYETRVAGIEKQKLLKPAPIDTMWMMQGRGPCSLDESRVGWWEQCHILFWR  402

Query  1459  GIRERWHDYFSWLRITQVIATALILGMLWWQSGGDTPSQMQDQAGLLFFIAVFWGFFPVF  1280
             G++ER H+Y S +R+ QV+ATA+I+G+LWW S   TP  +QDQAGLLFFI+VFWG+FPVF
Sbjct  403   GLKERRHEYLSCIRVIQVVATAVIIGLLWWHSDASTPKNLQDQAGLLFFISVFWGYFPVF  462

Query  1279  TAIFTFPQEKAMLSKERAADMYRLSAYFAARTTSdlpldlllpliflLVVYFMAGLKQDA  1100
              AIFTFP+E+ +L+KER+  MY+LSAYF ARTTSDLPLDL LP++FLL+VYFMAGL+ D 
Sbjct  463   AAIFTFPKEREILAKERSVGMYKLSAYFIARTTSDLPLDLTLPIVFLLIVYFMAGLRSDF  522

Query  1099  SSFLLTAVTVFLCIVVAQGLGLAIGATLMDLKKATTLASVTVMTFMLAGGYFIKKVPGFI  920
             ++FL + +T+FL IV AQGLGLA+GA LMD+KKATTLASV +MTFML+GG+F+++VP F+
Sbjct  523   TTFLESLLTIFLSIVAAQGLGLAVGAALMDIKKATTLASVIIMTFMLSGGFFVQRVPFFM  582

Query  919   VWLRDLSFNYHTFKLLLKVQY------EHKTNS-----VNGVQIDSGIKEVGALAAMAVS  773
              W+R LSFNYH ++LLL+ QY       H  N      +  + +D+   EVG + AM   
Sbjct  583   SWIRHLSFNYHAYRLLLQAQYGCTSTSHHNANPCKSRFIEELGLDNRGMEVGTMIAMVFG  642

Query  772   YRLLAYISLRRMKLQ  728
             YRLLAY+ LR+MKL+
Sbjct  643   YRLLAYLFLRKMKLR  657



>ref|XP_008237629.1| PREDICTED: ABC transporter G family member 22-like [Prunus mume]
Length=804

 Score =   644 bits (1661),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/629 (54%), Positives = 446/629 (71%), Gaps = 65/629 (10%)
 Frame = -2

Query  2527  DESADSKPFSDDENPEDLEAGTKKKRSIPAEPTFPIYLKFTEVSYKIVIKGVTFSEEKDI  2348
             D ++ +K  S +    D + G    R +  EPT PIYLKF +V +K+  KGV  S  + I
Sbjct  177   DNTSTAKSTSTEGGGPDADKG----RKLHVEPTLPIYLKFEDVKHKVAAKGVKSSNAEYI  232

Query  2347  LNGISGAVDPGEVLALMGPSGCGKTTLLSLLGGRIRDPSAGSITYNQHPYSKLLKSRIGF  2168
             L+GISG+V PGEVLALMGPSG GKTTLL+LL GR++  ++G+ITYN  PY+K LK RIG+
Sbjct  233   LHGISGSVLPGEVLALMGPSGGGKTTLLNLLSGRVK-LNSGTITYNDQPYAKSLKRRIGY  291

Query  2167  VTQDDILFPHLTVKETLIYAARLRLPRTLTKEEKDKRAMDVIYELGLDRCQDTMIGGSFV  1988
             V QDD+LFPHLTVKETL YAA LRLP TLT+ +K++RAMDVI ELGL+RCQDT+IGG+FV
Sbjct  292   VMQDDLLFPHLTVKETLTYAALLRLPITLTRNQKEERAMDVINELGLERCQDTLIGGTFV  351

Query  1987  RGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILHEIAKAGKTVITTIH  1808
             RGVSGGERKRVCIGNEI++NPSLLFLDEPTSGLDST ALR + +LH IAKAGKTV+TTIH
Sbjct  352   RGVSGGERKRVCIGNEILLNPSLLFLDEPTSGLDSTAALRTLQMLHIIAKAGKTVVTTIH  411

Query  1807  QPSSRLFHk--------------------------------fdklilleflldLANGNIN  1724
             QPSSR+F++                                   +   EFL+DLANGN N
Sbjct  412   QPSSRIFNEFDKLILLGRGSSLYFGQASEAMMYFSSIGCAPLIAMNPAEFLIDLANGNTN  471

Query  1723  DVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYETRVAETEKKKLMAPLPVE  1544
             + S+P+EL D+                PS   VHE+LV   + R+ + EK KL++    E
Sbjct  472   EKSLPTELEDR---------------GPSAVDVHEFLVEANQIRLGKMEKAKLLSSALTE  516

Query  1543  EELKSKVRYLKREWGASWSEQYVLLFHRGIRERWHDYFSWLRITQVIATALILGMLWWQS  1364
              E K +     RE  A+W EQ+++L  RG++ER H+Y S LR+ QVI+TA+I+G+LWWQS
Sbjct  517   GESKMQRMSYSRESKATWGEQFLILCRRGLKERRHEYLSCLRVVQVISTAIIIGLLWWQS  576

Query  1363  GGDTPSQMQDQAGLLFFIAVFWGFFPVFTAIFTFPQEKAMLSKERAADMYRLSAYFAART  1184
                +P ++QDQAGLLFFI+VFW FFP+FTA+FTFPQE+A+++KER+ +MY+LSAYF AR 
Sbjct  577   DASSPRRVQDQAGLLFFISVFWAFFPMFTAVFTFPQERAIVAKERSVEMYKLSAYFLARN  636

Query  1183  TSdlpldlllpliflLVVYFMAGLKQDASSFLLTAVTVFLCIVVAQGLGLAIGATLMDLK  1004
              SDLPLDLLLP++FL++VY MAGLK   S+F  T +T+FL IV +QGLGL+IGA  +D+K
Sbjct  637   ISDLPLDLLLPIVFLVIVYLMAGLKLRFSAFFQTMLTIFLSIVASQGLGLSIGAAFIDVK  696

Query  1003  KATTLASVTVMTFMLAGGYFIKKVPGFIVWLRDLSFNYHTFKLLLKVQYEHKTNS-----  839
             KAT LAS+ VMTFML+GG+FI+KVP  + W+R +SFNYHT++LLLK+QY   + +     
Sbjct  697   KATALASIIVMTFMLSGGFFIQKVPSMVSWIRYISFNYHTYRLLLKIQYGCSSGNSGTSG  756

Query  838   --------VNGVQIDSGIKEVGALAAMAV  776
                     +N +++DSG+ EVGA+  M +
Sbjct  757   YEACQSPFINELRLDSGVMEVGAMMVMII  785



>ref|XP_007019433.1| White-brown-complex ABC transporter family [Theobroma cacao]
 gb|EOY16658.1| White-brown-complex ABC transporter family [Theobroma cacao]
Length=802

 Score =   642 bits (1657),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/640 (55%), Positives = 449/640 (70%), Gaps = 62/640 (10%)
 Frame = -2

Query  2482  EDLEAGTKKKRSIPAEPTFPIYLKFTEVSYKIVIKGVTFSE-EKDILNGISGAVDPGEVL  2306
             ED E+ T++K  I  EPT PI LKF +V YK+ +KG   S+ EK IL+GISG+V PGEVL
Sbjct  165   EDTESRTRRK--IQYEPTLPICLKFEDVKYKVPVKGEKISDAEKYILHGISGSVYPGEVL  222

Query  2305  ALMGPSGCGKTTLLSLLGGRIRDPSAGSITYNQHPYSKLLKSRIGFVTQDDILFPHLTVK  2126
             ALMGPSG GKTTLL++L GR++  S G+ITYN  PYSK LK RIGFV QDD+ FPHLTVK
Sbjct  223   ALMGPSGGGKTTLLNVLSGRVKFDS-GTITYNDQPYSKSLKRRIGFVLQDDVTFPHLTVK  281

Query  2125  ETLIYAARLRLPRTLTKEEKDKRAMDVIYELGLDRCQDTMIGGSFVRGVSGGERKRVCIG  1946
             ETL YAA LRLP TLT ++K +RAM VI ELGL+RCQ+T+IGG+F+RG+SGGERKRVCI 
Sbjct  282   ETLTYAALLRLPNTLTMQQKKERAMSVISELGLERCQNTVIGGTFLRGISGGERKRVCIA  341

Query  1945  NEIIINPSLLFLDEPTSGLDSTTALRIVDILHEIAKAGKTVITTIHQPSSRLFHk-----  1781
             NEI++NPSLLFLDEPTSGLDSTTAL+IV +LH IA++G  V+TTIHQPSSRLF K     
Sbjct  342   NEILLNPSLLFLDEPTSGLDSTTALQIVQMLHNIAQSGTVVVTTIHQPSSRLFSKFDKLI  401

Query  1780  ---------------------------fdklilleflldLANGNINDVSIPSELADKVQT  1682
                                           +   EFL+DLANGNI D S+PS+  D+   
Sbjct  402   LLGKGSSLYYGKASEAMLYFSSIGCSPLIAMNPAEFLIDLANGNIKDKSVPSDFEDRFLP  461

Query  1681  WNSKEEPTRNNGKPSPAIVHEYLVGCYETRVAETEKKKLMAPLPVEEELKSKVRYLKREW  1502
              N   +     G PS   VHEYLV  Y  RV + EK KL+ P+ ++ E + + R   REW
Sbjct  462   RNRSLD--MKYGGPSQVDVHEYLVEAYAERVEKLEKTKLLQPV-LDAEPEMQTRLNSREW  518

Query  1501  GASWSEQYVLLFHRGIRERWHDYFSWLRITQVIATALILGMLWWQSGGDTPSQMQDQA--  1328
             GA+W +Q+ +LF RG +ER H+YFS +R+TQV++TA+I+G+LWW+S    P  ++DQA  
Sbjct  519   GATWWDQFSVLFKRGFKERRHEYFSCMRVTQVLSTAIIMGLLWWRSDASYPKGLEDQATI  578

Query  1327  ------------GLLFFIAVFWGFFPVFTAIFTFPQEKAMLSKERAADMYRLSAYFAART  1184
                         GLLFFI+VFW FFP+FTAIFTFPQE+ ML+ ER+  MYRLSA+F AR 
Sbjct  579   CYMLRLVLVTQAGLLFFISVFWAFFPMFTAIFTFPQERVMLALERSVGMYRLSAFFLARM  638

Query  1183  TSdlpldlllpliflLVVYFMAGLKQDASSFLLTAVTVFLCIVVAQGLGLAIGATLMDLK  1004
             TSDLPLDL+ P+ FL++VY MAGLK   ++F LT +TVF+ +V +QGLGL IGA LMD+K
Sbjct  639   TSDLPLDLIFPVAFLVIVYLMAGLKPTITAFSLTMLTVFVSVVASQGLGLTIGAALMDVK  698

Query  1003  KATTLASVTVMTFMLAGGYFIKKVPGFIVWLRDLSFNYHTFKLLLKVQY-----EHKTNS  839
             KA TLASV +M  ML+GG+FI+KVP F+ W+R +SF YHT++LLLK+ Y     +  + S
Sbjct  699   KAATLASVIIMASMLSGGFFIQKVPAFMSWVRYISFTYHTYRLLLKIHYGCAGSDTGSGS  758

Query  838   VN----GVQIDSGIKEVGALAAMAVSYRLLAYISLRRMKL  731
              N    G+++D   +EVG + A+ V YRLLAY  LRRMKL
Sbjct  759   CNSPFKGLRLDWDAREVGTMIAIIVGYRLLAYAFLRRMKL  798



>gb|EYU17426.1| hypothetical protein MIMGU_mgv1a002142mg [Erythranthe guttata]
Length=709

 Score =   639 bits (1647),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/647 (56%), Positives = 451/647 (70%), Gaps = 51/647 (8%)
 Frame = -2

Query  2536  VRPDESADSKPFSDDENPEDLEAGTKKKRSIPAEPTFPIYLKFTEVSYKIVIKGVTFSE-  2360
             V  D    + P   DE  ED ++ +  K  I  EP F I LKF +V+YK+ IKG   S+ 
Sbjct  67    VETDSFVSNNPRRIDEIEEDPDSCSWTK--IQIEPAFGISLKFEDVNYKVRIKGNKKSDV  124

Query  2359  EKDILNGISGAVDPGEVLALMGPSGCGKTTLLSLLGGRIRDPSAGSITYNQHPYSKLLKS  2180
              K+IL G+SG+V PGEVLALMGPSG GKTTLL+LL GR++  + G+ITYN   YSK LK 
Sbjct  125   GKNILQGVSGSVSPGEVLALMGPSGGGKTTLLNLLSGRVKY-NGGTITYNDQLYSKSLKR  183

Query  2179  RIGFVTQDDILFPHLTVKETLIYAARLRLPRTLTKEEKDKRAMDVIYELGLDRCQDTMIG  2000
             RIGFV QDD++FPHLTVKETL Y+A LRLP+ L+ E+K +RAM+VI ELGL+RCQ+TMIG
Sbjct  184   RIGFVFQDDVVFPHLTVKETLTYSALLRLPKKLSIEQKKERAMNVILELGLERCQNTMIG  243

Query  1999  GSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILHEIAKAGKTVI  1820
             G+FVRGVSGGERKRVCIGNEI++NPSLLFLDEPTSGLDSTTALRI+ +L +IA+AGKTV+
Sbjct  244   GTFVRGVSGGERKRVCIGNEILLNPSLLFLDEPTSGLDSTTALRIIQMLQKIARAGKTVV  303

Query  1819  TTIHQPSSRLFHkfdklilleflldL--------------------------------AN  1736
             TTIHQPSSRLF KFDKLIL+     L                                AN
Sbjct  304   TTIHQPSSRLFSKFDKLILMSNGCSLYFGKASEAMLYFSSIGCSPLIAMSPPEFLIDLAN  363

Query  1735  GNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYETRVAETEKKKLMAP  1556
             GNI D SIPS L DK        E T+ NG PSP  VHEYL+  YE+R    E+     P
Sbjct  364   GNIKDKSIPSVLEDKFLPGGEFFE-TKING-PSPFDVHEYLLEAYESRSCNVERIPKCEP  421

Query  1555  LPVEEELKSKVRYLKREWGASWSEQYVLLFHRGIRERWHDYFSWLRITQVIATALILGML  1376
             + +   L    R    E GA+W+ Q+ +LF RG++ER H+Y S LR+ QV++TA I+G+L
Sbjct  422   VTLNNGLWR--RNNTEEMGANWNSQFSILFKRGLKERRHEYLSSLRVIQVVSTAFIVGLL  479

Query  1375  WWQSGGDTPSQMQDQAGLLFFIAVFWGFFPVFTAIFTFPQEKAMLSKERAADMYRLSAYF  1196
             WW S     + +Q+Q GLLFFI+VFW FFPVF AIFTFPQE+AML+KER+ DMY+LSAY 
Sbjct  480   WWNSNASPSNSVQNQGGLLFFISVFWAFFPVFNAIFTFPQERAMLAKERSVDMYKLSAYL  539

Query  1195  AARTTSdlpldlllpliflLVVYFMAGLKQDASSFLLTAVTVFLCIVVAQGLGLAIGATL  1016
              AR TSDLPLDLLLP+IFL+++YFM GLK   S+F LT  T+FL I+ AQGLGL+IGA  
Sbjct  540   IARNTSDLPLDLLLPIIFLIIIYFMVGLKMTFSAFSLTLFTIFLSIIAAQGLGLSIGAAF  599

Query  1015  MDLKKATTLASVTVMTFMLAGGYFIKKVPGFIVWLRDLSFNYHTFKLLLKVQYE------  854
             MD+KKATTLASV VMTFML+GG+FIK+VP F+ W++ +S NYHT+ LL+K+QY       
Sbjct  600   MDVKKATTLASVIVMTFMLSGGFFIKEVPRFMSWIKYVSLNYHTYGLLMKIQYSCFGGES  659

Query  853   -----HKTNSVNGVQIDSGIKEVGALAAMAVSYRLLAYISLRRMKLQ  728
                    +  + G ++D G  E+GA+ AM + YRL+ Y+ LR MKL+
Sbjct  660   GLSLICDSPLIKGHKLDYGGVEIGAMFAMIIGYRLITYVLLRTMKLR  706



>ref|XP_009360789.1| PREDICTED: ABC transporter G family member 22-like [Pyrus x bretschneideri]
Length=764

 Score =   636 bits (1641),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/630 (56%), Positives = 454/630 (72%), Gaps = 57/630 (9%)
 Frame = -2

Query  2512  SKPFSDDENPEDLEAGTKKKRSIPAEPTFPIYLKFTEVSYKIVI-KGVTFSEEKDILNGI  2336
             +K  S +E   D + G    R++  EP+ PIYLKF +V +K+   KG+  S  + IL+GI
Sbjct  154   TKSMSTEEGGPDADKG----RNLHVEPSLPIYLKFQDVKHKVAAAKGMKSSNAEYILHGI  209

Query  2335  SGAVDPGEVLALMGPSGCGKTTLLSLLGGRIRDPSAGSITYNQHPYSKLLKSRIGFVTQD  2156
             +G+V PGEVLALMGPSG GKTTLL+LL GR++    G+ITYN  PY+K LK RIGFV QD
Sbjct  210   TGSVLPGEVLALMGPSGGGKTTLLNLLSGRVK-LKTGTITYNDQPYTKFLKRRIGFVMQD  268

Query  2155  DILFPHLTVKETLIYAARLRLPRTLTKEEKDKRAMDVIYELGLDRCQDTMIGGSFVRGVS  1976
             D+LF HLTVKETL YAA LRLP TLT+ +K +RAM+VI ELGL+RCQDT+IGG+FV+GVS
Sbjct  269   DLLFSHLTVKETLTYAALLRLPLTLTRNQKKERAMNVINELGLERCQDTLIGGTFVKGVS  328

Query  1975  GGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILHEIAKAGKTVITTIHQPSS  1796
             GGERKRVCIGNEI++NPSLLFLDEPTSGLDST+ALRI+ +LH IAKAGKTV+TTIHQPSS
Sbjct  329   GGERKRVCIGNEILLNPSLLFLDEPTSGLDSTSALRILQMLHIIAKAGKTVVTTIHQPSS  388

Query  1795  RLFHk--------------------------------fdklilleflldLANGNINDVSI  1712
             R+F+K                                   +   EFL+DLANGN ND S+
Sbjct  389   RIFNKFDKLILLGRGSSLYFGKASESMTYFSSIGCAPLIAMNPAEFLIDLANGNTNDKSL  448

Query  1711  PSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYETRVAETEKKKLMAPLPVEEE--  1538
             P+EL D               G+PS   VHE+LV   + R+AE +K KL++ +  + E  
Sbjct  449   PTELED---------------GRPSTVDVHEFLVEANQIRLAEMKKTKLLSYVQTDGENM  493

Query  1537  LKSKVRYLKREWGASWSEQYVLLFHRGIRERWHDYFSWLRITQVIATALILGMLWWQSGG  1358
             L+ K     RE  A+W EQ+ +LF RG++ER H+Y S LR+ QV++TALI+G+LWWQS  
Sbjct  494   LQGKGMTHLRESNATWCEQFSILFRRGLKERRHEYLSCLRVFQVVSTALIIGLLWWQSDT  553

Query  1357  DTPSQMQDQAGLLFFIAVFWGFFPVFTAIFTFPQEKAMLSKERAADMYRLSAYFAARTTS  1178
              +  Q QDQAGLLFFI+VFW FFP+FTA+FTFPQE+A+L+KER+ +MY+LSAYF AR TS
Sbjct  554   SSRRQFQDQAGLLFFISVFWTFFPLFTAVFTFPQERAILAKERSVEMYKLSAYFLARNTS  613

Query  1177  dlpldlllpliflLVVYFMAGLKQDASSFLLTAVTVFLCIVVAQGLGLAIGATLMDLKKA  998
             D+PLDLLLPL FL++VY M GLK   ++F+ T +T+FL IV +QGLGL IGA   D+KKA
Sbjct  614   DIPLDLLLPLAFLVIVYLMTGLKLTFTAFIQTMLTIFLSIVASQGLGLTIGAAFADVKKA  673

Query  997   TTLASVTVMTFMLAGGYFIKKVPGFIVWLRDLSFNYHTFKLLLKVQYEHKTNSVNGVQID  818
             TTLAS+ VMTFML+GG+FIKKVP  + W+R +SFNYH+++LLLK+QY   + S   +++D
Sbjct  674   TTLASIVVMTFMLSGGFFIKKVPSNVSWIRYISFNYHSYRLLLKIQYGCPSRS--ELRLD  731

Query  817   SGIKEVGALAAMAVSYRLLAYISLRRMKLQ  728
             SG+ EVGA+  M + YRLLAY+ LR MK +
Sbjct  732   SGVTEVGAMIVMIIGYRLLAYLFLRAMKFR  761



>gb|KDP43029.1| hypothetical protein JCGZ_25215 [Jatropha curcas]
Length=706

 Score =   629 bits (1622),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/634 (55%), Positives = 439/634 (69%), Gaps = 64/634 (10%)
 Frame = -2

Query  2500  SDDENPEDLEAGTKKKRSIPAEPTFPIYLKFTEVSYKIVIKGVTFSEEKDILNGISGAVD  2321
             S  ++ ED ++   KK  +  EPT PI LKF EV YK+         +K +L+GISG+  
Sbjct  89    SPSDHQEDPDSCKLKKMQV--EPTLPIALKFQEVKYKVY-------SDKYVLHGISGSAH  139

Query  2320  PGEVLALMGPSGCGKTTLLSLLGGRIRDPSAGSITYNQHPYSKLLKSRIGFVTQDDILFP  2141
             PGEVLALMGPSG GKT+LL+LL GR++  S GSI YN  PY+K LK RIGFVTQDD+LFP
Sbjct  140   PGEVLALMGPSGGGKTSLLNLLSGRVKFTS-GSIAYNGRPYTKSLKRRIGFVTQDDVLFP  198

Query  2140  HLTVKETLIYAARLRLPRTLTKEEKDKRAMDVIYELGLDRCQDTMIGGSFVRGVSGGERK  1961
             HLTVKETL YAA LRLP  LT+E+K +RAM VI ELGL+R Q+++IGG FVRG+SGGERK
Sbjct  199   HLTVKETLTYAALLRLPNILTREQKKERAMKVITELGLERSQNSVIGGKFVRGISGGERK  258

Query  1960  RVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILHEIAKAGKTVITTIHQPSSRLF--  1787
             RVCIG+EI++NPSLLFLDEPTSGLDSTTALRIV IL  +AK GKT++TTIHQPSSRLF  
Sbjct  259   RVCIGHEILLNPSLLFLDEPTSGLDSTTALRIVQILQNMAKTGKTIVTTIHQPSSRLFGK  318

Query  1786  ------------------------------HkfdklilleflldLANGNINDVSIPSELA  1697
                                           H    +   EFL+DLANGNIND   PSEL 
Sbjct  319   FDRLILLGKGSSLYFGKASEAMSYFSSIGCHPVIAMNPAEFLIDLANGNINDKPFPSELE  378

Query  1696  DKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYETRVAETEKK-KLMAPLPVEEELKSKVR  1520
             +K    +   E  R     S   +HEYL+  YE  V  + KK K +  + ++ E++   +
Sbjct  379   EKFLLESGSLE--RKKEGRSYTDIHEYLLKAYEKNVESSIKKTKSVQAITIDREMEFPGK  436

Query  1519  YLKREWGASWSEQYVLLFHRGIRERWHDYFSWLRITQVIATALILGMLWWQSGGDTPSQM  1340
                REW A+W EQ+ +L  R  +ER H YFS++RITQV+ATA+I+G+LWW SG  +  Q 
Sbjct  437   MNPREWEATWGEQFSVLVSRSFKERRHQYFSFMRITQVVATAIIIGLLWWHSG-SSLQQA  495

Query  1339  QDQAGLLFFIAVFWGFFPVFTAIFTFPQEKAMLSKERAADMYRLSAYFAARTTSdlpldl  1160
             +DQA       +FWGFFP+FTAIFTFPQEK ML+KERA  MYRLSAYFAAR  SDLPLDL
Sbjct  496   EDQA-------IFWGFFPLFTAIFTFPQEKVMLAKERAVGMYRLSAYFAARNISDLPLDL  548

Query  1159  llpliflLVVYFMAGLKQDASSFLLTAVTVFLCIVVAQGLGLAIGATLMDLKKATTLASV  980
             +LP IFL+ VYFM GLK   ++F LT +TVFL IV AQGLGL IGA  MD+KKATTLAS+
Sbjct  549   ILPTIFLVTVYFMVGLKLSFAAFSLTMLTVFLSIVAAQGLGLTIGAAFMDIKKATTLASI  608

Query  979   TVMTFMLAGGYFIKKVPGFIVWLRDLSFNYHTFKLLLKVQYEHKTNS-----------VN  833
             T+MTFML+GG+F+++VP F+ W+R +SFNYHT++LLL++QY   ++S           + 
Sbjct  609   TIMTFMLSGGFFLQEVPSFMSWVRYISFNYHTYRLLLRIQYPCSSDSDSEPSYCQSPFIT  668

Query  832   GVQIDSGIKEVGALAAMAVSYRLLAYISLRRMKL  731
              +++D G KEV A+  M V+YRLLAY+ LR+MKL
Sbjct  669   NLRLDRGAKEVVAMMVMIVAYRLLAYVFLRKMKL  702



>ref|XP_008356252.1| PREDICTED: ABC transporter G family member 22-like [Malus domestica]
Length=604

 Score =   610 bits (1573),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/609 (56%), Positives = 435/609 (71%), Gaps = 63/609 (10%)
 Frame = -2

Query  2413  KFTEVSYKIVI-KGVTFSEEKDILNGISGAVDPGEVLALMGPSGCGKTTLLSLLGGRIRD  2237
             KF +V +K+   KG+  S  + IL+GI+G+V PGEVLALMGPSG GKTTLL+LL GR++ 
Sbjct  9     KFQDVKHKVAAAKGMKSSNAEYILHGITGSVLPGEVLALMGPSGGGKTTLLNLLSGRVKL  68

Query  2236  PSAGSITYNQHPYSKLLKSRIGFVTQDDILFPHLTVKETLIYAARLRLPRTLTKEEKDKR  2057
              + G+ITYN  PY+K LK RIGFV QDD+LF HLTVKETL YAA LRLP TLT+ +K +R
Sbjct  69    KT-GTITYNDQPYTKFLKQRIGFVMQDDLLFSHLTVKETLTYAALLRLPLTLTRNQKKER  127

Query  2056  AMDVIYELGLDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTT  1877
             AM+VI ELGL+RCQDT+IGG FV+GVSGGERKRVCIGNEI++NPSLLFLDEPTSGLDST 
Sbjct  128   AMNVINELGLERCQDTLIGGXFVKGVSGGERKRVCIGNEILLNPSLLFLDEPTSGLDSTA  187

Query  1876  ALRIVDILHEIAKAGKTVITTIHQPSSRLFHk----------------------------  1781
             ALRI+ +LH IAKAGKTV+TTIHQPSSR+F+K                            
Sbjct  188   ALRILQMLHIIAKAGKTVVTTIHQPSSRIFNKFDKLILLGRGSSLYFGKASESMTYFSSI  247

Query  1780  ----fdklilleflldLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYL  1613
                    +   EFL+DLANGN ND S+P+EL D+               +PS   VHE+L
Sbjct  248   GCAPLIAMNPAEFLVDLANGNTNDKSLPTELEDE---------------RPSAVDVHEFL  292

Query  1612  VGCYETRVAETEKKKLMAPLPVEEE--LKSKVRYLKREWGASWSEQYVLLFHRGIRERWH  1439
             V   + R+AE +K KL++ +  E E  L+ K     RE  A+W EQ+ +LF RG+ ER H
Sbjct  293   VEANQVRLAEMKKXKLLSSVQTEGENMLQGKGMXYLRESNATWCEQFSILFRRGLXERRH  352

Query  1438  DYFSWLRITQVIATALILGMLWWQSGGDTPSQMQDQAGLLFFIAVFWGFFPVFTAIFTFP  1259
             +Y S LR+ QV++TA+I+G+LWWQS   +  Q+QDQAGLLFFI+VFW FFP+FTA+FTFP
Sbjct  353   EYLSCLRVFQVVSTAIIIGLLWWQSDTSSRRQLQDQAGLLFFISVFWTFFPLFTAVFTFP  412

Query  1258  QEKAMLSKERAADMYRLSAYFAARTTSdlpldlllpliflLVVYFMAGLKQDASSFLLTA  1079
             QE+A+L+KER+ +MY+LSAYF AR TSD+PLDLLLPL FL++VY M GLK   ++F+ T 
Sbjct  413   QERAILAKERSVEMYKLSAYFLARNTSDVPLDLLLPLAFLVIVYLMTGLKLTFTAFIQTM  472

Query  1078  VTVFLCIVVAQGLGLAIGATLMDLKKATTLASVTVMTFMLAGGYFIKKVPGFIVWLRDLS  899
             +T+FL IV +QGLGL IGA  +D+KKA TLAS+ VMTFML+GG+FIKKVP  + W+R + 
Sbjct  473   LTIFLSIVASQGLGLTIGAAFVDVKKAXTLASIVVMTFMLSGGFFIKKVPSNVSWIRYIX  532

Query  898   FNYHTFKLLLKVQYEHKTNS------------VNGVQIDSGIKEVGALAAMAVSYRLLAY  755
             FNYHT++LLLK+QY   + S            +  +++DSG+ EVGA+  M + YRLLAY
Sbjct  533   FNYHTYRLLLKIQYGCPSGSGTSGNETCESQLIKELRLDSGVMEVGAMIVMIIGYRLLAY  592

Query  754   ISLRRMKLQ  728
             + LR MK +
Sbjct  593   LFLRAMKFR  601



>ref|XP_004292538.1| PREDICTED: ABC transporter G family member 22-like [Fragaria 
vesca subsp. vesca]
Length=725

 Score =   606 bits (1563),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/608 (56%), Positives = 430/608 (71%), Gaps = 57/608 (9%)
 Frame = -2

Query  2437  EPTFPIYLKFTEVSYKIVIKGVTFSEEKDILNGISGAVDPGEVLALMGPSGCGKTTLLSL  2258
             EPT PIYLKF +V YK+   GV  S    IL GI+G+V PGEVLALMGPSG GKTTLL+L
Sbjct  134   EPTLPIYLKFQDVKYKVAAMGVKSSVPSCILQGITGSVQPGEVLALMGPSGGGKTTLLNL  193

Query  2257  LGGRIRDPSAGSITYNQHPYSKLLKSRIGFVTQDDILFPHLTVKETLIYAARLRLPRTLT  2078
             L GR +  ++GSITYN  PY+K LK RIG+V QDD+LFPHLTVKETL YAA LRLP +LT
Sbjct  194   LSGRTK-LNSGSITYNDQPYTKSLKHRIGYVMQDDLLFPHLTVKETLTYAALLRLPISLT  252

Query  2077  KEEKDKRAMDVIYELGLDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPT  1898
             K +K +RAM VI+ELGL+RCQDT+IGG  VRGVSGGERKRVCIGNEI++NPSLLFLDEPT
Sbjct  253   KTQKKERAMHVIHELGLERCQDTVIGGILVRGVSGGERKRVCIGNEILLNPSLLFLDEPT  312

Query  1897  SGLDSTTALRIVDILHEIAKAGKTVITTIHQPSSRLFHk---------------------  1781
             SGLDST A RI+ +L  IA+AGKTV+TTIHQPSSR+F K                     
Sbjct  313   SGLDSTAAFRILQMLQIIAEAGKTVVTTIHQPSSRIFSKFDKLILLGRGSSLYFGKASEA  372

Query  1780  -----------fdklilleflldLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSP  1634
                           +   EFL+DLANGN ND S+P+E  D               G PS 
Sbjct  373   MMYFSSIGCAPLIAMNPAEFLIDLANGNTNDKSLPTEWED---------------GGPS-  416

Query  1633  AIVHEYLVGCYETRVAETEKKKLMAPLPV--EEELKSKVRYLKREWGASWSEQYVLLFHR  1460
               VHE+LV   + R+++   +     + +    E + + R   +E  A+W EQ+ +LF R
Sbjct  417   --VHEFLVSANQDRLSKMAYRSHQNSVLLLHHGEHQKQGRSYSKESKATWWEQFSILFRR  474

Query  1459  GIRERWHDYFSWLRITQVIATALILGMLWWQSGGDTPSQMQDQAGLLFFIAVFWGFFPVF  1280
             G++ER H+YF W+RI QVI+TA+I+G+LWW S   +  Q+ DQAGLLFFI+VFW FFP+F
Sbjct  475   GLKERRHEYFCWMRIIQVISTAIIIGLLWWHSNASSAKQLHDQAGLLFFISVFWAFFPLF  534

Query  1279  TAIFTFPQEKAMLSKERAADMYRLSAYFAARTTSdlpldlllpliflLVVYFMAGLKQDA  1100
             TAIFTFPQE+A+++KER+ +MY+LS+YF AR  SDLPLDLLLP++FL++VY M GLK+  
Sbjct  535   TAIFTFPQERAIVAKERSVEMYKLSSYFLARNISDLPLDLLLPVVFLVIVYMMVGLKRTY  594

Query  1099  SSFLLTAVTVFLCIVVAQGLGLAIGATLMDLKKATTLASVTVMTFMLAGGYFIKKVPGFI  920
             ++F  T +T+FL IV AQGLGL+IGA  +D+KKATT ASV VMTFML+GG+FI+KVP  I
Sbjct  595   AAFFETMLTIFLSIVAAQGLGLSIGAAFIDIKKATTFASVIVMTFMLSGGFFIQKVPAVI  654

Query  919   VWLRDLSFNYHTFKLLLKVQYEHKTNS----VNGVQIDSGIKEVGALAAMAVSYRLLAYI  752
              W+R +SFNYHT++LLLK+QY    +     +  +++DSG  EVGA+  M + YRLLAY+
Sbjct  655   SWVRYISFNYHTYRLLLKIQYAGYESCESPFIKELRLDSGGMEVGAMMIMIIGYRLLAYL  714

Query  751   SLRRMKLQ  728
              LR MKL+
Sbjct  715   LLRTMKLR  722



>ref|XP_010680137.1| PREDICTED: ABC transporter G family member 22-like [Beta vulgaris 
subsp. vulgaris]
Length=729

 Score =   593 bits (1528),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/620 (53%), Positives = 429/620 (69%), Gaps = 60/620 (10%)
 Frame = -2

Query  2440  AEPTFPIYLKFTEVSYKIVIKGVTFSE-EKDILNGISGAVDPGEVLALMGPSGCGKTTLL  2264
             A P+ PI L+F +V +K+ + G+  +E EK IL+G++G+  PGE+LA++GPSG GKTTLL
Sbjct  119   AIPSLPICLRFQDVKFKVTMNGLKNTEGEKYILHGVTGSAVPGELLAMIGPSGGGKTTLL  178

Query  2263  SLLGGRIRDPSAGSITYNQHPYSKLLKSRIGFVTQDDILFPHLTVKETLIYAARLRLPRT  2084
             +LL GR++  S G+ITYN  PYSK LK +IGFV QDD+ FPHLTVKETLIYAA LRLP  
Sbjct  179   NLLSGRVKFNS-GTITYNNQPYSKSLKRKIGFVMQDDVAFPHLTVKETLIYAALLRLPNK  237

Query  2083  LTKEEKDKRAMDVIYELGLDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDE  1904
             L+KE+K  RAM VI +LGL+RCQ++M+GG+ ++G+SGGER+RVCIGNEI++NP LL LDE
Sbjct  238   LSKEQKRDRAMKVINDLGLERCQNSMVGGALLKGISGGERRRVCIGNEILLNPPLLLLDE  297

Query  1903  PTSGLDSTTALRIVDILHEIAKAGKTVITTIHQPSSRLF---------------------  1787
             PTS LDS +ALRIV IL ++AKAGKTV+TTIHQPSSRLF                     
Sbjct  298   PTSSLDSASALRIVQILQKLAKAGKTVVTTIHQPSSRLFCKFDKLILLGKGSSLYFGKAS  357

Query  1786  -----------HkfdklilleflldLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKP  1640
                             +   EFLLDLANGN+ND S PS L DK  T N+  +      KP
Sbjct  358   EAMKYFSTMGCSPLISMNPAEFLLDLANGNMNDKSFPSNLEDKFSTTNNSRQ------KP  411

Query  1639  SPAIVHEYLVGCYETRVAETEKKKLMAPLPVEEELKSKVRYLKREWG-----ASWSEQYV  1475
             SP  +HEY V  YE+    T K KL  P   +    S V+   R+W      A W +Q+ 
Sbjct  412   SPLEIHEYFVEAYESSSCTTRKAKLAKPTVKQ----STVKLGDRKWSSKDLEARWWDQFS  467

Query  1474  LLFHRGIRERWHDYFSWLRITQVIATALILGMLWWQSGGDTPSQMQDQAGLLFFIAVFWG  1295
             +L  RGI+ER H+Y S +R+ QVI+TA+I+G+LWW      P   QDQAGL+FFIAVFWG
Sbjct  468   VLLSRGIKERRHEYLSCIRVIQVISTAIIIGLLWWHPNHSYPIDPQDQAGLMFFIAVFWG  527

Query  1294  FFPVFTAIFTFPQEKAMLSKERAADMYRLSAYFAARTTSdlpldlllpliflLVVYFMAG  1115
             FFP+ TA+FTFPQE+ ML KER+  MY+LSAYFAAR  +DLPLDL+LP+ F+L+V+FM G
Sbjct  528   FFPLSTAVFTFPQERFMLMKERSVGMYKLSAYFAARNITDLPLDLILPIFFMLIVHFMVG  587

Query  1114  LKQDASSFLLTAVTVFLCIVVAQGLGLAIGATLMDLKKATTLASVTVMTFMLAGGYFIKK  935
             ++   ++F +T + VFL IV +QGLGL+IGA  MD++KA TLAS+ +M FML+GG+FI+ 
Sbjct  588   MQPSFTAFFVTLLAVFLSIVASQGLGLSIGAAFMDIRKAMTLASIIIMCFMLSGGFFIQD  647

Query  934   VPGFIVWLRDLSFNYHTFKLLLKVQYEHKTNSVN----------GVQID-SGIKEVGALA  788
             VP F+ W+R +SFNYHT++LLL++QY   T S+N          G+++D SG  EVGAL 
Sbjct  648   VPLFMSWVRYVSFNYHTYRLLLRIQYGCSTGSLNSSSCEAPIIKGLKVDYSGRVEVGALI  707

Query  787   AMAVSYRLLAYISLRRMKLQ  728
              M + YRLLAY  LRRMK +
Sbjct  708   FMIMGYRLLAYFFLRRMKYK  727



>gb|AAK63861.1|AF389289_1 AT5g06530/F15M7_6 [Arabidopsis thaliana]
 gb|AAN72282.1| At5g06530/F15M7_6 [Arabidopsis thaliana]
Length=458

 Score =   580 bits (1494),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/458 (68%), Positives = 357/458 (78%), Gaps = 34/458 (7%)
 Frame = -2

Query  2008  MIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILHEIAKAGK  1829
             MIGG+FVRGVSGGERKRV IGNEIIINPSLL LDEPTSGLDSTTALR + +LH+IA+AGK
Sbjct  1     MIGGAFVRGVSGGERKRVSIGNEIIINPSLLLLDEPTSGLDSTTALRTILMLHDIAEAGK  60

Query  1828  TVITTIHQPSSRLFHk--------------------------------fdklilleflld  1745
             TVITTIHQPSSRLFH+                                   +   EFLLD
Sbjct  61    TVITTIHQPSSRLFHRFDKLILLGRGSLLYFGKSSEALDYFSSIGCSPLIAMNPAEFLLD  120

Query  1744  LANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYETRVAETEKKKL  1565
             LANGNIND+S+PSEL D+VQ  NS  E     GKPSPA VHEYLV  YETRVAE EKKKL
Sbjct  121   LANGNINDISVPSELDDRVQVGNSGRET--QTGKPSPAAVHEYLVEAYETRVAEQEKKKL  178

Query  1564  MAPLPVEEELKSKVRYLKREWGASWSEQYVLLFHRGIRERWHDYFSWLRITQVIATALIL  1385
             + P+P++EE K+K   LKR+WG  W EQY +LF RG++ER H+YFSWLR+TQV++TA+IL
Sbjct  179   LDPVPLDEEAKAKSTRLKRQWGTCWWEQYCILFCRGLKERRHEYFSWLRVTQVLSTAVIL  238

Query  1384  GMLWWQSGGDTPSQMQDQAGLLFFIAVFWGFFPVFTAIFTFPQEKAMLSKERAADMYRLS  1205
             G+LW QS   TP  +QDQAGLLFFIAVFWGFFPVFTAIF FPQE+AML+KERAADMYRLS
Sbjct  239   GLLWRQSDIRTPMGLQDQAGLLFFIAVFWGFFPVFTAIFAFPQERAMLNKERAADMYRLS  298

Query  1204  AYFAARTTSdlpldlllpliflLVVYFMAGLKQDASSFLLTAVTVFLCIVVAQGLGLAIG  1025
             AYF ARTTSDLPLD +LP +FLLVVYFM GL+     F L+ +TVFLCI+ AQGLGLAIG
Sbjct  299   AYFLARTTSDLPLDFILPSLFLLVVYFMTGLRISPYPFFLSMLTVFLCIIAAQGLGLAIG  358

Query  1024  ATLMDLKKATTLASVTVMTFMLAGGYFIKKVPGFIVWLRDLSFNYHTFKLLLKVQYEHKT  845
             A LMDLKKATTLASVTVMTFMLAGG+F+KKVP FI W+R LSFNYHT+KLLLKVQY+   
Sbjct  359   AILMDLKKATTLASVTVMTFMLAGGFFVKKVPVFISWIRYLSFNYHTYKLLLKVQYQDFA  418

Query  844   NSVNGVQIDSGIKEVGALAAMAVSYRLLAYISLRRMKL  731
              S+NG++ID+G+ EV AL  M   YRLLAY+SLR+MK+
Sbjct  419   VSINGMRIDNGLTEVAALVVMIFGYRLLAYLSLRQMKI  456



>gb|KDO70711.1| hypothetical protein CISIN_1g0045372mg, partial [Citrus sinensis]
Length=435

 Score =   570 bits (1468),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/422 (68%), Positives = 337/422 (80%), Gaps = 35/422 (8%)
 Frame = -2

Query  2482  EDLEAGTKKKRSIPAEPTFPIYLKFTEVSYKIVIKGVTFSEEKDILNGISGAVDPGEVLA  2303
             ED+EAGT+++     EPT PIYLKFT+V+YK+++KG+T SEEKDILNGI+G+V+PGEVLA
Sbjct  1     EDIEAGTRERPKFQTEPTLPIYLKFTDVTYKVILKGMTSSEEKDILNGITGSVNPGEVLA  60

Query  2302  LMGPSGCGKTTLLSLLGGRIRDPS-AGSITYNQHPYSKLLKSRIGFVTQDDILFPHLTVK  2126
             LMGPSG GKTTLL+LL GR+ +P+  GSITYN HPYSK LKS+IGFVTQDD+LFPHLTVK
Sbjct  61    LMGPSGSGKTTLLNLLSGRLMEPTVGGSITYNDHPYSKSLKSKIGFVTQDDVLFPHLTVK  120

Query  2125  ETLIYAARLRLPRTLTKEEKDKRAMDVIYELGLDRCQDTMIGGSFVRGVSGGERKRVCIG  1946
             ETL YAA LRLP TLTK++K+KRA+DVI ELGL+RCQDTMIGGSFVRGVSGGERKRVCIG
Sbjct  121   ETLTYAALLRLPNTLTKQQKEKRAIDVINELGLERCQDTMIGGSFVRGVSGGERKRVCIG  180

Query  1945  NEIIINPSLLFLDEPTSGLDSTTALRIVDILHEIAKAGKTVITTIHQPSSRLFHk-----  1781
             NEIIINPSLLFLDEPTSGLDSTTALRIV +L +IA+AGKTV+TTIHQPSSRLFHK     
Sbjct  181   NEIIINPSLLFLDEPTSGLDSTTALRIVQMLQDIAEAGKTVVTTIHQPSSRLFHKFDKLI  240

Query  1780  ---------------------------fdklilleflldLANGNINDVSIPSELADKVQT  1682
                                           +   EFLLDLANGN++DVS+PSEL D+VQT
Sbjct  241   LLGKGSLLYFGKASEAMAYFSSIGCSPQIAMNPAEFLLDLANGNLHDVSVPSELQDRVQT  300

Query  1681  WNSKEEPTRNNGKPSPAIVHEYLVGCYETRVAETEKKKLMAPLPVEEELKSKVRYLKREW  1502
              NS+ +    NGKP+PAIVHEYLV  YETRVAE EKKKLMAP+P++EE+K+KV   KR W
Sbjct  301   ENSENDTA--NGKPTPAIVHEYLVEAYETRVAENEKKKLMAPIPLDEEIKAKVSSPKRNW  358

Query  1501  GASWSEQYVLLFHRGIRERWHDYFSWLRITQVIATALILGMLWWQSGGDTPSQMQDQAGL  1322
             GASW +QY +LF RGI+E  HDYFSWLRITQV+ATA+ILG+LWWQS   +P  ++DQ   
Sbjct  359   GASWIQQYTILFRRGIKEHRHDYFSWLRITQVLATAVILGLLWWQSDSKSPKGLEDQVHN  418

Query  1321  LF  1316
             LF
Sbjct  419   LF  420



>ref|XP_006826407.1| hypothetical protein AMTR_s00004p00153830 [Amborella trichopoda]
 gb|ERM93644.1| hypothetical protein AMTR_s00004p00153830 [Amborella trichopoda]
Length=468

 Score =   567 bits (1462),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/464 (66%), Positives = 360/464 (78%), Gaps = 35/464 (8%)
 Frame = -2

Query  2023  RCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILHEI  1844
             RCQDT+IGGSF+RGVSGGERKRVCIGNEI+INPSLLFLDEPTSGLDSTTALRIV +L+ I
Sbjct  7     RCQDTVIGGSFIRGVSGGERKRVCIGNEILINPSLLFLDEPTSGLDSTTALRIVQMLNNI  66

Query  1843  AKAGKTVITTIHQPSSRLFHk--------------------------------fdklill  1760
             A+AGKTV+TTIHQPSSRLFHK                                   +   
Sbjct  67    AEAGKTVVTTIHQPSSRLFHKFDKLILLGKGSLLYFGKASETMLYFSSIGCSPLIAMNPA  126

Query  1759  eflldLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYETRVAET  1580
             EFL+DLANGNINDVSIPS+L DKVQT  S E  TRN GKP   I  +YLV  YE+R A+ 
Sbjct  127   EFLIDLANGNINDVSIPSDLEDKVQT-ESPETETRN-GKPHHQI-KQYLVEAYESRAADK  183

Query  1579  EKKKLMAPLPVEEELKSKVRYLKREWGASWSEQYVLLFHRGIRERWHDYFSWLRITQVIA  1400
             EKKK      +EEE KSKV   KREWGASW +Q+ +LF RG++ER H+Y SW+RITQV++
Sbjct  184   EKKKSCKVGVLEEEAKSKVLKQKREWGASWWQQFSILFKRGLKERRHEYLSWMRITQVLS  243

Query  1399  TALILGMLWWQSGGDTPSQMQDQAGLLFFIAVFWGFFPVFTAIFTFPQEKAMLSKERAAD  1220
             TA+ILG+LWW+S   TP  +QDQAGLLFFIAVFWGFFPVFTAIFTFPQE+AML+KERA D
Sbjct  244   TAIILGLLWWRSDISTPKGLQDQAGLLFFIAVFWGFFPVFTAIFTFPQERAMLAKERAVD  303

Query  1219  MYRLSAYFAARTTSdlpldlllpliflLVVYFMAGLKQDASSFLLTAVTVFLCIVVAQGL  1040
             MYRLSAYF AR  SDLPLDL LP++FLL+VYFMAGLK  A++F L+ ++VFL IV AQG+
Sbjct  304   MYRLSAYFMARNISDLPLDLFLPIVFLLIVYFMAGLKLSATAFFLSMLSVFLSIVAAQGM  363

Query  1039  GLAIGATLMDLKKATTLASVTVMTFMLAGGYFIKKVPGFIVWLRDLSFNYHTFKLLLKVQ  860
             G AIGA+LMD+KKATTLASVTVMTFMLAGG+F++ VP FI W+R +SFNYHT++LLLKVQ
Sbjct  364   GQAIGASLMDIKKATTLASVTVMTFMLAGGFFVQGVPVFISWIRYISFNYHTYRLLLKVQ  423

Query  859   YEHKTNSVNGVQIDSGIKEVGALAAMAVSYRLLAYISLRRMKLQ  728
             Y H   SVNGV +D+G+KE  A+  M   YRLLAYISLRRMKL+
Sbjct  424   YNHIFRSVNGVALDNGMKEAWAMIIMVFGYRLLAYISLRRMKLR  467



>emb|CAN66426.1| hypothetical protein VITISV_029010 [Vitis vinifera]
Length=751

 Score =   554 bits (1428),  Expect = 5e-180, Method: Compositional matrix adjust.
 Identities = 317/577 (55%), Positives = 394/577 (68%), Gaps = 86/577 (15%)
 Frame = -2

Query  2533  RPDESADSKPFSDDENPEDLEAGTKKKRSIPAEPTFPIYLKFTEVSYKIVIKGVTFSEEK  2354
             R  +SA  +  S  E  +D   G +K  S   +PT PIYLKF +V YK+V KG   S+EK
Sbjct  171   RQKDSATRQSRSAHEKDQD-SCGWRKTHS---KPTLPIYLKFEDVKYKVVTKGGKSSDEK  226

Query  2353  DILNGISGAVDPGEVLALMGPSGCGKTTLLSLLGGRIRDPSAGSITYNQHPYSKLLK---  2183
              IL+GI+G+VDPGEVLALMGPSG GKTTLL+LL G+++  ++G ITYN  PY+K LK   
Sbjct  227   HILHGITGSVDPGEVLALMGPSGGGKTTLLNLLSGKVKT-NSGRITYNDQPYAKTLKHRL  285

Query  2182  -----SRIGFVTQDDILFPHLTVKETLIYAARLRLPRTLTKEEKDKRAMDVIYELGLDRC  2018
                  SRIGFV QDDI+FPHLTVKETL YAA LRLP TLT+++K +R MD+I EL L+RC
Sbjct  286   ILMRMSRIGFVLQDDIVFPHLTVKETLTYAALLRLPNTLTRQQKKERVMDIISELDLERC  345

Query  2017  QDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILHEIAK  1838
             Q+T+IGG+ VRG+SGGERKRVCIGNEI++NPSLLFLDEPTSGLDSTTALRI+ +L   A+
Sbjct  346   QNTIIGGALVRGISGGERKRVCIGNEILLNPSLLFLDEPTSGLDSTTALRILQMLQNTAE  405

Query  1837  AGKTVITTIHQPSSRLFHk--------------------------------fdklillef  1754
             AGKTV+TTIHQPSSRLF                                   + +   EF
Sbjct  406   AGKTVVTTIHQPSSRLFSMFDKLVLLGKGNSLYFGKASEAMLYFSSIGCSPLEAMNPAEF  465

Query  1753  lldLANGNINDVSIPSELADKVQTWNSKEEPTRNN-----GKPSPAIVHEYLVGCYETRV  1589
             L+DLANGNI++ S+PSEL DK         P R N     GKPSP  VHE   G  +   
Sbjct  466   LIDLANGNISNKSVPSELEDKY-------SPGRQNFENEEGKPSPGEVHE---GPMKKEF  515

Query  1588  AETEKKKLMAPLPVEEELKSKVRYLKREWGASWSEQYVLLFHRGIRERWHDYFSWLRITQ  1409
             A  EK KL++P+ ++   + + R    EWGA+W +Q+ +LF RG++ER H+Y   LRIT 
Sbjct  516   ANLEKMKLLSPVXIDSVSEMQRRENSXEWGANWWQQFSILFRRGLKERRHEYLXGLRIT-  574

Query  1408  VIATALILGMLWWQSGGDTPSQMQDQAGLLFFIAVFWGFFPVFTAIFTFPQEKAMLSKER  1229
                                      QAGLLFFI+VFWGF P+FTAIFTFPQE+AML KER
Sbjct  575   -------------------------QAGLLFFISVFWGFLPLFTAIFTFPQERAMLVKER  609

Query  1228  AADMYRLSAYFAARTTSdlpldlllpliflLVVYFMAGLKQDASSFLLTAVTVFLCIVVA  1049
             + DMYRLSAYF AR TSDLPLDL+LP++F+L+VYFMAGLK   ++F LT +TVFL I+ +
Sbjct  610   SVDMYRLSAYFVARNTSDLPLDLILPILFMLIVYFMAGLKPSFAAFSLTMLTVFLSILAS  669

Query  1048  QGLGLAIGATLMDLKKATTLASVTVMTFMLAGGYFIK  938
             QGLG+ IGA LMD+KKATTLAS+T+MTFML+GG+FI+
Sbjct  670   QGLGMTIGAALMDVKKATTLASITLMTFMLSGGFFIQ  706



>ref|XP_001763976.1| ATP-binding cassette transporter, subfamily G, member 4, group 
WBC protein PpABCG4 [Physcomitrella patens]
 gb|EDQ71115.1| ATP-binding cassette transporter, subfamily G, member 4, group 
WBC protein PpABCG4 [Physcomitrella patens]
Length=624

 Score =   546 bits (1407),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 304/591 (51%), Positives = 400/591 (68%), Gaps = 52/591 (9%)
 Frame = -2

Query  2359  EKDILNGISGAVDPGEVLALMGPSGCGKTTLLSLLGGRIRDPSAGSITYNQHPYSKLLKS  2180
             EK+IL+G++G+V PGE LA+MGPSG GKTTLL+LLGGR +   +G  TYN   Y+K LK 
Sbjct  34    EKEILHGVTGSVFPGETLAIMGPSGSGKTTLLNLLGGRNQHGVSGRFTYNDIAYNKALKR  93

Query  2179  RIGFVTQDDILFPHLTVKETLIYAARLRLPRT-LTKEEKDKRAMDVIYELGLDRCQDTMI  2003
             R+GFVTQDD+L+ HLTV+ETL+YAA LRLP +  T+ +K  RA + I ELGLD+C+DT+I
Sbjct  94    RMGFVTQDDVLYGHLTVRETLVYAALLRLPSSSFTRAQKIARAEETILELGLDKCRDTII  153

Query  2002  GGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILHEIAKAGKTV  1823
             GG F RGVSGGERKRVCIG+EI+++PS LFLDEPTSGLDSTTALRI+ ++  +AKAG+TV
Sbjct  154   GGPFFRGVSGGERKRVCIGHEILVDPSCLFLDEPTSGLDSTTALRIIHVIRNLAKAGRTV  213

Query  1822  ITTIHQPSSRLFHkfdklilleflld--------------------------------LA  1739
             +TTIHQPSSRLF+ FDKLILL                                     LA
Sbjct  214   LTTIHQPSSRLFYMFDKLILLSQGNSIYFGNACDAPNYFSSIGLTPFIAMNPADFILDLA  273

Query  1738  NGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYETRVAETEKKKLMA  1559
             +GN++D+SIP  L        S+         PS A VH YLV  +E  +   EK K++ 
Sbjct  274   SGNLSDISIPPALEKTTSL--SRHCQKTPAPLPSSANVHSYLVQQFEQELLPKEKSKILR  331

Query  1558  PLPVEEELKSKVRYLKREWGASWSEQYVLLFHRGIRERWHDYFSWLRITQVIATALILGM  1379
                 +EELK  V   KREW  SW +Q+ +L  RG++ER H+Y S+LR  QV   ++I+G 
Sbjct  332   SASAKEELKLAVT-AKREWSTSWLDQFSVLMMRGLKERRHEYLSYLRFVQVFFISVIVGC  390

Query  1378  LWWQSGGDTPSQMQDQAGLLFFIAVFWGFFPVFTAIFTFPQEKAMLSKERAADMYRLSAY  1199
             LWW+S  +T  Q+ DQ GL+FF ++FWG FP+FTAIFTFP E+AML+KERA+D+YRLS+Y
Sbjct  391   LWWRSKRETQVQIADQMGLIFFWSIFWGMFPLFTAIFTFPLERAMLNKERASDLYRLSSY  450

Query  1198  FAARTTSdlpldlllpliflLVVYFMAGLKQDASSFLLTAVTVFLCIVVAQGLGLAIGAT  1019
             F ART  DLPLDL++P+IF+ +VYFMA LK  A++F L+ +TVFL +V AQGLG  IGA 
Sbjct  451   FMARTLGDLPLDLIMPVIFVFIVYFMANLKLTAAAFFLSLLTVFLNVVTAQGLGFLIGAV  510

Query  1018  LMDLKKATTLASVTVMTFMLAGGYFIKKVPGFIVWLRDLSFNYHTFKLLLKVQYE----H  851
             LM+ KKATTLAS+ +  FML GGYF++ +P ++ WL+ +SFNY  ++LL K+QY     +
Sbjct  511   LMETKKATTLASIIMPAFMLTGGYFVQGIPVWMKWLKYVSFNYFNYRLLTKIQYSSSETY  570

Query  850   KTNS------------VNGVQIDSGIKEVGALAAMAVSYRLLAYISLRRMK  734
               NS             +GV ++ G  +  AL  M + YR+LAY +LR M 
Sbjct  571   DCNSSTGCKSMADAPAFHGVSLEGGGIDAMALVIMVIGYRILAYCALRWMN  621



>ref|XP_009799082.1| PREDICTED: ABC transporter G family member 22-like isoform X2 
[Nicotiana sylvestris]
Length=708

 Score =   546 bits (1407),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 306/511 (60%), Positives = 373/511 (73%), Gaps = 40/511 (8%)
 Frame = -2

Query  2452  RSIPAEPTFPIYLKFTEVSYKIVIKGVTFSE-EKDILNGISGAVDPGEVLALMGPSGCGK  2276
             R I  E T  I LKF +V Y + +KG   S+ EK IL G+SG+  PGEVLALMGPSG GK
Sbjct  158   RRIQIETTLRIRLKFQDVKYTVALKGEKHSDAEKCILQGVSGSACPGEVLALMGPSGGGK  217

Query  2275  TTLLSLLGGRIRDPSAGSITYNQHPYSKLLKSRIGFVTQDDILFPHLTVKETLIYAARLR  2096
             TTLL LL G++++ S G ITYN  PY+K LK RIGFV QDD++FPHLTVKETLIYAA LR
Sbjct  218   TTLLKLLSGKVKNDS-GMITYNDQPYNKSLKQRIGFVMQDDVVFPHLTVKETLIYAALLR  276

Query  2095  LPRTLTKEEKDKRAMDVIYELGLDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLL  1916
             LP TL+KE+K +RA++VI ELGL+RCQDT+IGG+FVRG+SGGERKRVCIGNEI++NPSLL
Sbjct  277   LPNTLSKEQKKERAINVINELGLERCQDTIIGGTFVRGISGGERKRVCIGNEILLNPSLL  336

Query  1915  FLDEPTSGLDSTTALRIVDILHEIAKAGKTVITTIHQPSSRLFHk---------------  1781
             FLDEPTSGLDSTTALRIV +LH IA+AGKTV+TTIHQPSSRLF +               
Sbjct  337   FLDEPTSGLDSTTALRIVQMLHNIARAGKTVVTTIHQPSSRLFSRFDRLILLGQGCSLYS  396

Query  1780  -----------------fdklilleflldLANGNINDVSIPSELADKVQTWNSKEEPTRN  1652
                                 +   EFL+DLANGNI D SIPS+L +K    N   + ++N
Sbjct  397   GKASEAMLYFSTIGCSPLIAMNPAEFLIDLANGNIKDKSIPSDLENKFLPGNHHFK-SKN  455

Query  1651  NGKPSPAIVHEYLVGCYETRVAETEKKKLMAPLPVEEELKSKVRYLK--REWGASWSEQY  1478
              G PS A VHEY VG YE+R A  EK KL+    +EE+  S+V+ L   R+ GA+W++Q+
Sbjct  456   EG-PSSADVHEYFVGAYESRFANEEKIKLLNHRLIEED--SEVQSLPNLRDSGATWNQQF  512

Query  1477  VLLFHRGIRERWHDYFSWLRITQVIATALILGMLWWQSGGDTPSQMQDQAGLLFFIAVFW  1298
              +LF RGI+ER H+YFS LRI QVIATA+I+G+LWW S   +P +M DQAGLLFFI+VFW
Sbjct  513   SILFTRGIKERSHEYFSSLRIIQVIATAIIVGLLWWHSDTSSPKKMADQAGLLFFISVFW  572

Query  1297  GFFPVFTAIFTFPQEKAMLSKERAADMYRLSAYFAARTTSdlpldlllpliflLVVYFMA  1118
              FFP+FTAIFTFPQE+AML KER+ +MY+LSAYF AR T+DL LDL+LP+IFL++VYFM 
Sbjct  573   AFFPLFTAIFTFPQERAMLVKERSVNMYKLSAYFIARVTTDLLLDLVLPVIFLVIVYFMV  632

Query  1117  GLKQDASSFLLTAVTVFLCIVVAQGLGLAIG  1025
             GLK    +F LT VTV L I+ AQ  GL  G
Sbjct  633   GLKLTFPAFSLTLVTVLLSIIAAQVRGLRFG  663



>gb|KHN10345.1| ABC transporter G family member 27 [Glycine soja]
Length=673

 Score =   545 bits (1403),  Expect = 3e-177, Method: Compositional matrix adjust.
 Identities = 323/501 (64%), Positives = 377/501 (75%), Gaps = 61/501 (12%)
 Frame = -2

Query  2878  MEQTNSTSLLRTKSDQLVEaiaaakgsarARLPRLSAEFAGSGVPESVRMLSRKPSRRLM  2699
             ME+ N TSL+RTKSDQL+E++ A   S        S++ + +GV +S     RK SR L 
Sbjct  1     MEKAN-TSLVRTKSDQLLESMVAGLKSPP------SSDHSANGVVDS-----RKSSRWL-  47

Query  2698  ppspggggsgGTNSTHIRKSRSAQ---MKLDLDElssgsvlsrassasl--GFSFTGFSV  2534
                 G     G  +THIRKSRSAQ   MKL+LD++SSG+ LSRASSASL   FSFTGF++
Sbjct  48    ---TGASPGRGGKNTHIRKSRSAQISQMKLELDDVSSGAALSRASSASLGLSFSFTGFTM  104

Query  2533  RPDESADSKPFSDDENPEDLEAGTKKKRSIPAEPTFPIYLKFTEVSYKIVIKGVTFSEEK  2354
              P+E ADSKPFSDD+ PED+E+G + K     EPT PIYLKFT+V+YKIVIKG+T +EEK
Sbjct  105   PPEEIADSKPFSDDDIPEDIESGPRTK--FQTEPTLPIYLKFTDVTYKIVIKGMTTTEEK  162

Query  2353  DILNGISGAVDPGEVLALMGPSGCGKTTLLSLLGGRIRDP-SAGSITYNQHPYSKLLKSR  2177
             DILNGI+G+V+PGEVLALMGPSG GKTTLL+LLGGR+  P S GSITYN  PYSK LKSR
Sbjct  163   DILNGITGSVNPGEVLALMGPSGSGKTTLLNLLGGRLSHPISGGSITYNDQPYSKFLKSR  222

Query  2176  IGFVTQDDILFPHLTVKETLIYAARLRLPRTLTKEEKDKRAMDVIYELGLDRCQDTMIGG  1997
             IGFVTQDD+LFPHLTVKETL YAARLRLP+T TKE+K+KRA+DVIYELGL+RCQDTMIGG
Sbjct  223   IGFVTQDDVLFPHLTVKETLTYAARLRLPKTYTKEQKEKRALDVIYELGLERCQDTMIGG  282

Query  1996  SFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILHEIAKAGKTVIT  1817
             SFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIV +L +IA+AGKTV+T
Sbjct  283   SFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVQMLQDIAEAGKTVVT  342

Query  1816  TIHQPSSRLFHk--------------------------------fdklilleflldLANG  1733
             TIHQPSSRLFHK                                   +   EFLLDLANG
Sbjct  343   TIHQPSSRLFHKFDKLILLGKGSLLYFGKASEAMTYFQSIGCSPLISMNPAEFLLDLANG  402

Query  1732  NINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYETRVAETEKKKLMAPL  1553
             NINDVS+PSEL DKVQ  N++ E    NGKPSPA+VHEYLV  YETRVAETEKK+LM P+
Sbjct  403   NINDVSLPSELEDKVQMGNAEAETL--NGKPSPAVVHEYLVEAYETRVAETEKKRLMVPI  460

Query  1552  PVEEELKSK---VRYLKREWG  1499
             P++E LK+K   + ++   WG
Sbjct  461   PIDEALKTKAGLLFFIAVFWG  481


 Score =   303 bits (776),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 158/205 (77%), Positives = 181/205 (88%), Gaps = 0/205 (0%)
 Frame = -2

Query  1342  MQDQAGLLFFIAVFWGFFPVFTAIFTFPQEKAMLSKERAADMYRLSAYFAARTTSdlpld  1163
             ++ +AGLLFFIAVFWGFFPVFTAIFTFPQE+AMLSKERAADMYRLSAYF ARTTSDLPLD
Sbjct  466   LKTKAGLLFFIAVFWGFFPVFTAIFTFPQERAMLSKERAADMYRLSAYFLARTTSDLPLD  525

Query  1162  lllpliflLVVYFMAGLKQDASSFLLTAVTVFLCIVVAQGLGLAIGATLMDLKKATTLAS  983
             L+LP++FLLVVYFMAGL+   + F LT +TVFLCIV AQGLGLAIGATLMDLK+ATTLAS
Sbjct  526   LILPVLFLLVVYFMAGLRLSVAPFFLTILTVFLCIVAAQGLGLAIGATLMDLKRATTLAS  585

Query  982   VTVMTFMLAGGYFIKKVPGFIVWLRDLSFNYHTFKLLLKVQYEHKTNSVNGVQIDSGIKE  803
             VTVMTFMLAGG+F+++VP F  W+R +SFNYHT+KLLLKVQYEH +  +NG++IDSG  E
Sbjct  586   VTVMTFMLAGGFFVQRVPIFFSWIRYMSFNYHTYKLLLKVQYEHISPVINGMRIDSGATE  645

Query  802   VGALAAMAVSYRLLAYISLRRMKLQ  728
             V AL AM   YR LAY+SLRRMKLQ
Sbjct  646   VAALIAMVFGYRFLAYLSLRRMKLQ  670



>gb|KDP37810.1| hypothetical protein JCGZ_06712 [Jatropha curcas]
Length=669

 Score =   514 bits (1325),  Expect = 8e-166, Method: Compositional matrix adjust.
 Identities = 296/654 (45%), Positives = 414/654 (63%), Gaps = 67/654 (10%)
 Frame = -2

Query  2548  TGFSVRPDESADSKPFSDDENPEDLEAGTK-KKRSIPAEPTFPIYLKFTEVSYKIVI--K  2378
             T F  +  +SA  +  S+  +   L    +   +S+     +PI LKF EV YK+ +  K
Sbjct  36    TVFQWQQVQSARQRNMSEPNDGAVLAYPVQPNSQSVLRLSIYPITLKFEEVVYKVKLEQK  95

Query  2377  GVTF-----SEEKDILNGISGAVDPGEVLALMGPSGCGKTTLLSLLGGRIRDPSAGSITY  2213
             GV +     ++EK ILNGI+G V PGE+LA++GPSG GKTTLL+ LGGRI    +G +TY
Sbjct  96    GVCWGGTWGTKEKTILNGITGMVCPGEILAMLGPSGSGKTTLLTALGGRINGKLSGKVTY  155

Query  2212  NQHPYSKLLKSRIGFVTQDDILFPHLTVKETLIYAARLRLPRTLTKEEKDKRAMDVIYEL  2033
             N  P+S  +K R GFV QDD+L+PHLTV ETL++ A LRLP+TLT EEK +    +I EL
Sbjct  156   NGQPFSGTIKRRTGFVAQDDVLYPHLTVTETLVFTALLRLPKTLTNEEKLRHVERIIAEL  215

Query  2032  GLDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDIL  1853
             GL RCQ++MIGG   RG+SGGE+KRV IG E++INPSLL LDEPTSGLDSTTA RI+  +
Sbjct  216   GLTRCQNSMIGGPLFRGISGGEKKRVSIGQEMLINPSLLLLDEPTSGLDSTTAQRIITTI  275

Query  1852  HEIAKAGKTVITTIHQPSSRLFHkfdklilleflldLANG------------------NI  1727
               +A  G+TV+TTIHQPSSRL+H FDK++LL     +  G                   I
Sbjct  276   KRLASGGRTVVTTIHQPSSRLYHMFDKVVLLSEGSPIYYGPASSALDYFSSIGFYTSMTI  335

Query  1726  NDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYETRVAETEKKKLMAPLPV  1547
             N   +  +LA+ +   +        N +    +V E L+  YE ++A   K +L      
Sbjct  336   NPADLLLDLANGIAPDSKHVTEQGENMEQEQKLVQEALLSGYEKKIATRLKAELC-----  390

Query  1546  EEELKSKVRYLKREWGASWSEQYVLLFHRGIRERWHDYFSWLRITQVIATALILGMLWWQ  1367
                L +K      +W  SW  Q+ +LF RG+RER ++ F+ LRI QVI+ A++ G+LWW 
Sbjct  391   --RLDTKA----EQWCTSWWYQFKVLFQRGLRERRYESFNRLRIFQVISVAVLGGLLWWH  444

Query  1366  SGGDTP-SQMQDQAGLLFFIAVFWGFFPVFTAIFTFPQEKAMLSKERAADMYRLSAYFAA  1190
                 TP S +QD+  LLFF +VFWGF+P++ A+FTFPQE++ML KERA+ MY LS+YF A
Sbjct  445   ----TPTSHIQDRIALLFFFSVFWGFYPLYNAVFTFPQERSMLIKERASGMYHLSSYFLA  500

Query  1189  RTTSdlpldlllpliflLVVYFMAGLKQDASSFLLTAVTVFLCIVVAQGLGLAIGATLMD  1010
             RT  DLPL+L LP  F+ ++Y+M GLK D  +F+L+ + +   ++V+Q LGLAIGA LMD
Sbjct  501   RTFGDLPLELALPTAFVFIIYWMGGLKADPITFILSLLVILYNVLVSQSLGLAIGAILMD  560

Query  1009  LKKATTLASVTVMTFMLAGGYFIKKVPGFIVWLRDLSFNYHTFKLLLKVQYEH-------  851
             +K+ATTLASVT + F++AGGY+++++P FIVWL+ LS++Y+ +KLLL VQY         
Sbjct  561   IKQATTLASVTTLVFLIAGGYYVQQIPTFIVWLKYLSYSYYCYKLLLGVQYSEDDYYECS  620

Query  850   -------------KTNSVNGVQIDSGIKEVGALAAMAVSYRLLAYISLRRMKLQ  728
                          K+  +N + +D     V  +A M V YRL+AY++L R++L+
Sbjct  621   KGVLCRVGDFPAVKSMGLNHLWVD-----VCIMALMLVGYRLVAYLALHRVQLR  669



>ref|XP_002992999.1| hypothetical protein SELMODRAFT_136316, partial [Selaginella 
moellendorffii]
 gb|EFJ05945.1| hypothetical protein SELMODRAFT_136316, partial [Selaginella 
moellendorffii]
Length=520

 Score =   505 bits (1301),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 275/504 (55%), Positives = 361/504 (72%), Gaps = 42/504 (8%)
 Frame = -2

Query  2356  KDILNGISGAVDPGEVLALMGPSGCGKTTLLSLLGGRIR-DPSAGSITYNQHPYSKLLKS  2180
             K+IL+G+SGAV PG++LA+MGPSG GKTTLLSLL GR + +  +GSITYN   Y+K LK 
Sbjct  3     KEILHGVSGAVGPGQILAMMGPSGSGKTTLLSLLAGRSQTNLHSGSITYNDMGYTKALKR  62

Query  2179  RIGFVTQDDILFPHLTVKETLIYAARLRLPRTLTKEEKDKRAMDVIYELGLDRCQDTMIG  2000
             R+GFVTQDD+LF HLTVKETL YAA LRLP+ L+++EK +RA  +I ELGLD+C+DT+IG
Sbjct  63    RMGFVTQDDVLFMHLTVKETLRYAALLRLPKKLSRQEKIQRADSIILELGLDKCKDTIIG  122

Query  1999  GSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILHEIAKAGKTVI  1820
             G F RGVSGGERKRVCIG EI+I+PS++FLDEPTSGLDSTTALRI+ +LH +A+AG+TVI
Sbjct  123   GPFERGVSGGERKRVCIGQEILIDPSIIFLDEPTSGLDSTTALRILQLLHGLAQAGRTVI  182

Query  1819  TTIHQPSSRLFHkfdklillef--------------------------------lldLAN  1736
             TTIHQPSSRL+H FD L+LL                                  LLDLAN
Sbjct  183   TTIHQPSSRLYHMFDNLLLLSNGHAIFFGRGQDALPYFSSIGLNASLLMNPADFLLDLAN  242

Query  1735  GNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYETRVAETEKKKLMAP  1556
             GNI+D SIP EL  +++   SK +     GKP    V EYLV C+ + VA  +      P
Sbjct  243   GNISDTSIPPEL--EIKLIQSKGD--SKVGKPPELAVQEYLVECFSSEVAFRDSSVDSPP  298

Query  1555  LPVEEELKSKVRYLKREWGASWSEQYVLLFHRGIRERWHDYFSWLRITQVIATALILGML  1376
                    K  +   +REW   W +Q+++L  RG +ER H+Y SWLR+ QV+ +A++ G++
Sbjct  299   -----HAKDVILPPRREWSIGWWQQFLVLMSRGFKERRHEYLSWLRVFQVLVSAVVAGLV  353

Query  1375  WWQSGGDTPSQMQDQAGLLFFIAVFWGFFPVFTAIFTFPQEKAMLSKERAADMYRLSAYF  1196
             W  S  D+   +QDQ GL+FFI+++W +FP+F AI+TFPQE+AM++KERA+DMYRLS+YF
Sbjct  354   WLHSSADSEKHLQDQVGLIFFISIYWAYFPIFVAIYTFPQERAMIAKERASDMYRLSSYF  413

Query  1195  AARTTSdlpldlllpliflLVVYFMAGLKQDASSFLLTAVTVFLCIVVAQGLGLAIGATL  1016
              +RT  DLPL+L+LPL+FLL+ YFMA LK    +FLLT +++FL ++ A+GLGL IGA +
Sbjct  414   MSRTLGDLPLNLVLPLVFLLITYFMAHLKLTVGAFLLTVLSLFLIVIAAEGLGLFIGAVM  473

Query  1015  MDLKKATTLASVTVMTFMLAGGYF  944
             MD K ATTLAS+ ++ FML GG+F
Sbjct  474   MDTKHATTLASILLLIFMLTGGFF  497



>gb|KFK44944.1| hypothetical protein AALP_AA1G323000 [Arabis alpina]
Length=640

 Score =   504 bits (1299),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 296/609 (49%), Positives = 398/609 (65%), Gaps = 51/609 (8%)
 Frame = -2

Query  2428  FPIYLKFTEVSYKIVIK------GVTFSEEKDILNGISGAVDPGEVLALMGPSGCGKTTL  2267
             +PI LKF EV YK+ IK      G   S+EK ILNGISG + PGE+LA++GPSG GKTTL
Sbjct  41    YPITLKFEEVMYKVKIKQTSQCFGSWSSKEKTILNGISGMICPGEILAMLGPSGSGKTTL  100

Query  2266  LSLLGGRIRDPSAGSITYNQHPYSKLLKSRIGFVTQDDILFPHLTVKETLIYAARLRLPR  2087
             LS LGGR+     G + YN  P+S  +K R GFV QDD+L+PHLTV ETL + A LRLP 
Sbjct  101   LSALGGRLSKTFTGKVMYNGQPFSGNIKRRTGFVAQDDVLYPHLTVWETLFFTALLRLPS  160

Query  2086  TLTKEEKDKRAMDVIYELGLDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLD  1907
             TLT++EK +    VI ELGL RC ++MIGG   RG+SGGE+KRV IG E++INPSLL LD
Sbjct  161   TLTRDEKAEHVDRVIAELGLTRCTNSMIGGPLFRGLSGGEKKRVSIGQEMLINPSLLLLD  220

Query  1906  EPTSGLDSTTALRIVDILHEIAKAGKTVITTIHQPSSRLFHkfdklilleflldLANGN-  1730
             EPTSGLDSTTA RIV  +  +A  G+TV+TTIHQPSSR++H FDK++LL     +  G+ 
Sbjct  221   EPTSGLDSTTAHRIVTTIKRLASGGRTVVTTIHQPSSRIYHMFDKVVLLSEGSPIYYGSA  280

Query  1729  -----------------INDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCY  1601
                              +N   +  +LA+ +   + ++E +    K     V E L+  Y
Sbjct  281   SSAVEYFSSVGFSTSMTVNPADLLLDLANGISP-DCQKETSEQEQK----TVKETLISAY  335

Query  1600  ETRVAETEKKKLM-APLPVEEELKSKVRYLKRE-WGASWSEQYVLLFHRGIRERWHDYFS  1427
             E  ++   K++L  A     E  K+  + LK E W  SW  Q+ +L  RG+RER  + F+
Sbjct  336   EKNISTKLKEELSNADSQSLEYTKAAAKNLKSEQWCTSWWYQFTVLLQRGVRERRFESFN  395

Query  1426  WLRITQVIATALILGMLWWQSGGDTP-SQMQDQAGLLFFIAVFWGFFPVFTAIFTFPQEK  1250
              LRI QVI+ A + G+LWWQ    TP S +QD+  LLFF +VFWGF+P++ A+FTFPQEK
Sbjct  396   KLRIFQVISVAFLGGLLWWQ----TPKSHIQDRTALLFFFSVFWGFYPLYNAVFTFPQEK  451

Query  1249  AMLSKERAADMYRLSAYFAARTTSdlpldlllpliflLVVYFMAGLKQDASSFLLTAVTV  1070
              ML KER++ MYRLS+YF ART  DLPL+L LP  F+ ++Y+M GLK DA++F+L+ + V
Sbjct  452   RMLIKERSSGMYRLSSYFMARTIGDLPLELALPTAFVFIIYWMGGLKPDATTFILSLLVV  511

Query  1069  FLCIVVAQGLGLAIGATLMDLKKATTLASVTVMTFMLAGGYFIKKVPGFIVWLRDLSFNY  890
                ++VAQGLGLA GA LM++K+ATTLASVT + F++AGGY+++ +P FIVWL+ LS++Y
Sbjct  512   LYSVLVAQGLGLAFGALLMNVKQATTLASVTTLVFLIAGGYYVQHIPPFIVWLKYLSYSY  571

Query  889   HTFKLLLKVQY--EHKTNSVNGVQIDSG----IKEVG---------ALAAMAVSYRLLAY  755
             + +KLLL +QY  +       GV    G    IK +G          +  M V YRLLAY
Sbjct  572   YCYKLLLGIQYTDDDVYECSKGVWCRVGDFPAIKSMGLHNLWVDVFVMGVMLVGYRLLAY  631

Query  754   ISLRRMKLQ  728
             ++L R+KL+
Sbjct  632   MALHRVKLR  640



>emb|CDP13689.1| unnamed protein product [Coffea canephora]
Length=679

 Score =   504 bits (1299),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 281/685 (41%), Positives = 406/685 (59%), Gaps = 104/685 (15%)
 Frame = -2

Query  2533  RPDESADSKP------------------FSDDENPEDLE-AGTKKKRSIPAEPTFPIYLK  2411
             RPDE  DS P                  +S + +  D+E A + +++  P     P+YLK
Sbjct  5     RPDEIEDSSPATLGSLQIAGSPEFMSQAYSINSSHIDIEDASSFEEKDCP----LPVYLK  60

Query  2410  FTEVSYKI------------------VIKGVTFSEE--KDILNGISGAVDPGEVLALMGP  2291
             F +V YK+                  V   ++F ++  K ILNGISG+V PGE+LALMGP
Sbjct  61    FADVEYKVKFSRASSNINIVTTVASKVASQLSFDQDNYKHILNGISGSVAPGEILALMGP  120

Query  2290  SGCGKTTLLSLLGGRIRDPSAGSITYNQHPYSKLLKSRIGFVTQDDILFPHLTVKETLIY  2111
             SG GKTTLL ++GGR+R+   G+ITYN  PYS  LK R+GFVTQDD+LFP LTV+ETL++
Sbjct  121   SGSGKTTLLKVIGGRLRERVKGTITYNDVPYSPALKKRVGFVTQDDVLFPQLTVEETLVF  180

Query  2110  AARLRLPRTLTKEEKDKRAMDVIYELGLDRCQDTMIGGSFVRGVSGGERKRVCIGNEIII  1931
             +A LRLP ++++ +K +R   ++ ELGL+RC+ T IGG FVRG+SGGERKR  IG EI++
Sbjct  181   SAFLRLPSSMSRNQKYERVDMIVKELGLERCRHTRIGGGFVRGISGGERKRTSIGYEILV  240

Query  1930  NPSLLFLDEPTSGLDSTTALRIVDILHEIAKAGKTVITTIHQPSSRLFHk----------  1781
             +PSLL LDEPTSGLDST+A RI+ IL  +AKAG+T++TTIHQPSSR+FH           
Sbjct  241   DPSLLLLDEPTSGLDSTSANRILQILQRLAKAGRTIVTTIHQPSSRIFHMFDKVLLIAQG  300

Query  1780  ----------------------fdklilleflldLANGNINDVSIPSELADKVQTWNSKE  1667
                                      +   EFLL+LA G ++D+S+P +L           
Sbjct  301   YPLYCGKAREAVEYFSSLRFIPEMAMNPAEFLLELAAGQVDDISVPEDL-----------  349

Query  1666  EPTRNNGKPSPAIVHEYLVGCYETRVAETEKKKLMAPLPVEEELKSKVRYLKREWGASWS  1487
              P          IV  +L   ++ ++   EK +      + E+L+  ++ +K++W  +W+
Sbjct  350   -PAPQGTAEYERIVIRFLHHKFKVQLEPKEKNENHNMSKISEQLRVAIQ-IKKDWTLTWT  407

Query  1486  EQYVLLFHRGIRERWHDYFSWLRITQVIATALILGMLWWQSGGDTPSQMQDQAGLLFFIA  1307
             +Q+++L  R  RER  DYF  +R+ Q +A A++LG+LWW+S   T +Q++DQ GLLF+I 
Sbjct  408   DQFMILLKRTYRERCRDYFDTIRLVQALAIAVLLGLLWWKSNFTTEAQLRDQIGLLFYIC  467

Query  1306  VFWGFFPVFTAIFTFPQEKAMLSKERAADMYRLSAYFAARTTSdlpldlllpliflLVVY  1127
             +FW    +F A++ FP EK  L KER ADMYRLS Y+   T  D+   +L P  F+ ++Y
Sbjct  468   IFWTSSSIFGAVYVFPFEKIFLVKERKADMYRLSVYYVCSTLCDMVAHILYPTFFMSILY  527

Query  1126  FMAGLKQDASSFLLTAVTVFLCIVVAQGLGLAIGATLMDLKKATTLASVTVMTFMLAGGY  947
             FMAG K+    F L+  T+ L  V +QG G   GA  M +K+A  +AS+ +M F+L GGY
Sbjct  528   FMAGFKRTIDCFFLSLSTILLIAVTSQGAGELFGAAAMSMKRAGMIASLVLMLFLLTGGY  587

Query  946   FIKKVPGFIVWLRDLSFNYHTFKLLLKVQYE----------------HKTNSVNGVQIDS  815
             +++ +P F+ WL+ +SF YH F+LLLKVQY+                  + S + V +D 
Sbjct  588   YVQHIPKFMKWLKYVSFMYHGFRLLLKVQYDGNELYECGSKVGCRTLQSSPSFDTVNLDG  647

Query  814   GIKEVGALAAMAVSYRLLAYISLRR  740
             G++EV  + AMA++YR+ AYI L R
Sbjct  648   GLEEVWIMLAMALAYRVGAYIFLNR  672



>ref|XP_006482405.1| PREDICTED: ABC transporter G family member 14-like [Citrus sinensis]
Length=637

 Score =   502 bits (1292),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 278/610 (46%), Positives = 391/610 (64%), Gaps = 51/610 (8%)
 Frame = -2

Query  2425  PIYLKFTEVSYKIVIK---------GVTFSEEKDILNGISGAVDPGEVLALMGPSGCGKT  2273
             PI LKF +V YK+ ++         G    +EK IL GI+G V PGE+LA++GPSG GKT
Sbjct  31    PITLKFEDVVYKVKLEQPIGFCTGTGTWGDKEKTILKGITGMVCPGELLAMLGPSGSGKT  90

Query  2272  TLLSLLGGRIRDPSAGSITYNQHPYSKLLKSRIGFVTQDDILFPHLTVKETLIYAARLRL  2093
             TLLS LGGR+     G ITYN  P+S  +K R GFV Q+DIL+PHLTV ETL++ A LRL
Sbjct  91    TLLSALGGRLHGKLTGKITYNDQPFSGSIKRRTGFVAQNDILYPHLTVTETLLFTALLRL  150

Query  2092  PRTLTKEEKDKRAMDVIYELGLDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLF  1913
             P +LT  EK +    VI ELGL RC+++MIGG  VRG+SGGE+KRV I  E++INP LL 
Sbjct  151   PNSLTYTEKYQHVEQVIAELGLTRCRNSMIGGPLVRGISGGEKKRVSIAQEMLINPCLLL  210

Query  1912  LDEPTSGLDSTTALRIVDILHEIAKAGKTVITTIHQPSSRLFHkfdklilleflldLANG  1733
             LDEPTSGLDSTTA RI+  +  +A +G+T+ITTIHQPSSRL+H FDK++LL     + NG
Sbjct  211   LDEPTSGLDSTTAQRILTTIKRLANSGRTIITTIHQPSSRLYHMFDKVVLLSEGSLIYNG  270

Query  1732  ------------------NINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVG  1607
                                +N   +  +LA+ V     +      N      +V E L  
Sbjct  271   PASTALEYFSSIGFSTSVTVNPADLLLDLANGVSPEYRQSTEQGENTDQDQKLVREALKS  330

Query  1606  CYETRVAETEKKKL--MAPLPVEEELKSKVRYLKR--EWGASWSEQYVLLFHRGIRERWH  1439
              YE  +A   K +L  +  +       +  +  ++  +W  SW  Q+ +L  RG+RER  
Sbjct  331   AYEKNIATKLKDELSNLGAIDCNSTKNASAKNGRKAEQWSTSWWHQFKVLLQRGVRERRF  390

Query  1438  DYFSWLRITQVIATALILGMLWWQSGGDTP-SQMQDQAGLLFFIAVFWGFFPVFTAIFTF  1262
             + F+ LRI QVI+ A++ G+LWW     TP S ++D+  LLFF +VFWGF+P++ A+FTF
Sbjct  391   EAFNKLRIFQVISVAVLGGLLWWH----TPTSHIEDRVALLFFFSVFWGFYPLYNAVFTF  446

Query  1261  PQEKAMLSKERAADMYRLSAYFAARTTSdlpldlllpliflLVVYFMAGLKQDASSFLLT  1082
             PQE+ ML KER++ MYRLS+YF ART  DLPL+L LP  F+ ++Y+M GLK D+ +F+L+
Sbjct  447   PQERTMLIKERSSGMYRLSSYFLARTFGDLPLELALPTAFVFIIYWMGGLKADSVTFILS  506

Query  1081  AVTVFLCIVVAQGLGLAIGATLMDLKKATTLASVTVMTFMLAGGYFIKKVPGFIVWLRDL  902
              + V   ++VAQGLGLAIGA LMD+K+ATTLASVT + F++AGGY+++++P FI+WL+ L
Sbjct  507   LLAVLYSVLVAQGLGLAIGAILMDVKQATTLASVTTLVFLMAGGYYVQQIPPFIIWLKYL  566

Query  901   SFNYHTFKLLLKVQYEHKTN---------------SVNGVQIDSGIKEVGALAAMAVSYR  767
             S++Y+ +K+LL +QY+                   +V  + +++   +V  +A M V YR
Sbjct  567   SYSYYCYKMLLGIQYDDDDYYECSKGELCRVADYPAVRSMGLNNLWADVCIMALMLVGYR  626

Query  766   LLAYISLRRM  737
             L+AY++LRR+
Sbjct  627   LIAYMALRRV  636



>gb|KDO72270.1| hypothetical protein CISIN_1g039221mg [Citrus sinensis]
Length=637

 Score =   500 bits (1288),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 278/610 (46%), Positives = 390/610 (64%), Gaps = 51/610 (8%)
 Frame = -2

Query  2425  PIYLKFTEVSYKIVIK---------GVTFSEEKDILNGISGAVDPGEVLALMGPSGCGKT  2273
             PI LKF +V YK+ ++         G    +EK IL GI+G V PGE+LA++GPSG GKT
Sbjct  31    PITLKFEDVVYKVKLEQPIGFCTGTGTWGDKEKTILKGITGMVCPGELLAMLGPSGSGKT  90

Query  2272  TLLSLLGGRIRDPSAGSITYNQHPYSKLLKSRIGFVTQDDILFPHLTVKETLIYAARLRL  2093
             TLLS LGGR+     G ITYN  P+S  +K R GFV Q+DIL+PHLTV ETL++ A LRL
Sbjct  91    TLLSALGGRLHGKLTGKITYNDQPFSGSIKRRTGFVAQNDILYPHLTVTETLLFTALLRL  150

Query  2092  PRTLTKEEKDKRAMDVIYELGLDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLF  1913
             P +LT  EK +    VI ELGL RC+++MIGG  VRG+SGGE+KRV I  E++INP LL 
Sbjct  151   PNSLTYTEKYQHVEQVIAELGLTRCRNSMIGGPLVRGISGGEKKRVSIAQEMLINPCLLL  210

Query  1912  LDEPTSGLDSTTALRIVDILHEIAKAGKTVITTIHQPSSRLFHkfdklilleflldLANG  1733
             LDEPTSGLDSTTA RI+  +  +A +G+T+ITTIHQPSSRL+H FDK++LL     + NG
Sbjct  211   LDEPTSGLDSTTAQRILTTIKRLANSGRTIITTIHQPSSRLYHMFDKVVLLSEGSLIYNG  270

Query  1732  ------------------NINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVG  1607
                                +N   +  +LA+ V     +      N       V E L  
Sbjct  271   PASTALEYFSSIGFSTSVTVNPADLLLDLANGVSPDYRQSTEQGENTDQDQKFVREALKS  330

Query  1606  CYETRVAETEKKKL--MAPLPVEEELKSKVRYLKR--EWGASWSEQYVLLFHRGIRERWH  1439
              YE  +A   K +L  +  +       +  +  ++  +W  SW  Q+ +L  RG+RER  
Sbjct  331   AYEKNIATKLKDELSNLGAIDCNSTKNASAKNGRKAEQWSTSWWHQFKVLLQRGVRERRF  390

Query  1438  DYFSWLRITQVIATALILGMLWWQSGGDTP-SQMQDQAGLLFFIAVFWGFFPVFTAIFTF  1262
             + F+ LRI QVI+ A++ G+LWW     TP S ++D+  LLFF +VFWGF+P++ A+FTF
Sbjct  391   EAFNKLRIFQVISVAVLGGLLWWH----TPTSHIEDRVALLFFFSVFWGFYPLYNAVFTF  446

Query  1261  PQEKAMLSKERAADMYRLSAYFAARTTSdlpldlllpliflLVVYFMAGLKQDASSFLLT  1082
             PQE+ ML KER++ MYRLS+YF ART  DLPL+L LP  F+ ++Y+M GLK D+ +F+L+
Sbjct  447   PQERTMLIKERSSGMYRLSSYFLARTFGDLPLELALPTAFVFIIYWMGGLKADSVTFILS  506

Query  1081  AVTVFLCIVVAQGLGLAIGATLMDLKKATTLASVTVMTFMLAGGYFIKKVPGFIVWLRDL  902
              + V   ++VAQGLGLAIGA LMD+K+ATTLASVT + F++AGGY+++++P FI+WL+ L
Sbjct  507   LLAVLYSVLVAQGLGLAIGAILMDVKQATTLASVTTLVFLMAGGYYVQQIPPFIIWLKYL  566

Query  901   SFNYHTFKLLLKVQYEHKTN---------------SVNGVQIDSGIKEVGALAAMAVSYR  767
             S++Y+ +K+LL +QY+                   +V  + +++   +V  +A M V YR
Sbjct  567   SYSYYCYKMLLGIQYDDDDYYECSKGELCRVADYPAVRSMGLNNLWADVCIMALMLVGYR  626

Query  766   LLAYISLRRM  737
             L+AY++LRR+
Sbjct  627   LIAYMALRRV  636



>ref|XP_010478591.1| PREDICTED: ABC transporter G family member 14 [Camelina sativa]
Length=649

 Score =   500 bits (1288),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 291/610 (48%), Positives = 398/610 (65%), Gaps = 52/610 (9%)
 Frame = -2

Query  2428  FPIYLKFTEVSYKIVIK-------GVTFSEEKDILNGISGAVDPGEVLALMGPSGCGKTT  2270
             +PI LKF EV YK+ I+       G   S+EK ILNGI+G V PGE+LA++GPSG GKTT
Sbjct  49    YPITLKFEEVVYKVKIEQTSSQCLGSWKSKEKTILNGITGMVCPGEILAMLGPSGSGKTT  108

Query  2269  LLSLLGGRIRDPSAGSITYNQHPYSKLLKSRIGFVTQDDILFPHLTVKETLIYAARLRLP  2090
             LLS LGGR+    +G + YN  P+S  +K R GFV QDD+L+PHLTV ETL + A LRLP
Sbjct  109   LLSALGGRLSKTFSGKVMYNGQPFSGCIKRRTGFVAQDDVLYPHLTVWETLFFTALLRLP  168

Query  2089  RTLTKEEKDKRAMDVIYELGLDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFL  1910
              +LT++EK +    VI ELGL+RC ++MIGG   RG+SGGE+KRV IG E++INPSLL L
Sbjct  169   SSLTRDEKAEHVDRVIAELGLNRCTNSMIGGPLFRGISGGEKKRVSIGQEMLINPSLLLL  228

Query  1909  DEPTSGLDSTTALRIVDILHEIAKAGKTVITTIHQPSSRLFHkfdklilleflldLANGN  1730
             DEPTSGLDSTTA RI+  +  +A  G+TV+TTIHQPSSR++H FDK++LL     +  G+
Sbjct  229   DEPTSGLDSTTAHRIITTIKRLASGGRTVVTTIHQPSSRIYHMFDKVVLLSEGSPIYYGS  288

Query  1729  ------------------INDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGC  1604
                               +N   +  +LA+ +   +S++E T    K     V E LV  
Sbjct  289   ASSAMEYFSSLGFSTSMTVNPADLLLDLANGIPP-DSQKETTEQEQK----TVKETLVSA  343

Query  1603  YETRVAETEKKKLM-APLPVEEELKSKVRYLKRE-WGASWSEQYVLLFHRGIRERWHDYF  1430
             YE  ++   K +L  A     E  K+  + LK E W  +W  Q+ +L  RG+RER  + F
Sbjct  344   YEKNISAKLKAELCNAESHSYEYTKAAAKNLKSEQWCTTWWYQFTVLLQRGVRERRFESF  403

Query  1429  SWLRITQVIATALILGMLWWQSGGDTP-SQMQDQAGLLFFIAVFWGFFPVFTAIFTFPQE  1253
             + LRI QVI+ A + G+LWW     TP S +QD+  LLFF +VFWGF+P++ A+FTFPQE
Sbjct  404   NKLRIFQVISVAFLGGLLWWH----TPKSHIQDRTALLFFFSVFWGFYPLYNAVFTFPQE  459

Query  1252  KAMLSKERAADMYRLSAYFAARTTSdlpldlllpliflLVVYFMAGLKQDASSFLLTAVT  1073
             K ML KER++ MYRLS+YF AR   DLPL+L LP  F+ ++Y+M GLK D ++F+L+ + 
Sbjct  460   KRMLIKERSSGMYRLSSYFMARNVGDLPLELALPTAFVFIIYWMGGLKPDPTTFILSLLV  519

Query  1072  VFLCIVVAQGLGLAIGATLMDLKKATTLASVTVMTFMLAGGYFIKKVPGFIVWLRDLSFN  893
             V   ++VAQGLGLA GA LM++K+ATTLASVT + F++AGGY+++++P FIVWL+ LS++
Sbjct  520   VLYSVLVAQGLGLAFGALLMNIKQATTLASVTTLVFLIAGGYYVQQIPPFIVWLKYLSYS  579

Query  892   YHTFKLLLKVQY--EHKTNSVNGVQIDSG----IKEVG---------ALAAMAVSYRLLA  758
             Y+ +KLLL +QY  +       GV    G    IK +G          +  M V YRL+A
Sbjct  580   YYCYKLLLGIQYTDDDYYECSKGVWCRVGDFPAIKSMGLNNLWIDVFVMGVMLVGYRLIA  639

Query  757   YISLRRMKLQ  728
             Y++L R+KL+
Sbjct  640   YMALHRVKLR  649



>ref|XP_006430907.1| hypothetical protein CICLE_v10011273mg [Citrus clementina]
 gb|ESR44147.1| hypothetical protein CICLE_v10011273mg [Citrus clementina]
Length=637

 Score =   500 bits (1287),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 278/610 (46%), Positives = 390/610 (64%), Gaps = 51/610 (8%)
 Frame = -2

Query  2425  PIYLKFTEVSYKIVIK---------GVTFSEEKDILNGISGAVDPGEVLALMGPSGCGKT  2273
             PI LKF +V YK+ ++         G   ++EK IL GI+G V PGE+LA++GPSG GKT
Sbjct  31    PITLKFEDVVYKVKLEQPIGFCTGTGTWGAKEKTILKGITGMVCPGELLAMLGPSGSGKT  90

Query  2272  TLLSLLGGRIRDPSAGSITYNQHPYSKLLKSRIGFVTQDDILFPHLTVKETLIYAARLRL  2093
             TLLS LGGR+     G ITYN  P+S  +K R GFV Q+DIL+PHLTV ETL++ A LRL
Sbjct  91    TLLSALGGRLHGKLTGKITYNDQPFSGSIKRRTGFVAQNDILYPHLTVTETLLFTALLRL  150

Query  2092  PRTLTKEEKDKRAMDVIYELGLDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLF  1913
             P +LT  EK +    VI ELGL RC+++MIGG  VRG+SGGE+KRV I  E++INP LL 
Sbjct  151   PNSLTYTEKYQHVEQVITELGLTRCRNSMIGGPLVRGISGGEKKRVSIAQEMLINPCLLL  210

Query  1912  LDEPTSGLDSTTALRIVDILHEIAKAGKTVITTIHQPSSRLFHkfdklilleflldLANG  1733
             LDEPTSGLDSTTA RI+  +  +A +G+T+ITTIHQPSSRL+H FDK++LL     + NG
Sbjct  211   LDEPTSGLDSTTAQRILTTIKRLANSGRTIITTIHQPSSRLYHMFDKVVLLSEGSLIYNG  270

Query  1732  ------------------NINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVG  1607
                                +N   +  +LA+ V     +      N       V E L  
Sbjct  271   PASTALEYFSSIGFSTSVTVNPADLLLDLANGVSPDYRQSTEQGENTDQDQKFVREALKS  330

Query  1606  CYETRVAETEKKKL--MAPLPVEEELKSKVRYLKR--EWGASWSEQYVLLFHRGIRERWH  1439
              YE  +A   K +L  +  +       +  +  ++  +W  SW  Q+ +L  RG+RER  
Sbjct  331   AYEKNIATKLKDELSNLGAIDCNSTKNASAKNGRKAEQWSTSWWHQFKVLLQRGVRERRF  390

Query  1438  DYFSWLRITQVIATALILGMLWWQSGGDTP-SQMQDQAGLLFFIAVFWGFFPVFTAIFTF  1262
             + F+ LRI QVI+ A++ G+LWW     TP S ++D+  LLFF +VFWGF+P++ A+FTF
Sbjct  391   EAFNKLRIFQVISVAVLGGLLWWH----TPTSHIEDRVALLFFFSVFWGFYPLYNAVFTF  446

Query  1261  PQEKAMLSKERAADMYRLSAYFAARTTSdlpldlllpliflLVVYFMAGLKQDASSFLLT  1082
             PQE+ ML KER++ MYRLS+YF ART  DLPL+L LP  F+ ++Y+M GLK D  +F+L+
Sbjct  447   PQERTMLIKERSSGMYRLSSYFLARTFGDLPLELALPTAFVFIIYWMGGLKADPVTFILS  506

Query  1081  AVTVFLCIVVAQGLGLAIGATLMDLKKATTLASVTVMTFMLAGGYFIKKVPGFIVWLRDL  902
              + V   ++VAQGLGLAIGA LMD+K+ATTLASVT + F++AGGY+++++P FI+WL+ L
Sbjct  507   LLAVLYSVLVAQGLGLAIGAILMDVKQATTLASVTTLVFLMAGGYYVQQIPPFIIWLKYL  566

Query  901   SFNYHTFKLLLKVQYEHKTN---------------SVNGVQIDSGIKEVGALAAMAVSYR  767
             S++Y+ +K+LL +QY+                   +V  + +++   +V  +A M V YR
Sbjct  567   SYSYYCYKMLLGIQYDDDDYYECSKGELCRVADYPAVRSMGLNNLWADVCIMALMLVGYR  626

Query  766   LLAYISLRRM  737
             L+AY++LRR+
Sbjct  627   LIAYMALRRV  636



>ref|XP_011095584.1| PREDICTED: ABC transporter G family member 26 [Sesamum indicum]
Length=687

 Score =   501 bits (1291),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 278/642 (43%), Positives = 387/642 (60%), Gaps = 83/642 (13%)
 Frame = -2

Query  2455  KRSIPA---EPTFPIYLKFTEVSYKIVIKG-------------------VTFSEEKDILN  2342
             +  IPA   +   PI+LKF +V +K+ ++                    +     K IL 
Sbjct  52    EEEIPATSQDRPLPIFLKFADVEFKVKVRNSPSVNPVKSVVSKVAVQLNIEQDNYKQILK  111

Query  2341  GISGAVDPGEVLALMGPSGCGKTTLLSLLGGRIRDPSAGSITYNQHPYSKLLKSRIGFVT  2162
             GI+G+  PGE LALMGPSG GKTTLL +LGGR+ +   G++TYN   Y+  LK RIGFVT
Sbjct  112   GITGSTGPGETLALMGPSGSGKTTLLKILGGRLHENVRGTVTYNDVSYNAALKRRIGFVT  171

Query  2161  QDDILFPHLTVKETLIYAARLRLPRTLTKEEKDKRAMDVIYELGLDRCQDTMIGGSFVRG  1982
             QDD+LFP L+V+ETL++AA LRLP  +++ +K +R   ++ ELGL+RC+ T IGG F++G
Sbjct  172   QDDVLFPQLSVEETLVFAAFLRLPSGMSRRQKYERVELIVKELGLERCRHTRIGGGFLKG  231

Query  1981  VSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILHEIAKAGKTVITTIHQP  1802
             +SGGERKR  IG+EI+++PSLL LDEPTSGLDST+A RI+ IL  +AK G+TVITTIHQP
Sbjct  232   ISGGERKRTSIGHEILVDPSLLLLDEPTSGLDSTSANRILQILQGLAKVGRTVITTIHQP  291

Query  1801  SSRLFHk--------------------------------fdklilleflldLANGNINDV  1718
             SSR+FH                                    +   EFLLDLA G +ND+
Sbjct  292   SSRMFHMFDKVLLISEGYPIYYGKASDSMEYFSSLRFVPELAMNPAEFLLDLATGQVNDI  351

Query  1717  SIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYETRVAETEKKKLMAPLPVEEE  1538
             S+P EL +  +T   ++            +V  YL   Y+  +   EK++    L V E 
Sbjct  352   SVPEELFESQETAEFEK------------VVIRYLQRKYKVELEPKEKEENHQALKVPER  399

Query  1537  LKSKVRYLKREWGASWSEQYVLLFHRGIRERWHDYFSWLRITQVIATALILGMLWWQSGG  1358
             L+  V+ +K++W  SWSEQ+ +LF R  +ERW DYF  LR+ Q    A++LG+LWW+S  
Sbjct  400   LQLAVQ-VKKDWTLSWSEQFTILFKRTFKERWRDYFDQLRLIQAFGVAVLLGLLWWKSST  458

Query  1357  DTPSQMQDQAGLLFFIAVFWGFFPVFTAIFTFPQEKAMLSKERAADMYRLSAYFAARTTS  1178
              T +Q++DQ GLLF+I +FW    +F A++ FP EK  L KER ADMYRLS Y+   T S
Sbjct  459   ATEAQLRDQIGLLFYICIFWTSSSIFGAVYVFPFEKIFLVKERKADMYRLSVYYVCSTLS  518

Query  1177  dlpldlllpliflLVVYFMAGLKQDASSFLLTAVTVFLCIVVAQGLGLAIGATLMDLKKA  998
             D+   LL P  F+ ++YFMAG K+    F LT   + L  V +QG G   GA +M +K+A
Sbjct  519   DMVAHLLYPTFFMCILYFMAGFKRTVECFFLTLSAILLVAVTSQGAGELFGAAVMSIKRA  578

Query  997   TTLASVTVMTFMLAGGYFIKKVPGFIVWLRDLSFNYHTFKLLLKVQY--------EHKTN  842
               +AS+ +M F+L GGY+++ +P F+ WL+ +SF Y+ F+LL+KVQY        E K+ 
Sbjct  579   GMIASLILMLFLLTGGYYVQHIPKFMQWLKYVSFMYYGFRLLVKVQYSGDQLYECESKSG  638

Query  841   --------SVNGVQIDSGIKEVGALAAMAVSYRLLAYISLRR  740
                     S + V ++ G++EV  L  MAV+YRL AYI LRR
Sbjct  639   CRRLQSSPSFDTVNLEGGLREVWILLTMAVAYRLCAYICLRR  680



>ref|XP_006878615.1| hypothetical protein AMTR_s00011p00258490 [Amborella trichopoda]
 gb|ERM94760.1| hypothetical protein AMTR_s00011p00258490 [Amborella trichopoda]
Length=648

 Score =   499 bits (1286),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 283/610 (46%), Positives = 405/610 (66%), Gaps = 48/610 (8%)
 Frame = -2

Query  2425  PIYLKFTEVSYKI-VIKGVTFSE-----EKDILNGISGAVDPGEVLALMGPSGCGKTTLL  2264
             P+ LKF +V YK+ + +G          EK IL G++G V PGE+LA++GPSG GKTTLL
Sbjct  43    PVTLKFEDVGYKVKLAQGECLPTRKLIVEKTILTGLTGIVSPGEILAMLGPSGSGKTTLL  102

Query  2263  SLLGGRIRDPSAGSITYNQHPYSKLLKSRIGFVTQDDILFPHLTVKETLIYAARLRLPRT  2084
             + LGGR+    +G +TYN HP+S  +K RIGFVTQDD+L+ HLTV ETL +AA LRLP +
Sbjct  103   TALGGRLPGKHSGFVTYNNHPFSSSMKRRIGFVTQDDVLYAHLTVSETLTFAALLRLPDS  162

Query  2083  LTKEEKDKRAMDVIYELGLDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDE  1904
             +T+ +K ++A  V+ +LGL +C++T+IGG  +RGVSGGERKRV IG E+++NPSLL LDE
Sbjct  163   ITRAKKLEQAEHVLNQLGLSKCKNTIIGGPLLRGVSGGERKRVSIGQEMLVNPSLLLLDE  222

Query  1903  PTSGLDSTTALRIVDILHEIAKAGKTVITTIHQPSSRLFHkfdklilleflldLANGN--  1730
             PTSGLDSTTA++I+ ++  +AK G+TV+TTIHQPSSRL+H FDK+++L     + +G   
Sbjct  223   PTSGLDSTTAMKILTMVKGLAKGGRTVVTTIHQPSSRLYHMFDKVVVLSEGAPIYHGQAS  282

Query  1729  ----------------INDVSIPSELADKV--QTWNSKEEPTRNN-GKPSPAIVHEYLVG  1607
                             +N      +LA+ +     +S+++   N+  +  P +VH+ L+ 
Sbjct  283   VAMGYFAAVGFSTPVAMNPADFLLDLANGIPPSKIDSEDQGEGNSLEEQDPKLVHQLLIS  342

Query  1606  CYETRVAETEKKKLMA--PLPVEEELKSKVRYLKREWGASWSEQYVLLFHRGIRERWHDY  1433
              Y   ++   K +L +    P +  +  + R ++ EWG SW EQ  +L  RG++ER H+ 
Sbjct  343   AYNENISPRLKAELRSTPSTPNQYSVACRSR-VEEEWGTSWWEQVRVLLKRGLKERKHEA  401

Query  1432  FSWLRITQVIATALILGMLWWQSGGDTPSQMQDQAGLLFFIAVFWGFFPVFTAIFTFPQE  1253
             FS LRI QV   +++ G+LWW S   T S +QDQ GLLFF ++FWGFFP+F A+F FPQE
Sbjct  402   FSGLRIFQVTTVSILSGLLWWHS---TISHIQDQIGLLFFYSIFWGFFPLFHAVFAFPQE  458

Query  1252  KAMLSKE-RAADMYRLSAYFAARTTSdlpldlllpliflLVVYFMAGLKQDASSFLLTAV  1076
             +A+L KE R +  YRLS+YF ART  DLP +L LP +F+L+ YF  GLK   ++F LT +
Sbjct  459   RAILMKEQRTSSYYRLSSYFTARTLGDLPTELALPTLFVLLSYFTGGLKPTFTNFTLTLL  518

Query  1075  TVFLCIVVAQGLGLAIGATLMDLKKATTLASVTVMTFMLAGGYFIKKVPGFIVWLRDLSF  896
              + L ++V+QGLGLA+GA LMD+KK TTLASV  + F+LAGGY++++VP FI WL+ +SF
Sbjct  519   VILLNVLVSQGLGLALGAVLMDVKKGTTLASVITLVFLLAGGYYVQRVPSFIAWLKYVSF  578

Query  895   NYHTFKLLLKVQYEH--------------KTNSVNGVQIDSGIKEVGALAAMAVSYRLLA  758
             +Y+ +KLLL VQY                   +V  V + +  ++VGAL  M V YRL+A
Sbjct  579   SYYCYKLLLGVQYGEGDVYGCGTGLCRVVDLPAVANVGVGNKGRDVGALVVMMVGYRLIA  638

Query  757   YISLRRMKLQ  728
             Y +LRR+K++
Sbjct  639   YAALRRLKVR  648



>ref|XP_009607601.1| PREDICTED: ABC transporter G family member 9-like [Nicotiana 
tomentosiformis]
Length=631

 Score =   499 bits (1284),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 290/621 (47%), Positives = 396/621 (64%), Gaps = 46/621 (7%)
 Frame = -2

Query  2482  EDLEAGTKKKRSIPAEPTFPIYLKFTEVSYKI------VIKGVTFSEEKDILNGISGAVD  2321
             ++L A   K  +I  +   P+ LKF  V YKI       IK     EEK IL G+SG V 
Sbjct  13    QNLRADQSKSAAIFKKSNRPVTLKFENVVYKIKLVKEGCIKSSKSEEEKIILKGVSGIVS  72

Query  2320  PGEVLALMGPSGCGKTTLLSLLGGRIRDPSA-GSITYNQHPYSKLLKSRIGFVTQDDILF  2144
             PGE+LA++GPSG GKTTLL+ LGGR+   +  G+ITYN  P+S  +K   GFVTQDD+L+
Sbjct  73    PGEMLAILGPSGSGKTTLLTGLGGRLVHGNLDGAITYNNKPFSNAMKRNTGFVTQDDVLY  132

Query  2143  PHLTVKETLIYAARLRLPRTLTKEEKDKRAMDVIYELGLDRCQDTMIGGSFVRGVSGGER  1964
             PHLTV ETL++ A LRLP TLT +EK   A  +I +LGL RC+D++IG   +RG+SGGER
Sbjct  133   PHLTVTETLVFTALLRLPGTLTVQEKTAHAEAIITQLGLTRCKDSIIGSPLLRGISGGER  192

Query  1963  KRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILHEIAKAGKTVITTIHQPSSRLFH  1784
             KRV IG E++INPSLLFLDEPTSGLDSTTA RIV  L ++ K G+T++ TIHQPSSRLF+
Sbjct  193   KRVSIGQEMLINPSLLFLDEPTSGLDSTTAQRIVSTLRDLVKGGRTIVMTIHQPSSRLFY  252

Query  1783  kfdklillefll-------dLANGNINDVSI-------PSELADKVQTWNSKEEPTRNNG  1646
              F+K++LL           + A G  + V         PS+    +      ++P   + 
Sbjct  253   MFNKVLLLSEGNPLYFGRGEDAMGYFSGVGFSPLVAMNPSDFLLDLSNGILSDDPRITSD  312

Query  1645  KPS--PAIVHEYLVGCYETRVAETEKKKLMAPLPVEEELKSKVRYLK-REWGASWSEQYV  1475
              P   PA + + LV  + T +AE  K++L      E ++  K+   K  +W  +W +Q+ 
Sbjct  313   DPGEDPASIKQTLVAAFRTNLAENLKEQLQQ--FDEHQVADKLHEKKFNQWSNTWWQQFS  370

Query  1474  LLFHRGIRERWHDYFSWLRITQVIATALILGMLWWQSGGDTPSQMQDQAGLLFFIAVFWG  1295
             +LF RG++ER H+ FS L++ QV+  + + G+LWW+S     S +QDQ GLLFF + FW 
Sbjct  371   VLFRRGMKERKHESFSGLKVGQVLVVSFLCGLLWWKS-----SNLQDQIGLLFFYSNFWE  425

Query  1294  FFPVFTAIFTFPQEKAMLSKERAADMYRLSAYFAARTTSdlpldlllpliflLVVYFMAG  1115
             F+P+F AIFTFPQE+ ML KER++ MYRLSAYF ART  DLP++L+LP IF+++ YFMAG
Sbjct  426   FYPMFQAIFTFPQERMMLEKERSSGMYRLSAYFIARTVGDLPMELVLPTIFVVITYFMAG  485

Query  1114  LKQDASSFLLTAVTVFLCIVVAQGLGLAIGATLMDLKKATTLASVTVMTFMLAGGYFIKK  935
             LK  A  F  T   +   ++V+QGLGLAIGA +MD K AT L SV +++F LAGGYF++ 
Sbjct  486   LKLSAGHFFSTLFALLYNVLVSQGLGLAIGAMVMDQKSATILGSVIMLSFTLAGGYFVQH  545

Query  934   VPGFIVWLRDLSFNYHTFKLLLKVQY---EHKTNSVNG---VQIDSGIKEVG--------  797
             VP FI W++ +S + + +KLLL  QY   E  T ++N    V+    IK +G        
Sbjct  546   VPSFIAWIKYVSISQYAYKLLLGSQYSPGETYTCAINATCLVEDFPSIKTIGLGGKGISV  605

Query  796   -ALAAMAVSYRLLAYISLRRM  737
              ALA M + YR LAY++L R+
Sbjct  606   VALAIMLLGYRFLAYVALMRI  626



>ref|XP_002519942.1| ATP-binding cassette transporter, putative [Ricinus communis]
 gb|EEF42546.1| ATP-binding cassette transporter, putative [Ricinus communis]
Length=634

 Score =   499 bits (1284),  Expect = 4e-160, Method: Compositional matrix adjust.
 Identities = 286/627 (46%), Positives = 403/627 (64%), Gaps = 59/627 (9%)
 Frame = -2

Query  2458  KKRSIPAEPTFPIYLKFTEVSYKIVIK-------GVTFSEEKDILNGISGAVDPGEVLAL  2300
              ++S+     +PI LKF EV YK+ ++       G   ++EK ILNGI+G V PGE+LA+
Sbjct  17    NQQSVLQLTVYPITLKFEEVVYKVKLEQKGSCCGGTWATKEKTILNGITGMVCPGEILAM  76

Query  2299  MGPSGCGKTTLLSLLGGRIRDPSAGSITYNQHPYSKLLKSRIGFVTQDDILFPHLTVKET  2120
             +GPSG GKTTLL+ LGGR+    +G ITYN  P+S   K R GFV QDDIL+PHLTV ET
Sbjct  77    LGPSGSGKTTLLTALGGRLNGKLSGKITYNGQPFSGATKRRTGFVPQDDILYPHLTVTET  136

Query  2119  LIYAARLRLPRTLTKEEKDKRAMDVIYELGLDRCQDTMIGGSFVRGVSGGERKRVCIGNE  1940
             L++ A LRLP+TLTK+EK +    +I ELGL RCQ++MIGG   RG+SGGE+KRV IG E
Sbjct  137   LLFTALLRLPKTLTKDEKLQHVQRIIAELGLTRCQNSMIGGPLFRGISGGEKKRVSIGQE  196

Query  1939  IIINPSLLFLDEPTSGLDSTTALRIVDILHEIAKAGKTVITTIHQPSSRLFHkfdklill  1760
             ++INPSLL LDEPTSGLDSTTA RI+ I+  +A  G+TV+TTIHQPSSRL+H FDK+ILL
Sbjct  197   MLINPSLLLLDEPTSGLDSTTAQRIITIIKRLASGGRTVVTTIHQPSSRLYHMFDKVILL  256

Query  1759  eflldLANGN------------------INDVSIPSELADKVQTWNSKEEPTRNNGKPSP  1634
                  +  G+                  IN   +  +LA+ +   +        N +   
Sbjct  257   SEGSPIYYGSASSALDYFSSIGFSTSMTINPADLLLDLANGIAPDSKTTTEQGENTEQEQ  316

Query  1633  AIVHEYLVGCYETRVAETEKKKLMA----PLPVEEELKSKVRYLKREWGASWSEQYVLLF  1466
              +V E L+  +E  ++   K +L +         ++  ++      +W  SW  Q+ +LF
Sbjct  317   KLVKETLISAFEKNISTRLKAELCSTDANSYNYTKDGLARTDTKSEQWCTSWWHQFKVLF  376

Query  1465  HRGIRERWHDYFSWLRITQVIATALILGMLWWQSGGDTP-SQMQDQAGLLFFIAVFWGFF  1289
              RG+RER ++ F+ LRI QV + A++ G+LWW+    TP S +QD+  LLFF +VFWGF+
Sbjct  377   QRGLRERRYESFNRLRIFQVTSVAILGGLLWWR----TPASHIQDRIALLFFFSVFWGFY  432

Query  1288  PVFTAIFTFPQEKAMLSKERAADMYRLSAYFAARTTSdlpldlllpliflLVVYFMAGLK  1109
             P++ A+FTFPQE+ ML KERA+ MY LS+YF ART  DLPL+L LP  F+ ++Y+M GLK
Sbjct  433   PLYNAVFTFPQERRMLIKERASGMYHLSSYFLARTFGDLPLELALPTAFVFIIYWMGGLK  492

Query  1108  QDASSFLLTAVTVFLCIVVAQGLGLAIGATLMDLKKATTLASVTVMTFMLAGGYFIKKVP  929
              D  +F+L+ + V   ++V+Q LGLA+GA LMD+K+ATTLASVT + F++AGGY+++++P
Sbjct  493   ADPITFILSLLVVLYNVLVSQSLGLALGAILMDIKQATTLASVTTLVFLIAGGYYVQQIP  552

Query  928   GFIVWLRDLSFNYHTFKLLLKVQYEH--------------------KTNSVNGVQIDSGI  809
              FIVWL+ +S++Y+ +KLLL VQY                      K+  +N + ID   
Sbjct  553   SFIVWLKYVSYSYYCYKLLLGVQYREDDYYECSKGVLCRVGDFPAVKSMGLNHLWID---  609

Query  808   KEVGALAAMAVSYRLLAYISLRRMKLQ  728
               V  +A M V YRL+AY++L R++L+
Sbjct  610   --VCIMALMLVGYRLIAYLALSRVQLR  634



>emb|CDY47690.1| BnaCnng15320D [Brassica napus]
Length=641

 Score =   498 bits (1283),  Expect = 6e-160, Method: Compositional matrix adjust.
 Identities = 297/644 (46%), Positives = 405/644 (63%), Gaps = 53/644 (8%)
 Frame = -2

Query  2533  RPDESADSKPFSDDENPEDLEAGTKKKRSIPAEPTFPIYLKFTEVSYKIVIK------GV  2372
             RP+ES   +     +   D+     K         +PI LKF EV YK+ I+      G 
Sbjct  9     RPEESGSGEAMV--QGLTDMSETQSKSVQGLQLSMYPITLKFEEVVYKVKIEQTGQCLGS  66

Query  2371  TFSEEKDILNGISGAVDPGEVLALMGPSGCGKTTLLSLLGGRIRDPSAGSITYNQHPYSK  2192
                +EK ILNGI+G V PGE+LA++GPSG GKTTLLS LGGR+    +G + YN  P+S 
Sbjct  67    WSCKEKTILNGITGMVCPGEILAMLGPSGSGKTTLLSALGGRLSKTFSGKVMYNGQPFSG  126

Query  2191  LLKSRIGFVTQDDILFPHLTVKETLIYAARLRLPRTLTKEEKDKRAMDVIYELGLDRCQD  2012
              +K R GFV QDDIL+PHLTV ETL + A LRLP +LT++EK +    VI ELGL RC +
Sbjct  127   CIKRRTGFVAQDDILYPHLTVWETLFFTALLRLPSSLTRDEKAEHVDRVITELGLTRCTN  186

Query  2011  TMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILHEIAKAG  1832
             +MIGG   RG+SGGE+KRV IG E++INPSLL LDEPTSGLDSTTA RIV  +  +A  G
Sbjct  187   SMIGGPLFRGISGGEKKRVSIGQEMLINPSLLLLDEPTSGLDSTTAHRIVTTIKRLASGG  246

Query  1831  KTVITTIHQPSSRLFHkfdklilleflldLANG------------------NINDVSIPS  1706
             +TV+TTIHQPSSR++H FDK++LL     +  G                   +N   +  
Sbjct  247   RTVVTTIHQPSSRIYHMFDKVVLLSEGSPIYYGPASSAMEYFSSVGFSTTMTVNPADLLL  306

Query  1705  ELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYETRVAETEKKKLM-APLPVEEELKS  1529
             +LA+ +   +S++E +    K     V E LV  YE  ++   K +L  A     E  K+
Sbjct  307   DLANGIPP-DSQKETSEQEQK----TVKETLVSAYEKNISTKLKAELCNADSHSYEYTKA  361

Query  1528  KVRYLKRE-WGASWSEQYVLLFHRGIRERWHDYFSWLRITQVIATALILGMLWWQSGGDT  1352
               + +K E W  +W  Q+ +L  RG+RER  + F+ LRI QVI+ A + G+LWW     T
Sbjct  362   AAKSIKSEQWCTTWWYQFTVLLQRGVRERRFESFNKLRIFQVISVAFLGGLLWWH----T  417

Query  1351  P-SQMQDQAGLLFFIAVFWGFFPVFTAIFTFPQEKAMLSKERAADMYRLSAYFAARTTSd  1175
             P S +QD+  LLFF +VFWGF+P++ A+FTFPQEK ML KER++ MYRLS+YF AR   D
Sbjct  418   PKSHLQDRTALLFFFSVFWGFYPLYNAVFTFPQEKRMLIKERSSGMYRLSSYFMARNIGD  477

Query  1174  lpldlllpliflLVVYFMAGLKQDASSFLLTAVTVFLCIVVAQGLGLAIGATLMDLKKAT  995
             LPL+L LP  F+ ++Y+M GLK D ++F+L+ + V   ++VAQGLGLA GA LM++K+AT
Sbjct  478   LPLELALPTAFVFIIYWMGGLKPDPTTFILSLLVVLYSVLVAQGLGLAFGALLMNIKQAT  537

Query  994   TLASVTVMTFMLAGGYFIKKVPGFIVWLRDLSFNYHTFKLLLKVQY--EHKTNSVNGVQI  821
             TLASVT + F++AGGY+++++P FIVWL+ LS++Y+ +KLLL +QY  E       GV  
Sbjct  538   TLASVTTLVFLIAGGYYVQQIPPFIVWLKYLSYSYYCYKLLLGIQYTDEDYYECSEGVWC  597

Query  820   D----SGIKEVG---------ALAAMAVSYRLLAYISLRRMKLQ  728
                   GIK +G          +  M V YRL+AY++L R+KL+
Sbjct  598   RVGDFPGIKAMGLNNLWIDVLVMGVMLVGYRLMAYMALHRVKLR  641



>ref|XP_009145231.1| PREDICTED: ABC transporter G family member 14-like [Brassica 
rapa]
 emb|CDY50951.1| BnaA05g36020D [Brassica napus]
Length=641

 Score =   498 bits (1283),  Expect = 6e-160, Method: Compositional matrix adjust.
 Identities = 297/644 (46%), Positives = 405/644 (63%), Gaps = 53/644 (8%)
 Frame = -2

Query  2533  RPDESADSKPFSDDENPEDLEAGTKKKRSIPAEPTFPIYLKFTEVSYKIVIK------GV  2372
             RP+ES   +     +   D+     K         +PI LKF EV YK+ I+      G 
Sbjct  9     RPEESGSGEAMV--QGLTDMSETQSKSVQGLQLSMYPITLKFEEVVYKVKIEQTGQCLGS  66

Query  2371  TFSEEKDILNGISGAVDPGEVLALMGPSGCGKTTLLSLLGGRIRDPSAGSITYNQHPYSK  2192
                +EK ILNGI+G V PGE+LA++GPSG GKTTLLS LGGR+    +G + YN  P+S 
Sbjct  67    WSCKEKTILNGITGMVCPGEILAMLGPSGSGKTTLLSALGGRLSKTFSGKVMYNGQPFSG  126

Query  2191  LLKSRIGFVTQDDILFPHLTVKETLIYAARLRLPRTLTKEEKDKRAMDVIYELGLDRCQD  2012
              +K R GFV QDDIL+PHLTV ETL + A LRLP +LT++EK +    VI ELGL RC +
Sbjct  127   CIKRRTGFVAQDDILYPHLTVWETLFFTALLRLPSSLTRDEKAEHVDRVISELGLTRCTN  186

Query  2011  TMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILHEIAKAG  1832
             +MIGG   RG+SGGE+KRV IG E++INPSLL LDEPTSGLDSTTA RIV  +  +A  G
Sbjct  187   SMIGGPLFRGISGGEKKRVSIGQEMLINPSLLLLDEPTSGLDSTTAHRIVTTIKRLASGG  246

Query  1831  KTVITTIHQPSSRLFHkfdklilleflldLANG------------------NINDVSIPS  1706
             +TV+TTIHQPSSR++H FDK++LL     +  G                   +N   +  
Sbjct  247   RTVVTTIHQPSSRIYHMFDKVVLLSEGSPIYYGPASSAMEYFSSVGFSTTMTVNPADLLL  306

Query  1705  ELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYETRVAETEKKKLM-APLPVEEELKS  1529
             +LA+ +   +S++E +    K     V E LV  YE  ++   K +L  A     E  K+
Sbjct  307   DLANGIPP-DSQKETSEQEQK----TVKETLVSAYEKNISTKLKAELCNADSHSYEYTKA  361

Query  1528  KVRYLKRE-WGASWSEQYVLLFHRGIRERWHDYFSWLRITQVIATALILGMLWWQSGGDT  1352
               + +K E W  +W  Q+ +L  RG+RER  + F+ LRI QVI+ A + G+LWW     T
Sbjct  362   AAKSIKSEQWCTTWWYQFTVLLQRGVRERRFESFNKLRIFQVISVAFLGGLLWWH----T  417

Query  1351  P-SQMQDQAGLLFFIAVFWGFFPVFTAIFTFPQEKAMLSKERAADMYRLSAYFAARTTSd  1175
             P S +QD+  LLFF +VFWGF+P++ A+FTFPQEK ML KER++ MYRLS+YF AR   D
Sbjct  418   PKSHLQDRTALLFFFSVFWGFYPLYNAVFTFPQEKRMLIKERSSGMYRLSSYFMARNIGD  477

Query  1174  lpldlllpliflLVVYFMAGLKQDASSFLLTAVTVFLCIVVAQGLGLAIGATLMDLKKAT  995
             LPL+L LP  F+ ++Y+M GLK D ++F+L+ + V   ++VAQGLGLA GA LM++K+AT
Sbjct  478   LPLELALPTAFVFIIYWMGGLKPDPTTFILSLLVVLYSVLVAQGLGLAFGALLMNIKQAT  537

Query  994   TLASVTVMTFMLAGGYFIKKVPGFIVWLRDLSFNYHTFKLLLKVQY--EHKTNSVNGVQI  821
             TLASVT + F++AGGY+++++P FIVWL+ LS++Y+ +KLLL +QY  E       GV  
Sbjct  538   TLASVTTLVFLIAGGYYVQQIPPFIVWLKYLSYSYYCYKLLLGIQYSDEDYYECSEGVWC  597

Query  820   D----SGIKEVG---------ALAAMAVSYRLLAYISLRRMKLQ  728
                   GIK +G          +  M V YRL+AY++L R+KL+
Sbjct  598   RVGDFPGIKAMGLNNLWIDVLVMGVMLVGYRLMAYMALHRVKLR  641



>ref|XP_010499718.1| PREDICTED: ABC transporter G family member 14-like [Camelina 
sativa]
Length=649

 Score =   498 bits (1282),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 291/610 (48%), Positives = 396/610 (65%), Gaps = 52/610 (9%)
 Frame = -2

Query  2428  FPIYLKFTEVSYKIVIK-------GVTFSEEKDILNGISGAVDPGEVLALMGPSGCGKTT  2270
             +PI LKF EV YK+ I+       G   S+EK ILNGI+G V PGE+LA++GPSG GKTT
Sbjct  49    YPITLKFEEVVYKVKIEQTSSQCLGSWKSKEKTILNGITGMVCPGEILAMLGPSGSGKTT  108

Query  2269  LLSLLGGRIRDPSAGSITYNQHPYSKLLKSRIGFVTQDDILFPHLTVKETLIYAARLRLP  2090
             LLS LGGR+    +G + YN  P+S  +K R GFV QDD+L+PHLTV ETL + A LRLP
Sbjct  109   LLSALGGRLSKTFSGKVMYNGQPFSGCIKRRTGFVAQDDVLYPHLTVWETLFFTALLRLP  168

Query  2089  RTLTKEEKDKRAMDVIYELGLDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFL  1910
              +LT++EK +    VI ELGL RC ++MIGG   RG+SGGE KRV IG E++INPSLL L
Sbjct  169   SSLTRDEKAEHVDRVIAELGLTRCTNSMIGGPLFRGISGGEMKRVSIGQEMLINPSLLLL  228

Query  1909  DEPTSGLDSTTALRIVDILHEIAKAGKTVITTIHQPSSRLFHkfdklilleflldLANGN  1730
             DEPTSGLDSTTA RI+  +  +A  G+TV+TTIHQPSSR++H FDK++LL     +  G+
Sbjct  229   DEPTSGLDSTTAHRIITTIKRLASGGRTVVTTIHQPSSRIYHMFDKVVLLSEGSPIYYGS  288

Query  1729  ------------------INDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGC  1604
                               +N   +  +LA+ +   +S++E T    K     V E LV  
Sbjct  289   ASSAMEYFSSLGFSTSMTVNPADLLLDLANGIPP-DSQKETTEQEQK----TVKETLVSA  343

Query  1603  YETRVAETEKKKLM-APLPVEEELKSKVRYLKRE-WGASWSEQYVLLFHRGIRERWHDYF  1430
             YE  ++   K +L  A     E  K+  + LK E W  +W  Q+ +L  RG+RER  + F
Sbjct  344   YEKNISAKLKAELCNAESHSYEYTKAAAKNLKSEQWCTTWWYQFTVLLQRGVRERRFESF  403

Query  1429  SWLRITQVIATALILGMLWWQSGGDTP-SQMQDQAGLLFFIAVFWGFFPVFTAIFTFPQE  1253
             + LRI QVI+ A + G+LWW     TP S +QD+  LLFF +VFWGF+P++ A+FTFPQE
Sbjct  404   NKLRIFQVISVAFLGGLLWWH----TPKSHIQDRTALLFFFSVFWGFYPLYNAVFTFPQE  459

Query  1252  KAMLSKERAADMYRLSAYFAARTTSdlpldlllpliflLVVYFMAGLKQDASSFLLTAVT  1073
             K ML KER++ MYRLS+YF AR   DLPL+L LP  F+ ++Y+M GLK D ++F+L+ + 
Sbjct  460   KRMLIKERSSGMYRLSSYFMARNVGDLPLELALPTAFVFIIYWMGGLKPDPTTFILSLLV  519

Query  1072  VFLCIVVAQGLGLAIGATLMDLKKATTLASVTVMTFMLAGGYFIKKVPGFIVWLRDLSFN  893
             V   ++VAQGLGLA GA LM++K+ATTLASVT + F++AGGY+++++P FIVWL+ LS++
Sbjct  520   VLYSVLVAQGLGLAFGALLMNIKQATTLASVTTLVFLIAGGYYVQQIPPFIVWLKYLSYS  579

Query  892   YHTFKLLLKVQY--EHKTNSVNGVQIDSG----IKEVG---------ALAAMAVSYRLLA  758
             Y+ +KLLL +QY  +       GV    G    IK +G          +  M V YRL+A
Sbjct  580   YYCYKLLLGIQYTDDDYYECSKGVWCRVGDFPAIKSMGLNNLWIDVFVMGVMLVGYRLIA  639

Query  757   YISLRRMKLQ  728
             Y++L R+KL+
Sbjct  640   YMALHRVKLR  649



>ref|XP_010518955.1| PREDICTED: ABC transporter G family member 14 [Tarenaya hassleriana]
Length=631

 Score =   497 bits (1280),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 292/638 (46%), Positives = 400/638 (63%), Gaps = 66/638 (10%)
 Frame = -2

Query  2485  PEDLEAGTKKKRSIP-----AEPTFPIYLKFTEVSYKIVIK------GVTFSEEKDILNG  2339
             P   E G    R +P      +  + I LKF E+ YK+ I+      G   S+EK ILNG
Sbjct  8     PRPEENGGVLARGLPDMSEMQKALYSITLKFEEIVYKVKIEQKGSCWGTWSSKEKTILNG  67

Query  2338  ISGAVDPGEVLALMGPSGCGKTTLLSLLGGRIRDPSAGSITYNQHPYSKLLKSRIGFVTQ  2159
             ++G V PGE+LA++GPSG GKTTLLS LGGR+    +G ITYN  P+S  +K R GFV Q
Sbjct  68    VTGMVCPGEILAMLGPSGSGKTTLLSALGGRLSGTFSGKITYNGSPFSGSIKRRTGFVAQ  127

Query  2158  DDILFPHLTVKETLIYAARLRLPRTLTKEEKDKRAMDVIYELGLDRCQDTMIGGSFVRGV  1979
             DD+L+PHLTV ETL + A LRLP ++T++EK +    VI ELGL RC+++MIGG   RG+
Sbjct  128   DDVLYPHLTVWETLFFTALLRLPGSMTRDEKAEHVDRVITELGLTRCRNSMIGGPLFRGI  187

Query  1978  SGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILHEIAKAGKTVITTIHQPS  1799
             SGGE+KRV IG E++INPSLL LDEPTSGLDSTTA RIV  +  +   G+TVITTIHQPS
Sbjct  188   SGGEKKRVSIGQEMLINPSLLLLDEPTSGLDSTTAQRIVTTIKRLVSGGRTVITTIHQPS  247

Query  1798  SRLFHkfdklilleflldLANG------------------NINDVSIPSELADKVQTWNS  1673
             SRL+H FDK++LL     +  G                   +N   +  +LA+ +     
Sbjct  248   SRLYHMFDKVVLLSEGSPIYYGPASSALEYFSSVGFSTSMTVNPADLLLDLANGI-----  302

Query  1672  KEEPTRNNGKPSPAIVHEYLVGCYETRVAETEKKKLMAPLPVE-EELKSKVRYLKRE-WG  1499
               E    N +     V E L   YE  ++   K +L +P     +  K++    K E W 
Sbjct  303   APESQAENSEQEQKTVKEALASAYEKNISTKLKAELCSPESHGFDSAKARGNNFKPEQWC  362

Query  1498  ASWSEQYVLLFHRGIRERWHDYFSWLRITQVIATALILGMLWWQSGGDTP-SQMQDQAGL  1322
              +W  Q+ +L  RG+RER H+ F+ LRI QV++ A + G+LWW     TP S +QD+  L
Sbjct  363   TTWWYQFSVLLQRGVRERRHESFNKLRIFQVVSVAFLGGLLWWH----TPKSHIQDRIAL  418

Query  1321  LFFIAVFWGFFPVFTAIFTFPQEKAMLSKERAADMYRLSAYFAARTTSdlpldlllplif  1142
             LFF +VFWGF+P++ A+FTFPQEK ML KER++ MYRLS+YF AR   DLPL+L LP  F
Sbjct  419   LFFFSVFWGFYPLYNAVFTFPQEKRMLIKERSSGMYRLSSYFMARNIGDLPLELALPTAF  478

Query  1141  lLVVYFMAGLKQDASSFLLTAVTVFLCIVVAQGLGLAIGATLMDLKKATTLASVTVMTFM  962
             + ++Y+M GLK D ++F+L+ + V   ++VAQGLGLA GA LM++K+ATTLASVT + F+
Sbjct  479   VFIIYWMGGLKPDPTTFILSLLVVLYNVLVAQGLGLAFGALLMNIKQATTLASVTTLVFL  538

Query  961   LAGGYFIKKVPGFIVWLRDLSFNYHTFKLLLKVQYEH--------------------KTN  842
             +AGGY+++++P FIVWL+ LS++Y+ +KLLL VQY                      K+ 
Sbjct  539   IAGGYYVQQIPSFIVWLKYLSYSYYCYKLLLGVQYSDDDYYECSKGVWCRVGDFPAVKSM  598

Query  841   SVNGVQIDSGIKEVGALAAMAVSYRLLAYISLRRMKLQ  728
              +N + ID     V  +A M V YRL+AY++L R+KL+
Sbjct  599   GLNNLWID-----VSVMALMLVGYRLVAYMALHRVKLK  631



>gb|KHG16348.1| ABC transporter G family member 14 [Gossypium arboreum]
Length=653

 Score =   498 bits (1281),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 290/629 (46%), Positives = 402/629 (64%), Gaps = 75/629 (12%)
 Frame = -2

Query  2443  PAEPTFPIYLKFTEVSYKIVIK------GVTFSEEKDILNGISGAVDPGEVLALMGPSGC  2282
             P    F I LKF EV YK+ ++      G   + EK ILNGI+G V PGE+LA++GPSG 
Sbjct  43    PRLTLFHITLKFEEVVYKVKLEEKGSCWGSWITREKTILNGITGVVCPGEILAMLGPSGS  102

Query  2281  GKTTLLSLLGGRIRDPSAGSITYNQHPYSKLLKSRIGFVTQDDILFPHLTVKETLIYAAR  2102
             GKTTLLS LGGR+    +G ITYN  P+S  LK R GFV QDD+L+PHLTV ETL++ A 
Sbjct  103   GKTTLLSALGGRLTGKLSGKITYNGQPFSGALKRRTGFVAQDDVLYPHLTVTETLLFTAL  162

Query  2101  LRLPRTLTKEEKDKRAMDVIYELGLDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPS  1922
             LRLP +LT++EK +    VI ELGL +C+++MIGG   RG+SGGE+KRV IG E++INPS
Sbjct  163   LRLPNSLTRDEKAQHVERVIAELGLTKCRNSMIGGPLFRGISGGEKKRVSIGQEMLINPS  222

Query  1921  LLFLDEPTSGLDSTTALRIVDILHEIAKAGKTVITTIHQPSSRLFHkfdklilleflldL  1742
             LL LDEPTSGLDSTTA RI+  +  +A  G+TV+TTIHQPSSRL+H FDK++LL     +
Sbjct  223   LLLLDEPTSGLDSTTAQRILTTIKGLASGGRTVVTTIHQPSSRLYHMFDKVVLLSEGCPI  282

Query  1741  ANGN------------------INDVSIPSELAD--------KVQTWNSKEEPTRNNGKP  1640
               G+                  +N   +  +LA+         V+   S EE  ++    
Sbjct  283   YYGSAASALDYFSSIGFSTSITVNPADLLLDLANGIGPDLLHSVEQVESTEEEQKS----  338

Query  1639  SPAIVHEYLVGCYETRVAETEKKKLM---APLPVEEELKSKVRYLKRE-WGASWSEQYVL  1472
                 V + L+  YE  ++   K +L    A   V  + ++  RY K E W  SW  Q+ +
Sbjct  339   ----VKDALLSAYEKNISTKLKAELCNSDANNFVNTK-EASARYEKTEQWCTSWWYQFKV  393

Query  1471  LFHRGIRERWHDYFSWLRITQVIATALILGMLWWQSGGDTP-SQMQDQAGLLFFIAVFWG  1295
             L  RG+RER ++ F+ LRI QVI+ A++ G+LWW     TP S + D+  LLFF +VFWG
Sbjct  394   LLQRGVRERRYEAFNRLRIFQVISVAVLGGLLWWH----TPASHISDRIALLFFFSVFWG  449

Query  1294  FFPVFTAIFTFPQEKAMLSKERAADMYRLSAYFAARTTSdlpldlllpliflLVVYFMAG  1115
             F+P++ A+FTFPQE+ ML KER++ MYRLS+YF ART  DLPL+L LP  F+ ++Y+M G
Sbjct  450   FYPLYNAVFTFPQERTMLIKERSSGMYRLSSYFLARTFGDLPLELALPTAFVFIIYWMGG  509

Query  1114  LKQDASSFLLTAVTVFLCIVVAQGLGLAIGATLMDLKKATTLASVTVMTFMLAGGYFIKK  935
             LK D  +F+L+ + V   ++V+Q LGLAIGA LMD+K+ATTLASVT + F++AGGY++++
Sbjct  510   LKPDPLTFILSLLIVLYSVLVSQSLGLAIGAILMDIKQATTLASVTTLVFLIAGGYYVQQ  569

Query  934   VPGFIVWLRDLSFNYHTFKLLLKVQYEH--------------------KTNSVNGVQIDS  815
             +P FIVWL+ LS++Y+ +KLLL +QY+                     K+  +N + ID 
Sbjct  570   IPSFIVWLKYLSYSYYCYKLLLGIQYDEDDVYECGTGGLCRVGDLPAIKSMGLNHLWID-  628

Query  814   GIKEVGALAAMAVSYRLLAYISLRRMKLQ  728
                 V  +A M + YRLLAY++L R++L+
Sbjct  629   ----VAIMALMLLGYRLLAYMALYRVRLR  653



>ref|XP_006303926.1| hypothetical protein CARUB_v10008545mg [Capsella rubella]
 gb|EOA36824.1| hypothetical protein CARUB_v10008545mg [Capsella rubella]
Length=648

 Score =   497 bits (1280),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 290/609 (48%), Positives = 396/609 (65%), Gaps = 51/609 (8%)
 Frame = -2

Query  2428  FPIYLKFTEVSYKIVIK------GVTFSEEKDILNGISGAVDPGEVLALMGPSGCGKTTL  2267
             +PI LKF EV YK+ I+      G   S+EK ILNGI+G V PGE+LA++GPSG GKTTL
Sbjct  49    YPITLKFEEVVYKVKIEQTSQCLGSWKSKEKTILNGITGMVCPGEILAMLGPSGSGKTTL  108

Query  2266  LSLLGGRIRDPSAGSITYNQHPYSKLLKSRIGFVTQDDILFPHLTVKETLIYAARLRLPR  2087
             LS LGGR+    +G + YN  P+S  +K R GFV QDD+L+PHLTV ETL + A LRLP 
Sbjct  109   LSALGGRLSKTFSGKVMYNGQPFSGCIKRRTGFVAQDDVLYPHLTVWETLFFTALLRLPS  168

Query  2086  TLTKEEKDKRAMDVIYELGLDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLD  1907
             +LT++EK +    VI ELGL+RC ++MIGG   RG+SGGE+KRV IG E++INPSLL LD
Sbjct  169   SLTRDEKAEHVDRVIAELGLNRCTNSMIGGPLFRGISGGEKKRVSIGQEMLINPSLLLLD  228

Query  1906  EPTSGLDSTTALRIVDILHEIAKAGKTVITTIHQPSSRLFHkfdklilleflldLANGN-  1730
             EPTSGLDSTTA RI+  +  +A  G+TV+TTIHQPSSR++H FDK++LL     +  G  
Sbjct  229   EPTSGLDSTTAHRIITTIKRLASGGRTVVTTIHQPSSRIYHMFDKVVLLSEGSPIYYGPA  288

Query  1729  -----------------INDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCY  1601
                              +N   +  +LA+ +   + ++E T    K     V E LV  Y
Sbjct  289   SSAMEYFTSLGFSTSMIVNPADLLLDLANGIPP-DCQKETTEQEQK----TVKETLVSAY  343

Query  1600  ETRVAETEKKKLM-APLPVEEELKSKVRYLKRE-WGASWSEQYVLLFHRGIRERWHDYFS  1427
             E  ++   K +L  A     E  K+  + LK E W  +W  Q+ +L  RG+RER  + F+
Sbjct  344   EKNISTKLKAELCNAESHSYEYTKAAAKNLKSEQWCTTWWYQFTVLLQRGVRERRFESFN  403

Query  1426  WLRITQVIATALILGMLWWQSGGDTP-SQMQDQAGLLFFIAVFWGFFPVFTAIFTFPQEK  1250
              LRI QVI+ A + G+LWW     TP S +QD+  LLFF +VFWGF+P++ A+FTFPQEK
Sbjct  404   KLRIFQVISVAFLGGLLWWH----TPKSHIQDRTALLFFFSVFWGFYPLYNAVFTFPQEK  459

Query  1249  AMLSKERAADMYRLSAYFAARTTSdlpldlllpliflLVVYFMAGLKQDASSFLLTAVTV  1070
              ML KER++ MYRLS+YF AR   DLPL+L LP  F+ ++Y+M GLK D ++F+L+ + V
Sbjct  460   RMLIKERSSGMYRLSSYFMARNVGDLPLELALPTAFVFIIYWMGGLKPDPTTFILSLLVV  519

Query  1069  FLCIVVAQGLGLAIGATLMDLKKATTLASVTVMTFMLAGGYFIKKVPGFIVWLRDLSFNY  890
                ++VAQGLGLA GA LM++K+ATTLASVT + F++AGGY+++++P FIVWL+ LS++Y
Sbjct  520   LYSVLVAQGLGLAFGALLMNIKQATTLASVTTLVFLIAGGYYVQQIPPFIVWLKYLSYSY  579

Query  889   HTFKLLLKVQY--EHKTNSVNGVQIDSG----IKEVG---------ALAAMAVSYRLLAY  755
             + +KLLL +QY  +       GV    G    IK +G          +  M V YRL+AY
Sbjct  580   YCYKLLLGIQYTDDDYYECSKGVWCRVGDFPAIKSMGLNNLWIDVFVMGVMLVGYRLIAY  639

Query  754   ISLRRMKLQ  728
             ++L R+KL+
Sbjct  640   MALHRVKLR  648



>ref|XP_010540713.1| PREDICTED: ABC transporter G family member 14 [Tarenaya hassleriana]
Length=649

 Score =   497 bits (1280),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 292/609 (48%), Positives = 395/609 (65%), Gaps = 51/609 (8%)
 Frame = -2

Query  2428  FPIYLKFTEVSYKIVIK------GVTFSEEKDILNGISGAVDPGEVLALMGPSGCGKTTL  2267
             +PI LKF E+ YK+ I+      G   S+EK ILNGI+G V PGE+LA++GPSG GKTTL
Sbjct  50    YPITLKFEEIVYKVKIEQKGSCWGTWSSKEKRILNGITGMVCPGEILAMLGPSGSGKTTL  109

Query  2266  LSLLGGRIRDPSAGSITYNQHPYSKLLKSRIGFVTQDDILFPHLTVKETLIYAARLRLPR  2087
             LS LGGR+    +G ITYN  P+S  +K R GFV QDDIL+PHLTV ETL + A LRLP 
Sbjct  110   LSALGGRLSGTFSGKITYNGLPFSGSIKRRTGFVAQDDILYPHLTVWETLFFTALLRLPS  169

Query  2086  TLTKEEKDKRAMDVIYELGLDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLD  1907
             +LT++EK      VI ELGL RCQ++MIGG   RG+SGGE+KRV IG E++INPSLL LD
Sbjct  170   SLTRDEKADHVDRVITELGLTRCQNSMIGGPLFRGISGGEKKRVSIGQEMLINPSLLLLD  229

Query  1906  EPTSGLDSTTALRIVDILHEIAKAGKTVITTIHQPSSRLFHkfdklilleflldLANG--  1733
             EPTSGLDSTTA RIV  +  +A  G+TVITTIHQPSSRL+H FDK++LL     +  G  
Sbjct  230   EPTSGLDSTTAQRIVTTIKRLASGGRTVITTIHQPSSRLYHMFDKVVLLSEGSPIYYGPA  289

Query  1732  ----------------NINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCY  1601
                              +N   +  +LA+ + T +S+ E    N +     V E LV  Y
Sbjct  290   SSALEYFSSVGFSTSMTVNPADLLLDLANGI-TPDSQAE----NSEQEQKTVKEALVSAY  344

Query  1600  ETRVAETEKKKLM-APLPVEEELKSKVRYLKRE-WGASWSEQYVLLFHRGIRERWHDYFS  1427
             E  ++   K +L  +     +  K+     K E W  SW  Q+ +L  RG+RER ++ F+
Sbjct  345   EKNISTKLKAELCNSESHGNDYAKAGGNNFKPEQWCTSWWYQFSVLLQRGVRERRYESFN  404

Query  1426  WLRITQVIATALILGMLWWQSGGDTP-SQMQDQAGLLFFIAVFWGFFPVFTAIFTFPQEK  1250
              LRI QV++ A + G+LWW     TP S +QD+  LLFF +VFWGF+P++ A+FTFPQEK
Sbjct  405   KLRIFQVVSVAFLGGLLWWH----TPKSHIQDRVALLFFFSVFWGFYPLYNAVFTFPQEK  460

Query  1249  AMLSKERAADMYRLSAYFAARTTSdlpldlllpliflLVVYFMAGLKQDASSFLLTAVTV  1070
              ML KER++ MYRLS+YF AR   DLPL+L LP  F+ ++Y+M GLK D ++F+L+ + V
Sbjct  461   RMLIKERSSGMYRLSSYFMARNIGDLPLELALPTAFVFIIYWMGGLKPDPTTFILSLLVV  520

Query  1069  FLCIVVAQGLGLAIGATLMDLKKATTLASVTVMTFMLAGGYFIKKVPGFIVWLRDLSFNY  890
                ++VAQGLGLA GA LM++K+ATTLASVT + F++AGGY+++ +P FIVWL+ LS++Y
Sbjct  521   LYNVLVAQGLGLAFGAFLMNIKQATTLASVTTLVFLIAGGYYVQHIPPFIVWLKYLSYSY  580

Query  889   HTFKLLLKVQYEHKTN---------------SVNGVQIDSGIKEVGALAAMAVSYRLLAY  755
             + +KLLL VQY                    +V  + ++S   +V  +A M V YR +AY
Sbjct  581   YCYKLLLGVQYSDDDYYECSKGVWCRVGDFPAVKSMGLNSLWIDVSVMALMLVGYRFIAY  640

Query  754   ISLRRMKLQ  728
             ++L R+KL+
Sbjct  641   MALHRVKLK  649



>ref|NP_564383.1| ABC transporter G family member 14 [Arabidopsis thaliana]
 sp|Q9C6W5.1|AB14G_ARATH RecName: Full=ABC transporter G family member 14; Short=ABC transporter 
ABCG.14; Short=AtABCG14; AltName: Full=White-brown 
complex homolog protein 14; Short=AtWBC14 [Arabidopsis thaliana]
 gb|AAG60152.1|AC074360_17 hypothetical protein [Arabidopsis thaliana]
 gb|AAM67104.1| ABC transporter, putative [Arabidopsis thaliana]
 dbj|BAC42192.1| unknown protein [Arabidopsis thaliana]
 gb|AEE31390.1| ABC transporter G family member 14 [Arabidopsis thaliana]
Length=648

 Score =   497 bits (1280),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 290/609 (48%), Positives = 396/609 (65%), Gaps = 51/609 (8%)
 Frame = -2

Query  2428  FPIYLKFTEVSYKIVIK------GVTFSEEKDILNGISGAVDPGEVLALMGPSGCGKTTL  2267
             +PI LKF EV YK+ I+      G   S+EK ILNGI+G V PGE LA++GPSG GKTTL
Sbjct  49    YPITLKFEEVVYKVKIEQTSQCMGSWKSKEKTILNGITGMVCPGEFLAMLGPSGSGKTTL  108

Query  2266  LSLLGGRIRDPSAGSITYNQHPYSKLLKSRIGFVTQDDILFPHLTVKETLIYAARLRLPR  2087
             LS LGGR+    +G + YN  P+S  +K R GFV QDD+L+PHLTV ETL + A LRLP 
Sbjct  109   LSALGGRLSKTFSGKVMYNGQPFSGCIKRRTGFVAQDDVLYPHLTVWETLFFTALLRLPS  168

Query  2086  TLTKEEKDKRAMDVIYELGLDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLD  1907
             +LT++EK +    VI ELGL+RC ++MIGG   RG+SGGE+KRV IG E++INPSLL LD
Sbjct  169   SLTRDEKAEHVDRVIAELGLNRCTNSMIGGPLFRGISGGEKKRVSIGQEMLINPSLLLLD  228

Query  1906  EPTSGLDSTTALRIVDILHEIAKAGKTVITTIHQPSSRLFHkfdklilleflldLANG--  1733
             EPTSGLDSTTA RIV  +  +A  G+TV+TTIHQPSSR++H FDK++LL     +  G  
Sbjct  229   EPTSGLDSTTAHRIVTTIKRLASGGRTVVTTIHQPSSRIYHMFDKVVLLSEGSPIYYGAA  288

Query  1732  ----------------NINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCY  1601
                              +N   +  +LA+ +   ++++E +    K     V E LV  Y
Sbjct  289   SSAVEYFSSLGFSTSLTVNPADLLLDLANGIPP-DTQKETSEQEQK----TVKETLVSAY  343

Query  1600  ETRVAETEKKKLM-APLPVEEELKSKVRYLKRE-WGASWSEQYVLLFHRGIRERWHDYFS  1427
             E  ++   K +L  A     E  K+  + LK E W  +W  Q+ +L  RG+RER  + F+
Sbjct  344   EKNISTKLKAELCNAESHSYEYTKAAAKNLKSEQWCTTWWYQFTVLLQRGVRERRFESFN  403

Query  1426  WLRITQVIATALILGMLWWQSGGDTP-SQMQDQAGLLFFIAVFWGFFPVFTAIFTFPQEK  1250
              LRI QVI+ A + G+LWW     TP S +QD+  LLFF +VFWGF+P++ A+FTFPQEK
Sbjct  404   KLRIFQVISVAFLGGLLWWH----TPKSHIQDRTALLFFFSVFWGFYPLYNAVFTFPQEK  459

Query  1249  AMLSKERAADMYRLSAYFAARTTSdlpldlllpliflLVVYFMAGLKQDASSFLLTAVTV  1070
              ML KER++ MYRLS+YF AR   DLPL+L LP  F+ ++Y+M GLK D ++F+L+ + V
Sbjct  460   RMLIKERSSGMYRLSSYFMARNVGDLPLELALPTAFVFIIYWMGGLKPDPTTFILSLLVV  519

Query  1069  FLCIVVAQGLGLAIGATLMDLKKATTLASVTVMTFMLAGGYFIKKVPGFIVWLRDLSFNY  890
                ++VAQGLGLA GA LM++K+ATTLASVT + F++AGGY+++++P FIVWL+ LS++Y
Sbjct  520   LYSVLVAQGLGLAFGALLMNIKQATTLASVTTLVFLIAGGYYVQQIPPFIVWLKYLSYSY  579

Query  889   HTFKLLLKVQY--EHKTNSVNGVQIDSG----IKEVG---------ALAAMAVSYRLLAY  755
             + +KLLL +QY  +       GV    G    IK +G          +  M V YRL+AY
Sbjct  580   YCYKLLLGIQYTDDDYYECSKGVWCRVGDFPAIKSMGLNNLWIDVFVMGVMLVGYRLMAY  639

Query  754   ISLRRMKLQ  728
             ++L R+KL+
Sbjct  640   MALHRVKLR  648



>ref|XP_002991839.1| ATP-binding cassette transporter, partial [Selaginella moellendorffii]
 gb|EFJ07101.1| ATP-binding cassette transporter, partial [Selaginella moellendorffii]
Length=524

 Score =   492 bits (1267),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 273/504 (54%), Positives = 359/504 (71%), Gaps = 42/504 (8%)
 Frame = -2

Query  2356  KDILNGISGAVDPGEVLALMGPSGCGKTTLLSLLGGRIR-DPSAGSITYNQHPYSKLLKS  2180
             K+IL+G+SGAV PG++LA+MGPSG GKTTLLSLL GR + +  +GSITYN   Y+K LK 
Sbjct  3     KEILHGVSGAVGPGQILAMMGPSGSGKTTLLSLLAGRSQTNLHSGSITYNDMGYTKALKR  62

Query  2179  RIGFVTQDDILFPHLTVKETLIYAARLRLPRTLTKEEKDKRAMDVIYELGLDRCQDTMIG  2000
             R+GFVTQDD+LF HLTVKETL YAA LRLP+ L+++EK +RA  +I ELGLD+C+DT+IG
Sbjct  63    RMGFVTQDDVLFMHLTVKETLRYAALLRLPKKLSRQEKIQRADSIILELGLDKCKDTIIG  122

Query  1999  GSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILHEIAKAGKTVI  1820
             G F RGVSGGERKRVCIG EI+I+PS++FLDEPTSGLDSTTALRI+ +LH +A+AG+TVI
Sbjct  123   GPFERGVSGGERKRVCIGQEILIDPSIIFLDEPTSGLDSTTALRILQLLHGLAQAGRTVI  182

Query  1819  TTIHQPSSRLFHkfdklilleflld--------------------------------LAN  1736
             TTIHQPSSRL+H FD L+LL                                     LAN
Sbjct  183   TTIHQPSSRLYHMFDNLLLLSNGHAIFFGRGQDALPYFSSIGLNASLLMNPADFLLDLAN  242

Query  1735  GNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYETRVAETEKKKLMAP  1556
             GNI+D SIP EL  +++   SK +     GKP    V EYLV C+ + VA  +      P
Sbjct  243   GNISDTSIPPEL--EIKLIQSKGD--SKVGKPPELAVQEYLVECFSSEVAFRDSSVDSPP  298

Query  1555  LPVEEELKSKVRYLKREWGASWSEQYVLLFHRGIRERWHDYFSWLRITQVIATALILGML  1376
                    K  +   +REW   W +Q+++L  RG +ER H+Y SWLR+ QV+ +A++ G++
Sbjct  299   -----HAKDVILPPRREWSIGWWQQFLVLMSRGFKERRHEYLSWLRVFQVLVSAVVAGLV  353

Query  1375  WWQSGGDTPSQMQDQAGLLFFIAVFWGFFPVFTAIFTFPQEKAMLSKERAADMYRLSAYF  1196
             WW S  D+   +QDQ GL+FFI+++W +FP+F AI+TFPQE+AM++KERA+DMYRLS+YF
Sbjct  354   WWHSSADSEKHLQDQVGLIFFISIYWAYFPIFVAIYTFPQERAMIAKERASDMYRLSSYF  413

Query  1195  AARTTSdlpldlllpliflLVVYFMAGLKQDASSFLLTAVTVFLCIVVAQGLGLAIGATL  1016
              +RT  DLPL+L+LPL+FLL+ YFMA LK    +FLLT +++FL ++ A+GLGL IGA +
Sbjct  414   MSRTLGDLPLNLVLPLVFLLITYFMAHLKLTVGAFLLTLLSLFLIVIAAEGLGLFIGAAM  473

Query  1015  MDLKKATTLASVTVMTFMLAGGYF  944
             MD K ATTLAS+ ++ FML GG+F
Sbjct  474   MDTKHATTLASILLLIFMLTGGFF  497



>ref|XP_004147769.1| PREDICTED: ABC transporter G family member 14-like [Cucumis sativus]
 gb|KGN53471.1| hypothetical protein Csa_4G056620 [Cucumis sativus]
Length=655

 Score =   497 bits (1280),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 285/658 (43%), Positives = 406/658 (62%), Gaps = 61/658 (9%)
 Frame = -2

Query  2536  VRPDESADSKPFS-DDENPEDLEAGTKKKRSIPAEPTFPIYLKFTEVSYKIVIKGVTF--  2366
             V  +++  + PF  D  N +D         ++   P   + LKF E+ YK+ ++G     
Sbjct  4     VAQNDAVFAYPFHVDSHNTQDNNN--NNNNNLHQLPLLTVTLKFEEIVYKVKLEGKGGSC  61

Query  2365  -------------SEEKDILNGISGAVDPGEVLALMGPSGCGKTTLLSLLGGRIRDPSAG  2225
                          + EK ILNG+SG V PGE+LA++GPSG GKTTLL+ LGGR+    +G
Sbjct  62    WGGGGGSSWGAAANREKTILNGLSGVVFPGEILAMLGPSGSGKTTLLTALGGRLSGKLSG  121

Query  2224  SITYNQHPYSKLLKSRIGFVTQDDILFPHLTVKETLIYAARLRLPRTLTKEEKDKRAMDV  2045
              ITYN  P+S   K R GFV QDD+L+PHLTV ETL++ A LRLP +LT +EK +    V
Sbjct  122   KITYNGQPFSGATKRRTGFVAQDDVLYPHLTVAETLLFTALLRLPSSLTADEKAEAVERV  181

Query  2044  IYELGLDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRI  1865
             I ELGL RC+++MIGG   RG+SGGE+KRV IG E++INPSLL LDEPTSGLDSTTA++I
Sbjct  182   ISELGLTRCRNSMIGGPLFRGISGGEKKRVSIGQEMLINPSLLLLDEPTSGLDSTTAMKI  241

Query  1864  VDILHEIAKAGKTVITTIHQPSSRLFHkfdklilleflldLANGN---------------  1730
             +  +  +A  G+T++TTIHQPSSRL+H FDK++LL     +  G+               
Sbjct  242   ITTVKRLAAGGRTIVTTIHQPSSRLYHMFDKVVLLSEGSPIYYGSASNAMDYFSSIGFST  301

Query  1729  ---INDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYETRVAETEKKKLMA  1559
                IN   +  +LA+ +   +        N +     V E L+  YE  ++ T K +L +
Sbjct  302   SITINPADLLLDLANGIAPDSKYANEGGENMEQEQKSVKEALISAYEKNISSTLKAELCS  361

Query  1558  PLP-----VEEELKSKVRYLKREWGASWSEQYVLLFHRGIRERWHDYFSWLRITQVIATA  1394
                       ++   + +  + EW  SW  Q+ +L  RG++ER +D F+ LRI QVI+ A
Sbjct  362   LDANNFNNYAKDASKREKRSREEWCTSWWYQFRVLLQRGLKERRYDAFNRLRIFQVISVA  421

Query  1393  LILGMLWWQSGGDTP-SQMQDQAGLLFFIAVFWGFFPVFTAIFTFPQEKAMLSKERAADM  1217
              + G+LWW     TP S ++D+  LLFF +VFWGF+P++ A+FTFPQE+ ML KER++ M
Sbjct  422   TLGGLLWWH----TPTSHIEDRIALLFFFSVFWGFYPLYNAVFTFPQERTMLIKERSSGM  477

Query  1216  YRLSAYFAARTTSdlpldlllpliflLVVYFMAGLKQDASSFLLTAVTVFLCIVVAQGLG  1037
             YRLS+YF ART  DLPL+L LP  F+ ++YFM GL    ++FLL+ + V   ++V+Q LG
Sbjct  478   YRLSSYFLARTVGDLPLELALPTAFVFIIYFMGGLDPHPTTFLLSLLIVLYSVLVSQSLG  537

Query  1036  LAIGATLMDLKKATTLASVTVMTFMLAGGYFIKKVPGFIVWLRDLSFNYHTFKLLLKVQY  857
             LA GA LMD+K+ATTLASVT + F++AGGY+I+++P FIVWL+ LS++Y+ +KLLL VQY
Sbjct  538   LAFGAILMDVKQATTLASVTTLVFLIAGGYYIQQIPPFIVWLKYLSYSYYCYKLLLGVQY  597

Query  856   EHKT---------------NSVNGVQIDSGIKEVGALAAMAVSYRLLAYISLRRMKLQ  728
              +                  +V  V +D    +V  +A M V YRL+AY++L R++L+
Sbjct  598   HNGDVYECGKGEFCQVVDFPAVKSVGLDRLWVDVCIMALMLVGYRLIAYLALHRVRLR  655



>ref|XP_009114967.1| PREDICTED: ABC transporter G family member 14 [Brassica rapa]
 emb|CDY49155.1| BnaA09g25160D [Brassica napus]
Length=649

 Score =   497 bits (1279),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 290/610 (48%), Positives = 396/610 (65%), Gaps = 52/610 (9%)
 Frame = -2

Query  2428  FPIYLKFTEVSYKIVIK------GVTFSEEKDILNGISGAVDPGEVLALMGPSGCGKTTL  2267
             +PI LKF EV YK+ I+      G    +EK ILNGI+G V PGE+LA++GPSG GKTTL
Sbjct  49    YPITLKFEEVEYKVKIEHTGQCLGSWSCKEKTILNGITGMVCPGEILAMLGPSGSGKTTL  108

Query  2266  LSLLGGRIRDPSAGSITYNQHPYSKLLKSRIGFVTQDDILFPHLTVKETLIYAARLRLPR  2087
             LS LGGR+    +G + YN  P+S  +K R GFV QDD+L+PHLTV ETL + A LRLP 
Sbjct  109   LSALGGRLSKTFSGKVIYNGQPFSGCIKRRTGFVAQDDVLYPHLTVWETLFFTALLRLPS  168

Query  2086  TLTKEEKDKRAMDVIYELGLDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLD  1907
             +LT++EK +    VI ELGL+RC ++MIGG   RG+SGGE+KRV IG E++INPSLL LD
Sbjct  169   SLTRDEKAEHVDRVIAELGLNRCTNSMIGGPLFRGISGGEKKRVSIGQEMLINPSLLLLD  228

Query  1906  EPTSGLDSTTALRIVDILHEIAKAGKTVITTIHQPSSRLFHkfdklilleflldLANG--  1733
             EPTSGLDSTTA RIV  +  +A  G+TV+TTIHQPSSR++H FDK++LL     L  G  
Sbjct  229   EPTSGLDSTTAHRIVTTIKRLASGGRTVVTTIHQPSSRIYHMFDKVVLLSEGSPLYYGPA  288

Query  1732  ----------------NINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCY  1601
                              +N   +  +LA+ +   +S++E +    K     V E L+  Y
Sbjct  289   SSALEYFSSVGFSTSMTVNPADLLLDLANGIPP-DSQKETSEQEQK----TVKESLISAY  343

Query  1600  ETRVAETEKKKLM-APLPVEEELKSKVRYLK--REWGASWSEQYVLLFHRGIRERWHDYF  1430
             E  ++   K +L  A     E  KS  + +K   +W  SW  Q+ +L  RG+RER  + F
Sbjct  344   EKNISTKLKAELCNADSHSFEYTKSAAKNIKSSEQWCTSWWYQFTVLLQRGVRERRFESF  403

Query  1429  SWLRITQVIATALILGMLWWQSGGDTP-SQMQDQAGLLFFIAVFWGFFPVFTAIFTFPQE  1253
             + LRI QVI+ A + G+LWW     TP S +QD+  LLFF +VFWGF+P++ A+FTFPQE
Sbjct  404   NKLRIFQVISVAFLGGLLWWH----TPKSHLQDRTALLFFFSVFWGFYPLYNAVFTFPQE  459

Query  1252  KAMLSKERAADMYRLSAYFAARTTSdlpldlllpliflLVVYFMAGLKQDASSFLLTAVT  1073
             K ML KER++ MYRLS+YF AR   DLPL+L LP  F+ ++Y+M GLK D ++F+L+ + 
Sbjct  460   KRMLIKERSSGMYRLSSYFMARNVGDLPLELALPTAFVFIIYWMGGLKPDPTTFILSLLV  519

Query  1072  VFLCIVVAQGLGLAIGATLMDLKKATTLASVTVMTFMLAGGYFIKKVPGFIVWLRDLSFN  893
             V   ++VAQGLGLA GA LM++K+ATTLASVT + F++AGGY+++++P FIVWL+ LS++
Sbjct  520   VLYSVLVAQGLGLAFGALLMNIKQATTLASVTTLVFLIAGGYYVQQIPPFIVWLKYLSYS  579

Query  892   YHTFKLLLKVQY--EHKTNSVNGVQID----SGIKEVG---------ALAAMAVSYRLLA  758
             Y+ +KLLL +QY  +       GV        GIK +G          +  M V YRL+A
Sbjct  580   YYCYKLLLGIQYTDDDYYECSEGVWCRVGDFPGIKAMGLNNLWIDVFVMGVMLVGYRLIA  639

Query  757   YISLRRMKLQ  728
             Y++L R+KL+
Sbjct  640   YMALHRVKLR  649



>ref|XP_011098341.1| PREDICTED: ABC transporter G family member 9 [Sesamum indicum]
Length=619

 Score =   496 bits (1276),  Expect = 4e-159, Method: Compositional matrix adjust.
 Identities = 291/627 (46%), Positives = 393/627 (63%), Gaps = 56/627 (9%)
 Frame = -2

Query  2494  DENPEDLEAGTKKKRSIPAEPTFPIYLKFTEVSYKI-------VIKGVTFSEEKDILNGI  2336
             D   ++L    +   +I  +   P+ LKF +V YKI         K    S+EK IL GI
Sbjct  3     DVEAQNLAGDGEISPAIFKKANLPVTLKFEDVVYKIKTEQSGKFFKKTAKSQEKLILKGI  62

Query  2335  SGAVDPGEVLALMGPSGCGKTTLLSLLGGRIRDPS-AGSITYNQHPYSKLLKSRIGFVTQ  2159
             SG V PGE+LA++GPSG GKTTLL+ LGGR+     +G+ITYN  P+S  +K   GFVTQ
Sbjct  63    SGMVLPGEMLAMLGPSGSGKTTLLTGLGGRLTSGRLSGNITYNGKPFSNAMKRNTGFVTQ  122

Query  2158  DDILFPHLTVKETLIYAARLRLPRTLTKEEKDKRAMDVIYELGLDRCQDTMIGGSFVRGV  1979
             DD+L+PHLTV ETL+Y A LRLPRTLTK EK + A  VI +LGL RC+ ++IGG  +RGV
Sbjct  123   DDVLYPHLTVTETLVYTALLRLPRTLTKAEKAEHAEAVIAQLGLSRCRHSIIGGPLLRGV  182

Query  1978  SGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILHEIAKAGKTVITTIHQPS  1799
             SGGERKRV IG E++INPSLLFLDEPTSGLDSTTA RIV  L ++A  G+T++ TIHQPS
Sbjct  183   SGGERKRVSIGQEMLINPSLLFLDEPTSGLDSTTAQRIVSTLWDLANGGRTIVMTIHQPS  242

Query  1798  SRLFHkfdklilleflldLANGN------------------INDVSIPSELADKVQTWNS  1673
             SRLF+ F K++LL     L  G                   +N      +LA+ + T +S
Sbjct  243   SRLFYMFHKVLLLSEGNPLYYGKGSSALDYFSSIGFSLSVAMNPADFLLDLANGISTADS  302

Query  1672  KEEPTRNNGKPSPAIVHEYLVGCYETRVAETEKKKLMAPLPVEEELKSKVRYLKREWGAS  1493
              E+          A + + LV  Y+T + E+   +L A   ++     K     R W  +
Sbjct  303   MED---------HAAIKQTLVASYKTHLLESVTAELAADDQLQMATDDKQL---RRWSNT  350

Query  1492  WSEQYVLLFHRGIRERWHDYFSWLRITQVIATALILGMLWWQSGGDTPSQMQDQAGLLFF  1313
             W +Q+ +LF RGI+ER H+ FS L+I QV+A A++ G+LWWQS     S +QDQ GL FF
Sbjct  351   WWDQFSVLFRRGIKERRHESFSGLKIGQVLAVAILTGLLWWQS---DISHLQDQVGLFFF  407

Query  1312  IAVFWGFFPVFTAIFTFPQEKAMLSKERAADMYRLSAYFAARTTSdlpldlllpliflLV  1133
              + FWGF+P+F AIFTFPQE+ ML+KER++ MYRLS+YF A T  DLP++L+LP +F ++
Sbjct  408   YSGFWGFYPLFQAIFTFPQERMMLAKERSSGMYRLSSYFMALTLGDLPMELVLPTVFFVI  467

Query  1132  VYFMAGLKQDASSFLLTAVTVFLCIVVAQGLGLAIGATLMDLKKATTLASVTVMTFMLAG  953
              Y+MAGLK D   F     T+   ++ +QGLGLA+GA +M+ K AT L SV ++TF+LA 
Sbjct  468   TYWMAGLKPDPRCFFAGLFTLLYSVLCSQGLGLALGAAVMNQKSATILGSVIMLTFLLAS  527

Query  952   GYFIKKVPGFIVWLRDLSFNYHTFKLLLKVQYEHKTNSVNG------VQIDSGIKEVG--  797
             GY+++ VP FI W++ +S + +TFKLLL  Q++       G      V+    IK VG  
Sbjct  528   GYYVQHVPAFISWIKYISISQYTFKLLLGSQFKPGETYPCGNGKTCLVEDFGMIKPVGLG  587

Query  796   -------ALAAMAVSYRLLAYISLRRM  737
                    ALA M V YRL+AY++L R+
Sbjct  588   GHAIAVIALAVMLVGYRLVAYVALMRI  614



>ref|XP_002893685.1| abc transporter family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69944.1| abc transporter family protein [Arabidopsis lyrata subsp. lyrata]
Length=640

 Score =   496 bits (1276),  Expect = 7e-159, Method: Compositional matrix adjust.
 Identities = 291/609 (48%), Positives = 394/609 (65%), Gaps = 51/609 (8%)
 Frame = -2

Query  2428  FPIYLKFTEVSYKIVIK------GVTFSEEKDILNGISGAVDPGEVLALMGPSGCGKTTL  2267
             +PI LKF EV YK+ I+      G   S+EK ILNGI+G V PGE LA++GPSG GKTTL
Sbjct  41    YPITLKFEEVVYKVKIEQTSQCMGSWKSKEKTILNGITGMVCPGEFLAMLGPSGSGKTTL  100

Query  2266  LSLLGGRIRDPSAGSITYNQHPYSKLLKSRIGFVTQDDILFPHLTVKETLIYAARLRLPR  2087
             LS LGGR+    +G + YN  P+S  +K R GFV QDD+L+PHLTV ETL + A LRLP 
Sbjct  101   LSALGGRLSKTFSGKVMYNGQPFSGCIKRRTGFVAQDDVLYPHLTVWETLFFTALLRLPS  160

Query  2086  TLTKEEKDKRAMDVIYELGLDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLD  1907
             +LT++EK +    VI ELGL RC ++MIGG   RG+SGGE+KRV IG E++INPSLL LD
Sbjct  161   SLTRDEKAEHVDRVIAELGLTRCTNSMIGGPLFRGISGGEKKRVSIGQEMLINPSLLLLD  220

Query  1906  EPTSGLDSTTALRIVDILHEIAKAGKTVITTIHQPSSRLFHkfdklilleflldLANG--  1733
             EPTSGLDSTTA RIV  +  +A  G+TV+TTIHQPSSR++H FDK++LL     +  G  
Sbjct  221   EPTSGLDSTTAHRIVTTIKRLASGGRTVVTTIHQPSSRIYHMFDKVVLLSEGSPIYYGPA  280

Query  1732  ----------------NINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCY  1601
                              +N   +  +LA+ +   +S++E +    K     V E LV  Y
Sbjct  281   TSAVEYFSSLGFSTSMTVNPADLLLDLANGIPP-DSQKETSEQEQK----TVKETLVSAY  335

Query  1600  ETRVAETEKKKLM-APLPVEEELKSKVRYLKRE-WGASWSEQYVLLFHRGIRERWHDYFS  1427
             E  ++   K +L  A     E  K+  + LK E W  +W  Q+ +L  RG+RER  + F+
Sbjct  336   EKNISTKLKAELCNAESHSYEYTKAAAKNLKSEQWCTTWWYQFTVLLQRGVRERRFESFN  395

Query  1426  WLRITQVIATALILGMLWWQSGGDTP-SQMQDQAGLLFFIAVFWGFFPVFTAIFTFPQEK  1250
              LRI QVI+ A + G+LWW     TP S +QD+  LLFF +VFWGF+P++ A+FTFPQEK
Sbjct  396   KLRIFQVISVAFLGGLLWWH----TPKSHIQDRTALLFFFSVFWGFYPLYNAVFTFPQEK  451

Query  1249  AMLSKERAADMYRLSAYFAARTTSdlpldlllpliflLVVYFMAGLKQDASSFLLTAVTV  1070
              ML KER++ MYRLS+YF AR   DLPL+L LP  F+ ++Y+M GLK D ++F+L+ + V
Sbjct  452   RMLIKERSSGMYRLSSYFMARNVGDLPLELALPTAFVFIIYWMGGLKPDPTTFILSLLVV  511

Query  1069  FLCIVVAQGLGLAIGATLMDLKKATTLASVTVMTFMLAGGYFIKKVPGFIVWLRDLSFNY  890
                ++VAQGLGLA GA LM++K+ATTLASVT + F++AGGY+++++P FIVWL+ LS++Y
Sbjct  512   LYSVLVAQGLGLAFGALLMNIKQATTLASVTTLVFLIAGGYYVQQIPPFIVWLKYLSYSY  571

Query  889   HTFKLLLKVQY--EHKTNSVNGVQIDSG----IKEVG---------ALAAMAVSYRLLAY  755
             + +KLLL +QY  +       GV    G    IK +G          +  M V YRL+AY
Sbjct  572   YCYKLLLGIQYTDDDYYECSKGVWCRVGDFPAIKSMGLNNLWIDVFVMGVMLVGYRLMAY  631

Query  754   ISLRRMKLQ  728
              +L R+KL+
Sbjct  632   FALHRVKLR  640



>ref|XP_006415305.1| hypothetical protein EUTSA_v10007027mg [Eutrema salsugineum]
 gb|ESQ33658.1| hypothetical protein EUTSA_v10007027mg [Eutrema salsugineum]
Length=648

 Score =   495 bits (1274),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 289/609 (47%), Positives = 395/609 (65%), Gaps = 51/609 (8%)
 Frame = -2

Query  2428  FPIYLKFTEVSYKIVIK------GVTFSEEKDILNGISGAVDPGEVLALMGPSGCGKTTL  2267
             +PI LKF EV YK+ I+      G    +EK ILNGI+G V PGE+LA++GPSG GKTTL
Sbjct  49    YPITLKFEEVVYKVKIEQTNQCLGSWSCKEKTILNGITGMVCPGEILAMLGPSGSGKTTL  108

Query  2266  LSLLGGRIRDPSAGSITYNQHPYSKLLKSRIGFVTQDDILFPHLTVKETLIYAARLRLPR  2087
             LS LGGR+    +G + YN  P+S  +K R GFV QDD+L+PHLTV ETL + A LRLP 
Sbjct  109   LSALGGRLAKSFSGKVMYNGQPFSGCIKRRTGFVAQDDVLYPHLTVWETLFFTALLRLPS  168

Query  2086  TLTKEEKDKRAMDVIYELGLDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLD  1907
             +LT++EK +    VI ELGL RC ++MIGG   RG+SGGE+KRV IG E++INPSLL LD
Sbjct  169   SLTRDEKAEHVDRVIAELGLTRCTNSMIGGPLFRGISGGEKKRVSIGQEMLINPSLLLLD  228

Query  1906  EPTSGLDSTTALRIVDILHEIAKAGKTVITTIHQPSSRLFHkfdklilleflldLANG--  1733
             EPTSGLDSTTA RIV  +  +A  G+TV+TTIHQPSSR++H FDK++LL     +  G  
Sbjct  229   EPTSGLDSTTAHRIVTTIKRLASGGRTVVTTIHQPSSRIYHMFDKVVLLSEGSPIYYGPA  288

Query  1732  ----------------NINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCY  1601
                              +N   +  +LA+ +   +S++E +    K     V E LV  Y
Sbjct  289   SSAVDYFSSVGFSTSMTVNPADLLLDLANGIPP-DSQKETSEQEQK----TVKETLVSAY  343

Query  1600  ETRVAETEKKKLM-APLPVEEELKSKVRYLKRE-WGASWSEQYVLLFHRGIRERWHDYFS  1427
             +  ++   K +L  A     E  K+  + LK E W  +W  Q+ +L  RG+RER  + F+
Sbjct  344   DKNISTKLKAELCNADSHSFEYTKAAAKNLKSEQWCTTWWYQFTVLLQRGVRERRFESFN  403

Query  1426  WLRITQVIATALILGMLWWQSGGDTP-SQMQDQAGLLFFIAVFWGFFPVFTAIFTFPQEK  1250
              LRI QVI+ A + G+LWW     TP S +QD+  LLFF +VFWGF+P++ A+FTFPQEK
Sbjct  404   KLRIFQVISVAFLGGLLWWH----TPKSHIQDRTALLFFFSVFWGFYPLYNAVFTFPQEK  459

Query  1249  AMLSKERAADMYRLSAYFAARTTSdlpldlllpliflLVVYFMAGLKQDASSFLLTAVTV  1070
              ML KER++ MYRLS+YF AR   DLPL+L LP  F+ ++Y+M GLK D ++F+L+ + V
Sbjct  460   RMLIKERSSGMYRLSSYFMARNVGDLPLELALPTAFVFIIYWMGGLKPDPTTFILSLLVV  519

Query  1069  FLCIVVAQGLGLAIGATLMDLKKATTLASVTVMTFMLAGGYFIKKVPGFIVWLRDLSFNY  890
                ++VAQGLGLA GA LM++K+ATTLASVT + F++AGGY+++++P FIVWL+ LS++Y
Sbjct  520   LYSVLVAQGLGLAFGALLMNIKQATTLASVTTLVFLIAGGYYVQQIPPFIVWLKYLSYSY  579

Query  889   HTFKLLLKVQY--EHKTNSVNGVQIDSG----IKEVG---------ALAAMAVSYRLLAY  755
             + +KLLL +QY  +       GV    G    IK +G          +  M V YRL+AY
Sbjct  580   YCYKLLLGIQYTDDDYYECSKGVWCRVGDFPAIKSMGLSNLWIDVFVMGVMLVGYRLIAY  639

Query  754   ISLRRMKLQ  728
             ++L R+KL+
Sbjct  640   MALHRVKLR  648



>ref|XP_004164431.1| PREDICTED: LOW QUALITY PROTEIN: ABC transporter G family member 
14-like [Cucumis sativus]
Length=655

 Score =   495 bits (1274),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 284/658 (43%), Positives = 405/658 (62%), Gaps = 61/658 (9%)
 Frame = -2

Query  2536  VRPDESADSKPFS-DDENPEDLEAGTKKKRSIPAEPTFPIYLKFTEVSYKIVIKGVTF--  2366
             V  +++  + PF  D  N +D         ++   P   + LKF E+ YK+ ++G     
Sbjct  4     VAQNDAVFAYPFHVDSHNTQDNNN--NNNNNLHQLPLLTVTLKFEEIVYKVKLEGKGGSC  61

Query  2365  -------------SEEKDILNGISGAVDPGEVLALMGPSGCGKTTLLSLLGGRIRDPSAG  2225
                          + EK ILNG+SG V PGE+LA++GPSG G TTLL+ LGGR+    +G
Sbjct  62    WGGGGGSSWGAAANREKTILNGLSGVVFPGEILAMLGPSGSGXTTLLTALGGRLSGKLSG  121

Query  2224  SITYNQHPYSKLLKSRIGFVTQDDILFPHLTVKETLIYAARLRLPRTLTKEEKDKRAMDV  2045
              ITYN  P+S   K R GFV QDD+L+PHLTV ETL++ A LRLP +LT +EK +    V
Sbjct  122   KITYNGQPFSGATKRRTGFVAQDDVLYPHLTVAETLLFTALLRLPSSLTADEKAEAVERV  181

Query  2044  IYELGLDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRI  1865
             I ELGL RC+++MIGG   RG+SGGE+KRV IG E++INPSLL LDEPTSGLDSTTA++I
Sbjct  182   ISELGLTRCRNSMIGGPLFRGISGGEKKRVSIGQEMLINPSLLLLDEPTSGLDSTTAMKI  241

Query  1864  VDILHEIAKAGKTVITTIHQPSSRLFHkfdklilleflldLANGN---------------  1730
             +  +  +A  G+T++TTIHQPSSRL+H FDK++LL     +  G+               
Sbjct  242   ITTVKRLAAGGRTIVTTIHQPSSRLYHMFDKVVLLSEGSPIYYGSASNAMDYFSSIGFST  301

Query  1729  ---INDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYETRVAETEKKKLMA  1559
                IN   +  +LA+ +   +        N +     V E L+  YE  ++ T K +L +
Sbjct  302   SITINPADLLLDLANGIAPDSKYANEGGENMEQEQKSVKEALISAYEKNISSTLKAELCS  361

Query  1558  PLP-----VEEELKSKVRYLKREWGASWSEQYVLLFHRGIRERWHDYFSWLRITQVIATA  1394
                       ++   + +  + EW  SW  Q+ +L  RG++ER +D F+ LRI QVI+ A
Sbjct  362   LDANNFNNYAKDASKREKRSREEWCTSWWYQFRVLLQRGLKERRYDAFNRLRIFQVISVA  421

Query  1393  LILGMLWWQSGGDTP-SQMQDQAGLLFFIAVFWGFFPVFTAIFTFPQEKAMLSKERAADM  1217
              + G+LWW     TP S ++D+  LLFF +VFWGF+P++ A+FTFPQE+ ML KER++ M
Sbjct  422   TLGGLLWWH----TPTSHIEDRIALLFFFSVFWGFYPLYNAVFTFPQERTMLIKERSSGM  477

Query  1216  YRLSAYFAARTTSdlpldlllpliflLVVYFMAGLKQDASSFLLTAVTVFLCIVVAQGLG  1037
             YRLS+YF ART  DLPL+L LP  F+ ++YFM GL    ++FLL+ + V   ++V+Q LG
Sbjct  478   YRLSSYFLARTVGDLPLELALPTAFVFIIYFMGGLDPHPTTFLLSLLIVLYSVLVSQSLG  537

Query  1036  LAIGATLMDLKKATTLASVTVMTFMLAGGYFIKKVPGFIVWLRDLSFNYHTFKLLLKVQY  857
             LA GA LMD+K+ATTLASVT + F++AGGY+I+++P FIVWL+ LS++Y+ +KLLL VQY
Sbjct  538   LAFGAILMDVKQATTLASVTTLVFLIAGGYYIQQIPPFIVWLKYLSYSYYCYKLLLGVQY  597

Query  856   EHKT---------------NSVNGVQIDSGIKEVGALAAMAVSYRLLAYISLRRMKLQ  728
              +                  +V  V +D    +V  +A M V YRL+AY++L R++L+
Sbjct  598   HNGDVYECGKGEFCQVVDFPAVKSVGLDRLWVDVCIMALMLVGYRLIAYLALHRVRLR  655



>ref|XP_009766511.1| PREDICTED: ABC transporter G family member 9-like [Nicotiana 
sylvestris]
Length=637

 Score =   494 bits (1273),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 288/621 (46%), Positives = 393/621 (63%), Gaps = 46/621 (7%)
 Frame = -2

Query  2482  EDLEAGTKKKRSIPAEPTFPIYLKFTEVSYKI--VIKGVTFS----EEKDILNGISGAVD  2321
             ++L +   K  +I  +   P+ LKF  V YKI  V +G   S    EEK IL G+SG V 
Sbjct  19    QNLHSAQSKSSAIFRKSNRPVTLKFENVVYKIKLVKEGCINSSKSVEEKIILKGVSGIVS  78

Query  2320  PGEVLALMGPSGCGKTTLLSLLGGR-IRDPSAGSITYNQHPYSKLLKSRIGFVTQDDILF  2144
             PGE+LA++GPSG GKTTLL+ LGGR +     G+ITYN  P+S  +K   GFVTQDD+L+
Sbjct  79    PGEMLAILGPSGSGKTTLLTGLGGRLVHGHLDGAITYNNKPFSNAMKRNTGFVTQDDVLY  138

Query  2143  PHLTVKETLIYAARLRLPRTLTKEEKDKRAMDVIYELGLDRCQDTMIGGSFVRGVSGGER  1964
             PHLTV ETL++ A LRLP TLT +EK   A  +I +LGL RC+D++IGG  +RG+SGGER
Sbjct  139   PHLTVTETLVFTALLRLPGTLTVQEKTAHAEAIITQLGLTRCKDSIIGGPLLRGISGGER  198

Query  1963  KRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILHEIAKAGKTVITTIHQPSSRLFH  1784
             KRV IG E++INPSLLFLDEPTSGLDSTTA RIV  L ++AK G+T++ TIHQPSSRLF+
Sbjct  199   KRVSIGQEMLINPSLLFLDEPTSGLDSTTAQRIVSTLRDLAKGGRTIVMTIHQPSSRLFY  258

Query  1783  kfdklilleflldLANGNIND-------------VSI-PSELADKVQTWNSKEEPTRNNG  1646
              F K++LL     L  G   D             V++ PS+    +      ++P   + 
Sbjct  259   MFHKVLLLSEGNPLYFGRGEDAMGYFSSVGYSPLVAMNPSDFLLDLSNGILSDDPRITSD  318

Query  1645  KPS--PAIVHEYLVGCYETRVAETEKKKLMAPLPVEEELKSKVRYLK-REWGASWSEQYV  1475
              P   PA + + LV  ++  +AE  K +L      + ++  K+   K  +W  +W +Q+ 
Sbjct  319   DPGEDPASIKQTLVTAFKNNLAENLKGQLQEF--DDHQVADKLHEKKFNQWSNTWWQQFS  376

Query  1474  LLFHRGIRERWHDYFSWLRITQVIATALILGMLWWQSGGDTPSQMQDQAGLLFFIAVFWG  1295
             +LF RG++ER H+ FS L++ QV+  + + G+LWW+S     S +QDQ GLLFF + FW 
Sbjct  377   VLFRRGMKERKHESFSGLKVGQVLVVSFLCGLLWWKS-----SNLQDQIGLLFFYSNFWE  431

Query  1294  FFPVFTAIFTFPQEKAMLSKERAADMYRLSAYFAARTTSdlpldlllpliflLVVYFMAG  1115
             F+P+F AIFTFPQE+ ML KER++ MYRLSAYF ART  DLP++L+LP IF+++ YFMAG
Sbjct  432   FYPMFQAIFTFPQERMMLEKERSSGMYRLSAYFMARTVGDLPMELVLPTIFVVITYFMAG  491

Query  1114  LKQDASSFLLTAVTVFLCIVVAQGLGLAIGATLMDLKKATTLASVTVMTFMLAGGYFIKK  935
             LK  A  F  T   +   ++V+QGLGLAIGA +MD K AT L SV +++F LAGGYF++ 
Sbjct  492   LKLSAGHFFSTLFALLYNVLVSQGLGLAIGAMVMDQKSATILGSVIMLSFTLAGGYFVQH  551

Query  934   VPGFIVWLRDLSFNYHTFKLLLKVQYEHKTNSVNGVQIDS------GIKEVG--------  797
             VP FI W++ +S + + +KLLL  QY        G+           IK +G        
Sbjct  552   VPSFIAWIKYVSISQYAYKLLLGSQYSPGETYACGINTTCLVEDFPSIKTIGLGGKGISV  611

Query  796   -ALAAMAVSYRLLAYISLRRM  737
              ALA M + YR LAY++L R+
Sbjct  612   LALAIMLLGYRFLAYVALMRI  632



>gb|EYU27464.1| hypothetical protein MIMGU_mgv1a002345mg [Erythranthe guttata]
Length=685

 Score =   495 bits (1275),  Expect = 4e-158, Method: Compositional matrix adjust.
 Identities = 279/659 (42%), Positives = 395/659 (60%), Gaps = 83/659 (13%)
 Frame = -2

Query  2512  SKPFSDDENPE-DLEAGTKKKRSIPAEPTFPIYLKFTEVSYKIVIKG-------------  2375
             S+P+  +   E D+E      R    +   PI+LKF +V +K+ +               
Sbjct  35    SQPYLRNTCSEIDIEEDIPSNRQ---DRPLPIFLKFADVEFKVKVGNGSSANPVKAVVSK  91

Query  2374  ------VTFSEEKDILNGISGAVDPGEVLALMGPSGCGKTTLLSLLGGRIRDPSAGSITY  2213
                   +     K IL GI+G++ PGE+LALMGPSG GKTTLL ++GGR+ +   GS+TY
Sbjct  92    VASQLNIEQDNYKQILKGITGSIGPGEILALMGPSGSGKTTLLKIIGGRLNENVKGSVTY  151

Query  2212  NQHPYSKLLKSRIGFVTQDDILFPHLTVKETLIYAARLRLPRTLTKEEKDKRAMDVIYEL  2033
             N   YS +LK RIGFVTQDD+LFP LTV+ETL++AA LRLP  ++  +K +R   ++ EL
Sbjct  152   NDISYSPVLKRRIGFVTQDDVLFPQLTVEETLVFAASLRLPSRMSVRQKYERVEMIVKEL  211

Query  2032  GLDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDIL  1853
             GL+RC+ T IGG F++G+SGGERKR  IG+EI+++PSLL LDEPTSGLDST+A R++ IL
Sbjct  212   GLERCRHTRIGGGFIKGISGGERKRTSIGHEILVDPSLLLLDEPTSGLDSTSANRLLQIL  271

Query  1852  HEIAKAGKTVITTIHQPSSRLFHkfdklillef---------------------------  1754
              ++ KAG+T+ITTIHQPSSR+FHKFD+++L+                             
Sbjct  272   QDLGKAGRTIITTIHQPSSRMFHKFDRVLLIAEGYPVYYGKARDSMEYFSCLRFIPQIPM  331

Query  1753  -----lldLANGNINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYETRV  1589
                  LLDLA G +ND+S+P EL     +  S  E  +N        V  YL   Y+  +
Sbjct  332   NPAEFLLDLATGQVNDISVPDEL---FASQESTAELEKN--------VIRYLQHKYKVEL  380

Query  1588  AETEKKKLMAPLPVEEELKSKVRYLKREWGASWSEQYVLLFHRGIRERWHDYFSWLRITQ  1409
                EK++      V E L+  ++  K +W  +W EQ+ +LF R  +ERW DYF  LR+ Q
Sbjct  381   EPKEKEENHQARKVPERLQLDIQ-AKLDWTLTWFEQFRILFKRTFKERWRDYFDQLRLIQ  439

Query  1408  VIATALILGMLWWQSGGDTPSQMQDQAGLLFFIAVFWGFFPVFTAIFTFPQEKAMLSKER  1229
                 A++LG+LWW+S   T +Q++DQ GLLF+I +FW    +F A++ FP EK  L KER
Sbjct  440   SFGVAILLGLLWWKSSTATEAQLRDQIGLLFYICIFWTSSSIFGAVYVFPFEKMYLVKER  499

Query  1228  AADMYRLSAYFAARTTSdlpldlllpliflLVVYFMAGLKQDASSFLLTAVTVFLCIVVA  1049
              ADMYRLS Y+   T SD+   LL P  F+ ++YFMAG K+    F LT  T+ L  V +
Sbjct  500   KADMYRLSVYYVCSTLSDMVAHLLYPTCFMCILYFMAGFKRTVECFFLTLSTILLIAVTS  559

Query  1048  QGLGLAIGATLMDLKKATTLASVTVMTFMLAGGYFIKKVPGFIVWLRDLSFNYHTFKLLL  869
             QG G   GA +M +++A  +AS+ +M F+L GGY+++ +P F+ WL+ +SF Y+ F+LL+
Sbjct  560   QGAGELFGAAVMSIRRAGMIASLILMLFLLTGGYYVQHIPKFMQWLKYVSFMYYGFRLLV  619

Query  868   KVQYE----------------HKTNSVNGVQIDSGIKEVGALAAMAVSYRLLAYISLRR  740
             KVQY                   + S + V ++ G+KEV  L AMA++YR+ AYI LRR
Sbjct  620   KVQYSGDQMYECESKGGCRSLQSSPSFDTVNLNGGMKEVWILLAMALAYRIAAYICLRR  678



>ref|XP_002270533.2| PREDICTED: ABC transporter G family member 14 [Vitis vinifera]
 emb|CBI29188.3| unnamed protein product [Vitis vinifera]
Length=657

 Score =   494 bits (1271),  Expect = 6e-158, Method: Compositional matrix adjust.
 Identities = 279/622 (45%), Positives = 401/622 (64%), Gaps = 49/622 (8%)
 Frame = -2

Query  2458  KKRSIPAEPTFPIYLKFTEVSYKIVIK-------GVTFSEEKDILNGISGAVDPGEVLAL  2300
               +SI     + I LKF EV YK+ ++       G   + +K ILNGI+G V PGE+LA+
Sbjct  40    NSQSILQHTLYSINLKFEEVVYKVKLEQKGFCWGGAWSTRDKTILNGITGMVCPGEILAM  99

Query  2299  MGPSGCGKTTLLSLLGGRIRDPSAGSITYNQHPYSKLLKSRIGFVTQDDILFPHLTVKET  2120
             +GPSG GKTTLL+ LGGR+    +G ITYN  P+S  +K R GFV QDD+L+PHLTV ET
Sbjct  100   LGPSGSGKTTLLTALGGRLNGKLSGKITYNGQPFSGAVKRRTGFVAQDDVLYPHLTVTET  159

Query  2119  LIYAARLRLPRTLTKEEKDKRAMDVIYELGLDRCQDTMIGGSFVRGVSGGERKRVCIGNE  1940
             L++ A LRLP++L + EK +    VI ELGL RC+++MIGG   RG+SGGE+KRV IG E
Sbjct  160   LLFTALLRLPKSLARNEKAQHVERVISELGLTRCRNSMIGGPLFRGISGGEKKRVSIGQE  219

Query  1939  IIINPSLLFLDEPTSGLDSTTALRIVDILHEIAKAGKTVITTIHQPSSRLFHkfdklill  1760
             ++INPSLL LDEPTSGLDSTTA RI+  +  +A  G+TV+TTIHQPSSRL+H FDK+ILL
Sbjct  220   MLINPSLLLLDEPTSGLDSTTAQRILTTIKRLASGGRTVVTTIHQPSSRLYHMFDKVILL  279

Query  1759  eflldLANG------------------NINDVSIPSELADKVQTWNSKEEPTRNNGKPSP  1634
                  + NG                   +N   +  +LA+ +   + +      N +   
Sbjct  280   SEGCPIYNGPASTAMEYFSSVGFSTCVTVNPADLLLDLANGISPDSKQAAEQSENMEQEQ  339

Query  1633  AIVHEYLVGCYETRVAETEKKKLMA----PLPVEEELKSKVRYLKREWGASWSEQYVLLF  1466
               V E L+  YE  ++   K +L +         ++ +++  +   +W  SW  Q+++L 
Sbjct  340   KSVREALISAYEKNISTRLKAELCSVDVNNYNYTKDGRARNNFKADQWCTSWWHQFMVLL  399

Query  1465  HRGIRERWHDYFSWLRITQVIATALILGMLWWQSGGDTP-SQMQDQAGLLFFIAVFWGFF  1289
              RG+RER ++ F+ LRI QVI+ A++ G+LWW     TP S ++D+  LLFF +VFWGF+
Sbjct  400   QRGLRERRYEAFNRLRIFQVISVAVLGGLLWWH----TPTSHIEDRIALLFFFSVFWGFY  455

Query  1288  PVFTAIFTFPQEKAMLSKERAADMYRLSAYFAARTTSdlpldlllpliflLVVYFMAGLK  1109
             P++ A+FTFPQE+ ML KER++ MYRLS+YF ART  DLPL+L LP  F++++Y+M GLK
Sbjct  456   PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLARTFGDLPLELALPTAFVIIIYWMGGLK  515

Query  1108  QDASSFLLTAVTVFLCIVVAQGLGLAIGATLMDLKKATTLASVTVMTFMLAGGYFIKKVP  929
              D  +F+L+ + V   ++V+Q LGLAIGA LMD+K+ATTLASVT + F++AGGY+++++P
Sbjct  516   PDPITFILSLLVVLYNVLVSQSLGLAIGAILMDIKQATTLASVTTLVFLIAGGYYVQQIP  575

Query  928   GFIVWLRDLSFNYHTFKLLLKVQYEHKTN---------------SVNGVQIDSGIKEVGA  794
              FIVWL+ LS++Y+ +KLLL +QY                    +V  V ++    +V  
Sbjct  576   PFIVWLKYLSYSYYCYKLLLGIQYSEDDYYECSKGVFCRVVDFPAVKSVGLNHLWIDVCI  635

Query  793   LAAMAVSYRLLAYISLRRMKLQ  728
             +A M V YRL+AY++L R++L+
Sbjct  636   MALMLVGYRLVAYLALHRVQLR  657



>ref|XP_006385164.1| ABC transporter family protein [Populus trichocarpa]
 gb|ERP62961.1| ABC transporter family protein [Populus trichocarpa]
Length=656

 Score =   494 bits (1271),  Expect = 7e-158, Method: Compositional matrix adjust.
 Identities = 282/625 (45%), Positives = 401/625 (64%), Gaps = 49/625 (8%)
 Frame = -2

Query  2467  GTKKKRSIPAEPTFPIYLKFTEVSYKIVI--KGVTF-----SEEKDILNGISGAVDPGEV  2309
             G    +S+     +P  LKF EV YK+ +  KG+ +     S EK ILNGI+G V PGE+
Sbjct  36    GQANSQSVLQLTIYPTTLKFEEVVYKVKLDQKGLCWGGTWSSREKTILNGITGMVCPGEI  95

Query  2308  LALMGPSGCGKTTLLSLLGGRIRDPSAGSITYNQHPYSKLLKSRIGFVTQDDILFPHLTV  2129
             LA++GPSG GKTTLL+ LGGR+    +G ITYN  P+S  +K R GFV QDDIL+PHLTV
Sbjct  96    LAMLGPSGSGKTTLLTALGGRLSGKLSGKITYNGQPFSGTMKRRTGFVAQDDILYPHLTV  155

Query  2128  KETLIYAARLRLPRTLTKEEKDKRAMDVIYELGLDRCQDTMIGGSFVRGVSGGERKRVCI  1949
              ETL++ A LRLP+TLT+EEK +    VI ELGL +C+++MIGG   RG+SGGE+KRV I
Sbjct  156   SETLLFTALLRLPKTLTREEKAQHVERVIAELGLSQCRNSMIGGPLFRGISGGEKKRVNI  215

Query  1948  GNEIIINPSLLFLDEPTSGLDSTTALRIVDILHEIAKAGKTVITTIHQPSSRLFHkfdkl  1769
             G E++INPSLL LDEPTSGLDSTTA RI+  +  +A  G+TV+TTIHQPSSRL+H FDK+
Sbjct  216   GQEMLINPSLLLLDEPTSGLDSTTAQRILTTIKRLASGGRTVVTTIHQPSSRLYHMFDKV  275

Query  1768  illeflldLANG------------------NINDVSIPSELADKVQTWNSKEEPTRNNGK  1643
             +LL     +  G                   +N   +  +LA+ +   +        N +
Sbjct  276   VLLSEGRPIYYGPASAALDYFSSIGFSTSMTVNPADLLLDLANGIGPDSKNATDYGENTE  335

Query  1642  PSPAIVHEYLVGCYETRVAETEKKKLMAPLP----VEEELKSKVRYLKREWGASWSEQYV  1475
                  V E L+  YE  ++   K +L    P      ++   +      +W  SW  Q+ 
Sbjct  336   QEQKSVREALISAYEKNISTRLKAELCNLDPNNYYYTKDASERNEKKSEKWCTSWWHQFK  395

Query  1474  LLFHRGIRERWHDYFSWLRITQVIATALILGMLWWQSGGDTP-SQMQDQAGLLFFIAVFW  1298
             +LF RG+RER ++ F+ LRI QV++ +++ G+LWW+    TP S ++D+  LLFF +VFW
Sbjct  396   VLFQRGLRERRYESFNRLRIFQVLSVSILGGLLWWK----TPTSHIEDRIALLFFFSVFW  451

Query  1297  GFFPVFTAIFTFPQEKAMLSKERAADMYRLSAYFAARTTSdlpldlllpliflLVVYFMA  1118
             GF+P++ A+FTFPQE+ ML KERA+ MY LS+YF ART  DLPL+L LP  F+ ++Y+M 
Sbjct  452   GFYPLYNAVFTFPQERRMLVKERASGMYHLSSYFLARTFGDLPLELALPTAFVFIIYWMG  511

Query  1117  GLKQDASSFLLTAVTVFLCIVVAQGLGLAIGATLMDLKKATTLASVTVMTFMLAGGYFIK  938
             GLK D  +F+L+ + V   ++V+Q LGLAIGA LMD+K+ATTLASVT + F++AGGY+++
Sbjct  512   GLKADPITFILSLLVVLYSVLVSQSLGLAIGAILMDVKQATTLASVTTLVFLIAGGYYVQ  571

Query  937   KVPGFIVWLRDLSFNYHTFKLLLKVQYEHKTN---------------SVNGVQIDSGIKE  803
             ++P FIVWL+ LS++Y+ +KLLL VQY    +               +V  + ++    +
Sbjct  572   QIPPFIVWLKYLSYSYYCYKLLLGVQYNEDDHYECSKGVLCRVGDFPAVKSMGLNHLWVD  631

Query  802   VGALAAMAVSYRLLAYISLRRMKLQ  728
             V  +A M V YR++AY++L R++L+
Sbjct  632   VAIMALMLVGYRMVAYLALHRVQLR  656



>gb|KHG01243.1| ABC transporter G family member 9 [Gossypium arboreum]
Length=629

 Score =   492 bits (1266),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 286/634 (45%), Positives = 403/634 (64%), Gaps = 63/634 (10%)
 Frame = -2

Query  2491  ENPEDLEAG-TKKKRSIPAEPTFPI-----YLKFTEVSYKIVIKGV--------TFSEEK  2354
             E   D+EA  T+ +    A   F +      LKF +V Y I ++ V        +  + K
Sbjct  2     EEVSDIEAAETRPEDQFKANAIFKVTNQQVVLKFIDVVYTIKLRKVGKLFEKNPSSDDNK  61

Query  2353  DILNGISGAVDPGEVLALMGPSGCGKTTLLSLLGGRIRDPSAGSITYNQHPYSKLLKSRI  2174
              ILNGI G V PGE+LA++GPSG GKTTLL+ LGGR+     G+ITYN  P+S  +K + 
Sbjct  62    VILNGIRGMVQPGEMLAMLGPSGSGKTTLLTALGGRLGGHLNGTITYNGKPFSNSMKRKT  121

Query  2173  GFVTQDDILFPHLTVKETLIYAARLRLPRTLTKEEKDKRAMDVIYELGLDRCQDTMIGGS  1994
             GFVTQDD+L+PHLTV ETLI+ A LRLP + TK++K   A  VI +LGL +C++++IG  
Sbjct  122   GFVTQDDVLYPHLTVTETLIFTALLRLPNSFTKQDKIMHAEAVIDQLGLTKCKNSIIGEP  181

Query  1993  FVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILHEIAKAGKTVITT  1814
             F+RGVSGGERKRV IG E++INPSLLFLDEPTSGLDSTTA RIV  L E+ + G+TV+ T
Sbjct  182   FLRGVSGGERKRVSIGQEMLINPSLLFLDEPTSGLDSTTAQRIVSTLLELTEGGRTVVLT  241

Query  1813  IHQPSSRLFHkfdkli-------------lleflldLANGNINDVSI-PSELADKVQTWN  1676
             IHQPSSR+F+ F K++                     + G +  V++ PS+    +   +
Sbjct  242   IHQPSSRIFYMFHKVLLLCDGNPLYFGQGSATMDYFSSIGYVPSVAMNPSDFLLDLANGD  301

Query  1675  SKEEPTRNNGKPSPAIVHEYLVGCYETRVAETEKKKL--MAPLPVEEELKSKVRYLKREW  1502
             S  E  +        +V + L+G Y  ++A+  K++L  M+  P  +EL++K   +   W
Sbjct  302   SPNESMKEQ-----TLVKKTLIGAYGMKIADKLKEELQDMSNEPAPDELENKKLAM---W  353

Query  1501  GASWSEQYVLLFHRGIRERWHDYFSWLRITQVIATALILGMLWWQSGGDTPSQMQDQAGL  1322
               +W +Q+++L  RG++ER H+ FS L I +V+  A++ G+LWW+      S +QDQ GL
Sbjct  354   PTTWWQQFIVLLRRGVKERKHESFSGLNIAEVLIVAVLSGLLWWKI---DISHLQDQIGL  410

Query  1321  LFFIAVFWGFFPVFTAIFTFPQEKAMLSKERAADMYRLSAYFAARTTSdlpldlllplif  1142
             LFF + FWGF+P+F AIFTFP+E+ ML KER++  YRLS+YF +R T+DLP++L+LP +F
Sbjct  411   LFFTSGFWGFYPLFQAIFTFPRERMMLEKERSSGTYRLSSYFISRITADLPMELILPTVF  470

Query  1141  lLVVYFMAGLKQDASSFLLTAVTVFLCIVVAQGLGLAIGATLMDLKKATTLASVTVMTFM  962
             L + Y+MAGLK  A++F  T   +   ++V+QGLGLA+GA +MDLK AT L SV ++TF 
Sbjct  471   LTITYWMAGLKPTATNFFHTLFVLLFSVLVSQGLGLALGAMVMDLKSATILGSVIMLTFF  530

Query  961   LAGGYFIKKVPGFIVWLRDLSFNYHTFKLLLKVQYE----------HKTNSVNGVQIDSG  812
             LAGGY+I+ VP FI W++ +S ++HT+KLLL  QY+           KT  +   Q   G
Sbjct  531   LAGGYYIQHVPPFIAWIKYMSISHHTYKLLLGSQYKPNETYPCGDHSKTCLIGDFQ---G  587

Query  811   IKEVG---------ALAAMAVSYRLLAYISLRRM  737
             IK VG         ALA M V YRL+AY++L R+
Sbjct  588   IKSVGLNGQVVSAVALAIMLVMYRLIAYLALMRI  621



>emb|CDY12299.1| BnaA09g24990D [Brassica napus]
Length=712

 Score =   494 bits (1273),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 289/610 (47%), Positives = 395/610 (65%), Gaps = 52/610 (9%)
 Frame = -2

Query  2428  FPIYLKFTEVSYKIVIK------GVTFSEEKDILNGISGAVDPGEVLALMGPSGCGKTTL  2267
             + I LKF EV YK+ I+      G    +EK ILNGI+G V PGE+LA++GPSG GKTTL
Sbjct  49    YSITLKFEEVVYKVKIEQTGQCLGSWSCKEKTILNGITGMVCPGEILAMLGPSGSGKTTL  108

Query  2266  LSLLGGRIRDPSAGSITYNQHPYSKLLKSRIGFVTQDDILFPHLTVKETLIYAARLRLPR  2087
             LS LGGR+    +G + YN  P+S  +K R GFV QDD+L+PHLTV ETL + A LRLP 
Sbjct  109   LSALGGRLSKTFSGKVIYNGQPFSGCIKRRTGFVAQDDVLYPHLTVWETLFFTALLRLPS  168

Query  2086  TLTKEEKDKRAMDVIYELGLDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLD  1907
             +LT++EK +    VI ELGL+RC ++MIGG   RG+SGGE+KRV IG E++INPSLL LD
Sbjct  169   SLTRDEKAEHVDRVIAELGLNRCTNSMIGGPLFRGISGGEKKRVSIGQEMLINPSLLLLD  228

Query  1906  EPTSGLDSTTALRIVDILHEIAKAGKTVITTIHQPSSRLFHkfdklilleflldLANG--  1733
             EPTSGLDSTTA RIV  +  +A  G+TV+TTIHQPSSR++H FDK++LL     L  G  
Sbjct  229   EPTSGLDSTTAHRIVTTIKRLASGGRTVVTTIHQPSSRIYHMFDKVVLLSEGSPLYYGPA  288

Query  1732  ----------------NINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCY  1601
                              +N   +  +LA+ +   +S++E +    K     V E L+  Y
Sbjct  289   SSAMEYFSSVGFCTSMTVNPADLLLDLANGIPP-DSQKETSEQEQK----TVKEALISAY  343

Query  1600  ETRVAETEKKKLM-APLPVEEELKSKVRYLK--REWGASWSEQYVLLFHRGIRERWHDYF  1430
             E  ++   K +L  A     E  KS  + +K   +W  SW  Q+ +L  RG+RER  + F
Sbjct  344   EKNISTKLKAELCNADSHSFEYTKSAAKNIKSSEQWCTSWWYQFTVLLQRGVRERRFESF  403

Query  1429  SWLRITQVIATALILGMLWWQSGGDTP-SQMQDQAGLLFFIAVFWGFFPVFTAIFTFPQE  1253
             + LRI QVI+ A + G+LWW     TP S +QD+  LLFF +VFWGF+P++ A+FTFPQE
Sbjct  404   NKLRIFQVISVAFLGGLLWWH----TPKSHLQDRTALLFFFSVFWGFYPLYNAVFTFPQE  459

Query  1252  KAMLSKERAADMYRLSAYFAARTTSdlpldlllpliflLVVYFMAGLKQDASSFLLTAVT  1073
             K ML KER++ MYRLS+YF AR   DLPL+L LP  F+ ++Y+M GLK D ++F+L+ + 
Sbjct  460   KRMLIKERSSGMYRLSSYFMARNVGDLPLELALPTAFVFIIYWMGGLKPDPTTFILSLLV  519

Query  1072  VFLCIVVAQGLGLAIGATLMDLKKATTLASVTVMTFMLAGGYFIKKVPGFIVWLRDLSFN  893
             V   ++VAQGLGLA GA LM++K+ATTLASVT + F++AGGY+++++P FIVWL+ LS++
Sbjct  520   VLYSVLVAQGLGLAFGALLMNIKQATTLASVTTLVFLIAGGYYVQQIPPFIVWLKYLSYS  579

Query  892   YHTFKLLLKVQY--EHKTNSVNGVQID----SGIKEVG---------ALAAMAVSYRLLA  758
             Y+ +KLLL +QY  +       GV        GIK +G          +  M V YRL+A
Sbjct  580   YYCYKLLLGIQYTDDDYYECSEGVWCRVGDFPGIKAMGLNSLWIDVFVMGVMLVGYRLIA  639

Query  757   YISLRRMKLQ  728
             Y++L R+KL+
Sbjct  640   YMALHRVKLR  649



>ref|XP_004294923.1| PREDICTED: ABC transporter G family member 26-like [Fragaria 
vesca subsp. vesca]
Length=688

 Score =   494 bits (1271),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 273/628 (43%), Positives = 385/628 (61%), Gaps = 76/628 (12%)
 Frame = -2

Query  2428  FPIYLKFTEVSYKI--------VIKGVTF---------SEEKDILNGISGAVDPGEVLAL  2300
              PIYLKF +V +K+         +K +           S  K IL GI+G++ PGE+LAL
Sbjct  65    LPIYLKFEDVEFKVRNSKASSNTVKAMVSKVASQLHIESNYKHILKGITGSIGPGEILAL  124

Query  2299  MGPSGCGKTTLLSLLGGRIRDPSAGSITYNQHPYSKLLKSRIGFVTQDDILFPHLTVKET  2120
             MGPSG GKTTLL ++GGR+ D   G +TYN  PY+ +LK RIGFVTQDD+LFP LTV+ET
Sbjct  125   MGPSGSGKTTLLKVIGGRLLDNVKGKVTYNDIPYTPVLKRRIGFVTQDDVLFPQLTVEET  184

Query  2119  LIYAARLRLPRTLTKEEKDKRAMDVIYELGLDRCQDTMIGGSFVRGVSGGERKRVCIGNE  1940
             L+++A LRLP +++++EK  R   ++ ELGL+RC+ T IGG F++G+SGGERKR  IG E
Sbjct  185   LVFSAFLRLPGSISRQEKYARVETILKELGLERCRHTRIGGGFIKGISGGERKRTSIGYE  244

Query  1939  IIINPSLLFLDEPTSGLDSTTALRIVDILHEIAKAGKTVITTIHQPSSRLFHkfdklill  1760
             I+++PSLL LDEPTSGLDST+A R++ IL  +AK G+T+ITTIHQPSSR+FH FDKL+L+
Sbjct  245   ILVDPSLLLLDEPTSGLDSTSANRLLMILQGLAKGGRTIITTIHQPSSRMFHMFDKLLLI  304

Query  1759  ef--------------------------------lldLANGNINDVSIPSELADKVQTWN  1676
                                               LLDLA G +ND+S+P +L        
Sbjct  305   AEGYPVYYGKAGESLEYFSALRFIPQLPMNPAEFLLDLATGQVNDISVPPDLL-------  357

Query  1675  SKEEPTRNNGKPSPAIVHEYLVGCYETRVAETEKKKLMAPLPVEEELKSKVRYLKREWGA  1496
                 P       S   V +YL   Y++++   EK++        E L+  V+ +K++W  
Sbjct  358   ---LPQGQRTLDSEKAVIQYLQLKYKSQLETKEKEENHRGRKAPEHLQLAVQ-VKKDWTV  413

Query  1495  SWSEQYVLLFHRGIRERWHDYFSWLRITQVIATALILGMLWWQSGGDTPSQMQDQAGLLF  1316
             SW EQ+++LF R  RER  DYF  LR+ Q +  A++LG+LWW+S  DT + ++DQ GL+F
Sbjct  414   SWVEQFMILFKRTFRERCRDYFDKLRLVQAVGVAILLGLLWWKSKTDTEAHLRDQVGLMF  473

Query  1315  FIAVFWGFFPVFTAIFTFPQEKAMLSKERAADMYRLSAYFAARTTSdlpldlllpliflL  1136
             +I +FW    +F A++ FP E+  L KER ADMYRLS Y+   T  D+   +  P  F+L
Sbjct  474   YICIFWTSSSIFGAVYVFPFEQIFLVKERKADMYRLSVYYVCSTLCDMIAHVFYPTFFML  533

Query  1135  VVYFMAGLKQDASSFLLTAVTVFLCIVVAQGLGLAIGATLMDLKKATTLASVTVMTFMLA  956
             +VYFMAG K     F LT   + L  + +QG G   GA ++ +K+A  +AS+ +M F+L 
Sbjct  534   IVYFMAGFKNTVPCFFLTLFAILLVAITSQGAGELFGALVLSIKRAGMVASLILMLFLLT  593

Query  955   GGYFIKKVPGFIVWLRDLSFNYHTFKLLLKVQYE----HKTNSVNG------------VQ  824
             GGY+++ +P F+ WL+ LSF ++ F+LLLKVQY     ++  S+ G            V+
Sbjct  594   GGYYVQHIPKFMQWLKYLSFMWYGFRLLLKVQYSGDDLYECESIGGCRPLQSSPTFEMVE  653

Query  823   IDSGIKEVGALAAMAVSYRLLAYISLRR  740
             +D G+KEV  L AMA+ YRL AY  LR+
Sbjct  654   LDGGMKEVWILLAMAICYRLCAYFCLRK  681



>ref|XP_009757349.1| PREDICTED: ABC transporter G family member 14-like [Nicotiana 
sylvestris]
Length=630

 Score =   491 bits (1263),  Expect = 4e-157, Method: Compositional matrix adjust.
 Identities = 277/603 (46%), Positives = 398/603 (66%), Gaps = 47/603 (8%)
 Frame = -2

Query  2428  FPIYLKFTEVSYKIVIKGVTFSEEKDILNGISGAVDPGEVLALMGPSGCGKTTLLSLLGG  2249
             FPI LKF E+ YKI     T ++EK ILNG++G V PGE+LA++GPSG GKTTLL+ LGG
Sbjct  37    FPITLKFEEIVYKI-----TSTKEKTILNGVTGIVCPGEMLAMLGPSGSGKTTLLTALGG  91

Query  2248  RIRDPSAGSITYNQHPYSKLLKSRIGFVTQDDILFPHLTVKETLIYAARLRLPRTLTKEE  2069
             R+    +G ITYN  P+S  +K   GFV QDDIL+PHLTV ETL++ A LRLP++L+K+E
Sbjct  92    RLSGKLSGKITYNSQPFSGAIKRSTGFVAQDDILYPHLTVTETLLFTALLRLPQSLSKQE  151

Query  2068  KDKRAMDVIYELGLDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGL  1889
             K++    VI ELGL++C+++MIGG   RG+SGGE+KRV IG E++INPSLL LDEPTSGL
Sbjct  152   KEQHVEHVITELGLNKCRNSMIGGPLFRGISGGEKKRVSIGQEMLINPSLLLLDEPTSGL  211

Query  1888  DSTTALRIVDILHEIAKAGKTVITTIHQPSSRLFHkfdklilleflldLANG--------  1733
             DSTTALRI+  +  +A  G+TVITTIHQPSSRL+H FDK++LL     +  G        
Sbjct  212   DSTTALRILTTVKRLANGGRTVITTIHQPSSRLYHMFDKVVLLSEGCPIYYGPASTALEY  271

Query  1732  ----------NINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYETRVAE  1583
                        IN   +  +LA+ +   +       +N +     V E L+  Y+  ++ 
Sbjct  272   FSSVGVSTSITINPADLLLDLANGIGPDSKHAIEQGDNPEQEKKSVREALISAYDKTIST  331

Query  1582  TEKKKLMA----PLPVEEELKSKVRYLKREWGASWSEQYVLLFHRGIRERWHDYFSWLRI  1415
               K +L +        ++++ +K      +W  SW  Q+ +L  RG+RER ++ F+ LRI
Sbjct  332   RLKTELCSLDTNNYSYKKDVSTKNGVKSEQWCTSWGYQFKVLLLRGLRERRYETFNRLRI  391

Query  1414  TQVIATALILGMLWWQSGGDTP-SQMQDQAGLLFFIAVFWGFFPVFTAIFTFPQEKAMLS  1238
              QVI+ A + G+LWW     TP S ++D+  +LFF AVFWGF+P++ A+FTFPQE+ ML 
Sbjct  392   FQVISVAFLAGLLWWH----TPTSHIEDRIAMLFFFAVFWGFYPLYNAVFTFPQERRMLI  447

Query  1237  KERAADMYRLSAYFAARTTSdlpldlllpliflLVVYFMAGLKQDASSFLLTAVTVFLCI  1058
             KER++ MYRLS+YF A+T  DLP++L LP  F  ++Y+M GLK + ++F+L+ + V   +
Sbjct  448   KERSSGMYRLSSYFLAKTVGDLPIELALPTAFTFILYWMGGLKANPATFILSLLIVLYSV  507

Query  1057  VVAQGLGLAIGATLMDLKKATTLASVTVMTFMLAGGYFIKKVPGFIVWLRDLSFNYHTFK  878
             +V+Q LGLA GA LMD+K+ATTLASVT + F++AGGY+I+++P FIVWL+ LS++Y+ +K
Sbjct  508   LVSQSLGLAYGAMLMDVKQATTLASVTTLVFLIAGGYYIQQIPPFIVWLKYLSYSYYCYK  567

Query  877   LLLKVQYEHKTN---------------SVNGVQIDSGIKEVGALAAMAVSYRLLAYISLR  743
             LLL VQY+ K                 ++  V +++   +V  +A M V YRL+AY++L 
Sbjct  568   LLLGVQYKDKDYYECSKGVYCRVADFPAIKSVGLNNMWMDVLIMALMLVGYRLVAYLALN  627

Query  742   RMK  734
             R++
Sbjct  628   RVR  630



>ref|XP_007040852.1| ATP-binding cassette 14 [Theobroma cacao]
 gb|EOY25353.1| ATP-binding cassette 14 [Theobroma cacao]
Length=656

 Score =   491 bits (1264),  Expect = 6e-157, Method: Compositional matrix adjust.
 Identities = 291/642 (45%), Positives = 407/642 (63%), Gaps = 50/642 (8%)
 Frame = -2

Query  2518  ADSKPFSDDENPEDLEAGTKKKRSIPAEPT-FPIYLKFTEVSYKIVIK------GVTFSE  2360
             A S+  S+  N   L    +     P   T +PI LKF +V YK+ ++      G   + 
Sbjct  20    ALSETSSESHNRAVLAFPIQHNSQPPVRVTLYPITLKFEKVVYKVKLEQKGSCWGAWITR  79

Query  2359  EKDILNGISGAVDPGEVLALMGPSGCGKTTLLSLLGGRIRDPSAGSITYNQHPYSKLLKS  2180
             EK ILNGI+G V PGE+LA++GPSG GKTTLL+ LGGR+    +G+ITYN  P+S  +K 
Sbjct  80    EKTILNGITGVVCPGEILAMLGPSGSGKTTLLTALGGRLTGKLSGNITYNGQPFSGGVKR  139

Query  2179  RIGFVTQDDILFPHLTVKETLIYAARLRLPRTLTKEEKDKRAMDVIYELGLDRCQDTMIG  2000
             R GFV QDD+L+PHLTV ETL++ A LRLP++L+++EK +    VI ELGL RC++++IG
Sbjct  140   RTGFVAQDDVLYPHLTVTETLLFTALLRLPKSLSRDEKVQHVERVIAELGLTRCRNSIIG  199

Query  1999  GSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILHEIAKAGKTVI  1820
             G  +RG+SGGE+KRV IG E++INPSLL LDEPTSGLDSTTA RI+  +  +A  G+TV+
Sbjct  200   GPLLRGISGGEKKRVSIGQEMLINPSLLLLDEPTSGLDSTTAQRILTTIKRLASGGRTVV  259

Query  1819  TTIHQPSSRLFHkfdklilleflldLANGN------------------INDVSIPSELAD  1694
             TTIHQPSSRL+H FDK++LL     +  G+                  +N   +  +LA+
Sbjct  260   TTIHQPSSRLYHMFDKVVLLSEGCPIYYGSASAALEYFSSIGFSTSMTVNPADLLLDLAN  319

Query  1693  KVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYETRVAETEKKKLMAPLPVEEELKSK---V  1523
              +            N +     V + L+  YE  ++   K +L     V   + +K    
Sbjct  320   GIGPDFKHSVEQVENTEQEQKSVKDALISAYEKNISPRLKAELCNS-DVNNHVNTKEAPA  378

Query  1522  RYLK-REWGASWSEQYVLLFHRGIRERWHDYFSWLRITQVIATALILGMLWWQSGGDTP-  1349
             R  K  EW  SW  Q+ +L  RG+RER H+ F+ LRI QVI+ A++ G+LWW     TP 
Sbjct  379   RNGKSEEWCTSWWHQFKVLLQRGVRERRHEAFNGLRIFQVISVAVLGGLLWWH----TPA  434

Query  1348  SQMQDQAGLLFFIAVFWGFFPVFTAIFTFPQEKAMLSKERAADMYRLSAYFAARTTSdlp  1169
             S + D+  LLFF +VFWGF+P++ A+FTFPQE+ ML KER++ MYRLS+YF ART  DLP
Sbjct  435   SHISDRIALLFFFSVFWGFYPLYNAVFTFPQERTMLIKERSSGMYRLSSYFLARTFGDLP  494

Query  1168  ldlllpliflLVVYFMAGLKQDASSFLLTAVTVFLCIVVAQGLGLAIGATLMDLKKATTL  989
             L+L LP  F+ ++Y+M GLK D  +F+L+ + V   ++V+Q LGLAIGA LMD+K+ATTL
Sbjct  495   LELALPTAFVFIIYWMGGLKPDPVTFILSLLVVLYNVLVSQSLGLAIGAILMDIKQATTL  554

Query  988   ASVTVMTFMLAGGYFIKKVPGFIVWLRDLSFNYHTFKLLLKVQYEHKT--NSVNGVQIDS  815
             ASVT + F++AGGY+++++P FIVWL+ LS++Y+ +KLLL VQY          GV    
Sbjct  555   ASVTTLVFLIAGGYYVQQIPAFIVWLKYLSYSYYCYKLLLGVQYNEDDYYECSKGVLCRV  614

Query  814   G----IKEVG---------ALAAMAVSYRLLAYISLRRMKLQ  728
             G    IK +G          +A M V YRL+AY++L R++L+
Sbjct  615   GDLPAIKSMGLNHLWVDVCIMALMLVGYRLIAYMALHRVRLR  656



>ref|XP_004246010.1| PREDICTED: ABC transporter G family member 14 [Solanum lycopersicum]
Length=646

 Score =   490 bits (1262),  Expect = 8e-157, Method: Compositional matrix adjust.
 Identities = 273/610 (45%), Positives = 395/610 (65%), Gaps = 49/610 (8%)
 Frame = -2

Query  2428  FPIYLKFTEVSYKI-------VIKGVTFSEEKDILNGISGAVDPGEVLALMGPSGCGKTT  2270
             FPI LKF EV YKI          G + ++EK ILNG++G V PGE+LA++GPSG GKTT
Sbjct  41    FPITLKFEEVVYKIKQETKGMCCGGPSSTKEKTILNGVTGIVCPGEMLAMLGPSGSGKTT  100

Query  2269  LLSLLGGRIRDPSAGSITYNQHPYSKLLKSRIGFVTQDDILFPHLTVKETLIYAARLRLP  2090
             LL+ LGGR+    +G ITYN  P+S  +K R GFV QDD+L+PHLTV ETL++ A LRLP
Sbjct  101   LLTALGGRLSGKLSGKITYNSQPFSGAIKRRTGFVAQDDVLYPHLTVTETLLFTALLRLP  160

Query  2089  RTLTKEEKDKRAMDVIYELGLDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFL  1910
             ++L++EEK++    VI ELGL++C+++MIGG   RG+SGGE+KRV IG E++INPSLL L
Sbjct  161   QSLSREEKERHVEHVIVELGLNKCRNSMIGGPLFRGISGGEKKRVSIGQEMLINPSLLLL  220

Query  1909  DEPTSGLDSTTALRIVDILHEIAKAGKTVITTIHQPSSRLFHkfdklilleflldLANG-  1733
             DEPTSGLDSTTALRI+  +  +A  G+TVITTIHQPSSRL+H FDK++LL     +  G 
Sbjct  221   DEPTSGLDSTTALRILTTVKRLADGGRTVITTIHQPSSRLYHMFDKVVLLSEGCPIYYGP  280

Query  1732  -----------------NINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGC  1604
                               IN   +  +LA+ +   +       +N +     V E L+  
Sbjct  281   ASTALEYFSSVGFSTSITINPADLLLDLANGIGPDSKHATEQGDNSEQEKKSVREALISA  340

Query  1603  YETRVAETEKKKLMAP----LPVEEELKSKVRYLKREWGASWSEQYVLLFHRGIRERWHD  1436
             Y+  +    K +L +         +++ ++       W  SW  Q+ +L  RG++ER ++
Sbjct  341   YDKNIYTRLKTELCSSDTNNYSYTKDVSTRNGAKSEHWCTSWGYQFKVLLLRGLKERRYE  400

Query  1435  YFSWLRITQVIATALILGMLWWQSGGDTP-SQMQDQAGLLFFIAVFWGFFPVFTAIFTFP  1259
              F+ LRI QV++ A + G+LWW     TP S ++D+  ++FF AVFWGF+P++ A+FTFP
Sbjct  401   TFNKLRIFQVVSVAFLAGLLWWH----TPTSHIEDRIAMVFFFAVFWGFYPLYNAVFTFP  456

Query  1258  QEKAMLSKERAADMYRLSAYFAARTTSdlpldlllpliflLVVYFMAGLKQDASSFLLTA  1079
             QE+ ML KER++ MYRLS+YF A+T  DLPL+L LP  F  ++Y+M GLK + ++F+L+ 
Sbjct  457   QERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLKANPATFILSL  516

Query  1078  VTVFLCIVVAQGLGLAIGATLMDLKKATTLASVTVMTFMLAGGYFIKKVPGFIVWLRDLS  899
             + V   ++V+Q LGLA GA LMD+K+ATTLASVT + F++AGGY+I+++P FIVWL+ LS
Sbjct  517   LVVLYSVLVSQSLGLAYGAMLMDVKQATTLASVTTLVFLIAGGYYIQQIPPFIVWLKYLS  576

Query  898   FNYHTFKLLLKVQYEHKTN---------------SVNGVQIDSGIKEVGALAAMAVSYRL  764
             ++Y+ +KLLL VQY                    ++  + +++   +V  +A M V YRL
Sbjct  577   YSYYCYKLLLGVQYNDNDYYECSKGVYCQVAEFPAIKSIGLNNMWMDVFIMALMLVGYRL  636

Query  763   LAYISLRRMK  734
             +AY++L R++
Sbjct  637   IAYLALNRVR  646



>gb|AAG50724.1|AC079041_17 ABC transporter, putative [Arabidopsis thaliana]
Length=646

 Score =   490 bits (1262),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 289/609 (47%), Positives = 395/609 (65%), Gaps = 53/609 (9%)
 Frame = -2

Query  2428  FPIYLKFTEVSYKIVIK------GVTFSEEKDILNGISGAVDPGEVLALMGPSGCGKTTL  2267
             +PI LK  EV YK+ I+      G   S+EK ILNGI+G V PGE LA++GPSG GKTTL
Sbjct  49    YPITLK--EVVYKVKIEQTSQCMGSWKSKEKTILNGITGMVCPGEFLAMLGPSGSGKTTL  106

Query  2266  LSLLGGRIRDPSAGSITYNQHPYSKLLKSRIGFVTQDDILFPHLTVKETLIYAARLRLPR  2087
             LS LGGR+    +G + YN  P+S  +K R GFV QDD+L+PHLTV ETL + A LRLP 
Sbjct  107   LSALGGRLSKTFSGKVMYNGQPFSGCIKRRTGFVAQDDVLYPHLTVWETLFFTALLRLPS  166

Query  2086  TLTKEEKDKRAMDVIYELGLDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLD  1907
             +LT++EK +    VI ELGL+RC ++MIGG   RG+SGGE+KRV IG E++INPSLL LD
Sbjct  167   SLTRDEKAEHVDRVIAELGLNRCTNSMIGGPLFRGISGGEKKRVSIGQEMLINPSLLLLD  226

Query  1906  EPTSGLDSTTALRIVDILHEIAKAGKTVITTIHQPSSRLFHkfdklilleflldLANG--  1733
             EPTSGLDSTTA RIV  +  +A  G+TV+TTIHQPSSR++H FDK++LL     +  G  
Sbjct  227   EPTSGLDSTTAHRIVTTIKRLASGGRTVVTTIHQPSSRIYHMFDKVVLLSEGSPIYYGAA  286

Query  1732  ----------------NINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCY  1601
                              +N   +  +LA+ +   ++++E +    K     V E LV  Y
Sbjct  287   SSAVEYFSSLGFSTSLTVNPADLLLDLANGIPP-DTQKETSEQEQK----TVKETLVSAY  341

Query  1600  ETRVAETEKKKLM-APLPVEEELKSKVRYLKRE-WGASWSEQYVLLFHRGIRERWHDYFS  1427
             E  ++   K +L  A     E  K+  + LK E W  +W  Q+ +L  RG+RER  + F+
Sbjct  342   EKNISTKLKAELCNAESHSYEYTKAAAKNLKSEQWCTTWWYQFTVLLQRGVRERRFESFN  401

Query  1426  WLRITQVIATALILGMLWWQSGGDTP-SQMQDQAGLLFFIAVFWGFFPVFTAIFTFPQEK  1250
              LRI QVI+ A + G+LWW     TP S +QD+  LLFF +VFWGF+P++ A+FTFPQEK
Sbjct  402   KLRIFQVISVAFLGGLLWWH----TPKSHIQDRTALLFFFSVFWGFYPLYNAVFTFPQEK  457

Query  1249  AMLSKERAADMYRLSAYFAARTTSdlpldlllpliflLVVYFMAGLKQDASSFLLTAVTV  1070
              ML KER++ MYRLS+YF AR   DLPL+L LP  F+ ++Y+M GLK D ++F+L+ + V
Sbjct  458   RMLIKERSSGMYRLSSYFMARNVGDLPLELALPTAFVFIIYWMGGLKPDPTTFILSLLVV  517

Query  1069  FLCIVVAQGLGLAIGATLMDLKKATTLASVTVMTFMLAGGYFIKKVPGFIVWLRDLSFNY  890
                ++VAQGLGLA GA LM++K+ATTLASVT + F++AGGY+++++P FIVWL+ LS++Y
Sbjct  518   LYSVLVAQGLGLAFGALLMNIKQATTLASVTTLVFLIAGGYYVQQIPPFIVWLKYLSYSY  577

Query  889   HTFKLLLKVQY--EHKTNSVNGVQIDSG----IKEVG---------ALAAMAVSYRLLAY  755
             + +KLLL +QY  +       GV    G    IK +G          +  M V YRL+AY
Sbjct  578   YCYKLLLGIQYTDDDYYECSKGVWCRVGDFPAIKSMGLNNLWIDVFVMGVMLVGYRLMAY  637

Query  754   ISLRRMKLQ  728
             ++L R+KL+
Sbjct  638   MALHRVKLR  646



>gb|EYU29117.1| hypothetical protein MIMGU_mgv1a002688mg [Erythranthe guttata]
Length=646

 Score =   490 bits (1261),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 279/629 (44%), Positives = 396/629 (63%), Gaps = 62/629 (10%)
 Frame = -2

Query  2461  KKKRSIPAEPTFPIYLKFTEVSYKI----------VIKGVTFSEEKDILNGISGAVDPGE  2312
             K  +S      +PI LKF E+ YK+               T + EK ILNG++G V PGE
Sbjct  27    KISQSFRQRALYPITLKFEEIVYKVNGGREGSCCGGGGASTATGEKTILNGVTGMVCPGE  86

Query  2311  VLALMGPSGCGKTTLLSLLGGRIRDPSAGSITYNQHPYSKLLKSRIGFVTQDDILFPHLT  2132
             +LA++GPSG GKTTLL+ LGGR+    +G ITYN HP+S  +K + GFV QDD+L+ HLT
Sbjct  87    LLAMLGPSGSGKTTLLTALGGRLTGKLSGKITYNGHPFSSSIKRKTGFVAQDDVLYQHLT  146

Query  2131  VKETLIYAARLRLPRTLTKEEKDKRAMDVIYELGLDRCQDTMIGGSFVRGVSGGERKRVC  1952
             V ETL++ A LRLP++LTKEEK +    VI ELGL++CQ++MIGG   RG+SGGE+KRV 
Sbjct  147   VFETLLFTALLRLPKSLTKEEKAEHVEHVIAELGLNKCQNSMIGGPLFRGISGGEKKRVS  206

Query  1951  IGNEIIINPSLLFLDEPTSGLDSTTALRIVDILHEIAKAGKTVITTIHQPSSRLFHkfdk  1772
             IG E++INPSLL LDEPTSGLDST+A RI+  L  +A  G+TVITTIHQPSSRL++ FDK
Sbjct  207   IGQEMLINPSLLLLDEPTSGLDSTSAQRILKTLKGLAGGGRTVITTIHQPSSRLYYMFDK  266

Query  1771  lilleflldLANG------------------NINDVSIPSELADKV----QTWNSKEEPT  1658
             ++LL     +  G                   +N   +  +LA+ +    Q  N+     
Sbjct  267   VVLLSEGSPIYYGLASTALEYFSSVGFSTSITVNPADLLLDLANGIGPDFQNANTNHS--  324

Query  1657  RNNGKPSPAIVHEYLVGCYETRVAETEKKKLMAP-----LPVEEELKSKVRYLKREWGAS  1493
               N +  P+ V E+L   YET ++   K +L +         E   K+ VR    +W  +
Sbjct  325   -ENPQQDPSAVREFLTSAYETNISTRLKIELCSSDGGSYTYKEACAKNDVR--SEKWCTT  381

Query  1492  WSEQYVLLFHRGIRERWHDYFSWLRITQVIATALILGMLWWQSGGDTP-SQMQDQAGLLF  1316
             W  Q+ +L  RG+RER  + F+ LRI QV++ A++ G+LWWQ    TP S + D+  +LF
Sbjct  382   WWHQFKILLIRGLRERRFETFNKLRIFQVLSVAILGGLLWWQ----TPSSHIDDRVAMLF  437

Query  1315  FIAVFWGFFPVFTAIFTFPQEKAMLSKERAADMYRLSAYFAARTTSdlpldlllpliflL  1136
             F +VFWGF+P++ A+FTFPQE++ML KER++ MYRLSAYF ART +DLP++L LP  F  
Sbjct  438   FYSVFWGFYPLYNAVFTFPQERSMLIKERSSGMYRLSAYFLARTVADLPMELALPTAFTF  497

Query  1135  VVYFMAGLKQDASSFLLTAVTVFLCIVVAQGLGLAIGATLMDLKKATTLASVTVMTFMLA  956
             + Y+M GLK D ++F+L+ + V   ++V+Q LGLA GA LMD+K+A TLASVT + F++A
Sbjct  498   IFYWMGGLKPDPTTFVLSLLIVLFSVLVSQSLGLAFGAVLMDVKQAATLASVTTLVFLIA  557

Query  955   GGYFIKKVPGFIVWLRDLSFNYHTFKLLLKVQYEHKTN---------------SVNGVQI  821
             GGY+++++P FIVWL+ LS++Y+ +KLLL V Y                    +V  V +
Sbjct  558   GGYYVRQIPPFIVWLKYLSYSYYCYKLLLGVHYTENDYYECAEKVYCRVSDYPAVKSVGL  617

Query  820   DSGIKEVGALAAMAVSYRLLAYISLRRMK  734
              +   ++  +  M + YRL+AY +L R++
Sbjct  618   TNLWVDMSVMLLMLIGYRLVAYRALHRVQ  646



>ref|XP_008221126.1| PREDICTED: ABC transporter G family member 14 [Prunus mume]
Length=675

 Score =   491 bits (1264),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 287/628 (46%), Positives = 404/628 (64%), Gaps = 69/628 (11%)
 Frame = -2

Query  2428  FPIYLKFTEVSYKIVIK-----GVTF------SEEKDILNGISGAVDPGEVLALMGPSGC  2282
             +PI LKF EV YK+ ++     GV++      S EK IL+GI+G V PGE+LA++GPSG 
Sbjct  56    YPITLKFEEVFYKVKMEQKGGGGVSWWGTNTSSREKSILSGITGTVCPGEILAMLGPSGS  115

Query  2281  GKTTLLSLLGGRIRDPS-----AGSITYNQHPYSKLLKSRIGFVTQDDILFPHLTVKETL  2117
             GKTTLL+ LGGR+   +     +G ITYN  P+   +K R GFV QDD+L+PHLTV ETL
Sbjct  116   GKTTLLTALGGRLNHQNNCKFMSGKITYNGQPFCGSIKRRTGFVAQDDVLYPHLTVTETL  175

Query  2116  IYAARLRLPRTLTKEEKDKRAMDVIYELGLDRCQDTMIGGSFVRGVSGGERKRVCIGNEI  1937
             ++ A LRLPR+L+++EK +    VI ELGL  C+ +MIGG   RG+SGGE+KRV IG E+
Sbjct  176   VFTALLRLPRSLSRDEKVQHVEHVISELGLSGCRSSMIGGPLFRGISGGEKKRVSIGQEM  235

Query  1936  IINPSLLFLDEPTSGLDSTTALRIVDILHEIAKAGKTVITTIHQPSSRLFHkfdklille  1757
             +INPSLL LDEPTSGLDSTTA RI+ IL  +A  G+T++TTIHQPSSR++H FDKL+LL 
Sbjct  236   LINPSLLLLDEPTSGLDSTTAQRILTILKRLASGGRTLVTTIHQPSSRIYHMFDKLVLLS  295

Query  1756  flldLANG-------------------NINDVSIPSELADKVQTWNSKEEPTRNNGKPSP  1634
                 +  G                   ++N   +  +LA+ +   +      R N +   
Sbjct  296   EGSPIYYGPASAALDYFSSIGFSTSLPSLNPADLLLDLANGIAPDSKHASEQRENMEQDQ  355

Query  1633  AIVHEYLVGCYETRVAETEKKKLMAPLPVEEELKSKVRYLK---------REWGASWSEQ  1481
               V + L+  YE  +    K +L A L    E+ +   Y+K         + W  SW +Q
Sbjct  356   KTVRKALISAYEKNICAKLKAELCAGL----EVNNYNNYMKDASARQGTEQHWCTSWWQQ  411

Query  1480  YVLLFHRGIRERWHDYFSWLRITQVIATALILGMLWWQSGGDTP-SQMQDQAGLLFFIAV  1304
             + +L  RG+RER ++ F+ LRI QVI+ A + G+LWW+    TP S ++D+  LLFF +V
Sbjct  412   FKVLLQRGLRERRYEAFNRLRIFQVISVATLGGLLWWR----TPTSHIEDRIALLFFFSV  467

Query  1303  FWGFFPVFTAIFTFPQEKAMLSKERAADMYRLSAYFAARTTSdlpldlllpliflLVVYF  1124
             FWGF+P++ A+FTFPQE+ ML KER++ MY+LS+YF ART  DLPL+L LP  F++++Y+
Sbjct  468   FWGFYPLYNAVFTFPQERRMLIKERSSGMYKLSSYFLARTVGDLPLELALPTAFVVIIYW  527

Query  1123  MAGLKQDASSFLLTAVTVFLCIVVAQGLGLAIGATLMDLKKATTLASVTVMTFMLAGGYF  944
             M GLK D  +F+L+ + V   ++V+Q LGLAIGA LMD+K+ATTLASVT + F++AGGY+
Sbjct  528   MGGLKPDPFTFILSLLVVLYNVLVSQSLGLAIGAILMDIKQATTLASVTTLVFLIAGGYY  587

Query  943   IKKVPGFIVWLRDLSFNYHTFKLLLKVQYEHKT--NSVNGVQIDSG----IKEVGA----  794
             I+++P FI+WL+ LS++Y+ +KLLL VQY+         GV    G    IK +G     
Sbjct  588   IQQIPAFIIWLKYLSYSYYCYKLLLGVQYDEDDYYECSKGVLCRVGDLPAIKSMGGLNHL  647

Query  793   ------LAAMAVSYRLLAYISLRRMKLQ  728
                   LA M + YRLLAY++L R++L+
Sbjct  648   WIDVSILALMLLGYRLLAYLALHRVRLR  675



>ref|XP_009605917.1| PREDICTED: ABC transporter G family member 14-like [Nicotiana 
tomentosiformis]
Length=633

 Score =   489 bits (1260),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 279/604 (46%), Positives = 394/604 (65%), Gaps = 49/604 (8%)
 Frame = -2

Query  2428  FPIYLKFTEVSYKIVIKGVTFSEEKDILNGISGAVDPGEVLALMGPSGCGKTTLLSLLGG  2249
             FPI LKF E+ YKI     T ++EK ILNG++G V PGE+LA++GPSG GKTTLL+ LGG
Sbjct  40    FPITLKFEEIVYKI-----TSTKEKTILNGVTGIVCPGEMLAMLGPSGSGKTTLLTALGG  94

Query  2248  RIRDPSAGSITYNQHPYSKLLKSRIGFVTQDDILFPHLTVKETLIYAARLRLPRTLTKEE  2069
             R+    +G I YN  P+S  +K   GFV QDDIL+PHLTV ETL++ A LRLP++L+KEE
Sbjct  95    RLSGKLSGKIAYNNQPFSGAIKRSTGFVAQDDILYPHLTVTETLLFTALLRLPQSLSKEE  154

Query  2068  KDKRAMDVIYELGLDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGL  1889
             K++    VI ELGL++C+++MIGG   RG+SGGE+KRV IG E++INPSLL LDEPTSGL
Sbjct  155   KEQHVEHVITELGLNKCRNSMIGGPLFRGISGGEKKRVSIGQEMLINPSLLLLDEPTSGL  214

Query  1888  DSTTALRIVDILHEIAKAGKTVITTIHQPSSRLFHkfdklilleflldLANG--------  1733
             DSTTALRI+  +  +A  G+TVITTIHQPSSRL+H FDK++LL     +  G        
Sbjct  215   DSTTALRILTTVKRLANGGRTVITTIHQPSSRLYHMFDKVVLLSEGCPIYYGPASTALEY  274

Query  1732  ----------NINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYETRVAE  1583
                        IN   +  +LA+ +   +       +N +     V E L+  Y+ +V  
Sbjct  275   FSSVGFSTSITINPADLLLDLANGIGPDSKHAIEQGDNTEQEKKSVREALISAYD-KVIS  333

Query  1582  TEKKKLMAPLPVE-----EELKSKVRYLKREWGASWSEQYVLLFHRGIRERWHDYFSWLR  1418
             T  K  +  L        +++ ++      +W  SW  Q+ +L  RG+RER ++ F+ LR
Sbjct  334   TRLKTELCSLDTNNYTYIKDVSTRNGVKSEQWSTSWGYQFKVLLLRGLRERRYETFNRLR  393

Query  1417  ITQVIATALILGMLWWQSGGDTP-SQMQDQAGLLFFIAVFWGFFPVFTAIFTFPQEKAML  1241
             I QVI+ A + G+LWW     TP S ++D+  +LFF AVFWGF+P++ A+FTFPQE+ ML
Sbjct  394   IFQVISVAFLAGLLWWH----TPTSHIEDRIAMLFFFAVFWGFYPLYNAVFTFPQERRML  449

Query  1240  SKERAADMYRLSAYFAARTTSdlpldlllpliflLVVYFMAGLKQDASSFLLTAVTVFLC  1061
              KER++ MYRLS+YF A+T  DLP++L LP  F  ++Y+M GLK + ++F+L+ V V   
Sbjct  450   IKERSSGMYRLSSYFLAKTVGDLPIELALPTAFTFILYWMGGLKANPATFILSLVIVLYS  509

Query  1060  IVVAQGLGLAIGATLMDLKKATTLASVTVMTFMLAGGYFIKKVPGFIVWLRDLSFNYHTF  881
             ++V+Q LGLA GA LMD+K+ATTLASVT + F++AGGY+I+++P FIVWL+ LS++Y+ +
Sbjct  510   VLVSQSLGLAYGAMLMDVKQATTLASVTTLVFLIAGGYYIQQIPPFIVWLKYLSYSYYCY  569

Query  880   KLLLKVQYEHKTN---------------SVNGVQIDSGIKEVGALAAMAVSYRLLAYISL  746
             KLLL VQY                    ++  V +++   +V  +A M V YRLLAY++L
Sbjct  570   KLLLGVQYNDNDYYECSKGVYCQVADFPAIKSVGLNNMWMDVLIMALMLVGYRLLAYLAL  629

Query  745   RRMK  734
              R++
Sbjct  630   NRVR  633



>emb|CDP05875.1| unnamed protein product [Coffea canephora]
Length=629

 Score =   489 bits (1259),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 298/642 (46%), Positives = 406/642 (63%), Gaps = 66/642 (10%)
 Frame = -2

Query  2500  SDDENPE-DLEAGTKKK--RSIPAEPTFPIYLKFTEVSYKIVIKG------VTFSEEKDI  2348
             +D E P+ +  AG +K    +I  +   P+ LKF +V YKI +K        T SEEK I
Sbjct  6     ADVEAPQPNGSAGQQKSCAAAIFEKANRPVTLKFEDVVYKIKVKKEGWFKKSTESEEKTI  65

Query  2347  LNGISGAVDPGEVLALMGPSGCGKTTLLSLLGGRIRDPSAGSITYNQHPYSKLLKSRIGF  2168
             L GISG V PGE+LA++GPSG GKTTLL+ LGGR+    +GSITYN  P+S ++K   GF
Sbjct  66    LKGISGMVLPGEMLAMLGPSGSGKTTLLTALGGRLGGSLSGSITYNGKPFSNVVKRNTGF  125

Query  2167  VTQDDILFPHLTVKETLIYAARLRLPRTLTKEEKDKRAMDVIYELGLDRCQDTMIGGSFV  1988
             VTQDDIL+PHLTV ETLI+ A LRLP +LTKEEK  RA  VI +LGL +C++++IG   V
Sbjct  126   VTQDDILYPHLTVNETLIFTALLRLPNSLTKEEKVMRAEAVITQLGLTKCKNSIIGSRLV  185

Query  1987  RGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILHEIAKAGKTVITTIH  1808
             RGVSGGERKRV IG E++INPS L LDEPTSGLDSTTA RIV  L E+A  G+TV+ TIH
Sbjct  186   RGVSGGERKRVSIGQEMLINPSFLLLDEPTSGLDSTTAQRIVSTLGELANGGRTVVMTIH  245

Query  1807  QPSSRLFHkfdklilleflldLANG------------------NINDVSIPSELADKVQT  1682
             QPSSRLF+ F K+++L     +  G                  ++N      +LA+ V  
Sbjct  246   QPSSRLFYMFHKVLVLSEGNPIYYGKGMDAMDYFSDVGFTPKFSMNPADFLLDLANGVSV  305

Query  1681  WNSKEEPTRNNGKPSPAIVHEYLVGCYETRVAET---EKKKLMAPLPVEEELKSKVRYLK  1511
              +S+++          A++ + LV  Y+ ++AE    E K+    L    E K   R   
Sbjct  306   DDSRDD---------QALIKQTLVSAYKAKLAENLQIELKQTTDNLHSVSEGKQFNR---  353

Query  1510  REWGASWSEQYVLLFHRGIRERWHDYFSWLRITQVIATALILGMLWWQSGGDTPSQMQDQ  1331
               W  +W +Q+ +L  RG++ER H+ FS ++I Q++  A++ G+LWWQS    PS +QDQ
Sbjct  354   --WTTTWWQQFSVLIRRGMKERKHESFSGIKIVQILVVAILCGLLWWQS---DPSHLQDQ  408

Query  1330  AGLLFFIAVFWGFFPVFTAIFTFPQEKAMLSKERAADMYRLSAYFAARTTSdlpldlllp  1151
              GLLFF   FWGFFP+F AIFTFPQE+ ML KERA+ MYRLS+YF ART  DLP++L+LP
Sbjct  409   IGLLFFYTGFWGFFPLFNAIFTFPQERLMLEKERASGMYRLSSYFMARTIGDLPMELVLP  468

Query  1150  liflLVVYFMAGLKQDASSFLLTAVTVFLCIVVAQGLGLAIGATLMDLKKATTLASVTVM  971
              +F+ + Y+MAGLK  A+SFL   + +   ++VAQGLGLA+GA ++D K AT L SV ++
Sbjct  469   SVFITITYWMAGLKATAASFLGCWLVLLYAVLVAQGLGLAVGALVLDQKNATILGSVIML  528

Query  970   TFMLAGGYFIKKVPGFIVWLRDLSFNYHTFKLLLKVQY---------EHKTN------SV  836
             +F+LAGGY+++ VP FI W++ +S   + +KL +  QY         E+KT       S+
Sbjct  529   SFILAGGYYVQHVPSFIAWIKYVSIGQYAYKLFIMSQYNPGETYPCAENKTCLVEDFPSI  588

Query  835   NGVQIDSGIKEVGALAAMAVSYRLLAYISLRRMKLQ*YISRN  710
               +        V A+A M V YRL+AYI+L R+     ++RN
Sbjct  589   KSIGPHGLFSSVVAMAIMLVGYRLVAYIALMRIG----VTRN  626



>ref|XP_006359961.1| PREDICTED: ABC transporter G family member 14-like [Solanum tuberosum]
Length=646

 Score =   489 bits (1260),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 275/629 (44%), Positives = 400/629 (64%), Gaps = 49/629 (8%)
 Frame = -2

Query  2485  PEDLEAGTKKKRSIPAEPTFPIYLKFTEVSYKI-------VIKGVTFSEEKDILNGISGA  2327
             P   +   K   S      FPI LKF EV YKI          G + ++EK ILNG++G 
Sbjct  22    PNSSKPEMKNSESFIQRALFPITLKFEEVVYKIKQETKGMCCGGPSSTKEKTILNGVTGI  81

Query  2326  VDPGEVLALMGPSGCGKTTLLSLLGGRIRDPSAGSITYNQHPYSKLLKSRIGFVTQDDIL  2147
             V PGE+LA++GPSG GKTTLL+ LGGR+    +G ITYN  P+S  +K R GFV QDD+L
Sbjct  82    VCPGEMLAMLGPSGSGKTTLLTALGGRLSGKLSGKITYNSQPFSGAIKRRTGFVAQDDVL  141

Query  2146  FPHLTVKETLIYAARLRLPRTLTKEEKDKRAMDVIYELGLDRCQDTMIGGSFVRGVSGGE  1967
             +PHLTV ETL++ A LRLP++L++EEK++    VI ELGL++C+++MIGG   RG+SGGE
Sbjct  142   YPHLTVTETLLFTALLRLPQSLSREEKERHVEHVIAELGLNKCRNSMIGGPLFRGISGGE  201

Query  1966  RKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILHEIAKAGKTVITTIHQPSSRLF  1787
             +KRV IG E++INPSLL LDEPTSGLDSTTALRI+  +  +A  G+TVITTIHQPSSRL+
Sbjct  202   KKRVSIGQEMLINPSLLLLDEPTSGLDSTTALRILTTIKRLADGGRTVITTIHQPSSRLY  261

Query  1786  HkfdklilleflldLANG------------------NINDVSIPSELADKVQTWNSKEEP  1661
             H FDK++LL     +  G                   IN   +  +LA+ +   +     
Sbjct  262   HMFDKVVLLSEGCPIYYGPASTALEYFSSVGFSTSITINPADLLLDLANGIGPDSKHAIE  321

Query  1660  TRNNGKPSPAIVHEYLVGCYETRVAETEKKKLMAP----LPVEEELKSKVRYLKREWGAS  1493
               ++ +     V E L+  Y+  ++   K +L +         +++ ++       W  S
Sbjct  322   QGDSSEQEKKSVREALISAYDKNISTRLKTELCSSDTNNYSYAKDVSTRNGVKSEHWCTS  381

Query  1492  WSEQYVLLFHRGIRERWHDYFSWLRITQVIATALILGMLWWQSGGDTP-SQMQDQAGLLF  1316
             W  Q+ +L  RG++ER ++ F+ LRI QV++ A + G+LWW     TP S ++D+  ++F
Sbjct  382   WGYQFKVLLLRGLKERRYETFNKLRIFQVVSVAFLAGLLWWH----TPTSHIEDRIAMVF  437

Query  1315  FIAVFWGFFPVFTAIFTFPQEKAMLSKERAADMYRLSAYFAARTTSdlpldlllpliflL  1136
             F AVFWGF+P++ A+FTFPQE+ ML KER++ MYRLS+YF A+T  DLPL+L LP  F  
Sbjct  438   FFAVFWGFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTF  497

Query  1135  VVYFMAGLKQDASSFLLTAVTVFLCIVVAQGLGLAIGATLMDLKKATTLASVTVMTFMLA  956
             ++Y+M GLK + ++F+L+ + V   ++V+Q LGLA GA LMD+K+ATTLASVT + F++A
Sbjct  498   ILYWMGGLKANPATFILSLLVVLYSVLVSQSLGLAYGAMLMDVKQATTLASVTTLVFLIA  557

Query  955   GGYFIKKVPGFIVWLRDLSFNYHTFKLLLKVQYEHKTN---------------SVNGVQI  821
             GGY+I+++P FIVWL+ LS++Y+ +KLLL VQY                    ++  + +
Sbjct  558   GGYYIQQIPPFIVWLKYLSYSYYCYKLLLGVQYNDNDYYECSKGVYCQVAEFPAIKSIGL  617

Query  820   DSGIKEVGALAAMAVSYRLLAYISLRRMK  734
             ++   +V  +A M V YRL+AY++L R++
Sbjct  618   NNMWMDVFIMALMLVGYRLIAYLALNRVR  646



>ref|XP_009605775.1| PREDICTED: ABC transporter G family member 9 [Nicotiana tomentosiformis]
Length=616

 Score =   488 bits (1256),  Expect = 3e-156, Method: Compositional matrix adjust.
 Identities = 290/627 (46%), Positives = 401/627 (64%), Gaps = 58/627 (9%)
 Frame = -2

Query  2494  DENPEDLEAGTKKKRSIPAEPTFPIYLKFTEVSYKIVIK-------GVTFSEEKDILNGI  2336
             +E   D++    +  +I  +   P+ LKF  V YKI  K            EEK IL GI
Sbjct  2     EEEMADIQITQLESAAIFKKTNLPVTLKFENVVYKIKPKKEGLFNSSSKLEEEKIILKGI  61

Query  2335  SGAVDPGEVLALMGPSGCGKTTLLSLLGGRIRDPSAGSITYNQHPYSKLLKSRIGFVTQD  2156
             +G V PGE+LA++GPSG GKTTLL+ LGGR+    AGSITYN  P++  +K   GFVTQD
Sbjct  62    TGIVFPGEMLAMLGPSGSGKTTLLTGLGGRLSGRLAGSITYNGKPFTNAMKRYTGFVTQD  121

Query  2155  DILFPHLTVKETLIYAARLRLPRTLTKEEKDKRAMDVIYELGLDRCQDTMIGGSFVRGVS  1976
             DIL+PHLTV ETL++ A LRLP+TL+ EEK   A  VI +LGL +C+D++IGG  +RG+S
Sbjct  122   DILYPHLTVTETLLFTALLRLPKTLSHEEKVVHAEAVISQLGLTKCKDSIIGGPLLRGIS  181

Query  1975  GGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILHEIAKAGKTVITTIHQPSS  1796
             GGERKRV IG E++INPSLLFLDEPTSGLDSTTA +IV  L E+ K G+T++ TIHQPSS
Sbjct  182   GGERKRVSIGQEMLINPSLLFLDEPTSGLDSTTAQKIVSTLWELVKGGRTIVMTIHQPSS  241

Query  1795  RLFHkfdklilleflldLANGNINDV-----SI---------PS----ELADKVQTWNSK  1670
             RLF+ F K++LL     L  G   D      SI         PS    +LA+ V      
Sbjct  242   RLFYMFHKVLLLSEGNPLYFGRGEDAMGYFSSIGFSPLVAMNPSDFLLDLANGVL-----  296

Query  1669  EEPTRNNGKPSPAIVHEYLVGCYETRVAETEKKKLMAPLPVEEELKSKVRYLK-REWGAS  1493
             ++P  +      A + + LV  ++T + ++ K++L      ++++  K+   K  +W  +
Sbjct  297   DDPQEDQ-----ASIKQTLVTAFKTNLLDSVKEELRK--FDDQQVHGKLHKGKFSQWSNT  349

Query  1492  WSEQYVLLFHRGIRERWHDYFSWLRITQVIATALILGMLWWQSGGDTPSQMQDQAGLLFF  1313
             W +Q+ +LF RG++ER H+ FS L+I QV+  A + G+LWWQS       +QDQ GL+FF
Sbjct  350   WWQQFSVLFRRGMKERKHESFSGLKIGQVLVVAFLCGLLWWQS-----KDIQDQIGLMFF  404

Query  1312  IAVFWGFFPVFTAIFTFPQEKAMLSKERAADMYRLSAYFAARTTSdlpldlllpliflLV  1133
              + FWGF+P+F AIFTFPQE+ ML KER++ MYRLS+YF +RT  DLP++L+LP IF+++
Sbjct  405   YSGFWGFYPLFQAIFTFPQERMMLEKERSSGMYRLSSYFMSRTVGDLPMELVLPTIFVII  464

Query  1132  VYFMAGLKQDASSFLLTAVTVFLCIVVAQGLGLAIGATLMDLKKATTLASVTVMTFMLAG  953
              Y+MAGLK  A +F  T  T+   ++V+QGLGLA+GA +MD K AT L SV +++F LAG
Sbjct  465   TYWMAGLKPFAPNFFSTLFTLLFSVLVSQGLGLALGALVMDQKSATILGSVIMLSFTLAG  524

Query  952   GYFIKKVPGFIVWLRDLSFNYHTFKLLLKVQYE------HKTNSVNGVQIDSGIKEVG--  797
             GY++  VP FI W++ +S + +TFKLL+  Q+E         N+   V+    IK VG  
Sbjct  525   GYYVHHVPSFIAWIKYISISQYTFKLLIGSQFEPGETYPCGLNATCYVEDFPAIKSVGLG  584

Query  796   -------ALAAMAVSYRLLAYISLRRM  737
                    AL  M V+YRLLAY++L R+
Sbjct  585   DKAISVVALGIMLVAYRLLAYVALMRI  611



>ref|XP_008387860.1| PREDICTED: ABC transporter G family member 14 [Malus domestica]
Length=668

 Score =   489 bits (1260),  Expect = 4e-156, Method: Compositional matrix adjust.
 Identities = 291/671 (43%), Positives = 422/671 (63%), Gaps = 67/671 (10%)
 Frame = -2

Query  2554  SFTGFSVRPDE--SADSKPFSDDENPEDLEAGTKKKRSIPAEPT----------FPIYLK  2411
             S +    +P E   +DS   +  E   ++ AGT+ K + PA             +PI LK
Sbjct  2     SLSSIVPKPAEYGGSDSSCTTTVEVSPEMPAGTQNKAA-PATQVNSQAFLQLTLYPITLK  60

Query  2410  FTEVSYKIVI-----KGVTFSEEKDILNGISGAVDPGEVLALMGPSGCGKTTLLSLLGGR  2246
             F EV YK+ +     +G + S EK IL+GI+G V PGE+LA++GPSG GKTTLL+ LGGR
Sbjct  61    FEEVFYKVKVEQKGSRGRSRSREKSILSGITGMVCPGEILAMLGPSGSGKTTLLTSLGGR  120

Query  2245  IRDPS-----AGSITYNQHPYSKLLKSRIGFVTQDDILFPHLTVKETLIYAARLRLPRTL  2081
             +   +     +G I+YN  P+   +K R GFV QDD+L+PHLTV ETL++ A LRLP +L
Sbjct  121   LNHQNNVKFMSGKISYNGQPFCGAIKRRTGFVAQDDVLYPHLTVTETLVFTALLRLPNSL  180

Query  2080  TKEEKDKRAMDVIYELGLDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEP  1901
             +++EK +    VI ELGL +C+ +MIGG   RG+SGGE+KRV IG E++INPSLL LDEP
Sbjct  181   SRDEKVQHVEQVISELGLTQCRSSMIGGPLFRGISGGEKKRVSIGQEMLINPSLLLLDEP  240

Query  1900  TSGLDSTTALRIVDILHEIAKAGKTVITTIHQPSSRLFHkfdklilleflldLANG----  1733
             TSGLDSTTA RI+  L  +A  G+T++TTIHQPSSR++H FDKL+LL     +  G    
Sbjct  241   TSGLDSTTAQRILITLKRLASGGRTLVTTIHQPSSRIYHMFDKLVLLSEGSPIYYGPASA  300

Query  1732  ---------------NINDVSIPSELADKV--QTWNSKEEPTRNNGKPSPAIVHEYLVGC  1604
                            ++N   +  +LA+ +   + ++ E+    N +    +V + L+  
Sbjct  301   ALNYFSSIGFSTSLPSVNPADLLLDLANGIAPDSQHASEQWENTNAEQEQKMVRKALISA  360

Query  1603  YETRVAETEKKKLMAPLPVE--EELKSKVRYLKREWGASWSEQYVLLFHRGIRERWHDYF  1430
             Y+  +    K +L A L V   +         K+ W  SW  Q+ +LF RG+RER ++ F
Sbjct  361   YDKNIYAKLKDELCAGLEVNNYDNYMKGAASAKQYWCTSWWHQFKVLFQRGLRERRYEAF  420

Query  1429  SWLRITQVIATALILGMLWWQSGGDTP-SQMQDQAGLLFFIAVFWGFFPVFTAIFTFPQE  1253
             + LRI QV++ A + G+LWW+    TP S ++D+  LLFF +VFWGF+P++ A+FTFPQE
Sbjct  421   NRLRIFQVVSVATLGGLLWWR----TPTSHIEDRIALLFFFSVFWGFYPLYNAVFTFPQE  476

Query  1252  KAMLSKERAADMYRLSAYFAARTTSdlpldlllpliflLVVYFMAGLKQDASSFLLTAVT  1073
             + ML KER++ MY+LS+YF ART  DLPL+L LP  F+L++Y+M GLK D  +F+L+ + 
Sbjct  477   RRMLIKERSSGMYQLSSYFLARTVGDLPLELALPTAFVLIIYWMGGLKPDPFTFILSLLV  536

Query  1072  VFLCIVVAQGLGLAIGATLMDLKKATTLASVTVMTFMLAGGYFIKKVPGFIVWLRDLSFN  893
             V   ++V+Q LGLAIGA LMD+K+ATTLASVT + F++AGGY+I+++P FIVWL+ LS++
Sbjct  537   VLYSVLVSQSLGLAIGAILMDIKQATTLASVTTLVFLIAGGYYIQQIPPFIVWLKYLSYS  596

Query  892   YHTFKLLLKVQYEH------------KTNSVNGVQIDSGIK----EVGALAAMAVSYRLL  761
             Y+ +KLLL VQY+             +   +  V+   G+     +V  L  M + YRLL
Sbjct  597   YYCYKLLLGVQYDEDDFYECSKGVLCRVGDLPAVKSMGGLDHLWLDVSILGLMLLGYRLL  656

Query  760   AYISLRRMKLQ  728
             AY++L R++L+
Sbjct  657   AYLALHRVRLR  667



>gb|KHG20314.1| ABC transporter G family member 14 [Gossypium arboreum]
Length=657

 Score =   488 bits (1256),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 296/660 (45%), Positives = 412/660 (62%), Gaps = 69/660 (10%)
 Frame = -2

Query  2545  GFSVRPDESADSKPFSDDENPEDLEAGTKKKRSIPAEPT--FPIYLKFTEVSYKIVIK--  2378
             G S  P E+    P  +  N   L    ++    P   T  +PI LKF E+ YK+ ++  
Sbjct  13    GMSSGPLEALSETP--EPHNSAMLAFPIQRNSQPPVRLTTLYPITLKFEEIVYKVKLEQK  70

Query  2377  ----GVTFSEEKDILNGISGAVDPGEVLALMGPSGCGKTTLLSLLGGRIRDPSAGSITYN  2210
                 G   + EK ILNGISG V PGE+LA++GPSG GKTTLL+ LGGR+    +G ITYN
Sbjct  71    GSCWGGWITREKTILNGISGVVYPGEILAMLGPSGSGKTTLLTALGGRLTGKLSGKITYN  130

Query  2209  QHPYSKLLKSRIGFVTQDDILFPHLTVKETLIYAARLRLPRTLTKEEKDKRAMDVIYELG  2030
               P+   +K R GFV QDD+L+PHLTV ETL++ A LRLP +L+++EK +    VI ELG
Sbjct  131   GQPFCGAIKRRAGFVAQDDVLYPHLTVTETLLFTALLRLPNSLSRDEKVQHVERVIAELG  190

Query  2029  LDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILH  1850
             L RC+++MIGG   RG+SGGE+KRV IG E++INPSLL LDEPTSGLDSTTA RI+  + 
Sbjct  191   LTRCRNSMIGGPLFRGISGGEKKRVSIGQEMLINPSLLLLDEPTSGLDSTTAQRILTTIK  250

Query  1849  EIAKAGKTVITTIHQPSSRLFHkfdklilleflldLANGN------------------IN  1724
              +A  G+TV+TTIHQPSSRL+H FDK++LL     +  G+                  +N
Sbjct  251   RLASGGRTVVTTIHQPSSRLYHMFDKVVLLSEGCPIYYGSASAALEYFSSIGFSTSMTVN  310

Query  1723  DVSIPSELAD--------KVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYETRVAETEKKK  1568
                +  +LA+         V+   S E+  ++        V + L+  YE  ++   K +
Sbjct  311   PADLLLDLANGIGPDFIHSVEQVESTEQEQKS--------VKDALISAYEKNISTRLKTE  362

Query  1567  LMAPLPVEEELKSK---VRYLKRE-WGASWSEQYVLLFHRGIRERWHDYFSWLRITQVIA  1400
             L     V   + +K    R  K E W  SW  Q+ +L  RG+RER ++ F+ LRI QVI+
Sbjct  363   LCNS-DVNSGMNAKEPSARNDKSEQWCTSWWHQFKVLLQRGVRERRYEAFNRLRIFQVIS  421

Query  1399  TALILGMLWWQSGGDTP-SQMQDQAGLLFFIAVFWGFFPVFTAIFTFPQEKAMLSKERAA  1223
              A++ G+LWW     TP S + D+  LLFF +VFWGF+P++ A+FTFPQE+ ML KER++
Sbjct  422   VAVLGGLLWWH----TPASHISDRIALLFFFSVFWGFYPLYNAVFTFPQERRMLIKERSS  477

Query  1222  DMYRLSAYFAARTTSdlpldlllpliflLVVYFMAGLKQDASSFLLTAVTVFLCIVVAQG  1043
              MYRLS+YF ART  DLPL+L LP  F+ ++Y+MAGLK D  +F+L+ + V   ++V+Q 
Sbjct  478   GMYRLSSYFLARTFGDLPLELALPTAFVFIIYWMAGLKPDPVTFILSLLVVLYNVLVSQS  537

Query  1042  LGLAIGATLMDLKKATTLASVTVMTFMLAGGYFIKKVPGFIVWLRDLSFNYHTFKLLLKV  863
             LGLAIGA LMD+K+ATTLASVT + F++AGGY+++++P FIVWL+ LS++Y+ +KLLL V
Sbjct  538   LGLAIGAILMDVKQATTLASVTTLVFLIAGGYYVQQIPAFIVWLKYLSYSYYCYKLLLGV  597

Query  862   QYEHKT--NSVNGVQIDSG----IKEVG---------ALAAMAVSYRLLAYISLRRMKLQ  728
             QY+         GV    G    IK +G          +A M V YRL+AY++L R++L+
Sbjct  598   QYKEDDYYECSKGVWCRVGDLPAIKSMGLSHMWIDVSIMALMLVGYRLIAYMALHRVRLR  657



>ref|XP_009792869.1| PREDICTED: ABC transporter G family member 9-like [Nicotiana 
sylvestris]
Length=616

 Score =   486 bits (1252),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 292/627 (47%), Positives = 401/627 (64%), Gaps = 58/627 (9%)
 Frame = -2

Query  2494  DENPEDLEAGTKKKRSIPAEPTFPIYLKFTEVSYKIVIK--GVTFS-----EEKDILNGI  2336
             +E   D++    +  +I  +   P+ LKF  V YKI  K  G+  S     EEK IL GI
Sbjct  2     EEEMADIQITQLETAAIFKKTNLPVTLKFENVVYKIKPKKEGLFNSSSKPEEEKIILKGI  61

Query  2335  SGAVDPGEVLALMGPSGCGKTTLLSLLGGRIRDPSAGSITYNQHPYSKLLKSRIGFVTQD  2156
             +G V PGE+LA++GPSG GKTTLL+ LGGR+    AGSITYN  P++  +K   GFVTQD
Sbjct  62    TGIVFPGEMLAMLGPSGSGKTTLLTGLGGRLNGRIAGSITYNGKPFTNAMKRYTGFVTQD  121

Query  2155  DILFPHLTVKETLIYAARLRLPRTLTKEEKDKRAMDVIYELGLDRCQDTMIGGSFVRGVS  1976
             DIL+PHLTV ETL++ A LRLP+TL+ EEK   A  VI +LGL +C+D++IGG  +RG+S
Sbjct  122   DILYPHLTVTETLVFTALLRLPKTLSHEEKVAHAEAVISQLGLTKCKDSIIGGPLLRGIS  181

Query  1975  GGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILHEIAKAGKTVITTIHQPSS  1796
             GGERKRV IG E++INPSLLFLDEPTSGLDSTTA +IV  L E+ K G+T++ TIHQPSS
Sbjct  182   GGERKRVSIGQEMLINPSLLFLDEPTSGLDSTTAQKIVSTLWELVKGGRTIVMTIHQPSS  241

Query  1795  RLFHkfdklilleflldLANGNINDV-----SI---------PS----ELADKVQTWNSK  1670
             RLF+ F K++LL     L  G   D      SI         PS    +LA+ V      
Sbjct  242   RLFYMFHKVLLLSEGNPLYFGRGEDAMGYFSSIGYSPLVAMNPSDFLLDLANGVL-----  296

Query  1669  EEPTRNNGKPSPAIVHEYLVGCYETRVAETEKKKLMAPLPVEEELKS-KVRYLKREWGAS  1493
             ++P  +      A V + LV  ++T + ++ K++L      +   KS K ++   +W  +
Sbjct  297   DDPQEDQ-----ASVKQTLVTAFKTDLLDSVKEELRKFDDQQVHEKSHKGKF--SQWSNT  349

Query  1492  WSEQYVLLFHRGIRERWHDYFSWLRITQVIATALILGMLWWQSGGDTPSQMQDQAGLLFF  1313
             W +Q+ +LF RG++ER H+ FS L+I QV+  A + G+LWWQS       +QDQ GL+FF
Sbjct  350   WWQQFSVLFRRGMKERKHESFSGLKIGQVLVVAFLCGLLWWQS-----KDIQDQIGLMFF  404

Query  1312  IAVFWGFFPVFTAIFTFPQEKAMLSKERAADMYRLSAYFAARTTSdlpldlllpliflLV  1133
              + FWGF+P+F AIFTFPQE+ ML KER++ MYRLS+YF +RT  DLP++L+LP IF+++
Sbjct  405   YSGFWGFYPLFQAIFTFPQERMMLEKERSSGMYRLSSYFMSRTVGDLPMELVLPTIFVII  464

Query  1132  VYFMAGLKQDASSFLLTAVTVFLCIVVAQGLGLAIGATLMDLKKATTLASVTVMTFMLAG  953
              Y++AGLK  A +F  T  T+   ++V+ GLGLA+GA +MD K AT L SV +++F LAG
Sbjct  465   TYWIAGLKPFALNFFSTLFTLLFSVLVSHGLGLALGALVMDQKSATILGSVIMLSFTLAG  524

Query  952   GYFIKKVPGFIVWLRDLSFNYHTFKLLLKVQYEHKTNSVNGVQIDS------GIKEVG--  797
             GY++  VP FI W++ +S + +TFKLL+  Q+E       G+           IK VG  
Sbjct  525   GYYVHHVPSFIAWIKYISISQYTFKLLIGSQFEAGETYTCGINTTCYVEDFPAIKSVGIG  584

Query  796   -------ALAAMAVSYRLLAYISLRRM  737
                    ALA M V+YRLLAY++L R+
Sbjct  585   DKAISVVALAIMLVAYRLLAYVALMRI  611



>emb|CAN70956.1| hypothetical protein VITISV_028138 [Vitis vinifera]
Length=677

 Score =   488 bits (1257),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 276/612 (45%), Positives = 396/612 (65%), Gaps = 49/612 (8%)
 Frame = -2

Query  2428  FPIYLKFTEVSYKIVIK-------GVTFSEEKDILNGISGAVDPGEVLALMGPSGCGKTT  2270
             F  Y  F EV YK+ ++       G   + +K ILNGI+G V PGE+LA++GPSG GKTT
Sbjct  70    FTHYNMFEEVVYKVKLEQKGFCWGGAWSTRDKTILNGITGMVCPGEILAMLGPSGSGKTT  129

Query  2269  LLSLLGGRIRDPSAGSITYNQHPYSKLLKSRIGFVTQDDILFPHLTVKETLIYAARLRLP  2090
             LL+ LGGR+    +G ITYN  P+S  +K R GFV QDD+L+PHLTV ETL++ A LRLP
Sbjct  130   LLTALGGRLNGKLSGKITYNGQPFSGAVKRRTGFVAQDDVLYPHLTVTETLLFTALLRLP  189

Query  2089  RTLTKEEKDKRAMDVIYELGLDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFL  1910
             ++L + EK +    VI ELGL RC+++MIGG   RG+SGGE+KRV IG E++INPSLL L
Sbjct  190   KSLARNEKAQHVERVISELGLTRCRNSMIGGPLFRGISGGEKKRVSIGQEMLINPSLLLL  249

Query  1909  DEPTSGLDSTTALRIVDILHEIAKAGKTVITTIHQPSSRLFHkfdklilleflldLANG-  1733
             DEPTSGLDSTTA RI+  +  +A  G+TV+TTIHQPSSRL+H FDK+ILL     + NG 
Sbjct  250   DEPTSGLDSTTAQRILTTIKRLASGGRTVVTTIHQPSSRLYHMFDKVILLSEGCPIYNGP  309

Query  1732  -----------------NINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGC  1604
                               +N   +  +LA+ +   + +      N +     V E L+  
Sbjct  310   ASTAMEYFSSVGFSTCVTVNPADLLLDLANGISPDSKQAAEQSENMEQEQKSVREALISA  369

Query  1603  YETRVAETEKKKLMA----PLPVEEELKSKVRYLKREWGASWSEQYVLLFHRGIRERWHD  1436
             YE  ++   K +L +         ++ +++  +   +W  SW  Q+++L  RG+RER ++
Sbjct  370   YEKNISTRLKAELCSVDVNNYNYTKDGRARNNFKADQWCTSWWHQFMVLLQRGLRERRYE  429

Query  1435  YFSWLRITQVIATALILGMLWWQSGGDTP-SQMQDQAGLLFFIAVFWGFFPVFTAIFTFP  1259
              F+ LRI QVI+ A++ G+LWW     TP S ++D+  LLFF +VFWGF+P++ A+FTFP
Sbjct  430   AFNRLRIFQVISVAVLGGLLWWH----TPTSHIEDRIALLFFFSVFWGFYPLYNAVFTFP  485

Query  1258  QEKAMLSKERAADMYRLSAYFAARTTSdlpldlllpliflLVVYFMAGLKQDASSFLLTA  1079
             QE+ ML KER++ MYRLS+YF ART  DLPL+L LP  F++++Y+M GLK D  +F+L+ 
Sbjct  486   QERRMLIKERSSGMYRLSSYFLARTFGDLPLELALPTAFVIIIYWMGGLKPDPITFILSL  545

Query  1078  VTVFLCIVVAQGLGLAIGATLMDLKKATTLASVTVMTFMLAGGYFIKKVPGFIVWLRDLS  899
             + V   ++V+Q LGLAIGA LMD+K+ATTLASVT + F++AGGY+++++P FIVWL+ LS
Sbjct  546   LVVLYNVLVSQSLGLAIGAILMDIKQATTLASVTTLVFLIAGGYYVQQIPPFIVWLKYLS  605

Query  898   FNYHTFKLLLKVQYEHKTN---------------SVNGVQIDSGIKEVGALAAMAVSYRL  764
             ++Y+ +KLLL +QY                    +V  V ++    +V  +A M V YRL
Sbjct  606   YSYYCYKLLLGIQYSEDDYYECSKGVFCRVVDFPAVKSVGLNHLWIDVCIMALMLVGYRL  665

Query  763   LAYISLRRMKLQ  728
             +AY++L R++L+
Sbjct  666   VAYLALHRVQLR  677



>ref|XP_002281949.1| PREDICTED: ABC transporter G family member 9 [Vitis vinifera]
Length=623

 Score =   486 bits (1252),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 297/633 (47%), Positives = 404/633 (64%), Gaps = 63/633 (10%)
 Frame = -2

Query  2512  SKPFSDDENPEDLEAGTKKKRSIPAEPTFPIYLKFTEVSYKI------VIKGVTFSEEKD  2351
             ++P S   NPE     TK K S        + LKF EV YK       +++  +  EEK 
Sbjct  6     AQPESITANPEPPPIFTKAKNS------GHVILKFEEVDYKAKTHKGGLLRKDSKPEEKH  59

Query  2350  ILNGISGAVDPGEVLALMGPSGCGKTTLLSLLGGRIRDPSAGSITYNQHPYSKLLKSRIG  2171
             IL GI+G V PGE+LA++GPSG GKTTLL+ LGGR+     GSITYN  P+S  +K   G
Sbjct  60    ILKGITGIVLPGEMLAMLGPSGSGKTTLLTALGGRLGGRLNGSITYNGKPFSNRMKRSTG  119

Query  2170  FVTQDDILFPHLTVKETLIYAARLRLPRTLTKEEKDKRAMDVIYELGLDRCQDTMIGGSF  1991
             FVTQDD+L+PHLTV ETL++ A LRLP T++KE+K + A  VI +LGL +C+D++IG  F
Sbjct  120   FVTQDDVLYPHLTVTETLVFTALLRLPNTISKEDKVRHAEAVITQLGLTKCKDSIIGNPF  179

Query  1990  VRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILHEIAKAGKTVITTI  1811
             +RGVSGGERKRV IG E++INPSLLFLDEPTSGLDSTTA RIV  L E+AK G+TV+ TI
Sbjct  180   LRGVSGGERKRVSIGQEMLINPSLLFLDEPTSGLDSTTAQRIVSTLWELAKGGRTVVMTI  239

Query  1810  HQPSSRLFHkfdklilleflldLANGN------------------INDVSIPSELADKVQ  1685
             HQPSSRLF+ F K++LL     L  G                   +N      +LA+ V 
Sbjct  240   HQPSSRLFYMFHKVLLLSEGNPLYFGKGAEAMDYFSSIGFAPSVAMNPSDFLLDLANGVL  299

Query  1684  TWNSKEEPTRNNGKPSPAIVHEYLVGCYETRVAETEKKKLMAPLPVEEELKSKV--RYLK  1511
             + +  E+PT          + + LV  Y +++ E  K +L     ++  L+  +  + L 
Sbjct  300   SDDIHEDPTT---------IKQTLVLSYRSKIDEGLKAELRE---IDNHLQDGLEDKQLD  347

Query  1510  REWGASWSEQYVLLFHRGIRERWHDYFSWLRITQVIATALILGMLWWQSGGDTPSQMQDQ  1331
             R W  +W +Q  +LF RG++ER H+ FS L+I QV+    + G+LWWQS     S +QDQ
Sbjct  348   R-WATTWWQQCSVLFRRGVKERRHESFSGLKIGQVLVVGFLSGLLWWQSDS---SHLQDQ  403

Query  1330  AGLLFFIAVFWGFFPVFTAIFTFPQEKAMLSKERAADMYRLSAYFAARTTSdlpldlllp  1151
              GLLFF + FWGFFP+F AIFTFPQE+ ML KER++ MYRLS+YF +RT  DLP++L+LP
Sbjct  404   IGLLFFCSGFWGFFPLFQAIFTFPQERMMLEKERSSGMYRLSSYFMSRTIGDLPMELVLP  463

Query  1150  liflLVVYFMAGLKQDASSFLLTAVTVFLCIVVAQGLGLAIGATLMDLKKATTLASVTVM  971
              IF+++ Y+MAGLK +A +FL T   +   ++V+Q LGLA+GA +MD K AT L SV ++
Sbjct  464   TIFVIITYWMAGLKPNAINFLHTLFALLFSVLVSQSLGLALGAAVMDQKSATILGSVIML  523

Query  970   TFMLAGGYFIKKVPGFIVWLRDLSFNYHTFKLLLKVQYE--------HKTNSVNG-----  830
             +F+LAGGY+++ VP FI W++ +S +++T+KLLL  QY+         KT  + G     
Sbjct  524   SFLLAGGYYVQNVPHFIAWIKYVSISHYTYKLLLGSQYKPGDIYPCSAKTTCLVGDFPAV  583

Query  829   --VQIDSGIKEVGALAAMAVSYRLLAYISLRRM  737
               V +D  I    ALA M V YRL+AYI+L R+
Sbjct  584   QLVGLDKQILAAVALAIMLVGYRLIAYIALMRI  616



>ref|XP_006452648.1| hypothetical protein CICLE_v10010223mg [Citrus clementina]
 gb|ESR65888.1| hypothetical protein CICLE_v10010223mg [Citrus clementina]
Length=687

 Score =   488 bits (1257),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 266/623 (43%), Positives = 382/623 (61%), Gaps = 54/623 (9%)
 Frame = -2

Query  2449  SIPAEPTFPIYLKFTEVSYKIVIKGVT----------------FSEEKD---ILNGISGA  2327
             SI  +   PI+LKF +V YK+ I                     S +KD   IL GI+G+
Sbjct  59    SIEKDRPLPIFLKFEDVEYKVRINKAASDSNPVKSVVSKVASQLSLDKDYKHILKGITGS  118

Query  2326  VDPGEVLALMGPSGCGKTTLLSLLGGRIRDPSAGSITYNQHPYSKLLKSRIGFVTQDDIL  2147
             + PGE+LALMGPSG GKTTLL ++GGR+ D   G+ITYN  PY+  LK RIGFVTQDD+L
Sbjct  119   ICPGEILALMGPSGSGKTTLLKIVGGRLTDDVKGNITYNDIPYNPALKRRIGFVTQDDVL  178

Query  2146  FPHLTVKETLIYAARLRLPRTLTKEEKDKRAMDVIYELGLDRCQDTMIGGSFVRGVSGGE  1967
              P LTV+ETL++AA LRLP  + +++K  R   ++ ELGL+RC+ T +GG F++G+SGGE
Sbjct  179   LPQLTVEETLVFAAFLRLPGNMNRQQKYARVQMILKELGLERCRHTRVGGGFIKGISGGE  238

Query  1966  RKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILHEIAKAGKTVITTIHQPSSRLF  1787
             RKR  IG EI+++PSLL LDEPTSGLDST+A +++ +L ++AKAG+TVITTIHQPSSR+F
Sbjct  239   RKRTSIGYEILVDPSLLLLDEPTSGLDSTSANKLIQVLQKVAKAGRTVITTIHQPSSRMF  298

Query  1786  HkfdklilleflldLANGN------------------INDVSIPSELADKVQTWNSKEEP  1661
             H FDKL+L+     +  G                   +N      +LA    T  S  E 
Sbjct  299   HMFDKLLLISEGYPVYYGKARESMEYFSSLGFIPEIAMNPAEFLLDLATGQVTDISVPEA  358

Query  1660  TRNNGKPSPAIVHEYLVGCYETRVAETEKKKLMAPLPVEEELKSKVRYLKREWGASWSEQ  1481
                +   S + V +YL   Y+T++   EK++      + E L+  ++ +K++W  SW +Q
Sbjct  359   LSASQGASDSEVLKYLQLKYKTQLEPKEKEEHHRNKKIPEHLQLAIQ-VKKDWTLSWWDQ  417

Query  1480  YVLLFHRGIRERWHDYFSWLRITQVIATALILGMLWWQSGGDTPSQMQDQAGLLFFIAVF  1301
             + ++  R  RERW DYF  LR+ Q +  A++LG+LWW+S   T +Q++DQ GL+F+I +F
Sbjct  418   FHIISRRTFRERWRDYFDKLRLVQALGVAVVLGLLWWKSQSTTEAQLRDQVGLIFYICIF  477

Query  1300  WGFFPVFTAIFTFPQEKAMLSKERAADMYRLSAYFAARTTSdlpldlllpliflLVVYFM  1121
             W    +F A++ FP EK  L KER ADMYRLS Y+   T  D+   +  P IF+++VYFM
Sbjct  478   WTSSSIFGAVYVFPFEKIYLVKERKADMYRLSVYYVCSTLCDMVAHVFYPTIFMVIVYFM  537

Query  1120  AGLKQDASSFLLTAVTVFLCIVVAQGLGLAIGATLMDLKKATTLASVTVMTFMLAGGYFI  941
             AG K+    F LT   + L  + +QG G   GA ++ +K+A  +AS+ +M F+L GGY++
Sbjct  538   AGFKRTVPCFFLTLFAILLVAITSQGAGELFGAAVLSIKRAGMIASLILMLFLLTGGYYV  597

Query  940   KKVPGFIVWLRDLSFNYHTFKLLLKVQYE----------------HKTNSVNGVQIDSGI  809
             + +P F+ WL+ LSF Y+ F+LLLKVQY+                  + S + V +  G+
Sbjct  598   QHIPKFMQWLKYLSFMYYGFRLLLKVQYDGDELYECESQEGCRNLQSSPSFDTVNLSGGL  657

Query  808   KEVGALAAMAVSYRLLAYISLRR  740
             +EV  L  MA++YRL AY  LR+
Sbjct  658   QEVWVLLGMALAYRLCAYFCLRK  680



>ref|XP_006474829.1| PREDICTED: ABC transporter G family member 26-like [Citrus sinensis]
Length=687

 Score =   488 bits (1257),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 266/623 (43%), Positives = 383/623 (61%), Gaps = 54/623 (9%)
 Frame = -2

Query  2449  SIPAEPTFPIYLKFTEVSYKIVIKGVT----------------FSEEKD---ILNGISGA  2327
             SI  +   PI+LKF +V YK+ I                     S +KD   IL GI+G+
Sbjct  59    SIEKDRPLPIFLKFEDVEYKVRINKAASDSNPVKSVVSKVASQLSLDKDYKHILKGITGS  118

Query  2326  VDPGEVLALMGPSGCGKTTLLSLLGGRIRDPSAGSITYNQHPYSKLLKSRIGFVTQDDIL  2147
             + PGE+LALMGPSG GKTTLL ++GGR+ D   G+ITYN  PY+  LK RIGFVTQDD+L
Sbjct  119   ICPGEILALMGPSGSGKTTLLKIVGGRLTDDVKGNITYNDIPYNPALKRRIGFVTQDDVL  178

Query  2146  FPHLTVKETLIYAARLRLPRTLTKEEKDKRAMDVIYELGLDRCQDTMIGGSFVRGVSGGE  1967
              P LTV+ETL++AA LRLP  + +++K  R   ++ ELGL+RC+ T +GG F++G+SGGE
Sbjct  179   LPQLTVEETLVFAAFLRLPGNMNRQQKYARVQMILKELGLERCRHTRVGGGFIKGISGGE  238

Query  1966  RKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILHEIAKAGKTVITTIHQPSSRLF  1787
             RKR  IG EI+++PSLL LDEPTSGLDST+A +++ +L ++AKAG+TVITTIHQPSSR+F
Sbjct  239   RKRTSIGYEILVDPSLLLLDEPTSGLDSTSANKLIQVLQKVAKAGRTVITTIHQPSSRMF  298

Query  1786  HkfdklilleflldLANGN------------------INDVSIPSELADKVQTWNSKEEP  1661
             H FDKL+L+     +  G                   +N      +LA    T  S  E 
Sbjct  299   HMFDKLLLISEGYPVYYGKARESMEYFSSLGFIPEIAMNPAEFLLDLATGQVTDISVPEA  358

Query  1660  TRNNGKPSPAIVHEYLVGCYETRVAETEKKKLMAPLPVEEELKSKVRYLKREWGASWSEQ  1481
                +   S + V +YL   Y+T++   EK++      + E L+ +++ +K++W  SW +Q
Sbjct  359   LSASEGASDSEVLKYLQLKYKTQLEPKEKEEHHRNKKIPEHLQLEIQ-VKKDWTLSWWDQ  417

Query  1480  YVLLFHRGIRERWHDYFSWLRITQVIATALILGMLWWQSGGDTPSQMQDQAGLLFFIAVF  1301
             + ++  R  RERW DYF  LR+ Q +  A++LG+LWW+S   T +Q++DQ GL+F+I +F
Sbjct  418   FHIISRRTFRERWRDYFDKLRLVQALGVAVVLGLLWWKSQSTTEAQLRDQVGLIFYICIF  477

Query  1300  WGFFPVFTAIFTFPQEKAMLSKERAADMYRLSAYFAARTTSdlpldlllpliflLVVYFM  1121
             W    +F A++ FP EK  L KER ADMYRLS Y+   T  D+   +  P IF+++VYFM
Sbjct  478   WTSSSIFGAVYVFPFEKIYLVKERKADMYRLSVYYVCSTLCDMVAHVFYPTIFMVIVYFM  537

Query  1120  AGLKQDASSFLLTAVTVFLCIVVAQGLGLAIGATLMDLKKATTLASVTVMTFMLAGGYFI  941
             AG K+    F LT   + L  + +QG G   GA ++ +K+A  +AS+ +M F+L GGY++
Sbjct  538   AGFKRTVPCFFLTLFAILLVAITSQGAGELFGAAVLSIKRAGMIASLILMLFLLTGGYYV  597

Query  940   KKVPGFIVWLRDLSFNYHTFKLLLKVQYE----------------HKTNSVNGVQIDSGI  809
             + +P F+ WL+ LSF Y+ F+LLLKVQY+                  + S + V +  G+
Sbjct  598   QHIPKFMQWLKYLSFLYYGFRLLLKVQYDGDQLYECESQGGCRNLQSSPSFDTVNLSGGL  657

Query  808   KEVGALAAMAVSYRLLAYISLRR  740
             +EV  L  MA++YRL AY  LR+
Sbjct  658   QEVWVLLGMALAYRLCAYFCLRK  680



>ref|XP_003547739.1| PREDICTED: ABC transporter G family member 14-like [Glycine max]
Length=656

 Score =   487 bits (1253),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 297/661 (45%), Positives = 412/661 (62%), Gaps = 68/661 (10%)
 Frame = -2

Query  2530  PDESADSKPFSDDENPEDLEAGTKK-----------KRSIPAEPTFPIYLKFTEVSYKIV  2384
             P+     KP  ++ N    E G  +           ++S P    FPI LKF E+ Y + 
Sbjct  2     PENCIAPKPEHNNNNTTHPEEGPPEMTETVLPIKTNEQSFPKLAMFPITLKFEELVYNVK  61

Query  2383  IK-------GVTFS-EEKDILNGISGAVDPGEVLALMGPSGCGKTTLLSLLGGRIRDPSA  2228
             I+       G T S +EK IL G++G V PGE++A++GPSG GKTTLL+ LGGR+    +
Sbjct  62    IEHKGGLCWGSTRSCKEKTILKGVTGMVSPGEIMAMLGPSGSGKTTLLTALGGRLSGKLS  121

Query  2227  GSITYNQHPYSKLLKSRIGFVTQDDILFPHLTVKETLIYAARLRLPRTLTKEEKDKRAMD  2048
             G +TYN  P+S  +K R GFV QDD+L+PHLTV ETL++ A LRLP +LTKEEK      
Sbjct  122   GKVTYNNQPFSGAMKRRTGFVAQDDVLYPHLTVFETLLFTALLRLPNSLTKEEKVHHVEH  181

Query  2047  VIYELGLDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALR  1868
             VI ELGL RC+ +MIGG F RG+SGGERKRV IG E++INPSLL LDEPTSGLDSTTA R
Sbjct  182   VISELGLSRCRGSMIGGPFFRGISGGERKRVSIGQEMLINPSLLLLDEPTSGLDSTTAQR  241

Query  1867  IVDILHEIAKAGKTVITTIHQPSSRLFHkfdklilleflldLANGN--------------  1730
             I+  +  +A  G+TV+TTIHQPSSRL+H FDK++LL     +  G               
Sbjct  242   IITTIKGLACGGRTVVTTIHQPSSRLYHMFDKVVLLSEGCPIYYGPASSAMDYFSSVGFS  301

Query  1729  ----INDVSIPSELADKVQTWNSKEEPTRNNG--KPSPAIVHEYLVGCYETRVAETEKKK  1568
                 +N   +  +LA+ +   +S + PT  +G  +    +V E LV  Y+  +A   K +
Sbjct  302   TSMIVNPADLMLDLANGIAP-DSSKLPTEQSGSQEVEKKLVREALVSAYDKNIATRLKDE  360

Query  1567  LMAP-----LPVEEELKSKVRYLKRE-WGASWSEQYVLLFHRGIRERWHDYFSWLRITQV  1406
             L +        +++   +   ++K E W  SW  Q+ +L  RG+RER  + F+ LRI QV
Sbjct  361   LCSLEVNNFKAIKDASTNAGNHIKPEQWCTSWWHQFKVLLQRGLRERRFEAFNRLRIFQV  420

Query  1405  IATALILGMLWWQSGGDTP-SQMQDQAGLLFFIAVFWGFFPVFTAIFTFPQEKAMLSKER  1229
             I+ A + G+LWW     TP S + D+  LLFF +VFWGF+P++ A+FTFPQE+ ML KER
Sbjct  421   ISVAFLGGLLWWH----TPESHIGDRIALLFFFSVFWGFYPLYNAVFTFPQERRMLIKER  476

Query  1228  AADMYRLSAYFAARTTSdlpldlllpliflLVVYFMAGLKQDASSFLLTAVTVFLCIVVA  1049
             ++ MYRLS+YF ART  DLP++L LP  F +++Y+M GLK    +FLL+ + V   ++V+
Sbjct  477   SSGMYRLSSYFLARTVGDLPIELALPTAFAIIIYWMGGLKPHPVTFLLSLLVVLYSVLVS  536

Query  1048  QGLGLAIGATLMDLKKATTLASVTVMTFMLAGGYFIKKVPGFIVWLRDLSFNYHTFKLLL  869
             Q LGLA GA LM++K+ATTLASVT + F++AGGY+I+++P FI WL+ LS++Y+ +KLL+
Sbjct  537   QSLGLAFGAILMEVKQATTLASVTTLVFLIAGGYYIQQIPPFIEWLKYLSYSYYCYKLLV  596

Query  868   KVQY---EHKTNSVNGVQIDSG----IKEVG---------ALAAMAVSYRLLAYISLRRM  737
              VQY   +H   S  GV    G    IK VG          +A M V YRL+AY++L+RM
Sbjct  597   GVQYNDDDHYECS-KGVLCKVGEFPPIKSVGLNHLWVDVAIMALMLVGYRLIAYLALQRM  655

Query  736   K  734
             +
Sbjct  656   R  656



>ref|XP_008218542.1| PREDICTED: ABC transporter G family member 26 [Prunus mume]
Length=687

 Score =   488 bits (1255),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 271/628 (43%), Positives = 380/628 (61%), Gaps = 76/628 (12%)
 Frame = -2

Query  2428  FPIYLKFTEVSYKI--------VIKGVTF---------SEEKDILNGISGAVDPGEVLAL  2300
              PI+LKF +V +++         +K +              K IL GI+G++ PGE+LAL
Sbjct  64    LPIFLKFEDVEFRVRSSKASSNTVKAMVSKVASQLNMEDNYKQILRGITGSIGPGEILAL  123

Query  2299  MGPSGCGKTTLLSLLGGRIRDPSAGSITYNQHPYSKLLKSRIGFVTQDDILFPHLTVKET  2120
             MGPSG GKTTLL ++GGRI D   G ITYN  PY++ LK RIGFVTQDD+LFP LTV+ET
Sbjct  124   MGPSGSGKTTLLKVIGGRILDNVKGKITYNDIPYNQALKRRIGFVTQDDVLFPQLTVEET  183

Query  2119  LIYAARLRLPRTLTKEEKDKRAMDVIYELGLDRCQDTMIGGSFVRGVSGGERKRVCIGNE  1940
             L++AA LRLP  +++++K  R   ++ ELGL+RC+ T IGG F++G+SGGERKR  IG E
Sbjct  184   LVFAAFLRLPGNMSRQQKYARVEMIVKELGLERCRHTRIGGGFIKGISGGERKRTSIGYE  243

Query  1939  IIINPSLLFLDEPTSGLDSTTALRIVDILHEIAKAGKTVITTIHQPSSRLFHkfdklill  1760
             I+++PSLL LDEPTSGLDST+A R++ IL  +AK G+T+ITTIHQPSSR+FH FDKL+L+
Sbjct  244   ILVDPSLLLLDEPTSGLDSTSANRLLLILQGLAKGGRTIITTIHQPSSRMFHSFDKLLLI  303

Query  1759  ef--------------------------------lldLANGNINDVSIPSELADKVQTWN  1676
                                               LLDLA G +ND+S+P +L        
Sbjct  304   SEGYPVYYGKGAESLEYFSSLRFIPEIPMNPAEFLLDLATGQVNDISVPEDLV-------  356

Query  1675  SKEEPTRNNGKPSPAIVHEYLVGCYETRVAETEKKKLMAPLPVEEELKSKVRYLKREWGA  1496
                 P       S   V  YL   Y+T++   EK +        + L+  ++  K++W  
Sbjct  357   ---VPQGQGTLDSEKAVVRYLQLKYKTQLEPKEKGENHGTTKAPDHLRVAIQ-AKKDWTI  412

Query  1495  SWSEQYVLLFHRGIRERWHDYFSWLRITQVIATALILGMLWWQSGGDTPSQMQDQAGLLF  1316
             +W EQ+++LF R  RER  DYF  LR+ Q +  A++LG+LWW+S  DT +Q++DQ GL+F
Sbjct  413   TWCEQFMILFKRTFRERCRDYFDKLRLVQAVGVAVLLGLLWWKSKTDTEAQLRDQVGLMF  472

Query  1315  FIAVFWGFFPVFTAIFTFPQEKAMLSKERAADMYRLSAYFAARTTSdlpldlllpliflL  1136
             +I +FW    +F A++ FP EK  L KER ADMYRLS Y+   T  D+   +  P  F+L
Sbjct  473   YICIFWTSSSIFGAVYVFPFEKVFLVKERKADMYRLSVYYVCSTLCDMMAHVFYPTFFML  532

Query  1135  VVYFMAGLKQDASSFLLTAVTVFLCIVVAQGLGLAIGATLMDLKKATTLASVTVMTFMLA  956
             +VYFMAG  +    F LT  +V L  V +QG G   GA ++ +++A  +AS+ +M F+L 
Sbjct  533   IVYFMAGFIRTVPCFFLTLFSVLLVAVTSQGAGELFGALVLSIRRAGMVASLILMLFLLT  592

Query  955   GGYFIKKVPGFIVWLRDLSFNYHTFKLLLKVQYE----HKTNSVNG------------VQ  824
             GGY+++ +P F+ WL+ LSF Y+ F+LLLKVQY     ++  S  G            V 
Sbjct  593   GGYYVQHIPKFMQWLKYLSFMYYGFRLLLKVQYSGDQLYECESKGGCRSLQSSPTFDMVD  652

Query  823   IDSGIKEVGALAAMAVSYRLLAYISLRR  740
             ++ G++EV  L AMA+ YR+ AY  LRR
Sbjct  653   LNGGMEEVWILLAMAIGYRICAYFCLRR  680



>ref|XP_006841289.1| hypothetical protein AMTR_s00134p00069640 [Amborella trichopoda]
 gb|ERN02964.1| hypothetical protein AMTR_s00134p00069640 [Amborella trichopoda]
Length=633

 Score =   486 bits (1250),  Expect = 4e-155, Method: Compositional matrix adjust.
 Identities = 270/626 (43%), Positives = 389/626 (62%), Gaps = 74/626 (12%)
 Frame = -2

Query  2434  PTFPIYLKFTEVSYKIVIKGVTFS------------------EEKDILNGISGAVDPGEV  2309
             P+FP+ +KF +++Y+I ++    +                  EE+ +L GI+G V PGE+
Sbjct  24    PSFPVTVKFVDITYRIKLQSTESTASSILSSIIGSKPPRKSIEERTVLKGITGVVSPGEI  83

Query  2308  LALMGPSGCGKTTLLSLLGGRIRDPSAGSITYNQHPYSKLLKSRIGFVTQDDILFPHLTV  2129
             LA++GPSG GKTT LS LGG++    AG++  N    +K ++ + GFVTQDD+L+PHLTV
Sbjct  84    LAILGPSGSGKTTFLSFLGGKLDGKFAGTLLANGQKVTKSIRRKTGFVTQDDLLYPHLTV  143

Query  2128  KETLIYAARLRLPRTLTKEEKDKRAMDVIYELGLDRCQDTMIGGSFVRGVSGGERKRVCI  1949
             +ETLIY+A LRLP+T++K EK   A  V+ ELGL+ C D+++G +FVRG+SGGERKRV I
Sbjct  144   RETLIYSALLRLPKTVSKREKVGLAESVLSELGLNGCGDSIVGSAFVRGISGGERKRVSI  203

Query  1948  GNEIIINPSLLFLDEPTSGLDSTTALRIVDILHEIAKAGKTVITTIHQPSSR---LFHkf  1778
             G E+++NPSLL LDEPTSGLDST A ++V  L  +A+ GK V+ T+HQPSSR   +FH  
Sbjct  204   GQEMLVNPSLLLLDEPTSGLDSTAAYKLVTTLRGLARKGKAVVATMHQPSSRVYQIFHSV  263

Query  1777  d-----------------------------klilleflldLANGNINDVSIPSELADKVQ  1685
                                            +   +F++DLANG   D+ +   +A +V+
Sbjct  264   LLLSDGNCLYFGKGSEAMDYFSSIGFSPAFAMNPADFMIDLANGVTPDLKL---VAGQVE  320

Query  1684  TWNSKEEPTRNNGKPSPAIVHEYLVGCYETRVAETEKKKLMAPLPVEEELKSKVRYLKRE  1505
             T    ++P           + ++L+  +   +A   K  ++A +  E       +    E
Sbjct  321   TQGDAQKPK----------LKQFLISSFNKSLAPKVKANVLATITTEVAQNPGTKRHDSE  370

Query  1504  WGASWSEQYVLLFHRGIRERWHDYFSWLRITQVIATALILGMLWWQSGGDTPSQMQDQAG  1325
                +W++Q+ +L  R ++ER H+ F  LRI QV ATA++ G +WWQS   +   + D+ G
Sbjct  371   LCTTWTDQFSVLLRRSLKERRHESFGGLRILQVGATAVLAGSMWWQS---SACDVLDRVG  427

Query  1324  LLFFIAVFWGFFPVFTAIFTFPQEKAMLSKERAADMYRLSAYFAARTTSdlpldlllpli  1145
             LLFFI++FWG FPVF ++FTFPQE+ +  KER A MY+LSAY AA+   DLP++L+LP  
Sbjct  428   LLFFISIFWGVFPVFNSVFTFPQERPIFIKERGAGMYKLSAYVAAKAIGDLPMELVLPTA  487

Query  1144  flLVVYFMAGLKQDASSFLLTAVTVFLCIVVAQGLGLAIGATLMDLKKATTLASVTVMTF  965
             F +V Y+MAGL+ DA SFLLT   V   ++V QGLGLA+GA +MD K+AT +ASVT+M F
Sbjct  488   FTIVAYWMAGLRADAFSFLLTLGVVLYSVLVGQGLGLALGAAIMDAKRATAVASVTMMAF  547

Query  964   MLAGGYFIKKVPGFIVWLRDLSFNYHTFKLLLKVQYE-HKTNSVNGVQIDSGIKE-----  803
             +L GGY+++KVP F+ WL+  SF Y+ F LL+ +QY   ++   NG      + E     
Sbjct  548   LLVGGYYVRKVPHFVRWLKYTSFTYYAFGLLIHIQYRGAQSQWCNGGGGGGAVMELPGPA  607

Query  802   --VGALAAMAVSYRLLAYISLRRMKL  731
               VGALAAM V YRLLAYI+LRR+K+
Sbjct  608   LCVGALAAMLVGYRLLAYIALRRVKV  633



>ref|XP_003548769.1| PREDICTED: ABC transporter G family member 14-like [Glycine max]
 gb|KHN30742.1| ABC transporter G family member 14 [Glycine soja]
Length=651

 Score =   486 bits (1251),  Expect = 5e-155, Method: Compositional matrix adjust.
 Identities = 285/621 (46%), Positives = 398/621 (64%), Gaps = 50/621 (8%)
 Frame = -2

Query  2458  KKRSIPAEPTFPIYLKFTEVSYKIVI--KGVTF-----SEEKDILNGISGAVDPGEVLAL  2300
              K+S P    +PI LKF E+ YK+ I  KGV +      +EK IL G++G V PGE++A+
Sbjct  35    NKQSFPKLAMYPITLKFEELVYKVKIEQKGVCWGSTRSCKEKTILKGVTGMVCPGEIMAM  94

Query  2299  MGPSGCGKTTLLSLLGGRIRDPSAGSITYNQHPYSKLLKSRIGFVTQDDILFPHLTVKET  2120
             +GPSG GKTTLL+ LGGR+    +G +TYN  P+S  +K R GFV QDD+L+PHLTV ET
Sbjct  95    LGPSGSGKTTLLTALGGRLSGKLSGKVTYNNQPFSGAMKRRTGFVAQDDVLYPHLTVTET  154

Query  2119  LIYAARLRLPRTLTKEEKDKRAMDVIYELGLDRCQDTMIGGSFVRGVSGGERKRVCIGNE  1940
             L++ A LRLP TLTKEEK +    VI ELGL RC+ +MIGG F RG+SGGERKRV IG E
Sbjct  155   LLFTALLRLPNTLTKEEKVQHVEHVISELGLSRCRGSMIGGPFFRGISGGERKRVSIGQE  214

Query  1939  IIINPSLLFLDEPTSGLDSTTALRIVDILHEIAKAGKTVITTIHQPSSRLFHkfdklill  1760
             ++INPSLL LDEPTSGLDSTTA RI+  +  +A  G+TV+TTIHQPSSRL+H FDK++LL
Sbjct  215   MLINPSLLLLDEPTSGLDSTTAQRIITTIKGLASGGRTVVTTIHQPSSRLYHMFDKVVLL  274

Query  1759  eflldLANGN------------------INDVSIPSELADKVQTWNSKEEPTRNNGKPS-  1637
                  +  G+                  +N   +  +LA+ +    SK     +  + + 
Sbjct  275   SEGCPIYYGHASSAMDYFSSVGFSTSMIVNPADLMLDLANGIAPDPSKLATEHSESQEAE  334

Query  1636  PAIVHEYLVGCYETRVAETEKKKLMA----PLPVEEELKSKVRYLKREWGASWSEQYVLL  1469
               +V E L+  Y+  +A   K +L +       V ++  ++      +W  SW  Q+ +L
Sbjct  335   KKLVREALISAYDKNIATRLKDELCSFEVNNYKVIKDSSTRNHIKPEQWCTSWWHQFKVL  394

Query  1468  FHRGIRERWHDYFSWLRITQVIATALILGMLWWQSGGDTP-SQMQDQAGLLFFIAVFWGF  1292
               RG+RER  + F+ LRI QVI+ A + G+LWW     TP S + D+  LLFF +VFWGF
Sbjct  395   LQRGLRERRFEAFNRLRIFQVISVAFLGGLLWWH----TPESHIGDRIALLFFFSVFWGF  450

Query  1291  FPVFTAIFTFPQEKAMLSKERAADMYRLSAYFAARTTSdlpldlllpliflLVVYFMAGL  1112
             +P++ A+FTFPQE+ ML KER++ MYRLS+YF ART  DLP++L LP  F++++Y+M GL
Sbjct  451   YPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLARTVGDLPIELALPTAFVIIIYWMGGL  510

Query  1111  KQDASSFLLTAVTVFLCIVVAQGLGLAIGATLMDLKKATTLASVTVMTFMLAGGYFIKKV  932
             K    +FLL+ + V   ++V+Q LGLA GA LM++K+ATTLASVT + F++AGGY+I+++
Sbjct  511   KPHPVTFLLSLLVVLYSVLVSQSLGLAFGAILMEVKQATTLASVTTLVFLIAGGYYIQQI  570

Query  931   PGFIVWLRDLSFNYHTFKLLLKVQY--EHKTNSVNGVQIDSG----IKEVG---------  797
             P FI WL+ LS++Y+ +KLL+ VQ+  +       GV    G    IK VG         
Sbjct  571   PPFIEWLKYLSYSYYCYKLLVGVQFNDDDYYECSKGVLCKVGEFPQIKSVGLNHLWVDVT  630

Query  796   ALAAMAVSYRLLAYISLRRMK  734
              +A M V YRL+AY++L R++
Sbjct  631   IMAMMLVGYRLIAYLALLRVR  651



>emb|CDP07185.1| unnamed protein product [Coffea canephora]
Length=655

 Score =   486 bits (1251),  Expect = 6e-155, Method: Compositional matrix adjust.
 Identities = 285/615 (46%), Positives = 394/615 (64%), Gaps = 61/615 (10%)
 Frame = -2

Query  2425  PIYLKFTEVSYKIVI--KGVTF-----SEEKDILNGISGAVDPGEVLALMGPSGCGKTTL  2267
             PI LKF E+ YK+ I  KG+       S+EK ILNG++G V PGE+LA++GPSG GKTTL
Sbjct  51    PITLKFEEIVYKVRIETKGMCCGQTLSSKEKTILNGLTGMVCPGEILAMLGPSGSGKTTL  110

Query  2266  LSLLGGRIRDPSAGSITYNQHPYSKLLKSRIGFVTQDDILFPHLTVKETLIYAARLRLPR  2087
             L+ LGGR+    +G ITYN  P S  ++ + GFV QDD+L+PHLTV ETL++ A LRLP+
Sbjct  111   LTALGGRLTSKLSGKITYNTQPISGHIRRQTGFVAQDDVLYPHLTVFETLLFTALLRLPK  170

Query  2086  TLTKEEKDKRAMDVIYELGLDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLD  1907
             TLTKEEK +    VI ELGL RC+++MIGG   RG+SGGE+KRV IG E++INPSLL LD
Sbjct  171   TLTKEEKVQHVEQVIAELGLSRCRNSMIGGPLFRGISGGEKKRVSIGQEMLINPSLLLLD  230

Query  1906  EPTSGLDSTTALRIVDILHEIAKAGKTVITTIHQPSSRLFHkfdklilleflldLANG--  1733
             EPTSGLDSTTA+RI+  +  +A AG+TV+TTIHQPSSRL+H FDKL+LL     +  G  
Sbjct  231   EPTSGLDSTTAMRILTTIKRLASAGRTVVTTIHQPSSRLYHMFDKLVLLSEGSPIYYGPA  290

Query  1732  ----------------NINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCY  1601
                              +N      +LA+ +            + +    +V E L+  Y
Sbjct  291   STALEYFSSIGFSTTLTVNPADFLLDLANGIGPDAKHAFELGESAEKEQKLVREALISAY  350

Query  1600  ETRVAETEKKKLMAPLPVEEELKSKVRYLKR-----EWGASWSEQYVLLFHRGIRERWHD  1436
             +  +A   K +L + L +     +K    KR     +W  SW  Q+ +L  RG+RER ++
Sbjct  351   DKNIATRLKAELCS-LDINNYAYAKDSSTKRDAKSEQWCTSWFHQFNVLLLRGLRERRYE  409

Query  1435  YFSWLRITQVIATALILGMLWWQSGGDTP-SQMQDQAGLLFFIAVFWGFFPVFTAIFTFP  1259
              F+ LRI QVI+ A + G+LWW     TP S ++DQ  +LFF +VFWGF+P++ A+FTFP
Sbjct  410   TFNRLRIFQVISVATLGGLLWWH----TPMSHIEDQIAMLFFFSVFWGFYPIYNAVFTFP  465

Query  1258  QEKAMLSKERAADMYRLSAYFAARTTSdlpldlllpliflLVVYFMAGLKQDASSFLLTA  1079
             QE+ ML KER++ MY LS+YF A+T  DLPL+L LP  F  ++Y+M GLK + ++F+L+ 
Sbjct  466   QERRMLIKERSSGMYHLSSYFLAKTVGDLPLELALPTAFTFIIYWMGGLKPEPATFILSL  525

Query  1078  VTVFLCIVVAQGLGLAIGATLMDLKKATTLASVTVMTFMLAGGYFIKKVPGFIVWLRDLS  899
             + V   ++V+Q LGLA GA LMD+K+ATTLASVT + F++AGGY+I+++P FIVWL+ LS
Sbjct  526   LIVLYSVLVSQSLGLAFGAILMDVKQATTLASVTTLVFLIAGGYYIQQIPAFIVWLKYLS  585

Query  898   FNYHTFKLLLKVQYEH--------------------KTNSVNGVQIDSGIKEVGALAAMA  779
             ++Y+ FKLLL VQY                      K+  +N + ID     V  +A M 
Sbjct  586   YSYYCFKLLLGVQYNGNDYYECSKGVYCRVADFPYVKSVGLNHLWID-----VSIMALMM  640

Query  778   VSYRLLAYISLRRMK  734
             V YR +AY++LRR++
Sbjct  641   VGYRFIAYLALRRVR  655



>emb|CDY46506.1| BnaA02g27560D [Brassica napus]
Length=668

 Score =   486 bits (1251),  Expect = 7e-155, Method: Compositional matrix adjust.
 Identities = 276/640 (43%), Positives = 406/640 (63%), Gaps = 58/640 (9%)
 Frame = -2

Query  2506  PFSDDENPEDLEAGTKKKRSIPAEPTFPIYLKFTEVSYKIVIKGVTFS---------EEK  2354
             P  DD+ P         + S+  +   PI LKF E++Y I I+    S         + +
Sbjct  37    PCLDDDGPSHQSC----QSSVLRQSLRPIILKFEELTYTIKIQSGKGSYWFGSQEPKQNR  92

Query  2353  DILNGISGAVDPGEVLALMGPSGCGKTTLLSLLGGRIRDPSAGSITYNQHPYSKLLKSRI  2174
              ILNG+SG V PGE+LA++GPSG GKTTL++ L GR++   +G+++YN  P++  +K R 
Sbjct  93    LILNGVSGIVKPGELLAMLGPSGSGKTTLVTALAGRLQGKLSGTVSYNGAPFTSSVKRRT  152

Query  2173  GFVTQDDILFPHLTVKETLIYAARLRLPRTLTKEEKDKRAMDVIYELGLDRCQDTMIGGS  1994
             GFVTQDD+L+PHLTV ETL Y A LRLP+ LT++EK ++A  VI +LGL RC +++IGG 
Sbjct  153   GFVTQDDVLYPHLTVMETLTYTALLRLPKELTRKEKIQQAESVISDLGLTRCCNSVIGGG  212

Query  1993  FVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILHEIAKAGKTVITT  1814
              +RG+SGGERKRV IG E+++NPSLL LDEPTSGLDSTTA RIV  L  +A+ G+TV+TT
Sbjct  213   LIRGISGGERKRVSIGQEMLVNPSLLLLDEPTSGLDSTTAARIVATLRSLARGGRTVVTT  272

Query  1813  IHQPSSRLFHkfdklilleflldLANGN-------------------INDVSIPSELADK  1691
             IHQPSSRL+  FDK+++L     + +G+                   +N      +LA+ 
Sbjct  273   IHQPSSRLYRMFDKVLVLSDGSPIYSGDSGRVMEYFGSIGFQPGSSFVNPADFVLDLANG  332

Query  1690  VQTWNSKEEPTRNNGK----PSPAIVHEYLVGCYETRVAETEKKKLMAPLPVEEEL---K  1532
             + +   + E    NGK         V + L+  Y+  +    K++     P ++ +   +
Sbjct  333   ITSDTKQYEQVEINGKLDRLEEQNSVKQSLISAYKKNLYPPLKEEFSRAFPQDQTVNMSR  392

Query  1531  SKVRYLKREWGASWSEQYVLLFHRGIRERWHDYFSWLRITQVIATALILGMLWWQSGGDT  1352
             SK R L   W  SW  Q+ +L  RG++ER H+ FS LRI  V++ +L+ G+LWW S    
Sbjct  393   SKTR-LTNRWPTSWWMQFSVLLKRGLKERSHESFSGLRIFMVMSVSLLSGLLWWHS---R  448

Query  1351  PSQMQDQAGLLFFIAVFWGFFPVFTAIFTFPQEKAMLSKERAADMYRLSAYFAARTTSdl  1172
              + +QDQ GLLFF ++FWGF P+F AIFTFPQE+ ML KER++ +YRLS+Y+ ART  DL
Sbjct  449   VAHIQDQVGLLFFFSIFWGFLPLFNAIFTFPQERPMLIKERSSGIYRLSSYYIARTVGDL  508

Query  1171  pldlllpliflLVVYFMAGLKQDASSFLLTAVTVFLCIVVAQGLGLAIGATLMDLKKATT  992
             P++L+LP IF+ + Y+M GLK   ++F++T + V   ++V+QG+GLA+GA LMD KKA T
Sbjct  509   PMELILPTIFVTITYWMGGLKSSLTTFIMTLMIVLYSVLVSQGVGLALGAILMDAKKAAT  568

Query  991   LASVTVMTFMLAGGYFIKKVPGFIVWLRDLSFNYHTFKLLLKVQYE-----------HKT  845
             L+SV ++ F+LAGGY+I+ +PGFI WL+ +SF+++ +KLL+ VQY            H +
Sbjct  569   LSSVLMLVFLLAGGYYIQHIPGFIAWLKYISFSHYCYKLLVGVQYTWDEVYECGPGLHCS  628

Query  844   ----NSVNGVQIDSGIKEVGALAAMAVSYRLLAYISLRRM  737
                   +  +++ + + +V AL  M + YR LAY++LR +
Sbjct  629   VMDYEGIKNLRLGNMMWDVLALTLMLLLYRFLAYVALRNL  668



>ref|XP_004293103.1| PREDICTED: ABC transporter G family member 9-like [Fragaria vesca 
subsp. vesca]
Length=633

 Score =   485 bits (1248),  Expect = 7e-155, Method: Compositional matrix adjust.
 Identities = 285/635 (45%), Positives = 397/635 (63%), Gaps = 57/635 (9%)
 Frame = -2

Query  2494  DENPEDLEAGTKKKRSIPAEPTF-----PIYLKFTEVSYKIVIK--GVTFSEEKD-----  2351
             D+   DLE+  +      +   F     P+ LKF +V+Y I  +  G+++  +KD     
Sbjct  2     DQQMVDLESNRRTNIDEESPAIFKKAIRPVTLKFEDVAYTIKAETDGMSWLRKKDKNSDS  61

Query  2350  ---ILNGISGAVDPGEVLALMGPSGCGKTTLLSLLGGRIRDPSAGSITYNQHPYSKLLKS  2180
                ILNGISG V PGE+LA++GPSG GKTTLL+ LGGR+    +GSITYN  P+S  +K 
Sbjct  62    EKHILNGISGVVKPGEILAMLGPSGSGKTTLLTALGGRLGGKLSGSITYNNKPFSNTMKR  121

Query  2179  RIGFVTQDDILFPHLTVKETLIYAARLRLPRTLTKEEKDKRAMDVIYELGLDRCQDTMIG  2000
               GFVTQDD L+PHLTV ETL++ A LRLP TLTK EK   A  VI +L L +C++++IG
Sbjct  122   NTGFVTQDDFLYPHLTVAETLVFTALLRLPNTLTKAEKTHEAEAVITQLELTKCRNSIIG  181

Query  1999  GSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILHEIAKAGKTVI  1820
                +RGVSGGER+RV IG E++INPSL+FLDEPTSGLDSTTA RIV  L E+A   +T++
Sbjct  182   DELLRGVSGGERRRVSIGQELLINPSLMFLDEPTSGLDSTTAQRIVKALSELAIGERTIV  241

Query  1819  TTIHQPSSRLFHkfdklilleflldLANGNINDVS-----------IPSELADKVQTWNS  1673
              TIHQPSSRLF+ F K++LL     L  G+++DV            +    AD +    +
Sbjct  242   MTIHQPSSRLFYMFHKVMLLSEGNALYFGHVSDVMKYFSGIGYAPLVAMNPADFLLDLAN  301

Query  1672  KEEPTRNNGKPSPAIVHEYLVGCYETRVAETEKKKLMAPLPVE------EELKSKVRYLK  1511
                P  +N   S   + + L   Y   + +  K +L     V+      EE  S+ +   
Sbjct  302   GLTPDESNDNKSE--LKQSLALAYRENLEDKLKAELKETSGVDCNNNQSEEASSEDKKF-  358

Query  1510  REWGASWSEQYVLLFHRGIRERWHDYFSWLRITQVIATALILGMLWWQSGGDTPSQMQDQ  1331
             R+W  +W +Q+ +LF RG++ER HD FS LRI QV+A AL+ G+LWWQS     S +QDQ
Sbjct  359   RKWPTTWWQQFTVLFRRGVKERKHDSFSGLRIGQVVAVALLCGLLWWQS-----SSLQDQ  413

Query  1330  AGLLFFIAVFWGFFPVFTAIFTFPQEKAMLSKERAADMYRLSAYFAARTTSdlpldlllp  1151
              GLLFF++ FWGFFP+F AIFTFP E+ ML KER +  YRLS+YF +R   DLP++L+LP
Sbjct  414   IGLLFFMSGFWGFFPLFQAIFTFPPERKMLEKERTSGTYRLSSYFMSRIIGDLPMELVLP  473

Query  1150  liflLVVYFMAGLKQDASSFLLTAVTVFLCIVVAQGLGLAIGATLMDLKKATTLASVTVM  971
              +F+ +VY+MAG K  A +F  T   + L ++VAQG+GLA+GA +MDL+ AT L SV ++
Sbjct  474   TLFITIVYWMAGFKTTAGNFFHTLFVLLLLVLVAQGMGLALGAVVMDLQSATVLGSVLML  533

Query  970   TFMLAGGYFIKKVPGFIVWLRDLSFNYHTFKLLLKVQYEHKTN-----------------  842
             +F+LAGGY+++ VP FI W++ +S + H +KLL+  QY+                     
Sbjct  534   SFLLAGGYYVQHVPRFISWIKYISISNHAYKLLIGSQYKGSDTFPCVNDANRLCLVRDFP  593

Query  841   SVNGVQIDSGIKEVGALAAMAVSYRLLAYISLRRM  737
             ++  + +D  +  + ALA M V YRL+AYI+L R+
Sbjct  594   NIKTIGLDGQVNALVALAIMLVFYRLIAYIALMRI  628



>gb|KHG30511.1| ABC transporter G family member 22 [Gossypium arboreum]
Length=668

 Score =   486 bits (1251),  Expect = 7e-155, Method: Compositional matrix adjust.
 Identities = 290/457 (63%), Positives = 343/457 (75%), Gaps = 42/457 (9%)
 Frame = -2

Query  2878  MEQT-NSTSLLRTKSDQLVEaiaaakgsarARLPRLSAEFAGSGVPESVRMLSRKPSRRL  2702
             ME++ NST+L RTKS+QLV     A  +  ++ P +  E A     ES+  LSRK S+R+
Sbjct  1     MEKSMNSTTLARTKSEQLV-IETQAAATQTSKSPTMQNEDAPI-TSESMGTLSRKSSQRM  58

Query  2701  MppspggggsgGT-NSTHIRKSRSAQMKLDLDElssgsvlsrassasl--GFSFTGFSVR  2531
             +  +  G  SGG  N+THIRK+RSAQ+K+D++ELS+G+ LSRASSASL   FSFTGF+V 
Sbjct  59    VVGASPGRSSGGNKNNTHIRKARSAQVKMDVEELSNGAALSRASSASLGLSFSFTGFTVP  118

Query  2530  PDESADSKPFSDDENPEDLEAGTKKKRSIPAEPTFPIYLKFTEVSYKIVIKGVTFSEEKD  2351
             PDE  DSKPFSDD+ PED+EAGT K +    EPT PIYLKF++V+YK++ KG+T SEE+D
Sbjct  119   PDEITDSKPFSDDDIPEDIEAGTCKPK-FQTEPTLPIYLKFSDVTYKVITKGMTTSEERD  177

Query  2350  ILNGISGAVDPGEVLALMGPSGCGKTTLLSLLGGR-IRDPSAGSITYNQHPYSKLLKSRI  2174
             ILNGI+GAV PGEVLALMGPSG GKTTLL+LLGGR I+    GS+TYN  PYSK LKS+I
Sbjct  178   ILNGITGAVSPGEVLALMGPSGSGKTTLLNLLGGRLIQSTVGGSVTYNDQPYSKFLKSKI  237

Query  2173  GFVTQDDILFPHLTVKETLIYAARLRLPRTLTKEEKDKRAMDVIYELGLDRCQDTMIGGS  1994
             GFVTQDD+LFPHLTVKETL Y ARLRL + L++++K+KRA+DVIYELGL+RCQDTMIGGS
Sbjct  238   GFVTQDDVLFPHLTVKETLTYTARLRLSKALSRQQKEKRAIDVIYELGLERCQDTMIGGS  297

Query  1993  FVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILHEIAKAGKTVITT  1814
             FVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALR V  L  IA+AGKTVITT
Sbjct  298   FVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRTVQTLQNIAEAGKTVITT  357

Query  1813  IHQPSSRLFHk--------------------------------fdklilleflldLANGN  1730
             IHQPSSRLFHK                                   +   EFLLDLANGN
Sbjct  358   IHQPSSRLFHKFDKLILLGKGSSLYFGRASEAMAYFSSIGCSPLIAMNPAEFLLDLANGN  417

Query  1729  INDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHE  1619
             IND+S+PSEL DKVQ  NS+ E TRN  KP PA++HE
Sbjct  418   INDISVPSELEDKVQVGNSETE-TRNE-KPPPAVIHE  452


 Score =   305 bits (782),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 160/204 (78%), Positives = 180/204 (88%), Gaps = 0/204 (0%)
 Frame = -2

Query  1339  QDQAGLLFFIAVFWGFFPVFTAIFTFPQEKAMLSKERAADMYRLSAYFAARTTSdlpldl  1160
             QDQAGLLFFIAVFWGFFPVFTAIFTFPQE+AMLSKERAADMYRLSAYF ARTTSDLPLDL
Sbjct  462   QDQAGLLFFIAVFWGFFPVFTAIFTFPQERAMLSKERAADMYRLSAYFLARTTSDLPLDL  521

Query  1159  llpliflLVVYFMAGLKQDASSFLLTAVTVFLCIVVAQGLGLAIGATLMDLKKATTLASV  980
             +LP++FLLVVYFMAGL+  A  F L+ +TVFLCI+ AQGLGLAIGATLMDLK+ATTLASV
Sbjct  522   ILPVLFLLVVYFMAGLRLSAGPFFLSMLTVFLCIIAAQGLGLAIGATLMDLKRATTLASV  581

Query  979   TVMTFMLAGGYFIKKVPGFIVWLRDLSFNYHTFKLLLKVQYEHKTNSVNGVQIDSGIKEV  800
             TVMTFMLAGGYF+KKVP FI W+R +SFNYHT+KLLLKVQY+  T  VNG++ D G+ EV
Sbjct  582   TVMTFMLAGGYFVKKVPVFISWIRYMSFNYHTYKLLLKVQYQDITPPVNGIKTDDGLWEV  641

Query  799   GALAAMAVSYRLLAYISLRRMKLQ  728
             GAL AM   YR+LAY+SLR M+L 
Sbjct  642   GALVAMIFGYRVLAYLSLRGMQLH  665



>ref|XP_007226971.1| hypothetical protein PRUPE_ppa002442mg [Prunus persica]
 gb|EMJ28170.1| hypothetical protein PRUPE_ppa002442mg [Prunus persica]
Length=672

 Score =   486 bits (1251),  Expect = 8e-155, Method: Compositional matrix adjust.
 Identities = 294/679 (43%), Positives = 418/679 (62%), Gaps = 78/679 (11%)
 Frame = -2

Query  2554  SFTGFSVRPDESADSKPFSDDENPEDLEAGTK------------KKRSIPAEPTFPIYLK  2411
             S +    +P E   S   + +  PE  E  +K              +S      +PI LK
Sbjct  2     SLSSIVPKPAEYGGSDSATVEGTPEMSETHSKAVVAYPAAAAQVNSQSFLQLAMYPITLK  61

Query  2410  FTEVSYKIVIK------GVTF------SEEKDILNGISGAVDPGEVLALMGPSGCGKTTL  2267
             F EV YK+ ++      GV++      S EK IL+GI+G V PGE+LA++GPSG GKTTL
Sbjct  62    FEEVFYKVKMEQKGGRGGVSWWGTNTSSREKSILSGITGTVCPGEILAMLGPSGSGKTTL  121

Query  2266  LSLLGGRIRDPS-----AGSITYNQHPYSKLLKSRIGFVTQDDILFPHLTVKETLIYAAR  2102
             L+ LGGR+   +     +G ITYN  P+   +K R GFV QDD+L+PHLTV ETL++ A 
Sbjct  122   LTALGGRLNHQNNCKFMSGKITYNGQPFCGSIKRRTGFVAQDDVLYPHLTVTETLVFTAL  181

Query  2101  LRLPRTLTKEEKDKRAMDVIYELGLDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPS  1922
             LRLP++L+++EK +    VI ELGL  C+ +MIGG   RG+SGGE+KRV IG E++INPS
Sbjct  182   LRLPKSLSRDEKVQHVEHVISELGLSGCRSSMIGGPLFRGISGGEKKRVSIGLEMLINPS  241

Query  1921  LLFLDEPTSGLDSTTALRIVDILHEIAKAGKTVITTIHQPSSRLFHkfdklilleflldL  1742
             LL LDEPTSGLDSTTA RI+  L  +A  G+T++TTIHQPSSR++H FDKL+LL     +
Sbjct  242   LLLLDEPTSGLDSTTAQRILTTLKRLASGGRTLVTTIHQPSSRIYHMFDKLVLLSEGSPI  301

Query  1741  ANG-------------------NINDVSIPSELADKVQTWNSKEEPTRNNGKPSPAIVHE  1619
               G                   ++N   +  +LA+ +   +      R N +     V +
Sbjct  302   YYGPASAALDYFSSIGFSTSLPSLNPADLLLDLANGIAPDSRHASEQRENMEQDQKTVRK  361

Query  1618  YLVGCYETRVAETEKKKLMAPLPVEEELKSKVRYL-----KREWGASWSEQYVLLFHRGI  1454
              L+  Y+  +    K +L A L    E+ +   Y+     K+ W  SW +Q+ +L  RG+
Sbjct  362   ALISAYDKNICAKLKAELCAGL----EVNNYNNYMKDASAKQHWCTSWWQQFKVLLQRGL  417

Query  1453  RERWHDYFSWLRITQVIATALILGMLWWQSGGDTP-SQMQDQAGLLFFIAVFWGFFPVFT  1277
             RER ++ F+ LRI QVI+ A + G+LWW+    TP S ++D+  LLFF +VFWGF+P++ 
Sbjct  418   RERRYEAFNRLRIFQVISVATLGGLLWWR----TPTSHIEDRIALLFFFSVFWGFYPLYN  473

Query  1276  AIFTFPQEKAMLSKERAADMYRLSAYFAARTTSdlpldlllpliflLVVYFMAGLKQDAS  1097
             A+FTFPQE+ ML KER++ MY+LS+YF ART  DLPL+L LP  F++++Y+M GLK D  
Sbjct  474   AVFTFPQERRMLIKERSSGMYKLSSYFLARTVGDLPLELALPTAFVVIIYWMGGLKPDPF  533

Query  1096  SFLLTAVTVFLCIVVAQGLGLAIGATLMDLKKATTLASVTVMTFMLAGGYFIKKVPGFIV  917
             +F+L+ + V   ++V+Q LGLAIGA LMD+K+ATTLASVT + F++AGGY+I+++P FIV
Sbjct  534   TFILSLLVVLYNVLVSQSLGLAIGAILMDIKQATTLASVTTLVFLIAGGYYIQQIPAFIV  593

Query  916   WLRDLSFNYHTFKLLLKVQYEHKT--NSVNGVQIDSG----IKEVGA----------LAA  785
             WL+ LS++Y+ +KLLL VQY+         GV    G    IK +G           LA 
Sbjct  594   WLKYLSYSYYCYKLLLGVQYDEDEYYECSKGVLCRVGDLPAIKSMGGLNHLWIDVSILAL  653

Query  784   MAVSYRLLAYISLRRMKLQ  728
             M + YRLLAY++L R++L+
Sbjct  654   MLLGYRLLAYLALHRVRLR  672



>gb|AES95438.2| white-brown-complex ABC transporter family protein [Medicago 
truncatula]
Length=638

 Score =   484 bits (1247),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 277/616 (45%), Positives = 400/616 (65%), Gaps = 47/616 (8%)
 Frame = -2

Query  2464  TKKKRSIPAEPTFPIYLKFTEVSYKIVIKGVTFSEEKDILNGISGAVDPGEVLALMGPSG  2285
             +  ++S+P    +PI LKF ++ YK+ +      +EK ILNGI+G V PGE+LA++GPSG
Sbjct  31    SNNEQSLPKLIMYPITLKFEDLVYKVKVN----QKEKTILNGITGVVCPGEILAMLGPSG  86

Query  2284  CGKTTLLSLLGGRIRDPSAGSITYNQHPYSKLLKSRIGFVTQDDILFPHLTVKETLIYAA  2105
              GKTTLL+ LGGR+     G  TYN  P+S  +K R GFV QDD+L+PHLTV ETL++ A
Sbjct  87    SGKTTLLTALGGRLNGKLTGKTTYNNQPFSGSIKRRTGFVAQDDVLYPHLTVTETLVFTA  146

Query  2104  RLRLPRTLTKEEKDKRAMDVIYELGLDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINP  1925
              LRLP+TLT++EK      VI ELGL+ C+++MIGG  +RG+SGGE++RV IG E++INP
Sbjct  147   LLRLPKTLTRDEKVVHVERVISELGLNNCRNSMIGGPLLRGISGGEKRRVSIGQEMLINP  206

Query  1924  SLLFLDEPTSGLDSTTALRIVDILHEIAKAGKTVITTIHQPSSRLFHkfdklilleflld  1745
             SLL LDEPTSGLDSTTALRI++ + ++A  G+TV+TTIHQPSSRL++ FDK++LL     
Sbjct  207   SLLLLDEPTSGLDSTTALRILNTIKKLASGGRTVVTTIHQPSSRLYYMFDKVVLLSEGCP  266

Query  1744  LANG------------------NINDVSIPSELADKVQTWNSKEEPTRNNG-KPSPAIVH  1622
             +  G                   +N   +  +LA+ +   +SK    ++   +     V 
Sbjct  267   IYYGPASTALEYFSSVGFSTSVTVNPADLLLDLANGIAP-DSKHVTEQSEALEHERKTVR  325

Query  1621  EYLVGCYETRV-----AETEKKKLMAPLPVEEELKSKVRYLKREWGASWSEQYVLLFHRG  1457
             E L+  Y+  +     AE    ++     + ++  ++ +    +W  SW  Q+ +L  RG
Sbjct  326   ESLISAYDKNIAPRLKAEVSSMEVNNFNNITKDSCTRNQINPEQWCTSWWYQFTVLLQRG  385

Query  1456  IRERWHDYFSWLRITQVIATALILGMLWWQSGGDTPSQMQDQAGLLFFIAVFWGFFPVFT  1277
             +RER H+ F+ LRI QVI+ A + G+LWW +     S ++D+  LLFF AVFWGF+P++ 
Sbjct  386   VRERRHEAFNRLRIFQVISVAFLAGLLWWHTPA---SHLEDRTALLFFFAVFWGFYPLYN  442

Query  1276  AIFTFPQEKAMLSKERAADMYRLSAYFAARTTSdlpldlllpliflLVVYFMAGLKQDAS  1097
             A+FTFPQE+ ML KER++ MYRLS+YF ART  DLPL+L LP  F++++Y+M GLK D  
Sbjct  443   AVFTFPQERRMLIKERSSGMYRLSSYFLARTIGDLPLELALPTAFVIILYWMGGLKPDPV  502

Query  1096  SFLLTAVTVFLCIVVAQGLGLAIGATLMDLKKATTLASVTVMTFMLAGGYFIKKVPGFIV  917
             +F+L+ + V   +VV+Q LGLA GA LM++K+ATTLASVT + F++AGGY+I+++P FIV
Sbjct  503   TFILSLLVVLYSVVVSQSLGLAFGAILMEIKQATTLASVTTLVFLIAGGYYIQQIPPFIV  562

Query  916   WLRDLSFNYHTFKLLLKVQ------YEHKTNSVNGVQIDSGIKEVG---------ALAAM  782
             WL+ LS++Y+ +KLLL VQ      YE     +  V     IK +G          +A M
Sbjct  563   WLKYLSYSYYCYKLLLGVQYNENDYYECSKGELCKVMDFPPIKSMGLNHMWVDVFIMALM  622

Query  781   AVSYRLLAYISLRRMK  734
                YRL+AY++LRR++
Sbjct  623   LFGYRLVAYLALRRVR  638



>ref|XP_010275138.1| PREDICTED: ABC transporter G family member 14 [Nelumbo nucifera]
Length=654

 Score =   485 bits (1248),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 284/625 (45%), Positives = 404/625 (65%), Gaps = 55/625 (9%)
 Frame = -2

Query  2452  RSIPAEPTFPIYLKFTEVSYKIVIK--------GVTFSEEKDILNGISGAVDPGEVLALM  2297
             RS+     FPI LKF EV YK+ ++        G   S EK ILNGI+G V PGE+LA++
Sbjct  35    RSVLRLALFPITLKFEEVVYKVKLEQKESCCWGGKWSSREKTILNGITGMVCPGEILAML  94

Query  2296  GPSGCGKTTLLSLLGGRIRDPSAGSITYNQHPYSKLLKSRIGFVTQDDILFPHLTVKETL  2117
             GPSG GKTTLL+ LGGR+    +G ITYN  P+S ++K R GFV QDD+L+PHLTV ETL
Sbjct  95    GPSGSGKTTLLTALGGRLNGKLSGKITYNGQPFSGVIKRRTGFVAQDDVLYPHLTVTETL  154

Query  2116  IYAARLRLPRTLTKEEKDKRAMDVIYELGLDRCQDTMIGGSFVRGVSGGERKRVCIGNEI  1937
             ++ A LRLP TLT++EK + A  VI ELGL RC+++MIGG   RG+SGGE+KRV IG E+
Sbjct  155   VFTALLRLPNTLTRDEKAQHAEHVIVELGLTRCRNSMIGGPLFRGISGGEKKRVSIGQEM  214

Query  1936  IINPSLLFLDEPTSGLDSTTALRIVDILHEIAKAGKTVITTIHQPSSRLFHkfdklille  1757
             +INPSLL LDEPTSGLDSTTA RI+  +  +A  G+TV+TTIHQPSSRL+H FDK++LL 
Sbjct  215   LINPSLLLLDEPTSGLDSTTAQRILTTVKRLASGGRTVVTTIHQPSSRLYHMFDKVVLLS  274

Query  1756  flldLANG------------------NINDVSIPSELADKV---QTWNSKEEPTRNNGKP  1640
                 + +G                   +N   +  +LA+ +       +++   + N + 
Sbjct  275   EGCPIYHGPASAALDYFSSIGFSTSVTVNPADVLLDLANGIAPDSKHVTEQGDLQANMEQ  334

Query  1639  SPAIVHEYLVGCYETRVAETEKKKLMAPLPVEE-----ELKSKVRYLKREWGASWSEQYV  1475
                 V E L+  Y+  +A T  K  +  L V       +  ++      +WG SW +Q+ 
Sbjct  335   EQKSVREALISAYDKNIA-TRLKAELCSLDVNNYGYARDASARNAAKLEQWGTSWCQQFK  393

Query  1474  LLFHRGIRERWHDYFSWLRITQVIATALILGMLWWQSGGDTP-SQMQDQAGLLFFIAVFW  1298
             +L  RG++ER ++ F+ LRI QVI+ A + G+LWW     TP S +QD+  L+FF +VFW
Sbjct  394   VLLRRGLKERRYESFNRLRIFQVISVATLGGLLWWH----TPASHLQDRIALIFFFSVFW  449

Query  1297  GFFPVFTAIFTFPQEKAMLSKERAADMYRLSAYFAARTTSdlpldlllpliflLVVYFMA  1118
             GFFP++ A+FTFPQE+ ML KER++ MYRLS+YF ART  DLP++L LP  F +++Y+M 
Sbjct  450   GFFPLYNAVFTFPQERLMLIKERSSGMYRLSSYFLARTVGDLPMELALPTAFTIIIYWMG  509

Query  1117  GLKQDASSFLLTAVTVFLCIVVAQGLGLAIGATLMDLKKATTLASVTVMTFMLAGGYFIK  938
             GLK D ++F+L+ + V   ++V+Q LGLA GA LMD+K+ATTLASVT + F++AGGY+++
Sbjct  510   GLKPDFTTFILSWLIVLYNVLVSQSLGLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQ  569

Query  937   KVPGFIVWLRDLSFNYHTFKLLLKVQYEHKTN---------------SVNGVQIDSGIKE  803
             ++P FIVWL+ LS++Y+ +K+LL VQY                    +V  V ++    +
Sbjct  570   QIPPFIVWLKYLSYSYYCYKMLLGVQYSENDYYECSEGVFCRVAEFPAVKAVGLNHLWVD  629

Query  802   VGALAAMAVSYRLLAYISLRRMKLQ  728
             V  +A M V YRL+AY++L R++++
Sbjct  630   VSIMAMMLVGYRLIAYMALHRVRVR  654



>ref|XP_004512314.1| PREDICTED: ABC transporter G family member 14-like [Cicer arietinum]
Length=661

 Score =   485 bits (1248),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 287/631 (45%), Positives = 407/631 (65%), Gaps = 65/631 (10%)
 Frame = -2

Query  2464  TKKKRSIPAEPTFPIYLKFTEVSYKIVI--KGVTF------SEEKDILNGISGAVDPGEV  2309
             T ++  +P    +PI LKF ++ YK+ +  KG T        +EK ILNGI+G V PGE+
Sbjct  42    TNEQSLVPKLIMYPITLKFEDLIYKVKLEQKGGTCWGSKWSYKEKTILNGITGVVCPGEI  101

Query  2308  LALMGPSGCGKTTLLSLLGGRIRDPSAGSITYNQHPYSKLLKSRIGFVTQDDILFPHLTV  2129
             LA++GPSG GKTTLL+ LGGR+    +G ITYN  P+S  +K R GFV QDD+L+PHLTV
Sbjct  102   LAMLGPSGSGKTTLLTALGGRLNGKLSGKITYNNQPFSGSMKRRTGFVAQDDVLYPHLTV  161

Query  2128  KETLIYAARLRLPRTLTKEEKDKRAMDVIYELGLDRCQDTMIGGSFVRGVSGGERKRVCI  1949
              ETL++ A LRLP+TLT++EK +    VI ELGL+ C+++MIGG  +RG+SGGE++RV I
Sbjct  162   TETLVFTALLRLPKTLTRDEKVEHVERVITELGLNLCRNSMIGGPLLRGISGGEKRRVSI  221

Query  1948  GNEIIINPSLLFLDEPTSGLDSTTALRIVDILHEIAKAGKTVITTIHQPSSRLFHkfdkl  1769
             G E++INPSLL LDEPTSGLDSTTALRI++ + ++A  G+TV+TTIHQPSSRL++ FDK+
Sbjct  222   GQEMLINPSLLLLDEPTSGLDSTTALRILNTIKKLASGGRTVVTTIHQPSSRLYYMFDKV  281

Query  1768  illeflldLANG------------------NINDVSIPSELADKVQTWNSKEEPTRNNG-  1646
             +LL     +  G                   +N   +  +LA+ +   +SK    ++   
Sbjct  282   VLLSEGCPIYYGPASTALDYFSSVGFSTCITVNPADLLLDLANGIAP-DSKHVTEQSEAL  340

Query  1645  KPSPAIVHEYLVGCYETRVAETEKKKLMAPLPVEEELKSKVRYLKR------EWGASWSE  1484
             +    IV E L+  Y+  +A T+ K  +  L V    K+      R      +W  SW  
Sbjct  341   EKERKIVRESLISAYDKNIA-TKLKAEVCNLEVNSYNKNTKDAFTRNQIKPEQWCTSWWY  399

Query  1483  QYVLLFHRGIRERWHDYFSWLRITQVIATALILGMLWWQSGGDTP-SQMQDQAGLLFFIA  1307
             Q+ +L  RG++ER H+ F+ LRI QVI+ A + G+LWW     TP S ++D+  LLFF A
Sbjct  400   QFTVLLQRGVKERRHEAFNRLRIFQVISVAFLGGLLWWH----TPESHLEDRTALLFFFA  455

Query  1306  VFWGFFPVFTAIFTFPQEKAMLSKERAADMYRLSAYFAARTTSdlpldlllpliflLVVY  1127
             VFWGF+P++ A+FTFPQE+ ML KER++ MYRLS+YF ART  DLPL+L LP  F++++Y
Sbjct  456   VFWGFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLARTIGDLPLELALPTAFVIILY  515

Query  1126  FMAGLKQDASSFLLTAVTVFLCIVVAQGLGLAIGATLMDLKKATTLASVTVMTFMLAGGY  947
             +M GLK D  +F+L+ + V   +VV+Q LGLA GA LM++K+ATTLASVT + F++AGGY
Sbjct  516   WMGGLKPDLVTFILSLLVVLYSVVVSQSLGLAFGAILMEVKQATTLASVTTLVFLIAGGY  575

Query  946   FIKKVPGFIVWLRDLSFNYHTFKLLLKVQYEH--------------------KTNSVNGV  827
             +I+++P FIVWL+ LS++Y+ +KLLL VQY                      K+  +N +
Sbjct  576   YIQQIPPFIVWLKYLSYSYYCYKLLLGVQYNENDYYECSKGELCKVVDFGPIKSMGLNHM  635

Query  826   QIDSGIKEVGALAAMAVSYRLLAYISLRRMK  734
              +D     V  +A M V YRL+AY +L R++
Sbjct  636   WVD-----VFIMALMLVGYRLVAYFALHRVR  661



>ref|XP_006359003.1| PREDICTED: ABC transporter G family member 9-like [Solanum tuberosum]
Length=628

 Score =   483 bits (1244),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 279/606 (46%), Positives = 382/606 (63%), Gaps = 53/606 (9%)
 Frame = -2

Query  2425  PIYLKFTEVSYKI-VIKGVTF------SEEKDILNGISGAVDPGEVLALMGPSGCGKTTL  2267
             P+ LKF  V YKI ++K   F      +EEK IL G+SG V PGE+LA++GPSG GKTTL
Sbjct  28    PVTLKFENVVYKINLVKEGCFKNSPKSNEEKIILKGVSGIVSPGEMLAILGPSGSGKTTL  87

Query  2266  LSLLGGRIRDPS-AGSITYNQHPYSKLLKSRIGFVTQDDILFPHLTVKETLIYAARLRLP  2090
             L+ LGGR+ +    G ITYN   +S  +    GFVTQDD+L+PHLTV ETL++ A LRLP
Sbjct  88    LTGLGGRLVNGHLKGVITYNNKTFSNAMNRNTGFVTQDDVLYPHLTVSETLVFTALLRLP  147

Query  2089  RTLTKEEKDKRAMDVIYELGLDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFL  1910
             +T T EEK   A  +I +LGL +C+D ++GG F+RG+SGGERKRV IG E++INPSLLFL
Sbjct  148   KTFTVEEKTAHAEAIITQLGLTKCKDIIVGGPFLRGISGGERKRVSIGQEMLINPSLLFL  207

Query  1909  DEPTSGLDSTTALRIVDILHEIAKAGKTVITTIHQPSSRLFHkfdklilleflldLANGN  1730
             DEPTSGLDSTTALRIV  L ++AK G+TV+ TIHQPSSRLF+ F K++LL     L  G 
Sbjct  208   DEPTSGLDSTTALRIVSTLRDLAKGGRTVVLTIHQPSSRLFYMFKKVLLLSEGNPLYFGR  267

Query  1729  IND-------------VSI-PSELADKVQTWNSKEEPTRNNGKP--SPAIVHEYLVGCYE  1598
               D             V++ PS+    +      ++P      P   PA + + LV  ++
Sbjct  268   GEDAMGYFSGIGFSPLVAMNPSDFLLDLSNGILSDDPRVLADTPIEDPASIKKTLVTAFK  327

Query  1597  TRVAETEKKKLMAPLPVEEELKSKVRYLKR----EWGASWSEQYVLLFHRGIRERWHDYF  1430
             T + E  K++       E ++   V  L      +W  +W +Q+ +LF RG++ER H+ F
Sbjct  328   TNLVENMKEQFQ-----ESDVHQVVEKLHEKKFTQWSNTWWQQFAVLFRRGMKERKHESF  382

Query  1429  SWLRITQVIATALILGMLWWQSGGDTPSQMQDQAGLLFFIAVFWGFFPVFTAIFTFPQEK  1250
             S L++ +V+  A + G+LWW+S     + +QDQ GL+FF   FW FFP+  AIFTFPQE+
Sbjct  383   SSLKVGEVLVVAFLCGLLWWKS-----NNIQDQVGLMFFYTDFWSFFPLLQAIFTFPQER  437

Query  1249  AMLSKERAADMYRLSAYFAARTTSdlpldlllpliflLVVYFMAGLKQDASSFLLTAVTV  1070
              ML KER++ MYRLSAYF ART  DLP++L+LP IF ++ Y+M GLK  A +F  T  ++
Sbjct  438   MMLEKERSSGMYRLSAYFMARTIGDLPMELVLPTIFTVITYWMTGLKPSALNFFSTLFSI  497

Query  1069  FLCIVVAQGLGLAIGATLMDLKKATTLASVTVMTFMLAGGYFIKKVPGFIVWLRDLSFNY  890
                ++V+QGLGLA+GA +MD + AT L SV +++F LAGGYF++ VP FI W++ +S + 
Sbjct  498   LYNVLVSQGLGLALGAMIMDQESATVLGSVIILSFTLAGGYFVQHVPWFISWIKYISISQ  557

Query  889   HTFKLLLKVQYEHKTNSVNGVQIDS------GIKEVG---------ALAAMAVSYRLLAY  755
             +T+KLLL  QY H      G+           IK +G         ALA M   YR LAY
Sbjct  558   YTYKLLLGSQYNHGETYSCGINATCLVEDFPTIKTIGIGGKGISMVALAVMFFGYRFLAY  617

Query  754   ISLRRM  737
             ++L R+
Sbjct  618   VALMRV  623



>ref|XP_008451875.1| PREDICTED: ABC transporter G family member 14 [Cucumis melo]
Length=655

 Score =   484 bits (1246),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 281/624 (45%), Positives = 394/624 (63%), Gaps = 60/624 (10%)
 Frame = -2

Query  2434  PTFPIYLKFTEVSYKIVIKGVTF---------------SEEKDILNGISGAVDPGEVLAL  2300
             P   + LKF E+ YK+ ++G                  + EK ILNG+SG V PGE+LA+
Sbjct  37    PLLTVTLKFEEIVYKVKLEGKGGSCWGGGGGSSWGAAATREKTILNGLSGVVFPGEILAM  96

Query  2299  MGPSGCGKTTLLSLLGGRIRDPSAGSITYNQHPYSKLLKSRIGFVTQDDILFPHLTVKET  2120
             +GPSG GKTTLL+ LGGR+    +G ITYN  P+    K R GFV QDD+L+PHLTV ET
Sbjct  97    LGPSGSGKTTLLTALGGRLSGKLSGKITYNGQPFCGATKRRTGFVAQDDVLYPHLTVAET  156

Query  2119  LIYAARLRLPRTLTKEEKDKRAMDVIYELGLDRCQDTMIGGSFVRGVSGGERKRVCIGNE  1940
             L++ A LRLP +LT EEK +    VI ELGL RC+++MIGG   RG+SGGE+KRV IG E
Sbjct  157   LLFTALLRLPSSLTAEEKAEAVERVISELGLTRCRNSMIGGPLFRGISGGEKKRVSIGQE  216

Query  1939  IIINPSLLFLDEPTSGLDSTTALRIVDILHEIAKAGKTVITTIHQPSSRLFHkfdklill  1760
             ++INPSLL LDEPTSGLDSTTA+RI+  +  +A  G+TV+TTIHQPSSRL+H FDK++LL
Sbjct  217   MLINPSLLLLDEPTSGLDSTTAMRIITTVKRLAAGGRTVVTTIHQPSSRLYHMFDKVVLL  276

Query  1759  eflldLANGN------------------INDVSIPSELADKVQTWNSKEEPTRNNGKPSP  1634
                  +  G+                  IN   +  +LA+ +   +        N +   
Sbjct  277   SEGSPIYYGSASNAMDYFSSIGFSTSITINPADLLLDLANGIAPDSKYANEGGENMEQEQ  336

Query  1633  AIVHEYLVGCYETRVAETEKKKLMAPLP-----VEEELKSKVRYLKREWGASWSEQYVLL  1469
               V E L+  Y+  ++ T K +L +          ++   + +  + EW  SW  Q+ +L
Sbjct  337   KSVKEALISAYDKNISSTLKAELCSLDANNFNNYAKDASKREKRSREEWCTSWWYQFRVL  396

Query  1468  FHRGIRERWHDYFSWLRITQVIATALILGMLWWQSGGDTP-SQMQDQAGLLFFIAVFWGF  1292
               RG++ER +D F+ LRI QVI+ A + G+LWW     TP S ++D+  LLFF +VFWGF
Sbjct  397   LQRGLKERRYDAFNRLRIFQVISVATLGGLLWWH----TPTSHIEDRIALLFFFSVFWGF  452

Query  1291  FPVFTAIFTFPQEKAMLSKERAADMYRLSAYFAARTTSdlpldlllpliflLVVYFMAGL  1112
             +P++ A+FTFPQE+ ML KER++ MYRLS+YF ART  DLPL+L LP  F+ ++YFM GL
Sbjct  453   YPLYNAVFTFPQERTMLIKERSSGMYRLSSYFLARTVGDLPLELALPTAFVFIIYFMGGL  512

Query  1111  KQDASSFLLTAVTVFLCIVVAQGLGLAIGATLMDLKKATTLASVTVMTFMLAGGYFIKKV  932
                 ++FLL+ + V   ++V+Q LGLA GA LMD+K+ATTLASVT + F++AGGY+I+++
Sbjct  513   DPHPTTFLLSLLVVLYSVLVSQSLGLAFGAILMDVKQATTLASVTTLVFLIAGGYYIQQI  572

Query  931   PGFIVWLRDLSFNYHTFKLLLKVQYEHKTN----------------SVNGVQIDSGIKEV  800
             P FIVWL+ LS++Y+ +KLLL VQY HK +                +V  V +D    +V
Sbjct  573   PPFIVWLKYLSYSYYCYKLLLGVQY-HKGDVYECGKGEFCRVVDFPAVKSVGLDRLWVDV  631

Query  799   GALAAMAVSYRLLAYISLRRMKLQ  728
               +A M + YRL+AY++L R++L+
Sbjct  632   CIMAIMLIGYRLIAYLALHRVRLR  655



>ref|XP_010262410.1| PREDICTED: ABC transporter G family member 21-like [Nelumbo nucifera]
Length=685

 Score =   485 bits (1249),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 290/645 (45%), Positives = 412/645 (64%), Gaps = 52/645 (8%)
 Frame = -2

Query  2530  PDESADSKPFSDDENPEDLEAGTKKKRSIPAEPTFPIYLKFTEVSYKIVIK---GVTFS-  2363
             P  S++  P  +D+ PE L+A    + S+      PI LKF +VSY I IK   G  FS 
Sbjct  39    PALSSNVSPSLEDQMPEQLQAAMGGQCSLLRGSLRPITLKFEDVSYSIKIKKSGGCWFSA  98

Query  2362  -----EEKDILNGISGAVDPGEVLALMGPSGCGKTTLLSLLGGRIRDPSAGSITYNQHPY  2198
                   E+ ILNG++G V PG++LA++GPSG GKTTLL+ L GR+    +GSITYN H +
Sbjct  99    PEPKPSERTILNGVTGVVQPGDLLAMLGPSGSGKTTLLTALAGRLPGKFSGSITYNGHTF  158

Query  2197  SKLLKSRIGFVTQDDILFPHLTVKETLIYAARLRLPRTLTKEEKDKRAMDVIYELGLDRC  2018
             S  +K +IGFV+QDD+L+PHLTV ETL YAA LRLP  LT+EEK ++A  VI ELGL RC
Sbjct  159   SGSIKRKIGFVSQDDVLYPHLTVLETLTYAALLRLPNKLTREEKVEQAELVIVELGLTRC  218

Query  2017  QDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILHEIAK  1838
             +++++GG  +RGVSGGERKRV IG E+++NPSLL LDEPTSGLDSTTA RIV  L  +A+
Sbjct  219   RNSVVGGPLLRGVSGGERKRVSIGQEMLVNPSLLLLDEPTSGLDSTTAQRIVTTLQGLAR  278

Query  1837  AGKTVITTIHQPSSRLFHkfdklilleflldLANGN-------------------INDVS  1715
             +G+TV+ TIHQPSSRL+  FDKL++L     + +G+                   +N   
Sbjct  279   SGRTVVATIHQPSSRLYRMFDKLVVLSDGCPIYSGSASRALEYFVSIGYMPGVNLVNPAD  338

Query  1714  IPSELADKVQTWNSKEEPTRNNGK---PSPAIVHEYLVGCYETRVAETEKKKLMAPLPVE  1544
                +LA  V     + +   N+G+      + + ++L+  Y+  +    K +L       
Sbjct  339   FLLDLATGVAPETRQRDQQNNHGQLEHEDQSSMKQHLISSYKRNLYNVLKAELCQTPQAP  398

Query  1543  EEL---KSKVRYLKREWGASWSEQYVLLFHRGIRERWHDYFSWLRITQVIATALILGMLW  1373
             E     K+  R  + +W  SW EQ+ +L  R ++ER H+ +S LRI QV++ +++ G+LW
Sbjct  399   EAFVAGKTSSRCPEEQWMTSWWEQFRVLLSRSLKERKHESYSGLRIFQVMSVSILSGLLW  458

Query  1372  WQSGGDTPSQMQDQAGLLFFIAVFWGFFPVFTAIFTFPQEKAMLSKERAADMYRLSAYFA  1193
             W S     S +QDQ GLLFF ++FWGFFP+F AIFTFPQE+ ML KER++ MYRLS+Y+ 
Sbjct  459   WHS---DISHVQDQVGLLFFFSIFWGFFPMFNAIFTFPQERPMLIKERSSGMYRLSSYYF  515

Query  1192  ARTTSdlpldlllpliflLVVYFMAGLKQDASSFLLTAVTVFLCIVVAQGLGLAIGATLM  1013
             AR   DLP++L+LP IF+ V Y+M GL+    +F+LT + +   ++V+QGLGLA+GA +M
Sbjct  516   ARMAGDLPMELVLPTIFVAVTYWMGGLRPSPVNFMLTLLIILYNVLVSQGLGLALGAIVM  575

Query  1012  DLKKATTLASVTVMTFMLAGGYFIKKVPGFIVWLRDLSFNYHTFKLLLKVQYEHKT----  845
             ++K+ATTLASVT++ F+LAGGY+I+ +P FI WL+  SF+++ +KLL+  QY        
Sbjct  576   EVKQATTLASVTMLVFLLAGGYYIQHIPPFIAWLKYSSFSHYCYKLLVGAQYTEDDYYNC  635

Query  844   -----------NSVNGVQIDSGIKEVGALAAMAVSYRLLAYISLR  743
                         SV  + +D+   +V AL  M V YRL+AY++LR
Sbjct  636   GTGVHCKIMDFPSVKSLGLDNKRLDVAALTVMLVGYRLMAYVALR  680



>ref|XP_010542511.1| PREDICTED: ABC transporter G family member 26 isoform X1 [Tarenaya 
hassleriana]
Length=689

 Score =   484 bits (1247),  Expect = 5e-154, Method: Compositional matrix adjust.
 Identities = 273/652 (42%), Positives = 387/652 (59%), Gaps = 89/652 (14%)
 Frame = -2

Query  2479  DLEAGTKKKRSIPAEPTFPIYLKFTEVSYKI-------------VIKGVTFSEEKD----  2351
             D+E       +  A P  PI+LKF +V YK+             ++  V    + D    
Sbjct  48    DIEEEDHASNAHEARP-LPIFLKFEDVEYKVRNSQAASTNPAKAMVSKVAAQMKSDPDGY  106

Query  2350  --ILNGISGAVDPGEVLALMGPSGCGKTTLLSLLGGRIRDPSAGSITYNQHPYSKLLKSR  2177
               IL GI+G+  PGE+LALMGPSG GKTTLL ++GGR+ D   G ITYN  PYS  +K R
Sbjct  107   KHILKGITGSTGPGEILALMGPSGSGKTTLLKIMGGRLTDNVKGKITYNDIPYSPAVKRR  166

Query  2176  IGFVTQDDILFPHLTVKETLIYAARLRLPRTLTKEEKDKRAMDVIYELGLDRCQDTMIGG  1997
             IGFVTQDD+L P LTV+ETL +AA LRLP ++++ +K  +   ++ ELGL+RC+ T +GG
Sbjct  167   IGFVTQDDVLLPQLTVEETLAFAAFLRLPSSMSRRQKYAKIETIVKELGLERCRHTRVGG  226

Query  1996  SFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILHEIAKAGKTVIT  1817
              FV+G+SGGERKR  I  EI+++PSLLFLDEPTSGLDST+A +++ IL  +AKAG+TVIT
Sbjct  227   GFVKGISGGERKRTSIAYEILVDPSLLFLDEPTSGLDSTSATKLLHILQGVAKAGRTVIT  286

Query  1816  TIHQPSSRLFHk--------------------------------fdklilleflldLANG  1733
             TIHQPSSR+FH                                    +   EFLLDLA G
Sbjct  287   TIHQPSSRMFHMFDKLLLISEGYPVFYGKARETMEYFSSLRIVPEIAMNPAEFLLDLATG  346

Query  1732  NINDVSIPSE-LADKVQTWNSKEEPTRNNGKPSPAIVHEYLVGCYETRVAETEK----KK  1568
              + D+S+P E LA K    +S+E            IV +YL   Y+T +   EK    + 
Sbjct  347   QVTDISLPDELLAAKASHPDSEE-----------VIVKQYLQLMYKTDLEPKEKEENHRN  395

Query  1567  LMAPLPVEEELKSKVRYLKREWGASWSEQYVLLFHRGIRERWHDYFSWLRITQVIATALI  1388
              MAP    E L+  ++ +K++W  SW +Q++++F R  RER  DYF  LR  Q +  A++
Sbjct  396   RMAP----EHLQRAIQ-VKKDWTLSWWDQFLIIFRRTFRERCRDYFDKLRFVQALGIAVL  450

Query  1387  LGMLWWQSGGDTPSQMQDQAGLLFFIAVFWGFFPVFTAIFTFPQEKAMLSKERAADMYRL  1208
             LG+LWW+S  DT + ++DQ GL+F+I +FW    +F A++ FP EK  + KER ADMYRL
Sbjct  451   LGLLWWKSKTDTEAHLRDQVGLMFYICIFWTSSSIFGAVYVFPFEKIYIVKERKADMYRL  510

Query  1207  SAYFAARTTSdlpldlllpliflLVVYFMAGLKQDASSFLLTAVTVFLCIVVAQGLGLAI  1028
             S Y+   T  D+   +  P  F+++VYFMAG ++    FL T  T+ L  + +QG G  +
Sbjct  511   SVYYVCSTLCDMVAHVFYPTFFMIIVYFMAGFRRTVPCFLFTLFTILLIAITSQGAGEFL  570

Query  1027  GATLMDLKKATTLASVTVMTFMLAGGYFIKKVPGFIVWLRDLSFNYHTFKLLLKVQYE--  854
             GA+++ +K A  +AS+ +M F+L GGY+++ +P F+ WL+ LSF ++ F+LLLKVQY   
Sbjct  571   GASVLSIKSAGMIASLVLMLFLLTGGYYVQHIPKFMQWLKYLSFMHYGFRLLLKVQYSGD  630

Query  853   --------------HKTNSVNGVQIDSGIKEVGALAAMAVSYRLLAYISLRR  740
                             ++S + V ++ G +E+  L AMA  YRL AY SLR+
Sbjct  631   HLYECGSKDGCKKLQSSSSFDTVNLNGGFQELWFLLAMAFGYRLCAYFSLRK  682



>ref|XP_008349497.1| PREDICTED: ABC transporter G family member 26-like [Malus domestica]
Length=688

 Score =   484 bits (1246),  Expect = 9e-154, Method: Compositional matrix adjust.
 Identities = 268/628 (43%), Positives = 375/628 (60%), Gaps = 76/628 (12%)
 Frame = -2

Query  2428  FPIYLKFTEVSYKI--------VIKGVTFS---------EEKDILNGISGAVDPGEVLAL  2300
              PI+LKF +V +K+         +K +              K+IL GI+G++ PGE+LAL
Sbjct  65    LPIFLKFEDVEFKVRNSKASSNTVKAMVSKVASQLNMEHNYKEILKGITGSIGPGEILAL  124

Query  2299  MGPSGCGKTTLLSLLGGRIRDPSAGSITYNQHPYSKLLKSRIGFVTQDDILFPHLTVKET  2120
             MGPSG GKTTLL ++GGR+ D   G +TYN   YS  LK RIGFVTQDD+LFP LTV+ET
Sbjct  125   MGPSGSGKTTLLKVIGGRLLDNVKGKVTYNDIRYSPALKRRIGFVTQDDVLFPQLTVEET  184

Query  2119  LIYAARLRLPRTLTKEEKDKRAMDVIYELGLDRCQDTMIGGSFVRGVSGGERKRVCIGNE  1940
             L++AA LRLP T+T++EK  R   ++ ELGL+RC+ T +GG F++G+SGGERKR  IG E
Sbjct  185   LVFAAFLRLPSTMTRQEKYARVEMIVKELGLERCRHTRVGGGFIKGISGGERKRTSIGYE  244

Query  1939  IIINPSLLFLDEPTSGLDSTTALRIVDILHEIAKAGKTVITTIHQPSSRLFHkfdklill  1760
             ++++PSLL LDEPTSGLDST+A R++ +L  +AK G+T+ITTIHQPSSR+FH FDKL+L+
Sbjct  245   VLVDPSLLLLDEPTSGLDSTSANRLLLVLQGLAKGGRTIITTIHQPSSRMFHTFDKLLLI  304

Query  1759  ef--------------------------------lldLANGNINDVSIPSELADKVQTWN  1676
                                               L+DLA G +N +S+P +L        
Sbjct  305   SEGYPVYYGKAXESLEYFSSLRFIPEIPMNPAEFLIDLATGQVNGISVPEDLL-------  357

Query  1675  SKEEPTRNNGKPSPAIVHEYLVGCYETRVAETEKKKLMAPLPVEEELKSKVRYLKREWGA  1496
                 P       S   V +YL   Y+T +   EK++      + E L+  ++  K++W  
Sbjct  358   ---VPQEQGTLDSEKAVVKYLQLKYKTLLETKEKEENHRATKIPEHLRVAIQ-AKKDWTI  413

Query  1495  SWSEQYVLLFHRGIRERWHDYFSWLRITQVIATALILGMLWWQSGGDTPSQMQDQAGLLF  1316
             +W EQ+ +LF R  RER  DYF  LR+ Q +  A++LG+LWW+S  DT +Q++DQ GLLF
Sbjct  414   TWWEQFTILFKRTFRERCRDYFDKLRLIQAVGVAILLGLLWWKSNTDTEAQLRDQVGLLF  473

Query  1315  FIAVFWGFFPVFTAIFTFPQEKAMLSKERAADMYRLSAYFAARTTSdlpldlllpliflL  1136
             +I +FW    +F A++ FP EK  L KER ADMYRLS Y+   T  D+   +L P  F+ 
Sbjct  474   YICIFWTSSSIFGAVYVFPFEKVFLVKERKADMYRLSVYYVCSTLCDMTAHVLYPTFFMA  533

Query  1135  VVYFMAGLKQDASSFLLTAVTVFLCIVVAQGLGLAIGATLMDLKKATTLASVTVMTFMLA  956
             +VYFMAG  +    F  T   + L  V +QG G   G+ ++ +++A  +AS+ +M F+L 
Sbjct  534   IVYFMAGFIRTVPCFFYTLXAILLVAVTSQGAGELFGSLVLSIRRAGMVASLVLMMFLLT  593

Query  955   GGYFIKKVPGFIVWLRDLSFNYHTFKLLLKVQYE----------------HKTNSVNGVQ  824
             GGY+++ +P FI WL+ LSF Y+ F+LLLKVQY                   + S + V 
Sbjct  594   GGYYVQHIPKFIQWLKYLSFMYYGFRLLLKVQYSGDKLYECESKGGCRKLQSSPSFDTVN  653

Query  823   IDSGIKEVGALAAMAVSYRLLAYISLRR  740
             +D  + EV  L AMAV YR+ AY  LRR
Sbjct  654   LDGDMNEVWILLAMAVGYRICAYFCLRR  681



>ref|XP_004297158.1| PREDICTED: ABC transporter G family member 21-like [Fragaria 
vesca subsp. vesca]
Length=694

 Score =   484 bits (1246),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 293/649 (45%), Positives = 408/649 (63%), Gaps = 56/649 (9%)
 Frame = -2

Query  2530  PDESADSKPFSDDENPEDLEAGTKKKRSIPAEPTFPIYLKFTEVSYKIVI---KGVTFS-  2363
             P     S+  + D+ PE    GT  + S+  E   P+ LKF +V+Y I +   KG   S 
Sbjct  44    PGSINGSQRLAPDDMPEQPHPGTPHRASVLRESLRPVTLKFEDVTYSIKLEPTKGSCVSS  103

Query  2362  -----EEKDILNGISGAVDPGEVLALMGPSGCGKTTLLSLLGGRIRDPSAGSITYNQHPY  2198
                  + +++LNG+SG V PGE+LA++GPSG GKTTLL+ LGGR+     G +TYN   +
Sbjct  104   YNEPKQTRNLLNGVSGIVRPGELLAMLGPSGSGKTTLLTALGGRLPGKITGKVTYNGQHF  163

Query  2197  SKLLKSRIGFVTQDDILFPHLTVKETLIYAARLRLPRTLTKEEKDKRAMDVIYELGLDRC  2018
             S  +K   GFVTQDD+L+PHLTV ETL Y A LRLP+ L+K+EK ++A  V+ ELGL RC
Sbjct  164   SSSMKHNTGFVTQDDVLYPHLTVLETLTYTALLRLPKQLSKQEKKEQAETVMVELGLTRC  223

Query  2017  QDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILHEIAK  1838
             +D+++GG  +RGVSGGERKRV IG E+++NPSLLFLDEPTSGLDSTTA RIV  L  +A+
Sbjct  224   RDSVVGGPLLRGVSGGERKRVSIGQEMLVNPSLLFLDEPTSGLDSTTAQRIVATLRRLAR  283

Query  1837  AGKTVITTIHQPSSRLFHkfdklilleflldLANGN-------------------INDVS  1715
              G+TVITTIHQPSSRL+  FDK+++L     + +G+                   IN   
Sbjct  284   GGRTVITTIHQPSSRLYRMFDKVVVLSDGCPIYSGHAGRVMEYFGSIGYEVGFNFINPAD  343

Query  1714  IPSELADKVQTWNSKEEPTRNNGK----PSPAIVHEYLVGCYETRV-----AETEK-KKL  1565
                +LA+ +     +++    NG+           ++LV  Y+  +     AE ++ +K 
Sbjct  344   FLLDLANGIAPDAKQDDQLEYNGRLDHHEEQNSTKQFLVSSYKKNLHPALKAEIQQSQKD  403

Query  1564  MAPLPVEEELKSKVRYLKREWGASWSEQYVLLFHRGIRERWHDYFSWLRITQVIATALIL  1385
              A +       S       EW  SW EQ+++L  RG++ER H+ FS LRI QV++ A++ 
Sbjct  404   PAVVSSSSRTLSSRGSRDYEWTTSWWEQFIVLLQRGLKERKHESFSGLRIFQVMSVAILS  463

Query  1384  GMLWWQSGGDTPSQMQDQAGLLFFIAVFWGFFPVFTAIFTFPQEKAMLSKERAADMYRLS  1205
             G+ WW S  DT S +QDQ GLLFF ++FWGFFP+F AIF FP E+ ML KER++ MYRLS
Sbjct  464   GLCWWHS--DT-SHLQDQVGLLFFFSIFWGFFPLFNAIFAFPMERPMLRKERSSGMYRLS  520

Query  1204  AYFAARTTSdlpldlllpliflLVVYFMAGLKQDASSFLLTAVTVFLCIVVAQGLGLAIG  1025
             +Y+ ART  DLP++L+LP +F+ V Y+M GLK    ++ LT   V   ++V+QGLGLA+G
Sbjct  521   SYYFARTVGDLPMELVLPTVFVTVAYWMGGLKPSLVTYGLTLFIVLFNVLVSQGLGLALG  580

Query  1024  ATLMDLKKATTLASVTVMTFMLAGGYFIKKVPGFIVWLRDLSFNYHTFKLLLKVQYEHKT  845
             A LMD+K+ TTLASVT++ F+L GGY+I+ +PGFI WL+ +SF+++ +KLLL VQY  K 
Sbjct  581   AILMDVKQGTTLASVTMLVFLLVGGYYIQHMPGFIAWLKYISFSHYCYKLLLGVQYSVKE  640

Query  844   ---------------NSVNGVQIDSGIKEVGALAAMAVSYRLLAYISLR  743
                             +V  V +D    +V AL  M V YR+LAY++LR
Sbjct  641   VYECDLGVRCRVIDYPAVKFVGLDGLWSDVAALGVMLVGYRVLAYVALR  689



>gb|KEH38788.1| white-brown-complex ABC transporter family protein [Medicago 
truncatula]
Length=597

 Score =   481 bits (1237),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 277/600 (46%), Positives = 386/600 (64%), Gaps = 52/600 (9%)
 Frame = -2

Query  2416  LKFTEVSYKI-VIKGVTFS-----EEKDILNGISGAVDPGEVLALMGPSGCGKTTLLSLL  2255
             ++F +V YKI   KG  F      EEK IL G++G V PGE+LA++GPSG GKTTLL+ L
Sbjct  3     MQFDDVVYKIKAKKGGLFKKNIEVEEKTILKGVTGIVQPGEMLAMLGPSGSGKTTLLTAL  62

Query  2254  GGRIRDPSAGSITYNQHPYSKLLKSRIGFVTQDDILFPHLTVKETLIYAARLRLPRTLTK  2075
             GGR+     GSITYN+ P+S ++K   GFVTQDD+L+PHLTV ETL++ A LRLP ++TK
Sbjct  63    GGRLGGKLYGSITYNEKPFSNVIKRNTGFVTQDDVLYPHLTVTETLVFTALLRLPNSVTK  122

Query  2074  EEKDKRAMDVIYELGLDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEPTS  1895
             EEK   A +VI +LGL +C+D+++G +++RGVSGGERKRV IG E++INPSLLFLDEPTS
Sbjct  123   EEKVTHAKNVIDQLGLTKCKDSIVGSAYLRGVSGGERKRVSIGQELLINPSLLFLDEPTS  182

Query  1894  GLDSTTALRIVDILHEIAKAGKTVITTIHQPSSRLFHkfdklilleflldLANGNINDVS  1715
             GLDSTTA RIV  L ++A+ G+T++ TIHQPSSRL++      +   +L LA GN+    
Sbjct  183   GLDSTTAQRIVSTLWDLARGGRTIVMTIHQPSSRLYY------MFHKVLLLAEGNVLYFG  236

Query  1714  IPSELADKVQTWNSKEEPTRN---------NGKPSPAIVHEY------LVGCYETRVAET  1580
               SE  +             N         NG  +    H++      L+  ++    E 
Sbjct  237   KGSEAIEHFTNIGYAPAMAMNPSDFLLDLANGIYTDDTNHDHTIDKQKLISAFKNNYDEQ  296

Query  1579  EKKKLMAPLPVEEELKSKVRYLKR---EWGASWSEQYVLLFHRGIRERWHDYFSWLRITQ  1409
              K +      + +   S+ R+ +    +W  SWSEQ+ +L  R ++ER ++ FS LRI Q
Sbjct  297   SKPE---HREINDSDTSQGRFQETGSGKWPTSWSEQFFVLLRRDVKERKYESFSGLRIAQ  353

Query  1408  VIATALILGMLWWQSGGDTPSQMQDQAGLLFFIAVFWGFFPVFTAIFTFPQEKAMLSKER  1229
             V+  AL+ G+LW++S     S +QDQ GLLFF+  FWGFFP+F AIFTFPQE  ML KER
Sbjct  354   VLVVALMSGLLWYKS---DMSHLQDQIGLLFFVTGFWGFFPLFQAIFTFPQELMMLEKER  410

Query  1228  AADMYRLSAYFAARTTSdlpldlllpliflLVVYFMAGLKQDASSFLLTAVTVFLCIVVA  1049
             ++ MYRLSAYF +R  +DLP++L+LP IFLL+ YFMAGLK    +F  T  ++ L ++V+
Sbjct  411   SSGMYRLSAYFISRMVADLPMELVLPTIFLLITYFMAGLKATVINFFQTLFSLLLNVLVS  470

Query  1048  QGLGLAIGATLMDLKKATTLASVTVMTFMLAGGYFIKKVPGFIVWLRDLSFNYHTFKLLL  869
             QGLGLA+GA ++D K ATTLASV ++ F+LAGG++++ VP FIVW++ +S +Y+T++L +
Sbjct  471   QGLGLALGAVVLDQKSATTLASVIMLCFLLAGGFYVQNVPKFIVWVKYVSVSYYTYQLFI  530

Query  868   KVQYEHKTN---SVNGVQIDS--GIKEVG-----------ALAAMAVSYRLLAYISLRRM  737
               QY        S     ID    IK++G           AL  M + YRL+AY +L R+
Sbjct  531   GSQYHSGDTYPCSSGQCLIDEFPPIKQIGIDLNGLGFAALALVIMLIGYRLIAYCALMRI  590



>ref|XP_007020427.1| ABC-2 type transporter family protein [Theobroma cacao]
 gb|EOY11952.1| ABC-2 type transporter family protein [Theobroma cacao]
Length=687

 Score =   484 bits (1245),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 270/630 (43%), Positives = 377/630 (60%), Gaps = 80/630 (13%)
 Frame = -2

Query  2428  FPIYLKFTEVSYKIV---------IKGVTF----------SEEKDILNGISGAVDPGEVL  2306
              PI+LKF +V YK+          +K V             + K+IL GI+G+  PGEVL
Sbjct  64    LPIFLKFEDVEYKVTNGQAACINPVKAVVSKVASQLNLEQDKYKEILKGITGSTGPGEVL  123

Query  2305  ALMGPSGCGKTTLLSLLGGRIRDPSAGSITYNQHPYSKLLKSRIGFVTQDDILFPHLTVK  2126
             ALMGPSG GKTTLL ++GGR+ D   GSITYN  PY+  LK RIGFVTQDDIL P LTV+
Sbjct  124   ALMGPSGSGKTTLLKIIGGRLTDNVKGSITYNDIPYNPALKRRIGFVTQDDILLPQLTVE  183

Query  2125  ETLIYAARLRLPRTLTKEEKDKRAMDVIYELGLDRCQDTMIGGSFVRGVSGGERKRVCIG  1946
             ETL+++A LRLP  ++ ++K  +   ++ ELGL+RC+ T IGG  V+G+SGGERKR  IG
Sbjct  184   ETLVFSAFLRLPSDMSLQQKYAKVEMIMKELGLERCRHTRIGGGLVKGISGGERKRTSIG  243

Query  1945  NEIIINPSLLFLDEPTSGLDSTTALRIVDILHEIAKAGKTVITTIHQPSSRLFHk-----  1781
              EI+++PSLL LDEPTSGLDST+A +++ IL  +AKAG+TVITTIHQPSSR+FH      
Sbjct  244   YEILVDPSLLLLDEPTSGLDSTSANKLIQILQGVAKAGRTVITTIHQPSSRMFHMFDKLL  303

Query  1780  ---------------------------fdklilleflldLANGNINDVSIPSELADKVQT  1682
                                           +   EFLLDLA G +ND+++P +L     T
Sbjct  304   LISEGYPVYCGKARESMEYFSSLRFIPEIAMNPAEFLLDLATGQVNDITLPEDLVASQGT  363

Query  1681  WNSKEEPTRNNGKPSPAIVHEYLVGCYETRVAETEKKKLMAPLPVEEELKSKVRYLKREW  1502
              +S               V +YL   Y+T +   EK++        E L+  V+ +K++W
Sbjct  364   ADSD------------GAVIKYLQLKYKTLLEPKEKEESHQCTKAPEHLRLAVQ-VKKDW  410

Query  1501  GASWSEQYVLLFHRGIRERWHDYFSWLRITQVIATALILGMLWWQSGGDTPSQMQDQAGL  1322
               +W EQ++++  R  RER  DYF  LR+ Q +  A++LG+LWW+S   T +Q++DQ GL
Sbjct  411   TMTWWEQFMIISKRTFRERRRDYFDKLRLVQSVGVAVLLGLLWWKSSAATEAQLRDQVGL  470

Query  1321  LFFIAVFWGFFPVFTAIFTFPQEKAMLSKERAADMYRLSAYFAARTTSdlpldlllplif  1142
             LF+I +FW    +F A++ FP EK  L KER ADMYRLS Y+A  T  D+   +  P  F
Sbjct  471   LFYICIFWTSSSLFGAVYVFPFEKVYLVKERKADMYRLSVYYACSTLCDMVAHVFYPTFF  530

Query  1141  lLVVYFMAGLKQDASSFLLTAVTVFLCIVVAQGLGLAIGATLMDLKKATTLASVTVMTFM  962
             +L++YFMAG K+    F LT  T+ L  V++QG G   GA ++ +K+A  +AS+ +M F+
Sbjct  531   MLILYFMAGFKRTVPCFFLTLFTILLIAVISQGAGELFGAAVLSIKRAGMIASLILMLFL  590

Query  961   LAGGYFIKKVPGFIVWLRDLSFNYHTFKLLLKVQYE----------------HKTNSVNG  830
             L GGY+++ +P F+ W++ LSF Y+ F+LLLKVQY                   + S + 
Sbjct  591   LTGGYYVQHIPKFMQWMKYLSFMYYGFRLLLKVQYSGDQLYECQSKGGCKTLQNSPSFDT  650

Query  829   VQIDSGIKEVGALAAMAVSYRLLAYISLRR  740
             V +D G++EV  L AMA+ YRL AY  L +
Sbjct  651   VNLDGGLQEVWVLLAMALGYRLCAYFCLHK  680



>ref|XP_007158067.1| hypothetical protein PHAVU_002G121200g [Phaseolus vulgaris]
 gb|ESW30061.1| hypothetical protein PHAVU_002G121200g [Phaseolus vulgaris]
Length=658

 Score =   483 bits (1242),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 283/629 (45%), Positives = 405/629 (64%), Gaps = 63/629 (10%)
 Frame = -2

Query  2464  TKKKRSIPAEPTFPIYLKFTEVSYKIVIK------GVTFS-EEKDILNGISGAVDPGEVL  2306
              ++++  P    +PI LKF E+ YK+ ++      G T++ +EK ILNGI+G V PGE+L
Sbjct  41    NEQQQPFPKLIMYPITLKFEELVYKVKLEQKGGCWGSTWTCKEKTILNGITGVVCPGEIL  100

Query  2305  ALMGPSGCGKTTLLSLLGGRIRDPSAGSITYNQHPYSKLLKSRIGFVTQDDILFPHLTVK  2126
             A++GPSG GKTTLL+ LGGR+    +G ITYN  P+S  +K R GFV QDD+L+PHLTV 
Sbjct  101   AMLGPSGSGKTTLLTALGGRLSGKLSGKITYNGQPFSGAMKRRTGFVAQDDVLYPHLTVT  160

Query  2125  ETLIYAARLRLPRTLTKEEKDKRAMDVIYELGLDRCQDTMIGGSFVRGVSGGERKRVCIG  1946
             ETL++ A LRLP +LT++EK +    VI ELGL RC+ +MIGG   RG+SGGE+KRV IG
Sbjct  161   ETLVFTALLRLPNSLTRDEKVQHVERVITELGLTRCRSSMIGGPLFRGISGGEKKRVSIG  220

Query  1945  NEIIINPSLLFLDEPTSGLDSTTALRIVDILHEIAKAGKTVITTIHQPSSRLFHkfdkli  1766
              E++INPSLL LDEPTSGLDSTTA RI++ +  +A  G+TV+TTIHQPSSRL++ FDK++
Sbjct  221   QEMLINPSLLLLDEPTSGLDSTTAQRILNTIKRLASGGRTVVTTIHQPSSRLYYMFDKVV  280

Query  1765  lleflldLANG------------------NINDVSIPSELADKVQTWNSKEEPTRNNG-K  1643
             LL     +  G                   +N   +  +LA+ +   +SK+   +N G +
Sbjct  281   LLSEGCPIYYGAASTALDYFSSVGFSTCVTVNPADLLLDLANGIAP-DSKQAAEQNEGLE  339

Query  1642  PSPAIVHEYLVGCYETRVAETEKKKLMAPLPVEEELKSKVRYLKR-----EWGASWSEQY  1478
                  V E L+  YE  +A + K ++ + L V     +K    +      +W  SW  Q+
Sbjct  340   QERKQVRESLISAYEKNIATSLKAEVCS-LEVNNHNITKDACARNSIKPEQWSTSWWHQF  398

Query  1477  VLLFHRGIRERWHDYFSWLRITQVIATALILGMLWWQSGGDTP-SQMQDQAGLLFFIAVF  1301
              +L  RG++ER ++ F+ LRI QV++ A + G+LWW     TP S ++D+  LLFF +VF
Sbjct  399   KVLLQRGVKERRYEAFNRLRIFQVVSVAFLGGLLWWH----TPESHIEDRVALLFFFSVF  454

Query  1300  WGFFPVFTAIFTFPQEKAMLSKERAADMYRLSAYFAARTTSdlpldlllpliflLVVYFM  1121
             WGF+P++ A+FTFPQE+ ML KER++ MYRLS+YF ART  DLPL+L LP  F+ ++Y+M
Sbjct  455   WGFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLARTIGDLPLELALPTAFVFIIYWM  514

Query  1120  AGLKQDASSFLLTAVTVFLCIVVAQGLGLAIGATLMDLKKATTLASVTVMTFMLAGGYFI  941
              GLK D  +F+L+ + V   +VV+Q LGLA GA LM++K+ATTLASVT + F++AGGY+I
Sbjct  515   GGLKPDPVTFILSLLVVLYSVVVSQSLGLAFGAILMEIKQATTLASVTTLVFLIAGGYYI  574

Query  940   KKVPGFIVWLRDLSFNYHTFKLLLKVQYEH--------------------KTNSVNGVQI  821
             +++P FIVWL+ LS++Y+ +KLLL VQY                      K+  +N + +
Sbjct  575   QQIPPFIVWLKYLSYSYYCYKLLLGVQYNENDYYECSKGELCKVADFPPIKSMGLNHLWV  634

Query  820   DSGIKEVGALAAMAVSYRLLAYISLRRMK  734
             D     V  +A M V YRL+AY +L R++
Sbjct  635   D-----VFIMALMLVGYRLVAYFALHRVR  658



>gb|KDO59196.1| hypothetical protein CISIN_1g044602mg [Citrus sinensis]
Length=674

 Score =   483 bits (1243),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 263/610 (43%), Positives = 379/610 (62%), Gaps = 41/610 (7%)
 Frame = -2

Query  2449  SIPAEPTFPIYLKFTEVSYKIVIKGVT----------------FSEEKD---ILNGISGA  2327
             SI  +   PI+LKF +V YK+ I                     S +KD   IL GI+G+
Sbjct  59    SIEKDRPLPIFLKFEDVEYKVRINKAASDSNPVKSVVSKVASQLSLDKDYKHILKGITGS  118

Query  2326  VDPGEVLALMGPSGCGKTTLLSLLGGRIRDPSAGSITYNQHPYSKLLKSRIGFVTQDDIL  2147
             + PGE+LALMGPSG GKTTLL ++GGR+ D   G+ITYN  PY+  LK RIGFVTQDD+L
Sbjct  119   ICPGEILALMGPSGSGKTTLLKIVGGRLTDDVKGNITYNDIPYNPALKRRIGFVTQDDVL  178

Query  2146  FPHLTVKETLIYAARLRLPRTLTKEEKDKRAMDVIYELGLDRCQDTMIGGSFVRGVSGGE  1967
              P LTV+ETL++AA LRLP  + +++K  R   ++ ELGL+RC+ T +GG F++G+SGGE
Sbjct  179   LPQLTVEETLVFAAFLRLPGNMNRQQKYARVQMILKELGLERCRHTRVGGGFIKGISGGE  238

Query  1966  RKRVCIGNEIIINPSLLFLDEPTSGLDSTTALRIVDILHEIAKAGKTVITTIHQPSSRLF  1787
             RKR  IG EI+++PSLL LDEPTSGLDST+A +++ +L ++AKAG+TVITTIHQPSSR+F
Sbjct  239   RKRTSIGYEILVDPSLLLLDEPTSGLDSTSANKLIQVLQKVAKAGRTVITTIHQPSSRMF  298

Query  1786  HkfdklilleflldLANGN------------------INDVSIPSELADKVQTWNSKEEP  1661
             H FDKL+L+     +  G                   +N      +LA    T  S  E 
Sbjct  299   HMFDKLLLISEGYPVYYGKARESMEYFSSLGFIPEIAMNPAEFLLDLATGQVTDISVPEA  358

Query  1660  TRNNGKPSPAIVHEYLVGCYETRVAETEKKKLMAPLPVEEELKSKVRYLKREWGASWSEQ  1481
                +   S + V +YL   Y+T++   EK++      + E L+  ++ +K++W  SW +Q
Sbjct  359   LSASQGASDSEVLKYLQLKYKTQLEPKEKEEHHRNKKIPEHLQLAIQ-VKKDWTLSWWDQ  417

Query  1480  YVLLFHRGIRERWHDYFSWLRITQVIATALILGMLWWQSGGDTPSQMQDQAGLLFFIAVF  1301
             + ++  R  RERW DYF  LR+ Q +  A++LG+LWW+S   T +Q++DQ GL+F+I +F
Sbjct  418   FHIISRRTFRERWRDYFDKLRLVQALGVAVVLGLLWWKSQSTTEAQLRDQVGLIFYICIF  477

Query  1300  WGFFPVFTAIFTFPQEKAMLSKERAADMYRLSAYFAARTTSdlpldlllpliflLVVYFM  1121
             W    +F A++ FP EK  L KER ADMYRLS Y+   T  D+   +  P IF+++VYFM
Sbjct  478   WTSSSIFGAVYVFPFEKIYLVKERKADMYRLSVYYVCSTLCDMVAHVFYPTIFMVIVYFM  537

Query  1120  AGLKQDASSFLLTAVTVFLCIVVAQGLGLAIGATLMDLKKATTLASVTVMTFMLAGGYFI  941
             AG K+    F LT   + L  + +QG G   GA ++ +K+A  +AS+ +M F+L GGY++
Sbjct  538   AGFKRTVPCFFLTLFAILLVAITSQGAGELFGAAVLSIKRAGMIASLILMLFLLTGGYYV  597

Query  940   KKVPGFIVWLRDLSFNYHTFKLLLK---VQYEHKTNSVNGVQIDSGIKEVGALAAMAVSY  770
             + +P F+ WL+ LSF Y+ F+LLLK    +    + S + V +  G++EV  L  MA++Y
Sbjct  598   QHIPKFMQWLKYLSFLYYGFRLLLKPRGCRNLQSSPSFDTVNLSGGLQEVWVLLGMALAY  657

Query  769   RLLAYISLRR  740
             RL AY  LR+
Sbjct  658   RLCAYFCLRK  667



>ref|XP_008347335.1| PREDICTED: ABC transporter G family member 14-like isoform X2 
[Malus domestica]
Length=755

 Score =   486 bits (1250),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 291/671 (43%), Positives = 419/671 (62%), Gaps = 67/671 (10%)
 Frame = -2

Query  2554  SFTGFSVRPDE--SADSKPFSDDENPEDLEAGTKKKRSIPAEPT----------FPIYLK  2411
             S +    +P E   +DS   +  E   ++ AG + K + PA             +PI LK
Sbjct  89    SLSSIVPKPAEYGGSDSTCATTVEGSPEMPAGNQNK-AAPATQVNSQAFLQLTLYPITLK  147

Query  2410  FTEVSYKIVI-----KGVTFSEEKDILNGISGAVDPGEVLALMGPSGCGKTTLLSLLGGR  2246
             F EV YK+ +     +  + S EK IL+GI+G V PGE+LA++GPSG GKTTLL+ LGGR
Sbjct  148   FEEVFYKVKVDQKGSRDSSRSREKSILSGITGMVXPGEILAMLGPSGSGKTTLLTALGGR  207

Query  2245  IRDPS-----AGSITYNQHPYSKLLKSRIGFVTQDDILFPHLTVKETLIYAARLRLPRTL  2081
             +   +     +G I+YN   +   +K R GFV QDD+L+PHLTV ETL++ A LRLP +L
Sbjct  208   LNHQNNSKFMSGKISYNGQSFCGAIKRRTGFVAQDDVLYPHLTVTETLVFTAMLRLPNSL  267

Query  2080  TKEEKDKRAMDVIYELGLDRCQDTMIGGSFVRGVSGGERKRVCIGNEIIINPSLLFLDEP  1901
              ++EK +    VI ELGL RC+ +MIGG   RG+SGGE+KRV IG E++INPSLL LDEP
Sbjct  268   GRDEKVQHVEHVISELGLTRCRSSMIGGPLFRGISGGEKKRVSIGQEMLINPSLLLLDEP  327

Query  1900  TSGLDSTTALRIVDILHEIAKAGKTVITTIHQPSSRLFHkfdklilleflldLANG----  1733
             TSGLDSTTA RI+  L  +A  G+T++TTIHQPSSR++H FDKL+LL     +  G    
Sbjct  328   TSGLDSTTAQRILTTLKRLASGGRTLVTTIHQPSSRIYHMFDKLVLLSEGSPIYYGPASA  387

Query  1732  ---------------NINDVSIPSELADKV--QTWNSKEEPTRNNGKPSPAIVHEYLVGC  1604
                            ++N   +  +LA+ +   + ++ E+    N +    +V + L+  
Sbjct  388   ALDYFSSIGFSTSLPSVNPADLLLDLANGIAPDSKHACEQRENTNTEQEQKMVRKALISA  447

Query  1603  YETRVAETEKKKLMAPLPVEE--ELKSKVRYLKREWGASWSEQYVLLFHRGIRERWHDYF  1430
             Y+  +    K +L A L V        +    K+ W  SW  Q+ +L  RG+RER ++ F
Sbjct  448   YDKNIYAKLKDELCAGLEVNNYNNYMKEAASAKQYWCTSWWHQFKVLLQRGLRERRYEAF  507

Query  1429  SWLRITQVIATALILGMLWWQSGGDTP-SQMQDQAGLLFFIAVFWGFFPVFTAIFTFPQE  1253
             + LRI QVI+ A + G+LWW+    TP S ++D+  LLFF +VFWGF+P++ A+FTFPQE
Sbjct  508   NRLRIFQVISVATLGGLLWWR----TPTSHIEDRIALLFFFSVFWGFYPLYNAVFTFPQE  563

Query  1252  KAMLSKERAADMYRLSAYFAARTTSdlpldlllpliflLVVYFMAGLKQDASSFLLTAVT  1073
             + ML KER++ MYRLS+YF ART  DLPL+L LP  F+L++Y+M GLK D  +F+L+ + 
Sbjct  564   RRMLIKERSSGMYRLSSYFLARTVGDLPLELALPTAFVLIIYWMGGLKPDPFTFILSLLV  623

Query  1072  VFLCIVVAQGLGLAIGATLMDLKKATTLASVTVMTFMLAGGYFIKKVPGFIVWLRDLSFN  893
             V   ++V+Q LGLAIGA LMD+K+ATTLASVT + F++AGGY+I+++P FIVWL+ LS++
Sbjct  624   VLYNVLVSQSLGLAIGAILMDIKQATTLASVTTLVFLIAGGYYIQQIPPFIVWLKYLSYS  683

Query  892   YHTFKLLLKVQYEH------------KTNSVNGVQIDSGIK----EVGALAAMAVSYRLL  761
             Y+ +KLLL VQY+             +   +  V+   G++    +V  LA M + YRLL
Sbjct  684   YYCYKLLLGVQYDEDDFYECSKGVLCRVGDLPAVKSMGGLEHLWLDVSILALMLLGYRLL  743

Query  760   AYISLRRMKLQ  728
             AY++L R++L+
Sbjct  744   AYLALHRVRLR  754



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 10047770294310