BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c24242_g1_i3 len=2070 path=[6737:0-413 2203:414-446 5636:447-579
2369:580-620 2410:621-783 2573:784-809 7804:810-885 2675:886-914
4236:915-969 4291:970-1134 2924:1135-1159 2949:1160-1212
3002:1213-1337 3127:1338-1582 3372:1583-1612 4722:1613-1835
4945:1836-1858 4968:1859-2069]

Length=2070
                                                                      Score     E

ref|XP_002272745.1|  PREDICTED: F-box/kelch-repeat protein At1g67480    608   0.0      Vitis vinifera
ref|XP_006438054.1|  hypothetical protein CICLE_v10031802mg             607   0.0      
ref|XP_006484078.1|  PREDICTED: F-box/kelch-repeat protein At1g67...    605   0.0      
gb|KDP26788.1|  hypothetical protein JCGZ_17946                         605   0.0      
emb|CDP13331.1|  unnamed protein product                                603   0.0      
ref|XP_011071214.1|  PREDICTED: F-box/kelch-repeat protein At1g67...    597   0.0      
ref|XP_007158696.1|  hypothetical protein PHAVU_002G174600g             597   0.0      
ref|XP_009771069.1|  PREDICTED: F-box/kelch-repeat protein At1g67480    590   0.0      
ref|XP_003531188.1|  PREDICTED: F-box/kelch-repeat protein At1g67...    588   0.0      
ref|XP_002514931.1|  Protein AFR, putative                              587   0.0      Ricinus communis
ref|XP_003538557.2|  PREDICTED: F-box/kelch-repeat protein At1g67...    587   0.0      
ref|XP_011086764.1|  PREDICTED: F-box/kelch-repeat protein At1g67...    587   0.0      
ref|XP_010105794.1|  F-box/kelch-repeat protein                         583   0.0      
gb|KHN24077.1|  F-box/kelch-repeat protein                              582   0.0      
ref|XP_006601756.1|  PREDICTED: uncharacterized protein LOC100500...    579   0.0      
ref|XP_007044074.1|  AFR, putative                                      578   0.0      
ref|XP_010025325.1|  PREDICTED: F-box/kelch-repeat protein At1g67480    577   0.0      
ref|XP_010250761.1|  PREDICTED: F-box/kelch-repeat protein At1g67480    576   0.0      
ref|XP_009620246.1|  PREDICTED: F-box/kelch-repeat protein At1g67480    572   0.0      
ref|XP_006376125.1|  hypothetical protein POPTR_0013s10040g             571   0.0      
ref|XP_011003970.1|  PREDICTED: F-box/kelch-repeat protein At1g67480    570   0.0      
gb|KHG24132.1|  hypothetical protein F383_07660                         568   0.0      
ref|XP_002311715.1|  kelch repeat-containing F-box family protein       565   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_007163744.1|  hypothetical protein PHAVU_001G260600g             566   0.0      
ref|XP_004502305.1|  PREDICTED: F-box/kelch-repeat protein At1g67...    565   0.0      
ref|XP_004504451.1|  PREDICTED: F-box/kelch-repeat protein At1g67...    564   0.0      
ref|XP_008340201.1|  PREDICTED: F-box/kelch-repeat protein At1g67480    563   0.0      
gb|KEH20583.1|  kelch repeat F-box protein                              560   0.0      
ref|XP_003601804.1|  F-box family protein                               559   0.0      
ref|XP_010682796.1|  PREDICTED: F-box/kelch-repeat protein At1g67480    559   0.0      
ref|XP_007223092.1|  hypothetical protein PRUPE_ppa007034mg             558   0.0      
ref|XP_006376126.1|  hypothetical protein POPTR_0013s10040g             560   0.0      
ref|XP_008222133.1|  PREDICTED: F-box/kelch-repeat protein At1g67480    556   0.0      
ref|XP_011029680.1|  PREDICTED: F-box/kelch-repeat protein At1g67...    555   0.0      
gb|KCW61966.1|  hypothetical protein EUGRSUZ_H04652                     553   0.0      
ref|XP_008806043.1|  PREDICTED: F-box/kelch-repeat protein At1g67...    552   0.0      
emb|CAN74339.1|  hypothetical protein VITISV_018334                     548   0.0      Vitis vinifera
ref|XP_008351068.1|  PREDICTED: F-box/kelch-repeat protein At1g67...    549   0.0      
ref|XP_008445494.1|  PREDICTED: F-box/kelch-repeat protein At1g67480    545   0.0      
ref|XP_002314539.1|  hypothetical protein POPTR_0010s06910g             543   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_010905202.1|  PREDICTED: F-box/kelch-repeat protein At1g67...    542   0.0      
ref|XP_004144194.1|  PREDICTED: F-box/kelch-repeat protein At1g67...    540   0.0      
gb|EYU25914.1|  hypothetical protein MIMGU_mgv1a007608mg                540   0.0      
ref|XP_010929773.1|  PREDICTED: F-box/kelch-repeat protein At1g67...    534   0.0      
gb|KHG24131.1|  hypothetical protein F383_07660                         532   0.0      
ref|XP_006438053.1|  hypothetical protein CICLE_v10031802mg             530   0.0      
ref|XP_006484079.1|  PREDICTED: F-box/kelch-repeat protein At1g67...    532   0.0      
ref|XP_009372304.1|  PREDICTED: F-box/kelch-repeat protein At1g67480    532   1e-180   
ref|XP_011041507.1|  PREDICTED: F-box/kelch-repeat protein At1g67...    531   2e-180   
ref|XP_009337499.1|  PREDICTED: F-box/kelch-repeat protein At1g67...    531   2e-180   
ref|XP_006484077.1|  PREDICTED: F-box/kelch-repeat protein At1g67...    531   2e-180   
ref|XP_006484080.1|  PREDICTED: F-box/kelch-repeat protein At1g67...    528   2e-180   
ref|XP_011014059.1|  PREDICTED: F-box/kelch-repeat protein At1g67...    530   5e-180   
ref|XP_004310065.1|  PREDICTED: F-box/kelch-repeat protein At1g67...    524   8e-178   
ref|XP_008788862.1|  PREDICTED: F-box/kelch-repeat protein At1g67...    523   2e-177   
ref|XP_006585113.1|  PREDICTED: F-box/kelch-repeat protein At1g67...    513   5e-174   
ref|XP_010531614.1|  PREDICTED: F-box/kelch-repeat protein At1g67...    498   1e-167   
ref|XP_009415115.1|  PREDICTED: F-box/kelch-repeat protein At1g67...    495   3e-166   
ref|XP_006391275.1|  hypothetical protein EUTSA_v10018729mg             492   2e-165   
ref|XP_006647277.1|  PREDICTED: F-box/kelch-repeat protein At1g67...    491   8e-165   
ref|XP_002453878.1|  hypothetical protein SORBIDRAFT_04g020510          491   9e-165   Sorghum bicolor [broomcorn]
gb|EAZ23161.1|  hypothetical protein OsJ_06846                          486   2e-163   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001046914.1|  Os02g0504900                                       487   2e-163   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004952542.1|  PREDICTED: F-box/kelch-repeat protein At1g67...    486   7e-163   
gb|EAY85972.1|  hypothetical protein OsI_07338                          485   8e-163   Oryza sativa Indica Group [Indian rice]
ref|XP_006302407.1|  hypothetical protein CARUB_v10020480mg             485   1e-162   
ref|XP_003575002.1|  PREDICTED: F-box/kelch-repeat protein At1g67...    485   1e-162   
ref|XP_009392489.1|  PREDICTED: F-box/kelch-repeat protein At1g67...    484   3e-162   
emb|CDY12647.1|  BnaA02g13150D                                          479   9e-161   
gb|AFW71520.1|  hypothetical protein ZEAMMB73_686872                    478   5e-160   
emb|CDY64883.1|  BnaC02g45970D                                          478   3e-159   
ref|XP_009127556.1|  PREDICTED: F-box/kelch-repeat protein At1g67...    476   4e-159   
ref|XP_010556158.1|  PREDICTED: F-box/kelch-repeat protein At1g67...    475   6e-159   
ref|XP_010415321.1|  PREDICTED: F-box/kelch-repeat protein At1g67...    473   3e-158   
ref|XP_010470651.1|  PREDICTED: F-box/kelch-repeat protein At1g67480    473   5e-158   
emb|CDY01812.1|  BnaC06g28520D                                          472   2e-157   
ref|NP_176915.1|  F-box/kelch-repeat protein                            471   2e-157   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010511677.1|  PREDICTED: F-box/kelch-repeat protein At1g67...    471   3e-157   
gb|AAC18788.1|  Contains similarity to beta scruin gb|Z47541 from...    473   7e-157   Arabidopsis thaliana [mouse-ear cress]
dbj|BAJ95391.1|  predicted protein                                      469   3e-156   
ref|XP_002887123.1|  kelch repeat-containing F-box family protein       468   4e-156   
ref|XP_009105286.1|  PREDICTED: F-box/kelch-repeat protein At1g67480    467   1e-155   
emb|CDM85931.1|  unnamed protein product                                467   2e-155   
gb|EMT06173.1|  hypothetical protein F775_06557                         471   2e-155   
emb|CDX96091.1|  BnaA07g26400D                                          464   2e-154   
ref|XP_004975373.1|  PREDICTED: F-box/kelch-repeat protein At1g67...    461   6e-153   
ref|NP_001052597.1|  Os04g0380300                                       455   7e-151   Oryza sativa Japonica Group [Japonica rice]
gb|EEC77152.1|  hypothetical protein OsI_15607                          453   3e-150   Oryza sativa Indica Group [Indian rice]
ref|XP_009405494.1|  PREDICTED: F-box/kelch-repeat protein At1g67...    453   4e-150   
gb|ABK25211.1|  unknown                                                 442   1e-145   Picea sitchensis
ref|XP_010044792.1|  PREDICTED: F-box/kelch-repeat protein At1g67...    437   6e-144   
dbj|BAJ93898.1|  predicted protein                                      410   3e-133   
ref|XP_002446277.1|  hypothetical protein SORBIDRAFT_06g012290          396   1e-128   Sorghum bicolor [broomcorn]
gb|EMT24396.1|  hypothetical protein F775_07758                         390   1e-126   
gb|EPS58108.1|  hypothetical protein M569_16708                         382   5e-124   
ref|XP_006848422.1|  hypothetical protein AMTR_s00013p00230800          382   2e-123   
gb|KDO36091.1|  hypothetical protein CISIN_1g028925mg                   366   4e-119   
gb|AFK43456.1|  unknown                                                 359   3e-116   
gb|AFW71518.1|  hypothetical protein ZEAMMB73_686872                    311   8e-98    
dbj|BAJ92634.1|  predicted protein                                      305   2e-95    
ref|XP_010531279.1|  PREDICTED: F-box/kelch-repeat protein At1g67...    301   8e-92    
gb|AAF99736.1|AC004557_15  F17L21.21                                    277   1e-82    Arabidopsis thaliana [mouse-ear cress]
ref|NP_174062.1|  putative F-box/kelch-repeat protein                   274   1e-81    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010531269.1|  PREDICTED: putative F-box/kelch-repeat prote...    271   2e-80    
ref|XP_002890727.1|  kelch repeat-containing F-box family protein       269   1e-79    
ref|XP_010460498.1|  PREDICTED: putative F-box/kelch-repeat prote...    267   8e-79    
ref|XP_010499220.1|  PREDICTED: putative F-box/kelch-repeat prote...    266   2e-78    
ref|XP_010478076.1|  PREDICTED: putative F-box/kelch-repeat prote...    265   3e-78    
emb|CDY11811.1|  BnaC03g57670D                                          263   3e-77    
emb|CDX90085.1|  BnaA08g18990D                                          261   8e-77    
ref|XP_009109805.1|  PREDICTED: putative F-box/kelch-repeat prote...    259   3e-76    
ref|XP_006415764.1|  hypothetical protein EUTSA_v10008094mg             259   4e-76    
gb|KFK44492.1|  hypothetical protein AALP_AA1G264200                    255   1e-74    
ref|NP_001237992.1|  uncharacterized protein LOC100500176               235   9e-70    
gb|KDO37508.1|  hypothetical protein CISIN_1g030026mg                   232   8e-68    
emb|CDY15708.1|  BnaA07g08790D                                          231   2e-65    
ref|XP_009103029.1|  PREDICTED: putative F-box/kelch-repeat prote...    231   2e-65    
emb|CDY03923.1|  BnaC07g11480D                                          226   1e-63    
ref|XP_009102975.1|  PREDICTED: putative F-box/kelch-repeat prote...    224   5e-63    
emb|CDY64382.1|  BnaA07g36630D                                          219   3e-61    
ref|XP_009109832.1|  PREDICTED: putative F-box/kelch-repeat prote...    217   2e-60    
emb|CDY66857.1|  BnaA08g31090D                                          214   4e-59    
ref|XP_009109833.1|  PREDICTED: putative F-box/kelch-repeat prote...    211   3e-58    
emb|CDY36145.1|  BnaA08g19030D                                          211   5e-58    
ref|XP_009109831.1|  PREDICTED: putative F-box/kelch-repeat prote...    210   1e-57    
ref|XP_009102973.1|  PREDICTED: putative F-box/kelch-repeat prote...    198   1e-52    
ref|XP_009110748.1|  PREDICTED: putative F-box/kelch-repeat prote...    193   7e-52    
emb|CDY52247.1|  BnaC08g20190D                                          187   7e-50    
emb|CDY70128.1|  BnaCnng66850D                                          184   2e-48    
emb|CDY46415.1|  BnaA08g20150D                                          189   9e-47    
ref|NP_001183399.1|  uncharacterized protein LOC100501817               163   8e-43    
gb|AEW07498.1|  hypothetical protein 0_2970_01                          161   1e-42    
gb|AFG48226.1|  hypothetical protein 0_2970_01                          160   3e-42    
emb|CDY15707.1|  BnaA07g08780D                                          160   5e-40    
ref|XP_004243661.1|  PREDICTED: F-box/kelch-repeat protein At1g16250    139   3e-32    
ref|XP_002315479.2|  kelch repeat-containing F-box family protein       139   3e-32    Populus trichocarpa [western balsam poplar]
ref|XP_004150018.1|  PREDICTED: F-box/kelch-repeat protein At1g55...    139   3e-32    
ref|XP_010999347.1|  PREDICTED: F-box/kelch-repeat protein At1g16250    139   3e-32    
ref|XP_008444019.1|  PREDICTED: F-box/kelch-repeat protein At1g55...    138   1e-31    
ref|XP_006353737.1|  PREDICTED: F-box/kelch-repeat protein At1g16...    137   1e-31    
ref|XP_006353736.1|  PREDICTED: F-box/kelch-repeat protein At1g16...    137   1e-31    
ref|XP_001771339.1|  predicted protein                                  136   1e-31    
ref|XP_002446276.1|  hypothetical protein SORBIDRAFT_06g012285          127   3e-31    Sorghum bicolor [broomcorn]
gb|ABK27009.1|  unknown                                                 134   8e-31    Picea sitchensis
ref|XP_006836439.1|  hypothetical protein AMTR_s00092p00167170          135   1e-30    
ref|XP_009793941.1|  PREDICTED: F-box/kelch-repeat protein At1g16250    134   1e-30    
ref|XP_008776459.1|  PREDICTED: F-box/kelch-repeat protein At1g16250    133   3e-30    
ref|XP_003609293.1|  F-box/kelch-repeat protein                         134   3e-30    
ref|XP_004508512.1|  PREDICTED: F-box/kelch-repeat protein At1g55...    133   5e-30    
ref|XP_009368827.1|  PREDICTED: F-box/kelch-repeat protein At1g55...    132   9e-30    
ref|XP_007030057.1|  Galactose oxidase/kelch repeat superfamily p...    131   1e-29    
ref|XP_010688026.1|  PREDICTED: F-box/kelch-repeat protein At1g55...    132   1e-29    
ref|XP_008385738.1|  PREDICTED: F-box/kelch-repeat protein At1g55...    132   1e-29    
ref|XP_010688025.1|  PREDICTED: F-box/kelch-repeat protein At1g55...    132   2e-29    
ref|XP_008337311.1|  PREDICTED: F-box/kelch-repeat protein At1g55...    131   2e-29    
gb|KHG06592.1|  hypothetical protein F383_00121                         130   2e-29    
ref|XP_009590459.1|  PREDICTED: F-box/kelch-repeat protein At1g16250    130   3e-29    
ref|XP_006450966.1|  hypothetical protein CICLE_v10008382mg             130   4e-29    
ref|XP_003554163.1|  PREDICTED: F-box/kelch-repeat protein At1g55...    130   4e-29    
ref|XP_011036156.1|  PREDICTED: F-box/kelch-repeat protein SKIP4        129   4e-29    
ref|XP_009407660.1|  PREDICTED: F-box/kelch-repeat protein At1g55...    130   4e-29    
gb|KHN23508.1|  F-box/kelch-repeat protein                              130   5e-29    
ref|XP_011084133.1|  PREDICTED: F-box/kelch-repeat protein At1g55...    130   5e-29    
ref|XP_010024901.1|  PREDICTED: F-box/kelch-repeat protein At1g16250    129   6e-29    
ref|XP_010268086.1|  PREDICTED: F-box/kelch-repeat protein At1g16...    129   6e-29    
ref|XP_003524553.1|  PREDICTED: F-box/kelch-repeat protein At1g55...    130   6e-29    
ref|XP_010268084.1|  PREDICTED: F-box/kelch-repeat protein At1g16...    129   7e-29    
ref|XP_001777680.1|  predicted protein                                  130   7e-29    
ref|XP_010268085.1|  PREDICTED: F-box/kelch-repeat protein At1g16...    129   8e-29    
ref|XP_008222313.1|  PREDICTED: F-box/kelch-repeat protein At1g16250    129   9e-29    
ref|XP_010268083.1|  PREDICTED: F-box/kelch-repeat protein At1g16...    129   9e-29    
ref|XP_007013402.1|  Galactose oxidase/kelch repeat superfamily p...    129   1e-28    
ref|XP_007013397.1|  Galactose oxidase/kelch repeat superfamily p...    129   1e-28    
ref|XP_004287344.1|  PREDICTED: F-box/kelch-repeat protein At1g55...    129   1e-28    
ref|XP_010093732.1|  F-box/kelch-repeat protein                         129   1e-28    
ref|XP_010250049.1|  PREDICTED: F-box/kelch-repeat protein At1g55...    128   2e-28    
ref|XP_007202129.1|  hypothetical protein PRUPE_ppa006078mg             128   2e-28    
ref|XP_002524469.1|  Protein AFR, putative                              129   2e-28    Ricinus communis
ref|XP_010250048.1|  PREDICTED: F-box/kelch-repeat protein At1g55...    128   2e-28    
ref|XP_008242752.1|  PREDICTED: F-box/kelch-repeat protein At1g55...    128   2e-28    
gb|ADE77005.1|  unknown                                                 127   2e-28    
gb|KHG22975.1|  hypothetical protein F383_01278                         128   2e-28    
ref|XP_009353463.1|  PREDICTED: F-box/kelch-repeat protein At1g16...    127   2e-28    
ref|XP_008360210.1|  PREDICTED: F-box/kelch-repeat protein At1g16...    127   3e-28    
emb|CDY54825.1|  BnaC03g75770D                                          123   3e-28    
emb|CDY02451.1|  BnaA08g00580D                                          127   3e-28    
ref|XP_006392663.1|  hypothetical protein EUTSA_v10011496mg             127   4e-28    
ref|XP_004297025.1|  PREDICTED: F-box/kelch-repeat protein At1g16...    127   4e-28    
emb|CDY10574.1|  BnaC03g70400D                                          127   5e-28    
ref|XP_003529944.1|  PREDICTED: F-box/kelch-repeat protein SKIP4-...    126   6e-28    
ref|XP_009106890.1|  PREDICTED: F-box/kelch-repeat protein At1g55270    126   1e-27    
ref|XP_010534884.1|  PREDICTED: F-box/kelch-repeat protein At1g55270    126   1e-27    
emb|CDX96822.1|  BnaA08g23650D                                          126   1e-27    
ref|XP_008784962.1|  PREDICTED: F-box/kelch-repeat protein At1g55...    126   1e-27    
ref|XP_008369571.1|  PREDICTED: F-box/kelch-repeat protein At1g16250    125   1e-27    
gb|EPS58278.1|  hypothetical protein M569_16536                         126   1e-27    
ref|XP_002986564.1|  hypothetical protein SELMODRAFT_124089             125   1e-27    
ref|XP_002527061.1|  Protein AFR, putative                              125   2e-27    Ricinus communis
gb|KDP32382.1|  hypothetical protein JCGZ_13307                         125   2e-27    
gb|KDP26940.1|  hypothetical protein JCGZ_21033                         125   2e-27    
ref|XP_002519349.1|  conserved hypothetical protein                     125   2e-27    Ricinus communis
ref|XP_004306790.1|  PREDICTED: F-box/kelch-repeat protein SKIP4-...    124   2e-27    
ref|XP_010656414.1|  PREDICTED: F-box/kelch-repeat protein At1g55...    125   2e-27    
ref|XP_010925234.1|  PREDICTED: F-box/kelch-repeat protein At1g55...    125   2e-27    
ref|XP_002965242.1|  hypothetical protein SELMODRAFT_83069              125   2e-27    
ref|XP_002894497.1|  kelch repeat-containing F-box family protein       125   2e-27    
ref|XP_010925232.1|  PREDICTED: F-box/kelch-repeat protein At1g55...    125   2e-27    
ref|NP_564684.1|  Galactose oxidase/kelch repeat superfamily protein    125   2e-27    Arabidopsis thaliana [mouse-ear cress]
gb|KHG30540.1|  hypothetical protein F383_04954                         125   3e-27    
ref|XP_008803430.1|  PREDICTED: F-box/kelch-repeat protein At1g55...    125   3e-27    
gb|KHG22974.1|  hypothetical protein F383_01277                         125   3e-27    
ref|XP_010257584.1|  PREDICTED: F-box/kelch-repeat protein At1g55...    125   3e-27    
ref|XP_010243433.1|  PREDICTED: F-box/kelch-repeat protein At1g55...    125   3e-27    
ref|XP_007014726.1|  Galactose oxidase/kelch repeat superfamily p...    124   4e-27    
ref|XP_004228650.1|  PREDICTED: F-box/kelch-repeat protein At1g55270    124   4e-27    
ref|XP_006445823.1|  hypothetical protein CICLE_v10015292mg             124   4e-27    
ref|XP_009388524.1|  PREDICTED: F-box/kelch-repeat protein At1g55...    124   4e-27    
gb|AAG51566.1|AC027034_12  unknown protein; 58496-60308                 125   4e-27    Arabidopsis thaliana [mouse-ear cress]
ref|XP_001770303.1|  predicted protein                                  123   5e-27    
ref|XP_009603914.1|  PREDICTED: F-box/kelch-repeat protein At1g55...    124   5e-27    
ref|XP_009785252.1|  PREDICTED: F-box/kelch-repeat protein At1g55...    124   6e-27    
emb|CDY08233.1|  BnaA05g13860D                                          124   6e-27    
ref|XP_009359825.1|  PREDICTED: F-box/kelch-repeat protein At1g16...    123   6e-27    
ref|XP_009603913.1|  PREDICTED: F-box/kelch-repeat protein At1g55...    124   6e-27    
emb|CDY26117.1|  BnaC06g10790D                                          124   6e-27    
ref|XP_009103742.1|  PREDICTED: F-box/kelch-repeat protein At1g55...    124   6e-27    
ref|XP_009785251.1|  PREDICTED: F-box/kelch-repeat protein At1g55...    124   7e-27    
ref|XP_004955477.1|  PREDICTED: F-box/kelch-repeat protein At1g30...    123   7e-27    
emb|CAN63498.1|  hypothetical protein VITISV_011673                     124   7e-27    Vitis vinifera
ref|XP_006307563.1|  hypothetical protein CARUB_v10009185mg             124   7e-27    
ref|XP_006354154.1|  PREDICTED: F-box/kelch-repeat protein At1g55...    124   7e-27    
ref|XP_009110457.1|  PREDICTED: F-box/kelch-repeat protein At1g16250    123   8e-27    
ref|XP_007223086.1|  hypothetical protein PRUPE_ppa007000mg             122   1e-26    
ref|XP_010047816.1|  PREDICTED: F-box/kelch-repeat protein At1g55...    123   1e-26    
ref|XP_010914885.1|  PREDICTED: F-box/kelch-repeat protein At1g55...    123   1e-26    
ref|XP_002320790.1|  SKP1 INTERACTING PARTNER 4 family protein          122   1e-26    Populus trichocarpa [western balsam poplar]
ref|XP_011025173.1|  PREDICTED: F-box/kelch-repeat protein At1g55270    123   1e-26    
ref|XP_010032898.1|  PREDICTED: F-box/kelch-repeat protein At1g55270    123   1e-26    
ref|XP_007154990.1|  hypothetical protein PHAVU_003G163600g             122   2e-26    
ref|XP_010932959.1|  PREDICTED: F-box/kelch-repeat protein At1g55270    122   2e-26    
ref|XP_008812564.1|  PREDICTED: F-box/kelch-repeat protein At1g30...    122   2e-26    
emb|CDP17358.1|  unnamed protein product                                122   2e-26    
ref|XP_011089119.1|  PREDICTED: F-box/kelch-repeat protein At1g55270    122   2e-26    
emb|CDX83957.1|  BnaC08g16880D                                          125   2e-26    
ref|XP_008232912.1|  PREDICTED: F-box/kelch-repeat protein SKIP4-...    121   3e-26    
ref|XP_008778886.1|  PREDICTED: F-box/kelch-repeat protein At1g55...    122   3e-26    
ref|XP_008232906.1|  PREDICTED: LOW QUALITY PROTEIN: F-box/kelch-...    121   3e-26    
ref|XP_004983256.1|  PREDICTED: F-box/kelch-repeat protein SKIP30...    120   3e-26    
ref|XP_010024899.1|  PREDICTED: F-box/kelch-repeat protein At1g16...    121   3e-26    
ref|XP_010024895.1|  PREDICTED: F-box/kelch-repeat protein At1g16...    121   4e-26    
emb|CDY33062.1|  BnaC06g07170D                                          121   4e-26    
ref|XP_002304010.2|  kelch repeat-containing F-box family protein       121   4e-26    Populus trichocarpa [western balsam poplar]
gb|KHG13775.1|  hypothetical protein F383_18309                         121   5e-26    
ref|XP_010480054.1|  PREDICTED: F-box/kelch-repeat protein At1g55270    121   5e-26    
gb|KDP28026.1|  hypothetical protein JCGZ_19106                         120   5e-26    
ref|XP_010535866.1|  PREDICTED: F-box/kelch-repeat protein At1g55...    121   5e-26    
ref|XP_010462371.1|  PREDICTED: F-box/kelch-repeat protein At1g55...    121   5e-26    
ref|XP_010537835.1|  PREDICTED: F-box/kelch-repeat protein At1g16250    120   5e-26    
ref|XP_006416837.1|  hypothetical protein EUTSA_v10007905mg             120   6e-26    
ref|XP_011010684.1|  PREDICTED: F-box/kelch-repeat protein At1g55...    120   6e-26    
ref|XP_008384436.1|  PREDICTED: LOW QUALITY PROTEIN: F-box/kelch-...    120   6e-26    
ref|XP_008393946.1|  PREDICTED: F-box protein AFR                       120   6e-26    
emb|CDY03921.1|  BnaC07g11460D                                          120   6e-26    
ref|XP_011010683.1|  PREDICTED: F-box/kelch-repeat protein At1g55...    121   6e-26    
ref|XP_001755270.1|  predicted protein                                  120   7e-26    
ref|XP_002297645.2|  hypothetical protein POPTR_0001s04530g             120   7e-26    Populus trichocarpa [western balsam poplar]
ref|XP_002978427.1|  hypothetical protein SELMODRAFT_443893             120   8e-26    
ref|XP_007218188.1|  hypothetical protein PRUPE_ppa007693mg             119   9e-26    
gb|KHN14372.1|  F-box/kelch-repeat protein                              120   9e-26    
ref|XP_002970270.1|  hypothetical protein SELMODRAFT_411144             120   9e-26    
ref|XP_006827639.1|  hypothetical protein AMTR_s00009p00247110          119   9e-26    
emb|CDP08823.1|  unnamed protein product                                120   9e-26    
ref|XP_010277223.1|  PREDICTED: F-box/kelch-repeat protein SKIP4        119   9e-26    
ref|XP_002274480.2|  PREDICTED: F-box/kelch-repeat protein SKIP4        119   1e-25    Vitis vinifera
ref|XP_006657454.1|  PREDICTED: F-box/kelch-repeat protein At1g30...    120   1e-25    
ref|XP_007051821.1|  SKP1 interacting partner 4                         119   1e-25    
ref|XP_011048245.1|  PREDICTED: F-box/kelch-repeat protein At1g55...    120   1e-25    
ref|XP_002969820.1|  hypothetical protein SELMODRAFT_92722              119   1e-25    
ref|XP_010055142.1|  PREDICTED: F-box/kelch-repeat protein SKIP4-...    119   1e-25    
ref|XP_011048244.1|  PREDICTED: F-box/kelch-repeat protein At1g55...    120   1e-25    
ref|XP_006299791.1|  hypothetical protein CARUB_v10015987mg             119   1e-25    
ref|XP_003528858.1|  PREDICTED: F-box/kelch-repeat protein SKIP4-...    119   1e-25    
ref|XP_004486017.1|  PREDICTED: F-box/kelch-repeat protein At1g30...    119   1e-25    
gb|EPS62277.1|  hypothetical protein M569_12514                         119   1e-25    
ref|XP_010501139.1|  PREDICTED: F-box/kelch-repeat protein At1g55...    120   2e-25    
ref|XP_002283484.1|  PREDICTED: F-box/kelch-repeat protein At1g55270    120   2e-25    
ref|XP_010055141.1|  PREDICTED: F-box/kelch-repeat protein SKIP4-...    119   2e-25    
gb|EMS47889.1|  F-box/kelch-repeat protein SKIP30                       118   2e-25    
ref|XP_002985156.1|  hypothetical protein SELMODRAFT_122034             119   2e-25    
ref|XP_007025062.1|  Galactose oxidase/kelch repeat superfamily p...    119   2e-25    
emb|CBI28177.3|  unnamed protein product                                119   2e-25    
ref|XP_010101133.1|  F-box/kelch-repeat protein                         119   2e-25    
ref|XP_009364116.1|  PREDICTED: F-box/kelch-repeat protein At1g55...    119   2e-25    
emb|CDP10385.1|  unnamed protein product                                118   3e-25    
ref|XP_009135621.1|  PREDICTED: F-box/kelch-repeat protein SKIP30       117   3e-25    
ref|XP_008351710.1|  PREDICTED: F-box/kelch-repeat protein At1g55...    119   3e-25    
ref|XP_006661711.1|  PREDICTED: F-box/kelch-repeat protein SKIP30...    117   4e-25    
emb|CCH50979.1|  T4.18                                                  119   4e-25    
ref|XP_002890155.1|  kelch repeat-containing F-box family protein       118   4e-25    
ref|XP_009772236.1|  PREDICTED: F-box/kelch-repeat protein SKIP30...    117   4e-25    
ref|XP_009611494.1|  PREDICTED: F-box/kelch-repeat protein SKIP30...    117   4e-25    
ref|XP_010673508.1|  PREDICTED: F-box/kelch-repeat protein At1g55270    118   4e-25    
ref|XP_011032669.1|  PREDICTED: F-box/kelch-repeat protein SKIP30...    117   4e-25    
gb|ABD16044.1|  Kelch-motif containing protein                          117   4e-25    
gb|ABD16046.1|  Kelch-motif containing protein                          117   4e-25    
gb|EYU32112.1|  hypothetical protein MIMGU_mgv1a019413mg                117   4e-25    
gb|ABD16056.1|  Kelch-motif containing protein                          117   5e-25    
gb|ABD16058.1|  Kelch-motif containing protein                          117   5e-25    
ref|XP_008344671.1|  PREDICTED: F-box/kelch-repeat protein At1g55...    118   5e-25    
ref|XP_008775369.1|  PREDICTED: F-box/kelch-repeat protein At1g30...    118   5e-25    
ref|XP_008243705.1|  PREDICTED: F-box/kelch-repeat protein At1g55270    118   5e-25    
gb|ABD16057.1|  Kelch-motif containing protein                          117   5e-25    
gb|ABD16054.1|  Kelch-motif containing protein                          117   5e-25    
gb|ABD16045.1|  Kelch-motif containing protein                          117   5e-25    
ref|XP_010259784.1|  PREDICTED: F-box protein AFR-like                  117   5e-25    
ref|NP_173075.3|  F-box/kelch-repeat protein                            117   5e-25    
gb|ABD16047.1|  Kelch-motif containing protein                          117   5e-25    
gb|ABD16062.1|  Kelch-motif containing protein                          117   5e-25    
ref|XP_009388054.1|  PREDICTED: F-box/kelch-repeat protein At1g16250    117   5e-25    
gb|ABD16061.1|  Kelch-motif containing protein                          117   5e-25    
gb|ABD16060.1|  Kelch-motif containing protein                          117   5e-25    
ref|XP_010940480.1|  PREDICTED: F-box/kelch-repeat protein SKIP4        117   6e-25    
gb|ABD16065.1|  Kelch-motif containing protein                          117   6e-25    
ref|XP_009405933.1|  PREDICTED: F-box/kelch-repeat protein SKIP30       117   6e-25    
gb|EEC66927.1|  hypothetical protein OsI_33535                          118   6e-25    
gb|EYU39245.1|  hypothetical protein MIMGU_mgv1a006629mg                118   6e-25    
emb|CDX82306.1|  BnaA03g35150D                                          117   7e-25    
ref|XP_010247992.1|  PREDICTED: F-box/kelch-repeat protein At1g30090    117   7e-25    
ref|XP_008338395.1|  PREDICTED: F-box/kelch-repeat protein At5g60570    117   7e-25    
ref|XP_009605512.1|  PREDICTED: F-box/kelch-repeat protein SKIP4        117   7e-25    
gb|EYU46560.1|  hypothetical protein MIMGU_mgv1a026779mg                116   8e-25    
dbj|BAJ94540.1|  predicted protein                                      117   8e-25    
ref|NP_001064574.1|  Os10g0409900                                       117   8e-25    
gb|EAZ16045.1|  hypothetical protein OsJ_31487                          117   8e-25    
ref|XP_008779501.1|  PREDICTED: F-box/kelch-repeat protein SKIP4        117   8e-25    
ref|XP_004983160.1|  PREDICTED: F-box/kelch-repeat protein At1g55...    117   9e-25    
ref|NP_564347.1|  F-box/kelch-repeat protein                            117   9e-25    
ref|XP_010670508.1|  PREDICTED: F-box/kelch-repeat protein SKIP4 ...    116   1e-24    
dbj|BAD07929.1|  putative SKP1 interacting partner                      116   1e-24    
ref|XP_002963336.1|  hypothetical protein SELMODRAFT_405137             117   1e-24    
ref|XP_002309296.2|  kelch repeat-containing F-box family protein       117   1e-24    
gb|ACN27709.1|  unknown                                                 117   1e-24    
ref|XP_006305067.1|  hypothetical protein CARUB_v10009433mg             116   1e-24    
ref|XP_006662347.1|  PREDICTED: F-box/kelch-repeat protein At1g55...    117   1e-24    
ref|XP_009375482.1|  PREDICTED: F-box/kelch-repeat protein At1g55...    117   1e-24    
ref|XP_006341889.1|  PREDICTED: F-box/kelch-repeat protein At1g55...    117   1e-24    
ref|NP_001045669.1|  Os02g0114600                                       116   1e-24    
ref|XP_006598348.1|  PREDICTED: F-box/kelch-repeat protein At1g55...    119   1e-24    
ref|XP_007205219.1|  hypothetical protein PRUPE_ppa005930mg             117   1e-24    
ref|XP_004510793.1|  PREDICTED: F-box/kelch-repeat protein SKIP4-...    116   1e-24    
ref|XP_009349543.1|  PREDICTED: F-box/kelch-repeat protein At5g60...    116   1e-24    
ref|XP_004510794.1|  PREDICTED: F-box/kelch-repeat protein SKIP4-...    116   1e-24    
gb|KEH18864.1|  SKP1 interacting partner 4                              116   1e-24    
ref|XP_011005285.1|  PREDICTED: F-box/kelch-repeat protein At1g30090    116   2e-24    
ref|XP_003546081.1|  PREDICTED: F-box/kelch-repeat protein At1g30...    116   2e-24    
ref|XP_002974626.1|  hypothetical protein SELMODRAFT_414962             117   2e-24    
gb|ABD16071.1|  Kelch-motif containing protein                          116   2e-24    
ref|XP_010086613.1|  F-box/kelch-repeat protein SKIP30                  115   2e-24    
emb|CDY22982.1|  BnaC03g40870D                                          115   2e-24    
gb|KDO86143.1|  hypothetical protein CISIN_1g045821mg                   115   2e-24    
ref|XP_002446925.1|  hypothetical protein SORBIDRAFT_06g025030          115   2e-24    
ref|NP_001058912.1|  Os07g0153400                                       116   2e-24    
ref|XP_006445056.1|  hypothetical protein CICLE_v10020824mg             115   2e-24    
ref|XP_010941565.1|  PREDICTED: F-box/kelch-repeat protein At5g60...    116   2e-24    
ref|XP_008778046.1|  PREDICTED: F-box/kelch-repeat protein At5g60...    116   2e-24    
gb|AIZ74338.1|  F-box family protein                                    115   2e-24    
ref|XP_007135058.1|  hypothetical protein PHAVU_010G098100g             115   2e-24    
gb|EEC72343.1|  hypothetical protein OsI_05568                          115   2e-24    
ref|XP_002976330.1|  hypothetical protein SELMODRAFT_55890              115   2e-24    
ref|XP_009626412.1|  PREDICTED: F-box/kelch-repeat protein At1g55...    116   2e-24    
ref|XP_009763739.1|  PREDICTED: F-box/kelch-repeat protein At1g55...    116   2e-24    
ref|XP_002464634.1|  hypothetical protein SORBIDRAFT_01g022240          116   3e-24    
ref|XP_010098203.1|  F-box/kelch-repeat protein                         115   3e-24    
ref|XP_011089699.1|  PREDICTED: F-box/kelch-repeat protein At1g55...    115   3e-24    
ref|XP_002461470.1|  hypothetical protein SORBIDRAFT_02g003160          115   3e-24    
ref|XP_010497732.1|  PREDICTED: F-box/kelch-repeat protein At1g16...    115   3e-24    
gb|KDP37984.1|  hypothetical protein JCGZ_04627                         115   3e-24    
ref|XP_010476730.1|  PREDICTED: F-box/kelch-repeat protein At1g16...    115   3e-24    
ref|XP_010459162.1|  PREDICTED: F-box/kelch-repeat protein At1g16250    115   4e-24    
ref|XP_002300832.1|  kelch repeat-containing F-box family protein       114   4e-24    
ref|XP_004504335.1|  PREDICTED: F-box/kelch-repeat protein At1g55...    115   4e-24    
ref|XP_009419563.1|  PREDICTED: F-box/kelch-repeat protein At5g60...    115   4e-24    
ref|XP_011026143.1|  PREDICTED: F-box/kelch-repeat protein SKIP30...    114   4e-24    
ref|XP_002987314.1|  hypothetical protein SELMODRAFT_183002             115   4e-24    
ref|XP_010043736.1|  PREDICTED: F-box/kelch-repeat protein At5g60570    114   4e-24    
ref|XP_009383687.1|  PREDICTED: F-box/kelch-repeat protein At5g60...    115   4e-24    
ref|XP_008681145.1|  PREDICTED: hypothetical protein isoform X2         114   5e-24    
ref|XP_002468444.1|  hypothetical protein SORBIDRAFT_01g046015          115   5e-24    
ref|XP_002966808.1|  hypothetical protein SELMODRAFT_87207              112   5e-24    
ref|XP_002962493.1|  hypothetical protein SELMODRAFT_404324             115   5e-24    
ref|XP_003524946.1|  PREDICTED: F-box/kelch-repeat protein At1g55...    115   5e-24    
ref|XP_011089309.1|  PREDICTED: F-box/kelch-repeat protein At5g60570    114   5e-24    
ref|XP_009340415.1|  PREDICTED: F-box/kelch-repeat protein SKIP4        114   5e-24    
ref|XP_008806831.1|  PREDICTED: F-box/kelch-repeat protein At5g60...    115   6e-24    
ref|XP_006307712.1|  hypothetical protein CARUB_v10009351mg             114   6e-24    
emb|CBI16496.3|  unnamed protein product                                114   6e-24    
gb|EAZ02807.1|  hypothetical protein OsI_24933                          116   6e-24    
ref|XP_009774193.1|  PREDICTED: F-box/kelch-repeat protein SKIP4        114   6e-24    
ref|XP_009147515.1|  PREDICTED: F-box/kelch-repeat protein At1g55...    115   6e-24    
ref|XP_003531234.1|  PREDICTED: F-box/kelch-repeat protein At1g55...    115   7e-24    
ref|XP_010941194.1|  PREDICTED: F-box/kelch-repeat protein At1g30090    114   7e-24    
emb|CDY24045.1|  BnaA06g00430D                                          114   7e-24    
ref|XP_008225546.1|  PREDICTED: F-box/kelch-repeat protein At5g60570    114   8e-24    
ref|XP_007011603.1|  Galactose oxidase/kelch repeat superfamily p...    114   8e-24    
ref|XP_003593908.1|  F-box/kelch-repeat protein                         114   8e-24    
ref|XP_002893599.1|  kelch repeat-containing F-box family protein       114   9e-24    
gb|KHN47330.1|  F-box/kelch-repeat protein                              114   9e-24    
ref|XP_002894044.1|  hypothetical protein ARALYDRAFT_314194             113   9e-24    
gb|ABK93324.1|  unknown                                                 113   9e-24    
ref|XP_010686268.1|  PREDICTED: F-box/kelch-repeat protein At1g30090    114   9e-24    
ref|XP_002307595.2|  hypothetical protein POPTR_0005s23330g             113   9e-24    
ref|XP_011085241.1|  PREDICTED: F-box/kelch-repeat protein At1g30...    114   1e-23    
ref|XP_006291382.1|  hypothetical protein CARUB_v10017520mg             113   1e-23    
ref|XP_002453173.1|  hypothetical protein SORBIDRAFT_04g001090          113   1e-23    
ref|XP_002962792.1|  hypothetical protein SELMODRAFT_438121             114   1e-23    
emb|CDX81755.1|  BnaC08g38460D                                          114   1e-23    
ref|XP_006449707.1|  hypothetical protein CICLE_v10015483mg             114   1e-23    
ref|XP_006467457.1|  PREDICTED: F-box/kelch-repeat protein At1g30...    114   1e-23    
ref|XP_009394722.1|  PREDICTED: F-box/kelch-repeat protein At1g55...    114   1e-23    
ref|XP_010040100.1|  PREDICTED: F-box/kelch-repeat protein SKIP30...    113   1e-23    
ref|XP_001763146.1|  predicted protein                                  114   1e-23    
ref|XP_009394427.1|  PREDICTED: F-box/kelch-repeat protein At1g55...    114   1e-23    
ref|XP_002981948.1|  hypothetical protein SELMODRAFT_115581             113   1e-23    
gb|ACN32130.1|  unknown                                                 114   1e-23    
ref|XP_002971565.1|  hypothetical protein SELMODRAFT_95487              113   1e-23    
ref|XP_002967761.1|  hypothetical protein SELMODRAFT_88328              113   1e-23    
ref|XP_004985575.1|  PREDICTED: F-box/kelch-repeat protein At1g55...    114   1e-23    
ref|XP_009353344.1|  PREDICTED: LOW QUALITY PROTEIN: F-box protei...    114   1e-23    
ref|XP_007159398.1|  hypothetical protein PHAVU_002G235000g             114   1e-23    
ref|XP_010070188.1|  PREDICTED: F-box/kelch-repeat protein SKIP30       112   1e-23    
ref|XP_007159399.1|  hypothetical protein PHAVU_002G235000g             114   1e-23    
ref|XP_011085238.1|  PREDICTED: F-box/kelch-repeat protein At1g30...    114   1e-23    
ref|NP_001131994.1|  uncharacterized protein LOC100193397               114   1e-23    
ref|XP_002992385.1|  hypothetical protein SELMODRAFT_236511             113   1e-23    
ref|XP_002530291.1|  ubiquitin-protein ligase, putative                 113   1e-23    
ref|XP_010478381.1|  PREDICTED: F-box/kelch-repeat protein At1g30...    113   1e-23    
ref|XP_003542937.1|  PREDICTED: F-box/kelch-repeat protein At1g30...    113   1e-23    
ref|XP_009112090.1|  PREDICTED: F-box/kelch-repeat protein SKIP30...    112   2e-23    
gb|KHN22962.1|  F-box/kelch-repeat protein                              115   2e-23    
emb|CDP15791.1|  unnamed protein product                                113   2e-23    
gb|AGT16182.1|  SKP1 interacting partner                                112   2e-23    
ref|XP_003629702.1|  F-box/kelch-repeat protein                         113   2e-23    
ref|XP_009348468.1|  PREDICTED: F-box protein AFR-like                  113   2e-23    
ref|XP_004228331.1|  PREDICTED: F-box/kelch-repeat protein At1g55...    113   2e-23    
ref|XP_010259086.1|  PREDICTED: F-box/kelch-repeat protein SKIP30       112   2e-23    
emb|CDY58259.1|  BnaC01g43820D                                          112   2e-23    
ref|NP_001147489.1|  kelch motif family protein                         113   2e-23    
ref|XP_008438055.1|  PREDICTED: F-box/kelch-repeat protein SKIP4-...    112   2e-23    
ref|XP_004148788.1|  PREDICTED: F-box/kelch-repeat protein At5g60...    112   2e-23    
ref|XP_006483556.1|  PREDICTED: F-box protein AFR-like                  112   2e-23    
gb|KHG24018.1|  F-box/kelch-repeat SKIP4 -like protein                  112   2e-23    
ref|XP_002963430.1|  hypothetical protein SELMODRAFT_79476              112   3e-23    
gb|EEC70533.1|  hypothetical protein OsI_01663                          112   3e-23    
ref|XP_004294988.1|  PREDICTED: F-box/kelch-repeat protein At1g55...    113   3e-23    
gb|EMT32107.1|  hypothetical protein F775_29728                         112   3e-23    
ref|XP_004493691.1|  PREDICTED: F-box/kelch-repeat protein SKIP30...    112   3e-23    
ref|XP_007050553.1|  Galactose oxidase/kelch repeat superfamily p...    115   3e-23    
ref|NP_001064494.1|  Os10g0388200                                       112   3e-23    
gb|KGN64735.1|  hypothetical protein Csa_1G084830                       112   3e-23    
ref|XP_004166738.1|  PREDICTED: F-box/kelch-repeat protein At5g60...    112   3e-23    
ref|XP_010499524.1|  PREDICTED: F-box/kelch-repeat protein At1g30...    112   3e-23    
ref|XP_007207467.1|  hypothetical protein PRUPE_ppa006004mg             112   3e-23    
ref|XP_002982927.1|  hypothetical protein SELMODRAFT_117329             112   3e-23    
ref|XP_006339558.1|  PREDICTED: F-box/kelch-repeat protein SKIP4-...    112   4e-23    
emb|CDX99248.1|  BnaC05g33630D                                          111   4e-23    
ref|XP_004247180.1|  PREDICTED: F-box/kelch-repeat protein SKIP30       111   4e-23    
ref|XP_010920393.1|  PREDICTED: F-box/kelch-repeat protein At5g60...    112   4e-23    
ref|NP_001183046.1|  hypothetical protein                               111   4e-23    
ref|NP_001276262.1|  uncharacterized protein LOC100800954               111   4e-23    
gb|KDP21432.1|  hypothetical protein JCGZ_21903                         111   5e-23    
ref|XP_010552760.1|  PREDICTED: F-box/kelch-repeat protein SKIP30...    111   5e-23    
gb|KCW71625.1|  hypothetical protein EUGRSUZ_E00152                     110   5e-23    
gb|AGT15881.1|  F-box/kelch-repeat protein                              111   5e-23    
emb|CBI30913.3|  unnamed protein product                                112   5e-23    
ref|XP_006450183.1|  hypothetical protein CICLE_v10008681mg             111   6e-23    
ref|XP_002277472.1|  PREDICTED: F-box/kelch-repeat protein At1g30090    111   6e-23    
dbj|BAJ86797.1|  predicted protein                                      111   6e-23    
ref|XP_008219946.1|  PREDICTED: F-box protein AFR                       111   6e-23    
ref|XP_004134327.1|  PREDICTED: F-box/kelch-repeat protein SKIP4-...    111   6e-23    
gb|KEH23789.1|  kelch repeat F-box protein                              110   7e-23    
ref|XP_008791520.1|  PREDICTED: F-box/kelch-repeat protein At5g60...    111   7e-23    
ref|XP_010460786.1|  PREDICTED: F-box/kelch-repeat protein At1g30090    111   7e-23    
ref|XP_008449801.1|  PREDICTED: F-box/kelch-repeat protein At1g55270    112   7e-23    
ref|XP_006415514.1|  hypothetical protein EUTSA_v10007818mg             111   7e-23    
ref|XP_003557654.1|  PREDICTED: F-box/kelch-repeat protein At1g30090    111   7e-23    
ref|XP_002878504.1|  kelch repeat-containing F-box family protein       110   7e-23    
ref|XP_009600696.1|  PREDICTED: F-box/kelch-repeat protein At5g60570    111   8e-23    
ref|XP_010468871.1|  PREDICTED: F-box/kelch-repeat protein SKIP30...    110   8e-23    
gb|EMS59999.1|  F-box/kelch-repeat protein SKIP4                        110   8e-23    
ref|XP_010413182.1|  PREDICTED: F-box/kelch-repeat protein SKIP30       110   9e-23    
gb|AAD34677.1|AC006341_5  Contains two PF|01344 Kelch motif domains     111   9e-23    
ref|XP_003575298.1|  PREDICTED: F-box/kelch-repeat protein SKIP30       110   9e-23    
ref|XP_010679070.1|  PREDICTED: F-box/kelch-repeat protein SKIP30       110   9e-23    
ref|XP_006646779.1|  PREDICTED: F-box/kelch-repeat protein SKIP4-...    110   9e-23    
ref|XP_010413425.1|  PREDICTED: F-box/kelch-repeat protein SKIP4        110   9e-23    
ref|XP_009609743.1|  PREDICTED: F-box/kelch-repeat protein At1g30090    111   9e-23    
gb|EYU43259.1|  hypothetical protein MIMGU_mgv1a026903mg                111   9e-23    
ref|XP_006340156.1|  PREDICTED: F-box/kelch-repeat protein At5g60...    110   1e-22    
ref|XP_004142161.1|  PREDICTED: F-box/kelch-repeat protein At1g55...    111   1e-22    
ref|XP_008378156.1|  PREDICTED: F-box protein AFR-like                  110   1e-22    



>ref|XP_002272745.1| PREDICTED: F-box/kelch-repeat protein At1g67480 [Vitis vinifera]
 emb|CBI27625.3| unnamed protein product [Vitis vinifera]
Length=385

 Score =   608 bits (1567),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/386 (76%), Positives = 326/386 (84%), Gaps = 1/386 (0%)
 Frame = -1

Query  1500  MPGTNCGKKRVTELKMCFSDEMNLDNPGHSKNISYFTSSVVVDDSYSPLLPGLPDDVAKY  1321
             MPG   GKKR T+  MC S+ +  D    SK+    TS    DDSY P+LPGLPDDVAKY
Sbjct  1     MPGIVAGKKRFTQSNMCLSNSVQQDTLTLSKSNPCLTSQFA-DDSYGPILPGLPDDVAKY  59

Query  1320  CLALVPRYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWLYVLTVDADGKESHWEVL  1141
             CLALVPR  FPAMGGV+K+WRSFIRSKEFI VRKLA +LEEWLYVLT+DA+GK SHWEVL
Sbjct  60    CLALVPRSNFPAMGGVSKKWRSFIRSKEFITVRKLAGMLEEWLYVLTMDAEGKGSHWEVL  119

Query  1140  DCLGHKHHQLPQMPAPIRAGFGVAVLNAKLLVMGGYSMIDESASVSPEVFQYDSCLNSWS  961
             DCLGHKH  LP MP P++ GF V VLN KLLVM G S++  + S S +V+QYDSCLNSWS
Sbjct  120   DCLGHKHQLLPPMPGPVKTGFEVVVLNGKLLVMAGCSVVGRTGSASADVYQYDSCLNSWS  179

Query  960   KLASMNVARYDFACAEVNGMVYAVGGNGVNGESLSCAEVYDPDTNKWRVIESLRRPRWGC  781
             KLA+MNVARYDFACAEVNGMVYAVGG G +G+SLS AE+YD D +KW +IESLRRPR+GC
Sbjct  180   KLANMNVARYDFACAEVNGMVYAVGGYGADGDSLSSAEMYDADADKWILIESLRRPRYGC  239

Query  780   FGCGFEGKLYVMGGRSSFTIGNSRFVDVYNPERQSWCEMKNGCVMVTAHAVVGKKLFCIE  601
             F CGFEGKLYVMGGRSSFTIGNSRFVDVYNPER +WCEMKNG VMVTAHAV+GKKLFC+E
Sbjct  240   FACGFEGKLYVMGGRSSFTIGNSRFVDVYNPERHTWCEMKNGRVMVTAHAVLGKKLFCME  299

Query  600   WKNQRKLGIFNPEDNSWKMVGVPVTGSSSIGFRLGILDEKLLLFSLQENPTYTTLLYDPN  421
             WKNQRKL IFNPEDNSWKMV VP+TGSSSIGFR GIL+ KLLLFSL+E+P Y TLLYDP+
Sbjct  300   WKNQRKLAIFNPEDNSWKMVPVPLTGSSSIGFRFGILEGKLLLFSLEEDPGYRTLLYDPD  359

Query  420   AAAGSEWQTCEIKPSGSCLCSVTIKA  343
             AA GSEWQT EIKPSGSCLCSVTIKA
Sbjct  360   AAPGSEWQTSEIKPSGSCLCSVTIKA  385



>ref|XP_006438054.1| hypothetical protein CICLE_v10031802mg [Citrus clementina]
 ref|XP_006438055.1| hypothetical protein CICLE_v10031802mg [Citrus clementina]
 ref|XP_006438056.1| hypothetical protein CICLE_v10031802mg [Citrus clementina]
 gb|ESR51294.1| hypothetical protein CICLE_v10031802mg [Citrus clementina]
 gb|ESR51295.1| hypothetical protein CICLE_v10031802mg [Citrus clementina]
 gb|ESR51296.1| hypothetical protein CICLE_v10031802mg [Citrus clementina]
Length=385

 Score =   607 bits (1565),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/386 (76%), Positives = 327/386 (85%), Gaps = 1/386 (0%)
 Frame = -1

Query  1500  MPGTNCGKKRVTELKMCFSDEMNLDNPGHSKNISYFTSSVVVDDSYSPLLPGLPDDVAKY  1321
             MPG   GKKR+TE  MCFS    LD   HSK+    TS V  D   SPLLPGLPDDVAK 
Sbjct  1     MPGVVSGKKRITEANMCFSTLTELDKLTHSKSNPLLTSQVAFDLD-SPLLPGLPDDVAKC  59

Query  1320  CLALVPRYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWLYVLTVDADGKESHWEVL  1141
              LALVPR  FPAMG V K+WRSFIRSKEFI VRKL  LLEEWL +LT+D +GK+S WEVL
Sbjct  60    ILALVPRSNFPAMGAVCKKWRSFIRSKEFITVRKLLGLLEEWLCILTMDPEGKQSQWEVL  119

Query  1140  DCLGHKHHQLPQMPAPIRAGFGVAVLNAKLLVMGGYSMIDESASVSPEVFQYDSCLNSWS  961
             DC G++H  LP MP P++AGFGV V+N KL+VM GYS+ID +AS S +V+QYDSCLNSWS
Sbjct  120   DCFGNRHRLLPLMPGPVKAGFGVVVINGKLVVMAGYSVIDGTASASADVYQYDSCLNSWS  179

Query  960   KLASMNVARYDFACAEVNGMVYAVGGNGVNGESLSCAEVYDPDTNKWRVIESLRRPRWGC  781
             KLA+MNVARYDFACAEVNG +YAVGG G++GESLS AEVYDPDT+KW +IESLRRPRWGC
Sbjct  180   KLANMNVARYDFACAEVNGKIYAVGGYGMDGESLSSAEVYDPDTDKWNLIESLRRPRWGC  239

Query  780   FGCGFEGKLYVMGGRSSFTIGNSRFVDVYNPERQSWCEMKNGCVMVTAHAVVGKKLFCIE  601
             F C F+GKLYVMGGRSSFTIGNS+FVDVYNPER +WC+MKNGCVMVTAHAVVGKKLFC+E
Sbjct  240   FACSFDGKLYVMGGRSSFTIGNSKFVDVYNPERHTWCQMKNGCVMVTAHAVVGKKLFCME  299

Query  600   WKNQRKLGIFNPEDNSWKMVGVPVTGSSSIGFRLGILDEKLLLFSLQENPTYTTLLYDPN  421
             WKNQRKL IF+PEDNSWKMV VP+TGSSSIGFR GILD KLLLFSL+E P+Y+TLLYDPN
Sbjct  300   WKNQRKLTIFDPEDNSWKMVPVPLTGSSSIGFRFGILDGKLLLFSLEEEPSYSTLLYDPN  359

Query  420   AAAGSEWQTCEIKPSGSCLCSVTIKA  343
             AA+GSEWQT +IKPSG CLCSVTIKA
Sbjct  360   AASGSEWQTSKIKPSGLCLCSVTIKA  385



>ref|XP_006484078.1| PREDICTED: F-box/kelch-repeat protein At1g67480-like isoform 
X2 [Citrus sinensis]
Length=385

 Score =   605 bits (1561),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/386 (75%), Positives = 326/386 (84%), Gaps = 1/386 (0%)
 Frame = -1

Query  1500  MPGTNCGKKRVTELKMCFSDEMNLDNPGHSKNISYFTSSVVVDDSYSPLLPGLPDDVAKY  1321
             MPG   GKKR+TE  MCFS    LD   HSK+    TS V  D   SPLLPGLPDDVAK 
Sbjct  1     MPGVVSGKKRITEANMCFSTLTELDKLTHSKSNPLLTSQVAFDLD-SPLLPGLPDDVAKC  59

Query  1320  CLALVPRYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWLYVLTVDADGKESHWEVL  1141
              LALVPR  FPAMG V K+WRSFIRSKEFI VRKL  LLEEWL +LT+D +GK+S WEVL
Sbjct  60    ILALVPRSNFPAMGAVCKKWRSFIRSKEFITVRKLLGLLEEWLCILTMDPEGKQSQWEVL  119

Query  1140  DCLGHKHHQLPQMPAPIRAGFGVAVLNAKLLVMGGYSMIDESASVSPEVFQYDSCLNSWS  961
             DC G++H  LP MP P++ GFGV V+N KL+VM GYS+ID +AS S +V+QYDSCLNSWS
Sbjct  120   DCFGNRHRLLPLMPGPVKVGFGVVVINGKLVVMAGYSVIDGTASASADVYQYDSCLNSWS  179

Query  960   KLASMNVARYDFACAEVNGMVYAVGGNGVNGESLSCAEVYDPDTNKWRVIESLRRPRWGC  781
             KLA+MNVARYDFACAEVNG +YAVGG G++GESLS AEVYDPDT+KW +IESLRRPRWGC
Sbjct  180   KLANMNVARYDFACAEVNGKIYAVGGYGMDGESLSSAEVYDPDTDKWNLIESLRRPRWGC  239

Query  780   FGCGFEGKLYVMGGRSSFTIGNSRFVDVYNPERQSWCEMKNGCVMVTAHAVVGKKLFCIE  601
             F C F+GKLYVMGGRSSFTIGNS+FVDVYNPER +WC+MKNGCVMVTAHAVVGKKLFC+E
Sbjct  240   FACSFDGKLYVMGGRSSFTIGNSKFVDVYNPERHTWCQMKNGCVMVTAHAVVGKKLFCME  299

Query  600   WKNQRKLGIFNPEDNSWKMVGVPVTGSSSIGFRLGILDEKLLLFSLQENPTYTTLLYDPN  421
             WKNQRKL IF+PEDNSWKMV VP+TGSSSIGFR GILD KLLLFSL+E P+Y+TLLYDPN
Sbjct  300   WKNQRKLTIFDPEDNSWKMVPVPLTGSSSIGFRFGILDGKLLLFSLEEEPSYSTLLYDPN  359

Query  420   AAAGSEWQTCEIKPSGSCLCSVTIKA  343
             AA+GSEWQT +IKPSG CLCSVTIKA
Sbjct  360   AASGSEWQTSKIKPSGLCLCSVTIKA  385



>gb|KDP26788.1| hypothetical protein JCGZ_17946 [Jatropha curcas]
Length=385

 Score =   605 bits (1560),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/386 (75%), Positives = 327/386 (85%), Gaps = 1/386 (0%)
 Frame = -1

Query  1500  MPGTNCGKKRVTELKMCFSDEMNLDNPGHSKNISYFTSSVVVDDSYSPLLPGLPDDVAKY  1321
             MPG   GKKR+ E+ M F   +  D P  SK+ +   +S V +D  SP+LPGLPDDVAKY
Sbjct  1     MPGFVSGKKRLAEMDMSFFTSLAQDKPTRSKS-NLQLASQVANDVDSPILPGLPDDVAKY  59

Query  1320  CLALVPRYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWLYVLTVDADGKESHWEVL  1141
             CLALVPR  FPAMG V K+WRSFIRSKEF++VRKLA LLEEWLYVLT+D++GKESHWEVL
Sbjct  60    CLALVPRPNFPAMGAVCKKWRSFIRSKEFLVVRKLAGLLEEWLYVLTMDSEGKESHWEVL  119

Query  1140  DCLGHKHHQLPQMPAPIRAGFGVAVLNAKLLVMGGYSMIDESASVSPEVFQYDSCLNSWS  961
             DCLGH+H  LP MP  ++AGFGV VLN KL+VM GYS +D + S S +V++YDSCLNSWS
Sbjct  120   DCLGHRHQLLPSMPGSMKAGFGVVVLNGKLVVMAGYSALDGTVSASSDVYEYDSCLNSWS  179

Query  960   KLASMNVARYDFACAEVNGMVYAVGGNGVNGESLSCAEVYDPDTNKWRVIESLRRPRWGC  781
             KL +MNVARYDFACAEVNG VYAVGG G++G+SLS AE+YDPDT KW +IESLRRPRWGC
Sbjct  180   KLPNMNVARYDFACAEVNGKVYAVGGYGIDGDSLSSAEMYDPDTEKWTLIESLRRPRWGC  239

Query  780   FGCGFEGKLYVMGGRSSFTIGNSRFVDVYNPERQSWCEMKNGCVMVTAHAVVGKKLFCIE  601
             F C FEGKLYVMGGRSSFTIGNS+FVDVYNPER SWCE+KNGCVMVTAHAV+GKKLFC+E
Sbjct  240   FACSFEGKLYVMGGRSSFTIGNSKFVDVYNPERHSWCEIKNGCVMVTAHAVLGKKLFCME  299

Query  600   WKNQRKLGIFNPEDNSWKMVGVPVTGSSSIGFRLGILDEKLLLFSLQENPTYTTLLYDPN  421
             WKNQRKL IFNPEDNSWKMV VP+TGS++IGFR GILD KLLLFSL+E P Y TLLYDPN
Sbjct  300   WKNQRKLAIFNPEDNSWKMVPVPLTGSTNIGFRFGILDGKLLLFSLEETPGYRTLLYDPN  359

Query  420   AAAGSEWQTCEIKPSGSCLCSVTIKA  343
             A+ GSEWQT EIKPSG CLCSVTIKA
Sbjct  360   ASPGSEWQTSEIKPSGLCLCSVTIKA  385



>emb|CDP13331.1| unnamed protein product [Coffea canephora]
Length=385

 Score =   603 bits (1554),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/386 (77%), Positives = 321/386 (83%), Gaps = 1/386 (0%)
 Frame = -1

Query  1500  MPGTNCGKKRVTELKMCFSDEMNLDNPGHSKNISYFTSSVVVDDSYSPLLPGLPDDVAKY  1321
             MP    GKKR TEL MCFS+ +    P HSK  S  T   V D  +SP+LPGLPDDVA Y
Sbjct  1     MPNFVSGKKRATELNMCFSNALEQGAPPHSKGGSCLTLKFV-DGIHSPILPGLPDDVAMY  59

Query  1320  CLALVPRYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWLYVLTVDADGKESHWEVL  1141
             CLALVPR  FPAMG V KRWRSFI+SKEFI VRKL  +LEEWLYVLTVD+ G  SHWEV+
Sbjct  60    CLALVPRTNFPAMGVVCKRWRSFIQSKEFIRVRKLVGMLEEWLYVLTVDSQGNGSHWEVI  119

Query  1140  DCLGHKHHQLPQMPAPIRAGFGVAVLNAKLLVMGGYSMIDESASVSPEVFQYDSCLNSWS  961
             DCLG KH++ P MP   + GFGV VLN KLLV+ GY+MID + S S +V+QYDSCLNSWS
Sbjct  120   DCLGQKHNEFPPMPGCEKVGFGVVVLNGKLLVIAGYAMIDGNRSPSADVYQYDSCLNSWS  179

Query  960   KLASMNVARYDFACAEVNGMVYAVGGNGVNGESLSCAEVYDPDTNKWRVIESLRRPRWGC  781
             KLA MNVARYDFACAEVNGMVYAVGG G++GESLSCAEVYDPD +KW VIESLRRPRWGC
Sbjct  180   KLADMNVARYDFACAEVNGMVYAVGGYGMDGESLSCAEVYDPDADKWTVIESLRRPRWGC  239

Query  780   FGCGFEGKLYVMGGRSSFTIGNSRFVDVYNPERQSWCEMKNGCVMVTAHAVVGKKLFCIE  601
             F CGFEGKLYVMGGRSSFTIGNSRFVDVYN ER +WCEMKNGCVMVTAHAVVGKKLFCIE
Sbjct  240   FACGFEGKLYVMGGRSSFTIGNSRFVDVYNTERHTWCEMKNGCVMVTAHAVVGKKLFCIE  299

Query  600   WKNQRKLGIFNPEDNSWKMVGVPVTGSSSIGFRLGILDEKLLLFSLQENPTYTTLLYDPN  421
             WKNQRKL IF+ EDNSWKMV VPVTGSSSI F+ GILD KLLLFSLQE+P YTTLLYDPN
Sbjct  300   WKNQRKLAIFDSEDNSWKMVPVPVTGSSSIRFQFGILDGKLLLFSLQEDPGYTTLLYDPN  359

Query  420   AAAGSEWQTCEIKPSGSCLCSVTIKA  343
             A  GSEWQT  IKPSGSC+CSVTIKA
Sbjct  360   APPGSEWQTSVIKPSGSCMCSVTIKA  385



>ref|XP_011071214.1| PREDICTED: F-box/kelch-repeat protein At1g67480-like [Sesamum 
indicum]
 ref|XP_011071215.1| PREDICTED: F-box/kelch-repeat protein At1g67480-like [Sesamum 
indicum]
Length=384

 Score =   597 bits (1540),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/386 (74%), Positives = 329/386 (85%), Gaps = 2/386 (1%)
 Frame = -1

Query  1500  MPGTNCGKKRVTELKMCFSDEMNLDNPGHSKNISYFTSSVVVDDSYSPLLPGLPDDVAKY  1321
             MP     K+RV E  MCFS+ +  D P  +KN S   + V  DD +SP+LPGLPDDV+K+
Sbjct  1     MPAFFPVKERVQESNMCFSNLVQQDAPT-TKNKSMLIAKVS-DDFHSPILPGLPDDVSKH  58

Query  1320  CLALVPRYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWLYVLTVDADGKESHWEVL  1141
             CLALVPR +FPAMG V KRWRSFI+SK+FI+VRKLA +LEEWLYVLTVDA+G  SHW+VL
Sbjct  59    CLALVPRSHFPAMGAVCKRWRSFIKSKDFIIVRKLAGVLEEWLYVLTVDAEGNGSHWDVL  118

Query  1140  DCLGHKHHQLPQMPAPIRAGFGVAVLNAKLLVMGGYSMIDESASVSPEVFQYDSCLNSWS  961
             DCLGHKHH+LP MP P +AGFGV VL+ KLLV+ GY ++D + SVS +++QYDSCLNSWS
Sbjct  119   DCLGHKHHELPPMPGPAKAGFGVVVLHGKLLVIAGYLVVDGTGSVSTDLYQYDSCLNSWS  178

Query  960   KLASMNVARYDFACAEVNGMVYAVGGNGVNGESLSCAEVYDPDTNKWRVIESLRRPRWGC  781
             KLASMNV RY+FACAEVNG++YA GG G +GESLSCAEVYDP+++KW VIESL+RPRWGC
Sbjct  179   KLASMNVGRYNFACAEVNGLIYAAGGCGADGESLSCAEVYDPESDKWTVIESLKRPRWGC  238

Query  780   FGCGFEGKLYVMGGRSSFTIGNSRFVDVYNPERQSWCEMKNGCVMVTAHAVVGKKLFCIE  601
             F CG EGKLYVMGGRSSFTIGNSR VDVY+PER +WC+MKNGCVMVTAHA++GKKL C+E
Sbjct  239   FACGVEGKLYVMGGRSSFTIGNSRSVDVYSPERHTWCQMKNGCVMVTAHALLGKKLCCME  298

Query  600   WKNQRKLGIFNPEDNSWKMVGVPVTGSSSIGFRLGILDEKLLLFSLQENPTYTTLLYDPN  421
             WKN+RKL IFNPEDNSWKMV VPVTGSSSIGFR GILD KLLLFSLQE+P Y TLLYDPN
Sbjct  299   WKNERKLAIFNPEDNSWKMVPVPVTGSSSIGFRFGILDGKLLLFSLQEDPAYHTLLYDPN  358

Query  420   AAAGSEWQTCEIKPSGSCLCSVTIKA  343
             AA GSEWQT EIKPSG CLC+VTIKA
Sbjct  359   AAPGSEWQTSEIKPSGLCLCTVTIKA  384



>ref|XP_007158696.1| hypothetical protein PHAVU_002G174600g [Phaseolus vulgaris]
 gb|ESW30690.1| hypothetical protein PHAVU_002G174600g [Phaseolus vulgaris]
Length=389

 Score =   597 bits (1539),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/389 (75%), Positives = 324/389 (83%), Gaps = 3/389 (1%)
 Frame = -1

Query  1500  MPGTNCGKKRVTELKMCFSDEMNLDNPGHSKNISYFTSSVVVDD---SYSPLLPGLPDDV  1330
             MPG    KKR T+  MCF +  N   P  SK+     S  + DD   S  P+LPGLPDDV
Sbjct  1     MPGFVAEKKRYTDPNMCFPNLANHGKPTFSKSNRCVRSEALDDDDDDSSIPILPGLPDDV  60

Query  1329  AKYCLALVPRYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWLYVLTVDADGKESHW  1150
             +K+CLALVPR  FPAMGGV+KRWR FIRSKEFI VRKLA + EEWLY+LT  ++GK SHW
Sbjct  61    SKHCLALVPRSNFPAMGGVSKRWRGFIRSKEFITVRKLAGMHEEWLYILTAGSEGKGSHW  120

Query  1149  EVLDCLGHKHHQLPQMPAPIRAGFGVAVLNAKLLVMGGYSMIDESASVSPEVFQYDSCLN  970
             EV+DCLGH    LP MP P +AGFGVAVLN KLL+M G S ID +ASVS EV+QYDSCLN
Sbjct  121   EVMDCLGHNRRSLPPMPGPAKAGFGVAVLNGKLLIMAGCSSIDGTASVSEEVYQYDSCLN  180

Query  969   SWSKLASMNVARYDFACAEVNGMVYAVGGNGVNGESLSCAEVYDPDTNKWRVIESLRRPR  790
             SWS+L+SMNVARYDFACAEVNG+VYAVGG G NG+SLSCAEVYDPDTNKW  IESLRRPR
Sbjct  181   SWSRLSSMNVARYDFACAEVNGLVYAVGGYGANGDSLSCAEVYDPDTNKWTPIESLRRPR  240

Query  789   WGCFGCGFEGKLYVMGGRSSFTIGNSRFVDVYNPERQSWCEMKNGCVMVTAHAVVGKKLF  610
             WGCF CGFEGKLYVMGGRS+FTIGNS+FVDVYNPE+  WCEMKNGCVMVTAHAV+GKKLF
Sbjct  241   WGCFACGFEGKLYVMGGRSNFTIGNSKFVDVYNPEKHDWCEMKNGCVMVTAHAVLGKKLF  300

Query  609   CIEWKNQRKLGIFNPEDNSWKMVGVPVTGSSSIGFRLGILDEKLLLFSLQENPTYTTLLY  430
             C+EWKNQRKL IFNPEDNSWKMV VP+TGSSSIGFR GILD+KLLLFSL+E P+Y TLLY
Sbjct  301   CMEWKNQRKLAIFNPEDNSWKMVPVPLTGSSSIGFRFGILDDKLLLFSLEEEPSYRTLLY  360

Query  429   DPNAAAGSEWQTCEIKPSGSCLCSVTIKA  343
             DP+AA GSEWQT +I+PSG CLCSVTIKA
Sbjct  361   DPSAAPGSEWQTSDIRPSGLCLCSVTIKA  389



>ref|XP_009771069.1| PREDICTED: F-box/kelch-repeat protein At1g67480 [Nicotiana sylvestris]
Length=380

 Score =   590 bits (1521),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/386 (75%), Positives = 321/386 (83%), Gaps = 6/386 (2%)
 Frame = -1

Query  1500  MPGTNCGKKRVTELKMCFSDEMNLDNPGHSKNISYFTSSVVVDDSYSPLLPGLPDDVAKY  1321
             M G   G KRVT   MC +D    D+ G     S+ T + V D    P+LPGLPDDVAKY
Sbjct  1     MLGVVSGNKRVTASSMCSTDLSQQDSLGFD---SFLTYNYVSD---GPILPGLPDDVAKY  54

Query  1320  CLALVPRYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWLYVLTVDADGKESHWEVL  1141
             CLALVPR  FPAMGG  KRWRSF+RSKEFI +RKLA LLEEWLYVLTV+A+G+ES+WEV 
Sbjct  55    CLALVPRSDFPAMGGACKRWRSFLRSKEFISIRKLAGLLEEWLYVLTVNAEGRESYWEVF  114

Query  1140  DCLGHKHHQLPQMPAPIRAGFGVAVLNAKLLVMGGYSMIDESASVSPEVFQYDSCLNSWS  961
             DCLG+KHHQLPQMP  I+A FG+ VLN KLLVMGG+SMIDES SVS +V+QYDS LN WS
Sbjct  115   DCLGNKHHQLPQMPGHIKAAFGIVVLNGKLLVMGGHSMIDESGSVSTDVYQYDSYLNRWS  174

Query  960   KLASMNVARYDFACAEVNGMVYAVGGNGVNGESLSCAEVYDPDTNKWRVIESLRRPRWGC  781
             K+ASMN+ARYDFACAEVNGMVYAVGG G++GESLSCAEVYDPD +KW VIESLRRPRWGC
Sbjct  175   KMASMNMARYDFACAEVNGMVYAVGGFGIDGESLSCAEVYDPDQDKWTVIESLRRPRWGC  234

Query  780   FGCGFEGKLYVMGGRSSFTIGNSRFVDVYNPERQSWCEMKNGCVMVTAHAVVGKKLFCIE  601
             F CGF GKLY+MGGRSSFTIGNSR VDVYNP+  +W EMK GCVMVTAHAV+ KKLFCIE
Sbjct  235   FACGFGGKLYIMGGRSSFTIGNSRSVDVYNPKSHTWGEMKKGCVMVTAHAVLEKKLFCIE  294

Query  600   WKNQRKLGIFNPEDNSWKMVGVPVTGSSSIGFRLGILDEKLLLFSLQENPTYTTLLYDPN  421
             WKNQRKL IFNPEDNSWKM  VPVTGSSSI F+ GILD KLLLFSLQ NP Y TLLY+PN
Sbjct  295   WKNQRKLSIFNPEDNSWKMEPVPVTGSSSIRFQFGILDGKLLLFSLQGNPGYNTLLYNPN  354

Query  420   AAAGSEWQTCEIKPSGSCLCSVTIKA  343
             AA  S+WQTC+IKPSG+CLC+VTIKA
Sbjct  355   AAPESQWQTCDIKPSGACLCTVTIKA  380



>ref|XP_003531188.1| PREDICTED: F-box/kelch-repeat protein At1g67480-like isoform 
X1 [Glycine max]
 ref|XP_006585112.1| PREDICTED: F-box/kelch-repeat protein At1g67480-like isoform 
X2 [Glycine max]
 gb|KHN12398.1| F-box/kelch-repeat protein [Glycine soja]
Length=388

 Score =   588 bits (1517),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/388 (74%), Positives = 317/388 (82%), Gaps = 2/388 (1%)
 Frame = -1

Query  1500  MPGTNCGKKRVTELKMCFSDEMNLDNPGHSKNISYFTSSVVVDDS--YSPLLPGLPDDVA  1327
             MP     KK   E  MCF++  N D P  +KN  Y  S  + DD    SP+LPGLPDDV+
Sbjct  1     MPSFVAEKKIFVEPNMCFTNLANHDRPTLTKNNHYVRSEALDDDDDGTSPILPGLPDDVS  60

Query  1326  KYCLALVPRYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWLYVLTVDADGKESHWE  1147
             K+CLALVPR  FPAMGGV KRWR FIRSKEFI VRKLA + EEWLY+LT  ++GK SHWE
Sbjct  61    KHCLALVPRSNFPAMGGVCKRWRGFIRSKEFITVRKLAGMHEEWLYILTAGSEGKGSHWE  120

Query  1146  VLDCLGHKHHQLPQMPAPIRAGFGVAVLNAKLLVMGGYSMIDESASVSPEVFQYDSCLNS  967
             V+DCLGH    LP MP P +AGFGV VLN KLLVM GYS ID +ASVS EV+QYDSCLNS
Sbjct  121   VMDCLGHNRRSLPPMPGPAKAGFGVVVLNGKLLVMAGYSSIDGTASVSAEVYQYDSCLNS  180

Query  966   WSKLASMNVARYDFACAEVNGMVYAVGGNGVNGESLSCAEVYDPDTNKWRVIESLRRPRW  787
             WS+L+SMNVARYDFACAEV+G+VYAVGG G  G+SLS AEVYD DT+KW  IESLRRPRW
Sbjct  181   WSRLSSMNVARYDFACAEVDGLVYAVGGYGATGDSLSSAEVYDLDTDKWTPIESLRRPRW  240

Query  786   GCFGCGFEGKLYVMGGRSSFTIGNSRFVDVYNPERQSWCEMKNGCVMVTAHAVVGKKLFC  607
             GCF CGFEGKLYVMGGRSSFTIGNS+FVDVYNPE+  WCEMKNGCVMVTA+AV+ KKLFC
Sbjct  241   GCFACGFEGKLYVMGGRSSFTIGNSKFVDVYNPEKHGWCEMKNGCVMVTAYAVLEKKLFC  300

Query  606   IEWKNQRKLGIFNPEDNSWKMVGVPVTGSSSIGFRLGILDEKLLLFSLQENPTYTTLLYD  427
             +EWKNQRKL IFNPEDNSWKMV VP+TGSSSIGFR GILD KLLLFSL+E P+Y TLLYD
Sbjct  301   MEWKNQRKLAIFNPEDNSWKMVPVPLTGSSSIGFRFGILDGKLLLFSLEEEPSYKTLLYD  360

Query  426   PNAAAGSEWQTCEIKPSGSCLCSVTIKA  343
             PNAA GSEW T +I+PSG CLCSVTIKA
Sbjct  361   PNAAPGSEWHTSDIRPSGLCLCSVTIKA  388



>ref|XP_002514931.1| Protein AFR, putative [Ricinus communis]
 gb|EEF47485.1| Protein AFR, putative [Ricinus communis]
Length=391

 Score =   587 bits (1514),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/389 (74%), Positives = 322/389 (83%), Gaps = 2/389 (1%)
 Frame = -1

Query  1509  IL*MPGTNCGKKRVTELKMCFSDEMNLDNPGHSKNISYFTSSVVVDDSYSPLLPGLPDDV  1330
              L MPG   GKKR+T + M F   +      +SKN +    S V DD  SP+LPGLPDDV
Sbjct  5     FLKMPGFVGGKKRLTNMDMSFLTSLTQAKLTYSKN-NLQLPSRVADDIDSPILPGLPDDV  63

Query  1329  AKYCLALVPRYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWLYVLTVDADGKESHW  1150
             AKYCLALVPR YFP+MG V K+WRSF++SKEF++VRKLA LLEE LYVLTVD++G +S W
Sbjct  64    AKYCLALVPRPYFPSMGAVCKKWRSFMKSKEFLVVRKLAGLLEELLYVLTVDSEGTQSQW  123

Query  1149  EVLDCLGHKHHQLPQMPAPIRAGFGVAVLNAKLLVMGGYSMIDESASVSPEVFQYDSCLN  970
             EVLDCLG +  QLP MP  ++AGFGV  LN KLLVM GYS+ID + S S +V++YDSCLN
Sbjct  124   EVLDCLGQRR-QLPLMPGSVKAGFGVVALNGKLLVMAGYSVIDGTGSASADVYEYDSCLN  182

Query  969   SWSKLASMNVARYDFACAEVNGMVYAVGGNGVNGESLSCAEVYDPDTNKWRVIESLRRPR  790
             SWSKL+SMNVARYDFACAEVNG VYAVGG GV+G+SLS AE YDPDT KW +IESLRRPR
Sbjct  183   SWSKLSSMNVARYDFACAEVNGKVYAVGGYGVDGDSLSSAETYDPDTKKWTLIESLRRPR  242

Query  789   WGCFGCGFEGKLYVMGGRSSFTIGNSRFVDVYNPERQSWCEMKNGCVMVTAHAVVGKKLF  610
             WGCF C FEGKLYVMGGRSSFTIGNS+ VDVYNPER +WCEMKNGCVMVTAHAV+GKKLF
Sbjct  243   WGCFACSFEGKLYVMGGRSSFTIGNSKKVDVYNPERHTWCEMKNGCVMVTAHAVLGKKLF  302

Query  609   CIEWKNQRKLGIFNPEDNSWKMVGVPVTGSSSIGFRLGILDEKLLLFSLQENPTYTTLLY  430
             C+EWKNQRKL IFNPEDNSWKMV VPVTGSSSIGF+ GILD KLLLFSL++ P Y TLLY
Sbjct  303   CMEWKNQRKLAIFNPEDNSWKMVPVPVTGSSSIGFQFGILDGKLLLFSLEKAPDYHTLLY  362

Query  429   DPNAAAGSEWQTCEIKPSGSCLCSVTIKA  343
             DPNA+ GSEWQT EIKPSG CLCSVTIKA
Sbjct  363   DPNASPGSEWQTSEIKPSGQCLCSVTIKA  391



>ref|XP_003538557.2| PREDICTED: F-box/kelch-repeat protein At1g67480-like [Glycine 
max]
 gb|KHN44426.1| F-box/kelch-repeat protein [Glycine soja]
Length=385

 Score =   587 bits (1512),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/386 (73%), Positives = 321/386 (83%), Gaps = 1/386 (0%)
 Frame = -1

Query  1500  MPGTNCGKKRVTELKMCFSDEMNLDNPGHSKNISYFTSSVVVDDSYSPLLPGLPDDVAKY  1321
             MPG   GKKR  +  MCF++ +N D    S+N ++      ++  YSP+LPGLPDDVA+Y
Sbjct  1     MPGFTVGKKRFIQPNMCFTNLINQDKSTLSQN-NHCLFPEALNKDYSPILPGLPDDVAEY  59

Query  1320  CLALVPRYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWLYVLTVDADGKESHWEVL  1141
             CLALVPR  FPAMGGV K WRSFI+SKEF  VRKLA +LEEWLY LT D +GKES+WEV+
Sbjct  60    CLALVPRSNFPAMGGVCKIWRSFIQSKEFATVRKLAGMLEEWLYFLTTDCEGKESYWEVM  119

Query  1140  DCLGHKHHQLPQMPAPIRAGFGVAVLNAKLLVMGGYSMIDESASVSPEVFQYDSCLNSWS  961
             DCLGHK   LP MP P +AGF V VLN KLLVM GYS+I+ +A  S EV+QYDSCLNSWS
Sbjct  120   DCLGHKCRSLPPMPGPGKAGFQVVVLNGKLLVMAGYSVIEGTAFASAEVYQYDSCLNSWS  179

Query  960   KLASMNVARYDFACAEVNGMVYAVGGNGVNGESLSCAEVYDPDTNKWRVIESLRRPRWGC  781
             +L+ MNV+RYDFACAEVNG+VYAVGG GVNG+SLS AEVYDPDT+KW +IESLRRPRWGC
Sbjct  180   RLSDMNVSRYDFACAEVNGLVYAVGGYGVNGDSLSSAEVYDPDTDKWALIESLRRPRWGC  239

Query  780   FGCGFEGKLYVMGGRSSFTIGNSRFVDVYNPERQSWCEMKNGCVMVTAHAVVGKKLFCIE  601
             F CGFEGKLYVMGGRSSFTIGNS+FVD+YNPER SWCE+KNGCVMVTAHAV+GKKLFCIE
Sbjct  240   FACGFEGKLYVMGGRSSFTIGNSKFVDIYNPERHSWCEIKNGCVMVTAHAVLGKKLFCIE  299

Query  600   WKNQRKLGIFNPEDNSWKMVGVPVTGSSSIGFRLGILDEKLLLFSLQENPTYTTLLYDPN  421
             WKNQRKL IF+PEDNSWKMV VP+TGSSSIGFR GILD KLLLF L+    + TLLYDPN
Sbjct  300   WKNQRKLAIFSPEDNSWKMVPVPLTGSSSIGFRFGILDGKLLLFPLEAETAFQTLLYDPN  359

Query  420   AAAGSEWQTCEIKPSGSCLCSVTIKA  343
             A+ GSEWQTC+I+PSG CLC VTIKA
Sbjct  360   ASLGSEWQTCDIRPSGLCLCCVTIKA  385



>ref|XP_011086764.1| PREDICTED: F-box/kelch-repeat protein At1g67480-like [Sesamum 
indicum]
 ref|XP_011086765.1| PREDICTED: F-box/kelch-repeat protein At1g67480-like [Sesamum 
indicum]
Length=396

 Score =   587 bits (1513),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/397 (71%), Positives = 323/397 (81%), Gaps = 12/397 (3%)
 Frame = -1

Query  1500  MPGTNCGKKRVTELKMCFSDEMNLDNPGHSKNISYFT-----------SSVVVDDSYSPL  1354
             MPG     KR+ EL MCFSD +  D P        F+           +S V DD  SP+
Sbjct  1     MPGP-FSVKRIKELDMCFSDSVQHDTPAAKSGPILFSKVADAENGSILASKVADDWNSPI  59

Query  1353  LPGLPDDVAKYCLALVPRYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWLYVLTVD  1174
             LPGLPDDV+K+CLALVPR  FPAMG V+KRWRSFI+SKE I +R+LA +LEEWLYVL VD
Sbjct  60    LPGLPDDVSKHCLALVPRSNFPAMGAVSKRWRSFIKSKELITIRRLAGVLEEWLYVLIVD  119

Query  1173  ADGKESHWEVLDCLGHKHHQLPQMPAPIRAGFGVAVLNAKLLVMGGYSMIDESASVSPEV  994
             A+GK+SHWEVLDC GHKHH+L  MP P++AGFG+ VLN KLLV+ GYS++D + SVS +V
Sbjct  120   AEGKQSHWEVLDCFGHKHHELLPMPGPLKAGFGIVVLNGKLLVIAGYSVVDGTGSVSSDV  179

Query  993   FQYDSCLNSWSKLASMNVARYDFACAEVNGMVYAVGGNGVNGESLSCAEVYDPDTNKWRV  814
             +QYDSCLNSW KLASMNVARYDFACAEVNG VY VGG G++G SLSCAE+YDPDT+KW +
Sbjct  180   YQYDSCLNSWGKLASMNVARYDFACAEVNGKVYVVGGCGIDGVSLSCAEMYDPDTDKWTL  239

Query  813   IESLRRPRWGCFGCGFEGKLYVMGGRSSFTIGNSRFVDVYNPERQSWCEMKNGCVMVTAH  634
             IE LRRPRWGCF CGFEGKLYVMGGRSSFTIGNSRFVDVY+PE  +WC+MKNGCVMVTAH
Sbjct  240   IEDLRRPRWGCFACGFEGKLYVMGGRSSFTIGNSRFVDVYSPEDHAWCQMKNGCVMVTAH  299

Query  633   AVVGKKLFCIEWKNQRKLGIFNPEDNSWKMVGVPVTGSSSIGFRLGILDEKLLLFSLQEN  454
             AV+GKKL C+EWKN+RKL I+NP +NSWKMV VPVTGSSSIGFR GILD KLLLF +QE+
Sbjct  300   AVLGKKLCCMEWKNERKLAIYNPAENSWKMVPVPVTGSSSIGFRFGILDGKLLLFPVQED  359

Query  453   PTYTTLLYDPNAAAGSEWQTCEIKPSGSCLCSVTIKA  343
             P Y TL Y+P+AA GSEWQT EIKPSG CLCSVTIKA
Sbjct  360   PGYHTLSYNPDAAPGSEWQTSEIKPSGLCLCSVTIKA  396



>ref|XP_010105794.1| F-box/kelch-repeat protein [Morus notabilis]
 gb|EXC06147.1| F-box/kelch-repeat protein [Morus notabilis]
Length=370

 Score =   583 bits (1502),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/371 (75%), Positives = 313/371 (84%), Gaps = 1/371 (0%)
 Frame = -1

Query  1455  MCFSDEMNLDNPGHSKNISYFTSSVVVDDSYSPLLPGLPDDVAKYCLALVPRYYFPAMGG  1276
             M   D +  D    SK+ S   S +  DD  SP+LPGLPDDVAK CLALVPR  FPAMGG
Sbjct  1     MSLFDSLKQDALVRSKSYSSLASQLP-DDYNSPILPGLPDDVAKLCLALVPRSNFPAMGG  59

Query  1275  VNKRWRSFIRSKEFIMVRKLACLLEEWLYVLTVDADGKESHWEVLDCLGHKHHQLPQMPA  1096
             V K+WRSFI+SKEFI VRKLA +LEEWLY+LT+DA+ KESHWEVLDC+GHK   LP MP 
Sbjct  60    VCKKWRSFIQSKEFITVRKLAGVLEEWLYILTMDAEAKESHWEVLDCVGHKTRTLPAMPG  119

Query  1095  PIRAGFGVAVLNAKLLVMGGYSMIDESASVSPEVFQYDSCLNSWSKLASMNVARYDFACA  916
             P ++GFGV VLN KLLVM GYS+I+ +   SP+V+QYDSCLNSWSKLA MN+ARYDFACA
Sbjct  120   PSKSGFGVVVLNGKLLVMAGYSVINGAVFASPDVYQYDSCLNSWSKLADMNIARYDFACA  179

Query  915   EVNGMVYAVGGNGVNGESLSCAEVYDPDTNKWRVIESLRRPRWGCFGCGFEGKLYVMGGR  736
             EVNGMVYAVGG G++G+SL   EVY+P+ NKW +IESLRRPRWGCF CGFEGKLYVMGGR
Sbjct  180   EVNGMVYAVGGYGMDGDSLCSVEVYNPEKNKWELIESLRRPRWGCFACGFEGKLYVMGGR  239

Query  735   SSFTIGNSRFVDVYNPERQSWCEMKNGCVMVTAHAVVGKKLFCIEWKNQRKLGIFNPEDN  556
             SSFTIGNS+FVDVYNPER +WCEMK GCVMVTAHAVVGK+LFC+EWKNQRK+ IFNP DN
Sbjct  240   SSFTIGNSKFVDVYNPERHTWCEMKKGCVMVTAHAVVGKRLFCMEWKNQRKVAIFNPVDN  299

Query  555   SWKMVGVPVTGSSSIGFRLGILDEKLLLFSLQENPTYTTLLYDPNAAAGSEWQTCEIKPS  376
             SWKMV VP+TGS+SIGFR GILD KLLLFSLQE+P+Y TLLYDPNAA GSEWQT +IKPS
Sbjct  300   SWKMVQVPLTGSTSIGFRFGILDGKLLLFSLQEDPSYQTLLYDPNAAPGSEWQTSQIKPS  359

Query  375   GSCLCSVTIKA  343
             GSCLC VTIKA
Sbjct  360   GSCLCCVTIKA  370



>gb|KHN24077.1| F-box/kelch-repeat protein [Glycine soja]
Length=385

 Score =   582 bits (1499),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/386 (73%), Positives = 318/386 (82%), Gaps = 1/386 (0%)
 Frame = -1

Query  1500  MPGTNCGKKRVTELKMCFSDEMNLDNPGHSKNISYFTSSVVVDDSYSPLLPGLPDDVAKY  1321
             MPG   GKKR  +  MCF++ +N D    S+N ++      ++  YSP+LPGLPDDVA+Y
Sbjct  1     MPGFTVGKKRFIQPNMCFTNLINQDKSTLSQN-NHCLFPEALNKDYSPILPGLPDDVAEY  59

Query  1320  CLALVPRYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWLYVLTVDADGKESHWEVL  1141
             CLALVPR  FPAMG V K WRSFI+SKEF  VRKLA +LEEWLY LT D +GKESHWEV+
Sbjct  60    CLALVPRSNFPAMGVVCKGWRSFIQSKEFTTVRKLAGMLEEWLYFLTTDCEGKESHWEVM  119

Query  1140  DCLGHKHHQLPQMPAPIRAGFGVAVLNAKLLVMGGYSMIDESASVSPEVFQYDSCLNSWS  961
             DCLGHK   LP MP P +AGF V VLN KLLVM GYS+I+ +A  S EV+QYDSCLNSWS
Sbjct  120   DCLGHKCGSLPPMPGPGKAGFQVVVLNGKLLVMAGYSVIEGTAFASAEVYQYDSCLNSWS  179

Query  960   KLASMNVARYDFACAEVNGMVYAVGGNGVNGESLSCAEVYDPDTNKWRVIESLRRPRWGC  781
             +L+ M VARYDFACAEV+G+VYAVGG GVNG+SLS AEVYDPDT+ W +IESLRRPRWGC
Sbjct  180   RLSDMIVARYDFACAEVDGLVYAVGGYGVNGDSLSSAEVYDPDTDTWTLIESLRRPRWGC  239

Query  780   FGCGFEGKLYVMGGRSSFTIGNSRFVDVYNPERQSWCEMKNGCVMVTAHAVVGKKLFCIE  601
             F CGFEGKLYVMGGRSSFTIGNS+FVD+YNPER SWCE+KNGCVMVTAHAV+GKKLFCIE
Sbjct  240   FACGFEGKLYVMGGRSSFTIGNSKFVDIYNPERHSWCEIKNGCVMVTAHAVLGKKLFCIE  299

Query  600   WKNQRKLGIFNPEDNSWKMVGVPVTGSSSIGFRLGILDEKLLLFSLQENPTYTTLLYDPN  421
             WKNQRKL IF+PEDNSWKMV VP+TGSSSI FR+GILDEKLLLF L+    + TLLYDPN
Sbjct  300   WKNQRKLAIFSPEDNSWKMVPVPLTGSSSIDFRIGILDEKLLLFPLEAETAFQTLLYDPN  359

Query  420   AAAGSEWQTCEIKPSGSCLCSVTIKA  343
             A  GSEWQTC+I+PSG CLC VTIKA
Sbjct  360   ATLGSEWQTCDIRPSGLCLCCVTIKA  385



>ref|XP_006601756.1| PREDICTED: uncharacterized protein LOC100500176 isoform X1 [Glycine 
max]
Length=385

 Score =   579 bits (1492),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/387 (73%), Positives = 318/387 (82%), Gaps = 3/387 (1%)
 Frame = -1

Query  1500  MPGTNCGKKRVTELKMCFSDEMNLDNPGHSK-NISYFTSSVVVDDSYSPLLPGLPDDVAK  1324
             MPG   GKKR  +  MCF++ ++ D    S+ N   F  ++  D  YSP+LPGLPDDVA+
Sbjct  1     MPGFTVGKKRFIQPNMCFTNLIHQDKSTLSQSNHCLFPEALNKD--YSPILPGLPDDVAE  58

Query  1323  YCLALVPRYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWLYVLTVDADGKESHWEV  1144
             YCLALVPR  FPAMG V K WRSFI+SKEF  VRKLA +LEEWLY LT D +GKESHWEV
Sbjct  59    YCLALVPRSNFPAMGVVCKGWRSFIQSKEFTTVRKLAGMLEEWLYFLTTDCEGKESHWEV  118

Query  1143  LDCLGHKHHQLPQMPAPIRAGFGVAVLNAKLLVMGGYSMIDESASVSPEVFQYDSCLNSW  964
             +DCLGHK   LP MP P +AGF V VLN KLLVM GYS+I+ +A  S EV+QYDSCLNSW
Sbjct  119   MDCLGHKCRSLPPMPGPGKAGFQVVVLNGKLLVMAGYSVIEGTAFASAEVYQYDSCLNSW  178

Query  963   SKLASMNVARYDFACAEVNGMVYAVGGNGVNGESLSCAEVYDPDTNKWRVIESLRRPRWG  784
             S+L+ M VARYDFACAEV+G+VYAVGG GVNG+SLS AEVYDPDT+ W +IESLRRPRWG
Sbjct  179   SRLSDMIVARYDFACAEVDGLVYAVGGYGVNGDSLSSAEVYDPDTDTWTLIESLRRPRWG  238

Query  783   CFGCGFEGKLYVMGGRSSFTIGNSRFVDVYNPERQSWCEMKNGCVMVTAHAVVGKKLFCI  604
             CF CGFEGKLYVMGGRSSFTIGNS+FVD+YNPER SWCE+KNGCVMVTAHAV+GKKLFCI
Sbjct  239   CFACGFEGKLYVMGGRSSFTIGNSKFVDIYNPERHSWCEIKNGCVMVTAHAVLGKKLFCI  298

Query  603   EWKNQRKLGIFNPEDNSWKMVGVPVTGSSSIGFRLGILDEKLLLFSLQENPTYTTLLYDP  424
             EWKNQRKL IF+PEDNSWKMV VP+TGSSSI FR+GILDEKLLLF L+    + TLLYDP
Sbjct  299   EWKNQRKLAIFSPEDNSWKMVPVPLTGSSSIDFRIGILDEKLLLFPLEAETAFQTLLYDP  358

Query  423   NAAAGSEWQTCEIKPSGSCLCSVTIKA  343
             NA  GSEWQTC+I+PSG CLC VTIKA
Sbjct  359   NATLGSEWQTCDIRPSGLCLCCVTIKA  385



>ref|XP_007044074.1| AFR, putative [Theobroma cacao]
 gb|EOX99905.1| AFR, putative [Theobroma cacao]
Length=402

 Score =   578 bits (1490),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/390 (73%), Positives = 317/390 (81%), Gaps = 1/390 (0%)
 Frame = -1

Query  1512  VIL*MPGTNCGKKRVTELKMCFSDEMNLDNPGHSKNISYFTSSVVVDDSYSPLLPGLPDD  1333
             +I  MPG   GKKR TE   C S  +  D   HSK     +SS   D+  SPLLPGLPDD
Sbjct  14    IIKKMPGFVRGKKRFTEPNRCLSSSVKEDILIHSKGNPQ-SSSQATDELDSPLLPGLPDD  72

Query  1332  VAKYCLALVPRYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWLYVLTVDADGKESH  1153
             VAKYCLALVPR  FPAMGGV KRWRSFI+SKEF   R++A +LEEWLYVLT+D++GKESH
Sbjct  73    VAKYCLALVPRSSFPAMGGVCKRWRSFIQSKEFFTERRIAGMLEEWLYVLTMDSEGKESH  132

Query  1152  WEVLDCLGHKHHQLPQMPAPIRAGFGVAVLNAKLLVMGGYSMIDESASVSPEVFQYDSCL  973
             WEVLDCLG KH  LP MP P + GFGVAVLN KLLVM GYS+ + + S S +V+QYDSCL
Sbjct  133   WEVLDCLGQKHQLLPPMPGPAKVGFGVAVLNGKLLVMAGYSVNNGTVSASADVYQYDSCL  192

Query  972   NSWSKLASMNVARYDFACAEVNGMVYAVGGNGVNGESLSCAEVYDPDTNKWRVIESLRRP  793
             N WSKLA +NVARYDFACAEVNGMVY VGG G +GESLS AEVYD DT+KW +IESLRRP
Sbjct  193   NRWSKLADLNVARYDFACAEVNGMVYVVGGYGNDGESLSTAEVYDTDTDKWTLIESLRRP  252

Query  792   RWGCFGCGFEGKLYVMGGRSSFTIGNSRFVDVYNPERQSWCEMKNGCVMVTAHAVVGKKL  613
             RWGCF CG  GKLYV+GGRSSFTIGNSRFVDVYNPE+ +W EMKNGCVMVTAHAV+ +KL
Sbjct  253   RWGCFACGLNGKLYVLGGRSSFTIGNSRFVDVYNPEKHTWGEMKNGCVMVTAHAVLERKL  312

Query  612   FCIEWKNQRKLGIFNPEDNSWKMVGVPVTGSSSIGFRLGILDEKLLLFSLQENPTYTTLL  433
             FC+EWKNQRKL IFNPEDNSWKMV VP+TGS+SIGF  GILD KLLLFS++ +P Y TLL
Sbjct  313   FCMEWKNQRKLAIFNPEDNSWKMVPVPLTGSTSIGFCFGILDGKLLLFSVEGDPGYHTLL  372

Query  432   YDPNAAAGSEWQTCEIKPSGSCLCSVTIKA  343
             YDPNAA GSEWQT +IKPSG CLCSVTIKA
Sbjct  373   YDPNAAPGSEWQTSDIKPSGLCLCSVTIKA  402



>ref|XP_010025325.1| PREDICTED: F-box/kelch-repeat protein At1g67480 [Eucalyptus grandis]
 ref|XP_010025326.1| PREDICTED: F-box/kelch-repeat protein At1g67480 [Eucalyptus grandis]
 gb|KCW61965.1| hypothetical protein EUGRSUZ_H04652 [Eucalyptus grandis]
Length=385

 Score =   577 bits (1488),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/385 (72%), Positives = 319/385 (83%), Gaps = 1/385 (0%)
 Frame = -1

Query  1500  MPGTNCGKKRVTELKMCFSDEMNLDNPGHSKNISYFTSSVVVDDSYSPLLPGLPDDVAKY  1321
             MP     KKR TE  M FS+ ++   P  SK+ +   ++ + DD  SP+LPGLPD VA +
Sbjct  1     MPCFVSEKKRSTEQAMFFSNSVHESTPARSKS-NLPIATPIADDFGSPILPGLPDHVADH  59

Query  1320  CLALVPRYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWLYVLTVDADGKESHWEVL  1141
             CLALVPR  FP+MG V K+WR+ ++S+EF++VRKLA ++EEWLYVLT+DA+GKESHWEV 
Sbjct  60    CLALVPRCNFPSMGAVCKKWRTVLQSREFLIVRKLAKVVEEWLYVLTMDAEGKESHWEVF  119

Query  1140  DCLGHKHHQLPQMPAPIRAGFGVAVLNAKLLVMGGYSMIDESASVSPEVFQYDSCLNSWS  961
             DCLGHK  QLP MP P+++GFGV VLN KL VM GYS +D   S S EV+QYDSCLNSWS
Sbjct  120   DCLGHKIRQLPLMPGPVKSGFGVVVLNGKLFVMAGYSSLDGPCSASAEVYQYDSCLNSWS  179

Query  960   KLASMNVARYDFACAEVNGMVYAVGGNGVNGESLSCAEVYDPDTNKWRVIESLRRPRWGC  781
             KLASMNVARYDFACAEVNG+VY VGG G+ GESLS AEVYDPD++KW +IESLRRPRWGC
Sbjct  180   KLASMNVARYDFACAEVNGLVYVVGGYGIEGESLSSAEVYDPDSDKWTLIESLRRPRWGC  239

Query  780   FGCGFEGKLYVMGGRSSFTIGNSRFVDVYNPERQSWCEMKNGCVMVTAHAVVGKKLFCIE  601
             F C FEGKLYVMGGRSSFTIGNSRFVDVYNPE+ +WCEMKNG VMVTAHAV+GKKLFC+E
Sbjct  240   FACSFEGKLYVMGGRSSFTIGNSRFVDVYNPEQHTWCEMKNGRVMVTAHAVLGKKLFCME  299

Query  600   WKNQRKLGIFNPEDNSWKMVGVPVTGSSSIGFRLGILDEKLLLFSLQENPTYTTLLYDPN  421
             WKNQRKL I+NPEDNSW  V VP+TGSSSIGF+ GIL+ KLLLFSL+E+P Y TLLYDPN
Sbjct  300   WKNQRKLAIYNPEDNSWSTVPVPLTGSSSIGFQFGILEGKLLLFSLKEDPEYHTLLYDPN  359

Query  420   AAAGSEWQTCEIKPSGSCLCSVTIK  346
             AA GSEWQT EIKPSG CLCSVTIK
Sbjct  360   AAPGSEWQTSEIKPSGLCLCSVTIK  384



>ref|XP_010250761.1| PREDICTED: F-box/kelch-repeat protein At1g67480 [Nelumbo nucifera]
Length=385

 Score =   576 bits (1485),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/387 (75%), Positives = 318/387 (82%), Gaps = 3/387 (1%)
 Frame = -1

Query  1500  MPGTNCGKKRVTELKMCFSDEMNLDNPGHSKNISYFTSSVVVDDSYSPLLPGLPDDVAKY  1321
             MP    GKKR TE +MCFS  +  D+    KN  + TS    +D Y+P+LPGLPDDVAKY
Sbjct  1     MPSFVSGKKRNTESEMCFSTTVQKDHQTPLKNNLHLTSQAR-NDIYNPILPGLPDDVAKY  59

Query  1320  CLALVPRYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWLYVLTVDADGKESHWEVL  1141
             CLALVPR  FP MG V KRWRSFI+SKEFI VRK A  LEEWLYVLT DA+GK SHWEVL
Sbjct  60    CLALVPRSKFPTMGAVCKRWRSFIQSKEFITVRKQAGRLEEWLYVLTGDAEGKGSHWEVL  119

Query  1140  DCLGHKHHQLPQMPAPIRAGFGVAVLNAKLLVMGGYSMIDESAS-VSPEVFQYDSCLNSW  964
              CLGH+H  LP MP P++AGFGV VLN KLLVM GY ++DE A  VS +V+QYDSCLN W
Sbjct  120   GCLGHEHLLLPPMPGPLQAGFGVVVLNGKLLVMAGY-LVDEGAGCVSSDVYQYDSCLNRW  178

Query  963   SKLASMNVARYDFACAEVNGMVYAVGGNGVNGESLSCAEVYDPDTNKWRVIESLRRPRWG  784
             S LA MNVARYDFACAEV+GMVYAVGG G +GESLS AEVYDPD N+W +IESLRRPRWG
Sbjct  179   SALAKMNVARYDFACAEVDGMVYAVGGYGADGESLSSAEVYDPDKNEWELIESLRRPRWG  238

Query  783   CFGCGFEGKLYVMGGRSSFTIGNSRFVDVYNPERQSWCEMKNGCVMVTAHAVVGKKLFCI  604
             CF CGFEGKLYVMGGRSSFTIGNSRFVDVYNPE  +WCEMKNGCVMVTAHAV+GKKLFC+
Sbjct  239   CFACGFEGKLYVMGGRSSFTIGNSRFVDVYNPEHHTWCEMKNGCVMVTAHAVLGKKLFCM  298

Query  603   EWKNQRKLGIFNPEDNSWKMVGVPVTGSSSIGFRLGILDEKLLLFSLQENPTYTTLLYDP  424
             EWKNQRKL IFNP DNSWKMV VP+TGSS IGFR GILD KLLLFSL+E P Y TLLYDP
Sbjct  299   EWKNQRKLAIFNPADNSWKMVPVPLTGSSRIGFRFGILDGKLLLFSLEEEPEYRTLLYDP  358

Query  423   NAAAGSEWQTCEIKPSGSCLCSVTIKA  343
             +AA GSEWQT EIKPSG CLCSVTIKA
Sbjct  359   DAAPGSEWQTSEIKPSGVCLCSVTIKA  385



>ref|XP_009620246.1| PREDICTED: F-box/kelch-repeat protein At1g67480 [Nicotiana tomentosiformis]
Length=365

 Score =   572 bits (1475),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/371 (75%), Positives = 313/371 (84%), Gaps = 6/371 (2%)
 Frame = -1

Query  1455  MCFSDEMNLDNPGHSKNISYFTSSVVVDDSYSPLLPGLPDDVAKYCLALVPRYYFPAMGG  1276
             MC +D    D+ G    ++Y   + V D    P+LPGLPDDVAKYCLALVPR  FPAMGG
Sbjct  1     MCSTDLSQQDSLGFDSLLTY---NYVSD---GPILPGLPDDVAKYCLALVPRSDFPAMGG  54

Query  1275  VNKRWRSFIRSKEFIMVRKLACLLEEWLYVLTVDADGKESHWEVLDCLGHKHHQLPQMPA  1096
               KRWRSF+RSKEFI +RKLA LLEEWLYVLTV+A+G+ES+WEV DCLG+KHHQLPQMP 
Sbjct  55    ACKRWRSFLRSKEFISIRKLAGLLEEWLYVLTVNAEGRESYWEVFDCLGNKHHQLPQMPG  114

Query  1095  PIRAGFGVAVLNAKLLVMGGYSMIDESASVSPEVFQYDSCLNSWSKLASMNVARYDFACA  916
              I+A FG+ VLN KLLV+GG+SMI ES SVS +V+QYDS LN WSK+ASMNVARYDFACA
Sbjct  115   HIKAAFGIVVLNGKLLVIGGHSMIGESGSVSADVYQYDSYLNRWSKMASMNVARYDFACA  174

Query  915   EVNGMVYAVGGNGVNGESLSCAEVYDPDTNKWRVIESLRRPRWGCFGCGFEGKLYVMGGR  736
             EVNGMVYAVGG G++GESLSCAEVYDPD +KW VIESLRRPRWGCF CGF GKLY+MGGR
Sbjct  175   EVNGMVYAVGGFGIDGESLSCAEVYDPDQDKWTVIESLRRPRWGCFACGFGGKLYIMGGR  234

Query  735   SSFTIGNSRFVDVYNPERQSWCEMKNGCVMVTAHAVVGKKLFCIEWKNQRKLGIFNPEDN  556
             SSFTIGNSR VDVYNP+  +W EMK GCVMVTAHAV+ KKLFCIEWKNQRKL IFNPEDN
Sbjct  235   SSFTIGNSRSVDVYNPKSHTWGEMKRGCVMVTAHAVLEKKLFCIEWKNQRKLSIFNPEDN  294

Query  555   SWKMVGVPVTGSSSIGFRLGILDEKLLLFSLQENPTYTTLLYDPNAAAGSEWQTCEIKPS  376
             SWKM  VPVTGSSSI F+ GILD KLLLFSLQ +P Y TLLY+PNAA+ S+WQTC+IKPS
Sbjct  295   SWKMEPVPVTGSSSIRFQFGILDGKLLLFSLQGDPGYNTLLYNPNAASESQWQTCDIKPS  354

Query  375   GSCLCSVTIKA  343
             G CLC+VTIKA
Sbjct  355   GVCLCTVTIKA  365



>ref|XP_006376125.1| hypothetical protein POPTR_0013s10040g [Populus trichocarpa]
 gb|ERP53922.1| hypothetical protein POPTR_0013s10040g [Populus trichocarpa]
Length=381

 Score =   571 bits (1472),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/386 (72%), Positives = 314/386 (81%), Gaps = 5/386 (1%)
 Frame = -1

Query  1500  MPGTNCGKKRVTELKMCFSDEMNLDNPGHSKNISYFTSSVVVDDSYSPLLPGLPDDVAKY  1321
             M G   GKKR TE  M FS  +  D     +      +S + +D  SP+LPGLPDDVAKY
Sbjct  1     MLGIVSGKKRFTEANMTFSTLITQDFKSKPR-----LASQIPNDIDSPILPGLPDDVAKY  55

Query  1320  CLALVPRYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWLYVLTVDADGKESHWEVL  1141
             CLALVPR +FP MG V K+WRSF++SKE I +RKLA LLEEWLYVLT+D++ KESHWEV 
Sbjct  56    CLALVPRSHFPTMGSVCKKWRSFLKSKELITIRKLAGLLEEWLYVLTMDSEAKESHWEVF  115

Query  1140  DCLGHKHHQLPQMPAPIRAGFGVAVLNAKLLVMGGYSMIDESASVSPEVFQYDSCLNSWS  961
             DCLGHKH  LP MP P++A FGV VLN KLLVM GYS+ID + S S +V++YDSCLNSW 
Sbjct  116   DCLGHKHQLLPPMPGPVKAEFGVVVLNGKLLVMAGYSVIDGTGSASADVYEYDSCLNSWR  175

Query  960   KLASMNVARYDFACAEVNGMVYAVGGNGVNGESLSCAEVYDPDTNKWRVIESLRRPRWGC  781
             KLASMNVARY+FACAEVNG VY VGGNG++G+SLS  E+Y+PDT+KW +IESLRRPR GC
Sbjct  176   KLASMNVARYEFACAEVNGKVYVVGGNGMDGDSLSSVEMYNPDTDKWTLIESLRRPRRGC  235

Query  780   FGCGFEGKLYVMGGRSSFTIGNSRFVDVYNPERQSWCEMKNGCVMVTAHAVVGKKLFCIE  601
             F C FEGKLYVMGGRSSFTIGNS+FVDVYNPE  +WCEMKNG VMVTAHAV+GKKLFC+E
Sbjct  236   FACSFEGKLYVMGGRSSFTIGNSKFVDVYNPEGHTWCEMKNGRVMVTAHAVLGKKLFCME  295

Query  600   WKNQRKLGIFNPEDNSWKMVGVPVTGSSSIGFRLGILDEKLLLFSLQENPTYTTLLYDPN  421
             WKNQRKL IF+PEDNSWKMV VP+TGSSSIGFR GILD KLLLFS +  P Y TLLYDP+
Sbjct  296   WKNQRKLAIFSPEDNSWKMVPVPLTGSSSIGFRFGILDGKLLLFSQEMEPGYRTLLYDPD  355

Query  420   AAAGSEWQTCEIKPSGSCLCSVTIKA  343
             A+ GSEWQT EIKPSG CLCSVTIKA
Sbjct  356   ASPGSEWQTSEIKPSGWCLCSVTIKA  381



>ref|XP_011003970.1| PREDICTED: F-box/kelch-repeat protein At1g67480 [Populus euphratica]
Length=381

 Score =   570 bits (1468),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/389 (71%), Positives = 313/389 (80%), Gaps = 11/389 (3%)
 Frame = -1

Query  1500  MPGTNCGKKRVTELKMCFSDEMNLD---NPGHSKNISYFTSSVVVDDSYSPLLPGLPDDV  1330
             M G   GKKR TE  M FS  +  D   NP  +  I Y        D  SP+LPGLPDDV
Sbjct  1     MLGIVSGKKRFTEANMNFSTLITQDFKSNPRLASQIPY--------DIDSPILPGLPDDV  52

Query  1329  AKYCLALVPRYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWLYVLTVDADGKESHW  1150
             AKYCLALVPR +FP MG V K+WRSF++SKE I +RKLA LLEE LYVLT+D++ KESHW
Sbjct  53    AKYCLALVPRSHFPTMGSVCKKWRSFLKSKELITIRKLAGLLEERLYVLTMDSEAKESHW  112

Query  1149  EVLDCLGHKHHQLPQMPAPIRAGFGVAVLNAKLLVMGGYSMIDESASVSPEVFQYDSCLN  970
             EV DCLGHKH  LP MP P++A FGV VLN KLLVM GYS+ID + S S +V++YDSCLN
Sbjct  113   EVFDCLGHKHQLLPPMPGPVKAEFGVVVLNGKLLVMAGYSVIDGTGSASADVYEYDSCLN  172

Query  969   SWSKLASMNVARYDFACAEVNGMVYAVGGNGVNGESLSCAEVYDPDTNKWRVIESLRRPR  790
             SW KLASMNVARY+FACAEVNG VY VGGNG++G+SLS  E+Y+PDT+KW +IESLRRPR
Sbjct  173   SWRKLASMNVARYEFACAEVNGKVYVVGGNGMDGDSLSSVEMYNPDTDKWTLIESLRRPR  232

Query  789   WGCFGCGFEGKLYVMGGRSSFTIGNSRFVDVYNPERQSWCEMKNGCVMVTAHAVVGKKLF  610
             WGCF C FEGKLYVMGGRSSFTIGNS+ VDVYNPE  +WCE+KNGCVMVTAHAV+GKKLF
Sbjct  233   WGCFACSFEGKLYVMGGRSSFTIGNSKVVDVYNPEGHTWCEIKNGCVMVTAHAVLGKKLF  292

Query  609   CIEWKNQRKLGIFNPEDNSWKMVGVPVTGSSSIGFRLGILDEKLLLFSLQENPTYTTLLY  430
             C+EWKNQRKL IF+PEDNSWKMV VP+TGSSSIGFR GILD KLLLFS    P Y TLLY
Sbjct  293   CMEWKNQRKLAIFSPEDNSWKMVPVPLTGSSSIGFRFGILDGKLLLFSQVMEPGYRTLLY  352

Query  429   DPNAAAGSEWQTCEIKPSGSCLCSVTIKA  343
             DP+A+ GSEWQT EIKPSG CLCSVTIKA
Sbjct  353   DPDASPGSEWQTSEIKPSGWCLCSVTIKA  381



>gb|KHG24132.1| hypothetical protein F383_07660 [Gossypium arboreum]
Length=382

 Score =   568 bits (1463),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/386 (74%), Positives = 324/386 (84%), Gaps = 4/386 (1%)
 Frame = -1

Query  1500  MPGTNCGKKRVTELKMCFSDEMNLDNPGHSKNISYFTSSVVVDDSYSPLLPGLPDDVAKY  1321
             MPG    KKR+TE  MC S  +    P HSK  ++ + S   D+  SPLLPGLPDDVAKY
Sbjct  1     MPGFVREKKRITEPNMCLSSPLM---PDHSKG-NHRSPSQATDEIESPLLPGLPDDVAKY  56

Query  1320  CLALVPRYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWLYVLTVDADGKESHWEVL  1141
             CLALVPR  FP+MGGV KRWRSFI+SKEF+M RK+A +LEEWLYVLT+D++GKESHWEVL
Sbjct  57    CLALVPRSSFPSMGGVCKRWRSFIQSKEFLMERKIAGMLEEWLYVLTMDSEGKESHWEVL  116

Query  1140  DCLGHKHHQLPQMPAPIRAGFGVAVLNAKLLVMGGYSMIDESASVSPEVFQYDSCLNSWS  961
             DCLG KH  LP MP P + GFG  VLN KLLV+ GYS+I+ +AS S +V+QYDSCLN WS
Sbjct  117   DCLGQKHRLLPPMPGPEKVGFGTTVLNGKLLVLAGYSVINGTASASADVYQYDSCLNCWS  176

Query  960   KLASMNVARYDFACAEVNGMVYAVGGNGVNGESLSCAEVYDPDTNKWRVIESLRRPRWGC  781
             KLA++NVARYDFACAEVNG+VY VGG GV GESLS AEVYDPDT+KW +IESLRRPRWGC
Sbjct  177   KLANLNVARYDFACAEVNGVVYVVGGYGVEGESLSTAEVYDPDTDKWTLIESLRRPRWGC  236

Query  780   FGCGFEGKLYVMGGRSSFTIGNSRFVDVYNPERQSWCEMKNGCVMVTAHAVVGKKLFCIE  601
             F CG  GKLYV+GGRSSFTIGNSRFVDVYNPE+Q+WCEMKNGCVMVTAHAV+ K+LFC+E
Sbjct  237   FACGLNGKLYVLGGRSSFTIGNSRFVDVYNPEKQTWCEMKNGCVMVTAHAVLEKQLFCME  296

Query  600   WKNQRKLGIFNPEDNSWKMVGVPVTGSSSIGFRLGILDEKLLLFSLQENPTYTTLLYDPN  421
             WKNQRKL IFNP+DNSWKMV VP+TGS+SIGFR GILD KLLLFS++ +P Y TLLYDPN
Sbjct  297   WKNQRKLAIFNPDDNSWKMVSVPLTGSTSIGFRFGILDGKLLLFSVEGDPGYHTLLYDPN  356

Query  420   AAAGSEWQTCEIKPSGSCLCSVTIKA  343
             AA GSEWQT EIKPSG CLCSVTIKA
Sbjct  357   AAPGSEWQTSEIKPSGLCLCSVTIKA  382



>ref|XP_002311715.1| kelch repeat-containing F-box family protein [Populus trichocarpa]
 gb|EEE89082.1| kelch repeat-containing F-box family protein [Populus trichocarpa]
Length=371

 Score =   565 bits (1456),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/371 (73%), Positives = 304/371 (82%), Gaps = 0/371 (0%)
 Frame = -1

Query  1455  MCFSDEMNLDNPGHSKNISYFTSSVVVDDSYSPLLPGLPDDVAKYCLALVPRYYFPAMGG  1276
             M F   +  DNP      +    S V  D    ++PGLPDDVAKYCLALVPR Y PAMG 
Sbjct  1     MSFFTLITQDNPLVHSKSNPVVDSRVAHDIDVLIVPGLPDDVAKYCLALVPRRYLPAMGA  60

Query  1275  VNKRWRSFIRSKEFIMVRKLACLLEEWLYVLTVDADGKESHWEVLDCLGHKHHQLPQMPA  1096
             V K+WRSF++S+EFI VRKLA LLEEWLYVLT+D++GKESHW VLD LGHK   LP MP 
Sbjct  61    VCKKWRSFLKSQEFITVRKLAGLLEEWLYVLTMDSEGKESHWVVLDRLGHKRQLLPPMPG  120

Query  1095  PIRAGFGVAVLNAKLLVMGGYSMIDESASVSPEVFQYDSCLNSWSKLASMNVARYDFACA  916
             P +AGFGV VLN KLLVM G+S+ID + + S +V++YD CLNSWSKL+ MNVARYDFACA
Sbjct  121   PTKAGFGVVVLNGKLLVMAGHSLIDGTGTASADVYEYDCCLNSWSKLSRMNVARYDFACA  180

Query  915   EVNGMVYAVGGNGVNGESLSCAEVYDPDTNKWRVIESLRRPRWGCFGCGFEGKLYVMGGR  736
             EVNG VYA GG G++G+SLS  E+YDPDTN W +IESLRRPRWGCF CGFEGKLYVMGGR
Sbjct  181   EVNGKVYAAGGYGMDGDSLSSVEMYDPDTNTWTMIESLRRPRWGCFACGFEGKLYVMGGR  240

Query  735   SSFTIGNSRFVDVYNPERQSWCEMKNGCVMVTAHAVVGKKLFCIEWKNQRKLGIFNPEDN  556
             S+F+IGNSR VDVYNPER SWCEMKNGCVMVTAHAV+GKKLFC+EWKNQRKL IFNPED+
Sbjct  241   STFSIGNSRSVDVYNPERHSWCEMKNGCVMVTAHAVLGKKLFCMEWKNQRKLAIFNPEDS  300

Query  555   SWKMVGVPVTGSSSIGFRLGILDEKLLLFSLQENPTYTTLLYDPNAAAGSEWQTCEIKPS  376
             SWK V VP+TGSSSIGFR GILD KLLLFSLQE P Y TLLYDPNA+AGSEW T EIKPS
Sbjct  301   SWKTVAVPLTGSSSIGFRFGILDGKLLLFSLQEEPGYRTLLYDPNASAGSEWCTSEIKPS  360

Query  375   GSCLCSVTIKA  343
             G CLCSVTIKA
Sbjct  361   GCCLCSVTIKA  371



>ref|XP_007163744.1| hypothetical protein PHAVU_001G260600g [Phaseolus vulgaris]
 gb|ESW35738.1| hypothetical protein PHAVU_001G260600g [Phaseolus vulgaris]
Length=385

 Score =   566 bits (1458),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/386 (71%), Positives = 314/386 (81%), Gaps = 1/386 (0%)
 Frame = -1

Query  1500  MPGTNCGKKRVTELKMCFSDEMNLDNPGHSKNISYFTSSVVVDDSYSPLLPGLPDDVAKY  1321
             MP  + GKKR  +  MCF++  N D    S+N +      + +D YSP+LPGLPDDVA+Y
Sbjct  1     MPYFSVGKKRFIQPNMCFTNLTNQDKSTLSQNDNCLFPDAMSED-YSPILPGLPDDVAEY  59

Query  1320  CLALVPRYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWLYVLTVDADGKESHWEVL  1141
             CLALVPR  FPAMG V KRWRSF+ SK F  VRKLA +LEEWLY LT D + KESHWEV+
Sbjct  60    CLALVPRSNFPAMGAVCKRWRSFMGSKAFATVRKLAGMLEEWLYFLTTDCEEKESHWEVM  119

Query  1140  DCLGHKHHQLPQMPAPIRAGFGVAVLNAKLLVMGGYSMIDESASVSPEVFQYDSCLNSWS  961
             DCLG K   LP MP   +AGFGV VLN KLLVM GYS I+ +   S EV+QYDSCLNSWS
Sbjct  120   DCLGRKCRSLPPMPGLEKAGFGVVVLNGKLLVMAGYSAIEGTTFASAEVYQYDSCLNSWS  179

Query  960   KLASMNVARYDFACAEVNGMVYAVGGNGVNGESLSCAEVYDPDTNKWRVIESLRRPRWGC  781
             +L++MNVARYDFACAEVNG+VYA+GG+G +G+SLS AE+YDP+T+KW +IESLRRPRWGC
Sbjct  180   RLSNMNVARYDFACAEVNGLVYAIGGHGEDGDSLSSAEMYDPETDKWTLIESLRRPRWGC  239

Query  780   FGCGFEGKLYVMGGRSSFTIGNSRFVDVYNPERQSWCEMKNGCVMVTAHAVVGKKLFCIE  601
             F CGFEGKLYVMGGRSSFTIGNS+FVDVYNPER SWCE+KNGCVMVTAHAVVGKKLFCIE
Sbjct  240   FACGFEGKLYVMGGRSSFTIGNSKFVDVYNPERHSWCEIKNGCVMVTAHAVVGKKLFCIE  299

Query  600   WKNQRKLGIFNPEDNSWKMVGVPVTGSSSIGFRLGILDEKLLLFSLQENPTYTTLLYDPN  421
             WKNQRKL IF+PEDNSWKMV VP+TGS+S+GFR G+LDEKLLLF L    +Y TLLYDPN
Sbjct  300   WKNQRKLAIFSPEDNSWKMVPVPLTGSTSVGFRFGMLDEKLLLFPLVAEHSYQTLLYDPN  359

Query  420   AAAGSEWQTCEIKPSGSCLCSVTIKA  343
             AA GSEW+T +IKPSG CL  VTIKA
Sbjct  360   AALGSEWRTSDIKPSGLCLSCVTIKA  385



>ref|XP_004502305.1| PREDICTED: F-box/kelch-repeat protein At1g67480-like [Cicer arietinum]
Length=385

 Score =   565 bits (1456),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/386 (69%), Positives = 315/386 (82%), Gaps = 1/386 (0%)
 Frame = -1

Query  1500  MPGTNCGKKRVTELKMCFSDEMNLDNPGHSKNISYFTSSVVVDDSYSPLLPGLPDDVAKY  1321
             MPG   GKKR  +  MCF++ +N D    +++    T   + D+  SP+LPGLPDDVAKY
Sbjct  1     MPGFVVGKKRFIKSNMCFTNFVNQDKSIRTQSDHSLTIEAL-DEEGSPILPGLPDDVAKY  59

Query  1320  CLALVPRYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWLYVLTVDADGKESHWEVL  1141
             CLALVPR  FPAMGGV KRWR F++SKEF+MVRKLA +LEEWLY LT D++G+ESHWEV+
Sbjct  60    CLALVPRSNFPAMGGVCKRWRLFMQSKEFVMVRKLAGVLEEWLYFLTNDSEGRESHWEVM  119

Query  1140  DCLGHKHHQLPQMPAPIRAGFGVAVLNAKLLVMGGYSMIDESASVSPEVFQYDSCLNSWS  961
             DCLG+K   +P MP P +A FGV VLN KL++M GYS ID  A  S EV+QYDSCLNSWS
Sbjct  120   DCLGNKCLSIPPMPGPEKASFGVVVLNGKLIIMAGYSAIDGVAVASAEVYQYDSCLNSWS  179

Query  960   KLASMNVARYDFACAEVNGMVYAVGGNGVNGESLSCAEVYDPDTNKWRVIESLRRPRWGC  781
             +L++MNVAR+DFACAEVNG+VY VGG+G +G SLS  E+YDPDT+KW +IESLRRPRWGC
Sbjct  180   RLSNMNVARFDFACAEVNGLVYIVGGHGADGNSLSSVEMYDPDTDKWTLIESLRRPRWGC  239

Query  780   FGCGFEGKLYVMGGRSSFTIGNSRFVDVYNPERQSWCEMKNGCVMVTAHAVVGKKLFCIE  601
             F CGFE KLYVMGGRSSFTIGNS+FVD+YNPE+ SWC++KNGCVMVTAHAV+G KLFC E
Sbjct  240   FACGFESKLYVMGGRSSFTIGNSKFVDIYNPEKHSWCDIKNGCVMVTAHAVLGNKLFCTE  299

Query  600   WKNQRKLGIFNPEDNSWKMVGVPVTGSSSIGFRLGILDEKLLLFSLQENPTYTTLLYDPN  421
             WKNQRKL IF+PEDNSW MV VP+TGS S+GF+ GILD KLLLF L++ PT  TLLYDPN
Sbjct  300   WKNQRKLSIFSPEDNSWTMVPVPMTGSLSVGFQFGILDGKLLLFPLEKEPTNQTLLYDPN  359

Query  420   AAAGSEWQTCEIKPSGSCLCSVTIKA  343
             AA GSEWQT  I+PSG CLCSVTIKA
Sbjct  360   AALGSEWQTSNIRPSGLCLCSVTIKA  385



>ref|XP_004504451.1| PREDICTED: F-box/kelch-repeat protein At1g67480-like isoform 
X1 [Cicer arietinum]
 ref|XP_004504452.1| PREDICTED: F-box/kelch-repeat protein At1g67480-like isoform 
X2 [Cicer arietinum]
 ref|XP_004504453.1| PREDICTED: F-box/kelch-repeat protein At1g67480-like isoform 
X3 [Cicer arietinum]
Length=377

 Score =   564 bits (1454),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/386 (71%), Positives = 316/386 (82%), Gaps = 9/386 (2%)
 Frame = -1

Query  1500  MPGTNCGKKRVTELKMCFSDEMNLDNPGHSKNISYFTSSVVVDDSYSPLLPGLPDDVAKY  1321
             MPG   GKKR +E K  FS+ +N D     K+        VVDDS  P+LPGL DDV+KY
Sbjct  1     MPGFVAGKKRFSETK--FSNLVNEDKSTLLKD-----HHKVVDDS--PILPGLLDDVSKY  51

Query  1320  CLALVPRYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWLYVLTVDADGKESHWEVL  1141
             CLALVPR   PAMG V KRWR FI+ +EFI VRKLA  +EEWLY+L  D+ GK SHWEV+
Sbjct  52    CLALVPRSDSPAMGSVCKRWRQFIQGEEFITVRKLARQVEEWLYILIADSKGKGSHWEVM  111

Query  1140  DCLGHKHHQLPQMPAPIRAGFGVAVLNAKLLVMGGYSMIDESASVSPEVFQYDSCLNSWS  961
             DC GH    LP MP P++A FGV VLN KLLVMGGYS ID +ASVSP+V+QY+SCLNSWS
Sbjct  112   DCFGHNRRSLPLMPGPVKAEFGVVVLNGKLLVMGGYSSIDGTASVSPDVYQYNSCLNSWS  171

Query  960   KLASMNVARYDFACAEVNGMVYAVGGNGVNGESLSCAEVYDPDTNKWRVIESLRRPRWGC  781
             +L++MNV+RYDFACAEVNG+VYAVGG G  G+SLS AEVYDPDTNKW +IES+RRPRWGC
Sbjct  172   RLSNMNVSRYDFACAEVNGLVYAVGGYGEAGDSLSSAEVYDPDTNKWTLIESIRRPRWGC  231

Query  780   FGCGFEGKLYVMGGRSSFTIGNSRFVDVYNPERQSWCEMKNGCVMVTAHAVVGKKLFCIE  601
             F CGFEGKLYVMGGRSSFTIGNS+FVDVYNPE+  WCEMKNGCVMVTAHAV+  KLFC+E
Sbjct  232   FACGFEGKLYVMGGRSSFTIGNSKFVDVYNPEKHKWCEMKNGCVMVTAHAVLENKLFCME  291

Query  600   WKNQRKLGIFNPEDNSWKMVGVPVTGSSSIGFRLGILDEKLLLFSLQENPTYTTLLYDPN  421
             WKNQRKL IF+P++NSWKMV VP+TGSSS+GFR GIL+ KLLLFS++E+PTY TLLYDPN
Sbjct  292   WKNQRKLSIFDPQNNSWKMVPVPLTGSSSVGFRFGILNGKLLLFSMKEDPTYRTLLYDPN  351

Query  420   AAAGSEWQTCEIKPSGSCLCSVTIKA  343
             AA GSEW+T +I+PSG CLCSVT KA
Sbjct  352   AAVGSEWETIDIRPSGLCLCSVTTKA  377



>ref|XP_008340201.1| PREDICTED: F-box/kelch-repeat protein At1g67480 [Malus domestica]
Length=386

 Score =   563 bits (1451),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/387 (70%), Positives = 313/387 (81%), Gaps = 2/387 (1%)
 Frame = -1

Query  1500  MPGTNCGKKRVTELKMCFSDEMNLDNPGHSKNISYFTSSVVVDDSYSPLLPGLPDDVAKY  1321
             MP     KKR  +  M  S+ +  D P   K+    TS +VVDD  SP+LPGLPDD+AKY
Sbjct  1     MPAFVSEKKRFKDPNMGLSNSVKQDTPIREKSYRSLTS-LVVDDFDSPILPGLPDDIAKY  59

Query  1320  CLALVPRYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWLYVLTVDADGKESHWEVL  1141
             CLALVPR  FPAMGGV K+WR F++SKE I VR+LA LLEEWLYVLT D++GKE+HWEVL
Sbjct  60    CLALVPRSDFPAMGGVCKKWRYFLQSKELITVRRLAGLLEEWLYVLTTDSEGKENHWEVL  119

Query  1140  DCLGHKHHQLPQMPAPIRAGFGVAVLNAKLLVMGGYSMIDESASVSPEVFQYDSCLNSWS  961
             DC GH HH LP MP P+R+GFGV VLN KLLV+GGYS+I E+   S +V+QYDSCLN W 
Sbjct  120   DCHGHXHHVLPPMPGPMRSGFGVVVLNGKLLVVGGYSVITETTVASDDVYQYDSCLNRWG  179

Query  960   KLASMNVARYDFACAEVNGMVYAVGGNGVNGESLSCAEVYDPDTNKWRVIESLRRPRWGC  781
             KLA+MNVARYDFACAE++GM+YAVGG G++G SLS AEVY+PDT+ W +I S+RRPR+GC
Sbjct  180   KLANMNVARYDFACAELSGMIYAVGGYGIDGSSLSSAEVYNPDTDTWTLISSIRRPRYGC  239

Query  780   FGCGFEGKLYVMGGRSSFTIGNSRFVDVYNPERQSWCEM-KNGCVMVTAHAVVGKKLFCI  604
             F CGFEGKLYVMGGRSSFTIGNS+FVDVY+PE  +WCEM KNGCVMVTAHAV+ KKLFC 
Sbjct  240   FACGFEGKLYVMGGRSSFTIGNSKFVDVYDPESHTWCEMKKNGCVMVTAHAVLEKKLFCS  299

Query  603   EWKNQRKLGIFNPEDNSWKMVGVPVTGSSSIGFRLGILDEKLLLFSLQENPTYTTLLYDP  424
             EWKNQRKL I+NP DNSW+MV +P+TGS+SI FR G LDEKLLLFSL+E P Y TLLYDP
Sbjct  300   EWKNQRKLSIYNPYDNSWEMVQIPLTGSTSIKFRFGTLDEKLLLFSLEEEPGYRTLLYDP  359

Query  423   NAAAGSEWQTCEIKPSGSCLCSVTIKA  343
             NAA GSEWQT E+K SG CLC VTIK 
Sbjct  360   NAAPGSEWQTSEVKMSGPCLCCVTIKV  386



>gb|KEH20583.1| kelch repeat F-box protein [Medicago truncatula]
Length=388

 Score =   560 bits (1444),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/388 (70%), Positives = 311/388 (80%), Gaps = 2/388 (1%)
 Frame = -1

Query  1500  MPGTNCGKKRVTELKMCFSDEMNLDNPGHSKNISYFTSSVVVD--DSYSPLLPGLPDDVA  1327
             MPG    KKR +E  MCFS+ +N + P   K      S  V D  D  S +L GLPDD++
Sbjct  1     MPGFVAVKKRFSEKNMCFSNMVNQEKPSLLKGGHSVRSEAVHDVVDDDSLILSGLPDDIS  60

Query  1326  KYCLALVPRYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWLYVLTVDADGKESHWE  1147
             K+CLALVPR  F AMGGV KRW+ FI+SKEFI VRKLA LLEEWLY+LT D++GK SHWE
Sbjct  61    KHCLALVPRSNFLAMGGVCKRWKCFIQSKEFITVRKLAGLLEEWLYILTADSEGKGSHWE  120

Query  1146  VLDCLGHKHHQLPQMPAPIRAGFGVAVLNAKLLVMGGYSMIDESASVSPEVFQYDSCLNS  967
             V+D  GH    LP MP P +AGFGV VLN KLLVM GYS  D + SVS EV+QY+S L+S
Sbjct  121   VMDSFGHNRRSLPPMPGPRKAGFGVVVLNGKLLVMAGYSSTDGTVSVSAEVYQYNSNLDS  180

Query  966   WSKLASMNVARYDFACAEVNGMVYAVGGNGVNGESLSCAEVYDPDTNKWRVIESLRRPRW  787
             W++L++MNVARYDFACAEVNG+VYAVGG G  G+SLS AEVYDPDT+KW VIESLRRPRW
Sbjct  181   WTRLSNMNVARYDFACAEVNGLVYAVGGYGAEGDSLSSAEVYDPDTDKWTVIESLRRPRW  240

Query  786   GCFGCGFEGKLYVMGGRSSFTIGNSRFVDVYNPERQSWCEMKNGCVMVTAHAVVGKKLFC  607
             GCF CG EGKLYVMGGRSSFTIGNS+FVD+Y+PE  SWCEMKNGCVMVTAHAV+ KKLFC
Sbjct  241   GCFACGLEGKLYVMGGRSSFTIGNSKFVDIYDPENHSWCEMKNGCVMVTAHAVLEKKLFC  300

Query  606   IEWKNQRKLGIFNPEDNSWKMVGVPVTGSSSIGFRLGILDEKLLLFSLQENPTYTTLLYD  427
             +EWKNQRKL IFNP+DNSWK V VP+TGSSS+GFR GIL+ KLLLFSL+E+PTY TLLYD
Sbjct  301   MEWKNQRKLSIFNPDDNSWKTVPVPLTGSSSVGFRFGILNGKLLLFSLKEDPTYRTLLYD  360

Query  426   PNAAAGSEWQTCEIKPSGSCLCSVTIKA  343
             PNA  G EW T +IKPSG CLCSVTIKA
Sbjct  361   PNAEPGCEWGTTDIKPSGLCLCSVTIKA  388



>ref|XP_003601804.1| F-box family protein [Medicago truncatula]
 gb|AES72055.1| kelch repeat F-box protein [Medicago truncatula]
Length=372

 Score =   559 bits (1441),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/372 (71%), Positives = 312/372 (84%), Gaps = 1/372 (0%)
 Frame = -1

Query  1455  MCFSDEMNLDNPGHSKNISYFTSSV-VVDDSYSPLLPGLPDDVAKYCLALVPRYYFPAMG  1279
             MCF++ +N D   H+++ S    ++  +D   SP+LPGLPDDVAKYCLALVPR  FPAMG
Sbjct  1     MCFTNLVNQDKTTHTRSKSNHCLTIEALDKDDSPILPGLPDDVAKYCLALVPRSNFPAMG  60

Query  1278  GVNKRWRSFIRSKEFIMVRKLACLLEEWLYVLTVDADGKESHWEVLDCLGHKHHQLPQMP  1099
             GV+K+WR FIRSKEF+MVRKLA LLEEWLY LT+D++G+ESHWEV+D LG K   LP MP
Sbjct  61    GVSKKWRLFIRSKEFVMVRKLAGLLEEWLYCLTLDSEGRESHWEVMDSLGRKCRSLPPMP  120

Query  1098  APIRAGFGVAVLNAKLLVMGGYSMIDESASVSPEVFQYDSCLNSWSKLASMNVARYDFAC  919
              P +A FGV VLN KLL+M GYS I+ +   S EV+QYDS LNSWS+L++MNVARYDFAC
Sbjct  121   GPAKASFGVVVLNGKLLIMAGYSAIEGTVVASDEVYQYDSYLNSWSRLSNMNVARYDFAC  180

Query  918   AEVNGMVYAVGGNGVNGESLSCAEVYDPDTNKWRVIESLRRPRWGCFGCGFEGKLYVMGG  739
             AEV+G+VY VGG GVNG++LS  E+YDPDT+KW +IESLRRPRWGCF CGFE KLYVMGG
Sbjct  181   AEVDGLVYIVGGYGVNGDNLSSVEMYDPDTDKWTLIESLRRPRWGCFACGFEDKLYVMGG  240

Query  738   RSSFTIGNSRFVDVYNPERQSWCEMKNGCVMVTAHAVVGKKLFCIEWKNQRKLGIFNPED  559
             RSSFTIGNS+FVD+YNPE+ SWCE+KNGCVMVTAHAV+ KKLFCIEWKNQRKL IF+PE+
Sbjct  241   RSSFTIGNSKFVDIYNPEKHSWCEIKNGCVMVTAHAVLEKKLFCIEWKNQRKLAIFSPEN  300

Query  558   NSWKMVGVPVTGSSSIGFRLGILDEKLLLFSLQENPTYTTLLYDPNAAAGSEWQTCEIKP  379
             NSW MV VP+TGSSS+GFR GILD KLLLF +++ PT  TL YDPNAA+GSEWQT +I+P
Sbjct  301   NSWTMVPVPLTGSSSVGFRFGILDGKLLLFPVEKEPTNQTLSYDPNAASGSEWQTSDIRP  360

Query  378   SGSCLCSVTIKA  343
             SG CLCSVT+KA
Sbjct  361   SGLCLCSVTMKA  372



>ref|XP_010682796.1| PREDICTED: F-box/kelch-repeat protein At1g67480 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010682797.1| PREDICTED: F-box/kelch-repeat protein At1g67480 [Beta vulgaris 
subsp. vulgaris]
Length=378

 Score =   559 bits (1441),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/386 (69%), Positives = 310/386 (80%), Gaps = 8/386 (2%)
 Frame = -1

Query  1500  MPGTNCGKKRVTELKMCFSDEMNLDNPGHSKNISYFTSSVVVDDSYSPLLPGLPDDVAKY  1321
             MPG    KKR+TE  +CFS+        HSK+    T S+ VDD Y P+LPGLPDDVAK 
Sbjct  1     MPGFVSEKKRLTESNLCFSN--------HSKDARGSTGSLNVDDRYVPVLPGLPDDVAKL  52

Query  1320  CLALVPRYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWLYVLTVDADGKESHWEVL  1141
             CLALVPR Y+ AMG V+ RWRS IRSKEFI +RK A +LEEWLY+LT+D +GKE+ WEVL
Sbjct  53    CLALVPRTYYTAMGAVSNRWRSVIRSKEFITIRKQAGMLEEWLYLLTIDEEGKENQWEVL  112

Query  1140  DCLGHKHHQLPQMPAPIRAGFGVAVLNAKLLVMGGYSMIDESASVSPEVFQYDSCLNSWS  961
             DC G+KH  LP MP  ++ GFGV VL+ KL VM G ++ + +AS + +V+QYDS LN WS
Sbjct  113   DCFGNKHRVLPPMPGELKTGFGVVVLHGKLFVMAGCTISEGAASPTADVYQYDSYLNCWS  172

Query  960   KLASMNVARYDFACAEVNGMVYAVGGNGVNGESLSCAEVYDPDTNKWRVIESLRRPRWGC  781
             KL+SMNVARYDFACAEV GM+Y VGG G++GESL  AEVY+PDT KW +IES+RRPRWGC
Sbjct  173   KLSSMNVARYDFACAEVGGMIYVVGGYGMDGESLCSAEVYNPDTEKWTLIESIRRPRWGC  232

Query  780   FGCGFEGKLYVMGGRSSFTIGNSRFVDVYNPERQSWCEMKNGCVMVTAHAVVGKKLFCIE  601
             F CGFEGKLYVMGGRSSFTIGNS+FVDVY+PE Q WC+MKNGCVMVTAHAV+ KKLFC+E
Sbjct  233   FACGFEGKLYVMGGRSSFTIGNSKFVDVYDPENQKWCQMKNGCVMVTAHAVIAKKLFCME  292

Query  600   WKNQRKLGIFNPEDNSWKMVGVPVTGSSSIGFRLGILDEKLLLFSLQENPTYTTLLYDPN  421
             WKNQRKL IFNPEDNSWK+V VPVTGS SIGFR GILD KLLLFS+ + P Y TLLYDP 
Sbjct  293   WKNQRKLSIFNPEDNSWKIVPVPVTGSLSIGFRFGILDGKLLLFSVNDEPGYRTLLYDPE  352

Query  420   AAAGSEWQTCEIKPSGSCLCSVTIKA  343
             AA GSEW+T  IKPSG CLCSVT+KA
Sbjct  353   AAPGSEWKTTNIKPSGLCLCSVTMKA  378



>ref|XP_007223092.1| hypothetical protein PRUPE_ppa007034mg [Prunus persica]
 gb|EMJ24291.1| hypothetical protein PRUPE_ppa007034mg [Prunus persica]
Length=385

 Score =   558 bits (1438),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/386 (69%), Positives = 308/386 (80%), Gaps = 1/386 (0%)
 Frame = -1

Query  1500  MPGTNCGKKRVTELKMCFSDEMNLDNPGHSKNISYFTSSVVVDDSYSPLLPGLPDDVAKY  1321
             MPG     KR  E  MC S+ +  D P  SK+    T  + VDD   P+LPGLPDD+AK+
Sbjct  1     MPGFVSENKRFKEPNMCLSNLVMQDTPIRSKSYRSLTP-LAVDDFDIPILPGLPDDIAKH  59

Query  1320  CLALVPRYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWLYVLTVDADGKESHWEVL  1141
             CLALVPR  FP M GV K+WR FI+SKE I VR+LA +LEEWLYVLT D  G  SHWEVL
Sbjct  60    CLALVPRSNFPVMSGVCKKWRHFIQSKELITVRQLAGVLEEWLYVLTTDTQGNPSHWEVL  119

Query  1140  DCLGHKHHQLPQMPAPIRAGFGVAVLNAKLLVMGGYSMIDESASVSPEVFQYDSCLNSWS  961
             DCLG KHH LP MP P+R+GFGV VL+ KLLV+GGYS+   ++  S +V+QYDSCLN W 
Sbjct  120   DCLGCKHHILPSMPGPMRSGFGVVVLSGKLLVIGGYSVTSGTSVASEDVYQYDSCLNRWG  179

Query  960   KLASMNVARYDFACAEVNGMVYAVGGNGVNGESLSCAEVYDPDTNKWRVIESLRRPRWGC  781
             KLAS+NVAR+DFACAEV GM+YAVGG G++G SLS AEVY+PDT+ W +IESLRRPR+GC
Sbjct  180   KLASLNVARHDFACAEVGGMIYAVGGFGIDGSSLSSAEVYNPDTDTWTLIESLRRPRYGC  239

Query  780   FGCGFEGKLYVMGGRSSFTIGNSRFVDVYNPERQSWCEMKNGCVMVTAHAVVGKKLFCIE  601
             F CGFEG+LYVMGGRSSFTIGNS+FVDVY+PE+ +WCEMKNGCVMVTAHAV+ KKLFC+E
Sbjct  240   FACGFEGRLYVMGGRSSFTIGNSKFVDVYDPEKHTWCEMKNGCVMVTAHAVLEKKLFCLE  299

Query  600   WKNQRKLGIFNPEDNSWKMVGVPVTGSSSIGFRLGILDEKLLLFSLQENPTYTTLLYDPN  421
             WKNQRKL I+NPEDNSW+MV +P+TGS+SI FR GIL EKLLLFSL+E P Y TLLYDPN
Sbjct  300   WKNQRKLSIYNPEDNSWEMVQIPLTGSTSIKFRFGILGEKLLLFSLEEEPGYRTLLYDPN  359

Query  420   AAAGSEWQTCEIKPSGSCLCSVTIKA  343
             A  GSEWQT E+KPSG C C VTIK 
Sbjct  360   ATPGSEWQTSEVKPSGPCFCCVTIKV  385



>ref|XP_006376126.1| hypothetical protein POPTR_0013s10040g [Populus trichocarpa]
 gb|ERP53923.1| hypothetical protein POPTR_0013s10040g [Populus trichocarpa]
Length=431

 Score =   560 bits (1442),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/349 (76%), Positives = 300/349 (86%), Gaps = 0/349 (0%)
 Frame = -1

Query  1389  SSVVVDDSYSPLLPGLPDDVAKYCLALVPRYYFPAMGGVNKRWRSFIRSKEFIMVRKLAC  1210
             +S + +D  SP+LPGLPDDVAKYCLALVPR +FP MG V K+WRSF++SKE I +RKLA 
Sbjct  83    ASQIPNDIDSPILPGLPDDVAKYCLALVPRSHFPTMGSVCKKWRSFLKSKELITIRKLAG  142

Query  1209  LLEEWLYVLTVDADGKESHWEVLDCLGHKHHQLPQMPAPIRAGFGVAVLNAKLLVMGGYS  1030
             LLEEWLYVLT+D++ KESHWEV DCLGHKH  LP MP P++A FGV VLN KLLVM GYS
Sbjct  143   LLEEWLYVLTMDSEAKESHWEVFDCLGHKHQLLPPMPGPVKAEFGVVVLNGKLLVMAGYS  202

Query  1029  MIDESASVSPEVFQYDSCLNSWSKLASMNVARYDFACAEVNGMVYAVGGNGVNGESLSCA  850
             +ID + S S +V++YDSCLNSW KLASMNVARY+FACAEVNG VY VGGNG++G+SLS  
Sbjct  203   VIDGTGSASADVYEYDSCLNSWRKLASMNVARYEFACAEVNGKVYVVGGNGMDGDSLSSV  262

Query  849   EVYDPDTNKWRVIESLRRPRWGCFGCGFEGKLYVMGGRSSFTIGNSRFVDVYNPERQSWC  670
             E+Y+PDT+KW +IESLRRPR GCF C FEGKLYVMGGRSSFTIGNS+FVDVYNPE  +WC
Sbjct  263   EMYNPDTDKWTLIESLRRPRRGCFACSFEGKLYVMGGRSSFTIGNSKFVDVYNPEGHTWC  322

Query  669   EMKNGCVMVTAHAVVGKKLFCIEWKNQRKLGIFNPEDNSWKMVGVPVTGSSSIGFRLGIL  490
             EMKNG VMVTAHAV+GKKLFC+EWKNQRKL IF+PEDNSWKMV VP+TGSSSIGFR GIL
Sbjct  323   EMKNGRVMVTAHAVLGKKLFCMEWKNQRKLAIFSPEDNSWKMVPVPLTGSSSIGFRFGIL  382

Query  489   DEKLLLFSLQENPTYTTLLYDPNAAAGSEWQTCEIKPSGSCLCSVTIKA  343
             D KLLLFS +  P Y TLLYDP+A+ GSEWQT EIKPSG CLCSVTIKA
Sbjct  383   DGKLLLFSQEMEPGYRTLLYDPDASPGSEWQTSEIKPSGWCLCSVTIKA  431



>ref|XP_008222133.1| PREDICTED: F-box/kelch-repeat protein At1g67480 [Prunus mume]
 ref|XP_008222135.1| PREDICTED: F-box/kelch-repeat protein At1g67480 [Prunus mume]
Length=385

 Score =   556 bits (1434),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/386 (69%), Positives = 311/386 (81%), Gaps = 1/386 (0%)
 Frame = -1

Query  1500  MPGTNCGKKRVTELKMCFSDEMNLDNPGHSKNISYFTSSVVVDDSYSPLLPGLPDDVAKY  1321
             MPG     KR  E  M  S+ +  D P  SK+    TS +VVDD  SP+LPGLPDD+AK+
Sbjct  1     MPGFVSENKRFREPNMRLSNLVMQDTPIRSKSYRSLTS-LVVDDFDSPILPGLPDDIAKH  59

Query  1320  CLALVPRYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWLYVLTVDADGKESHWEVL  1141
             CLALVPR  FP M GV K+WR FI+SKE I VR+LA +LEEWLYVLT D+ GK SHWEVL
Sbjct  60    CLALVPRSNFPVMSGVCKKWRHFIQSKELITVRQLAGVLEEWLYVLTTDSQGKPSHWEVL  119

Query  1140  DCLGHKHHQLPQMPAPIRAGFGVAVLNAKLLVMGGYSMIDESASVSPEVFQYDSCLNSWS  961
             DCLG KHH LP M  P+ +GFGV VL+ KLLV+GGYS+   ++  S +V+QYDSCLN W 
Sbjct  120   DCLGRKHHILPSMTGPMGSGFGVVVLSGKLLVIGGYSVTSGTSVASEDVYQYDSCLNRWG  179

Query  960   KLASMNVARYDFACAEVNGMVYAVGGNGVNGESLSCAEVYDPDTNKWRVIESLRRPRWGC  781
             KLAS+NVAR+DFACAEV+GM+YAVGG G++G SLS AEVY+PDT+ W +IESLRRPR+GC
Sbjct  180   KLASLNVARHDFACAEVSGMIYAVGGFGIDGSSLSSAEVYNPDTDTWTLIESLRRPRYGC  239

Query  780   FGCGFEGKLYVMGGRSSFTIGNSRFVDVYNPERQSWCEMKNGCVMVTAHAVVGKKLFCIE  601
             F CGFEGKLYVMGGRSSFTIGNS+FVDVY+PE+ +WCEMKNGCVMVTAHAV+ KKLFC+E
Sbjct  240   FACGFEGKLYVMGGRSSFTIGNSKFVDVYDPEKHTWCEMKNGCVMVTAHAVLEKKLFCLE  299

Query  600   WKNQRKLGIFNPEDNSWKMVGVPVTGSSSIGFRLGILDEKLLLFSLQENPTYTTLLYDPN  421
             WKNQRKL I+NPEDNSW+MV +P+TGS+SI F+ GIL EKLLLFSL+E P Y TLLYDPN
Sbjct  300   WKNQRKLSIYNPEDNSWEMVQIPLTGSTSIKFQFGILGEKLLLFSLEEEPGYCTLLYDPN  359

Query  420   AAAGSEWQTCEIKPSGSCLCSVTIKA  343
             A  GSEWQT E+KPSG C C VTIK 
Sbjct  360   ATPGSEWQTSEVKPSGPCFCCVTIKV  385



>ref|XP_011029680.1| PREDICTED: F-box/kelch-repeat protein At1g67480-like [Populus 
euphratica]
 ref|XP_011029681.1| PREDICTED: F-box/kelch-repeat protein At1g67480-like [Populus 
euphratica]
 ref|XP_011029682.1| PREDICTED: F-box/kelch-repeat protein At1g67480-like [Populus 
euphratica]
 ref|XP_011029684.1| PREDICTED: F-box/kelch-repeat protein At1g67480-like [Populus 
euphratica]
 ref|XP_011029685.1| PREDICTED: F-box/kelch-repeat protein At1g67480-like [Populus 
euphratica]
 ref|XP_011029686.1| PREDICTED: F-box/kelch-repeat protein At1g67480-like [Populus 
euphratica]
 ref|XP_011029687.1| PREDICTED: F-box/kelch-repeat protein At1g67480-like [Populus 
euphratica]
 ref|XP_011029688.1| PREDICTED: F-box/kelch-repeat protein At1g67480-like [Populus 
euphratica]
 ref|XP_011029689.1| PREDICTED: F-box/kelch-repeat protein At1g67480-like [Populus 
euphratica]
 ref|XP_011029690.1| PREDICTED: F-box/kelch-repeat protein At1g67480-like [Populus 
euphratica]
 ref|XP_011029691.1| PREDICTED: F-box/kelch-repeat protein At1g67480-like [Populus 
euphratica]
 ref|XP_011029692.1| PREDICTED: F-box/kelch-repeat protein At1g67480-like [Populus 
euphratica]
 ref|XP_011013463.1| PREDICTED: F-box/kelch-repeat protein At1g67480-like [Populus 
euphratica]
 ref|XP_011013464.1| PREDICTED: F-box/kelch-repeat protein At1g67480-like [Populus 
euphratica]
 ref|XP_011013466.1| PREDICTED: F-box/kelch-repeat protein At1g67480-like [Populus 
euphratica]
 ref|XP_011013467.1| PREDICTED: F-box/kelch-repeat protein At1g67480-like [Populus 
euphratica]
 ref|XP_011013468.1| PREDICTED: F-box/kelch-repeat protein At1g67480-like [Populus 
euphratica]
 ref|XP_011013469.1| PREDICTED: F-box/kelch-repeat protein At1g67480-like [Populus 
euphratica]
 ref|XP_011013470.1| PREDICTED: F-box/kelch-repeat protein At1g67480-like [Populus 
euphratica]
 ref|XP_011013471.1| PREDICTED: F-box/kelch-repeat protein At1g67480-like [Populus 
euphratica]
 ref|XP_011013472.1| PREDICTED: F-box/kelch-repeat protein At1g67480-like [Populus 
euphratica]
 ref|XP_011013473.1| PREDICTED: F-box/kelch-repeat protein At1g67480-like [Populus 
euphratica]
 ref|XP_011013474.1| PREDICTED: F-box/kelch-repeat protein At1g67480-like [Populus 
euphratica]
 ref|XP_011013475.1| PREDICTED: F-box/kelch-repeat protein At1g67480-like [Populus 
euphratica]
Length=385

 Score =   555 bits (1430),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/386 (70%), Positives = 307/386 (80%), Gaps = 1/386 (0%)
 Frame = -1

Query  1500  MPGTNCGKKRVTELKMCFSDEMNLDNPGHSKNISYFTSSVVVDDSYSPLLPGLPDDVAKY  1321
             MPG    KK   +  M F   +  DNP      +    S V  D    ++PGLPDDVAKY
Sbjct  1     MPGF-ASKKGFLDTSMSFFTLITQDNPPVHSKSNPVVDSRVAHDIDGLIVPGLPDDVAKY  59

Query  1320  CLALVPRYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWLYVLTVDADGKESHWEVL  1141
             CLALVPR Y PA+G V K+WRSF+RS+EFI VRKLA LLEEWLYVLT+D++ KESHW VL
Sbjct  60    CLALVPRRYLPAIGAVCKKWRSFLRSQEFITVRKLAGLLEEWLYVLTMDSERKESHWVVL  119

Query  1140  DCLGHKHHQLPQMPAPIRAGFGVAVLNAKLLVMGGYSMIDESASVSPEVFQYDSCLNSWS  961
             D LGHK   LP MP P +AGFGV VLN KLLVM G+S+ID + + S +V++YD CLNSW+
Sbjct  120   DRLGHKRQLLPPMPGPTKAGFGVVVLNGKLLVMAGHSLIDGTGTASADVYEYDCCLNSWT  179

Query  960   KLASMNVARYDFACAEVNGMVYAVGGNGVNGESLSCAEVYDPDTNKWRVIESLRRPRWGC  781
             KL+ MNVARYDFACAEVNG VYA GG G++G+SLS  E+YDPDTN W +IESLRRPRWGC
Sbjct  180   KLSRMNVARYDFACAEVNGKVYAAGGYGMDGDSLSSVEMYDPDTNTWTMIESLRRPRWGC  239

Query  780   FGCGFEGKLYVMGGRSSFTIGNSRFVDVYNPERQSWCEMKNGCVMVTAHAVVGKKLFCIE  601
             F CGFEGKLYVMGGRS+F+IGNSR VDVY PER SWCE+KNGCVMVTAHAV+GKKLFC+E
Sbjct  240   FACGFEGKLYVMGGRSTFSIGNSRSVDVYTPERHSWCEIKNGCVMVTAHAVLGKKLFCME  299

Query  600   WKNQRKLGIFNPEDNSWKMVGVPVTGSSSIGFRLGILDEKLLLFSLQENPTYTTLLYDPN  421
             WKNQRKL IFNPED+SWK V VP+TGS+SIGFR GILD KLLLFSL+E P Y TLLYDP+
Sbjct  300   WKNQRKLAIFNPEDSSWKTVAVPLTGSTSIGFRFGILDGKLLLFSLREEPGYRTLLYDPD  359

Query  420   AAAGSEWQTCEIKPSGSCLCSVTIKA  343
             A+ GSEW T EIKPSG CLCSVTIKA
Sbjct  360   ASPGSEWCTSEIKPSGCCLCSVTIKA  385



>gb|KCW61966.1| hypothetical protein EUGRSUZ_H04652 [Eucalyptus grandis]
Length=378

 Score =   553 bits (1426),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/385 (70%), Positives = 311/385 (81%), Gaps = 8/385 (2%)
 Frame = -1

Query  1500  MPGTNCGKKRVTELKMCFSDEMNLDNPGHSKNISYFTSSVVVDDSYSPLLPGLPDDVAKY  1321
             MP     KKR TE  M FS+ ++   P  SK+ +   ++ + DD  SP+LPGLPD VA +
Sbjct  1     MPCFVSEKKRSTEQAMFFSNSVHESTPARSKS-NLPIATPIADDFGSPILPGLPDHVADH  59

Query  1320  CLALVPRYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWLYVLTVDADGKESHWEVL  1141
             CLALVPR  FP+MG V K+WR+ ++S+EF++VRKLA ++EEWLYVLT+DA+GKESHWEV 
Sbjct  60    CLALVPRCNFPSMGAVCKKWRTVLQSREFLIVRKLAKVVEEWLYVLTMDAEGKESHWEVF  119

Query  1140  DCLGHKHHQLPQMPAPIRAGFGVAVLNAKLLVMGGYSMIDESASVSPEVFQYDSCLNSWS  961
             DCLGHK  QLP MP P+++GFGV VLN KL VM GYS +D   S S EV+        WS
Sbjct  120   DCLGHKIRQLPLMPGPVKSGFGVVVLNGKLFVMAGYSSLDGPCSASAEVYH-------WS  172

Query  960   KLASMNVARYDFACAEVNGMVYAVGGNGVNGESLSCAEVYDPDTNKWRVIESLRRPRWGC  781
             KLASMNVARYDFACAEVNG+VY VGG G+ GESLS AEVYDPD++KW +IESLRRPRWGC
Sbjct  173   KLASMNVARYDFACAEVNGLVYVVGGYGIEGESLSSAEVYDPDSDKWTLIESLRRPRWGC  232

Query  780   FGCGFEGKLYVMGGRSSFTIGNSRFVDVYNPERQSWCEMKNGCVMVTAHAVVGKKLFCIE  601
             F C FEGKLYVMGGRSSFTIGNSRFVDVYNPE+ +WCEMKNG VMVTAHAV+GKKLFC+E
Sbjct  233   FACSFEGKLYVMGGRSSFTIGNSRFVDVYNPEQHTWCEMKNGRVMVTAHAVLGKKLFCME  292

Query  600   WKNQRKLGIFNPEDNSWKMVGVPVTGSSSIGFRLGILDEKLLLFSLQENPTYTTLLYDPN  421
             WKNQRKL I+NPEDNSW  V VP+TGSSSIGF+ GIL+ KLLLFSL+E+P Y TLLYDPN
Sbjct  293   WKNQRKLAIYNPEDNSWSTVPVPLTGSSSIGFQFGILEGKLLLFSLKEDPEYHTLLYDPN  352

Query  420   AAAGSEWQTCEIKPSGSCLCSVTIK  346
             AA GSEWQT EIKPSG CLCSVTIK
Sbjct  353   AAPGSEWQTSEIKPSGLCLCSVTIK  377



>ref|XP_008806043.1| PREDICTED: F-box/kelch-repeat protein At1g67480-like [Phoenix 
dactylifera]
 ref|XP_008806044.1| PREDICTED: F-box/kelch-repeat protein At1g67480-like [Phoenix 
dactylifera]
 ref|XP_008806045.1| PREDICTED: F-box/kelch-repeat protein At1g67480-like [Phoenix 
dactylifera]
Length=384

 Score =   552 bits (1422),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/378 (72%), Positives = 297/378 (79%), Gaps = 1/378 (0%)
 Frame = -1

Query  1476  KRVTELKMCFSDEMNLDNPGHSKNISYFTSSVVVDDSYSPLLPGLPDDVAKYCLALVPRY  1297
             K   E +M  S  M  +   H K  S  T      D Y PLLPGLPDDVAKYCLALVPR 
Sbjct  8     KLFAESEMYLSTTMQNNFATHLKVSSRLTIQAP-QDRYCPLLPGLPDDVAKYCLALVPRC  66

Query  1296  YFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWLYVLTVDADGKESHWEVLDCLGHKHH  1117
             YFP MG V KRW SFI+SKEF +VRK A  LEEWLY+LT DA+GK SHWEVL CLG KH 
Sbjct  67    YFPVMGAVCKRWMSFIQSKEFTIVRKEAGKLEEWLYILTGDAEGKGSHWEVLGCLGEKHQ  126

Query  1116  QLPQMPAPIRAGFGVAVLNAKLLVMGGYSMIDESASVSPEVFQYDSCLNSWSKLASMNVA  937
              LP MP P++AGFGV VL  KL V+ GYS+   +  VS +V+QYDS LN WS LA MNVA
Sbjct  127   LLPPMPGPVKAGFGVVVLGGKLFVIAGYSVDAGTGRVSDDVYQYDSRLNRWSMLAKMNVA  186

Query  936   RYDFACAEVNGMVYAVGGNGVNGESLSCAEVYDPDTNKWRVIESLRRPRWGCFGCGFEGK  757
             RYDF CAEVNG +YAVGG G +GESLS AEVYDPD NKW +IESLRRPRWGCF CGFEGK
Sbjct  187   RYDFGCAEVNGAIYAVGGYGSDGESLSSAEVYDPDKNKWTLIESLRRPRWGCFACGFEGK  246

Query  756   LYVMGGRSSFTIGNSRFVDVYNPERQSWCEMKNGCVMVTAHAVVGKKLFCIEWKNQRKLG  577
             LYVMGGRSSFTIGNSRFVDVYNPE+ SWCEMKNGCVMVT+HAV+GKKLFC+EWKNQRKL 
Sbjct  247   LYVMGGRSSFTIGNSRFVDVYNPEQHSWCEMKNGCVMVTSHAVLGKKLFCMEWKNQRKLA  306

Query  576   IFNPEDNSWKMVGVPVTGSSSIGFRLGILDEKLLLFSLQENPTYTTLLYDPNAAAGSEWQ  397
             IFNP D+SW+ V VP+TGSS+IGFR GILD KLLLFSL+E P Y TLLYDPNA  GSEWQ
Sbjct  307   IFNPADSSWQKVPVPLTGSSAIGFRFGILDGKLLLFSLEEEPGYQTLLYDPNAPVGSEWQ  366

Query  396   TCEIKPSGSCLCSVTIKA  343
             T  +KPSG CLCSVTIKA
Sbjct  367   TSSLKPSGLCLCSVTIKA  384



>emb|CAN74339.1| hypothetical protein VITISV_018334 [Vitis vinifera]
Length=371

 Score =   548 bits (1413),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/386 (71%), Positives = 303/386 (78%), Gaps = 15/386 (4%)
 Frame = -1

Query  1500  MPGTNCGKKRVTELKMCFSDEMNLDNPGHSKNISYFTSSVVVDDSYSPLLPGLPDDVAKY  1321
             MPG   GKKR T+  MC S+ +  D    SK+    TS    DDSY P+LPGLPD   K 
Sbjct  1     MPGIVAGKKRFTQSNMCLSNSVQQDTLTLSKSNPCLTSQFA-DDSYGPILPGLPDGCGKI  59

Query  1320  CLALVPRYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWLYVLTVDADGKESHWEVL  1141
                                  SFIRSKEFI VRKLA +LEEWLYVLT+DA+GK SHWEVL
Sbjct  60    LPCTCSS--------------SFIRSKEFITVRKLAGMLEEWLYVLTMDAEGKGSHWEVL  105

Query  1140  DCLGHKHHQLPQMPAPIRAGFGVAVLNAKLLVMGGYSMIDESASVSPEVFQYDSCLNSWS  961
             DCLGHKH  LP MP P++ GF V VLN KLLVM G S++  + S S +V+QYDSCLNSWS
Sbjct  106   DCLGHKHQLLPPMPGPVKTGFEVVVLNGKLLVMAGCSVVGRTGSASADVYQYDSCLNSWS  165

Query  960   KLASMNVARYDFACAEVNGMVYAVGGNGVNGESLSCAEVYDPDTNKWRVIESLRRPRWGC  781
             KLA+MNVARYDFACAEVNGMVYAVGG G +G+SLS AE+YD D +KW +IESLRRPR+GC
Sbjct  166   KLANMNVARYDFACAEVNGMVYAVGGYGADGDSLSSAEMYDADADKWILIESLRRPRYGC  225

Query  780   FGCGFEGKLYVMGGRSSFTIGNSRFVDVYNPERQSWCEMKNGCVMVTAHAVVGKKLFCIE  601
             F CGFEGKLYVMGGRSSFTIGNSRFVDVYNPER +WCEMKNG VMVTAHAV+GKKLFC+E
Sbjct  226   FACGFEGKLYVMGGRSSFTIGNSRFVDVYNPERHTWCEMKNGRVMVTAHAVLGKKLFCME  285

Query  600   WKNQRKLGIFNPEDNSWKMVGVPVTGSSSIGFRLGILDEKLLLFSLQENPTYTTLLYDPN  421
             WKNQRKL IFNPEDNSWKMV VP+TGSSSIGFR GIL+ KLLLFSL+E+P Y TLLYDP+
Sbjct  286   WKNQRKLAIFNPEDNSWKMVPVPLTGSSSIGFRFGILEGKLLLFSLEEDPGYRTLLYDPD  345

Query  420   AAAGSEWQTCEIKPSGSCLCSVTIKA  343
             AA GSEWQT EIKPSGSCLCSVTIKA
Sbjct  346   AAPGSEWQTSEIKPSGSCLCSVTIKA  371



>ref|XP_008351068.1| PREDICTED: F-box/kelch-repeat protein At1g67480-like [Malus domestica]
Length=463

 Score =   549 bits (1415),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/380 (69%), Positives = 311/380 (82%), Gaps = 2/380 (1%)
 Frame = -1

Query  1479  KKRVTELKMCFSDEMNLDNPGHSKNISYFTSSVVVDDSYSPLLPGLPDDVAKYCLALVPR  1300
             K+R  +  MC S+ +  D P  +K+    TS + VDDS SP+LPGLPDDVAKYCLALVP 
Sbjct  85    KRRFIDPNMCRSNLVKQDAPIGAKSYRSLTS-LEVDDSESPILPGLPDDVAKYCLALVPH  143

Query  1299  YYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWLYVLTVDADGKESHWEVLDCLGHKH  1120
               FPAMGGV K+WR F++SKE I VR+LA LLEEWLYVLT D++GKE+HWEVLDC GHKH
Sbjct  144   SDFPAMGGVCKKWRYFLQSKELITVRQLAGLLEEWLYVLTTDSEGKENHWEVLDCHGHKH  203

Query  1119  HQLPQMPAPIRAGFGVAVLNAKLLVMGGYSMIDESASVSPEVFQYDSCLNSWSKLASMNV  940
             H LP MP P R GFGVAVLN KLLV+GGYS I  +   S +V+QYDSCLN W KLA+MNV
Sbjct  204   HVLPPMPGPTRFGFGVAVLNGKLLVVGGYSAIPGTTVASEDVYQYDSCLNRWGKLANMNV  263

Query  939   ARYDFACAEVNGMVYAVGGNGVNGESLSCAEVYDPDTNKWRVIESLRRPRWGCFGCGFEG  760
             AR+DFACAE++GM+YAVGG G++G SLS AEVY+PDT+ W +I S+RRPR+GCF CGFEG
Sbjct  264   ARHDFACAELSGMIYAVGGYGIDGSSLSSAEVYNPDTDTWTLISSIRRPRYGCFACGFEG  323

Query  759   KLYVMGGRSSFTIGNSRFVDVYNPERQSWCEM-KNGCVMVTAHAVVGKKLFCIEWKNQRK  583
             KLYVMGGRSSF+IGNS+FVDVY+PE  +W EM KNGCVMVTAHAV+ KKLFC+EW+NQRK
Sbjct  324   KLYVMGGRSSFSIGNSKFVDVYDPESHTWGEMKKNGCVMVTAHAVLEKKLFCLEWRNQRK  383

Query  582   LGIFNPEDNSWKMVGVPVTGSSSIGFRLGILDEKLLLFSLQENPTYTTLLYDPNAAAGSE  403
             L I+NP+DNSW+MV +P+TGS+SI  R GILD+KLLLFSL+E+P Y TLLYDPNAA GSE
Sbjct  384   LSIYNPDDNSWEMVQIPLTGSTSIKLRFGILDDKLLLFSLEEDPGYRTLLYDPNAAPGSE  443

Query  402   WQTCEIKPSGSCLCSVTIKA  343
             W T E+K SG CLC VTIK 
Sbjct  444   WLTSEVKLSGPCLCCVTIKV  463



>ref|XP_008445494.1| PREDICTED: F-box/kelch-repeat protein At1g67480 [Cucumis melo]
 ref|XP_008445495.1| PREDICTED: F-box/kelch-repeat protein At1g67480 [Cucumis melo]
Length=382

 Score =   545 bits (1403),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/386 (69%), Positives = 305/386 (79%), Gaps = 4/386 (1%)
 Frame = -1

Query  1500  MPGTNCGKKRVTELKMCFSDEMNLDNPGHSKNISYFTSSVVVDDSYSPLLPGLPDDVAKY  1321
             MPG   GKKR+TE KMC  + +  ++   SK+ + F S       Y  LLPGLPDDVAK 
Sbjct  1     MPGFISGKKRLTEPKMCIINTVKQNSICLSKSDTGFHSQY----DYESLLPGLPDDVAKL  56

Query  1320  CLALVPRYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWLYVLTVDADGKESHWEVL  1141
             CLALVPR   P+M GV+K WRSFI+ KEFI  RKLA  +EEWLY LT+D   KE HWEV 
Sbjct  57    CLALVPRSSHPSMAGVSKNWRSFIKGKEFITERKLAGAVEEWLYFLTMDTVRKECHWEVF  116

Query  1140  DCLGHKHHQLPQMPAPIRAGFGVAVLNAKLLVMGGYSMIDESASVSPEVFQYDSCLNSWS  961
             DC+ HK   LP MP  ++AGF V VLN KLLV+ GYS+ D + SVS +V+QYDSCLN WS
Sbjct  117   DCVEHKFRVLPPMPGAVKAGFEVVVLNGKLLVIAGYSIADGTDSVSSDVYQYDSCLNRWS  176

Query  960   KLASMNVARYDFACAEVNGMVYAVGGNGVNGESLSCAEVYDPDTNKWRVIESLRRPRWGC  781
             KLA++NVARYDFACA V+G+VY VGG GV G++LS AEVYDP+T+KW +IESLRRPR GC
Sbjct  177   KLANLNVARYDFACAAVDGIVYVVGGYGVEGDNLSSAEVYDPETDKWTLIESLRRPRSGC  236

Query  780   FGCGFEGKLYVMGGRSSFTIGNSRFVDVYNPERQSWCEMKNGCVMVTAHAVVGKKLFCIE  601
             F CGF+GKLYVMGGRSSFTIGNS+FVDVYNP+R SWCEMKNGCVMVTAHAVVGKKLFC+E
Sbjct  237   FACGFDGKLYVMGGRSSFTIGNSKFVDVYNPKRHSWCEMKNGCVMVTAHAVVGKKLFCME  296

Query  600   WKNQRKLGIFNPEDNSWKMVGVPVTGSSSIGFRLGILDEKLLLFSLQENPTYTTLLYDPN  421
             WKNQRKL +FNPEDNSWK V VP+TGSSSIGFR GILD KLLLFSL+  P Y TL YDPN
Sbjct  297   WKNQRKLSMFNPEDNSWKTVPVPLTGSSSIGFRFGILDGKLLLFSLKNEPEYRTLSYDPN  356

Query  420   AAAGSEWQTCEIKPSGSCLCSVTIKA  343
             A  GSEW+T +IKPSG CLCSVTIK 
Sbjct  357   ATPGSEWKTSDIKPSGLCLCSVTIKV  382



>ref|XP_002314539.1| hypothetical protein POPTR_0010s06910g [Populus trichocarpa]
 gb|EEF00710.1| hypothetical protein POPTR_0010s06910g [Populus trichocarpa]
Length=385

 Score =   543 bits (1399),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/379 (69%), Positives = 302/379 (80%), Gaps = 0/379 (0%)
 Frame = -1

Query  1479  KKRVTELKMCFSDEMNLDNPGHSKNISYFTSSVVVDDSYSPLLPGLPDDVAKYCLALVPR  1300
             KKR  +  M F   +  +N       +   +S   DD  S +LPGLPDDVAKYCLALVPR
Sbjct  7     KKRFLDTSMSFCTLITHENHQVYSKSNLLLASRGSDDIDSSILPGLPDDVAKYCLALVPR  66

Query  1299  YYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWLYVLTVDADGKESHWEVLDCLGHKH  1120
              Y PAMG V K+WRSF+++KEFI VRKLA LLEEWL+VLT+D++GKESHW VLDCLG K 
Sbjct  67    RYLPAMGAVCKKWRSFLKTKEFITVRKLAGLLEEWLFVLTMDSEGKESHWVVLDCLGLKR  126

Query  1119  HQLPQMPAPIRAGFGVAVLNAKLLVMGGYSMIDESASVSPEVFQYDSCLNSWSKLASMNV  940
               LP MP   +AGFGV VLN KLLVM GYS+I+ + + S +V++YD  LNSWSKL+SMNV
Sbjct  127   QLLPPMPGSTKAGFGVVVLNGKLLVMAGYSVIEGTGTASADVYEYDCYLNSWSKLSSMNV  186

Query  939   ARYDFACAEVNGMVYAVGGNGVNGESLSCAEVYDPDTNKWRVIESLRRPRWGCFGCGFEG  760
             ARYDFACAEVNG VYA GG G + +SLS  E+YDP+T++W +IESLRRPRWGCF CGFEG
Sbjct  187   ARYDFACAEVNGKVYAAGGYGTDRDSLSSVEMYDPETDRWTLIESLRRPRWGCFACGFEG  246

Query  759   KLYVMGGRSSFTIGNSRFVDVYNPERQSWCEMKNGCVMVTAHAVVGKKLFCIEWKNQRKL  580
             KLYVMGGRS+FTIGNSRFV+VYNPE+ +WCEMKNG VMVTAHAV+GKKLFC+EWKNQRKL
Sbjct  247   KLYVMGGRSTFTIGNSRFVEVYNPEKHTWCEMKNGRVMVTAHAVLGKKLFCMEWKNQRKL  306

Query  579   GIFNPEDNSWKMVGVPVTGSSSIGFRLGILDEKLLLFSLQENPTYTTLLYDPNAAAGSEW  400
              IFNPED+SWK V VP+TG+S I FR GILD KLLLFSL+E P Y TLLYDPNA+ GSEW
Sbjct  307   SIFNPEDSSWKTVAVPLTGNSIIDFRFGILDGKLLLFSLEEEPGYRTLLYDPNASPGSEW  366

Query  399   QTCEIKPSGSCLCSVTIKA  343
              T EIKPS  CLC VTIKA
Sbjct  367   CTSEIKPSARCLCCVTIKA  385



>ref|XP_010905202.1| PREDICTED: F-box/kelch-repeat protein At1g67480-like [Elaeis 
guineensis]
 ref|XP_010905203.1| PREDICTED: F-box/kelch-repeat protein At1g67480-like [Elaeis 
guineensis]
Length=384

 Score =   542 bits (1397),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/384 (70%), Positives = 300/384 (78%), Gaps = 7/384 (2%)
 Frame = -1

Query  1485  CGKKRVTELKMCFSDEMNLDNPGHSKNISYFTSSVVVD---DSYSPLLPGLPDDVAKYCL  1315
             C  K+  E +M  S  M  +   H K     +S +++    D Y PLLPGLPDDVAKYCL
Sbjct  5     CVSKQFAESEMDLSTAMQNNFATHLK----VSSRLIIQSPQDVYCPLLPGLPDDVAKYCL  60

Query  1314  ALVPRYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWLYVLTVDADGKESHWEVLDC  1135
             ALVPRYYFP MG V KRW  FI+SKEFI+VRK A  LEEWLYVLT DA+GK  HWEVL C
Sbjct  61    ALVPRYYFPVMGAVCKRWMGFIQSKEFIIVRKEARRLEEWLYVLTGDAEGKGCHWEVLGC  120

Query  1134  LGHKHHQLPQMPAPIRAGFGVAVLNAKLLVMGGYSMIDESASVSPEVFQYDSCLNSWSKL  955
              G KH  LP MP P++AGFGV VL+ KL V+ GYS+   +   S +V+QYDS LN WS L
Sbjct  121   FGEKHQLLPPMPGPVKAGFGVVVLDGKLFVLAGYSVDAGTGCASDDVYQYDSRLNRWSML  180

Query  954   ASMNVARYDFACAEVNGMVYAVGGNGVNGESLSCAEVYDPDTNKWRVIESLRRPRWGCFG  775
             A MNVARYDFACAEVNG++YAVGG G NGESLS AE+YDPD NKW +IESLR PRWGCF 
Sbjct  181   AKMNVARYDFACAEVNGVIYAVGGYGSNGESLSSAEMYDPDKNKWTLIESLRCPRWGCFA  240

Query  774   CGFEGKLYVMGGRSSFTIGNSRFVDVYNPERQSWCEMKNGCVMVTAHAVVGKKLFCIEWK  595
             C FEGKLYVMGGRSSFTIGNSRFVDVY+PE+ +WCEMKNGCVMVTAHAV+ KKLFC+EWK
Sbjct  241   CSFEGKLYVMGGRSSFTIGNSRFVDVYSPEQHTWCEMKNGCVMVTAHAVLDKKLFCMEWK  300

Query  594   NQRKLGIFNPEDNSWKMVGVPVTGSSSIGFRLGILDEKLLLFSLQENPTYTTLLYDPNAA  415
             NQRKL IFNP DNSW  V VP+TGSS+IGFR GILD KLLLFSL+E+P Y TLLYDP+A 
Sbjct  301   NQRKLAIFNPVDNSWHKVPVPLTGSSAIGFRFGILDGKLLLFSLEEDPGYQTLLYDPDAP  360

Query  414   AGSEWQTCEIKPSGSCLCSVTIKA  343
              GSEWQT  +KPSG CLCSVTIKA
Sbjct  361   VGSEWQTSSLKPSGLCLCSVTIKA  384



>ref|XP_004144194.1| PREDICTED: F-box/kelch-repeat protein At1g67480-like [Cucumis 
sativus]
 ref|XP_004158253.1| PREDICTED: F-box/kelch-repeat protein At1g67480-like [Cucumis 
sativus]
 gb|KGN47621.1| hypothetical protein Csa_6G365210 [Cucumis sativus]
Length=382

 Score =   540 bits (1391),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/386 (69%), Positives = 305/386 (79%), Gaps = 4/386 (1%)
 Frame = -1

Query  1500  MPGTNCGKKRVTELKMCFSDEMNLDNPGHSKNISYFTSSVVVDDSYSPLLPGLPDDVAKY  1321
             MPG   GKKR+TE KMC  + +  ++   SK+ + F S       +  LLPGLPDDVAK 
Sbjct  1     MPGFISGKKRLTEPKMCIINTVKQNSICLSKSDTGFHSQF----DHVSLLPGLPDDVAKL  56

Query  1320  CLALVPRYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWLYVLTVDADGKESHWEVL  1141
             CLALVPR   P+M GV+K WRSFI+ KEFI  RKLA  +EEWLY LT+D   KE HWEV 
Sbjct  57    CLALVPRSSHPSMAGVSKNWRSFIKGKEFITERKLAGAVEEWLYFLTMDTVRKECHWEVF  116

Query  1140  DCLGHKHHQLPQMPAPIRAGFGVAVLNAKLLVMGGYSMIDESASVSPEVFQYDSCLNSWS  961
             D +  K   LP MP  ++AGF V VLN KLLV+ GYS+ D + SVS +V+QYDSCLN WS
Sbjct  117   DGVERKFRVLPPMPGAVKAGFEVVVLNGKLLVIAGYSIADGTDSVSSDVYQYDSCLNRWS  176

Query  960   KLASMNVARYDFACAEVNGMVYAVGGNGVNGESLSCAEVYDPDTNKWRVIESLRRPRWGC  781
             KLA++NVARYDFACA V+G+VY VGG GV G++LS AEVYDP+T+KW +IESLRRPR GC
Sbjct  177   KLANLNVARYDFACATVDGIVYVVGGYGVEGDNLSSAEVYDPETDKWTLIESLRRPRSGC  236

Query  780   FGCGFEGKLYVMGGRSSFTIGNSRFVDVYNPERQSWCEMKNGCVMVTAHAVVGKKLFCIE  601
             F CGF+GKLYVMGGRSSFTIGNS+FVDVYNP+R SWCEMKNGCVMVTAHAVVGKKLFC+E
Sbjct  237   FACGFDGKLYVMGGRSSFTIGNSKFVDVYNPKRHSWCEMKNGCVMVTAHAVVGKKLFCME  296

Query  600   WKNQRKLGIFNPEDNSWKMVGVPVTGSSSIGFRLGILDEKLLLFSLQENPTYTTLLYDPN  421
             WKNQRKL +FNPEDNSWKMV VP+TGSSSIGFR GILD KLLLFSL+  P Y TLLYDPN
Sbjct  297   WKNQRKLSMFNPEDNSWKMVPVPLTGSSSIGFRFGILDGKLLLFSLKNEPEYRTLLYDPN  356

Query  420   AAAGSEWQTCEIKPSGSCLCSVTIKA  343
             A  GSEW+T +IKPSG CLCSVTIK 
Sbjct  357   ATPGSEWKTSDIKPSGLCLCSVTIKV  382



>gb|EYU25914.1| hypothetical protein MIMGU_mgv1a007608mg [Erythranthe guttata]
Length=402

 Score =   540 bits (1391),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/349 (73%), Positives = 298/349 (85%), Gaps = 1/349 (0%)
 Frame = -1

Query  1386  SVVVDDSYSPLLPGLPDDVAKYCLALVPRYYFPAMGGVNKRWRSFIRSKEFIMVRKLACL  1207
             S + +D +S +LPGLPDDV+K CL+LVPR  FPAMG V+KRWRS+I+SKEF+ VRKLA +
Sbjct  54    SKIAEDYHSSILPGLPDDVSKQCLSLVPRSNFPAMGAVSKRWRSYIKSKEFVTVRKLAGV  113

Query  1206  LEEWLYVLTVDADGKESHWEVLDCLGHKHHQLPQMPAPIRAGFGVAVLNAKLLVMGGYSM  1027
             +EEWLYVLTVD +GKESHWEVLDC G+K  +L  MP P++AGFGV VLN KLLV+ GYS+
Sbjct  114   VEEWLYVLTVDDEGKESHWEVLDCSGNKRCRLLPMPGPVKAGFGVVVLNGKLLVIAGYSV  173

Query  1026  IDESASVSPEVFQYDSCLNSWSKLASMNVARYDFACAEVNGMVYAVGGNGVNGESLSCAE  847
             +D + SVS +V+QYD CLNSWSKLASMNVARYDFACAEV+GMVYAVGG G +GESLSCAE
Sbjct  174   VDGTGSVSADVYQYDPCLNSWSKLASMNVARYDFACAEVDGMVYAVGGCGADGESLSCAE  233

Query  846   VYDPDTNKWRVIESLRRPRWGCFGCGFEGKLYVMGGRSSFTIGNSRFVDVYNPERQSWC-  670
             VYDPD+++W  IESLRRPRWGCF C F+GKLYVMGGRS+F+IGNSRFVDVY+P+ +SW  
Sbjct  234   VYDPDSDRWTAIESLRRPRWGCFACSFQGKLYVMGGRSTFSIGNSRFVDVYSPKSRSWAP  293

Query  669   EMKNGCVMVTAHAVVGKKLFCIEWKNQRKLGIFNPEDNSWKMVGVPVTGSSSIGFRLGIL  490
             +MKNGCVMVTAHAVVG +L C+EWKN+R+L IFNP DNSWKMV +PV GSSSIGFR GIL
Sbjct  294   QMKNGCVMVTAHAVVGGRLCCMEWKNERRLAIFNPSDNSWKMVPIPVNGSSSIGFRFGIL  353

Query  489   DEKLLLFSLQENPTYTTLLYDPNAAAGSEWQTCEIKPSGSCLCSVTIKA  343
               KLLLFS+Q +P+Y TL+YDP AA GSEW   EIKPSGS LCSVTI A
Sbjct  354   KGKLLLFSVQADPSYRTLVYDPEAAPGSEWGVSEIKPSGSFLCSVTIAA  402



>ref|XP_010929773.1| PREDICTED: F-box/kelch-repeat protein At1g67480-like [Elaeis 
guineensis]
 ref|XP_010929774.1| PREDICTED: F-box/kelch-repeat protein At1g67480-like [Elaeis 
guineensis]
Length=384

 Score =   534 bits (1375),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/343 (75%), Positives = 282/343 (82%), Gaps = 0/343 (0%)
 Frame = -1

Query  1371  DSYSPLLPGLPDDVAKYCLALVPRYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWL  1192
             D Y PLLPGLPDDVAKYCLALVPR YFP MG V KRWRSFI+SKEFI VRK A  LEEWL
Sbjct  42    DMYCPLLPGLPDDVAKYCLALVPRGYFPVMGAVCKRWRSFIQSKEFITVRKEAGKLEEWL  101

Query  1191  YVLTVDADGKESHWEVLDCLGHKHHQLPQMPAPIRAGFGVAVLNAKLLVMGGYSMIDESA  1012
             Y+LT DA+G+ SHWEVL C   KH  LP MP  ++AGFGVAVL+ KLLV+ GYS+   + 
Sbjct  102   YILTGDAEGQGSHWEVLGCFREKHQVLPPMPGHVKAGFGVAVLDGKLLVIAGYSVSAAAV  161

Query  1011  SVSPEVFQYDSCLNSWSKLASMNVARYDFACAEVNGMVYAVGGNGVNGESLSCAEVYDPD  832
              VS +V+QYDS LN WS LA MNVARYDFACAEVNG++YAVGG G  GESLS  EVY PD
Sbjct  162   CVSDDVYQYDSRLNGWSMLAKMNVARYDFACAEVNGLIYAVGGYGSEGESLSSTEVYHPD  221

Query  831   TNKWRVIESLRRPRWGCFGCGFEGKLYVMGGRSSFTIGNSRFVDVYNPERQSWCEMKNGC  652
              N+W +IESLRRPRWGCF C FEGKLYVMGGRSSFTIGNSRFVDVYNPER SW EMKNGC
Sbjct  222   KNEWTLIESLRRPRWGCFACSFEGKLYVMGGRSSFTIGNSRFVDVYNPERHSWFEMKNGC  281

Query  651   VMVTAHAVVGKKLFCIEWKNQRKLGIFNPEDNSWKMVGVPVTGSSSIGFRLGILDEKLLL  472
             VMVTAHAV+GKKLFC+EWKNQRKL IFNP DNSW+ + VP+TGSSS  FR GILD KLLL
Sbjct  282   VMVTAHAVLGKKLFCMEWKNQRKLAIFNPVDNSWQKIPVPLTGSSSTEFRFGILDGKLLL  341

Query  471   FSLQENPTYTTLLYDPNAAAGSEWQTCEIKPSGSCLCSVTIKA  343
             F+L+E P Y TLLYDP+A  GSEWQT  +KPSG CLCSVTIKA
Sbjct  342   FALKEEPGYQTLLYDPDAPVGSEWQTSSLKPSGLCLCSVTIKA  384



>gb|KHG24131.1| hypothetical protein F383_07660 [Gossypium arboreum]
Length=372

 Score =   532 bits (1371),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/386 (69%), Positives = 304/386 (79%), Gaps = 14/386 (4%)
 Frame = -1

Query  1500  MPGTNCGKKRVTELKMCFSDEMNLDNPGHSKNISYFTSSVVVDDSYSPLLPGLPDDVAKY  1321
             MPG    KKR+TE  MC S  +    P HSK  ++ + S   D+  SPLLPGLPDDVAKY
Sbjct  1     MPGFVREKKRITEPNMCLSSPLM---PDHSKG-NHRSPSQATDEIESPLLPGLPDDVAKY  56

Query  1320  CLALVPRYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWLYVLTVDADGKESHWEVL  1141
             CLALVPR  FP+MGGV KRWRSFI+SKEF+M RK+A +LEEWLYVLT+D++GKESHWEVL
Sbjct  57    CLALVPRSSFPSMGGVCKRWRSFIQSKEFLMERKIAGMLEEWLYVLTMDSEGKESHWEVL  116

Query  1140  DCLGHKHHQLPQMPAPIRAGFGVAVLNAKLLVMGGYSMIDESASVSPEVFQYDSCLNSWS  961
             DCLG KH  LP MP P + GFG  VLN KLLV+ GYS+I+ +AS S +V+QYDSCLN WS
Sbjct  117   DCLGQKHRLLPPMPGPEKVGFGTTVLNGKLLVLAGYSVINGTASASADVYQYDSCLNCWS  176

Query  960   KLASMNVARYDFACAEVNGMVYAVGGNGVNGESLSCAEVYDPDTNKWRVIESLRRPRWGC  781
             KLA++NV    +                   ESLS AEVYDPDT+KW +IESLRRPRWGC
Sbjct  177   KLANLNVNGVVYVVGGYGVEG----------ESLSTAEVYDPDTDKWTLIESLRRPRWGC  226

Query  780   FGCGFEGKLYVMGGRSSFTIGNSRFVDVYNPERQSWCEMKNGCVMVTAHAVVGKKLFCIE  601
             F CG  GKLYV+GGRSSFTIGNSRFVDVYNPE+Q+WCEMKNGCVMVTAHAV+ K+LFC+E
Sbjct  227   FACGLNGKLYVLGGRSSFTIGNSRFVDVYNPEKQTWCEMKNGCVMVTAHAVLEKQLFCME  286

Query  600   WKNQRKLGIFNPEDNSWKMVGVPVTGSSSIGFRLGILDEKLLLFSLQENPTYTTLLYDPN  421
             WKNQRKL IFNP+DNSWKMV VP+TGS+SIGFR GILD KLLLFS++ +P Y TLLYDPN
Sbjct  287   WKNQRKLAIFNPDDNSWKMVSVPLTGSTSIGFRFGILDGKLLLFSVEGDPGYHTLLYDPN  346

Query  420   AAAGSEWQTCEIKPSGSCLCSVTIKA  343
             AA GSEWQT EIKPSG CLCSVTIKA
Sbjct  347   AAPGSEWQTSEIKPSGLCLCSVTIKA  372



>ref|XP_006438053.1| hypothetical protein CICLE_v10031802mg [Citrus clementina]
 ref|XP_006438057.1| hypothetical protein CICLE_v10031802mg [Citrus clementina]
 gb|ESR51293.1| hypothetical protein CICLE_v10031802mg [Citrus clementina]
 gb|ESR51297.1| hypothetical protein CICLE_v10031802mg [Citrus clementina]
Length=314

 Score =   530 bits (1364),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 248/314 (79%), Positives = 281/314 (89%), Gaps = 0/314 (0%)
 Frame = -1

Query  1284  MGGVNKRWRSFIRSKEFIMVRKLACLLEEWLYVLTVDADGKESHWEVLDCLGHKHHQLPQ  1105
             MG V K+WRSFIRSKEFI VRKL  LLEEWL +LT+D +GK+S WEVLDC G++H  LP 
Sbjct  1     MGAVCKKWRSFIRSKEFITVRKLLGLLEEWLCILTMDPEGKQSQWEVLDCFGNRHRLLPL  60

Query  1104  MPAPIRAGFGVAVLNAKLLVMGGYSMIDESASVSPEVFQYDSCLNSWSKLASMNVARYDF  925
             MP P++AGFGV V+N KL+VM GYS+ID +AS S +V+QYDSCLNSWSKLA+MNVARYDF
Sbjct  61    MPGPVKAGFGVVVINGKLVVMAGYSVIDGTASASADVYQYDSCLNSWSKLANMNVARYDF  120

Query  924   ACAEVNGMVYAVGGNGVNGESLSCAEVYDPDTNKWRVIESLRRPRWGCFGCGFEGKLYVM  745
             ACAEVNG +YAVGG G++GESLS AEVYDPDT+KW +IESLRRPRWGCF C F+GKLYVM
Sbjct  121   ACAEVNGKIYAVGGYGMDGESLSSAEVYDPDTDKWNLIESLRRPRWGCFACSFDGKLYVM  180

Query  744   GGRSSFTIGNSRFVDVYNPERQSWCEMKNGCVMVTAHAVVGKKLFCIEWKNQRKLGIFNP  565
             GGRSSFTIGNS+FVDVYNPER +WC+MKNGCVMVTAHAVVGKKLFC+EWKNQRKL IF+P
Sbjct  181   GGRSSFTIGNSKFVDVYNPERHTWCQMKNGCVMVTAHAVVGKKLFCMEWKNQRKLTIFDP  240

Query  564   EDNSWKMVGVPVTGSSSIGFRLGILDEKLLLFSLQENPTYTTLLYDPNAAAGSEWQTCEI  385
             EDNSWKMV VP+TGSSSIGFR GILD KLLLFSL+E P+Y+TLLYDPNAA+GSEWQT +I
Sbjct  241   EDNSWKMVPVPLTGSSSIGFRFGILDGKLLLFSLEEEPSYSTLLYDPNAASGSEWQTSKI  300

Query  384   KPSGSCLCSVTIKA  343
             KPSG CLCSVTIKA
Sbjct  301   KPSGLCLCSVTIKA  314



>ref|XP_006484079.1| PREDICTED: F-box/kelch-repeat protein At1g67480-like isoform 
X3 [Citrus sinensis]
Length=381

 Score =   532 bits (1370),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 248/315 (79%), Positives = 281/315 (89%), Gaps = 0/315 (0%)
 Frame = -1

Query  1287  AMGGVNKRWRSFIRSKEFIMVRKLACLLEEWLYVLTVDADGKESHWEVLDCLGHKHHQLP  1108
             AMG V K+WRSFIRSKEFI VRKL  LLEEWL +LT+D +GK+S WEVLDC G++H  LP
Sbjct  67    AMGAVCKKWRSFIRSKEFITVRKLLGLLEEWLCILTMDPEGKQSQWEVLDCFGNRHRLLP  126

Query  1107  QMPAPIRAGFGVAVLNAKLLVMGGYSMIDESASVSPEVFQYDSCLNSWSKLASMNVARYD  928
              MP P++ GFGV V+N KL+VM GYS+ID +AS S +V+QYDSCLNSWSKLA+MNVARYD
Sbjct  127   LMPGPVKVGFGVVVINGKLVVMAGYSVIDGTASASADVYQYDSCLNSWSKLANMNVARYD  186

Query  927   FACAEVNGMVYAVGGNGVNGESLSCAEVYDPDTNKWRVIESLRRPRWGCFGCGFEGKLYV  748
             FACAEVNG +YAVGG G++GESLS AEVYDPDT+KW +IESLRRPRWGCF C F+GKLYV
Sbjct  187   FACAEVNGKIYAVGGYGMDGESLSSAEVYDPDTDKWNLIESLRRPRWGCFACSFDGKLYV  246

Query  747   MGGRSSFTIGNSRFVDVYNPERQSWCEMKNGCVMVTAHAVVGKKLFCIEWKNQRKLGIFN  568
             MGGRSSFTIGNS+FVDVYNPER +WC+MKNGCVMVTAHAVVGKKLFC+EWKNQRKL IF+
Sbjct  247   MGGRSSFTIGNSKFVDVYNPERHTWCQMKNGCVMVTAHAVVGKKLFCMEWKNQRKLTIFD  306

Query  567   PEDNSWKMVGVPVTGSSSIGFRLGILDEKLLLFSLQENPTYTTLLYDPNAAAGSEWQTCE  388
             PEDNSWKMV VP+TGSSSIGFR GILD KLLLFSL+E P+Y+TLLYDPNAA+GSEWQT +
Sbjct  307   PEDNSWKMVPVPLTGSSSIGFRFGILDGKLLLFSLEEEPSYSTLLYDPNAASGSEWQTSK  366

Query  387   IKPSGSCLCSVTIKA  343
             IKPSG CLCSVTIKA
Sbjct  367   IKPSGLCLCSVTIKA  381



>ref|XP_009372304.1| PREDICTED: F-box/kelch-repeat protein At1g67480 [Pyrus x bretschneideri]
 ref|XP_009372306.1| PREDICTED: F-box/kelch-repeat protein At1g67480 [Pyrus x bretschneideri]
Length=394

 Score =   532 bits (1370),  Expect = 1e-180, Method: Compositional matrix adjust.
 Identities = 266/387 (69%), Positives = 311/387 (80%), Gaps = 2/387 (1%)
 Frame = -1

Query  1500  MPGTNCGKKRVTELKMCFSDEMNLDNPGHSKNISYFTSSVVVDDSYSPLLPGLPDDVAKY  1321
             MP     KKR  +     S+ +  D P   ++    TS +VVDD  SP+LPGLPDD+AKY
Sbjct  9     MPAFVSEKKRFKDPNTGLSNSVKQDTPIRKESYRSLTS-LVVDDFDSPILPGLPDDIAKY  67

Query  1320  CLALVPRYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWLYVLTVDADGKESHWEVL  1141
             CLALVPR  FP MGGV K+WR F++SKE I VR+LA LLEEWLYVLT D++GKE+HWEVL
Sbjct  68    CLALVPRSDFPTMGGVCKKWRYFLQSKELITVRRLAGLLEEWLYVLTTDSEGKENHWEVL  127

Query  1140  DCLGHKHHQLPQMPAPIRAGFGVAVLNAKLLVMGGYSMIDESASVSPEVFQYDSCLNSWS  961
             DC GHKHH LP MP P R+GFGV VLN KLLV+GGYS+I E+   S +V+QYDSCLN W 
Sbjct  128   DCHGHKHHVLPPMPGPTRSGFGVVVLNGKLLVVGGYSVITETTVASEDVYQYDSCLNRWG  187

Query  960   KLASMNVARYDFACAEVNGMVYAVGGNGVNGESLSCAEVYDPDTNKWRVIESLRRPRWGC  781
             KLA+MNVAR+DFACAE++GM+YAVGG G++G SLS AEVY+PDT+ W +I S+RRPR+GC
Sbjct  188   KLANMNVARHDFACAELSGMIYAVGGYGIDGSSLSSAEVYNPDTDTWTLISSIRRPRYGC  247

Query  780   FGCGFEGKLYVMGGRSSFTIGNSRFVDVYNPERQSWCEM-KNGCVMVTAHAVVGKKLFCI  604
             F CGFEGKLYVMGGRSSFTIGNS+FVDVY+PE ++WCEM KNGCVMVTAHAV+ KKLFC 
Sbjct  248   FACGFEGKLYVMGGRSSFTIGNSKFVDVYDPESRTWCEMKKNGCVMVTAHAVLEKKLFCS  307

Query  603   EWKNQRKLGIFNPEDNSWKMVGVPVTGSSSIGFRLGILDEKLLLFSLQENPTYTTLLYDP  424
             EWKNQRKL I+NP DNSW+MV +P+TGS+SI FR G LDEKLLL SL+E P Y TLLYDP
Sbjct  308   EWKNQRKLSIYNPYDNSWEMVQIPLTGSTSIKFRFGTLDEKLLLLSLEEEPGYRTLLYDP  367

Query  423   NAAAGSEWQTCEIKPSGSCLCSVTIKA  343
             NAA GSEWQT E+K SG CLC VTIK 
Sbjct  368   NAAPGSEWQTSEVKMSGPCLCCVTIKV  394



>ref|XP_011041507.1| PREDICTED: F-box/kelch-repeat protein At1g67480-like [Populus 
euphratica]
 ref|XP_011041508.1| PREDICTED: F-box/kelch-repeat protein At1g67480-like [Populus 
euphratica]
 ref|XP_011041509.1| PREDICTED: F-box/kelch-repeat protein At1g67480-like [Populus 
euphratica]
 ref|XP_011041510.1| PREDICTED: F-box/kelch-repeat protein At1g67480-like [Populus 
euphratica]
Length=385

 Score =   531 bits (1368),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 258/379 (68%), Positives = 297/379 (78%), Gaps = 0/379 (0%)
 Frame = -1

Query  1479  KKRVTELKMCFSDEMNLDNPGHSKNISYFTSSVVVDDSYSPLLPGLPDDVAKYCLALVPR  1300
             KKR  +  M FS  +  +N       +   +S   DD  S +LPGLPDDVAKYCLALVPR
Sbjct  7     KKRFLDTSMSFSTLITHENHQVYSKSNLLVASGGSDDIDSSILPGLPDDVAKYCLALVPR  66

Query  1299  YYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWLYVLTVDADGKESHWEVLDCLGHKH  1120
              Y PAMG V K+WRSF+++KEFI VRKLA LLEEWL+VLT+D++GKESHW VLD LG K 
Sbjct  67    RYLPAMGAVCKKWRSFLKTKEFITVRKLAGLLEEWLFVLTMDSEGKESHWVVLDRLGLKR  126

Query  1119  HQLPQMPAPIRAGFGVAVLNAKLLVMGGYSMIDESASVSPEVFQYDSCLNSWSKLASMNV  940
               LP MP   +AGFGV VLN KLLVM GYS+I+ + + S +V++YD  LNSWSKL+SMNV
Sbjct  127   QLLPPMPGSTKAGFGVVVLNGKLLVMAGYSVIEGTGTASADVYEYDCYLNSWSKLSSMNV  186

Query  939   ARYDFACAEVNGMVYAVGGNGVNGESLSCAEVYDPDTNKWRVIESLRRPRWGCFGCGFEG  760
             ARYDFACAEVNG VYA GG G +  SLS  E+YDP+T +W +IESLR PRWGCF CGFEG
Sbjct  187   ARYDFACAEVNGKVYAAGGYGTDRNSLSSVEMYDPETGRWTLIESLRGPRWGCFACGFEG  246

Query  759   KLYVMGGRSSFTIGNSRFVDVYNPERQSWCEMKNGCVMVTAHAVVGKKLFCIEWKNQRKL  580
             KLYVMGGRS+FTIGNSRFV+VYNPE+ +W EMKNG VMVTAHAV+GKKLFC+EWKNQRKL
Sbjct  247   KLYVMGGRSTFTIGNSRFVEVYNPEKHTWYEMKNGRVMVTAHAVLGKKLFCMEWKNQRKL  306

Query  579   GIFNPEDNSWKMVGVPVTGSSSIGFRLGILDEKLLLFSLQENPTYTTLLYDPNAAAGSEW  400
              IFNPED+SWK V VP+TG+S I FR GILD KLLLFSL+E P Y TLLYDPNA+ GSEW
Sbjct  307   SIFNPEDSSWKTVAVPLTGNSIIDFRFGILDGKLLLFSLEEEPGYRTLLYDPNASPGSEW  366

Query  399   QTCEIKPSGSCLCSVTIKA  343
              T  IKPS  CLC VTIKA
Sbjct  367   CTSAIKPSARCLCCVTIKA  385



>ref|XP_009337499.1| PREDICTED: F-box/kelch-repeat protein At1g67480-like [Pyrus x 
bretschneideri]
 ref|XP_009337500.1| PREDICTED: F-box/kelch-repeat protein At1g67480-like [Pyrus x 
bretschneideri]
Length=394

 Score =   531 bits (1369),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 266/387 (69%), Positives = 310/387 (80%), Gaps = 2/387 (1%)
 Frame = -1

Query  1500  MPGTNCGKKRVTELKMCFSDEMNLDNPGHSKNISYFTSSVVVDDSYSPLLPGLPDDVAKY  1321
             MP     KKR  +     S+ +  D P   ++    TS +VVDD  SP+LPGLPDD+AKY
Sbjct  9     MPAFVSEKKRFKDPNTGLSNSVKQDTPIRKESYRSLTS-LVVDDFDSPILPGLPDDIAKY  67

Query  1320  CLALVPRYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWLYVLTVDADGKESHWEVL  1141
             CLALVPR  FPAMG V K+WR F++SKE I VR+LA LLEEWLYVLT D++GKE+HWEVL
Sbjct  68    CLALVPRSDFPAMGAVCKKWRYFLQSKELITVRRLAGLLEEWLYVLTTDSEGKENHWEVL  127

Query  1140  DCLGHKHHQLPQMPAPIRAGFGVAVLNAKLLVMGGYSMIDESASVSPEVFQYDSCLNSWS  961
             DC GHKHH LP MP P R+GFGV VLN KLLV+GGYS+I E+   S +V+QYDSCLN W 
Sbjct  128   DCHGHKHHVLPPMPGPTRSGFGVVVLNGKLLVVGGYSVITETTVASEDVYQYDSCLNRWG  187

Query  960   KLASMNVARYDFACAEVNGMVYAVGGNGVNGESLSCAEVYDPDTNKWRVIESLRRPRWGC  781
             KLA+MNVAR+DFACAE++GM+YAVGG G++G SLS AEVY+PDT+ W +I S+RRPR+GC
Sbjct  188   KLANMNVARHDFACAELSGMIYAVGGYGIDGSSLSSAEVYNPDTDTWTLISSIRRPRYGC  247

Query  780   FGCGFEGKLYVMGGRSSFTIGNSRFVDVYNPERQSWCEM-KNGCVMVTAHAVVGKKLFCI  604
             F CGFEGKLYVMGGRSSFTIGNS+FVDVY+PE  +WCEM KNGCVMVTAHAV+ KKLFC 
Sbjct  248   FACGFEGKLYVMGGRSSFTIGNSKFVDVYDPESHTWCEMKKNGCVMVTAHAVLEKKLFCS  307

Query  603   EWKNQRKLGIFNPEDNSWKMVGVPVTGSSSIGFRLGILDEKLLLFSLQENPTYTTLLYDP  424
             EWKNQRKL I+NP DNSW+MV +P+TGS+SI FR G LDEKLLL SL+E P Y TLLYDP
Sbjct  308   EWKNQRKLSIYNPYDNSWEMVQIPLTGSTSIKFRFGTLDEKLLLLSLEEEPGYRTLLYDP  367

Query  423   NAAAGSEWQTCEIKPSGSCLCSVTIKA  343
             NAA GSEWQT E+K SG CLC VTIK 
Sbjct  368   NAAPGSEWQTSEVKMSGPCLCCVTIKV  394



>ref|XP_006484077.1| PREDICTED: F-box/kelch-repeat protein At1g67480-like isoform 
X1 [Citrus sinensis]
Length=389

 Score =   531 bits (1368),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 248/315 (79%), Positives = 281/315 (89%), Gaps = 0/315 (0%)
 Frame = -1

Query  1287  AMGGVNKRWRSFIRSKEFIMVRKLACLLEEWLYVLTVDADGKESHWEVLDCLGHKHHQLP  1108
             AMG V K+WRSFIRSKEFI VRKL  LLEEWL +LT+D +GK+S WEVLDC G++H  LP
Sbjct  75    AMGAVCKKWRSFIRSKEFITVRKLLGLLEEWLCILTMDPEGKQSQWEVLDCFGNRHRLLP  134

Query  1107  QMPAPIRAGFGVAVLNAKLLVMGGYSMIDESASVSPEVFQYDSCLNSWSKLASMNVARYD  928
              MP P++ GFGV V+N KL+VM GYS+ID +AS S +V+QYDSCLNSWSKLA+MNVARYD
Sbjct  135   LMPGPVKVGFGVVVINGKLVVMAGYSVIDGTASASADVYQYDSCLNSWSKLANMNVARYD  194

Query  927   FACAEVNGMVYAVGGNGVNGESLSCAEVYDPDTNKWRVIESLRRPRWGCFGCGFEGKLYV  748
             FACAEVNG +YAVGG G++GESLS AEVYDPDT+KW +IESLRRPRWGCF C F+GKLYV
Sbjct  195   FACAEVNGKIYAVGGYGMDGESLSSAEVYDPDTDKWNLIESLRRPRWGCFACSFDGKLYV  254

Query  747   MGGRSSFTIGNSRFVDVYNPERQSWCEMKNGCVMVTAHAVVGKKLFCIEWKNQRKLGIFN  568
             MGGRSSFTIGNS+FVDVYNPER +WC+MKNGCVMVTAHAVVGKKLFC+EWKNQRKL IF+
Sbjct  255   MGGRSSFTIGNSKFVDVYNPERHTWCQMKNGCVMVTAHAVVGKKLFCMEWKNQRKLTIFD  314

Query  567   PEDNSWKMVGVPVTGSSSIGFRLGILDEKLLLFSLQENPTYTTLLYDPNAAAGSEWQTCE  388
             PEDNSWKMV VP+TGSSSIGFR GILD KLLLFSL+E P+Y+TLLYDPNAA+GSEWQT +
Sbjct  315   PEDNSWKMVPVPLTGSSSIGFRFGILDGKLLLFSLEEEPSYSTLLYDPNAASGSEWQTSK  374

Query  387   IKPSGSCLCSVTIKA  343
             IKPSG CLCSVTIKA
Sbjct  375   IKPSGLCLCSVTIKA  389



>ref|XP_006484080.1| PREDICTED: F-box/kelch-repeat protein At1g67480-like isoform 
X4 [Citrus sinensis]
Length=314

 Score =   528 bits (1360),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 247/314 (79%), Positives = 280/314 (89%), Gaps = 0/314 (0%)
 Frame = -1

Query  1284  MGGVNKRWRSFIRSKEFIMVRKLACLLEEWLYVLTVDADGKESHWEVLDCLGHKHHQLPQ  1105
             MG V K+WRSFIRSKEFI VRKL  LLEEWL +LT+D +GK+S WEVLDC G++H  LP 
Sbjct  1     MGAVCKKWRSFIRSKEFITVRKLLGLLEEWLCILTMDPEGKQSQWEVLDCFGNRHRLLPL  60

Query  1104  MPAPIRAGFGVAVLNAKLLVMGGYSMIDESASVSPEVFQYDSCLNSWSKLASMNVARYDF  925
             MP P++ GFGV V+N KL+VM GYS+ID +AS S +V+QYDSCLNSWSKLA+MNVARYDF
Sbjct  61    MPGPVKVGFGVVVINGKLVVMAGYSVIDGTASASADVYQYDSCLNSWSKLANMNVARYDF  120

Query  924   ACAEVNGMVYAVGGNGVNGESLSCAEVYDPDTNKWRVIESLRRPRWGCFGCGFEGKLYVM  745
             ACAEVNG +YAVGG G++GESLS AEVYDPDT+KW +IESLRRPRWGCF C F+GKLYVM
Sbjct  121   ACAEVNGKIYAVGGYGMDGESLSSAEVYDPDTDKWNLIESLRRPRWGCFACSFDGKLYVM  180

Query  744   GGRSSFTIGNSRFVDVYNPERQSWCEMKNGCVMVTAHAVVGKKLFCIEWKNQRKLGIFNP  565
             GGRSSFTIGNS+FVDVYNPER +WC+MKNGCVMVTAHAVVGKKLFC+EWKNQRKL IF+P
Sbjct  181   GGRSSFTIGNSKFVDVYNPERHTWCQMKNGCVMVTAHAVVGKKLFCMEWKNQRKLTIFDP  240

Query  564   EDNSWKMVGVPVTGSSSIGFRLGILDEKLLLFSLQENPTYTTLLYDPNAAAGSEWQTCEI  385
             EDNSWKMV VP+TGSSSIGFR GILD KLLLFSL+E P+Y+TLLYDPNAA+GSEWQT +I
Sbjct  241   EDNSWKMVPVPLTGSSSIGFRFGILDGKLLLFSLEEEPSYSTLLYDPNAASGSEWQTSKI  300

Query  384   KPSGSCLCSVTIKA  343
             KPSG CLCSVTIKA
Sbjct  301   KPSGLCLCSVTIKA  314



>ref|XP_011014059.1| PREDICTED: F-box/kelch-repeat protein At1g67480-like [Populus 
euphratica]
 ref|XP_011014060.1| PREDICTED: F-box/kelch-repeat protein At1g67480-like [Populus 
euphratica]
 ref|XP_011014061.1| PREDICTED: F-box/kelch-repeat protein At1g67480-like [Populus 
euphratica]
 ref|XP_011014062.1| PREDICTED: F-box/kelch-repeat protein At1g67480-like [Populus 
euphratica]
Length=385

 Score =   530 bits (1365),  Expect = 5e-180, Method: Compositional matrix adjust.
 Identities = 257/379 (68%), Positives = 297/379 (78%), Gaps = 0/379 (0%)
 Frame = -1

Query  1479  KKRVTELKMCFSDEMNLDNPGHSKNISYFTSSVVVDDSYSPLLPGLPDDVAKYCLALVPR  1300
             KKR  +  M FS  +  +N       +   +S   DD  S +LPGLPDDVAKYCLALVPR
Sbjct  7     KKRFLDTSMSFSTLITHENHQVYSKSNLLVASGGSDDIDSSILPGLPDDVAKYCLALVPR  66

Query  1299  YYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWLYVLTVDADGKESHWEVLDCLGHKH  1120
              Y PAMG V K+WRSF+++KEFI VRKLA LLEEWL+VLT+D++GKESHW VLD LG K 
Sbjct  67    RYLPAMGAVCKKWRSFLKTKEFITVRKLAGLLEEWLFVLTMDSEGKESHWVVLDRLGLKR  126

Query  1119  HQLPQMPAPIRAGFGVAVLNAKLLVMGGYSMIDESASVSPEVFQYDSCLNSWSKLASMNV  940
               LP MP   +AGFGV VLN KLLVM GYS+I+ + + S +V++YD  LNSWSKL+SMNV
Sbjct  127   QLLPPMPGSTKAGFGVVVLNGKLLVMAGYSVIEGTGTASADVYEYDCYLNSWSKLSSMNV  186

Query  939   ARYDFACAEVNGMVYAVGGNGVNGESLSCAEVYDPDTNKWRVIESLRRPRWGCFGCGFEG  760
             ARYDFACAEVNG VYA GG G +  SLS  E+YDP+T +W +IESLR PRWGCF CGFEG
Sbjct  187   ARYDFACAEVNGKVYAAGGYGTDRNSLSSVEMYDPETGRWTLIESLRGPRWGCFACGFEG  246

Query  759   KLYVMGGRSSFTIGNSRFVDVYNPERQSWCEMKNGCVMVTAHAVVGKKLFCIEWKNQRKL  580
             KL+VMGGRS+FTIGNSRFV+VYNPE+ +W EMKNG VMVTAHAV+GKKLFC+EWKNQRKL
Sbjct  247   KLFVMGGRSTFTIGNSRFVEVYNPEKHTWYEMKNGRVMVTAHAVLGKKLFCMEWKNQRKL  306

Query  579   GIFNPEDNSWKMVGVPVTGSSSIGFRLGILDEKLLLFSLQENPTYTTLLYDPNAAAGSEW  400
              IFNPED+SWK V VP+TG+S I FR GILD KLLLFSL+E P Y TLLYDPNA+ GSEW
Sbjct  307   SIFNPEDSSWKTVAVPLTGNSIIDFRFGILDGKLLLFSLEEEPGYRTLLYDPNASPGSEW  366

Query  399   QTCEIKPSGSCLCSVTIKA  343
              T  IKPS  CLC VTIKA
Sbjct  367   CTSAIKPSARCLCCVTIKA  385



>ref|XP_004310065.1| PREDICTED: F-box/kelch-repeat protein At1g67480-like [Fragaria 
vesca subsp. vesca]
Length=370

 Score =   524 bits (1349),  Expect = 8e-178, Method: Compositional matrix adjust.
 Identities = 247/371 (67%), Positives = 295/371 (80%), Gaps = 1/371 (0%)
 Frame = -1

Query  1455  MCFSDEMNLDNPGHSKNISYFTSSVVVDDSYSPLLPGLPDDVAKYCLALVPRYYFPAMGG  1276
             MC +  +  D P HSK+     +    DD  SP+LPGLPDD++KYCLALVPR  F +M  
Sbjct  1     MCLTTLLKKDTPIHSKSFRNLRTEAT-DDFDSPILPGLPDDISKYCLALVPRSDFCSMSV  59

Query  1275  VNKRWRSFIRSKEFIMVRKLACLLEEWLYVLTVDADGKESHWEVLDCLGHKHHQLPQMPA  1096
             V+K+WR F++SKEF  VR+LA LL+EWLYVLT+DA+GKES WEVLDCLGH+H  L  MP 
Sbjct  60    VSKKWRHFMQSKEFTTVRQLAGLLQEWLYVLTMDAEGKESRWEVLDCLGHQHRILSPMPG  119

Query  1095  PIRAGFGVAVLNAKLLVMGGYSMIDESASVSPEVFQYDSCLNSWSKLASMNVARYDFACA  916
             P R+ FGV VL  KL+++GG+S+ID     SPEV+ YDSC+N WSKLA MNVARYDFACA
Sbjct  120   PTRSLFGVVVLGGKLVIVGGFSVIDGIGVASPEVYNYDSCINRWSKLAEMNVARYDFACA  179

Query  915   EVNGMVYAVGGNGVNGESLSCAEVYDPDTNKWRVIESLRRPRWGCFGCGFEGKLYVMGGR  736
             E+ G+VYAVGG   +G  LS AEVY+P+T+ W +IES+RRPR+GCF CGFEGKLY+MGGR
Sbjct  180   ELCGLVYAVGGYSADGNILSSAEVYNPETDTWTLIESIRRPRYGCFACGFEGKLYIMGGR  239

Query  735   SSFTIGNSRFVDVYNPERQSWCEMKNGCVMVTAHAVVGKKLFCIEWKNQRKLGIFNPEDN  556
             SSFTIGNS+FVDVY+P+  +WC+MKNGCVMVT HAV+ KKLFC+EWKNQRKL IFNPEDN
Sbjct  240   SSFTIGNSKFVDVYDPKTHTWCQMKNGCVMVTTHAVLEKKLFCMEWKNQRKLSIFNPEDN  299

Query  555   SWKMVGVPVTGSSSIGFRLGILDEKLLLFSLQENPTYTTLLYDPNAAAGSEWQTCEIKPS  376
             SWKMV +P+TGS+SI FR GIL EKLLLFSLQ+   Y TL+YDPNAA GSEWQT  +K S
Sbjct  300   SWKMVQIPLTGSNSIEFRFGILGEKLLLFSLQQELGYCTLMYDPNAAPGSEWQTSVVKLS  359

Query  375   GSCLCSVTIKA  343
             G CLCSV I A
Sbjct  360   GPCLCSVRINA  370



>ref|XP_008788862.1| PREDICTED: F-box/kelch-repeat protein At1g67480-like [Phoenix 
dactylifera]
 ref|XP_008788863.1| PREDICTED: F-box/kelch-repeat protein At1g67480-like [Phoenix 
dactylifera]
Length=384

 Score =   523 bits (1347),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 261/379 (69%), Positives = 290/379 (77%), Gaps = 1/379 (0%)
 Frame = -1

Query  1479  KKRVTELKMCFSDEMNLDNPGHSKNISYFTSSVVVDDSYSPLLPGLPDDVAKYCLALVPR  1300
             +KR  E + C S     +N      +S   +     D   PLL GLPDDVAKYCLALVPR
Sbjct  7     RKRFAESEKCLSIATK-NNFASCLKVSTGLTLQAPWDMCCPLLSGLPDDVAKYCLALVPR  65

Query  1299  YYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWLYVLTVDADGKESHWEVLDCLGHKH  1120
              YFP MG V KRWRSFI+SKEFI VRK A  LEEWLY+LT DADGK SHWEVL C G  H
Sbjct  66    CYFPVMGAVCKRWRSFIQSKEFITVRKEAGKLEEWLYILTGDADGKGSHWEVLGCFGETH  125

Query  1119  HQLPQMPAPIRAGFGVAVLNAKLLVMGGYSMIDESASVSPEVFQYDSCLNSWSKLASMNV  940
               LP MP P++AGFGV VL+ KLLV+ GY +   +  V  +V+QYDS LN WS LA MNV
Sbjct  126   QVLPPMPGPVKAGFGVVVLDGKLLVIAGYLVDAGTGCVLDDVYQYDSRLNGWSMLAKMNV  185

Query  939   ARYDFACAEVNGMVYAVGGNGVNGESLSCAEVYDPDTNKWRVIESLRRPRWGCFGCGFEG  760
             ARYDFACAEVNG++YAVGG G +GESLS AEVYDPD N+W +IESLRRPRWGCF C FEG
Sbjct  186   ARYDFACAEVNGLIYAVGGYGSDGESLSSAEVYDPDKNEWTLIESLRRPRWGCFACSFEG  245

Query  759   KLYVMGGRSSFTIGNSRFVDVYNPERQSWCEMKNGCVMVTAHAVVGKKLFCIEWKNQRKL  580
             KLYVMGGRSSF IGNSRFVDVYNPE  SW EMKNGCVMVTAHAV+GKKLFC+EWK+QRKL
Sbjct  246   KLYVMGGRSSFIIGNSRFVDVYNPECHSWYEMKNGCVMVTAHAVLGKKLFCMEWKSQRKL  305

Query  579   GIFNPEDNSWKMVGVPVTGSSSIGFRLGILDEKLLLFSLQENPTYTTLLYDPNAAAGSEW  400
              IFNP DNSW+ + VPVT SS+I FR GILD KLLLF+L+E P Y TLLYDP A  GSEW
Sbjct  306   AIFNPVDNSWQKIPVPVTRSSTIEFRFGILDGKLLLFALEEEPGYQTLLYDPVAPVGSEW  365

Query  399   QTCEIKPSGSCLCSVTIKA  343
             QT  +KPSG CLCSVTIKA
Sbjct  366   QTSSLKPSGLCLCSVTIKA  384



>ref|XP_006585113.1| PREDICTED: F-box/kelch-repeat protein At1g67480-like isoform 
X3 [Glycine max]
Length=341

 Score =   513 bits (1321),  Expect = 5e-174, Method: Compositional matrix adjust.
 Identities = 249/340 (73%), Positives = 276/340 (81%), Gaps = 2/340 (1%)
 Frame = -1

Query  1500  MPGTNCGKKRVTELKMCFSDEMNLDNPGHSKNISYFTSSVVVDDS--YSPLLPGLPDDVA  1327
             MP     KK   E  MCF++  N D P  +KN  Y  S  + DD    SP+LPGLPDDV+
Sbjct  1     MPSFVAEKKIFVEPNMCFTNLANHDRPTLTKNNHYVRSEALDDDDDGTSPILPGLPDDVS  60

Query  1326  KYCLALVPRYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWLYVLTVDADGKESHWE  1147
             K+CLALVPR  FPAMGGV KRWR FIRSKEFI VRKLA + EEWLY+LT  ++GK SHWE
Sbjct  61    KHCLALVPRSNFPAMGGVCKRWRGFIRSKEFITVRKLAGMHEEWLYILTAGSEGKGSHWE  120

Query  1146  VLDCLGHKHHQLPQMPAPIRAGFGVAVLNAKLLVMGGYSMIDESASVSPEVFQYDSCLNS  967
             V+DCLGH    LP MP P +AGFGV VLN KLLVM GYS ID +ASVS EV+QYDSCLNS
Sbjct  121   VMDCLGHNRRSLPPMPGPAKAGFGVVVLNGKLLVMAGYSSIDGTASVSAEVYQYDSCLNS  180

Query  966   WSKLASMNVARYDFACAEVNGMVYAVGGNGVNGESLSCAEVYDPDTNKWRVIESLRRPRW  787
             WS+L+SMNVARYDFACAEV+G+VYAVGG G  G+SLS AEVYD DT+KW  IESLRRPRW
Sbjct  181   WSRLSSMNVARYDFACAEVDGLVYAVGGYGATGDSLSSAEVYDLDTDKWTPIESLRRPRW  240

Query  786   GCFGCGFEGKLYVMGGRSSFTIGNSRFVDVYNPERQSWCEMKNGCVMVTAHAVVGKKLFC  607
             GCF CGFEGKLYVMGGRSSFTIGNS+FVDVYNPE+  WCEMKNGCVMVTA+AV+ KKLFC
Sbjct  241   GCFACGFEGKLYVMGGRSSFTIGNSKFVDVYNPEKHGWCEMKNGCVMVTAYAVLEKKLFC  300

Query  606   IEWKNQRKLGIFNPEDNSWKMVGVPVTGSSSIGFRLGILD  487
             +EWKNQRKL IFNPEDNSWKMV VP+TGSSSIGFR GILD
Sbjct  301   MEWKNQRKLAIFNPEDNSWKMVPVPLTGSSSIGFRFGILD  340



>ref|XP_010531614.1| PREDICTED: F-box/kelch-repeat protein At1g67480-like [Tarenaya 
hassleriana]
Length=375

 Score =   498 bits (1282),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 247/380 (65%), Positives = 297/380 (78%), Gaps = 11/380 (3%)
 Frame = -1

Query  1482  GKKRVTELKMCFSDEMNLDNPGHSKNISYFTSSVVVDDSYSPLLPGLPDDVAKYCLALVP  1303
             GKKR+    MCFS           K     +S V      +PL+PGLPDDVAK CLALVP
Sbjct  7     GKKRIVGQSMCFS-----------KGNLRLSSRVSEKFQGNPLIPGLPDDVAKLCLALVP  55

Query  1302  RYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWLYVLTVDADGKESHWEVLDCLGHK  1123
             R  FP+MG V ++WR F++SKEFI VRKLA +LEEWLYVLT+D DGKESHWEV+D  GHK
Sbjct  56    RANFPSMGSVCRKWRFFMQSKEFITVRKLAGVLEEWLYVLTMDIDGKESHWEVMDSSGHK  115

Query  1122  HHQLPQMPAPIRAGFGVAVLNAKLLVMGGYSMIDESASVSPEVFQYDSCLNSWSKLASMN  943
                LP MP P ++GFGVAVLN KLLV+ GYS+ID +   S +V+QYDSCLNSWSKL+ +N
Sbjct  116   LSCLPSMPGPTKSGFGVAVLNGKLLVVAGYSVIDGARVASSDVYQYDSCLNSWSKLSELN  175

Query  942   VARYDFACAEVNGMVYAVGGNGVNGESLSCAEVYDPDTNKWRVIESLRRPRWGCFGCGFE  763
             VAR DFACAEVNG++Y  GG+G++GESLS AEVYDP T+KW +IESLRRPRWGCF CGF+
Sbjct  176   VARQDFACAEVNGLIYVAGGHGIDGESLSSAEVYDPQTSKWTLIESLRRPRWGCFACGFD  235

Query  762   GKLYVMGGRSSFTIGNSRFVDVYNPERQSWCEMKNGCVMVTAHAVVGKKLFCIEWKNQRK  583
             GKLYVMGGRS+FTIGNS+FVDVY+PE  SW E KNG  MVTAHAV+G+KLFCI+WKNQRK
Sbjct  236   GKLYVMGGRSNFTIGNSKFVDVYDPECGSWRESKNGLTMVTAHAVMGEKLFCIQWKNQRK  295

Query  582   LGIFNPEDNSWKMVGVPVTGSSSIGFRLGILDEKLLLFSLQENPTYTTLLYDPNAAAGSE  403
             + +F PE++SW+ V +P++GSS  GF+LG L  KLLLF  QE  +++TLLYDP A  GSE
Sbjct  296   MLVFKPEEDSWEAVALPLSGSSRAGFQLGKLGGKLLLFPSQEETSFSTLLYDPKADPGSE  355

Query  402   WQTCEIKPSGSCLCSVTIKA  343
             W+T +IKPSGSCLCSV+I A
Sbjct  356   WKTSDIKPSGSCLCSVSIAA  375



>ref|XP_009415115.1| PREDICTED: F-box/kelch-repeat protein At1g67480-like [Musa acuminata 
subsp. malaccensis]
Length=389

 Score =   495 bits (1274),  Expect = 3e-166, Method: Compositional matrix adjust.
 Identities = 237/339 (70%), Positives = 272/339 (80%), Gaps = 0/339 (0%)
 Frame = -1

Query  1359  PLLPGLPDDVAKYCLALVPRYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWLYVLT  1180
             P++PGLPDDVAK+CL LVPR   P MG V KRWRSFI+SKEF+ +RK A  LEEW+Y+LT
Sbjct  51    PVIPGLPDDVAKFCLVLVPRSDLPVMGAVCKRWRSFIKSKEFLGIRKEAGKLEEWVYILT  110

Query  1179  VDADGKESHWEVLDCLGHKHHQLPQMPAPIRAGFGVAVLNAKLLVMGGYSMIDESASVSP  1000
              DA G+E+HWEVL   G K   LP MP P++AGFGV V++A L ++ GYS+      VS 
Sbjct  111   GDAQGRENHWEVLVGPGDKSMVLPPMPGPVKAGFGVVVIDANLFIIAGYSVDIGKECVSD  170

Query  999   EVFQYDSCLNSWSKLASMNVARYDFACAEVNGMVYAVGGNGVNGESLSCAEVYDPDTNKW  820
             + +QYDS +N WS LA MNVAR DFAC+E++G+VYAVGG   NG+SLS  EVYDPD NKW
Sbjct  171   DAYQYDSRVNRWSTLAKMNVARRDFACSELDGVVYAVGGFDSNGDSLSSVEVYDPDRNKW  230

Query  819   RVIESLRRPRWGCFGCGFEGKLYVMGGRSSFTIGNSRFVDVYNPERQSWCEMKNGCVMVT  640
              +IESLR PRWGCF CGFEGKLYVMGGRSSFTIGNSRFVDVYN E  SWCEMKNGCVMVT
Sbjct  231   TLIESLRCPRWGCFACGFEGKLYVMGGRSSFTIGNSRFVDVYNTEHHSWCEMKNGCVMVT  290

Query  639   AHAVVGKKLFCIEWKNQRKLGIFNPEDNSWKMVGVPVTGSSSIGFRLGILDEKLLLFSLQ  460
             AHA++ KKLFCIEWKNQRKL IFNP DNSW+ V VPVTGSS+I FRLGI + KLLLFSL+
Sbjct  291   AHAMLNKKLFCIEWKNQRKLAIFNPADNSWQKVPVPVTGSSTIAFRLGIFEGKLLLFSLK  350

Query  459   ENPTYTTLLYDPNAAAGSEWQTCEIKPSGSCLCSVTIKA  343
             E P Y TLLYDP+A  GSEW+T  +KPSG CLCSVTIKA
Sbjct  351   EVPGYRTLLYDPDAPVGSEWKTTSLKPSGLCLCSVTIKA  389



>ref|XP_006391275.1| hypothetical protein EUTSA_v10018729mg [Eutrema salsugineum]
 ref|XP_006391276.1| hypothetical protein EUTSA_v10018729mg [Eutrema salsugineum]
 gb|ESQ28561.1| hypothetical protein EUTSA_v10018729mg [Eutrema salsugineum]
 gb|ESQ28562.1| hypothetical protein EUTSA_v10018729mg [Eutrema salsugineum]
Length=372

 Score =   492 bits (1266),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 239/379 (63%), Positives = 289/379 (76%), Gaps = 14/379 (4%)
 Frame = -1

Query  1479  KKRVTELKMCFSDEMNLDNPGHSKNISYFTSSVVVDDSYSPLLPGLPDDVAKYCLALVPR  1300
             KK +    MCFS + NLD+ G             +     PL+PGL DDVAK CLALVPR
Sbjct  8     KKMIVNNGMCFS-KGNLDDLG-------------LRLLSEPLIPGLSDDVAKLCLALVPR  53

Query  1299  YYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWLYVLTVDADGKESHWEVLDCLGHKH  1120
               FP+MG V K+WR  ++SKEFI VR+LA +LEEWLYVLT++A G+ESHWEV+DCLG K 
Sbjct  54    ASFPSMGRVCKKWRFVVQSKEFITVRRLAGMLEEWLYVLTMNAGGEESHWEVMDCLGRKL  113

Query  1119  HQLPQMPAPIRAGFGVAVLNAKLLVMGGYSMIDESASVSPEVFQYDSCLNSWSKLASMNV  940
               LP MP P ++GF V V++ KLLV+ G++MI+ S   S +V+QYD+CLNSWS+LA + V
Sbjct  114   ASLPPMPGPAKSGFKVVVVDGKLLVIAGFAMINGSHVASSDVYQYDTCLNSWSRLADLEV  173

Query  939   ARYDFACAEVNGMVYAVGGNGVNGESLSCAEVYDPDTNKWRVIESLRRPRWGCFGCGFEG  760
             ARYDFACAEVNG+VY VGG+GV+GESLS AEVYDP+T KW  IESLRRPRWGCF  GF G
Sbjct  174   ARYDFACAEVNGLVYVVGGHGVDGESLSSAEVYDPETGKWTFIESLRRPRWGCFASGFNG  233

Query  759   KLYVMGGRSSFTIGNSRFVDVYNPERQSWCEMKNGCVMVTAHAVVGKKLFCIEWKNQRKL  580
             KLYVMGGRS+FTIGNS+ VDVYNP+  SWC  KNG  MVTAH  VGKKLFCIEWKNQRK+
Sbjct  234   KLYVMGGRSNFTIGNSKLVDVYNPQCGSWCSSKNGVTMVTAHVEVGKKLFCIEWKNQRKM  293

Query  579   GIFNPEDNSWKMVGVPVTGSSSIGFRLGILDEKLLLFSLQENPTYTTLLYDPNAAAGSEW  400
              +FN ED++W++V +P++GSS  GF+ G L  KLLLFS QE    +TLLYDP+AA G +W
Sbjct  294   SVFNAEDDTWEVVALPLSGSSRAGFQFGKLSGKLLLFSSQEETGRSTLLYDPDAAPGRQW  353

Query  399   QTCEIKPSGSCLCSVTIKA  343
             +TCEIK SGSC+CSVTI A
Sbjct  354   KTCEIKLSGSCVCSVTITA  372



>ref|XP_006647277.1| PREDICTED: F-box/kelch-repeat protein At1g67480-like [Oryza brachyantha]
Length=385

 Score =   491 bits (1264),  Expect = 8e-165, Method: Compositional matrix adjust.
 Identities = 235/343 (69%), Positives = 265/343 (77%), Gaps = 0/343 (0%)
 Frame = -1

Query  1371  DSYSPLLPGLPDDVAKYCLALVPRYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWL  1192
             D Y  L+PGLP+D+AK CLALVPR +FP MG V+KRW SF+ SKEFI VRK    LEEW+
Sbjct  43    DPYCALIPGLPEDLAKICLALVPRSHFPVMGSVSKRWMSFLESKEFIAVRKEVGKLEEWV  102

Query  1191  YVLTVDADGKESHWEVLDCLGHKHHQLPQMPAPIRAGFGVAVLNAKLLVMGGYSMIDESA  1012
             YVLT D   K SHWEVL C G KH  LP MP P +AGFGV VL+ KL V+ GY+      
Sbjct  103   YVLTTDVGSKGSHWEVLGCSGQKHSPLPPMPGPTKAGFGVVVLDGKLFVIAGYAADHGKE  162

Query  1011  SVSPEVFQYDSCLNSWSKLASMNVARYDFACAEVNGMVYAVGGNGVNGESLSCAEVYDPD  832
              VS +V++YDSCLN W +L+ MNVAR DFACAEVNGM+Y  GG G NGESLS  EVYDP+
Sbjct  163   CVSDDVYRYDSCLNRWVELSKMNVARCDFACAEVNGMIYVAGGFGSNGESLSSVEVYDPE  222

Query  831   TNKWRVIESLRRPRWGCFGCGFEGKLYVMGGRSSFTIGNSRFVDVYNPERQSWCEMKNGC  652
              NKW +IESLRRPRWGCF C FEGKLYVMGGRSSFTIGNSRFVDVYNP   +W E+KNGC
Sbjct  223   QNKWMLIESLRRPRWGCFACSFEGKLYVMGGRSSFTIGNSRFVDVYNPNNHAWGEVKNGC  282

Query  651   VMVTAHAVVGKKLFCIEWKNQRKLGIFNPEDNSWKMVGVPVTGSSSIGFRLGILDEKLLL  472
             VMVTAHAV+GK+LFCIEWKNQR L +FNP DNSW+ V +P+TGSSS  F  GI D KLLL
Sbjct  283   VMVTAHAVLGKRLFCIEWKNQRSLAVFNPADNSWQKVPLPLTGSSSTRFCFGIHDGKLLL  342

Query  471   FSLQENPTYTTLLYDPNAAAGSEWQTCEIKPSGSCLCSVTIKA  343
             FSL E P Y TL+YDP A  GSEW T E+KPSG CLCSVTI+A
Sbjct  343   FSLDEEPGYKTLMYDPAAPTGSEWCTSELKPSGLCLCSVTIRA  385



>ref|XP_002453878.1| hypothetical protein SORBIDRAFT_04g020510 [Sorghum bicolor]
 gb|EES06854.1| hypothetical protein SORBIDRAFT_04g020510 [Sorghum bicolor]
Length=383

 Score =   491 bits (1263),  Expect = 9e-165, Method: Compositional matrix adjust.
 Identities = 239/379 (63%), Positives = 277/379 (73%), Gaps = 1/379 (0%)
 Frame = -1

Query  1479  KKRVTELKMCFSDEMNLDNPGHSKNISYFTSSVVVDDSYSPLLPGLPDDVAKYCLALVPR  1300
             ++ +   + CF   M L  P   K  S        D SY  L+PGLP+D+AK CLALVPR
Sbjct  6     QEHLAHSQTCFRARMQLKPPTRPKLYSGLMPQEEFD-SYCDLIPGLPEDLAKICLALVPR  64

Query  1299  YYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWLYVLTVDADGKESHWEVLDCLGHKH  1120
              +FP MG V+KRW SF+ SKE I VRK    LEEW+YVLT DA  K SHWE+L+C G K 
Sbjct  65    THFPVMGAVSKRWMSFLESKELIAVRKEVGKLEEWVYVLTPDAGAKGSHWEILECSGQKQ  124

Query  1119  HQLPQMPAPIRAGFGVAVLNAKLLVMGGYSMIDESASVSPEVFQYDSCLNSWSKLASMNV  940
               LP+MP   +AGFGV V+  KL ++ GYS       VS EV+QYDSCLN W+ LA MNV
Sbjct  125   SPLPRMPGLTKAGFGVVVIGGKLFIIAGYSADHGKDCVSDEVYQYDSCLNRWTVLAKMNV  184

Query  939   ARYDFACAEVNGMVYAVGGNGVNGESLSCAEVYDPDTNKWRVIESLRRPRWGCFGCGFEG  760
             AR DFACAEVNG++Y  GG G NGESLS  EVYD + NKW +IE LRRPRWGCFGC FEG
Sbjct  185   ARCDFACAEVNGVIYVAGGFGPNGESLSSVEVYDLEQNKWTLIEGLRRPRWGCFGCSFEG  244

Query  759   KLYVMGGRSSFTIGNSRFVDVYNPERQSWCEMKNGCVMVTAHAVVGKKLFCIEWKNQRKL  580
             KLYVMGGRSSFTIGNSRFVDVYNP   +W ++KNGCVMVTAHAV+G+KLFCIEWKNQR L
Sbjct  245   KLYVMGGRSSFTIGNSRFVDVYNPNNHAWDQVKNGCVMVTAHAVLGEKLFCIEWKNQRSL  304

Query  579   GIFNPEDNSWKMVGVPVTGSSSIGFRLGILDEKLLLFSLQENPTYTTLLYDPNAAAGSEW  400
              IFNP DNSW+ V VP+TGSSS  F  G+ ++KLLLF L+E P Y TL+YDP A  GSEW
Sbjct  305   AIFNPADNSWQKVPVPLTGSSSTRFSFGVHEDKLLLFPLEEEPGYQTLMYDPAAPMGSEW  364

Query  399   QTCEIKPSGSCLCSVTIKA  343
              T ++KPSGSCLCSVTIKA
Sbjct  365   CTSKLKPSGSCLCSVTIKA  383



>gb|EAZ23161.1| hypothetical protein OsJ_06846 [Oryza sativa Japonica Group]
Length=364

 Score =   486 bits (1252),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 239/365 (65%), Positives = 269/365 (74%), Gaps = 1/365 (0%)
 Frame = -1

Query  1437  MNLDNPGHSKNISYFTSSVVVDDSYSPLLPGLPDDVAKYCLALVPRYYFPAMGGVNKRWR  1258
             M L  P  +K    F   +   D+Y  L+PGLP+D+AK CLALVPR  FP MG V+KRW 
Sbjct  1     MQLKAPTRAKYSQGFMP-IGESDAYCALIPGLPEDLAKICLALVPRSQFPVMGSVSKRWM  59

Query  1257  SFIRSKEFIMVRKLACLLEEWLYVLTVDADGKESHWEVLDCLGHKHHQLPQMPAPIRAGF  1078
             SF+ SKEFI VRK    LEEW+YVLT DA  K SHWEVL C G KH  LP MP P +AGF
Sbjct  60    SFLESKEFIAVRKEVGKLEEWVYVLTADAGSKGSHWEVLGCSGQKHSPLPPMPGPTKAGF  119

Query  1077  GVAVLNAKLLVMGGYSMIDESASVSPEVFQYDSCLNSWSKLASMNVARYDFACAEVNGMV  898
             GV VL+ KL V+ GY+       VS EV++YDSCLN W +L+ MNVAR DFACAEVNGM+
Sbjct  120   GVVVLDGKLFVIAGYAADHGKECVSDEVYRYDSCLNRWVELSKMNVARCDFACAEVNGMI  179

Query  897   YAVGGNGVNGESLSCAEVYDPDTNKWRVIESLRRPRWGCFGCGFEGKLYVMGGRSSFTIG  718
             Y  GG G NG+SLS  EVYD + NKW +IESLRRPRWGCF C FEGKLYVMGGRS FTIG
Sbjct  180   YVAGGFGPNGDSLSSVEVYDAEQNKWTLIESLRRPRWGCFACSFEGKLYVMGGRSRFTIG  239

Query  717   NSRFVDVYNPERQSWCEMKNGCVMVTAHAVVGKKLFCIEWKNQRKLGIFNPEDNSWKMVG  538
             N+RFVDVYNP   SW E+KNGCVMVTAHAV+ KKLFCIEWKNQR L +FNP DNSW+ V 
Sbjct  240   NTRFVDVYNPNDNSWGEVKNGCVMVTAHAVLDKKLFCIEWKNQRSLAVFNPADNSWQKVP  299

Query  537   VPVTGSSSIGFRLGILDEKLLLFSLQENPTYTTLLYDPNAAAGSEWQTCEIKPSGSCLCS  358
             VP+TGSSS  F  GI D KLLLFSL E P Y TL+YDP A  GSEW T E+KP G CLCS
Sbjct  300   VPLTGSSSTRFCFGIHDGKLLLFSLDEEPCYKTLMYDPAAPTGSEWFTSELKPPGLCLCS  359

Query  357   VTIKA  343
             VTI+A
Sbjct  360   VTIRA  364



>ref|NP_001046914.1| Os02g0504900 [Oryza sativa Japonica Group]
 dbj|BAD23231.1| kelch repeat-containing F-box protein-like [Oryza sativa Japonica 
Group]
 dbj|BAF08828.1| Os02g0504900 [Oryza sativa Japonica Group]
Length=385

 Score =   487 bits (1254),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 239/365 (65%), Positives = 269/365 (74%), Gaps = 1/365 (0%)
 Frame = -1

Query  1437  MNLDNPGHSKNISYFTSSVVVDDSYSPLLPGLPDDVAKYCLALVPRYYFPAMGGVNKRWR  1258
             M L  P  +K    F   +   D+Y  L+PGLP+D+AK CLALVPR  FP MG V+KRW 
Sbjct  22    MQLKAPTRAKYSQGFMP-IGESDAYCALIPGLPEDLAKICLALVPRSQFPVMGSVSKRWM  80

Query  1257  SFIRSKEFIMVRKLACLLEEWLYVLTVDADGKESHWEVLDCLGHKHHQLPQMPAPIRAGF  1078
             SF+ SKEFI VRK    LEEW+YVLT DA  K SHWEVL C G KH  LP MP P +AGF
Sbjct  81    SFLESKEFIAVRKEVGKLEEWVYVLTADAGSKGSHWEVLGCSGQKHSPLPPMPGPTKAGF  140

Query  1077  GVAVLNAKLLVMGGYSMIDESASVSPEVFQYDSCLNSWSKLASMNVARYDFACAEVNGMV  898
             GV VL+ KL V+ GY+       VS EV++YDSCLN W +L+ MNVAR DFACAEVNGM+
Sbjct  141   GVVVLDGKLFVIAGYAADHGKECVSDEVYRYDSCLNRWVELSKMNVARCDFACAEVNGMI  200

Query  897   YAVGGNGVNGESLSCAEVYDPDTNKWRVIESLRRPRWGCFGCGFEGKLYVMGGRSSFTIG  718
             Y  GG G NG+SLS  EVYD + NKW +IESLRRPRWGCF C FEGKLYVMGGRS FTIG
Sbjct  201   YVAGGFGPNGDSLSSVEVYDAEQNKWTLIESLRRPRWGCFACSFEGKLYVMGGRSRFTIG  260

Query  717   NSRFVDVYNPERQSWCEMKNGCVMVTAHAVVGKKLFCIEWKNQRKLGIFNPEDNSWKMVG  538
             N+RFVDVYNP   SW E+KNGCVMVTAHAV+ KKLFCIEWKNQR L +FNP DNSW+ V 
Sbjct  261   NTRFVDVYNPNDNSWGEVKNGCVMVTAHAVLDKKLFCIEWKNQRSLAVFNPADNSWQKVP  320

Query  537   VPVTGSSSIGFRLGILDEKLLLFSLQENPTYTTLLYDPNAAAGSEWQTCEIKPSGSCLCS  358
             VP+TGSSS  F  GI D KLLLFSL E P Y TL+YDP A  GSEW T E+KP G CLCS
Sbjct  321   VPLTGSSSTRFCFGIHDGKLLLFSLDEEPCYKTLMYDPAAPTGSEWFTSELKPPGLCLCS  380

Query  357   VTIKA  343
             VTI+A
Sbjct  381   VTIRA  385



>ref|XP_004952542.1| PREDICTED: F-box/kelch-repeat protein At1g67480-like [Setaria 
italica]
Length=385

 Score =   486 bits (1251),  Expect = 7e-163, Method: Compositional matrix adjust.
 Identities = 236/379 (62%), Positives = 279/379 (74%), Gaps = 1/379 (0%)
 Frame = -1

Query  1479  KKRVTELKMCFSDEMNLDNPGHSKNISYFTSSVVVDDSYSPLLPGLPDDVAKYCLALVPR  1300
             +++ ++ + C    M L  P   K  S         DSY  L+PGLP+D+AK CLALVPR
Sbjct  8     QEQFSQSQTCLRARMLLKPPTRPKLYSGLMPQEE-RDSYCDLIPGLPEDLAKICLALVPR  66

Query  1299  YYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWLYVLTVDADGKESHWEVLDCLGHKH  1120
              +FP MG V+KRW SF+ SKE I VRK    LEEW+YVLT +A  K SHWE+L+C G   
Sbjct  67    SHFPVMGAVSKRWMSFLESKELIAVRKEVGKLEEWVYVLTPEAGTKGSHWEILECSGQTQ  126

Query  1119  HQLPQMPAPIRAGFGVAVLNAKLLVMGGYSMIDESASVSPEVFQYDSCLNSWSKLASMNV  940
               LP+MP   +AGFGV V+  KL V+ GY+       VS EV+QYDSCLN W+ LA MNV
Sbjct  127   SPLPRMPGLTKAGFGVVVIGGKLFVIAGYAADHGKEYVSDEVYQYDSCLNRWTLLAKMNV  186

Query  939   ARYDFACAEVNGMVYAVGGNGVNGESLSCAEVYDPDTNKWRVIESLRRPRWGCFGCGFEG  760
             AR DFACAEVNG++Y  GG G NG++LS  EVYDP+ N+W +IESLRRPRWGCFGC FEG
Sbjct  187   ARCDFACAEVNGVIYVAGGFGPNGDNLSSVEVYDPEQNRWTLIESLRRPRWGCFGCSFEG  246

Query  759   KLYVMGGRSSFTIGNSRFVDVYNPERQSWCEMKNGCVMVTAHAVVGKKLFCIEWKNQRKL  580
             KL+VMGGRSSFTIGNSRFVDVYNP   +W E+KNGCVMVTAHAV+G+KLFCIEWKNQR L
Sbjct  247   KLFVMGGRSSFTIGNSRFVDVYNPINHAWGEVKNGCVMVTAHAVLGEKLFCIEWKNQRSL  306

Query  579   GIFNPEDNSWKMVGVPVTGSSSIGFRLGILDEKLLLFSLQENPTYTTLLYDPNAAAGSEW  400
              IFNP DNSW+ + VP+TGSS   F LGI D+KLLLF L+E P Y TL+YDP A  GSEW
Sbjct  307   AIFNPADNSWQKIPVPLTGSSRTRFSLGIHDDKLLLFPLEEEPGYQTLMYDPAAPTGSEW  366

Query  399   QTCEIKPSGSCLCSVTIKA  343
              T ++KPSGSCLCSVTIKA
Sbjct  367   CTSKLKPSGSCLCSVTIKA  385



>gb|EAY85972.1| hypothetical protein OsI_07338 [Oryza sativa Indica Group]
Length=364

 Score =   485 bits (1248),  Expect = 8e-163, Method: Compositional matrix adjust.
 Identities = 238/365 (65%), Positives = 269/365 (74%), Gaps = 1/365 (0%)
 Frame = -1

Query  1437  MNLDNPGHSKNISYFTSSVVVDDSYSPLLPGLPDDVAKYCLALVPRYYFPAMGGVNKRWR  1258
             M L  P  +K    F   +   D+Y  L+PGLP+D+AK CLALVPR  FP MG V+KRW 
Sbjct  1     MQLKAPTRAKYSQGFMP-IGESDAYCALIPGLPEDLAKICLALVPRSQFPVMGSVSKRWM  59

Query  1257  SFIRSKEFIMVRKLACLLEEWLYVLTVDADGKESHWEVLDCLGHKHHQLPQMPAPIRAGF  1078
             SF+ SKEFI VRK    LEEW+YVLT DA  K SHWEVL C G KH  LP MP P +AGF
Sbjct  60    SFLESKEFIAVRKEVGKLEEWVYVLTADAGSKGSHWEVLGCSGQKHSPLPPMPGPTKAGF  119

Query  1077  GVAVLNAKLLVMGGYSMIDESASVSPEVFQYDSCLNSWSKLASMNVARYDFACAEVNGMV  898
             GV VL+ KL V+ GY+       VS EV++YDSCLN W +L+ MNVAR DFACAEVNGM+
Sbjct  120   GVVVLDGKLFVIAGYAADHGKECVSDEVYRYDSCLNRWVELSKMNVARCDFACAEVNGMI  179

Query  897   YAVGGNGVNGESLSCAEVYDPDTNKWRVIESLRRPRWGCFGCGFEGKLYVMGGRSSFTIG  718
             Y  GG G NG+SLS  EVYD + NKW +IESLRRPRWGCF C FEGKLYVMGGRS FTIG
Sbjct  180   YVAGGFGPNGDSLSSVEVYDAEQNKWTLIESLRRPRWGCFACSFEGKLYVMGGRSRFTIG  239

Query  717   NSRFVDVYNPERQSWCEMKNGCVMVTAHAVVGKKLFCIEWKNQRKLGIFNPEDNSWKMVG  538
             N+RFVDVYNP   +W E+KNGCVMVTAHAV+ KKLFCIEWKNQR L +FNP DNSW+ V 
Sbjct  240   NTRFVDVYNPNDNAWGEVKNGCVMVTAHAVLDKKLFCIEWKNQRSLAVFNPADNSWQKVP  299

Query  537   VPVTGSSSIGFRLGILDEKLLLFSLQENPTYTTLLYDPNAAAGSEWQTCEIKPSGSCLCS  358
             VP+TGSSS  F  GI D KLLLFSL E P Y TL+YDP A  GSEW T E+KP G CLCS
Sbjct  300   VPLTGSSSTRFCFGIHDGKLLLFSLDEEPCYKTLMYDPAAPTGSEWCTSELKPPGLCLCS  359

Query  357   VTIKA  343
             VTI+A
Sbjct  360   VTIRA  364



>ref|XP_006302407.1| hypothetical protein CARUB_v10020480mg [Capsella rubella]
 ref|XP_006302408.1| hypothetical protein CARUB_v10020480mg [Capsella rubella]
 gb|EOA35305.1| hypothetical protein CARUB_v10020480mg [Capsella rubella]
 gb|EOA35306.1| hypothetical protein CARUB_v10020480mg [Capsella rubella]
Length=376

 Score =   485 bits (1248),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 235/380 (62%), Positives = 288/380 (76%), Gaps = 11/380 (3%)
 Frame = -1

Query  1482  GKKRVTELKMCFSDEMNLDNPGHSKNISYFTSSVVVDDSYSPLLPGLPDDVAKYCLALVP  1303
             GKKR+    MC+S + NLD       I    S   +DD   PL+PGLPDDVAK CLALVP
Sbjct  8     GKKRIVNHGMCYS-KGNLD-------IGSRLSENFMDD---PLIPGLPDDVAKQCLALVP  56

Query  1302  RYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWLYVLTVDADGKESHWEVLDCLGHK  1123
             R  FP+MG V K+WR  ++SKEFI VR+LA ++EEWLYVLT +A G +S WEV+DCLG K
Sbjct  57    RARFPSMGSVCKKWRFVVQSKEFITVRRLAGMVEEWLYVLTTNAGGNDSQWEVMDCLGQK  116

Query  1122  HHQLPQMPAPIRAGFGVAVLNAKLLVMGGYSMIDESASVSPEVFQYDSCLNSWSKLASMN  943
                LP MP P++ GF V V++ KLLV+ G SMI+ S   S +V+QYD+CLNSWS+LA + 
Sbjct  117   LSSLPPMPGPVKTGFKVVVVDGKLLVIAGCSMINGSLVASADVYQYDTCLNSWSRLADLE  176

Query  942   VARYDFACAEVNGMVYAVGGNGVNGESLSCAEVYDPDTNKWRVIESLRRPRWGCFGCGFE  763
             VARYDFACAEVNG++Y VGG+G++G+SLS AEVYDP+T KW  IESLRRPRWGCF  GF 
Sbjct  177   VARYDFACAEVNGLIYVVGGHGLDGDSLSSAEVYDPETGKWTFIESLRRPRWGCFASGFN  236

Query  762   GKLYVMGGRSSFTIGNSRFVDVYNPERQSWCEMKNGCVMVTAHAVVGKKLFCIEWKNQRK  583
             GKLYVMGGRS+FTIGNS+ +DVYN +  SW   KNG  MVTAH  VGKKLFCI+WKNQRK
Sbjct  237   GKLYVMGGRSNFTIGNSKLLDVYNTQCGSWHGSKNGLTMVTAHVEVGKKLFCIDWKNQRK  296

Query  582   LGIFNPEDNSWKMVGVPVTGSSSIGFRLGILDEKLLLFSLQENPTYTTLLYDPNAAAGSE  403
             + +FN ED +W++V +P++GSS  GF+ G L  KLLLFS QE   + TLLYDPNAAAG++
Sbjct  297   MSVFNAEDETWEVVSLPLSGSSRTGFQFGKLSGKLLLFSSQEGTGHNTLLYDPNAAAGTQ  356

Query  402   WQTCEIKPSGSCLCSVTIKA  343
             W+T E+K SGSC+CSVTI A
Sbjct  357   WKTSELKLSGSCVCSVTITA  376



>ref|XP_003575002.1| PREDICTED: F-box/kelch-repeat protein At1g67480-like [Brachypodium 
distachyon]
 ref|XP_010235455.1| PREDICTED: F-box/kelch-repeat protein At1g67480-like [Brachypodium 
distachyon]
 ref|XP_010235456.1| PREDICTED: F-box/kelch-repeat protein At1g67480-like [Brachypodium 
distachyon]
Length=385

 Score =   485 bits (1249),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 236/379 (62%), Positives = 275/379 (73%), Gaps = 1/379 (0%)
 Frame = -1

Query  1479  KKRVTELKMCFSDEMNLDNPGHSKNISYFTSSVVVDDSYSPLLPGLPDDVAKYCLALVPR  1300
             +++  + + C   +M L  P   K  S F      D  Y  L+PGLP+D+AK CLALVPR
Sbjct  8     REQFVQPQTCLRAKMLLKAPTRPKLSSCFMPQEECDQ-YCALIPGLPEDLAKICLALVPR  66

Query  1299  YYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWLYVLTVDADGKESHWEVLDCLGHKH  1120
              +FP MGGV+KRW SF+ SKE I VR+    LEE +YVLT DA+ K SHWEVL C G KH
Sbjct  67    CHFPIMGGVSKRWMSFLESKELIAVRREVGKLEECVYVLTADAEAKGSHWEVLGCPGQKH  126

Query  1119  HQLPQMPAPIRAGFGVAVLNAKLLVMGGYSMIDESASVSPEVFQYDSCLNSWSKLASMNV  940
               LP MP P +AGFGV VL  KL V+ GY+       VS EV+QYDSCLN W+ L+ MNV
Sbjct  127   TPLPPMPGPTKAGFGVVVLAGKLFVIAGYAADHGKECVSDEVYQYDSCLNRWTALSKMNV  186

Query  939   ARYDFACAEVNGMVYAVGGNGVNGESLSCAEVYDPDTNKWRVIESLRRPRWGCFGCGFEG  760
             AR DFACAEVNGM+Y  GG G  G+SLS  EVYDP+ NKW  IE+LRRPRWGCFGC F+G
Sbjct  187   ARCDFACAEVNGMIYVAGGFGPGGDSLSSVEVYDPEQNKWTFIENLRRPRWGCFGCSFDG  246

Query  759   KLYVMGGRSSFTIGNSRFVDVYNPERQSWCEMKNGCVMVTAHAVVGKKLFCIEWKNQRKL  580
              +YVMGGRSSFTIGNSRF+D+YN    +W E+K GCVMV AHAV+G KLFCIEWKNQR L
Sbjct  247   NMYVMGGRSSFTIGNSRFIDIYNTNNHTWGEVKKGCVMVMAHAVLGDKLFCIEWKNQRSL  306

Query  579   GIFNPEDNSWKMVGVPVTGSSSIGFRLGILDEKLLLFSLQENPTYTTLLYDPNAAAGSEW  400
              IFNPEDNSW+ V VP+TGSSS  F LGI D KLLLFSL+E P Y TL+YDP A  G+EW
Sbjct  307   AIFNPEDNSWQKVSVPLTGSSSTRFNLGIHDGKLLLFSLEEEPGYETLMYDPAAPRGAEW  366

Query  399   QTCEIKPSGSCLCSVTIKA  343
              T ++KPSG CLCSVTIKA
Sbjct  367   GTSKLKPSGLCLCSVTIKA  385



>ref|XP_009392489.1| PREDICTED: F-box/kelch-repeat protein At1g67480-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009392490.1| PREDICTED: F-box/kelch-repeat protein At1g67480-like [Musa acuminata 
subsp. malaccensis]
Length=382

 Score =   484 bits (1246),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 236/380 (62%), Positives = 284/380 (75%), Gaps = 9/380 (2%)
 Frame = -1

Query  1482  GKKRVTELKMCFSDEMNLDNPGHSKNISYFTSSVVVDDSYSPLLPGLPDDVAKYCLALVP  1303
             G+KR  +L      E+ L  P  +       +S    + Y P++PGLPDDVAK+CL LVP
Sbjct  12    GRKRFVDL------EVQLHVPVQTNLALTLQAS---QELYCPVIPGLPDDVAKFCLTLVP  62

Query  1302  RYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWLYVLTVDADGKESHWEVLDCLGHK  1123
             R   P +G V KRW SFI+SKEF+ VRK A  LEEW+YVLT DADG+E+HWEVL   G K
Sbjct  63    RRDLPVIGAVCKRWMSFIKSKEFLAVRKEAGKLEEWVYVLTGDADGRENHWEVLVGSGEK  122

Query  1122  HHQLPQMPAPIRAGFGVAVLNAKLLVMGGYSMIDESASVSPEVFQYDSCLNSWSKLASMN  943
                LP MP P++AGFG+ V++A L ++ GYS+    A VS +V+QYDS LN WS LA MN
Sbjct  123   GKVLPSMPGPVKAGFGLVVIDAILFIIAGYSVDIGKACVSNDVYQYDSRLNRWSTLAKMN  182

Query  942   VARYDFACAEVNGMVYAVGGNGVNGESLSCAEVYDPDTNKWRVIESLRRPRWGCFGCGFE  763
             VAR+DFACAE+NG +YAVGG   NG+ LS  EVYDP+ N W ++ SLR PRWGCF C FE
Sbjct  183   VARHDFACAELNGNIYAVGGFDSNGDCLSSVEVYDPNRNMWTLVASLRCPRWGCFACSFE  242

Query  762   GKLYVMGGRSSFTIGNSRFVDVYNPERQSWCEMKNGCVMVTAHAVVGKKLFCIEWKNQRK  583
             GKLYVMGGRSSFTIGNSRFV+VYNP+  SWCEMK+GC+MVTAHAV+ KKLFC EWKNQRK
Sbjct  243   GKLYVMGGRSSFTIGNSRFVNVYNPQHHSWCEMKSGCLMVTAHAVLAKKLFCFEWKNQRK  302

Query  582   LGIFNPEDNSWKMVGVPVTGSSSIGFRLGILDEKLLLFSLQENPTYTTLLYDPNAAAGSE  403
             L I++P DNSW+ + VPVTGSS++ FR GI D KLLLFSL++ P Y TLLYDP+A  GSE
Sbjct  303   LAIYDPVDNSWRKIPVPVTGSSAVAFRFGIFDGKLLLFSLEKVPGYQTLLYDPDAPVGSE  362

Query  402   WQTCEIKPSGSCLCSVTIKA  343
             W+T  +KPSG CLCSVTIKA
Sbjct  363   WKTSSLKPSGLCLCSVTIKA  382



>emb|CDY12647.1| BnaA02g13150D [Brassica napus]
Length=362

 Score =   479 bits (1234),  Expect = 9e-161, Method: Compositional matrix adjust.
 Identities = 226/339 (67%), Positives = 270/339 (80%), Gaps = 0/339 (0%)
 Frame = -1

Query  1359  PLLPGLPDDVAKYCLALVPRYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWLYVLT  1180
             PL+PGL DDVAK CLALVPR   P+MG V K+WR  ++SKEFI VR+LA + EEWLYVLT
Sbjct  24    PLIPGLSDDVAKLCLALVPRSSLPSMGRVCKKWRYVVQSKEFITVRRLAGMPEEWLYVLT  83

Query  1179  VDADGKESHWEVLDCLGHKHHQLPQMPAPIRAGFGVAVLNAKLLVMGGYSMIDESASVSP  1000
             +DA GKESHWEV+DCLGHK   LP MP P++ GF V V++ KLLV+ G +MI  S   S 
Sbjct  84    MDAGGKESHWEVMDCLGHKLSSLPPMPGPVKTGFKVVVVDGKLLVIAGCAMISGSHVASS  143

Query  999   EVFQYDSCLNSWSKLASMNVARYDFACAEVNGMVYAVGGNGVNGESLSCAEVYDPDTNKW  820
             +V+Q+D+CLNSWSKLA +  ARYDFACAEVNG+VY VGG+G +GESLS AEVYDP+T  W
Sbjct  144   DVYQFDTCLNSWSKLADLKEARYDFACAEVNGLVYVVGGHGGDGESLSSAEVYDPETGVW  203

Query  819   RVIESLRRPRWGCFGCGFEGKLYVMGGRSSFTIGNSRFVDVYNPERQSWCEMKNGCVMVT  640
               I+SLRRPRWGCF  GF GKLYVMGGRS+FTIGNS+ VDVYNP+  SWC  KNG  MVT
Sbjct  204   TFIQSLRRPRWGCFASGFNGKLYVMGGRSNFTIGNSKLVDVYNPQCGSWCGSKNGVTMVT  263

Query  639   AHAVVGKKLFCIEWKNQRKLGIFNPEDNSWKMVGVPVTGSSSIGFRLGILDEKLLLFSLQ  460
             AH  VGKKLFC+EWKNQRK+ +FN ED++W++V +P++GSSS GF+ G L+ KLLLFS Q
Sbjct  264   AHVEVGKKLFCMEWKNQRKMSVFNAEDDTWEVVALPLSGSSSAGFQFGKLNGKLLLFSSQ  323

Query  459   ENPTYTTLLYDPNAAAGSEWQTCEIKPSGSCLCSVTIKA  343
             E   ++TLLYDP AA G +WQT EIK SGSC+CSVTI A
Sbjct  324   EETGHSTLLYDPEAAPGRQWQTSEIKLSGSCVCSVTIIA  362



>gb|AFW71520.1| hypothetical protein ZEAMMB73_686872 [Zea mays]
 gb|AFW71521.1| hypothetical protein ZEAMMB73_686872 [Zea mays]
 gb|AFW71522.1| hypothetical protein ZEAMMB73_686872 [Zea mays]
Length=364

 Score =   478 bits (1230),  Expect = 5e-160, Method: Compositional matrix adjust.
 Identities = 232/365 (64%), Positives = 270/365 (74%), Gaps = 1/365 (0%)
 Frame = -1

Query  1437  MNLDNPGHSKNISYFTSSVVVDDSYSPLLPGLPDDVAKYCLALVPRYYFPAMGGVNKRWR  1258
             M L  P   K  S       +D  Y  L+PGLP+D+AK CLALVPR +FPAMG V+KRW 
Sbjct  1     MQLKPPARPKLYSGLMPQEDLD-PYRDLIPGLPEDLAKICLALVPRAHFPAMGAVSKRWM  59

Query  1257  SFIRSKEFIMVRKLACLLEEWLYVLTVDADGKESHWEVLDCLGHKHHQLPQMPAPIRAGF  1078
             SF+ SKE + VRK    LEEW+YVL  DA  K SHWE+L+C G K   LP+MP   +AGF
Sbjct  60    SFLESKELVAVRKEVGKLEEWVYVLVPDAGAKGSHWEILECSGQKQSPLPRMPGLTKAGF  119

Query  1077  GVAVLNAKLLVMGGYSMIDESASVSPEVFQYDSCLNSWSKLASMNVARYDFACAEVNGMV  898
             GV V+  KL V+ GY+        S EV+QYDSCLN W+ LA MNVAR DFACAEVNG++
Sbjct  120   GVVVIGGKLFVIAGYAADHGKDCASDEVYQYDSCLNRWTVLAKMNVARCDFACAEVNGVI  179

Query  897   YAVGGNGVNGESLSCAEVYDPDTNKWRVIESLRRPRWGCFGCGFEGKLYVMGGRSSFTIG  718
             Y  GG G NGESLS  EVYDP+ NKW +IE LRRPRWGCFGC FEGKLYVMGGRSSFTIG
Sbjct  180   YVAGGFGPNGESLSSVEVYDPEQNKWTLIEGLRRPRWGCFGCSFEGKLYVMGGRSSFTIG  239

Query  717   NSRFVDVYNPERQSWCEMKNGCVMVTAHAVVGKKLFCIEWKNQRKLGIFNPEDNSWKMVG  538
             NSR VDVYNP   +W ++KNGCVMVTAHAV+GK+LFCIEWKNQR L IFNP D+SW+ V 
Sbjct  240   NSRSVDVYNPNSHAWGQVKNGCVMVTAHAVLGKRLFCIEWKNQRSLAIFNPADDSWQKVP  299

Query  537   VPVTGSSSIGFRLGILDEKLLLFSLQENPTYTTLLYDPNAAAGSEWQTCEIKPSGSCLCS  358
             VP+TGSSS  F L + ++KLLLF L+E P Y TL+YDP A  GSEW T ++KP+GSCLCS
Sbjct  300   VPLTGSSSTRFSLVVHEDKLLLFPLEEEPGYQTLMYDPAAPMGSEWCTSKLKPTGSCLCS  359

Query  357   VTIKA  343
             VTIKA
Sbjct  360   VTIKA  364



>emb|CDY64883.1| BnaC02g45970D [Brassica napus]
Length=411

 Score =   478 bits (1229),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 225/339 (66%), Positives = 268/339 (79%), Gaps = 0/339 (0%)
 Frame = -1

Query  1359  PLLPGLPDDVAKYCLALVPRYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWLYVLT  1180
             PL+PGL DDVAK CLALVPR   P+MG V KRWR  ++SKEFI VR+LA + EEWLYVLT
Sbjct  73    PLIPGLSDDVAKLCLALVPRASLPSMGRVCKRWRYVVQSKEFITVRRLAGMPEEWLYVLT  132

Query  1179  VDADGKESHWEVLDCLGHKHHQLPQMPAPIRAGFGVAVLNAKLLVMGGYSMIDESASVSP  1000
             +DA GKESHWEV+DCLGHK   LP MP P++ GF V V++ KLLV+ G +MI  S   S 
Sbjct  133   MDAGGKESHWEVIDCLGHKLSSLPPMPGPVKTGFKVVVVDGKLLVIAGCAMISGSHVASS  192

Query  999   EVFQYDSCLNSWSKLASMNVARYDFACAEVNGMVYAVGGNGVNGESLSCAEVYDPDTNKW  820
             +V+Q+D+CLNSWS+LA +  ARYDFACAEVNG+VY VGG+G +GESLS AEVYDP+T  W
Sbjct  193   DVYQFDTCLNSWSRLADLKEARYDFACAEVNGLVYVVGGHGGDGESLSSAEVYDPETGVW  252

Query  819   RVIESLRRPRWGCFGCGFEGKLYVMGGRSSFTIGNSRFVDVYNPERQSWCEMKNGCVMVT  640
               I+SLRRPRWGCF  GF GKLYVMGGRS+FTIGNS+ VDVYNP+  SWC  KNG  MVT
Sbjct  253   TFIQSLRRPRWGCFASGFNGKLYVMGGRSNFTIGNSKLVDVYNPQCGSWCGSKNGVTMVT  312

Query  639   AHAVVGKKLFCIEWKNQRKLGIFNPEDNSWKMVGVPVTGSSSIGFRLGILDEKLLLFSLQ  460
             AH  VGKKLFCIEWKNQRK+ +FN ED++W++V +P++GSS  GF+ G L  KLLLFS Q
Sbjct  313   AHVEVGKKLFCIEWKNQRKMSVFNAEDDTWEVVALPLSGSSRAGFQFGKLSGKLLLFSSQ  372

Query  459   ENPTYTTLLYDPNAAAGSEWQTCEIKPSGSCLCSVTIKA  343
             E   ++TLLYDP AA G +W+T EIK SGSC+CSVTI A
Sbjct  373   EETGHSTLLYDPEAAPGRQWKTSEIKLSGSCVCSVTIIA  411



>ref|XP_009127556.1| PREDICTED: F-box/kelch-repeat protein At1g67480-like [Brassica 
rapa]
Length=362

 Score =   476 bits (1224),  Expect = 4e-159, Method: Compositional matrix adjust.
 Identities = 224/339 (66%), Positives = 270/339 (80%), Gaps = 0/339 (0%)
 Frame = -1

Query  1359  PLLPGLPDDVAKYCLALVPRYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWLYVLT  1180
             PL+PGL DDVAK CLALVPR   P+MG V K+WR  ++SKEFI VR+LA + EEWLYVLT
Sbjct  24    PLIPGLSDDVAKLCLALVPRSSLPSMGRVCKKWRYVVQSKEFITVRRLAGMPEEWLYVLT  83

Query  1179  VDADGKESHWEVLDCLGHKHHQLPQMPAPIRAGFGVAVLNAKLLVMGGYSMIDESASVSP  1000
             +DA GKESHWEV+DCLGHK   LP MP P++ GF V V++ KLLV+ G +MI  S   S 
Sbjct  84    MDAGGKESHWEVMDCLGHKLSSLPPMPGPVKTGFKVVVVDGKLLVIAGCAMISGSHVASS  143

Query  999   EVFQYDSCLNSWSKLASMNVARYDFACAEVNGMVYAVGGNGVNGESLSCAEVYDPDTNKW  820
             +V+Q+D+CLNSWS+LA +  ARYDFACAEVNG+VY VGG+G +GESLS AEVYDP+T  W
Sbjct  144   DVYQFDTCLNSWSRLADLKEARYDFACAEVNGLVYVVGGHGGDGESLSSAEVYDPETGVW  203

Query  819   RVIESLRRPRWGCFGCGFEGKLYVMGGRSSFTIGNSRFVDVYNPERQSWCEMKNGCVMVT  640
               I+SLRRPRWGCF  GF GKLYVMGGRS+FTIGNS+ VDVYNP+  SWC  KNG  MVT
Sbjct  204   TFIQSLRRPRWGCFASGFNGKLYVMGGRSNFTIGNSKLVDVYNPQCGSWCGRKNGVTMVT  263

Query  639   AHAVVGKKLFCIEWKNQRKLGIFNPEDNSWKMVGVPVTGSSSIGFRLGILDEKLLLFSLQ  460
             AH  VGKKLFC+EWKNQRK+ +FN ED++W++V +P++GSSS GF+ G L+ KLLLFS Q
Sbjct  264   AHVEVGKKLFCMEWKNQRKMYVFNAEDDTWEVVALPLSGSSSAGFQFGKLNGKLLLFSSQ  323

Query  459   ENPTYTTLLYDPNAAAGSEWQTCEIKPSGSCLCSVTIKA  343
             E   ++TLLYDP AA G +W+T EIK SGSC+CSVTI A
Sbjct  324   EETGHSTLLYDPEAAPGRQWKTSEIKLSGSCVCSVTIIA  362



>ref|XP_010556158.1| PREDICTED: F-box/kelch-repeat protein At1g67480-like [Tarenaya 
hassleriana]
 ref|XP_010556159.1| PREDICTED: F-box/kelch-repeat protein At1g67480-like [Tarenaya 
hassleriana]
Length=365

 Score =   475 bits (1223),  Expect = 6e-159, Method: Compositional matrix adjust.
 Identities = 226/357 (63%), Positives = 273/357 (76%), Gaps = 0/357 (0%)
 Frame = -1

Query  1419  GHSKNISYFTSSVVVDDSYSPLLPGLPDDVAKYCLALVPRYYFPAMGGVNKRWRSFIRSK  1240
             G  +    F S +  D   +PL+PGLPDDVAK CL LVPR  FP+MG V+K+WR F++SK
Sbjct  7     GKKRTSLGFASWLSDDFRDNPLIPGLPDDVAKLCLTLVPRADFPSMGSVSKKWRFFMQSK  66

Query  1239  EFIMVRKLACLLEEWLYVLTVDADGKESHWEVLDCLGHKHHQLPQMPAPIRAGFGVAVLN  1060
             EFI VRKLA +LEEWLYVLT+D +GKES+WEV+D  GHK   LP MP P ++GFGV VLN
Sbjct  67    EFITVRKLAGVLEEWLYVLTMDCEGKESNWEVMDSSGHKRSFLPPMPGPAKSGFGVVVLN  126

Query  1059  AKLLVMGGYSMIDESASVSPEVFQYDSCLNSWSKLASMNVARYDFACAEVNGMVYAVGGN  880
              +LLV+ G S+ D +   S +V+QYDSCLN+WSKL  +NVARY FACAEVNG+VY  GG+
Sbjct  127   GRLLVLAGVSVTDGARVASADVYQYDSCLNNWSKLPELNVARYGFACAEVNGLVYVAGGH  186

Query  879   GVNGESLSCAEVYDPDTNKWRVIESLRRPRWGCFGCGFEGKLYVMGGRSSFTIGNSRFVD  700
             G+ G SLS AEVYDP T KW VI+SLRRPRWGCF  GF GK YVMGGRS+FTIGNS+ VD
Sbjct  187   GIEGNSLSSAEVYDPQTGKWTVIDSLRRPRWGCFAFGFNGKFYVMGGRSNFTIGNSKLVD  246

Query  699   VYNPERQSWCEMKNGCVMVTAHAVVGKKLFCIEWKNQRKLGIFNPEDNSWKMVGVPVTGS  520
             +YNPE  SW E KNG  MVTAHA +G+KLFCI+WKNQRK+ +FNPED SW  V +P++GS
Sbjct  247   IYNPELGSWRESKNGLTMVTAHAEMGEKLFCIQWKNQRKMVVFNPEDESWDEVDIPLSGS  306

Query  519   SSIGFRLGILDEKLLLFSLQENPTYTTLLYDPNAAAGSEWQTCEIKPSGSCLCSVTI  349
             S  GF+ G L  KLLLF  +E  ++ TLLYDPNA   +EW+T +IKP GSC+CSVTI
Sbjct  307   SRAGFQFGKLGGKLLLFPSREENSHNTLLYDPNADPAAEWKTSQIKPFGSCVCSVTI  363



>ref|XP_010415321.1| PREDICTED: F-box/kelch-repeat protein At1g67480-like [Camelina 
sativa]
 ref|XP_010415322.1| PREDICTED: F-box/kelch-repeat protein At1g67480-like [Camelina 
sativa]
Length=357

 Score =   473 bits (1218),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 221/346 (64%), Positives = 271/346 (78%), Gaps = 0/346 (0%)
 Frame = -1

Query  1380  VVDDSYSPLLPGLPDDVAKYCLALVPRYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLE  1201
             +V+    PL+PGLPDDVAK CLALVPR  FP+MG V K+WR  ++SKEFI +R+LA +LE
Sbjct  12    IVNFMDDPLIPGLPDDVAKQCLALVPRARFPSMGSVCKKWRFVVQSKEFITLRRLAGMLE  71

Query  1200  EWLYVLTVDADGKESHWEVLDCLGHKHHQLPQMPAPIRAGFGVAVLNAKLLVMGGYSMID  1021
             EWLYV T++A G ES WEV+DCLG K   LP MP P++ GF V V++ KLLV+ G SMI+
Sbjct  72    EWLYVFTMNAGGNESQWEVMDCLGQKLSSLPPMPGPVKTGFKVVVVDGKLLVIAGCSMIN  131

Query  1020  ESASVSPEVFQYDSCLNSWSKLASMNVARYDFACAEVNGMVYAVGGNGVNGESLSCAEVY  841
              S   S +V+QYD+CLNSWS+LA + VARYDFACAEVNG++Y VGG+G++GESLS AEVY
Sbjct  132   GSLVASADVYQYDTCLNSWSRLADLEVARYDFACAEVNGLIYVVGGHGIDGESLSSAEVY  191

Query  840   DPDTNKWRVIESLRRPRWGCFGCGFEGKLYVMGGRSSFTIGNSRFVDVYNPERQSWCEMK  661
             DP+T  W  IESLRRPRWGCF  GF GKLYVMGGRS+FTIGNS+ +DVYN +  SW   K
Sbjct  192   DPETGTWTFIESLRRPRWGCFASGFNGKLYVMGGRSNFTIGNSKLLDVYNTQCGSWHGSK  251

Query  660   NGCVMVTAHAVVGKKLFCIEWKNQRKLGIFNPEDNSWKMVGVPVTGSSSIGFRLGILDEK  481
             NG  MVTAH  VGKKLFCI+WKNQRK+ +FN ED +W++V +P++GSS  GF+ G L  K
Sbjct  252   NGLTMVTAHVEVGKKLFCIDWKNQRKMSVFNAEDETWEVVALPLSGSSRAGFQFGKLSGK  311

Query  480   LLLFSLQENPTYTTLLYDPNAAAGSEWQTCEIKPSGSCLCSVTIKA  343
             LLLFS QE   + TLLYDP+AA G++W+T EIK SGSC+CSVTI A
Sbjct  312   LLLFSSQEGTGHNTLLYDPDAAPGTQWKTSEIKLSGSCVCSVTITA  357



>ref|XP_010470651.1| PREDICTED: F-box/kelch-repeat protein At1g67480 [Camelina sativa]
 ref|XP_010470652.1| PREDICTED: F-box/kelch-repeat protein At1g67480 [Camelina sativa]
 ref|XP_010470653.1| PREDICTED: F-box/kelch-repeat protein At1g67480 [Camelina sativa]
 ref|XP_010470654.1| PREDICTED: F-box/kelch-repeat protein At1g67480 [Camelina sativa]
Length=357

 Score =   473 bits (1216),  Expect = 5e-158, Method: Compositional matrix adjust.
 Identities = 221/346 (64%), Positives = 270/346 (78%), Gaps = 0/346 (0%)
 Frame = -1

Query  1380  VVDDSYSPLLPGLPDDVAKYCLALVPRYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLE  1201
             +V+    PL+PGLPDDVAK CLALVPR  FP+MG V K+WR  ++SKEFI VR+LA +LE
Sbjct  12    IVNFMDDPLIPGLPDDVAKQCLALVPRARFPSMGSVCKKWRFVVQSKEFITVRRLAGMLE  71

Query  1200  EWLYVLTVDADGKESHWEVLDCLGHKHHQLPQMPAPIRAGFGVAVLNAKLLVMGGYSMID  1021
             EWLYVLT++A G ES WEV+DC G K   LP MP P++ GF V V++ KLLV+ G SMI+
Sbjct  72    EWLYVLTMNAGGNESQWEVMDCFGQKLSSLPPMPGPVKTGFKVVVVDGKLLVIAGCSMIN  131

Query  1020  ESASVSPEVFQYDSCLNSWSKLASMNVARYDFACAEVNGMVYAVGGNGVNGESLSCAEVY  841
              S   S +V+QYD+CLNSWS+LA + V RYDFACAEVNG++Y VGG+G++GESLS AEVY
Sbjct  132   GSLVASADVYQYDTCLNSWSRLADLEVERYDFACAEVNGLIYVVGGHGIDGESLSSAEVY  191

Query  840   DPDTNKWRVIESLRRPRWGCFGCGFEGKLYVMGGRSSFTIGNSRFVDVYNPERQSWCEMK  661
             DP+T  W  IESLRRPRWGCF  GF GKLYVMGGRS+FTIGNS+ +DVYN +  SW   K
Sbjct  192   DPETGTWTFIESLRRPRWGCFASGFNGKLYVMGGRSNFTIGNSKLLDVYNTQCGSWHGSK  251

Query  660   NGCVMVTAHAVVGKKLFCIEWKNQRKLGIFNPEDNSWKMVGVPVTGSSSIGFRLGILDEK  481
             NG  MVTAH  VGKKLFCI+WKNQRK+ +FN ED +W++V +P++GSS  GF+ G L  K
Sbjct  252   NGLTMVTAHVEVGKKLFCIDWKNQRKMSVFNAEDETWEVVALPLSGSSRAGFQFGKLSGK  311

Query  480   LLLFSLQENPTYTTLLYDPNAAAGSEWQTCEIKPSGSCLCSVTIKA  343
             LLLFS QE   + TLLYDP+AA G++W+T EIK SGSC+CSVTI A
Sbjct  312   LLLFSSQEGTGHNTLLYDPDAAPGTQWKTSEIKLSGSCVCSVTITA  357



>emb|CDY01812.1| BnaC06g28520D [Brassica napus]
Length=373

 Score =   472 bits (1214),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 236/381 (62%), Positives = 281/381 (74%), Gaps = 15/381 (4%)
 Frame = -1

Query  1482  GKKRVT-ELKMCFSDEMNLDNPGHSKNISYFTSSVVVDDSYSPLLPGLPDDVAKYCLALV  1306
             GKKRV     MCFS + NLD            S    DD   PL+PGL DDVAK CLALV
Sbjct  7     GKKRVVVSNGMCFSKD-NLD----------LGSENYGDD---PLIPGLSDDVAKMCLALV  52

Query  1305  PRYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWLYVLTVDADGKESHWEVLDCLGH  1126
             PR  FP+MG V K+WR  ++SKEFI VR+LA +LEEWLYVLT  A GKESHWEV+DC GH
Sbjct  53    PRASFPSMGRVCKKWRYVVKSKEFITVRRLAGMLEEWLYVLTTKAGGKESHWEVMDCQGH  112

Query  1125  KHHQLPQMPAPIRAGFGVAVLNAKLLVMGGYSMIDESASVSPEVFQYDSCLNSWSKLASM  946
             K   LP +P P + GF V V++ KLLV+ G ++I+ S   S +V+Q+D+CLNSWSKL  +
Sbjct  113   KLSSLPPIPGPAKTGFKVVVVDGKLLVVAGCALINGSLVASSDVYQFDTCLNSWSKLDDL  172

Query  945   NVARYDFACAEVNGMVYAVGGNGVNGESLSCAEVYDPDTNKWRVIESLRRPRWGCFGCGF  766
               ARY+FACAEVNG+VY VGG+GV+GESLS AEVYDP+T  W  IESLRRPRWGCF  GF
Sbjct  173   KEARYEFACAEVNGLVYVVGGHGVDGESLSSAEVYDPETGVWTFIESLRRPRWGCFASGF  232

Query  765   EGKLYVMGGRSSFTIGNSRFVDVYNPERQSWCEMKNGCVMVTAHAVVGKKLFCIEWKNQR  586
              GKLYVMGGRS+FTIGNS+ VDVYNP+  SWC  KNG  MVTAH  VGKKLFCI+WKNQR
Sbjct  233   NGKLYVMGGRSNFTIGNSKLVDVYNPQCGSWCGNKNGLTMVTAHVEVGKKLFCIDWKNQR  292

Query  585   KLGIFNPEDNSWKMVGVPVTGSSSIGFRLGILDEKLLLFSLQENPTYTTLLYDPNAAAGS  406
             K+ +FN ED +W++V +P++GSS  GF+ G L+ KLLLFS QE    +TLLYDP+AA G 
Sbjct  293   KMSVFNAEDETWEVVALPLSGSSRAGFQFGKLNGKLLLFSSQEEAGRSTLLYDPDAAPGK  352

Query  405   EWQTCEIKPSGSCLCSVTIKA  343
             +W T EIK SG C+CSVTI A
Sbjct  353   QWMTSEIKLSGPCVCSVTITA  373



>ref|NP_176915.1| F-box/kelch-repeat protein [Arabidopsis thaliana]
 ref|NP_001077785.1| F-box/kelch-repeat protein [Arabidopsis thaliana]
 sp|Q9CAG8.1|FBK28_ARATH RecName: Full=F-box/kelch-repeat protein At1g67480 [Arabidopsis 
thaliana]
 gb|AAG52295.1|AC011020_2 unknown protein [Arabidopsis thaliana]
 dbj|BAF00876.1| hypothetical protein [Arabidopsis thaliana]
 gb|ABM06000.1| At1g67480 [Arabidopsis thaliana]
 gb|AEE34651.1| F-box/kelch-repeat protein [Arabidopsis thaliana]
 gb|AEE34652.1| F-box/kelch-repeat protein [Arabidopsis thaliana]
Length=376

 Score =   471 bits (1213),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 233/380 (61%), Positives = 282/380 (74%), Gaps = 11/380 (3%)
 Frame = -1

Query  1482  GKKRVTELKMCFSDEMNLDNPGHSKNISYFTSSVVVDDSYSPLLPGLPDDVAKYCLALVP  1303
             GKKR+    MCFS + NLD       +    S   +DD   PL+PGLPDDVAK CLALVP
Sbjct  8     GKKRIVNHGMCFS-KGNLD-------LGSRLSENFMDD---PLIPGLPDDVAKQCLALVP  56

Query  1302  RYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWLYVLTVDADGKESHWEVLDCLGHK  1123
             R  FP+MG V K+WR  ++SKEFI VR+LA +LEEWLYVLT++A GK++ WEV+DCLG K
Sbjct  57    RARFPSMGSVCKKWRFVVQSKEFITVRRLAGMLEEWLYVLTMNAGGKDNRWEVMDCLGQK  116

Query  1122  HHQLPQMPAPIRAGFGVAVLNAKLLVMGGYSMIDESASVSPEVFQYDSCLNSWSKLASMN  943
                LP MP P + GF V V++ KLLV+ G  MI+ S   S +V+QYD+CLNSWS+LA + 
Sbjct  117   LSSLPPMPGPAKTGFKVVVVDGKLLVIAGCCMINGSLVASADVYQYDTCLNSWSRLADLE  176

Query  942   VARYDFACAEVNGMVYAVGGNGVNGESLSCAEVYDPDTNKWRVIESLRRPRWGCFGCGFE  763
             VARYDFACAEVNG VY VGG+GV+GESLS AEVYDP+T  W  IESLRRPRWGCF   F 
Sbjct  177   VARYDFACAEVNGHVYVVGGHGVDGESLSSAEVYDPETCTWTFIESLRRPRWGCFASAFN  236

Query  762   GKLYVMGGRSSFTIGNSRFVDVYNPERQSWCEMKNGCVMVTAHAVVGKKLFCIEWKNQRK  583
             GKLYVMGGRS+FTIGNS+ +DVYN +  SW   KNG  MVTAH  VGKKLFCI+WKN RK
Sbjct  237   GKLYVMGGRSNFTIGNSKLLDVYNTQCGSWHGSKNGLTMVTAHVEVGKKLFCIDWKNHRK  296

Query  582   LGIFNPEDNSWKMVGVPVTGSSSIGFRLGILDEKLLLFSLQENPTYTTLLYDPNAAAGSE  403
             + +FN ED +W++V +P++GSS  GF+ G L  KLLLFS QE     TLLYDP+A+ G++
Sbjct  297   MSVFNAEDETWEVVALPLSGSSRAGFQFGKLSGKLLLFSSQEETGQCTLLYDPDASPGTQ  356

Query  402   WQTCEIKPSGSCLCSVTIKA  343
             W+T EIK SGSC+CSVTI A
Sbjct  357   WKTSEIKLSGSCVCSVTITA  376



>ref|XP_010511677.1| PREDICTED: F-box/kelch-repeat protein At1g67480-like [Camelina 
sativa]
 ref|XP_010511678.1| PREDICTED: F-box/kelch-repeat protein At1g67480-like [Camelina 
sativa]
 ref|XP_010511679.1| PREDICTED: F-box/kelch-repeat protein At1g67480-like [Camelina 
sativa]
 ref|XP_010511680.1| PREDICTED: F-box/kelch-repeat protein At1g67480-like [Camelina 
sativa]
Length=357

 Score =   471 bits (1211),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 220/346 (64%), Positives = 269/346 (78%), Gaps = 0/346 (0%)
 Frame = -1

Query  1380  VVDDSYSPLLPGLPDDVAKYCLALVPRYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLE  1201
             +V+    PL+PGLPDDVAK CLALVPR  FP+MG V K+WR  ++SKEFI VR+LA +LE
Sbjct  12    IVNFMDDPLIPGLPDDVAKQCLALVPRARFPSMGSVCKKWRFVVQSKEFITVRRLAGMLE  71

Query  1200  EWLYVLTVDADGKESHWEVLDCLGHKHHQLPQMPAPIRAGFGVAVLNAKLLVMGGYSMID  1021
             EWLYVLT++A G ES WEV+DC G K   LP MP P++ GF V V++ KLLV+ G SMI+
Sbjct  72    EWLYVLTMNAGGNESQWEVMDCFGQKLSSLPPMPGPVKTGFKVVVVDGKLLVIAGCSMIN  131

Query  1020  ESASVSPEVFQYDSCLNSWSKLASMNVARYDFACAEVNGMVYAVGGNGVNGESLSCAEVY  841
              S   S +V+QYD+CLNSW +LA + VARYDFACAEVNG++Y VGG+G++GESLS AEVY
Sbjct  132   GSLVASADVYQYDTCLNSWGRLADLEVARYDFACAEVNGLIYVVGGHGIDGESLSSAEVY  191

Query  840   DPDTNKWRVIESLRRPRWGCFGCGFEGKLYVMGGRSSFTIGNSRFVDVYNPERQSWCEMK  661
             DP+T  W  IESLRRPRWGCF  GF GKLYVMGGRS+FTIGNS+ +DVYN +  SW   K
Sbjct  192   DPETGTWTFIESLRRPRWGCFASGFNGKLYVMGGRSNFTIGNSKLLDVYNTQCGSWHGSK  251

Query  660   NGCVMVTAHAVVGKKLFCIEWKNQRKLGIFNPEDNSWKMVGVPVTGSSSIGFRLGILDEK  481
             NG  MVTAH  VG KLFCI+WKNQRK+ +FN ED +W++V +P++GSS  GF+ G L  K
Sbjct  252   NGLTMVTAHVEVGTKLFCIDWKNQRKMSVFNAEDETWEVVALPLSGSSRAGFQFGKLSGK  311

Query  480   LLLFSLQENPTYTTLLYDPNAAAGSEWQTCEIKPSGSCLCSVTIKA  343
             LLLFS QE   + TLLYDP+AA G++W+T EIK SGSC+CSVTI A
Sbjct  312   LLLFSSQEGTGHNTLLYDPDAAPGTQWKTSEIKLSGSCVCSVTITA  357



>gb|AAC18788.1| Contains similarity to beta scruin gb|Z47541 from Limulus polyphemus. 
ESTs gb|T04493 and gb|AA585955 come from this gene 
[Arabidopsis thaliana]
Length=433

 Score =   473 bits (1216),  Expect = 7e-157, Method: Compositional matrix adjust.
 Identities = 233/380 (61%), Positives = 282/380 (74%), Gaps = 11/380 (3%)
 Frame = -1

Query  1482  GKKRVTELKMCFSDEMNLDNPGHSKNISYFTSSVVVDDSYSPLLPGLPDDVAKYCLALVP  1303
             GKKR+    MCFS + NLD       +    S   +DD   PL+PGLPDDVAK CLALVP
Sbjct  65    GKKRIVNHGMCFS-KGNLD-------LGSRLSENFMDD---PLIPGLPDDVAKQCLALVP  113

Query  1302  RYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWLYVLTVDADGKESHWEVLDCLGHK  1123
             R  FP+MG V K+WR  ++SKEFI VR+LA +LEEWLYVLT++A GK++ WEV+DCLG K
Sbjct  114   RARFPSMGSVCKKWRFVVQSKEFITVRRLAGMLEEWLYVLTMNAGGKDNRWEVMDCLGQK  173

Query  1122  HHQLPQMPAPIRAGFGVAVLNAKLLVMGGYSMIDESASVSPEVFQYDSCLNSWSKLASMN  943
                LP MP P + GF V V++ KLLV+ G  MI+ S   S +V+QYD+CLNSWS+LA + 
Sbjct  174   LSSLPPMPGPAKTGFKVVVVDGKLLVIAGCCMINGSLVASADVYQYDTCLNSWSRLADLE  233

Query  942   VARYDFACAEVNGMVYAVGGNGVNGESLSCAEVYDPDTNKWRVIESLRRPRWGCFGCGFE  763
             VARYDFACAEVNG VY VGG+GV+GESLS AEVYDP+T  W  IESLRRPRWGCF   F 
Sbjct  234   VARYDFACAEVNGHVYVVGGHGVDGESLSSAEVYDPETCTWTFIESLRRPRWGCFASAFN  293

Query  762   GKLYVMGGRSSFTIGNSRFVDVYNPERQSWCEMKNGCVMVTAHAVVGKKLFCIEWKNQRK  583
             GKLYVMGGRS+FTIGNS+ +DVYN +  SW   KNG  MVTAH  VGKKLFCI+WKN RK
Sbjct  294   GKLYVMGGRSNFTIGNSKLLDVYNTQCGSWHGSKNGLTMVTAHVEVGKKLFCIDWKNHRK  353

Query  582   LGIFNPEDNSWKMVGVPVTGSSSIGFRLGILDEKLLLFSLQENPTYTTLLYDPNAAAGSE  403
             + +FN ED +W++V +P++GSS  GF+ G L  KLLLFS QE     TLLYDP+A+ G++
Sbjct  354   MSVFNAEDETWEVVALPLSGSSRAGFQFGKLSGKLLLFSSQEETGQCTLLYDPDASPGTQ  413

Query  402   WQTCEIKPSGSCLCSVTIKA  343
             W+T EIK SGSC+CSVTI A
Sbjct  414   WKTSEIKLSGSCVCSVTITA  433



>dbj|BAJ95391.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK07553.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=385

 Score =   469 bits (1207),  Expect = 3e-156, Method: Compositional matrix adjust.
 Identities = 228/379 (60%), Positives = 275/379 (73%), Gaps = 1/379 (0%)
 Frame = -1

Query  1479  KKRVTELKMCFSDEMNLDNPGHSKNISYFTSSVVVDDSYSPLLPGLPDDVAKYCLALVPR  1300
             +++  + + C    M L +P   K +S+  +     D Y  L+PGLP+D+AK CLALVPR
Sbjct  8     REQFVQPQSCLRATMQLKSPTRPK-LSFCFTPQGDCDQYCALIPGLPEDLAKICLALVPR  66

Query  1299  YYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWLYVLTVDADGKESHWEVLDCLGHKH  1120
              +FP MGGV+KRW SF+ SKE I VRK    L+E +YVLT DA  K SHWEVL C G K+
Sbjct  67    THFPVMGGVSKRWMSFLESKELIAVRKEVRKLDECVYVLTADAGAKGSHWEVLGCQGQKN  126

Query  1119  HQLPQMPAPIRAGFGVAVLNAKLLVMGGYSMIDESASVSPEVFQYDSCLNSWSKLASMNV  940
               LP MP P +AGFGV VL+ KL+V+ GY+       VS EV+QYD  LN W+ ++ +NV
Sbjct  127   TPLPPMPGPTKAGFGVVVLDGKLVVIAGYAADHGKECVSDEVYQYDCFLNRWTTISKLNV  186

Query  939   ARYDFACAEVNGMVYAVGGNGVNGESLSCAEVYDPDTNKWRVIESLRRPRWGCFGCGFEG  760
             AR DFACAEVNG++Y  GG G +G+SLS  EVYDP+ NKW +I  LRRPRWGCFGC FE 
Sbjct  187   ARCDFACAEVNGVIYVAGGFGPDGDSLSSVEVYDPEQNKWALIGRLRRPRWGCFGCSFED  246

Query  759   KLYVMGGRSSFTIGNSRFVDVYNPERQSWCEMKNGCVMVTAHAVVGKKLFCIEWKNQRKL  580
             K+YVMGGRSSFTIGNSRF+DVY+    +W E +NGCVMVTAHAV+G+KLFCIEWKNQR L
Sbjct  247   KMYVMGGRSSFTIGNSRFIDVYDTNSGAWGEFRNGCVMVTAHAVLGEKLFCIEWKNQRSL  306

Query  579   GIFNPEDNSWKMVGVPVTGSSSIGFRLGILDEKLLLFSLQENPTYTTLLYDPNAAAGSEW  400
              IFNP DNSW+ V VP+TGSSS  F LG  D KLLLFSL+E P Y TL+YDP A  GSEW
Sbjct  307   AIFNPADNSWQKVPVPLTGSSSTRFSLGTHDGKLLLFSLEEEPGYQTLMYDPAAPTGSEW  366

Query  399   QTCEIKPSGSCLCSVTIKA  343
                 ++PSGSCLCSVTIKA
Sbjct  367   CKSTLRPSGSCLCSVTIKA  385



>ref|XP_002887123.1| kelch repeat-containing F-box family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH63382.1| kelch repeat-containing F-box family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=376

 Score =   468 bits (1205),  Expect = 4e-156, Method: Compositional matrix adjust.
 Identities = 231/380 (61%), Positives = 281/380 (74%), Gaps = 11/380 (3%)
 Frame = -1

Query  1482  GKKRVTELKMCFSDEMNLDNPGHSKNISYFTSSVVVDDSYSPLLPGLPDDVAKYCLALVP  1303
             GKKR+    MCFS + NLD       +    S   +DD   PL+PGLPDDVAK CLALVP
Sbjct  8     GKKRIVNHGMCFS-KGNLD-------LGSRLSENFMDD---PLIPGLPDDVAKQCLALVP  56

Query  1302  RYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWLYVLTVDADGKESHWEVLDCLGHK  1123
             R  FP+MG V K+WR  ++SKEFI VR+LA +LEEWLYVLT +A GK+S WEV+DCLG K
Sbjct  57    RARFPSMGSVCKKWRFVVQSKEFITVRRLAGMLEEWLYVLTTNAGGKQSQWEVMDCLGQK  116

Query  1122  HHQLPQMPAPIRAGFGVAVLNAKLLVMGGYSMIDESASVSPEVFQYDSCLNSWSKLASMN  943
                L  MP P + GF V V++ KLLV+ G S I+ S   S +V+QYD+ LNSWS+LA + 
Sbjct  117   LSSLSPMPGPEKTGFKVVVVDGKLLVIAGCSKINGSLVASADVYQYDTGLNSWSRLADLK  176

Query  942   VARYDFACAEVNGMVYAVGGNGVNGESLSCAEVYDPDTNKWRVIESLRRPRWGCFGCGFE  763
             VARYDFACAEVNG++Y VGG+GV+GESLS AEVYDP+   W  IESLRRPRWGCF  GF 
Sbjct  177   VARYDFACAEVNGLIYVVGGHGVDGESLSSAEVYDPEMGTWTFIESLRRPRWGCFASGFN  236

Query  762   GKLYVMGGRSSFTIGNSRFVDVYNPERQSWCEMKNGCVMVTAHAVVGKKLFCIEWKNQRK  583
             GKLYVMGGRS+FTIGNS+ +DVYN +  SW   KNG  MVTAH  VGKKLFCI+WKNQRK
Sbjct  237   GKLYVMGGRSNFTIGNSKLLDVYNTQCGSWHGSKNGLTMVTAHVEVGKKLFCIDWKNQRK  296

Query  582   LGIFNPEDNSWKMVGVPVTGSSSIGFRLGILDEKLLLFSLQENPTYTTLLYDPNAAAGSE  403
             + +FN ED +W++V +P++GSS  GF+ G L  KLLLFS QE     TL+YDP+A+ G++
Sbjct  297   MSVFNAEDETWEVVALPLSGSSRAGFQFGKLSGKLLLFSSQEETGQCTLVYDPDASPGTQ  356

Query  402   WQTCEIKPSGSCLCSVTIKA  343
             W+T EIK SGSC+CSVTI A
Sbjct  357   WKTSEIKLSGSCVCSVTITA  376



>ref|XP_009105286.1| PREDICTED: F-box/kelch-repeat protein At1g67480 [Brassica rapa]
 ref|XP_009105287.1| PREDICTED: F-box/kelch-repeat protein At1g67480 [Brassica rapa]
 ref|XP_009105288.1| PREDICTED: F-box/kelch-repeat protein At1g67480 [Brassica rapa]
 ref|XP_009105289.1| PREDICTED: F-box/kelch-repeat protein At1g67480 [Brassica rapa]
Length=373

 Score =   467 bits (1202),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 230/382 (60%), Positives = 279/382 (73%), Gaps = 17/382 (4%)
 Frame = -1

Query  1482  GKKRVTELK-MCFS-DEMNLDNPGHSKNISYFTSSVVVDDSYSPLLPGLPDDVAKYCLAL  1309
             GKKRV     MCFS D ++L +  +                  PL+PGL DDVAK CLAL
Sbjct  7     GKKRVVVSNGMCFSKDNLDLGSENYRD---------------VPLIPGLSDDVAKMCLAL  51

Query  1308  VPRYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWLYVLTVDADGKESHWEVLDCLG  1129
             VPR  FP+MG V K+WR  ++SKEFI VR+LA +LEEWLYVLT +A GKESHWEV+DC G
Sbjct  52    VPRASFPSMGRVCKKWRYVVKSKEFITVRRLAGMLEEWLYVLTTNAGGKESHWEVMDCQG  111

Query  1128  HKHHQLPQMPAPIRAGFGVAVLNAKLLVMGGYSMIDESASVSPEVFQYDSCLNSWSKLAS  949
              K   LP MP P + GF V V++ KLLV+ G ++I+ S   S +V+Q+D+CLNSWS+L  
Sbjct  112   RKLSSLPPMPGPAKTGFKVVVVDGKLLVVAGCALINGSLVASSDVYQFDTCLNSWSRLED  171

Query  948   MNVARYDFACAEVNGMVYAVGGNGVNGESLSCAEVYDPDTNKWRVIESLRRPRWGCFGCG  769
             +  ARYDFACAEVNG+VY VGG+ V+GESLS AEVYDP+T  W  IESLRRPRWGCF  G
Sbjct  172   LKEARYDFACAEVNGLVYVVGGHAVDGESLSSAEVYDPETGIWTFIESLRRPRWGCFASG  231

Query  768   FEGKLYVMGGRSSFTIGNSRFVDVYNPERQSWCEMKNGCVMVTAHAVVGKKLFCIEWKNQ  589
             F GKLYVMGGRS+FTIGNS+ VDVYNP+  SWC  KNG  MVTAH  VGKKLFCI+WKNQ
Sbjct  232   FNGKLYVMGGRSNFTIGNSKLVDVYNPQCGSWCGNKNGLTMVTAHVEVGKKLFCIDWKNQ  291

Query  588   RKLGIFNPEDNSWKMVGVPVTGSSSIGFRLGILDEKLLLFSLQENPTYTTLLYDPNAAAG  409
             RK+ +FN ED +W++V +P++GSS  GF+ G L+ KLLLFS QE    +TL+YDP+AA G
Sbjct  292   RKMSVFNAEDETWEVVALPLSGSSRAGFQFGKLNGKLLLFSSQEEAGRSTLMYDPDAAPG  351

Query  408   SEWQTCEIKPSGSCLCSVTIKA  343
              +W T EIK SG C+CSVTI A
Sbjct  352   KQWMTSEIKLSGPCVCSVTITA  373



>emb|CDM85931.1| unnamed protein product [Triticum aestivum]
Length=384

 Score =   467 bits (1201),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 221/343 (64%), Positives = 262/343 (76%), Gaps = 0/343 (0%)
 Frame = -1

Query  1371  DSYSPLLPGLPDDVAKYCLALVPRYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWL  1192
             D Y  L+PGLP+D+AK CLALVPR +FP MGGV+KRW SF+ SKE I VRK    L+E +
Sbjct  42    DQYCALIPGLPEDLAKICLALVPRTHFPVMGGVSKRWMSFLESKELIAVRKEVRKLDECV  101

Query  1191  YVLTVDADGKESHWEVLDCLGHKHHQLPQMPAPIRAGFGVAVLNAKLLVMGGYSMIDESA  1012
             YVLT D+  K SHWE+L C G K+  LP MP P +AGFGV VL+ KL+V+ GY+      
Sbjct  102   YVLTADSRAKTSHWEILGCQGQKNTPLPPMPGPTKAGFGVVVLDGKLIVIAGYAADHGKE  161

Query  1011  SVSPEVFQYDSCLNSWSKLASMNVARYDFACAEVNGMVYAVGGNGVNGESLSCAEVYDPD  832
              VS EV+QYD  LN W+ L+ MNVAR DFACAEVNG++Y  GG G +G+SLS  EVYDP+
Sbjct  162   CVSDEVYQYDCFLNRWTALSKMNVARCDFACAEVNGVIYVTGGFGPSGDSLSSVEVYDPE  221

Query  831   TNKWRVIESLRRPRWGCFGCGFEGKLYVMGGRSSFTIGNSRFVDVYNPERQSWCEMKNGC  652
              NKW +I  LRRPRWGCFGC FEGK+YVMGGRSSFTIGNSRF+DVY+    +W E +NGC
Sbjct  222   QNKWTLIGGLRRPRWGCFGCSFEGKMYVMGGRSSFTIGNSRFIDVYDTNSHAWGEFRNGC  281

Query  651   VMVTAHAVVGKKLFCIEWKNQRKLGIFNPEDNSWKMVGVPVTGSSSIGFRLGILDEKLLL  472
             VMVTAHAV+G+KLFCIEWKNQR L IF+P DNSW+ V VP+TGSSS  F LG  D KLLL
Sbjct  282   VMVTAHAVLGEKLFCIEWKNQRSLAIFDPADNSWQKVPVPLTGSSSTRFSLGTHDGKLLL  341

Query  471   FSLQENPTYTTLLYDPNAAAGSEWQTCEIKPSGSCLCSVTIKA  343
             FSL+E P Y TL+YDP A  GSEW T +++PSG CLC+VTIKA
Sbjct  342   FSLEEEPGYQTLMYDPAAPKGSEWCTSKLRPSGLCLCTVTIKA  384



>gb|EMT06173.1| hypothetical protein F775_06557 [Aegilops tauschii]
Length=503

 Score =   471 bits (1212),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 224/343 (65%), Positives = 261/343 (76%), Gaps = 0/343 (0%)
 Frame = -1

Query  1371  DSYSPLLPGLPDDVAKYCLALVPRYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWL  1192
             D Y  L+PGLP+D+AK CLALVPR +FP MGGV+KRW SF+ SKE I VRK    L+E +
Sbjct  161   DQYCALIPGLPEDLAKICLALVPRTHFPVMGGVSKRWMSFLESKELIAVRKEVQKLDECV  220

Query  1191  YVLTVDADGKESHWEVLDCLGHKHHQLPQMPAPIRAGFGVAVLNAKLLVMGGYSMIDESA  1012
             YVLT DA  K SHWEVL C G K+  LP MP P +AGFGV VL+ KL+V+ GY+      
Sbjct  221   YVLTADAQAKGSHWEVLGCQGQKNTPLPPMPGPTKAGFGVVVLDGKLIVIAGYAADHGKE  280

Query  1011  SVSPEVFQYDSCLNSWSKLASMNVARYDFACAEVNGMVYAVGGNGVNGESLSCAEVYDPD  832
              VS EV+QYD  LN W+ L+ MNVAR DFACAEVNG++Y  GG G +G+SLS  EVYDP+
Sbjct  281   FVSDEVYQYDCFLNRWTALSKMNVARCDFACAEVNGVIYVAGGFGPSGDSLSSVEVYDPE  340

Query  831   TNKWRVIESLRRPRWGCFGCGFEGKLYVMGGRSSFTIGNSRFVDVYNPERQSWCEMKNGC  652
              NKW +IE LRRPRWGCFGC FEGK+YVMGGRSSFTIGNSR++DVY+    +W E +NGC
Sbjct  341   QNKWTLIEGLRRPRWGCFGCSFEGKMYVMGGRSSFTIGNSRYIDVYDTNSNAWGEFRNGC  400

Query  651   VMVTAHAVVGKKLFCIEWKNQRKLGIFNPEDNSWKMVGVPVTGSSSIGFRLGILDEKLLL  472
             VMVTAHAV+G+KLFCIEWKNQR L IF P DNSWK   VP+TGSSS  F LGI D KLLL
Sbjct  401   VMVTAHAVLGEKLFCIEWKNQRSLAIFEPADNSWKKAPVPLTGSSSTRFSLGIHDGKLLL  460

Query  471   FSLQENPTYTTLLYDPNAAAGSEWQTCEIKPSGSCLCSVTIKA  343
             FSL+E P Y TL+YDP A  GSEW T  ++PSG CLC+VTIKA
Sbjct  461   FSLEEEPGYQTLMYDPAAPTGSEWCTSNLRPSGRCLCTVTIKA  503



>emb|CDX96091.1| BnaA07g26400D [Brassica napus]
Length=373

 Score =   464 bits (1193),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 229/382 (60%), Positives = 278/382 (73%), Gaps = 17/382 (4%)
 Frame = -1

Query  1482  GKKRVT-ELKMCFS-DEMNLDNPGHSKNISYFTSSVVVDDSYSPLLPGLPDDVAKYCLAL  1309
             GKKRV     MCFS D ++L +  +                  PL+PGL DDVAK CLAL
Sbjct  7     GKKRVVVSNGMCFSKDNLDLGSENYRD---------------VPLIPGLSDDVAKMCLAL  51

Query  1308  VPRYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWLYVLTVDADGKESHWEVLDCLG  1129
             VPR  FP+MG V K+WR  ++SKEFI VR+LA +LEEWLYVLT +A GKESHWEV+DC G
Sbjct  52    VPRASFPSMGRVCKKWRYVVKSKEFITVRRLAGMLEEWLYVLTTNAGGKESHWEVMDCQG  111

Query  1128  HKHHQLPQMPAPIRAGFGVAVLNAKLLVMGGYSMIDESASVSPEVFQYDSCLNSWSKLAS  949
              K   LP MP P + GF V V++ KLLV+ G ++I+ S   S +V+Q+D+CLNSWS+L  
Sbjct  112   RKLSSLPPMPGPAKTGFKVVVVDGKLLVVAGCALINGSLVASSDVYQFDTCLNSWSRLED  171

Query  948   MNVARYDFACAEVNGMVYAVGGNGVNGESLSCAEVYDPDTNKWRVIESLRRPRWGCFGCG  769
             +  ARYDFACAEVNG+VY VGG+GV+GESLS AEVYDP+T  W  IESLRRPRWGCF  G
Sbjct  172   LKEARYDFACAEVNGLVYVVGGHGVDGESLSSAEVYDPETGIWTFIESLRRPRWGCFASG  231

Query  768   FEGKLYVMGGRSSFTIGNSRFVDVYNPERQSWCEMKNGCVMVTAHAVVGKKLFCIEWKNQ  589
             F GKLYVMGGRS+FTIGNS+ VDVYN +  SW   KNG  MVTAH  VGKKLFCI+WKNQ
Sbjct  232   FNGKLYVMGGRSNFTIGNSKLVDVYNTQCGSWSGNKNGLTMVTAHVEVGKKLFCIDWKNQ  291

Query  588   RKLGIFNPEDNSWKMVGVPVTGSSSIGFRLGILDEKLLLFSLQENPTYTTLLYDPNAAAG  409
             RK+ +FN ED +W++V +P++GSS  GF+ G L+ KLLLFS QE    +TL+YDP+AA G
Sbjct  292   RKMSVFNAEDETWEVVALPLSGSSRAGFQFGKLNGKLLLFSSQEEAGRSTLMYDPDAAPG  351

Query  408   SEWQTCEIKPSGSCLCSVTIKA  343
              +W T EIK SG C+CSVTI A
Sbjct  352   KQWMTSEIKLSGPCVCSVTITA  373



>ref|XP_004975373.1| PREDICTED: F-box/kelch-repeat protein At1g67480-like isoform 
X1 [Setaria italica]
 ref|XP_004975374.1| PREDICTED: F-box/kelch-repeat protein At1g67480-like isoform 
X2 [Setaria italica]
Length=385

 Score =   461 bits (1185),  Expect = 6e-153, Method: Compositional matrix adjust.
 Identities = 220/342 (64%), Positives = 258/342 (75%), Gaps = 0/342 (0%)
 Frame = -1

Query  1371  DSYSPLLPGLPDDVAKYCLALVPRYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWL  1192
             DSYS L+PGLP+D+AK CLALVPR YFP MG V+K W +FI SKEFI VRK    LEEW+
Sbjct  43    DSYSVLIPGLPEDLAKICLALVPRSYFPVMGSVSKSWMTFIGSKEFIAVRKEVGKLEEWI  102

Query  1191  YVLTVDADGKESHWEVLDCLGHKHHQLPQMPAPIRAGFGVAVLNAKLLVMGGYSMIDESA  1012
             YVLT  A G  S WEVL  L  K   LP MP P +AGFGV VL+  L VM GY+      
Sbjct  103   YVLTAGAGGHGSRWEVLGSLDQKKRILPPMPGPNKAGFGVVVLDGNLFVMAGYAADHGKE  162

Query  1011  SVSPEVFQYDSCLNSWSKLASMNVARYDFACAEVNGMVYAVGGNGVNGESLSCAEVYDPD  832
              VS EV+ YD+CLN W+ LA MNVAR DFACAEVNG++Y  GG G +G+SLS  E Y+P 
Sbjct  163   FVSDEVYSYDACLNRWTALAKMNVARRDFACAEVNGVIYVAGGFGPDGDSLSSVEAYNPQ  222

Query  831   TNKWRVIESLRRPRWGCFGCGFEGKLYVMGGRSSFTIGNSRFVDVYNPERQSWCEMKNGC  652
              NKW +I+SLRR RWGCF CGF  KLYVMGGRSSFTIGNSR VDVY+P+R+SW E+K GC
Sbjct  223   KNKWILIQSLRRSRWGCFACGFNDKLYVMGGRSSFTIGNSRSVDVYDPDRRSWDEIKRGC  282

Query  651   VMVTAHAVVGKKLFCIEWKNQRKLGIFNPEDNSWKMVGVPVTGSSSIGFRLGILDEKLLL  472
             VMVT+HAV+ K+LFCIEWKNQR L  FNP DNSW+ + VP+TGSSS  F LG+L +K+LL
Sbjct  283   VMVTSHAVLDKRLFCIEWKNQRSLATFNPADNSWQRIPVPLTGSSSTRFCLGVLGKKVLL  342

Query  471   FSLQENPTYTTLLYDPNAAAGSEWQTCEIKPSGSCLCSVTIK  346
             FSL+E P Y TL+YDP A    EWQT ++KPSGSC+CSVTI+
Sbjct  343   FSLEEEPGYQTLMYDPAAPTECEWQTSKLKPSGSCICSVTIE  384



>ref|NP_001052597.1| Os04g0380300 [Oryza sativa Japonica Group]
 emb|CAE03998.1| OSJNBb0089B03.12 [Oryza sativa Japonica Group]
 dbj|BAF14511.1| Os04g0380300 [Oryza sativa Japonica Group]
 gb|EAZ30476.1| hypothetical protein OsJ_14521 [Oryza sativa Japonica Group]
 dbj|BAG99888.1| unnamed protein product [Oryza sativa Japonica Group]
Length=375

 Score =   455 bits (1170),  Expect = 7e-151, Method: Compositional matrix adjust.
 Identities = 218/343 (64%), Positives = 253/343 (74%), Gaps = 0/343 (0%)
 Frame = -1

Query  1371  DSYSPLLPGLPDDVAKYCLALVPRYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWL  1192
             DSY  L+PGLP+D+AK CLALVPR YFP MG V+K W SFI SKEFI VRK    LEE +
Sbjct  33    DSYGALIPGLPEDLAKVCLALVPRSYFPVMGAVSKSWMSFIGSKEFIAVRKEVGRLEERI  92

Query  1191  YVLTVDADGKESHWEVLDCLGHKHHQLPQMPAPIRAGFGVAVLNAKLLVMGGYSMIDESA  1012
             Y L     GK  +WEVL  L  ++  LP MP   +AGF V VL+ KLLVM GY +     
Sbjct  93    YALITGDGGKGPYWEVLGSLEQQNRMLPPMPGLTKAGFSVVVLDGKLLVMAGYGVDYGKE  152

Query  1011  SVSPEVFQYDSCLNSWSKLASMNVARYDFACAEVNGMVYAVGGNGVNGESLSCAEVYDPD  832
              VS EV+QYD+ LN W+ LA MNVAR DFACAEVNG VY  GG G +G+ LS  EVYDP 
Sbjct  153   CVSDEVYQYDARLNRWAALAKMNVARRDFACAEVNGAVYVAGGFGSDGDGLSSVEVYDPQ  212

Query  831   TNKWRVIESLRRPRWGCFGCGFEGKLYVMGGRSSFTIGNSRFVDVYNPERQSWCEMKNGC  652
              NKW +IESLRRPRWG F C F GKLY+MGGRSSFTIGNSRF+DVY+P   SW E+K GC
Sbjct  213   RNKWTIIESLRRPRWGSFACSFNGKLYIMGGRSSFTIGNSRFIDVYDPILHSWTEIKKGC  272

Query  651   VMVTAHAVVGKKLFCIEWKNQRKLGIFNPEDNSWKMVGVPVTGSSSIGFRLGILDEKLLL  472
             VMVT+HAV+ K+LFCIEWKNQR L IFNP D+SW+ + VP+TGSS+  F LG+LD KLLL
Sbjct  273   VMVTSHAVINKRLFCIEWKNQRSLAIFNPSDSSWQKIPVPLTGSSATLFSLGVLDGKLLL  332

Query  471   FSLQENPTYTTLLYDPNAAAGSEWQTCEIKPSGSCLCSVTIKA  343
             FS +E P Y TL+YDP A AGSEW T  +KPSG CLCSVTI++
Sbjct  333   FSQEEEPGYQTLMYDPTAPAGSEWHTSTLKPSGLCLCSVTIES  375



>gb|EEC77152.1| hypothetical protein OsI_15607 [Oryza sativa Indica Group]
Length=377

 Score =   453 bits (1166),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 222/380 (58%), Positives = 262/380 (69%), Gaps = 11/380 (3%)
 Frame = -1

Query  1482  GKKRVTELKMCFSDEMNLDNPGHSKNISYFTSSVVVDDSYSPLLPGLPDDVAKYCLALVP  1303
              ++R  + +      M L  P  ++            DSY  L+PGLP+D+AK CLALVP
Sbjct  9     ARERFVKAQTSLPATMQLKFPTRTQG-----------DSYGALIPGLPEDLAKVCLALVP  57

Query  1302  RYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWLYVLTVDADGKESHWEVLDCLGHK  1123
             R YFP MG V+KRW SFI SKEFI VRK    LEE +Y L     GK   WEVL  L  +
Sbjct  58    RSYFPVMGAVSKRWMSFIGSKEFIAVRKEVGRLEELIYALITGDGGKGPCWEVLGSLEQQ  117

Query  1122  HHQLPQMPAPIRAGFGVAVLNAKLLVMGGYSMIDESASVSPEVFQYDSCLNSWSKLASMN  943
             +  LP MP   +AGF V VL+ KLLVM GY +      VS EV+QYD+ LN W+ LA MN
Sbjct  118   NRMLPPMPGLTKAGFSVVVLDGKLLVMAGYVVDYGKECVSDEVYQYDARLNRWAALAKMN  177

Query  942   VARYDFACAEVNGMVYAVGGNGVNGESLSCAEVYDPDTNKWRVIESLRRPRWGCFGCGFE  763
             VAR DFACAEVNG VY  GG G +G+ LS  EVYDP  NKW +IESLRRPRWG F C F 
Sbjct  178   VARRDFACAEVNGAVYVAGGFGSDGDGLSSVEVYDPQRNKWTIIESLRRPRWGSFACSFN  237

Query  762   GKLYVMGGRSSFTIGNSRFVDVYNPERQSWCEMKNGCVMVTAHAVVGKKLFCIEWKNQRK  583
             GKLY+MGGRSSFTIGNSRF+DVY+P   SW E+K GCVMVT+HAV+ K+LFCIEWKNQR 
Sbjct  238   GKLYIMGGRSSFTIGNSRFIDVYDPILHSWTEIKKGCVMVTSHAVIDKRLFCIEWKNQRS  297

Query  582   LGIFNPEDNSWKMVGVPVTGSSSIGFRLGILDEKLLLFSLQENPTYTTLLYDPNAAAGSE  403
             L IFNP D+SW+ + VP+TGSS+  F LG+LD KLLLFS +E P Y TL+YDP A AG E
Sbjct  298   LAIFNPSDSSWQKILVPLTGSSTTLFSLGVLDGKLLLFSQEEEPGYQTLMYDPTAPAGYE  357

Query  402   WQTCEIKPSGSCLCSVTIKA  343
             W T  +KPSG CLCSVTI++
Sbjct  358   WHTSTLKPSGLCLCSVTIES  377



>ref|XP_009405494.1| PREDICTED: F-box/kelch-repeat protein At1g67480-like [Musa acuminata 
subsp. malaccensis]
Length=390

 Score =   453 bits (1166),  Expect = 4e-150, Method: Compositional matrix adjust.
 Identities = 223/340 (66%), Positives = 262/340 (77%), Gaps = 1/340 (0%)
 Frame = -1

Query  1359  PLLPGLPDDVAKYCLALVPRYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWLYVLT  1180
             P++PGLPDDVAK CLALVPR   P MG V K WRSFI+SKEF+ VRK A  +EEWL++LT
Sbjct  51    PIIPGLPDDVAKTCLALVPRCDIPVMGAVCKTWRSFIQSKEFLTVRKDAKQVEEWLFILT  110

Query  1179  VDADGKESHWEVLDCLGHKHHQLPQMPAPIRAGFGVAVLNAKLLVMGGYSMIDESASVSP  1000
              DA G+ESHWEV    G K   L  MP P +AGFGVAVL+AKL+++GGY +   +  VS 
Sbjct  111   GDAQGRESHWEVWGGSGEKLKVLLPMPGPAKAGFGVAVLDAKLIIVGGYVVDAGTKCVSN  170

Query  999   EVFQYDSCLNSWSKLASMNVARYDFACAEVNGMVYAVGGNGVNGESLSCAEVYDPDTNKW  820
             +V+QYDS LN WS LA M+VAR+DFAC  VNG++YAVGG G NGE+LS  EVYDPD N+W
Sbjct  171   DVYQYDSRLNRWSLLAKMSVARHDFACDVVNGLIYAVGGLGPNGENLSSVEVYDPDKNQW  230

Query  819   RVIESLRRPRWGCFGCGFEGKLYVMGGRSSFTIGNSRFVDVYNPERQSWCEMKNGCVMVT  640
              +IESLRRPRWGCF C F+G LYVMGGRSSFTIGNSRFVDVY+P+R SW  MK GCVMVT
Sbjct  231   TLIESLRRPRWGCFACSFDGLLYVMGGRSSFTIGNSRFVDVYSPQRHSWHGMKIGCVMVT  290

Query  639   AHAVVGKKLFCIEWKNQRKLGIFNPEDNSWKMVGVPVTGSSSIGFRLGILDEKLLLFSLQ  460
              HA++GKKLFC+ W+NQRKL IF+P +NSW  V VPV+GSS+IGF  GI   KLLLFS++
Sbjct  291   THAMLGKKLFCMGWRNQRKLSIFDPVENSWHDVPVPVSGSSAIGFCFGIFGGKLLLFSVK  350

Query  459   ENPTYTTLLYDPNAAAGSEWQTCEIKP-SGSCLCSVTIKA  343
               P Y TL YDP+A  GSEWQ    KP  G CLCSVTI+A
Sbjct  351   NEPGYRTLSYDPDAPVGSEWQISSFKPWGGVCLCSVTIEA  390



>gb|ABK25211.1| unknown [Picea sitchensis]
Length=386

 Score =   442 bits (1136),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 208/345 (60%), Positives = 260/345 (75%), Gaps = 1/345 (0%)
 Frame = -1

Query  1374  DDSYSPLLPGLPDDVAKYCLALVPRYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEW  1195
             ++  S LLPGLPDDVAK+CLALVPR +F ++G V K WR F++SKEF +VRKLA  +EEW
Sbjct  42    NEPESALLPGLPDDVAKHCLALVPRIHFQSLGSVCKPWRKFLQSKEFHVVRKLAGTVEEW  101

Query  1194  LYVLTVDADGKESHWEVLDCLGHKHHQLPQMPAPIRAGFGVAVLNAKLLVMGGYSMIDE-  1018
             +YVLT DAD + +HW+VL+ +  K   LP MP P++ GFG  V++ KLLVM G    D  
Sbjct  102   IYVLTTDADTERTHWQVLNSVQGKWQSLPPMPGPMKTGFGYVVIDGKLLVMAGLFEDDSG  161

Query  1017  SASVSPEVFQYDSCLNSWSKLASMNVARYDFACAEVNGMVYAVGGNGVNGESLSCAEVYD  838
             +A  S  V+ YDS LN WS+L +M VARY FACAEVNG+VYAVGG+G   E+LS  EV+D
Sbjct  162   TAKASANVYMYDSALNRWSELPNMKVARYGFACAEVNGLVYAVGGHGERDENLSSVEVFD  221

Query  837   PDTNKWRVIESLRRPRWGCFGCGFEGKLYVMGGRSSFTIGNSRFVDVYNPERQSWCEMKN  658
             P TN+W ++ESLRRPRWGCF CG EG+LYVMGGRSSFTIG+SR +DVY+PE  +W EMKN
Sbjct  222   PKTNEWTMVESLRRPRWGCFACGLEGRLYVMGGRSSFTIGHSRCIDVYDPEIHTWAEMKN  281

Query  657   GCVMVTAHAVVGKKLFCIEWKNQRKLGIFNPEDNSWKMVGVPVTGSSSIGFRLGILDEKL  478
             GCVM  AHAV+ KKLFC+EWKN+RKL +FN  DNSW+ V +P+TGS ++GF  GIL+  L
Sbjct  282   GCVMAVAHAVLDKKLFCMEWKNERKLAVFNVVDNSWQRVPLPLTGSVTVGFCFGILNGNL  341

Query  477   LLFSLQENPTYTTLLYDPNAAAGSEWQTCEIKPSGSCLCSVTIKA  343
             LLF  +  P   TL+YDPNA  G EWQ  +I+P G C+C+VTI A
Sbjct  342   LLFPTKMEPLCKTLVYDPNAMPGLEWQAIDIRPLGICICTVTITA  386



>ref|XP_010044792.1| PREDICTED: F-box/kelch-repeat protein At1g67480-like [Eucalyptus 
grandis]
 ref|XP_010044793.1| PREDICTED: F-box/kelch-repeat protein At1g67480-like [Eucalyptus 
grandis]
 gb|KCW86902.1| hypothetical protein EUGRSUZ_B03483 [Eucalyptus grandis]
 gb|KCW86903.1| hypothetical protein EUGRSUZ_B03483 [Eucalyptus grandis]
Length=370

 Score =   437 bits (1123),  Expect = 6e-144, Method: Compositional matrix adjust.
 Identities = 220/350 (63%), Positives = 269/350 (77%), Gaps = 0/350 (0%)
 Frame = -1

Query  1392  TSSVVVDDSYSPLLPGLPDDVAKYCLALVPRYYFPAMGGVNKRWRSFIRSKEFIMVRKLA  1213
             +SS  +++   P++PGLPDDVAK CLA VPR   P++G V K+WRSF+ SKEF++ RKL 
Sbjct  21    SSSEPLNEFDGPIIPGLPDDVAKSCLAFVPRRELPSVGLVCKKWRSFLGSKEFLLERKLG  80

Query  1212  CLLEEWLYVLTVDADGKESHWEVLDCLGHKHHQLPQMPAPIRAGFGVAVLNAKLLVMGGY  1033
               LEEW++VL+ DA  KESHWE +D LG+K  +LP MP   +A FGVAV+N KLL+ GGY
Sbjct  81    GTLEEWVFVLSTDARTKESHWEAIDSLGNKQRRLPPMPGLSKACFGVAVVNGKLLIAGGY  140

Query  1032  SMIDESASVSPEVFQYDSCLNSWSKLASMNVARYDFACAEVNGMVYAVGGNGVNGESLSC  853
             S+   S  VS EV+QYDSCLNSWSKL +MN AR +FACAEVNGMVYAVGG G  G+ +S 
Sbjct  141   SVAGGSRVVSAEVYQYDSCLNSWSKLRNMNEARRNFACAEVNGMVYAVGGYGAGGDIISS  200

Query  852   AEVYDPDTNKWRVIESLRRPRWGCFGCGFEGKLYVMGGRSSFTIGNSRFVDVYNPERQSW  673
             AE YDP+T KW  IESLR PRWGCF CGFEGKLYVMGGRSSFTIG++R V VY+PE+++W
Sbjct  201   AEAYDPNTGKWTPIESLRLPRWGCFACGFEGKLYVMGGRSSFTIGSARSVCVYDPEKRAW  260

Query  672   CEMKNGCVMVTAHAVVGKKLFCIEWKNQRKLGIFNPEDNSWKMVGVPVTGSSSIGFRLGI  493
             CE+KNGCVMVTAHAV+G +LFC+EW++Q+KL +F+  +NSW  V +P   SS   FRLG 
Sbjct  261   CELKNGCVMVTAHAVLGTRLFCMEWRSQKKLSVFDQGNNSWSTVTLPPCQSSEASFRLGT  320

Query  492   LDEKLLLFSLQENPTYTTLLYDPNAAAGSEWQTCEIKPSGSCLCSVTIKA  343
              D KLLLFS++E   Y TL YDPNA  GSEWQ  +I PSG CL SVTI+A
Sbjct  321   SDGKLLLFSVKELAGYRTLSYDPNAPPGSEWQVSKINPSGPCLYSVTIEA  370



>dbj|BAJ93898.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=384

 Score =   410 bits (1053),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 206/386 (53%), Positives = 263/386 (68%), Gaps = 4/386 (1%)
 Frame = -1

Query  1500  MPGTNCGKKRVTELKMCFSDEMNLDNPGHSKNISYFTSSVVVDDSYSPLL-PGLPDDVAK  1324
             M   +  ++ + +  MC   +M L + G   ++S  T +V   +++  LL PGLP+D+AK
Sbjct  1     MLALDGAREPLVQAHMCHRVKMPLKSLGR-PSLSPVTMTVKETNTHDSLLIPGLPEDMAK  59

Query  1323  YCLALVPRYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWLYVLTVDADGKESHWEV  1144
              CLALVPR +FPAMG V++RW SFI S+EF  VRK    +EE +YVL  +A  K   WE+
Sbjct  60    ICLALVPRRHFPAMGAVSRRWMSFIGSREFSAVRKEVMKIEELVYVLAAEAGEKGCRWEI  119

Query  1143  LDCLGHKHHQLPQMPAPIRAGFGVAVLNAKLLVMGGYSMIDESASVSPEVFQYDSCLNSW  964
             L     K+  +P MP   + GFGV VL  KL V+ GY+ I     VS +V++YD+ LN W
Sbjct  120   LG--ERKNSAIPPMPGLTKVGFGVVVLYGKLYVIAGYAAIHGMDYVSDDVYEYDARLNRW  177

Query  963   SKLASMNVARYDFACAEVNGMVYAVGGNGVNGESLSCAEVYDPDTNKWRVIESLRRPRWG  784
               LA MNVAR DFACAEV+G +YA GG G +G SLS  E YDP  N+W +I+ LRRPRWG
Sbjct  178   GALAKMNVARRDFACAEVDGTIYAAGGFGSSGNSLSSVEAYDPQQNRWTLIDGLRRPRWG  237

Query  783   CFGCGFEGKLYVMGGRSSFTIGNSRFVDVYNPERQSWCEMKNGCVMVTAHAVVGKKLFCI  604
             CF  G   KLY+MGGRSSFTIGNSRFVDVY+P R  W E+K GCVMVT+HA+VG+ LFC+
Sbjct  238   CFASGLSSKLYIMGGRSSFTIGNSRFVDVYDPGRSRWEEIKRGCVMVTSHAIVGEALFCV  297

Query  603   EWKNQRKLGIFNPEDNSWKMVGVPVTGSSSIGFRLGILDEKLLLFSLQENPTYTTLLYDP  424
             EWKNQR L +F+P  +SWK + VP+TGSSS  F LG    KLLL S +E+  Y T+ YDP
Sbjct  298   EWKNQRCLSVFDPWYSSWKKISVPLTGSSSTRFCLGARGGKLLLLSQEEDDGYRTMTYDP  357

Query  423   NAAAGSEWQTCEIKPSGSCLCSVTIK  346
              AA GSEW T E+KPSG C+CSVT++
Sbjct  358   AAAPGSEWGTSELKPSGLCMCSVTVQ  383



>ref|XP_002446277.1| hypothetical protein SORBIDRAFT_06g012290 [Sorghum bicolor]
 gb|EES10605.1| hypothetical protein SORBIDRAFT_06g012290 [Sorghum bicolor]
Length=347

 Score =   396 bits (1018),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 201/365 (55%), Positives = 247/365 (68%), Gaps = 20/365 (5%)
 Frame = -1

Query  1437  MNLDNPGHSKNISYFTSSVVVDDSYSPLLPGLPDDVAKYCLALVPRYYFPAMGGVNKRWR  1258
             M L  P      S   + +  D SYS L+PGLP+DVAK CLALV R YFP MG V+KRW 
Sbjct  1     MRLMLPAEQNVPSKTMTQMPNDYSYSSLIPGLPEDVAKICLALVSRSYFPVMGAVSKRWM  60

Query  1257  SFIRSKEFIMVRKLACLLEEWLYVLTVDADGK-ESHWEVLDCLGHKHHQLPQMPAPIRAG  1081
             +FI S+EFI VRK    LEEW+YVLT +A  K  S WEVL     K  +LP MP P +AG
Sbjct  61    TFIGSREFIAVRKEVGKLEEWIYVLTAEAGRKGRSCWEVLRSPDQKKRRLPPMPGPNKAG  120

Query  1080  FGVAVLNAKLLVMGGYSMIDESASVSPEVFQYDSCLNSWSKLASMNVARYDFACAEVNGM  901
             FGV VL+ KL VM GY+       VS EV+ Y +CLN W+ LA +NVAR+DFACAEV G+
Sbjct  121   FGVVVLDGKLFVMAGYAADHGKEFVSDEVYCYHACLNRWTALAKLNVARHDFACAEVKGV  180

Query  900   VYAVGGNGVNGESLSCAEVYDPDTNKWRVIESLRRPRWGCFGCGFEGKLYVMGGRSSFTI  721
             +Y  GG G+ G SL+  E Y+P  NKW +I+SLRRPRWGCFGCGF  KLY+MGGRSSFTI
Sbjct  181   IYVAGGLGLAGVSLNSVEAYNPQQNKWTLIKSLRRPRWGCFGCGFSDKLYIMGGRSSFTI  240

Query  720   GNSRFVDVYNPERQSWCEMKNGCVMVTAHAVVGKKLFCIEWKNQRKLGIFNPEDNSWKMV  541
             GN+R VDVY P+R +W E+K GCVMVT++AV+GK                   +NSW+ +
Sbjct  241   GNTRSVDVYEPDRHTWEELKRGCVMVTSNAVLGK-------------------NNSWQRI  281

Query  540   GVPVTGSSSIGFRLGILDEKLLLFSLQENPTYTTLLYDPNAAAGSEWQTCEIKPSGSCLC  361
              +P TGSSS  F L +   K+LLFSL+E P Y TL+YDP A  G EWQT ++KPSGSC+C
Sbjct  282   LLPHTGSSSTKFCLRVFGMKVLLFSLEEEPGYQTLMYDPAAPTGYEWQTTKLKPSGSCIC  341

Query  360   SVTIK  346
             SV+I+
Sbjct  342   SVSIE  346



>gb|EMT24396.1| hypothetical protein F775_07758 [Aegilops tauschii]
Length=328

 Score =   390 bits (1003),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 194/329 (59%), Positives = 232/329 (71%), Gaps = 2/329 (1%)
 Frame = -1

Query  1332  VAKYCLALVPRYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWLYVLTVDADGKESH  1153
             +AK CLALVPR +FP+MG V++RW SFI S+EF  VRK    +E  +YVL  +A  K   
Sbjct  1     MAKICLALVPRRHFPSMGAVSRRWMSFIGSREFSAVRKEVGKIEGLVYVLAAEAGEKGCR  60

Query  1152  WEVLDCLGHKHHQLPQMPAPIRAGFGVAVLNAKLLVMGGYSMIDESASVSPEVFQYDSCL  973
             WEVL     K+  +P MP   +AGFGV VL  KL V+ GY+ +    SVS EV+QYD+ L
Sbjct  61    WEVLG--ERKNSAIPPMPGLTKAGFGVVVLYGKLYVIAGYAAVHGKDSVSDEVYQYDARL  118

Query  972   NSWSKLASMNVARYDFACAEVNGMVYAVGGNGVNGESLSCAEVYDPDTNKWRVIESLRRP  793
             N W  LA MNVAR DFACA+V+G +YA GG G +  SLS  E YDP  N+W +I+ LRRP
Sbjct  119   NRWGALAKMNVARRDFACAKVDGTIYAAGGFGSSDNSLSSVEAYDPQQNRWTLIDGLRRP  178

Query  792   RWGCFGCGFEGKLYVMGGRSSFTIGNSRFVDVYNPERQSWCEMKNGCVMVTAHAVVGKKL  613
             RWGCF  G   KLY+MGGRSSFTIGNSRFVDVY+P R  W E+K GCVMVT+HAVVG+ L
Sbjct  179   RWGCFASGLNSKLYIMGGRSSFTIGNSRFVDVYDPGRSRWEEIKRGCVMVTSHAVVGESL  238

Query  612   FCIEWKNQRKLGIFNPEDNSWKMVGVPVTGSSSIGFRLGILDEKLLLFSLQENPTYTTLL  433
             FC+EWKNQR L  F+P D+SWK + VP+TGSSS  F LG    KLLL S +E   Y T+ 
Sbjct  239   FCVEWKNQRCLSAFDPSDSSWKKIPVPLTGSSSTRFCLGARGGKLLLLSQEEEGGYWTMT  298

Query  432   YDPNAAAGSEWQTCEIKPSGSCLCSVTIK  346
             YDP AA GSEW T E+KPSG CLCSVTI+
Sbjct  299   YDPAAAPGSEWGTSELKPSGLCLCSVTIQ  327



>gb|EPS58108.1| hypothetical protein M569_16708, partial [Genlisea aurea]
Length=269

 Score =   382 bits (980),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 183/269 (68%), Positives = 208/269 (77%), Gaps = 1/269 (0%)
 Frame = -1

Query  1455  MCFSDEMNLDNPGHSKNISYFTSSVVVDDSYSPLLPGLPDDVAKYCLALVPRYYFPAMGG  1276
             MCFS  +   +    K+ S   S    D  YSPLLPGLPDDV+K+CLALVPR + P MG 
Sbjct  1     MCFSSSVTARDDETVKSSSVLVSRTTDDVHYSPLLPGLPDDVSKHCLALVPRSHLPVMGA  60

Query  1275  VNKRWRSFIRSKEFIMVRKLACLLEEWLYVLTVDADGKESHWEVLDCLGHKHHQLPQMPA  1096
             V+KRWRSFI+S EF+ VR+LA +LEE LY+LTVD +GK SHWEVLDC G+K  +LPQMP 
Sbjct  61    VSKRWRSFIKSGEFVTVRRLAGVLEERLYILTVDVNGKGSHWEVLDCFGNKQSELPQMPG  120

Query  1095  PIRAGFGVAVLNAKLLVMGGYSMIDESASVSPEVFQYDSCLNSWSKLASMNVARYDFACA  916
             P +  FGV VLN KL+V+ GYS+ID   SVS + +QYDS LNSWSKL  M   RYDFACA
Sbjct  121   PAKVSFGVVVLNGKLIVLAGYSLIDGIVSVSDDAYQYDSFLNSWSKLGKMKTPRYDFACA  180

Query  915   EVNGMVYAVGGNGVNGESLSCAEVYDPDTNKWRVIESLRRPRWGCFGCGFEGKLYVMGGR  736
              VNG VYAVGG G +GESLS AEVYDPD+N+W  IESLRRPRWGCF CG EGKLYVMGGR
Sbjct  181   AVNGKVYAVGGCGSDGESLSSAEVYDPDSNEWTRIESLRRPRWGCFACGIEGKLYVMGGR  240

Query  735   SSFTIGNSRFVDVYNPERQSWCE-MKNGC  652
             SSFTIGNSRFVDVY PER+SWCE MKNGC
Sbjct  241   SSFTIGNSRFVDVYAPERRSWCEPMKNGC  269



>ref|XP_006848422.1| hypothetical protein AMTR_s00013p00230800 [Amborella trichopoda]
 gb|ERN10003.1| hypothetical protein AMTR_s00013p00230800 [Amborella trichopoda]
Length=320

 Score =   382 bits (981),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 201/346 (58%), Positives = 239/346 (69%), Gaps = 36/346 (10%)
 Frame = -1

Query  1377  VDDSYSPLLPGLPDDVAKYCLALVPRYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEE  1198
             V + Y P+LPGLPDDVAKYCLALVPR  FP +G V                         
Sbjct  10    VSEPYCPILPGLPDDVAKYCLALVPRSDFPIVGSV-------------------------  44

Query  1197  WLYVLTVDADGKESHWEVLDCLGHKHHQLPQMPAPIRAGFGVAVLNAKLLVMGGY-SMID  1021
             W          K SHWEVL  L  +HH LP MP   ++ FGV VL+ KLLV+ GY +   
Sbjct  45    W----------KASHWEVLGSLDGEHHLLPPMPGLSKSAFGVVVLDGKLLVIAGYVTEGS  94

Query  1020  ESASVSPEVFQYDSCLNSWSKLASMNVARYDFACAEVNGMVYAVGGNGVNGESLSCAEVY  841
              +  VS EV+QYDS LN WS LA++N+ARYDFACAEV G VY VGG   +GESLS AEVY
Sbjct  95    GTKGVSSEVYQYDSRLNRWSALANLNIARYDFACAEVGGAVYVVGGYDEDGESLSSAEVY  154

Query  840   DPDTNKWRVIESLRRPRWGCFGCGFEGKLYVMGGRSSFTIGNSRFVDVYNPERQSWCEMK  661
             DPD N W +IESLRRPRWGCF C   GKLYVMGGRSSFTIGNS+FVD+Y+P+  SW EMK
Sbjct  155   DPDHNSWTLIESLRRPRWGCFACALNGKLYVMGGRSSFTIGNSKFVDIYDPDEHSWQEMK  214

Query  660   NGCVMVTAHAVVGKKLFCIEWKNQRKLGIFNPEDNSWKMVGVPVTGSSSIGFRLGILDEK  481
             NGCVMV AHAV+G++L+C+EWKNQR++ IF+ E+  W++  VP+ GS  IGFR GIL  K
Sbjct  215   NGCVMVIAHAVLGQRLYCMEWKNQRRITIFDAEEGLWRVAPVPLMGSECIGFRFGILGGK  274

Query  480   LLLFSLQENPTYTTLLYDPNAAAGSEWQTCEIKPSGSCLCSVTIKA  343
             LLLFS +  P Y TL+YDP+A AG EWQT E++PSG+CL SVTI A
Sbjct  275   LLLFSCENEPGYRTLVYDPDAGAGGEWQTTELRPSGTCLWSVTICA  320



>gb|KDO36091.1| hypothetical protein CISIN_1g028925mg [Citrus sinensis]
Length=202

 Score =   366 bits (940),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 171/202 (85%), Positives = 188/202 (93%), Gaps = 0/202 (0%)
 Frame = -1

Query  948  MNVARYDFACAEVNGMVYAVGGNGVNGESLSCAEVYDPDTNKWRVIESLRRPRWGCFGCG  769
            MNVARYDFACAEVNG +YAVGG G++GESLS AEVYDPDT+KW +IESLRRPRWGCF C 
Sbjct  1    MNVARYDFACAEVNGKIYAVGGYGMDGESLSSAEVYDPDTDKWNLIESLRRPRWGCFACS  60

Query  768  FEGKLYVMGGRSSFTIGNSRFVDVYNPERQSWCEMKNGCVMVTAHAVVGKKLFCIEWKNQ  589
            F+GKLYVMGGRSSFTIGNS+FVDVYNPER +WC+MKNGCVMVTAHAVVGKKLFC+EWKNQ
Sbjct  61   FDGKLYVMGGRSSFTIGNSKFVDVYNPERHTWCQMKNGCVMVTAHAVVGKKLFCMEWKNQ  120

Query  588  RKLGIFNPEDNSWKMVGVPVTGSSSIGFRLGILDEKLLLFSLQENPTYTTLLYDPNAAAG  409
            RKL IF+PEDNSWKMV VP+TGSSSIGFR GILD KLLLFSL+E P+Y+TLLYDPNAA+G
Sbjct  121  RKLTIFDPEDNSWKMVPVPLTGSSSIGFRFGILDGKLLLFSLEEEPSYSTLLYDPNAASG  180

Query  408  SEWQTCEIKPSGSCLCSVTIKA  343
            SEWQT +IKPSG CLCSVTIKA
Sbjct  181  SEWQTSKIKPSGLCLCSVTIKA  202



>gb|AFK43456.1| unknown [Lotus japonicus]
Length=202

 Score =   359 bits (921),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 169/202 (84%), Positives = 183/202 (91%), Gaps = 0/202 (0%)
 Frame = -1

Query  948  MNVARYDFACAEVNGMVYAVGGNGVNGESLSCAEVYDPDTNKWRVIESLRRPRWGCFGCG  769
            MNVARYDFACAEVNG+VYAVGG G +G+SLS AEVYDPDT+KW +IESLRRPRWGCF CG
Sbjct  1    MNVARYDFACAEVNGLVYAVGGYGEHGDSLSSAEVYDPDTDKWTLIESLRRPRWGCFACG  60

Query  768  FEGKLYVMGGRSSFTIGNSRFVDVYNPERQSWCEMKNGCVMVTAHAVVGKKLFCIEWKNQ  589
             EGKLYVMGGRSSFTIGNS+FVDVYNPE+Q WCEMKNGCVMVTAHAV+ KKLFC+EWKNQ
Sbjct  61   IEGKLYVMGGRSSFTIGNSKFVDVYNPEKQGWCEMKNGCVMVTAHAVLEKKLFCMEWKNQ  120

Query  588  RKLGIFNPEDNSWKMVGVPVTGSSSIGFRLGILDEKLLLFSLQENPTYTTLLYDPNAAAG  409
            RKL IFNPEDNSWKMV VP+TGS+SIGFR GILD KLLLFSL++ P Y TLLYDPNAA G
Sbjct  121  RKLAIFNPEDNSWKMVPVPLTGSTSIGFRFGILDGKLLLFSLEDEPAYKTLLYDPNAAPG  180

Query  408  SEWQTCEIKPSGSCLCSVTIKA  343
             EW+T EIKPSG CLCSVTIKA
Sbjct  181  KEWRTSEIKPSGLCLCSVTIKA  202



>gb|AFW71518.1| hypothetical protein ZEAMMB73_686872 [Zea mays]
Length=202

 Score =   311 bits (797),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 147/202 (73%), Positives = 167/202 (83%), Gaps = 0/202 (0%)
 Frame = -1

Query  948  MNVARYDFACAEVNGMVYAVGGNGVNGESLSCAEVYDPDTNKWRVIESLRRPRWGCFGCG  769
            MNVAR DFACAEVNG++Y  GG G NGESLS  EVYDP+ NKW +IE LRRPRWGCFGC 
Sbjct  1    MNVARCDFACAEVNGVIYVAGGFGPNGESLSSVEVYDPEQNKWTLIEGLRRPRWGCFGCS  60

Query  768  FEGKLYVMGGRSSFTIGNSRFVDVYNPERQSWCEMKNGCVMVTAHAVVGKKLFCIEWKNQ  589
            FEGKLYVMGGRSSFTIGNSR VDVYNP   +W ++KNGCVMVTAHAV+GK+LFCIEWKNQ
Sbjct  61   FEGKLYVMGGRSSFTIGNSRSVDVYNPNSHAWGQVKNGCVMVTAHAVLGKRLFCIEWKNQ  120

Query  588  RKLGIFNPEDNSWKMVGVPVTGSSSIGFRLGILDEKLLLFSLQENPTYTTLLYDPNAAAG  409
            R L IFNP D+SW+ V VP+TGSSS  F L + ++KLLLF L+E P Y TL+YDP A  G
Sbjct  121  RSLAIFNPADDSWQKVPVPLTGSSSTRFSLVVHEDKLLLFPLEEEPGYQTLMYDPAAPMG  180

Query  408  SEWQTCEIKPSGSCLCSVTIKA  343
            SEW T ++KP+GSCLCSVTIKA
Sbjct  181  SEWCTSKLKPTGSCLCSVTIKA  202



>dbj|BAJ92634.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=211

 Score =   305 bits (782),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 143/208 (69%), Positives = 166/208 (80%), Gaps = 0/208 (0%)
 Frame = -1

Query  966  WSKLASMNVARYDFACAEVNGMVYAVGGNGVNGESLSCAEVYDPDTNKWRVIESLRRPRW  787
            W+ ++ +NVAR DFACAEVNG++Y  GG G +G+SLS  EVYDP+ NKW +I  LRRPRW
Sbjct  4    WTTISKLNVARCDFACAEVNGVIYVAGGFGPDGDSLSSVEVYDPEQNKWALIGRLRRPRW  63

Query  786  GCFGCGFEGKLYVMGGRSSFTIGNSRFVDVYNPERQSWCEMKNGCVMVTAHAVVGKKLFC  607
            GCFGC FE K+YVMGGRSSFTIGNSRF+DVY+    +W E +NGCVMVTAHAV+G+KLFC
Sbjct  64   GCFGCSFEDKMYVMGGRSSFTIGNSRFIDVYDTNSGAWGEFRNGCVMVTAHAVLGEKLFC  123

Query  606  IEWKNQRKLGIFNPEDNSWKMVGVPVTGSSSIGFRLGILDEKLLLFSLQENPTYTTLLYD  427
            IEWKNQR L IFNP DNSW+ V VP+TGSSS  F LG  D KLLLFSL+E P Y TL+YD
Sbjct  124  IEWKNQRSLAIFNPADNSWQKVPVPLTGSSSTRFSLGTHDGKLLLFSLEEEPGYQTLMYD  183

Query  426  PNAAAGSEWQTCEIKPSGSCLCSVTIKA  343
            P A  GSEW    ++PSGSCLCSVTIKA
Sbjct  184  PAAPTGSEWCKSTLRPSGSCLCSVTIKA  211



>ref|XP_010531279.1| PREDICTED: F-box/kelch-repeat protein At1g67480-like [Tarenaya 
hassleriana]
Length=352

 Score =   301 bits (771),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 161/354 (45%), Positives = 223/354 (63%), Gaps = 12/354 (3%)
 Frame = -1

Query  1395  FTSSVVVDDSYSPLLPGLPDDVAKYCLALVPRYYFPAMGGVNKRWRSFIRSKEFIMVRKL  1216
              TS+ + D+    L+PGLP+DV+  CLALV R     +  V++RWRSF+   +   VR+ 
Sbjct  8     LTSTDISDE----LIPGLPNDVSATCLALVGRSGLRDLAIVSRRWRSFLVGGDLQAVRES  63

Query  1215  ACLLEEWLYVLTVDADGKESHWEVLDCLGHKHHQLPQMPAPIRAGFGVAVLNAKLLVMGG  1036
               L+EE L+VL   + G    W +LD  G     LP MP P ++GFGVAVL  K+LV GG
Sbjct  64    LGLVEELLHVLV--STGNRKQWNILDSSGRIVGILPPMPGPNKSGFGVAVLGDKILVAGG  121

Query  1035  YSMI-DESASVSPEVFQYDSCLNSWSKLASMNVARYDFACAEVNGMVYAVGGNGVNGESL  859
             +S+I +   + S +VFQ+D CLNSWSKL  MN ARY FA A VNG VYAVGG G +G +L
Sbjct  122   FSVIANRIFTASSDVFQFDPCLNSWSKLPEMNEARYSFAFAAVNGKVYAVGGYGRDGYAL  181

Query  858   SCAEVYDPDTNKWRVIESLRRPRWGCFGCGFEGKLYVMGGRSSFTIGNSRFVDVYNPERQ  679
             S AEVYDP  N+W   + ++RPR+  F   F   L+VMGGRS+ T+G++  V+VY+P+  
Sbjct  182   STAEVYDPRANRWTFFQGIQRPRYSAFAFSFNNSLHVMGGRSTTTVGSADCVEVYDPDTD  241

Query  678   SWCEMKN--GCVMVTAHAVVGKKLFCIEWKNQRKLGIFNPEDNSWKMVGVPVTGSSSIGF  505
             +W          MVT    VG ++FC++WK+ +++ +F  E+ SW+ + +P  GS+ +G 
Sbjct  242   TWRVFSGPWRSAMVTGCVAVGNRVFCLDWKDPKEIRVFGLENCSWESIRIP-GGSNCVGH  300

Query  504   RLGILDEKLLLFSLQENPTYTTLLYDPNAAAGSEWQTCEIKPSGSCLCSVTIKA  343
              LG +D KLLLF ++  P   TL YDP+  +GS W TC I+P GSC  SVT KA
Sbjct  301   VLGSMDGKLLLFPME--PGADTLRYDPSVGSGSGWDTCGIRPPGSCSASVTTKA  352



>gb|AAF99736.1|AC004557_15 F17L21.21 [Arabidopsis thaliana]
Length=360

 Score =   277 bits (708),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 154/361 (43%), Positives = 223/361 (62%), Gaps = 19/361 (5%)
 Frame = -1

Query  1383  VVVDDSYSPLLPGLPDDVAKYCLALVPRYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLL  1204
             +VV+ S SP++PGL DDVA+ C++ +PR  F     V +RWRSF+RS+ F  VRKL   +
Sbjct  1     MVVESSSSPIIPGLTDDVAELCVSKIPRSSFQITSQVCRRWRSFLRSQHFAAVRKLTGTV  60

Query  1203  EEWLYVLTVDADGKESHWEVLDCLGHKHHQLPQMPAPIRAGFGVAVLN-AKLLVMGGYSM  1027
             EE+L VL     G++ +WEV D  G+K  Q+P +P P++ GFGVAVL+  K++  GGY+ 
Sbjct  61    EEFLCVLMESECGRDVYWEVFDASGNKLGQIPPVPGPLKRGFGVAVLDGGKIVFFGGYTE  120

Query  1026  IDESA------SVSPEVFQYDSCLNSWSKLASMNVARYDFACAEVNGMVYAVGGNGVNGE  865
             ++ S       S S +V+++D   NSW KLA MN+ RY+FA AEVNG++Y + G   +  
Sbjct  121   VEGSGINSTTVSASADVYEFDPANNSWRKLAGMNIPRYNFAFAEVNGLLYVIRGYSTDTY  180

Query  864   SLSCAEVYDPDTNKWRVIESLRRPRWGCFGCGFEGKLYVMGGRS------SFTIGN-SRF  706
             SLS AEVY+P TN+W ++    RP W  F   F  KLY +G R         T+GN SRF
Sbjct  181   SLSNAEVYNPKTNQWSLMHCPNRPVWRGFAFAFSSKLYAVGRRQWNHIRFQGTLGNGSRF  240

Query  705   VDVYNPERQSWCEMKN-GCVMVTAHAVVGKKLFCIEWKNQRKLGIFNPEDNSWKMVGVPV  529
             +D+Y+P+ Q+W E+ +   V V ++ VV  K++ ++     +LG+F+PE+NSW  V VP 
Sbjct  241   IDIYDPKTQTWEELNSEQSVSVYSYTVVRNKVYFMDRNMPGRLGVFDPEENSWSSVFVP-  299

Query  528   TGSSSIGFRLGILDEKLLLFSLQENPTYTTLLYDPNAAAGSEWQTC-EIKPSGSCLCSVT  352
                     RLG+ + K+LLFS      + TL+YD +   GS+W+ C +IKPS S L SV 
Sbjct  300   PREGGFWVRLGVWNNKVLLFS--RVCGHETLMYDLDKEKGSKWRVCDQIKPSASQLASVL  357

Query  351   I  349
             I
Sbjct  358   I  358



>ref|NP_174062.1| putative F-box/kelch-repeat protein [Arabidopsis thaliana]
 sp|Q9FZJ3.2|FBK16_ARATH RecName: Full=Putative F-box/kelch-repeat protein At1g27420 [Arabidopsis 
thaliana]
 gb|AEE30827.1| putative F-box/kelch-repeat protein [Arabidopsis thaliana]
Length=346

 Score =   274 bits (701),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 150/354 (42%), Positives = 218/354 (62%), Gaps = 19/354 (5%)
 Frame = -1

Query  1383  VVVDDSYSPLLPGLPDDVAKYCLALVPRYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLL  1204
             +VV+ S SP++PGL DDVA+ C++ +PR  F     V +RWRSF+RS+ F  VRKL   +
Sbjct  1     MVVESSSSPIIPGLTDDVAELCVSKIPRSSFQITSQVCRRWRSFLRSQHFAAVRKLTGTV  60

Query  1203  EEWLYVLTVDADGKESHWEVLDCLGHKHHQLPQMPAPIRAGFGVAVLN-AKLLVMGGYSM  1027
             EE+L VL     G++ +WEV D  G+K  Q+P +P P++ GFGVAVL+  K++  GGY+ 
Sbjct  61    EEFLCVLMESECGRDVYWEVFDASGNKLGQIPPVPGPLKRGFGVAVLDGGKIVFFGGYTE  120

Query  1026  IDESA------SVSPEVFQYDSCLNSWSKLASMNVARYDFACAEVNGMVYAVGGNGVNGE  865
             ++ S       S S +V+++D   NSW KLA MN+ RY+FA AEVNG++Y + G   +  
Sbjct  121   VEGSGINSTTVSASADVYEFDPANNSWRKLAGMNIPRYNFAFAEVNGLLYVIRGYSTDTY  180

Query  864   SLSCAEVYDPDTNKWRVIESLRRPRWGCFGCGFEGKLYVMGGRSSFTIGNSRFVDVYNPE  685
             SLS AEVY+P TN+W ++    RP W  F   F  KLY +G         SRF+D+Y+P+
Sbjct  181   SLSNAEVYNPKTNQWSLMHCPNRPVWRGFAFAFSSKLYAVG-------NGSRFIDIYDPK  233

Query  684   RQSWCEMKN-GCVMVTAHAVVGKKLFCIEWKNQRKLGIFNPEDNSWKMVGVPVTGSSSIG  508
              Q+W E+ +   V V ++ VV  K++ ++     +LG+F+PE+NSW  V VP        
Sbjct  234   TQTWEELNSEQSVSVYSYTVVRNKVYFMDRNMPGRLGVFDPEENSWSSVFVP-PREGGFW  292

Query  507   FRLGILDEKLLLFSLQENPTYTTLLYDPNAAAGSEWQTC-EIKPSGSCLCSVTI  349
              RLG+ + K+LLFS      + TL+YD +   GS+W+ C +IKPS S L SV I
Sbjct  293   VRLGVWNNKVLLFS--RVCGHETLMYDLDKEKGSKWRVCDQIKPSASQLASVLI  344



>ref|XP_010531269.1| PREDICTED: putative F-box/kelch-repeat protein At1g27420 [Tarenaya 
hassleriana]
Length=343

 Score =   271 bits (692),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 150/348 (43%), Positives = 213/348 (61%), Gaps = 19/348 (5%)
 Frame = -1

Query  1362  SPLLPGLPDDVAKYCLALVPRYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWLYVL  1183
             S ++PGL DD A+ CL  VPR     +  V +RWRSF+  + F  VRK A ++EE++ +L
Sbjct  5     SSIIPGLTDDAAELCLTHVPRSSVRTLSRVCRRWRSFVGGEHFAAVRKSAGVVEEFMCIL  64

Query  1182  TVDADGKESHWEVLDCLGHKHHQLPQMPAPIRAGFGVAVLNA-KLLVMGGYSMIDESA--  1012
                  G+E +WEV D  G+K  Q+P +P P++ GFGVAVL   K++ +GGY+ I+ S   
Sbjct  65    MESECGREVYWEVFDGSGNKLGQIPPVPGPVKRGFGVAVLGGGKIVFVGGYTEIEGSGIN  124

Query  1011  ----SVSPEVFQYDSCLNSWSKLASMNVARYDFACAEVNGMVYAVGGNGVNGESLSCAEV  844
                 S S +V+++D  +NSW KLASMNV RY+FACAEV+G +Y + G   +  SLS AEV
Sbjct  125   STTVSASADVYEFDPAVNSWRKLASMNVPRYNFACAEVDGFLYVIRGYSRDTFSLSNAEV  184

Query  843   YDPDTNKWRVIESLRRPRWGCFGCGFEGKLYVMGGRSSFTIGNSRFVDVYNPERQSWCEM  664
             Y+P+TNKW +IE   RP W  F   F  KLY +G         +RF+DVY+PE Q+W E+
Sbjct  185   YNPETNKWSLIECRNRPVWRGFAFSFNSKLYAIG-------NGTRFIDVYDPESQTWDEL  237

Query  663   KN-GCVMVTAHAVVGKKLFCIEWKNQRKLGIFNPEDNSWKMVGVPVTGSSSIGFRLGILD  487
              +   V V +H V+  K++ ++      LG+F+P++NSW  V VP         RLG+ +
Sbjct  238   NSEQSVSVYSHTVLKNKVYFMDRNMPGILGVFDPDENSWSSVFVPPR-EGGFWVRLGVWN  296

Query  486   EKLLLFSLQENPTYTTLLYDPNAAAGSEWQTC-EIKPSGSCLCSVTIK  346
             +K+LLFS      + TL+YDP    GS+W+ C +IKPS S L S  IK
Sbjct  297   DKVLLFS--RVCGHETLMYDPYKETGSKWRVCDQIKPSASHLTSALIK  342



>ref|XP_002890727.1| kelch repeat-containing F-box family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH66986.1| kelch repeat-containing F-box family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=346

 Score =   269 bits (688),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 147/354 (42%), Positives = 217/354 (61%), Gaps = 19/354 (5%)
 Frame = -1

Query  1383  VVVDDSYSPLLPGLPDDVAKYCLALVPRYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLL  1204
             +VV++S  P++PGL DDVA+ C++ +PR  F     V +RWRSF+RS+ F  VRKL   +
Sbjct  1     MVVEESLYPIIPGLTDDVAELCVSKIPRSSFQITSQVCRRWRSFLRSQHFAAVRKLTGTV  60

Query  1203  EEWLYVLTVDADGKESHWEVLDCLGHKHHQLPQMPAPIRAGFGVAVLN-AKLLVMGGYSM  1027
             EE+L VL     G++ +WEV D  G+K  Q+P +P P++ GFGVAVL+  K++  GGY+ 
Sbjct  61    EEFLCVLMESECGRDVYWEVFDASGNKLGQIPPVPGPLKRGFGVAVLDGGKIVFFGGYTE  120

Query  1026  IDESA------SVSPEVFQYDSCLNSWSKLASMNVARYDFACAEVNGMVYAVGGNGVNGE  865
             ++ S       S S +V+++D   NSW KLA+MN+ RY+FA  EVNG++Y + G   +  
Sbjct  121   VEGSGINSTTVSASADVYEFDPASNSWRKLAAMNIPRYNFAFTEVNGLLYVIRGYSTDTY  180

Query  864   SLSCAEVYDPDTNKWRVIESLRRPRWGCFGCGFEGKLYVMGGRSSFTIGNSRFVDVYNPE  685
             SLS AEVY+P TN+W +++   RP W  F   F  KLY +G         SRF+D+Y+P+
Sbjct  181   SLSNAEVYNPHTNRWSLMDCPNRPVWRGFAFAFNYKLYAVG-------NGSRFIDIYDPK  233

Query  684   RQSWCEMKN-GCVMVTAHAVVGKKLFCIEWKNQRKLGIFNPEDNSWKMVGVPVTGSSSIG  508
              Q+W  + +   V V ++ VV  K+F ++     +LG+F+PE+NSW  V VP        
Sbjct  234   TQTWEALNSEQSVSVYSYTVVRNKVFFMDRNMPGRLGVFDPEENSWSSVFVP-PREGGFW  292

Query  507   FRLGILDEKLLLFSLQENPTYTTLLYDPNAAAGSEWQTC-EIKPSGSCLCSVTI  349
              RLG+ + K+LLFS      +  L+YD +   GS+W+ C +IKPS S L SV I
Sbjct  293   VRLGVWNNKVLLFS--RVCGHEALMYDLDKEKGSKWRVCDQIKPSASQLASVLI  344



>ref|XP_010460498.1| PREDICTED: putative F-box/kelch-repeat protein At1g27420 [Camelina 
sativa]
Length=346

 Score =   267 bits (682),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 147/354 (42%), Positives = 217/354 (61%), Gaps = 19/354 (5%)
 Frame = -1

Query  1383  VVVDDSYSPLLPGLPDDVAKYCLALVPRYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLL  1204
             +VV+ S  P++PGL DD A+ CL+ +PR  F     V +RW+SF+RSK F   RKL   +
Sbjct  1     MVVESSSYPIIPGLTDDAAELCLSKIPRSSFQITSQVCRRWKSFLRSKHFAAFRKLTRTV  60

Query  1203  EEWLYVLTVDADGKESHWEVLDCLGHKHHQLPQMPAPIRAGFGVAVLN-AKLLVMGGYSM  1027
             EE+L VL     G++ +WEV D  G+K  Q+P +P P++ GFGVAVL+  K++ +GGY+ 
Sbjct  61    EEFLCVLMESECGRDVYWEVFDASGNKLGQIPPVPGPLKRGFGVAVLDGGKIVFIGGYTE  120

Query  1026  IDESA------SVSPEVFQYDSCLNSWSKLASMNVARYDFACAEVNGMVYAVGGNGVNGE  865
             +D S       S S +V+++D   NSW KLA MN+ RY+FA AEVNG++Y + G   +  
Sbjct  121   VDGSGINSTTVSASADVYEFDPATNSWKKLADMNIPRYNFAFAEVNGLLYVIRGYSTDTY  180

Query  864   SLSCAEVYDPDTNKWRVIESLRRPRWGCFGCGFEGKLYVMGGRSSFTIGNSRFVDVYNPE  685
             SLS AEVY+P+TN+W +++   RP W  F   F  KLY +G         SRF+D+Y+P+
Sbjct  181   SLSNAEVYNPETNQWSLMDCPNRPVWRGFAFSFCSKLYAVG-------NGSRFIDIYDPK  233

Query  684   RQSWCEMKN-GCVMVTAHAVVGKKLFCIEWKNQRKLGIFNPEDNSWKMVGVPVTGSSSIG  508
              Q+W ++ +   V V ++ VV  K++ ++      LG+F+PE+NSW  V VP        
Sbjct  234   TQTWEKLNSEQSVSVYSYTVVRNKVYYMDRNMPGCLGVFDPEENSWSSVFVP-RREGGFW  292

Query  507   FRLGILDEKLLLFSLQENPTYTTLLYDPNAAAGSEWQTC-EIKPSGSCLCSVTI  349
              RLG+ ++K+LLFS      +  L+YD +   GS+W+ C +IKPS S L SV I
Sbjct  293   VRLGVWNDKVLLFS--RVCGHEILMYDLDTEKGSKWRVCDQIKPSASQLTSVLI  344



>ref|XP_010499220.1| PREDICTED: putative F-box/kelch-repeat protein At1g27420 [Camelina 
sativa]
Length=347

 Score =   266 bits (679),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 148/354 (42%), Positives = 213/354 (60%), Gaps = 19/354 (5%)
 Frame = -1

Query  1383  VVVDDSYSPLLPGLPDDVAKYCLALVPRYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLL  1204
             VV   S  P++PGL DD A+ CL+ +PR  F     V +RWRSF+RSK F   RKL   +
Sbjct  2     VVESSSSYPIIPGLTDDAAELCLSKIPRSSFQITSQVCRRWRSFLRSKHFAAFRKLTGTV  61

Query  1203  EEWLYVLTVDADGKESHWEVLDCLGHKHHQLPQMPAPIRAGFGVAVLN-AKLLVMGGYSM  1027
             EE+L VL     G++ +WEV D  G+K  Q+P +P P++ GFGVAVL+  K++ +GGY+ 
Sbjct  62    EEFLCVLMESECGRDVYWEVFDASGNKLGQIPPVPGPLKRGFGVAVLDGGKIVFIGGYTE  121

Query  1026  IDESA------SVSPEVFQYDSCLNSWSKLASMNVARYDFACAEVNGMVYAVGGNGVNGE  865
             +D S       S S +V+++D   NSW KLA MN+ RY+FA AEVNG++Y + G   +  
Sbjct  122   VDGSGINSTTVSASADVYEFDPAANSWKKLADMNIPRYNFAFAEVNGLLYVIRGYSTDTY  181

Query  864   SLSCAEVYDPDTNKWRVIESLRRPRWGCFGCGFEGKLYVMGGRSSFTIGNSRFVDVYNPE  685
             SLS AEVY+P+TN+W +++   RP W  F   F  KLY  G         SRF+D+Y+P+
Sbjct  182   SLSNAEVYNPETNQWSLMDCPNRPVWRGFAFSFRSKLYAAG-------NGSRFIDIYDPK  234

Query  684   RQSWCEMKN-GCVMVTAHAVVGKKLFCIEWKNQRKLGIFNPEDNSWKMVGVPVTGSSSIG  508
              Q+W ++ +   V V ++ VV  K++ ++      LG+F+PE NSW  V VP        
Sbjct  235   TQTWEKLNSEQSVSVYSYTVVRNKVYFMDRNMPGCLGVFDPEKNSWISVFVP-RREGGFW  293

Query  507   FRLGILDEKLLLFSLQENPTYTTLLYDPNAAAGSEWQTC-EIKPSGSCLCSVTI  349
              RLG+ ++K+LLFS      +  L+YD +   GS+W+ C +IKPS S L SV I
Sbjct  294   VRLGVWNDKVLLFS--RVCGHEILMYDLDKEKGSKWRVCDQIKPSASQLTSVLI  345



>ref|XP_010478076.1| PREDICTED: putative F-box/kelch-repeat protein At1g27420 [Camelina 
sativa]
Length=347

 Score =   265 bits (678),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 149/354 (42%), Positives = 215/354 (61%), Gaps = 19/354 (5%)
 Frame = -1

Query  1383  VVVDDSYSPLLPGLPDDVAKYCLALVPRYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLL  1204
             VV   S  P++PGL DD A+ CL+ +PR  F     V  RWRSF+RSK F   RKL   +
Sbjct  2     VVESSSSYPIIPGLTDDAAELCLSKIPRSSFQITSQVCWRWRSFLRSKHFASFRKLTGTV  61

Query  1203  EEWLYVLTVDADGKESHWEVLDCLGHKHHQLPQMPAPIRAGFGVAVLN-AKLLVMGGYSM  1027
             EE+L VL     G++ +WEV D  G+K  Q+P +P P++ GFGVAVL+  K++ +GGY+ 
Sbjct  62    EEFLCVLMESECGRDVYWEVFDASGNKLGQIPPVPGPLKRGFGVAVLDGGKIVFIGGYTE  121

Query  1026  IDESA------SVSPEVFQYDSCLNSWSKLASMNVARYDFACAEVNGMVYAVGGNGVNGE  865
             +D S       S S +V+++D   NSW KLA MN+ RY+FA AEVNG++Y + G   +  
Sbjct  122   VDGSGINSTTVSASADVYEFDPATNSWKKLADMNIPRYNFAFAEVNGLLYVIRGYSTDTY  181

Query  864   SLSCAEVYDPDTNKWRVIESLRRPRWGCFGCGFEGKLYVMGGRSSFTIGNSRFVDVYNPE  685
             SLS AEVY+P+TN+W +++   RP W  F   F  KLY +G         SRF+D+Y+P+
Sbjct  182   SLSNAEVYNPETNQWSLMDCPNRPVWRGFAFSFCSKLYAVG-------NGSRFIDIYDPK  234

Query  684   RQSWCEMKN-GCVMVTAHAVVGKKLFCIEWKNQRKLGIFNPEDNSWKMVGVPVTGSSSIG  508
              Q+W ++ +   V V ++ VV  K++ ++      LG+F+PE+NSW  V VP T      
Sbjct  235   TQTWEKLNSEQSVSVYSYTVVRNKVYYMDRNMPGCLGVFDPEENSWSSVFVPRT-EGGFW  293

Query  507   FRLGILDEKLLLFSLQENPTYTTLLYDPNAAAGSEWQTC-EIKPSGSCLCSVTI  349
              RLG+ ++K+LLFS      +  L+YD +   GS+W+ C +IKPS S L SV I
Sbjct  294   VRLGVWNDKVLLFS--RVCGHEILMYDLDKEKGSKWRVCDQIKPSASQLTSVLI  345



>emb|CDY11811.1| BnaC03g57670D [Brassica napus]
Length=345

 Score =   263 bits (671),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 142/353 (40%), Positives = 218/353 (62%), Gaps = 20/353 (6%)
 Frame = -1

Query  1377  VDDSYSPLLPGLPDDVAKYCLALVPRYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEE  1198
             +D S S L+PGL DD A+ CL+  PR  F     V +RWR+F+RS+ F  VR+L   +EE
Sbjct  1     MDSSSSSLIPGLTDDAAELCLSRTPRSNFRITSQVCRRWRTFLRSEHFASVRELTGTVEE  60

Query  1197  WLYVLTVDADGKESHWEVLDCLGHKHHQLPQMPAPIRAGFGVAVL-NAKLLVMGGYSMID  1021
             ++ VL     G++ +WEV D  G+K  Q+P +P P++ GFGVAVL   K++ +GGY+ ++
Sbjct  61    FMCVLMESECGRDVYWEVFDASGNKLGQIPPVPGPMKRGFGVAVLGGGKIVFIGGYTEVE  120

Query  1020  ESASV-------SPEVFQYDSCLNSWSKLASMNVARYDFACAEVNGMVYAVGGNGVNGES  862
              S+S+       S +V+++D   NSW KLA MN+ RY+FA A VNG++Y + G   +  S
Sbjct  121   GSSSINSTIVSASADVYEFDPASNSWRKLAGMNIPRYNFAFAVVNGLLYVIRGYSTDAYS  180

Query  861   LSCAEVYDPDTNKWRVIESLRRPRWGCFGCGFEGKLYVMGGRSSFTIGNSRFVDVYNPER  682
             LS +EVY+P+TN+W +++   RP W  F   F+ KL+ +G         SRF+D+Y+P+ 
Sbjct  181   LSNSEVYNPETNRWSLMDCPNRPVWRGFAFSFKSKLFAVG-------NGSRFIDIYDPKT  233

Query  681   QSWCEMKN-GCVMVTAHAVVGKKLFCIEWKNQRKLGIFNPEDNSWKMVGVPVTGSSSIGF  505
             ++W E+ +   + V ++ VV  K++ ++     +LG+F+PE+N W  VGVP   +    F
Sbjct  234   ETWQELDSEQSISVYSYTVVRNKVYFMDRNMPGRLGVFDPEENCWSSVGVPPR-AGGFWF  292

Query  504   RLGILDEKLLLFSLQENPTYTTLLYDPNAAAGSEWQTC-EIKPSGSCLCSVTI  349
             RLG  + K+LLFS      + TL+YD +   GS+W+ C +IKPS S L SV I
Sbjct  293   RLGEWNNKVLLFS--RVCGHETLMYDLDKENGSKWRVCDQIKPSASHLTSVLI  343



>emb|CDX90085.1| BnaA08g18990D [Brassica napus]
Length=345

 Score =   261 bits (668),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 141/353 (40%), Positives = 217/353 (61%), Gaps = 20/353 (6%)
 Frame = -1

Query  1377  VDDSYSPLLPGLPDDVAKYCLALVPRYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEE  1198
             +D S S L+PGL DD A+ CL+  PR  F  +  V +RWR+F+RS+ F  VR+L   +EE
Sbjct  1     MDSSPSSLIPGLTDDAAELCLSRTPRSNFRTISQVCRRWRTFLRSEHFASVRELTGTVEE  60

Query  1197  WLYVLTVDADGKESHWEVLDCLGHKHHQLPQMPAPIRAGFGVAVL-NAKLLVMGGYSMID  1021
             ++ VL     G++ +WEV D  G+K  Q+P +P P++ GFGVAVL   K++ +GGY+ ++
Sbjct  61    FMCVLMESECGRDVYWEVFDASGNKLGQIPPVPGPMKRGFGVAVLGGGKIVFVGGYTEVE  120

Query  1020  ESASV-------SPEVFQYDSCLNSWSKLASMNVARYDFACAEVNGMVYAVGGNGVNGES  862
              S+S+       S +V+++D   N W KLA MN+ RY+FA A VNG++Y + G   +  S
Sbjct  121   GSSSINSTIVSASADVYEFDPASNRWRKLAGMNIPRYNFAFAVVNGLLYVIRGYSTDAYS  180

Query  861   LSCAEVYDPDTNKWRVIESLRRPRWGCFGCGFEGKLYVMGGRSSFTIGNSRFVDVYNPER  682
             LS +EVY+P+TN+W +++   RP W  F   F+ KL+ +G         SRF+D+Y+P+ 
Sbjct  181   LSNSEVYNPETNRWSLMDCPNRPVWRGFAFSFKSKLFAVG-------NGSRFIDIYDPKT  233

Query  681   QSWCEMKN-GCVMVTAHAVVGKKLFCIEWKNQRKLGIFNPEDNSWKMVGVPVTGSSSIGF  505
             ++W E+ +   + V ++ VV  K++ ++     +LG+F+PE+N W  VGVP   +    F
Sbjct  234   ETWEELDSEQSISVYSYTVVRNKVYFMDRNMPGRLGVFDPEENYWSSVGVP-PRAGGFWF  292

Query  504   RLGILDEKLLLFSLQENPTYTTLLYDPNAAAGSEWQTC-EIKPSGSCLCSVTI  349
             RLG  + K+LLFS      + TL+YD +   GS W+ C +IKPS S L SV I
Sbjct  293   RLGEWNNKVLLFS--RVCGHETLMYDLDKETGSRWRVCDQIKPSASHLTSVLI  343



>ref|XP_009109805.1| PREDICTED: putative F-box/kelch-repeat protein At1g27420 [Brassica 
rapa]
Length=345

 Score =   259 bits (663),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 141/353 (40%), Positives = 216/353 (61%), Gaps = 20/353 (6%)
 Frame = -1

Query  1377  VDDSYSPLLPGLPDDVAKYCLALVPRYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEE  1198
             +D S S L+PGL DD A+ CL+  PR  F  +  V +RWR+F+RS+ F  VR+L   +EE
Sbjct  1     MDSSPSSLIPGLTDDAAELCLSRTPRSNFRTISQVCRRWRTFLRSEHFASVRELTGTVEE  60

Query  1197  WLYVLTVDADGKESHWEVLDCLGHKHHQLPQMPAPIRAGFGVAVL-NAKLLVMGGYSMID  1021
             ++ VL     G++  WEV D  G+K  Q+P +P P + GFGVAVL   K++ +GGY+ ++
Sbjct  61    FMCVLMESECGRDVFWEVFDASGNKLGQIPPIPGPTKRGFGVAVLGGGKIVFVGGYTEVE  120

Query  1020  ESASV-------SPEVFQYDSCLNSWSKLASMNVARYDFACAEVNGMVYAVGGNGVNGES  862
              S+S+       S +V+++D   N W KLA MN+ RY+FA A VNG++Y + G   +  S
Sbjct  121   GSSSINSTIVSASADVYEFDPASNRWRKLAGMNIPRYNFAFAVVNGLLYVIRGYSTDAYS  180

Query  861   LSCAEVYDPDTNKWRVIESLRRPRWGCFGCGFEGKLYVMGGRSSFTIGNSRFVDVYNPER  682
             LS +EVY+P+TN+W +++   RP W  F   F+ KL+ +G         SRF+D+Y+P+ 
Sbjct  181   LSNSEVYNPETNRWSLMDCPNRPVWRGFAFSFKSKLFAVG-------NGSRFIDIYDPKT  233

Query  681   QSWCEMKN-GCVMVTAHAVVGKKLFCIEWKNQRKLGIFNPEDNSWKMVGVPVTGSSSIGF  505
             ++W E+ +   + V ++ VV  K++ ++     +LG+F+PE+N W  VGVP   +    F
Sbjct  234   ETWEELDSEQSISVYSYTVVRNKVYFMDRNMPGRLGVFDPEENYWSSVGVPPR-AGGFWF  292

Query  504   RLGILDEKLLLFSLQENPTYTTLLYDPNAAAGSEWQTC-EIKPSGSCLCSVTI  349
             RLG  + K+LLFS      + TL+YD +   GS+W+ C +IKPS S L SV I
Sbjct  293   RLGEWNNKVLLFS--RVCGHETLMYDLDKENGSKWRVCDQIKPSASHLTSVLI  343



>ref|XP_006415764.1| hypothetical protein EUTSA_v10008094mg [Eutrema salsugineum]
 gb|ESQ34117.1| hypothetical protein EUTSA_v10008094mg [Eutrema salsugineum]
Length=345

 Score =   259 bits (663),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 141/353 (40%), Positives = 217/353 (61%), Gaps = 19/353 (5%)
 Frame = -1

Query  1380  VVDDSYSPLLPGLPDDVAKYCLALVPRYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLE  1201
             +V +S S ++PGL DD A+  L+ +PR  F ++  V++RWR+F+RS  F  +R+L   +E
Sbjct  1     MVMESSSAIIPGLTDDAAELSLSRIPRSSFRSVSQVSRRWRTFLRSDHFAAIRELTGTVE  60

Query  1200  EWLYVLTVDADGKESHWEVLDCLGHKHHQLPQMPAPIRAGFGVAVLNA-KLLVMGGYSMI  1024
             E++ VL     G++ +WEV D  G+K   +P +P P++ GFGVAVL+  K++ +GGY+ +
Sbjct  61    EFMCVLMESECGRDVYWEVFDGSGNKLGLIPPVPGPLKRGFGVAVLDGGKIVFIGGYTEV  120

Query  1023  DESA------SVSPEVFQYDSCLNSWSKLASMNVARYDFACAEVNGMVYAVGGNGVNGES  862
             + S       S S +V+++D   NSW KLA MN+ RY+FA AEV+G++Y + G   +  S
Sbjct  121   EGSGINSTTVSASADVYEFDPAANSWRKLAGMNIPRYNFAFAEVDGLLYVIRGYSTDAYS  180

Query  861   LSCAEVYDPDTNKWRVIESLRRPRWGCFGCGFEGKLYVMGGRSSFTIGNSRFVDVYNPER  682
             LS +EVY+P+TN+W +++   RP W  F   F  KLY +G         SRF+DVY+P+ 
Sbjct  181   LSNSEVYNPETNQWSIMDCPNRPVWRGFAFSFNSKLYAVG-------NGSRFIDVYDPKT  233

Query  681   QSWCEMK-NGCVMVTAHAVVGKKLFCIEWKNQRKLGIFNPEDNSWKMVGVPVTGSSSIGF  505
             Q+W E+     V V ++ VV  K++ ++     +LG+F+PE++SW  V VP        F
Sbjct  234   QTWEELNLEKSVSVYSYTVVRHKVYFMDRNMPGRLGVFDPEESSWSSVFVP-PREGGFWF  292

Query  504   RLGILDEKLLLFSLQENPTYTTLLYDPNAAAGSEWQTC-EIKPSGSCLCSVTI  349
             RLG  + K+LLFS      + TL+YD +   GS+W+ C +IKPS S L SV I
Sbjct  293   RLGEWNNKVLLFS--RVCGHETLMYDLDKETGSKWRVCDQIKPSASQLTSVLI  343



>gb|KFK44492.1| hypothetical protein AALP_AA1G264200 [Arabis alpina]
Length=345

 Score =   255 bits (652),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 138/348 (40%), Positives = 215/348 (62%), Gaps = 20/348 (6%)
 Frame = -1

Query  1362  SPLLPGLPDDVAKYCLALVPRYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWLYVL  1183
             S ++PGL DD A+ CL+ +PR  F  +  V++RWR+F+RS+ F  VR+L   +EE+L VL
Sbjct  6     SSIIPGLTDDAAELCLSRIPRCSFQIISLVSRRWRTFLRSEHFSAVRRLTGTVEEFLCVL  65

Query  1182  TVDADGKESHWEVLDCLGHKHHQLPQMPAPIRAGFGVAVLNA--KLLVMGGYSMIDESA-  1012
                  G++ +WEV D  G+K  Q+P +P P++ GFG+ VL+   +++ +GGY+ ++ S  
Sbjct  66    MESECGRDVYWEVFDASGNKLGQIPPVPGPLKRGFGLVVLDGGKRMVFIGGYTEVEGSGI  125

Query  1011  -----SVSPEVFQYDSCLNSWSKLASMNVARYDFACAEVNGMVYAVGGNGVNGESLSCAE  847
                  S S +VF++D   NSW K+A MN+ RY+FA A+V+G++Y + G   +  SLS AE
Sbjct  126   NSTTVSASADVFEFDPAANSWRKVAGMNIPRYNFAFAQVDGLLYVIRGYSTDAYSLSNAE  185

Query  846   VYDPDTNKWRVIESLRRPRWGCFGCGFEGKLYVMGGRSSFTIGNSRFVDVYNPERQSWCE  667
             VY+ +TN+W +++   RP W  F   F  KLY +G         SRF+D+Y+P+ Q+W E
Sbjct  186   VYNLETNQWSLMDCPNRPVWRGFAFSFNSKLYAVG-------NGSRFIDIYDPKTQTWEE  238

Query  666   MKN-GCVMVTAHAVVGKKLFCIEWKNQRKLGIFNPEDNSWKMVGVPVTGSSSIGFRLGIL  490
             + +   V V ++AVV  K++ ++      LG+F+PE+NSW  V VP         RLG+ 
Sbjct  239   LNSEQSVSVYSYAVVRNKVYFMDRNMPGCLGVFDPEENSWSSVFVP-RREGGFWVRLGVW  297

Query  489   DEKLLLFSLQENPTYTTLLYDPNAAAGSEWQTC-EIKPSGSCLCSVTI  349
             ++K+LLFS      + TL+YD +   GS+W+ C +IKPS S L S+ I
Sbjct  298   NDKVLLFS--RVCGHETLMYDLDKEKGSKWRVCDQIKPSASHLASLLI  343



>ref|NP_001237992.1| uncharacterized protein LOC100500176 [Glycine max]
 gb|ACU15133.1| unknown [Glycine max]
Length=135

 Score =   235 bits (599),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 109/135 (81%), Positives = 120/135 (89%), Gaps = 0/135 (0%)
 Frame = -1

Query  747  MGGRSSFTIGNSRFVDVYNPERQSWCEMKNGCVMVTAHAVVGKKLFCIEWKNQRKLGIFN  568
            MGGRSSFTIGNS+FVD+YNPER SWCE+KNGCVMVTAHAV+GKKLFCIEWKNQRKL IF+
Sbjct  1    MGGRSSFTIGNSKFVDIYNPERHSWCEIKNGCVMVTAHAVLGKKLFCIEWKNQRKLAIFS  60

Query  567  PEDNSWKMVGVPVTGSSSIGFRLGILDEKLLLFSLQENPTYTTLLYDPNAAAGSEWQTCE  388
            PEDNSWKMV VP+TGSSSI FR+GILDEKLLLF L+    + TLLYDPNA  GSEWQTC+
Sbjct  61   PEDNSWKMVPVPLTGSSSIDFRIGILDEKLLLFPLEAETAFQTLLYDPNATLGSEWQTCD  120

Query  387  IKPSGSCLCSVTIKA  343
            I+P G CLC VTIKA
Sbjct  121  IRPFGLCLCCVTIKA  135



>gb|KDO37508.1| hypothetical protein CISIN_1g030026mg [Citrus sinensis]
 gb|KDO37509.1| hypothetical protein CISIN_1g030026mg [Citrus sinensis]
Length=184

 Score =   232 bits (591),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 115/183 (63%), Positives = 134/183 (73%), Gaps = 1/183 (1%)
 Frame = -1

Query  1500  MPGTNCGKKRVTELKMCFSDEMNLDNPGHSKNISYFTSSVVVDDSYSPLLPGLPDDVAKY  1321
             MPG   GKKR+TE  MCFS    LD   HSK+    TS V  D   SPLLPGLPDDVAK 
Sbjct  1     MPGVVSGKKRITEANMCFSTLTELDKLTHSKSNPLLTSQVAFDLD-SPLLPGLPDDVAKC  59

Query  1320  CLALVPRYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWLYVLTVDADGKESHWEVL  1141
              LALVPR  FPAMG V K+WRSFIRSKEFI VRKL  LLEEWL +LT+D +GK+S WEVL
Sbjct  60    ILALVPRSNFPAMGTVCKKWRSFIRSKEFITVRKLLGLLEEWLCILTMDPEGKQSQWEVL  119

Query  1140  DCLGHKHHQLPQMPAPIRAGFGVAVLNAKLLVMGGYSMIDESASVSPEVFQYDSCLNSWS  961
             DC G++H  LP MP P++ GFGV V+N KL+VM GYS+ID +AS S +V+QYDSCLN + 
Sbjct  120   DCFGNRHRLLPLMPGPVKVGFGVVVINGKLVVMAGYSVIDGTASASADVYQYDSCLNRFG  179

Query  960   KLA  952
              +A
Sbjct  180   SVA  182



>emb|CDY15708.1| BnaA07g08790D [Brassica napus]
Length=343

 Score =   231 bits (589),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 132/347 (38%), Positives = 204/347 (59%), Gaps = 23/347 (7%)
 Frame = -1

Query  1356  LLPGLPDDVAKYCLALVPRYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWLYVLTV  1177
             ++PGL DDVA  CL+ +PR  F  +  V +RW++F+RS+ F  VRKL   +EE++ VL  
Sbjct  7     IIPGLTDDVAALCLSRIPRSNFRVLSQVCRRWKTFLRSEHFTAVRKLTGTVEEFMCVLME  66

Query  1176  DADGKESHWEVLDCLGHKHHQLPQMPAPIRAGFGVAVLNA-KLLVMGGYSMI------DE  1018
                GK+ +WEV D  G+K  Q+P +P P++ G+GV VL   K+L +GGY+ I        
Sbjct  67    TVPGKKVYWEVFDSSGNKLGQIPNVPGPLKWGYGVTVLGGEKILFIGGYTGIGGCVTNRN  126

Query  1017  SASVSPEVFQYDSCLNSWSKLASMNVARYDFACAEVNGMVYAVGGNGVNGESLSCAEVYD  838
             +   S +V+++D   NSW KL  MN+ RY+FA AEV+G++Y V G   +G  L  ++VY+
Sbjct  127   TPLASADVYEFDPATNSWGKLPDMNIPRYNFALAEVDGLLYVVRGYTNDGYCLLNSDVYN  186

Query  837   PDTNKWRVIESLRRPRWGCFGCGFEGKLYVMGGRSSFTIGNSRFVDVYNPERQSWCEMK-  661
             P+T +W +++  +      F   F+ KLY +G  S         VDVY+P+  +W E++ 
Sbjct  187   PETKQWTLMDCPQFRNISGFAFSFKSKLYAIGNGSC-------TVDVYDPKTNTWEELEL  239

Query  660   NGCVMVTAHAVVGKKLFCIEWKNQRKLGIFNPEDNSWKMVGVPVTGSSSIGFRLGI--LD  487
                + V ++ VV  K++ ++     +LG+F+PE+NSW  V VP       GFR G+   +
Sbjct  240   EKSMSVYSYTVVRNKVYFLDKDMPGRLGVFDPEENSWTTVFVPTVAG---GFRFGVGQWN  296

Query  486   EKLLLFSLQENPTYTTLLYDPNAAAGSEWQTC-EIKPSGSCLCSVTI  349
              K+LLFS      + T++ D +   GS+W+ C +IKPSGS L SV I
Sbjct  297   NKVLLFSRLS--VHETIINDFDKEKGSKWRYCSQIKPSGSHLFSVLI  341



>ref|XP_009103029.1| PREDICTED: putative F-box/kelch-repeat protein At1g27420 [Brassica 
rapa]
Length=343

 Score =   231 bits (589),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 131/347 (38%), Positives = 205/347 (59%), Gaps = 23/347 (7%)
 Frame = -1

Query  1356  LLPGLPDDVAKYCLALVPRYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWLYVLTV  1177
             ++PGL DDVA  CL+ +PR  F  +  V +RW++ +RS+ F  VRKL   +EE++ VL  
Sbjct  7     IIPGLTDDVAALCLSRIPRSNFRVLSQVCRRWKTLLRSEHFAAVRKLTGTVEEFMCVLME  66

Query  1176  DADGKESHWEVLDCLGHKHHQLPQMPAPIRAGFGVAVLNA-KLLVMGGYSMID------E  1018
                GK+ +WEV D  G+K  Q+P +P P++ G+GV VL   K+L +GGY+ I        
Sbjct  67    TVPGKKVYWEVFDSSGNKLGQIPNVPGPLKWGYGVTVLGGEKILFIGGYTGIGGCVTNRN  126

Query  1017  SASVSPEVFQYDSCLNSWSKLASMNVARYDFACAEVNGMVYAVGGNGVNGESLSCAEVYD  838
             +   S +V+++D   NSW KL  MN+ RY+FA AEV+G++Y V G   +G  L  ++VY+
Sbjct  127   TPLASADVYEFDPATNSWGKLPDMNIPRYNFALAEVDGLLYVVRGYTNDGYCLLNSDVYN  186

Query  837   PDTNKWRVIESLRRPRWGCFGCGFEGKLYVMGGRSSFTIGNSRFVDVYNPERQSWCEMK-  661
             P+TN+W +++  +      F   F+ KLY +G  S         VD+Y+P+ ++W E++ 
Sbjct  187   PETNQWTLMDCPQFRNISGFAFSFKSKLYALGNGSC-------TVDIYDPKTKTWEELEL  239

Query  660   NGCVMVTAHAVVGKKLFCIEWKNQRKLGIFNPEDNSWKMVGVPVTGSSSIGFRLGI--LD  487
                + V ++ VV  K++ ++     +LG+F+PE+NSW  V VP       GFR G+   +
Sbjct  240   EKSMSVYSYTVVRNKVYFLDKDLTGRLGVFDPEENSWTTVFVPTVAG---GFRFGVGQWN  296

Query  486   EKLLLFSLQENPTYTTLLYDPNAAAGSEWQTC-EIKPSGSCLCSVTI  349
              K+LLFS      + T++ D +   GS+W+ C +IKPSGS L SV I
Sbjct  297   NKVLLFSRLS--VHETIINDFDKEKGSKWRYCSQIKPSGSHLFSVLI  341



>emb|CDY03923.1| BnaC07g11480D [Brassica napus]
Length=338

 Score =   226 bits (576),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 126/346 (36%), Positives = 202/346 (58%), Gaps = 14/346 (4%)
 Frame = -1

Query  1371  DSYSPLLPGLPDDVAKYCLALVPRYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWL  1192
             +S SP++PGL DDVA  CL+ +PR  F  +  V +RW++F+RS+ F  VRKL   +EE++
Sbjct  2     ESSSPIIPGLTDDVAALCLSRIPRSNFRLLSQVCRRWKTFLRSEHFTAVRKLTGRMEEFM  61

Query  1191  YVLTVDADGKESHWEVLDCLGHKHHQLPQMP--APIRAGFGVAVLNAKLLVMGGYSMIDE  1018
              VL  D  G   +WEV D  G+K  ++P +P   P++ G+GV VLN K+L +GG++    
Sbjct  62    CVLMEDKPGTSVYWEVFDSSGNKLGRIPNIPDPGPLKWGYGVTVLNEKILFIGGFTGSIG  121

Query  1017  SASVSPEVFQYDSCLNSWSKLASMNVARYDFACAEVNGMVYAVGGNGVNGESLSCAEVYD  838
             +   SP V+++    NSW KLA MN+ RY F+ AEV+G++Y V G   +G  L   EVY+
Sbjct  122   TPLASPNVYEFSPATNSWRKLADMNIPRYSFSLAEVDGLLYVVQGFSNDGYCLFNTEVYN  181

Query  837   PDTNKWRVIESLRRPRWGCFGCGFEGKLYVMGGRSSFTIGNSRFVDVYNPERQSWCEMK-  661
             P TN+W +++  +      F   F+ KLYV+   ++        +D+Y+ + ++W  ++ 
Sbjct  182   PKTNQWSLMDGPKIQVAIGFAFSFKSKLYVLDNGTT-------TIDIYDTKTKTWEMLES  234

Query  660   NGCVMVTAHAVVGKKLFCIEWKNQRKLGIFNPEDNSWKMVGVPVTGSSSIGFRLGILDEK  481
             +    V ++ VV  K++ ++ +   +LG+F+PE+NSW  V VP T       +LG  + K
Sbjct  235   DELTAVYSYTVVRNKVYFLDSERPERLGVFDPEENSWTRVFVP-TEPGGFQSKLGQWNNK  293

Query  480   LLLFSLQENPTYTTLLYDPNAAAGSEWQTC-EIKPSGSCLCSVTIK  346
             +LLF         T++ D +   GS+W+ C +IK SG  + SV IK
Sbjct  294   VLLF--LRGSVGKTIINDFDKEEGSKWRDCDQIKLSGYHVYSVLIK  337



>ref|XP_009102975.1| PREDICTED: putative F-box/kelch-repeat protein At1g27420 [Brassica 
rapa]
Length=339

 Score =   224 bits (571),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 128/348 (37%), Positives = 201/348 (58%), Gaps = 14/348 (4%)
 Frame = -1

Query  1377  VDDSYSPLLPGLPDDVAKYCLALVPRYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEE  1198
             ++ S S ++PGL DDVA  CL+ +PR  F  +  V +RW++F+RS+ F  VRKL   +EE
Sbjct  1     MESSSSWIIPGLTDDVAALCLSRIPRSNFRLLSQVCRRWKTFLRSEHFTAVRKLTGRMEE  60

Query  1197  WLYVLTVDADGKESHWEVLDCLGHKHHQLPQMP--APIRAGFGVAVLNAKLLVMGGYSMI  1024
             ++ VL  D  G   +WEV D  G+K   +P +P   P++ G+GV VLN K+L +GG++  
Sbjct  61    FMCVLMEDKPGTSVYWEVFDSSGNKLGPIPNIPDPGPLKWGYGVTVLNEKILFIGGFTGN  120

Query  1023  DESASVSPEVFQYDSCLNSWSKLASMNVARYDFACAEVNGMVYAVGGNGVNGESLSCAEV  844
               +   SP+V+++    NSW KL  MN+ RY F+ AEV+G++Y V G   +G  L   EV
Sbjct  121   IGTPHASPDVYEFSPATNSWRKLGDMNIPRYSFSLAEVDGLLYVVQGFSNDGYCLFNTEV  180

Query  843   YDPDTNKWRVIESLRRPRWGCFGCGFEGKLYVMGGRSSFTIGNSRFVDVYNPERQSWCEM  664
             Y+P TN+WR+++         F   F+ KLYV+   ++        +D+Y+ + ++W  +
Sbjct  181   YNPKTNQWRLMDGPNIQVAIGFAFSFKSKLYVLDNGTA-------TIDMYDTKTKTWEML  233

Query  663   K-NGCVMVTAHAVVGKKLFCIEWKNQRKLGIFNPEDNSWKMVGVPVTGSSSIGFRLGILD  487
             + N    V ++ VV  K++ ++ +   +LG+F+PE+NSW  V VP T       +LG  +
Sbjct  234   ESNELAAVYSYTVVRNKVYFLDSERPGRLGVFDPEENSWTRVFVP-TEPRGFQSKLGQWN  292

Query  486   EKLLLFSLQENPTYTTLLYDPNAAAGSEWQTC-EIKPSGSCLCSVTIK  346
              K+LLF         T++ D N   GSEW+ C +IK SG  + SV IK
Sbjct  293   NKVLLF--LRGSVGKTIINDFNKEEGSEWRDCDQIKLSGYHVYSVLIK  338



>emb|CDY64382.1| BnaA07g36630D [Brassica napus]
Length=342

 Score =   219 bits (559),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 125/345 (36%), Positives = 198/345 (57%), Gaps = 14/345 (4%)
 Frame = -1

Query  1368  SYSPLLPGLPDDVAKYCLALVPRYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWLY  1189
             S S ++PGL DDVA  CL+ +PR  F  +  V +RW++F+RS+ F  VRKL   +EE++ 
Sbjct  7     SSSWIIPGLTDDVAALCLSRIPRSNFRLLSQVCRRWKTFLRSEHFTAVRKLTETMEEFMC  66

Query  1188  VLTVDADGKESHWEVLDCLGHKHHQLPQMP--APIRAGFGVAVLNAKLLVMGGYSMIDES  1015
             VL  D  G   +WEV D  G+K   +P +P   P++ G+GV VLN K+L +GG++    +
Sbjct  67    VLMEDKPGTSVYWEVFDSSGNKLGPIPNIPDPGPLKWGYGVTVLNEKILFIGGFTGNIGT  126

Query  1014  ASVSPEVFQYDSCLNSWSKLASMNVARYDFACAEVNGMVYAVGGNGVNGESLSCAEVYDP  835
                SP+V+++    NSW KL  MN+ RY F+ AEV+G++Y V G   +G  L   EVY+P
Sbjct  127   PHASPDVYEFSPATNSWRKLGDMNIPRYSFSLAEVDGLLYVVQGFSNDGYCLFNTEVYNP  186

Query  834   DTNKWRVIESLRRPRWGCFGCGFEGKLYVMGGRSSFTIGNSRFVDVYNPERQSWCEMK-N  658
              TN+W +++         F   F+ KLYV+   ++        +D+Y+ + ++W  ++ +
Sbjct  187   QTNQWSLMDGPNIQVAIGFAFSFKSKLYVLDNGTA-------TIDMYDTKTKTWEMLESD  239

Query  657   GCVMVTAHAVVGKKLFCIEWKNQRKLGIFNPEDNSWKMVGVPVTGSSSIGFRLGILDEKL  478
                 V ++ VV  K++ ++ +   +LG+F+PE+NSW  V VP T       +LG  + K+
Sbjct  240   ELAAVYSYTVVRNKVYFLDSERPGRLGVFDPEENSWTRVFVP-TEPGGFQSKLGQWNNKV  298

Query  477   LLFSLQENPTYTTLLYDPNAAAGSEWQTC-EIKPSGSCLCSVTIK  346
             LLF         T++ D +   GS W+ C +IK SG  +CSV IK
Sbjct  299   LLF--LRGSVGKTIINDFDKEEGSNWRDCDQIKLSGYNVCSVLIK  341



>ref|XP_009109832.1| PREDICTED: putative F-box/kelch-repeat protein At1g27420 [Brassica 
rapa]
Length=348

 Score =   217 bits (553),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 134/358 (37%), Positives = 202/358 (56%), Gaps = 27/358 (8%)
 Frame = -1

Query  1377  VDDSYSPLLPGLPDDVAKYCLALVPRYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEE  1198
             ++ S S L+PGL DDVA+ CL+ +P   F  +  V +RWR+F+RS+ F  VRKL   +EE
Sbjct  1     MESSQSSLIPGLTDDVAELCLSRIPHSGFRIIAQVCRRWRTFLRSEHFSAVRKLTGSVEE  60

Query  1197  WLYVLTVDA---DGKESHW---EVLDCLGHKHHQLPQMPAPIRAGFGVAVLNA-KLLVMG  1039
             +  VL       DG+   +   EV D  G+   ++P  P P  +GFGVAVL   K++  G
Sbjct  61    FTCVLMESQFVRDGRFVKYLFGEVFDVSGNCLGRIPTFPGPFVSGFGVAVLRGRKIVFFG  120

Query  1038  GYSMIDESASV-------SPEVFQYDSCLNSWSKLASMNVARYDFACAEVNGMVYAVGGN  880
             GY+  DE  ++       S  V ++D   NSW KLA+MNV R++FA A VNG++Y + G 
Sbjct  121   GYTR-DERFAIKGTTIYASAHVHEFDPATNSWRKLANMNVPRHNFAYAVVNGLLYVIRGF  179

Query  879   GVNGESLSCAEVYDPDTNKWRVIESLRRPRWGCFGCGFEGKLYVMGGRSSFTIGNSRFVD  700
                G+SL   EVY+P TN+W +++   RP W  F   F+ KL+V+          SRF+D
Sbjct  180   SSFGDSLLSTEVYNPKTNQWSLMDCPYRPVWRGFAFSFKSKLFVVS-------NESRFID  232

Query  699   VYNPERQSWCEMKNG-CVMVTAHAVVGKKLFCIEWKNQRKLGIFNPEDNSWKMVGVPVTG  523
             +Y+P+ ++W E+ +G  + V ++ V+  K++  + +    LG+F+PE+NSW  VGVP + 
Sbjct  233   IYDPKTETWKELDSGQSLSVYSYTVIRNKVYFFD-RKMPGLGVFDPEENSWSWVGVPRS-  290

Query  522   SSSIGFRLGILDEKLLLFSLQENPTYTTLLYDPNAAAGSEWQTCEIKPSGSCLCSVTI  349
                  FRLG  + K++L +        T   D + A  S+W+   IKPSGS    V I
Sbjct  291   PGGYWFRLGEWNNKVILIARLRGCKALTGDLDKDDA--SKWRATHIKPSGSNATVVLI  346



>emb|CDY66857.1| BnaA08g31090D [Brassica napus]
Length=356

 Score =   214 bits (545),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 132/361 (37%), Positives = 207/361 (57%), Gaps = 32/361 (9%)
 Frame = -1

Query  1368  SYSPLLPGLPDDVAKYCLALVPRYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWLY  1189
             S S L+PGL DDVA+ CL+ +PR  F  +  V +RWR+F++SK F  VRKL   +EE++ 
Sbjct  5     SPSSLIPGLTDDVAELCLSRIPRCDFRIISQVCRRWRTFLKSKHFSAVRKLTGPVEEFMC  64

Query  1188  VLTVDADGKE-SHW------EVLDCLGHKHHQLPQMPAPIRAGFGVAVLNA-KLLVMGGY  1033
             VL      ++ S W      EV D  G+   Q+P +P P+++ FGVAVL   K++++GGY
Sbjct  65    VLMKSKSPEDGSRWVEYLYGEVFDASGNNLGQIPSVPGPLKSQFGVAVLGGGKIVLVGGY  124

Query  1032  SMID-------ESASVSPEVFQYDSCLNSWSKLASMNVARYDFACAEVNGMVYAVGGNGV  874
             + ++          S S + +++D   NSW KLA MNV R +FA A V G++Y + G   
Sbjct  125   AEVEGFPIDGTTRISASADAYEFDPATNSWRKLAGMNVPRREFAFAVVGGLLYVIRGFSS  184

Query  873   NGESLSCAEVYDPDTNKWRVIESL-RRPRWG-CFGCGFEGKLYVMGGRSSFTIGNSRFVD  700
             +GE L  +EVYDP+TN+W +++    RP +   F   F+ KL+V+G         SRF+D
Sbjct  185   DGECLQSSEVYDPETNQWSLMDDCPDRPDFHRAFAFSFKSKLFVVG-------NESRFID  237

Query  699   VYNPERQSWCEMKNG-CVMVTAHAVVGKKLFCIEWK---NQRKLGIFNPEDNSWKMVGVP  532
             +Y+P  ++W E+ +G  + V ++ VV  K++  +     N+ +LG+F+PE+NSW  V VP
Sbjct  238   IYDPRTETWEELDSGQSLSVYSYTVVRNKVYFFDHNSDYNKPELGVFDPEENSWSSVSVP  297

Query  531   VTGSSSIGFRLGILDEKLLLFSLQENPTYTTLLYDPNAAAGSEWQTCEIKPSGSCLCSVT  352
              +   +   ++G  + K++L S        TL+ D +    S+W+   IKPSGS    V 
Sbjct  298   RS-PGAYWCKVGEWNNKVILVSPLGG---RTLIRDLDKENASKWRDTHIKPSGSNPTIVL  353

Query  351   I  349
             I
Sbjct  354   I  354



>ref|XP_009109833.1| PREDICTED: putative F-box/kelch-repeat protein At1g27420 [Brassica 
rapa]
Length=350

 Score =   211 bits (538),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 127/359 (35%), Positives = 201/359 (56%), Gaps = 26/359 (7%)
 Frame = -1

Query  1380  VVDDSYSPLLPGLPDDVAKYCLALVPRYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLE  1201
             + + S S L+PGL DDVA+ CL+ +PRY F  +  V + WR FI+SK F  VRKL   +E
Sbjct  1     MAESSPSSLIPGLTDDVAERCLSRIPRYDFRIISQVCRGWRMFIKSKHFADVRKLTGPVE  60

Query  1200  EWLYVLTVDADGKESHW------EVLDCLGHKHHQLPQMPAPIRAGFGVAVLNAKLLV--  1045
             E++ V+      ++  +      EV D  G+   Q+P++P P ++ FGVAVL    +V  
Sbjct  61    EFMCVMMDGRFIRDRQFVNYLYGEVFDASGNNLGQIPRVPGPFKSRFGVAVLGGGKIVII  120

Query  1044  -----MGGYSMIDESASVSPEVFQYDSCLNSWSKLASMNVARYDFACAEVNGMVYAVGGN  880
                  + G+ +     S S +V+++D   NSW  LA MN+ RY FA A  +G++Y + G 
Sbjct  121   GGYAEVEGFPVDGNRISASADVYEFDPAFNSWRNLAPMNIPRYSFAFAVADGLLYVIRGR  180

Query  879   GVNGESLSCAEVYDPDTNKWRVIESLRRPRWGC-FGCGFEGKLYVMGGRSSFTIGNSRFV  703
               +G+ L  +EVY+P+TN+W +++   RP + C F   F  KLYV+  +       SRF+
Sbjct  181   SSDGKHLLSSEVYNPETNQWSLMDCPHRPNFRCAFAFSFNSKLYVVDDK-------SRFI  233

Query  702   DVYNPERQSWCEMKNG-CVMVTAHAVVGKKLFCIEWKNQRKLGIFNPEDNSWKMVGVPVT  526
             ++Y+P+ ++W E+ +G  + V ++ V+  K++  E  N+  LG+F+PE+NSW  V VP  
Sbjct  234   EIYDPKTETWEELDSGQSLSVYSYTVIRNKVYFFE-HNKPGLGVFDPEENSWSSVFVP-W  291

Query  525   GSSSIGFRLGILDEKLLLFSLQENPTYTTLLYDPNAAAGSEWQTCEIKPSGSCLCSVTI  349
                +  FRLG  + K++L +         L  D + A  S+W   +IKPSGS    V I
Sbjct  292   APGAYWFRLGEWNNKVILIARMGG--CNALTGDLDKANSSKWTATQIKPSGSYPTIVLI  348



>emb|CDY36145.1| BnaA08g19030D [Brassica napus]
Length=350

 Score =   211 bits (537),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 126/359 (35%), Positives = 201/359 (56%), Gaps = 26/359 (7%)
 Frame = -1

Query  1380  VVDDSYSPLLPGLPDDVAKYCLALVPRYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLE  1201
             + + S S L+PGL DDVA+ CL+ +PRY F  +  V + WR FI+SK F  VRKL   +E
Sbjct  1     MAESSPSSLIPGLTDDVAERCLSRIPRYDFRIISQVCRGWRMFIKSKHFADVRKLTGPVE  60

Query  1200  EWLYVLTVDADGKESHW------EVLDCLGHKHHQLPQMPAPIRAGFGVAVLNAKLLV--  1045
             E++ V+      ++  +      EV D  G+   Q+P++P P ++ FGVAVL    +V  
Sbjct  61    EFMCVMMDGRFIRDRQFVNYLYGEVFDASGNNLGQIPRVPGPFKSRFGVAVLGGGKIVII  120

Query  1044  -----MGGYSMIDESASVSPEVFQYDSCLNSWSKLASMNVARYDFACAEVNGMVYAVGGN  880
                  + G+ +     S S +V+++D   NSW  LA MN+ RY FA A  +G++Y + G 
Sbjct  121   GGYAEVEGFPVDGNRISASADVYEFDPAFNSWRNLAPMNIPRYSFAFAVADGLLYVIRGR  180

Query  879   GVNGESLSCAEVYDPDTNKWRVIESLRRPRWGC-FGCGFEGKLYVMGGRSSFTIGNSRFV  703
               +G+ L  +E+Y+P+TN+W +++   RP + C F   F  KLYV+  +       SRF+
Sbjct  181   SSDGKHLLSSEIYNPETNQWSLMDCPHRPNFRCAFAFSFNSKLYVVDDK-------SRFI  233

Query  702   DVYNPERQSWCEMKNG-CVMVTAHAVVGKKLFCIEWKNQRKLGIFNPEDNSWKMVGVPVT  526
             ++Y+P+ ++W E+ +G  + V ++ V+  K++  E  N+  LG+F+PE+NSW  V VP  
Sbjct  234   EIYDPKTETWEELDSGQSLSVYSYTVIRNKVYFFE-HNKPGLGVFDPEENSWSSVFVP-W  291

Query  525   GSSSIGFRLGILDEKLLLFSLQENPTYTTLLYDPNAAAGSEWQTCEIKPSGSCLCSVTI  349
                +  FRLG  + K++L +         L  D + A  S+W   +IKPSGS    V I
Sbjct  292   APGAYWFRLGEWNNKVILIARMGG--CNALTGDLDKANSSKWTATQIKPSGSYPTIVLI  348



>ref|XP_009109831.1| PREDICTED: putative F-box/kelch-repeat protein At1g27420 [Brassica 
rapa]
Length=356

 Score =   210 bits (535),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 133/365 (36%), Positives = 207/365 (57%), Gaps = 32/365 (9%)
 Frame = -1

Query  1380  VVDDSYSPLLPGLPDDVAKYCLALVPRYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLE  1201
             +V+ S S L+PGL DDVA+ CL+ +PRY F  +  V +RWR+F+RS+ F  VRKL   +E
Sbjct  1     MVESSPSWLIPGLTDDVAERCLSRIPRYDFRIISQVCRRWRTFLRSEHFSAVRKLTGPVE  60

Query  1200  EWLYVLTVDADGKE-SHW------EVLDCLGHKHHQLPQMPAPIRAGFGVAVLNA-KLLV  1045
             E++ VL      ++ S W      EV D  G+   Q+P +P P+++ FGVAVL   K+++
Sbjct  61    EFMCVLMKSKSPEDGSRWVEYLYGEVYDASGNNLGQIPSVPGPLKSQFGVAVLGGGKIVL  120

Query  1044  MGGYSMID-------ESASVSPEVFQYDSCLNSWSKLASMNVARYDFACAEVNGMVYAVG  886
             +GGY+ ++          S S + +++D   NSW KLA MNV R +FA A V G++Y + 
Sbjct  121   VGGYAEVEGFPIDGTTRISASADAYEFDPATNSWRKLAGMNVPRREFAFAVVGGLLYVIR  180

Query  885   GNGVNGESLSCAEVYDPDTNKWRVIESLRR-PRWG-CFGCGFEGKLYVMGGRSSFTIGNS  712
             G   +GE L  +EVYDP+TN W +++     P +   F   F+ KL+V+G         S
Sbjct  181   GFSSDGECLQSSEVYDPETNHWSLMDDCPDCPDFHRAFAFSFKSKLFVVG-------NES  233

Query  711   RFVDVYNPERQSWCEMKNG-CVMVTAHAVVGKKLFCIEWKNQRK---LGIFNPEDNSWKM  544
             RF+D+Y+P  ++W E+ +G  + V ++ VV  K++  +  +  K   LG+F+PE+NSW  
Sbjct  234   RFIDIYDPRTETWKELDSGQSLSVYSYTVVRNKVYFSDHNSDYKKPELGVFDPEENSWSS  293

Query  543   VGVPVTGSSSIGFRLGILDEKLLLFSLQENPTYTTLLYDPNAAAGSEWQTCEIKPSGSCL  364
             V VP     +   ++G  + K++L S        TL+ D +    S+W+   IKPSGS  
Sbjct  294   VSVPRC-PGAYWCKVGEWNNKVILVSPLGG---RTLIRDLDKENASKWRDTHIKPSGSNP  349

Query  363   CSVTI  349
               V I
Sbjct  350   TIVLI  354



>ref|XP_009102973.1| PREDICTED: putative F-box/kelch-repeat protein At1g27420 [Brassica 
rapa]
Length=420

 Score =   198 bits (504),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 126/367 (34%), Positives = 200/367 (54%), Gaps = 42/367 (11%)
 Frame = -1

Query  1377  VDDSYSPLLPGLPDDVAKYCLALVPRYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEE  1198
             +++S + ++PGL DDVA  CL+ +PR  F  +  V +RW++F+RS+ F  VRKL   +EE
Sbjct  1     MEESSTSIIPGLTDDVAALCLSRIPRSNFRVLSQVCRRWKTFLRSEHFAAVRKLTGTMEE  60

Query  1197  WLYVLTVDADGKESHWEVLDCLGHKHHQLPQMPAPIRAGFGVAVLNA-KLLVMGGY----  1033
             ++ V      G++ +WEV D  G+   Q+P  P P++ GF VAV+   K+L +GGY    
Sbjct  61    FMCVFMKSIRGRKVYWEVFDSSGNNLGQIPPFPGPLKRGFCVAVIGGEKILFIGGYTGMK  120

Query  1032  ----SMIDESAS----------------VSPEVFQYDSCLNSWSKLASMNVARYDFACAE  913
                 S I   AS                 S +V++++   NSW KLA MN+ RYDF+ AE
Sbjct  121   YWDFSRIPPIASGDINEFSLSTKRNPPLASADVYEFNPATNSWRKLADMNIPRYDFSLAE  180

Query  912   VNGMVYAVGGNGVNGESLSCAEVYDPDTNKWRVIESLRRPRWGCFGCGFEGKLYVMGGRS  733
             V+G++Y V G   +G  L   EVY+P TN+W +++       G F   F+ KLY +   S
Sbjct  181   VDGLLYVVQGFSNDGYCLFNTEVYNPQTNQWSLMDGPVAFPIGGFAFSFKSKLYAVANGS  240

Query  732   SFTIGNSRFVDVYNPERQSWCEMK-NGCVMVTAHAVVGKKLFCIEWKNQRKLGIFNPEDN  556
             +        +++Y+P+ ++W E+     + V ++ VV   ++ ++ +N   LG+F+PE+N
Sbjct  241   T-------TMNIYDPKTETWEELDLKQLLSVHSNTVVRNIVYFLD-QNSGCLGVFDPEEN  292

Query  555   SWKMVGVPVTGSSSIGFR--LGILDEKLLLFSLQENPTYTTLLYDPNAAAGSEWQTC-EI  385
             SW    +P       G+R  LG  + K+LLFS        TL+   +   G +W+ C +I
Sbjct  293   SWTDEFLPTVEG---GYRSGLGQWNNKVLLFSRLS--VRETLINGFDKEEGFKWRDCDQI  347

Query  384   KPSGSCL  364
             KPSGS L
Sbjct  348   KPSGSYL  354



>ref|XP_009110748.1| PREDICTED: putative F-box/kelch-repeat protein At1g27420 [Brassica 
rapa]
Length=329

 Score =   193 bits (491),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 118/340 (35%), Positives = 187/340 (55%), Gaps = 21/340 (6%)
 Frame = -1

Query  1356  LLPGLPDDVAKYCLALVPRYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWLYVLTV  1177
             L+PGL DDVA+ CL+ +PR  F  +  V  RWR F+RS+ +  VRKL   +EE + VL  
Sbjct  5     LIPGLMDDVAELCLSRIPRSSFQIISQVCSRWRRFLRSERYAAVRKLTGSVEELMCVLQD  64

Query  1176  DADGKESHWEVLDCLGHKHHQLPQMPAPIRAGFGVAVLNAKLLVM--GGYSMIDESASVS  1003
             D      + EV DC G+K  ++P +P  +++G G+A L+   +V   G Y   +   + S
Sbjct  65    D-----QYCEVFDCSGNKLGRIPPVPGLLKSGSGLATLDGGNIVFIGGKYHEGEYDNAAS  119

Query  1002  PEVFQYDSCLNSWSKLASMNVARYDFACAEVNGMVYAVGGNGVNGESLSCAEVYDPDTNK  823
              +V++++   N W KLA MN+ RY+F  A V+G++Y + G    G+ L   EVY+P TNK
Sbjct  120   ADVYEFNPATNRWRKLADMNIPRYNFGYAVVDGLLYVIRGFTSYGDKLLSLEVYNPKTNK  179

Query  822   WRVIESLRRPRWGC-FGCGFEGKLYVMGGRSSFTIGNSRFVDVYNPERQSWCEMKNGCVM  646
             W +++   RP   C F   F+ KL+V    SS       F+D+Y+P+ ++W ++ +G  +
Sbjct  180   WSLMDCPYRPTSSCAFAFSFKSKLFVADSGSS-------FIDIYDPKMETWDQLDSGQEL  232

Query  645   -VTAHAVVGKKLFCIEWKNQRKLGIFNPEDNSWKMVGVPVTGSSSIGFRLGILDEKLLLF  469
              V + AV+  K++ ++  N   +G+F+PE NSW  V VP      + F LG ++ K++L 
Sbjct  233   WVYSCAVIRNKVYLLKIFNS-GMGVFDPEKNSWSSVSVPPFNGHELMFILGQMNNKVILA  291

Query  468   SLQENPTYTTLLYDPNAAAGSEWQTCEIKPSGSCLCSVTI  349
             +         L  D      +EW+   IK SG  + SV I
Sbjct  292   A----QGCEGLCGDIGKEDAAEWRASPIKLSGYDVSSVLI  327



>emb|CDY52247.1| BnaC08g20190D [Brassica napus]
Length=320

 Score =   187 bits (476),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 114/341 (33%), Positives = 189/341 (55%), Gaps = 30/341 (9%)
 Frame = -1

Query  1362  SPLLPGLPDDVAKYCLALVPRYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWLYVL  1183
             S L+PGL DD+A+ CL+ +PR  F  +  V  RWR F+RS+ +  VRKL   +EE + +L
Sbjct  5     SSLIPGLVDDLAELCLSRIPRSSFQIISQVCWRWRRFLRSERYGAVRKLTGSVEELMCLL  64

Query  1182  TVDADGKESHWEVLDCLGHKHHQLPQMPAPIRAGFGVAVLN-AKLLVMGG-YSMIDESAS  1009
               D      +WEV D  G++  ++P +P P++ GFG+ VL+  K++ +GG Y+ +     
Sbjct  65    VYD-----KYWEVFDGSGNQLGRIPHIPGPLKGGFGLVVLDGGKIVFIGGRYNCV-----  114

Query  1008  VSPEVFQYDSCLNSWSKLASMNVARYDFACAEVNGMVYAVGGNGVNGESLSCAEVYDPDT  829
              S +V++++   N W KLA MN+ R++F  A V+G++Y + G   +  S+  AE     T
Sbjct  115   ASADVYEFNPATNRWRKLADMNIPRHNFTYAVVDGLLYVIRGLSSDNVSILNAE-----T  169

Query  828   NKWRVIESLRRPRWGCFGCGFEGKLYVMGGRSSFTIGNSRFVDVYNPERQSWCEMKNGCV  649
             N+W +I+      +  F   F  KL+V+G R        RF+D+Y+P+ ++W ++ +G  
Sbjct  170   NQWSLIDCPHSHSFSGFAFSFNSKLFVVGNR-------WRFIDIYDPKTETWEKLDSGQT  222

Query  648   M-VTAHAVVGKKLFCIEWKNQRKLGIFNPEDNSWKMVGVPVTGSSSIGFRLGILDEKLLL  472
             + V+++ VV  K +  +W  +  +G+F+PE NSW  V V  +   +  +RLG  + K++L
Sbjct  223   LSVSSYTVVRNKAYFFDWF-KSGMGVFDPEKNSWSSVSVLPSEKCAFKYRLGQWNNKVIL  281

Query  471   FSLQENPTYTTLLYDPNAAAGSEWQTCEIKPSGSCLCSVTI  349
             FS         L  D +    ++W    IKPSG    SV I
Sbjct  282   FS----RGCEALSGDLDKEDAAKWIATPIKPSGLHPTSVLI  318



>emb|CDY70128.1| BnaCnng66850D [Brassica napus]
Length=337

 Score =   184 bits (466),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 125/363 (34%), Positives = 196/363 (54%), Gaps = 47/363 (13%)
 Frame = -1

Query  1380  VVDDSYSPLLPGLPDDVAKYCLALVPRYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLE  1201
             +V+ S S L+PGL DDVA+ CL+ +PRY F  +  V +RWR F++SK F  VRKL   +E
Sbjct  1     MVESSPSSLIPGLTDDVAELCLSRIPRYDFRIISQVCRRWRRFLKSKHFSAVRKLTGPVE  60

Query  1200  EWLYVLTVDADGKE-SHW------EVLDCLGHKHHQLPQMPAPIRAGFGVAVLNA-KLLV  1045
             E++ VL      ++ S W      EV D  G+   Q+P +PAP+++ FGV VL   K+++
Sbjct  61    EFMCVLMKSQSPEDGSMWVEYLYGEVFDASGNNLGQIPSVPAPLKSQFGVEVLGGEKIVL  120

Query  1044  MGGYSM-----IDESA--SVSPEVFQYDSCLNSWSKLASMNVARYDFACAEVNGMVYAVG  886
             +GGY+      ID +   S S +V+++D   NSW KLA MNV R +FA A V+G++Y + 
Sbjct  121   VGGYAEAEGFPIDGTTRISASADVYEFDPASNSWRKLAGMNVPRREFAFAVVDGLLYVIR  180

Query  885   GNGVNGESLSCAEVYDPDTNKWRVIESLRRPRWGCFGCGFEGKLYVMGGRSSFTIGNSRF  706
             G   +GE L  +EVY+P+TN+W  ++    P    F   F                    
Sbjct  181   GFSSDGECLQSSEVYNPETNQWSFMDEC--PDRPDFHRAF--------------------  218

Query  705   VDVYNPERQSWCEMKNG-CVMVTAHAVVGKKLFCIEWKNQRK---LGIFNPEDNSWKMVG  538
                ++ + ++W E+ +G  + V ++ VV  K++  +  +  K   LG+F+PE+NSW  V 
Sbjct  219   --AFSFKTETWEELDSGQSLSVYSYTVVRNKVYFFDHNSDYKKPELGVFDPEENSWSSVS  276

Query  537   VPVTGSSSIGFRLGILDEKLLLFSLQENPTYTTLLYDPNAAAGSEWQTCEIKPSGSCLCS  358
             VP +   +   ++G  + K++L S        TL+ D +    S+W+   IKPSGS    
Sbjct  277   VPRS-PGAYWCKVGEWNNKVILVSPLGG---RTLIRDLDKENASKWRDTHIKPSGSNPTI  332

Query  357   VTI  349
             V I
Sbjct  333   VLI  335



>emb|CDY46415.1| BnaA08g20150D [Brassica napus]
Length=1189

 Score =   189 bits (480),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 107/299 (36%), Positives = 172/299 (58%), Gaps = 17/299 (6%)
 Frame = -1

Query  1356  LLPGLPDDVAKYCLALVPRYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWLYVLTV  1177
             L+PGL DDVA+ CL+ +PR  F  +  V  RWR F+RS+ +  VRKL   +EE + VL  
Sbjct  5     LIPGLMDDVAELCLSRIPRSSFQIISQVCSRWRRFLRSERYAAVRKLTGSVEELMCVLQD  64

Query  1176  DADGKESHWEVLDCLGHKHHQLPQMPAPIRAGFGVAVLNAKLLVM--GGYSMIDESASVS  1003
             D      + EV DC G+K  ++P +P  +++G G+A L+   +V   G Y   +   + S
Sbjct  65    D-----QYCEVFDCSGNKLGRMPPVPGLLKSGSGLATLDGGNIVFIGGKYHEGEYDNAAS  119

Query  1002  PEVFQYDSCLNSWSKLASMNVARYDFACAEVNGMVYAVGGNGVNGESLSCAEVYDPDTNK  823
              +V++++   N W KLA MN+ RY+F  A V+G++Y + G    G+ L   EVY+P TNK
Sbjct  120   ADVYEFNPATNRWRKLADMNIPRYNFGYAVVDGLLYVIRGFTSYGDKLLSLEVYNPKTNK  179

Query  822   WRVIESLRRPRWGC-FGCGFEGKLYVMGGRSSFTIGNSRFVDVYNPERQSWCEMKNGCVM  646
             W +++   RP   C F   F+ KL+V    SS       F+D+Y+P+ ++W ++ +G  +
Sbjct  180   WSLMDCPYRPTSSCAFAFSFKSKLFVADSGSS-------FIDIYDPKMETWDQLDSGQEL  232

Query  645   -VTAHAVVGKKLFCIEWKNQRKLGIFNPEDNSWKMVGVPVTGSSSIGFRLGILDEKLLL  472
              V + AV+  K++ ++  N   +G+F+PE NSW  V VP      + F LG ++ K++L
Sbjct  233   WVYSCAVIRNKVYLLKIFNS-GMGVFDPEKNSWSSVSVPPFNGHELMFILGQMNNKVIL  290



>ref|NP_001183399.1| uncharacterized protein LOC100501817 [Zea mays]
 gb|ACR36649.1| unknown [Zea mays]
 gb|AFW71519.1| hypothetical protein ZEAMMB73_686872 [Zea mays]
Length=184

 Score =   163 bits (412),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 82/159 (52%), Positives = 101/159 (64%), Gaps = 1/159 (1%)
 Frame = -1

Query  1437  MNLDNPGHSKNISYFTSSVVVDDSYSPLLPGLPDDVAKYCLALVPRYYFPAMGGVNKRWR  1258
             M L  P   K  S       +D  Y  L+PGLP+D+AK CLALVPR +FPAMG V+KRW 
Sbjct  1     MQLKPPARPKLYSGLMPQEDLD-PYRDLIPGLPEDLAKICLALVPRAHFPAMGAVSKRWM  59

Query  1257  SFIRSKEFIMVRKLACLLEEWLYVLTVDADGKESHWEVLDCLGHKHHQLPQMPAPIRAGF  1078
             SF+ SKE + VRK    LEEW+YVL  DA  K SHWE+L+C G K   LP+MP   +AGF
Sbjct  60    SFLESKELVAVRKEVGKLEEWVYVLVPDAGAKGSHWEILECSGQKQSPLPRMPGLTKAGF  119

Query  1077  GVAVLNAKLLVMGGYSMIDESASVSPEVFQYDSCLNSWS  961
             GV V+  KL V+ GY+        S EV+QYDSCLN ++
Sbjct  120   GVVVIGGKLFVIAGYAADHGKDCASDEVYQYDSCLNRYA  158



>gb|AEW07498.1| hypothetical protein 0_2970_01, partial [Pinus radiata]
 gb|AFG48223.1| hypothetical protein 0_2970_01, partial [Pinus taeda]
 gb|AFG48224.1| hypothetical protein 0_2970_01, partial [Pinus taeda]
 gb|AFG48225.1| hypothetical protein 0_2970_01, partial [Pinus taeda]
 gb|AFG48227.1| hypothetical protein 0_2970_01, partial [Pinus taeda]
 gb|AFG48228.1| hypothetical protein 0_2970_01, partial [Pinus taeda]
 gb|AFG48229.1| hypothetical protein 0_2970_01, partial [Pinus taeda]
 gb|AFG48230.1| hypothetical protein 0_2970_01, partial [Pinus taeda]
 gb|AFG48231.1| hypothetical protein 0_2970_01, partial [Pinus taeda]
 gb|AFG48232.1| hypothetical protein 0_2970_01, partial [Pinus taeda]
 gb|AFG48233.1| hypothetical protein 0_2970_01, partial [Pinus taeda]
 gb|AFG48234.1| hypothetical protein 0_2970_01, partial [Pinus taeda]
 gb|AFG48235.1| hypothetical protein 0_2970_01, partial [Pinus taeda]
 gb|AFG48236.1| hypothetical protein 0_2970_01, partial [Pinus taeda]
 gb|AFG48237.1| hypothetical protein 0_2970_01, partial [Pinus taeda]
 gb|AFG48238.1| hypothetical protein 0_2970_01, partial [Pinus taeda]
 gb|AFG48239.1| hypothetical protein 0_2970_01, partial [Pinus taeda]
Length=139

 Score =   161 bits (407),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 80/137 (58%), Positives = 101/137 (74%), Gaps = 0/137 (0%)
 Frame = -1

Query  1077  GVAVLNAKLLVMGGYSMIDESASVSPEVFQYDSCLNSWSKLASMNVARYDFACAEVNGMV  898
             G  V++ KL+V+GG      SA  S + + YD  LN WS LA MNVAR++FAC+ V+ +V
Sbjct  1     GFVVIDEKLMVIGGLVDNGYSAEASADTYSYDPILNRWSLLAKMNVARFEFACSVVDDLV  60

Query  897   YAVGGNGVNGESLSCAEVYDPDTNKWRVIESLRRPRWGCFGCGFEGKLYVMGGRSSFTIG  718
             YA+GG+G  GE LS  EV+D   NKW +IESL+RPRWGCF CG E KLYVMGGRSSFTIG
Sbjct  61    YAIGGHGAGGEGLSSVEVFDRQRNKWTLIESLKRPRWGCFACGLEDKLYVMGGRSSFTIG  120

Query  717   NSRFVDVYNPERQSWCE  667
             NSR+VD+Y+P++  W E
Sbjct  121   NSRYVDIYDPKKHVWNE  137



>gb|AFG48226.1| hypothetical protein 0_2970_01, partial [Pinus taeda]
Length=139

 Score =   160 bits (404),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 80/137 (58%), Positives = 100/137 (73%), Gaps = 0/137 (0%)
 Frame = -1

Query  1077  GVAVLNAKLLVMGGYSMIDESASVSPEVFQYDSCLNSWSKLASMNVARYDFACAEVNGMV  898
             G  V++ KL+V+GG      SA  S + + YD  LN WS LA MNVAR++FAC+ V  +V
Sbjct  1     GFVVIDEKLMVIGGLVDNGYSAEASADTYSYDPILNRWSLLAKMNVARFEFACSVVGDLV  60

Query  897   YAVGGNGVNGESLSCAEVYDPDTNKWRVIESLRRPRWGCFGCGFEGKLYVMGGRSSFTIG  718
             YA+GG+G  GE LS  EV+D   NKW +IESL+RPRWGCF CG E KLYVMGGRSSFTIG
Sbjct  61    YAIGGHGAGGEGLSSVEVFDRQRNKWTLIESLKRPRWGCFACGLEDKLYVMGGRSSFTIG  120

Query  717   NSRFVDVYNPERQSWCE  667
             NSR+VD+Y+P++  W E
Sbjct  121   NSRYVDIYDPKKHVWNE  137



>emb|CDY15707.1| BnaA07g08780D [Brassica napus]
Length=353

 Score =   160 bits (405),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 86/244 (35%), Positives = 138/244 (57%), Gaps = 22/244 (9%)
 Frame = -1

Query  1377  VDDSYSPLLPGLPDDVAKYCLALVPRYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEE  1198
             +++S + ++PGL DDVA  CL+ +PR  F  +  V +RW++F+RS+ F  VRKL   +EE
Sbjct  1     MEESSTSIIPGLTDDVAALCLSRIPRSNFRVLSQVCRRWKTFLRSEHFAAVRKLTGTMEE  60

Query  1197  WLYVLTVDADGKESHWEVLDCLGHKHHQLPQMPAPIRAGFGVAVLNA-KLLVMGGYSMID  1021
             ++ V      G++ +WEV D  G+   Q+P  P P++ GF VAV+   K+L +GGY+ + 
Sbjct  61    FMCVFMKSIRGRKVYWEVFDSSGNNLGQIPPFPGPLKRGFCVAVIGGEKILFIGGYTGMK  120

Query  1020  --ESASVSP----EVFQYDSCLNSWSKLASMNVARYDFACAEVNGMVYAVGGNGVNGESL  859
               + + + P    ++ ++     SW KLA MN+ RYDF+ AEV+G++Y V G   +G  L
Sbjct  121   YWDFSRIPPIASGDINEFSLSTKSWRKLADMNIPRYDFSLAEVDGLLYVVQGFSNDGYCL  180

Query  858   SCAEVYDPDTNKWRVIESLRRPRWGCFGCGFEGKLYVMGGRSSFTIGNSRFVDVYNPERQ  679
                EVY+P TN+W +++       G F   F+ KLY +               V++PE  
Sbjct  181   FNTEVYNPQTNQWSLMDGPVAFPIGGFAFSFKSKLYAV---------------VFDPEEN  225

Query  678   SWCE  667
             SW +
Sbjct  226   SWTD  229



>ref|XP_004243661.1| PREDICTED: F-box/kelch-repeat protein At1g16250 [Solanum lycopersicum]
Length=382

 Score =   139 bits (349),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 85/246 (35%), Positives = 124/246 (50%), Gaps = 16/246 (7%)
 Frame = -1

Query  1362  SPLLPGLPDDVAKYCLALVPRYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWLYVL  1183
              PL+PGLPDD+A  CLA++   Y   +  V++RWR    S E+   +        WL+VL
Sbjct  6     QPLIPGLPDDLALRCLAMISHGYHGILETVSRRWRKLFHSAEYSNYKAREGWSGNWLFVL  65

Query  1182  TVDADGKESHWEVLDCLGHKHHQLPQMPA--PIRAGFGVA---VLNAKLLVMGGYSMIDE  1018
             T    G E+ W   D    + H LP++P   P +   G +   VLN  LL+ G Y   D+
Sbjct  66    T---GGSENQWVAYDPEADRWHPLPRIPTSHPDQEHLGFSCACVLNKFLLIGGTYGARDQ  122

Query  1017  -----SASVSPEVFQYDSCLNSWSKLASMNVARYDFACAEVNGMVYAVGG-NGVNGESLS  856
                  +A  + EVFQ+D     W  +ASM  AR +FAC+ V+G VY  GG N  +G  L 
Sbjct  123   VIPHQTALTTNEVFQFDPFRKEWRNVASMRTARSNFACSVVSGKVYVAGGRNTSSGGGLV  182

Query  855   CAEVYDPDTNKWRVIESLRRPRWGCFGCGFEGKLYVMGGRSSFTIGNSRFVDVYNPERQS  676
              AEVY+P T+KW  +  L  P+  C G  + GK YV+          +    V++P  ++
Sbjct  183   LAEVYNPLTDKWEDLPPLPSPQMDCIGLPYNGKFYVLTDLVGLLEQETSV--VFDPSDET  240

Query  675   WCEMKN  658
             W  + +
Sbjct  241   WLSVND  246



>ref|XP_002315479.2| kelch repeat-containing F-box family protein [Populus trichocarpa]
 gb|EEF01650.2| kelch repeat-containing F-box family protein [Populus trichocarpa]
Length=383

 Score =   139 bits (349),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 81/247 (33%), Positives = 125/247 (51%), Gaps = 16/247 (6%)
 Frame = -1

Query  1365  YSPLLPGLPDDVAKYCLALVPRYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWLYV  1186
             + P++PGLPDD+A  CLA V   Y   +  V+KRWR  IRS ++   R       +WL+V
Sbjct  2     HQPIIPGLPDDLALRCLAKVSHGYHGLLESVSKRWRDMIRSADYARYRAKQGCCGDWLFV  61

Query  1185  LTVDADGKESHWEVLDCLGHKHHQLPQMPAPI--RAGFG---VAVLNAKLLVMGGYSMID  1021
             LT  ++ +   W   D    + H LP++      R  FG   V V N  L++ G Y+ +D
Sbjct  62    LTEQSNNQ---WVAFDPEADRWHPLPKVSGDCADRQHFGFSCVCVYNRLLVIGGSYAPLD  118

Query  1020  ESA-----SVSPEVFQYDSCLNSWSKLASMNVARYDFACAEVNGMVYAVGGNGVN-GESL  859
              S       ++  V Q+D     W+ +A M   R  FAC+ + G VY  GG  ++  + L
Sbjct  119   SSVLIQRPLITDNVLQFDPFKKQWTSVARMRTPRSHFACSVIAGKVYVAGGRNLSCTKGL  178

Query  858   SCAEVYDPDTNKWRVIESLRRPRWGCFGCGFEGKLYVMGGRSSFTIGNSRFVDVYNPERQ  679
             + AEVYDP T+KW  +  +  P   C G  ++GK +V+  +   +  N     V+NP   
Sbjct  179   ALAEVYDPLTDKWEELPPMPAPLMDCLGLSYKGKFHVLSDQVGLSETN--ITHVFNPSIN  236

Query  678   SWCEMKN  658
             +WC M++
Sbjct  237   TWCTMED  243



>ref|XP_004150018.1| PREDICTED: F-box/kelch-repeat protein At1g55270-like [Cucumis 
sativus]
 ref|XP_004167918.1| PREDICTED: F-box/kelch-repeat protein At1g55270-like [Cucumis 
sativus]
 gb|KGN65315.1| hypothetical protein Csa_1G320320 [Cucumis sativus]
Length=428

 Score =   139 bits (351),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 96/277 (35%), Positives = 127/277 (46%), Gaps = 14/277 (5%)
 Frame = -1

Query  1362  SPLLPGLPDDVAKYCLALVPRYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWLYVL  1183
             SPLLPGLPDD+A  CL  VPR     +  V KRW   +    F  +RK   + EEW+YV+
Sbjct  65    SPLLPGLPDDLAIACLIRVPRVEHRKLRLVCKRWYRLLAGNFFYSLRKSLGVAEEWIYVI  124

Query  1182  TVDADGKESHWEVLDCLGHKHHQLPQMPAPIRA--GFGVAVLNA-KLLVMGGYSMIDESA  1012
               D D K S W   D +      LP +P       GFG AVL+   L V GG   I  + 
Sbjct  125   KRDRDNKIS-WHAFDPVYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYVFGGRDPIKGTM  183

Query  1011  SVSPEVFQYDSCLNSWSKLASMNVARYDFACAEVNGMVYAVGGNGVNGE-SLSCAEVYDP  835
                  V  Y +  N W +   M   R+ F    +N  +Y  GG    G  SL  AEVYDP
Sbjct  184   R---RVIFYSARTNKWHRAPDMLRRRHVFGSCVINNCLYVAGGENEGGHRSLKSAEVYDP  240

Query  834   DTNKWRVIESLRRPRWGCFGCGFEGKLYVMGGRSSFTIGNSRFVDVYNPERQSWCEMKNG  655
             + N+W  I  +  P     G  +EGK Y+ G    F        DVY PE  SWC + +G
Sbjct  241   NKNRWTFISDMSTPMVPIIGVVYEGKWYLKG----FGAQRQVLSDVYQPETDSWCSVYDG  296

Query  654   CVM--VTAHAVVGKKLFCIEWKNQRKLGIFNPEDNSW  550
              V         +   L+ ++ K+  KL +++   NSW
Sbjct  297   MVAGWRNPSVSLNGHLYSVDCKDGCKLRVYDEVSNSW  333



>ref|XP_010999347.1| PREDICTED: F-box/kelch-repeat protein At1g16250 [Populus euphratica]
Length=385

 Score =   139 bits (349),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 80/247 (32%), Positives = 126/247 (51%), Gaps = 16/247 (6%)
 Frame = -1

Query  1365  YSPLLPGLPDDVAKYCLALVPRYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWLYV  1186
             + P++PGLPDD+A  CL+ V   Y   +  V+KRWR  IRS ++   R       +WL+V
Sbjct  2     HQPIIPGLPDDLALRCLSKVSHGYHGLLESVSKRWRDMIRSADYARYRAKQGCCGDWLFV  61

Query  1185  LTVDADGKESHWEVLDCLGHKHHQLPQMPAPI--RAGFG---VAVLNAKLLVMGGYSMID  1021
             LT  ++   + W   D    + H LP++      R  FG   V V N  L++ G Y+ +D
Sbjct  62    LTEQSN---NQWVAFDPEADRWHPLPKVSGDCADRQHFGFSCVCVYNRLLVIGGSYAPLD  118

Query  1020  ESA-----SVSPEVFQYDSCLNSWSKLASMNVARYDFACAEVNGMVYAVGGNGVN-GESL  859
              S       ++  V Q+D     W+ +A M   R  FAC+ ++G VY  GG  ++  + L
Sbjct  119   SSVLIQRPLITDNVLQFDPFKKQWTNVARMRTPRSHFACSVISGKVYVAGGRNLSCTKGL  178

Query  858   SCAEVYDPDTNKWRVIESLRRPRWGCFGCGFEGKLYVMGGRSSFTIGNSRFVDVYNPERQ  679
             + AEVYDP T+KW  +  +  P   C G  ++GK +V+  +   +  N     V+NP   
Sbjct  179   ALAEVYDPLTDKWEELPPMPAPLMDCLGLSYKGKFHVLSDQVGLSETN--ITQVFNPSIN  236

Query  678   SWCEMKN  658
             +WC M++
Sbjct  237   TWCTMED  243



>ref|XP_008444019.1| PREDICTED: F-box/kelch-repeat protein At1g55270-like [Cucumis 
melo]
Length=428

 Score =   138 bits (347),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 95/277 (34%), Positives = 127/277 (46%), Gaps = 14/277 (5%)
 Frame = -1

Query  1362  SPLLPGLPDDVAKYCLALVPRYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWLYVL  1183
             SPLLPGLPDD+A  CL  VPR     +  V KRW   +    F  +RK   + EEW+YV+
Sbjct  65    SPLLPGLPDDLAIACLIRVPRVEHRKLRLVCKRWYRLLAGNFFYSLRKSLGVAEEWIYVI  124

Query  1182  TVDADGKESHWEVLDCLGHKHHQLPQMPAPIRA--GFGVAVLNA-KLLVMGGYSMIDESA  1012
               D D K S W   D +      LP +P       GFG AVL+   L + GG   I  + 
Sbjct  125   KRDRDNKIS-WHAFDPVYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGRDPIKGTM  183

Query  1011  SVSPEVFQYDSCLNSWSKLASMNVARYDFACAEVNGMVYAVGGNGVNGE-SLSCAEVYDP  835
                  V  Y +  N W +   M   R+ F    +N  +Y  GG    G  SL  AEVYDP
Sbjct  184   R---RVIFYSARTNKWHRAPDMLRRRHVFGSCVINNCLYVAGGENEGGHRSLKSAEVYDP  240

Query  834   DTNKWRVIESLRRPRWGCFGCGFEGKLYVMGGRSSFTIGNSRFVDVYNPERQSWCEMKNG  655
             + N+W  I  +  P     G  +EGK Y+ G    F        DVY PE  SWC + +G
Sbjct  241   NKNRWTFISDMSTPMVPIIGVVYEGKWYLKG----FGAQRQVLSDVYQPETDSWCPVYDG  296

Query  654   CVM--VTAHAVVGKKLFCIEWKNQRKLGIFNPEDNSW  550
              V         +   L+ ++ K+  KL +++   NSW
Sbjct  297   MVAGWRNPSVSLNGHLYSVDCKDGCKLRVYDEVSNSW  333



>ref|XP_006353737.1| PREDICTED: F-box/kelch-repeat protein At1g16250-like isoform 
X2 [Solanum tuberosum]
Length=382

 Score =   137 bits (345),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 83/246 (34%), Positives = 124/246 (50%), Gaps = 16/246 (7%)
 Frame = -1

Query  1362  SPLLPGLPDDVAKYCLALVPRYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWLYVL  1183
              PL+PGLPDD+A  CLA++   Y   +  V++RWR    S E+   +        WL+VL
Sbjct  6     QPLIPGLPDDLALRCLAMISHGYHGILETVSRRWRKLFHSAEYSNYKAREGWSGNWLFVL  65

Query  1182  TVDADGKESHWEVLDCLGHKHHQLPQMPA--PIRAGFGVA---VLNAKLLVMGGYSMIDE  1018
             T      E+ W   D    + H LP++P   P +   G +   VLN  LL+ G Y   D+
Sbjct  66    T---GASENQWVAYDPEADRWHPLPRIPTSHPDQEHLGFSCACVLNKFLLIGGTYGARDQ  122

Query  1017  -----SASVSPEVFQYDSCLNSWSKLASMNVARYDFACAEVNGMVYAVGG-NGVNGESLS  856
                  +A  + EVFQ+D     W  +ASM  AR  FAC+ V+G VY  GG N  +G  L+
Sbjct  123   VIPHQTALTTNEVFQFDPFRKEWRNVASMRTARSHFACSVVSGKVYVAGGRNTSSGGGLA  182

Query  855   CAEVYDPDTNKWRVIESLRRPRWGCFGCGFEGKLYVMGGRSSFTIGNSRFVDVYNPERQS  676
              AEVY+P T++W  +  L  P+  C G  ++GK YV+          +    V++P  ++
Sbjct  183   LAEVYNPLTDRWEDLPPLPSPQMDCIGLPYDGKFYVLTDLVGLLEHETSV--VFDPSDET  240

Query  675   WCEMKN  658
             W  + +
Sbjct  241   WLSVND  246



>ref|XP_006353736.1| PREDICTED: F-box/kelch-repeat protein At1g16250-like isoform 
X1 [Solanum tuberosum]
Length=396

 Score =   137 bits (345),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 83/246 (34%), Positives = 124/246 (50%), Gaps = 16/246 (7%)
 Frame = -1

Query  1362  SPLLPGLPDDVAKYCLALVPRYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWLYVL  1183
              PL+PGLPDD+A  CLA++   Y   +  V++RWR    S E+   +        WL+VL
Sbjct  20    QPLIPGLPDDLALRCLAMISHGYHGILETVSRRWRKLFHSAEYSNYKAREGWSGNWLFVL  79

Query  1182  TVDADGKESHWEVLDCLGHKHHQLPQMPA--PIRAGFGVA---VLNAKLLVMGGYSMIDE  1018
             T      E+ W   D    + H LP++P   P +   G +   VLN  LL+ G Y   D+
Sbjct  80    T---GASENQWVAYDPEADRWHPLPRIPTSHPDQEHLGFSCACVLNKFLLIGGTYGARDQ  136

Query  1017  -----SASVSPEVFQYDSCLNSWSKLASMNVARYDFACAEVNGMVYAVGG-NGVNGESLS  856
                  +A  + EVFQ+D     W  +ASM  AR  FAC+ V+G VY  GG N  +G  L+
Sbjct  137   VIPHQTALTTNEVFQFDPFRKEWRNVASMRTARSHFACSVVSGKVYVAGGRNTSSGGGLA  196

Query  855   CAEVYDPDTNKWRVIESLRRPRWGCFGCGFEGKLYVMGGRSSFTIGNSRFVDVYNPERQS  676
              AEVY+P T++W  +  L  P+  C G  ++GK YV+          +    V++P  ++
Sbjct  197   LAEVYNPLTDRWEDLPPLPSPQMDCIGLPYDGKFYVLTDLVGLLEHETSV--VFDPSDET  254

Query  675   WCEMKN  658
             W  + +
Sbjct  255   WLSVND  260



>ref|XP_001771339.1| predicted protein [Physcomitrella patens]
 gb|EDQ63899.1| predicted protein [Physcomitrella patens]
Length=359

 Score =   136 bits (343),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 95/299 (32%), Positives = 147/299 (49%), Gaps = 9/299 (3%)
 Frame = -1

Query  1362  SPLLPGLPDDVAKYCLALVPRYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWLYVL  1183
             + L+PGLP+D+A  CLA VPR +  ++  V K WR+ I S+ +  +RK   L E W+Y  
Sbjct  18    TSLIPGLPNDLALQCLARVPRRHHLSLRCVCKEWRNMIASEYYYSLRKRLKLTEGWIYAF  77

Query  1182  TVDADGKESHWEVLDCLGHKHHQLPQMPAPIRAGFGV--AVLNAKLLVMGGYSMIDESAS  1009
             + D   +  HW VLD +     +LP MP      +GV  +V+  +L VMGG         
Sbjct  78    SRDYF-ECLHWHVLDPVTRLWKELPSMPGDCLRRYGVTCSVVERELYVMGGGGKFHVP--  134

Query  1008  VSPEVFQYDSCLNSWSKLASMNVARYDFACAEVNGMVYAVGGNGVNGESLSCAEVYDPDT  829
              SPEV++YD   N W++ A+M  AR  F    +NG +YAVGG GV   +L+  EV++P+T
Sbjct  135   -SPEVYKYDPVKNEWTEAAAMETARCYFVSGALNGRLYAVGGMGVTSSALTSWEVFNPET  193

Query  828   NKWRVIESLRRPRWGCFGCGFEGKLYVMGGRSSFTIGNSRFVDVYNPERQSWCEMKNGCV  649
             N+W   E              +GK+YV    +      S +  V++P   SW  + N  +
Sbjct  194   NEWFFREDPNVVSDLGESLVMDGKIYVRHVSACPGYMGS-YAAVFDPVESSWAAVDNDMM  252

Query  648   M--VTAHAVVGKKLFCIEWKNQRKLGIFNPEDNSWKMVGVPVTGSSSIGFRLGILDEKL  478
                    AV G  ++ ++     KL + + E   W  +G     S  +  RL  +++ L
Sbjct  253   KKWCGPTAVTGNDVYMLDQSFGIKLMVLDKESGEWGRIGRFSPHSIRLPCRLAAIEKNL  311



>ref|XP_002446276.1| hypothetical protein SORBIDRAFT_06g012285 [Sorghum bicolor]
 gb|EES10604.1| hypothetical protein SORBIDRAFT_06g012285 [Sorghum bicolor]
Length=91

 Score =   127 bits (320),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 57/82 (70%), Positives = 65/82 (79%), Gaps = 0/82 (0%)
 Frame = -1

Query  798  RPRWGCFGCGFEGKLYVMGGRSSFTIGNSRFVDVYNPERQSWCEMKNGCVMVTAHAVVGK  619
            +P  GCFGCGF  KLY+MGGRSSFTIGN+R V+VY P   +W E+  GCVMVT+HAV+GK
Sbjct  10   QPMSGCFGCGFNDKLYIMGGRSSFTIGNTRSVNVYEPNLHTWEELNRGCVMVTSHAVLGK  69

Query  618  KLFCIEWKNQRKLGIFNPEDNS  553
             LFCIEWKNQR L  FNP DNS
Sbjct  70   SLFCIEWKNQRSLATFNPADNS  91



>gb|ABK27009.1| unknown [Picea sitchensis]
Length=369

 Score =   134 bits (338),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 96/305 (31%), Positives = 149/305 (49%), Gaps = 16/305 (5%)
 Frame = -1

Query  1434  NLDNPGH-SKNISYFTSSVVVDDSYSPLLPGLPDDVAKYCLALVPRYYFPAMGGVNKRWR  1258
             +LDN  H  K    + S     D+ S L+PGLP D+   CLA VPR     +  V+K+WR
Sbjct  8     DLDNALHFEKTRGQYDSDF--GDTDSELIPGLPHDIGILCLARVPRRDHQLLKCVSKKWR  65

Query  1257  SFIRSKEFIMVRKLACLLEEWLYVLTVDADGKESHWEVLDCLGHKHHQLPQMPAPIRAGF  1078
              FI S+ +   ++L  + + W+Y +  D+  +  H  VLD    K  +LP +P      F
Sbjct  66    DFISSELYFYRQRLG-IADGWIYAVCRDS-SECVHCYVLDPARRKWKKLPGLPYACSKRF  123

Query  1077  GVA--VLNAKLLVMGGYSMIDESASVSPEVFQYDSCLNSWSKLASMNVARYDFACAEVNG  904
             G+   VL  KL ++GG    +++ +   EV+ YD  LN W  +A+M  AR+ F     +G
Sbjct  124   GMTCEVLGRKLYLLGGCGWTEDATN---EVYCYDPLLNKWENVANMETARFHFVSGASDG  180

Query  903   MVYAVGGNGVNGESLSCAEVYDPDTNKWRVIESLR-RPRWGCFGCGFEGKLYVMGGRSSF  727
              +YA+GG G N E+L+  E YD + NKW   E L   P  G     F+ ++Y+     S 
Sbjct  181   CLYAIGGMGSNSEALTSWETYDSEANKWTSHEDLNILPDLG-ESLAFDSRIYIR--HIST  237

Query  726   TIGNSRFVDVYNPERQSWCEMKNGCVM--VTAHAVVGKKLFCIEWKNQRKLGIFNPEDNS  553
              +  + +  VY+     W  + N   M       VVG  ++ ++     KL + + E+ S
Sbjct  238   NVFPATYAAVYDTSNDVWSPVDNEMTMNWCGPAIVVGDDVYMLDQTAGIKLMMLDKENQS  297

Query  552   WKMVG  538
             W  VG
Sbjct  298   WVSVG  302



>ref|XP_006836439.1| hypothetical protein AMTR_s00092p00167170 [Amborella trichopoda]
 gb|ERM99292.1| hypothetical protein AMTR_s00092p00167170 [Amborella trichopoda]
Length=416

 Score =   135 bits (339),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 93/286 (33%), Positives = 134/286 (47%), Gaps = 11/286 (4%)
 Frame = -1

Query  1365  YSPLLPGLPDDVAKYCLALVPRYYFPAMGGVNKRWRSFIRSKE-FIMVRKLACLLEEWLY  1189
             + PL+PGLPDD+A  CL  +P +  P    V KRWRS + +KE F  +R+   L+E WL+
Sbjct  49    FLPLIPGLPDDIALNCLLRIPVHAHPLCRPVCKRWRSLLLNKETFFTLRRQLGLVEPWLF  108

Query  1188  VLTVDADGKESHWEVLDCLGHKHHQLPQMPAPIRA---GFGVAVLNAK--LLVMGGYSMI  1024
             V +      +  W+VLD +    H LP MP   R    GFG   ++ +  L V GG  M+
Sbjct  109   VFSFHRCTGKIQWQVLDLVRLCWHTLPSMPCKDRVCPPGFGCIAMSEQGALYVCGG--ML  166

Query  1023  DESASVSPEVFQYDSCLNSWSKLASMNVARYDFACAEVNGMVYAVGGNGVNGESLSCAEV  844
              +       V +Y+   N W+ +  M   R  FA   +NG +YA GGN  +   L+ AEV
Sbjct  167   SDIDCPMDRVLKYEVHRNRWTVMNHMLTPRSFFASGMINGRIYAAGGNSTDLFELNSAEV  226

Query  843   YDPDTNKWRVIESLRRPRWGCFGCGFEGKLYVMGGRSSFTIGNSRFVDVYNPERQSWCEM  664
             +DP    WR I  +            + KLYV  G   +    S    VY+PE   W  M
Sbjct  227   FDPMKGYWRSIAKMGANMASYDAAVLDAKLYVTEG-WLWPFSFSPRGQVYDPETDKWETM  285

Query  663   KNGCV--MVTAHAVVGKKLFCIEWKNQRKLGIFNPEDNSWKMVGVP  532
               G       A  V+   LF +    + +L +++ E +SW  V  P
Sbjct  286   AAGMTEGWTGASLVLHGHLFVVSEHERMRLKVYDVESDSWDAVDGP  331



>ref|XP_009793941.1| PREDICTED: F-box/kelch-repeat protein At1g16250 [Nicotiana sylvestris]
Length=386

 Score =   134 bits (337),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 80/252 (32%), Positives = 125/252 (50%), Gaps = 16/252 (6%)
 Frame = -1

Query  1380  VVDDSYSPLLPGLPDDVAKYCLALVPRYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLE  1201
             +++ ++ P++PGLPDD+A  CLA++   Y   +  V + WR    S E+   +       
Sbjct  4     LMETTHQPIIPGLPDDLALRCLAMISHGYHGILETVCRGWRKLCHSAEYSNYKAREGWCG  63

Query  1200  EWLYVLTVDADGKESHWEVLDCLGHKHHQLPQMPAP----IRAGFGVAVLNAKLLVMGG-  1036
              WL+VLT   +G E+ W   D    + H LP++P         GF  A ++ K L++GG 
Sbjct  64    NWLFVLT---EGSENQWIAYDPEADRWHPLPRVPTSHPDQKHLGFSCACVSNKFLLIGGS  120

Query  1035  YSMID-----ESASVSPEVFQYDSCLNSWSKLASMNVARYDFACAEVNGMVYAVGGNGVN  871
             Y   D     + A  + EVFQ+D     W ++ASM   R  FAC+ V+G VY  GG   +
Sbjct  121   YEPSDQVFSRQKALTTNEVFQFDPFRKEWRRVASMKTPRSHFACSVVSGKVYVAGGRDTS  180

Query  870   GE-SLSCAEVYDPDTNKWRVIESLRRPRWGCFGCGFEGKLYVMGGRSSFTIGNSRFVDVY  694
                 L+  EVY+P T+KW  +  L  P+  C G  FEGK YV+          +    V+
Sbjct  181   SRGGLAFVEVYNPLTDKWEDLPPLPSPQMDCIGLSFEGKFYVLTDLVGLLEQETSV--VF  238

Query  693   NPERQSWCEMKN  658
             +P  ++W  + +
Sbjct  239   DPSDETWVSVDD  250



>ref|XP_008776459.1| PREDICTED: F-box/kelch-repeat protein At1g16250 [Phoenix dactylifera]
Length=374

 Score =   133 bits (334),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 76/243 (31%), Positives = 122/243 (50%), Gaps = 9/243 (4%)
 Frame = -1

Query  1374  DDSYSPLLPGLPDDVAKYCLALVPRYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEW  1195
             D  Y  ++PGLPDD+A  CLA +   Y   +  ++++WR  IRS ++  ++        W
Sbjct  9     DREYQAIIPGLPDDLALRCLARISHGYHGLLECISRKWRDAIRSMDYAHMKARHERCGNW  68

Query  1194  LYVLTVDADGKESHWEVLDCLGHKHHQLPQMPAPIR---AGFGVAVLNAKLLVMGGYSMI  1024
             L+V T D  G+   W+  D    + H LP +P        GF    +  K LV+GG  + 
Sbjct  69    LFVSTADGKGQ---WDAYDPDADRWHPLPTVPTDCDESFCGFSCVSVCKKFLVIGGCYLY  125

Query  1023  DESASVSPEVFQYDSCLNSWSKLASMNVARYDFACAEVNGMVY-AVGGNGVNGESLSCAE  847
             ++ +    +V  +D     W + A+M  AR DFACA ++  VY A GGN    + LS  E
Sbjct  126   NKRSLAINDVILFDPFKKQWKRAANMQTARTDFACAVISNKVYVAGGGNSSCTKGLSSVE  185

Query  846   VYDPDTNKWRVIESLRRPRWGCFGCGFEGKLYVMGGRSSFTIGNSRFVDVYNPERQSWCE  667
             VYDP  ++W  +  +      CF   + G+ +V+G R  + I    ++ ++NP  Q WC 
Sbjct  186   VYDPCADRWEDLPPMPFTLIECFSISYGGQFHVLGKR-EYNIQQDTYL-IFNPVNQHWCI  243

Query  666   MKN  658
             M++
Sbjct  244   MED  246



>ref|XP_003609293.1| F-box/kelch-repeat protein [Medicago truncatula]
 gb|AES91490.1| galactose oxidase/kelch repeat protein [Medicago truncatula]
Length=442

 Score =   134 bits (337),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 96/280 (34%), Positives = 134/280 (48%), Gaps = 20/280 (7%)
 Frame = -1

Query  1362  SPLLPGLPDDVAKYCLALVPRYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWLYVL  1183
             SPLLPGLPDD+A  CL  VPR     +  V KRW   +    F  +RK   L EEW+YV+
Sbjct  79    SPLLPGLPDDLAIACLIRVPRVEHRKLRLVCKRWYRLLIGNFFYSLRKSLRLAEEWIYVI  138

Query  1182  TVDADGKESHWEVLDCLGHKHHQLPQMPAPIRA--GFGVAVLNA-KLLVMGGYSMIDESA  1012
               D DGK S W   D +  +   LP +P       GFG AVLN   L + GG   +  S 
Sbjct  139   KRDRDGKIS-WHAFDPVYQQWQPLPPVPKEYSGALGFGCAVLNGCHLYLFGGKDPLKGSM  197

Query  1011  SVSPEVFQYDSCLNSWSKLASMNVARYDFACAEVNGMVYAVGG--NGVNGESLSCAEVYD  838
                  V  Y +  N W +   M   R+ F    +N  +Y  GG   GV+  SL  AEVYD
Sbjct  198   R---RVIFYSTRTNKWHRAPDMLRRRHFFGSCVINNCLYVAGGENEGVH-RSLRSAEVYD  253

Query  837   PDTNKWRVIESLRRPRWGCFGCGFEGKLYVMGGRSSFTIGNSRFV--DVYNPERQSWCEM  664
             P+ N+W  I  +        G  ++GK ++ G      +G+ R V  +VY     SWC +
Sbjct  254   PNKNRWSFISDMSTAMVPFIGVVYDGKWFLKG------LGSHRQVLSEVYQLANDSWCPV  307

Query  663   KNGCVM--VTAHAVVGKKLFCIEWKNQRKLGIFNPEDNSW  550
             +NG +         +  KL+ +E K+  KL +++   +SW
Sbjct  308   QNGMISGWRNPSTTLNGKLYALECKDGCKLRVYDDATDSW  347



>ref|XP_004508512.1| PREDICTED: F-box/kelch-repeat protein At1g55270-like isoform 
X1 [Cicer arietinum]
 ref|XP_004508513.1| PREDICTED: F-box/kelch-repeat protein At1g55270-like isoform 
X2 [Cicer arietinum]
Length=428

 Score =   133 bits (334),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 97/280 (35%), Positives = 135/280 (48%), Gaps = 20/280 (7%)
 Frame = -1

Query  1362  SPLLPGLPDDVAKYCLALVPRYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWLYVL  1183
             SPLLPGLPDD+A  CL  VPR     +  V KRW   +    F  +RK   + EEW+YV+
Sbjct  65    SPLLPGLPDDLAIACLIRVPRVEHRKLRLVCKRWYRLLVGNFFYSLRKSLRISEEWIYVI  124

Query  1182  TVDADGKESHWEVLDCLGHKHHQLPQMPAPI--RAGFGVAVLNA-KLLVMGGYSMIDESA  1012
               D DGK S W   D +  +   LP +P       GFG AVLN   L + GG   +  S 
Sbjct  125   KRDRDGKIS-WHAFDPVYQQWQPLPPVPKEYFGALGFGCAVLNGCHLYLFGGKDPLKGSM  183

Query  1011  SVSPEVFQYDSCLNSWSKLASMNVARYDFACAEVNGMVYAVGG--NGVNGESLSCAEVYD  838
                  V  Y +  N W +   M   R+ F    +N  +Y  GG   GV+  SL  AEVYD
Sbjct  184   R---RVIFYSARTNKWHRAPDMLRRRHFFGSCVINNCLYVAGGENEGVH-RSLRSAEVYD  239

Query  837   PDTNKWRVIESLRRPRWGCFGCGFEGKLYVMGGRSSFTIGNSRFV--DVYNPERQSWCEM  664
             P+ N+W  I  +        G  ++GK ++ G      +G+ R V  +VY PE  SW  +
Sbjct  240   PNKNRWSFISDMSTAMVPFIGVVYDGKWFLQG------LGSHRQVLSEVYLPENDSWYPV  293

Query  663   KNGCVM--VTAHAVVGKKLFCIEWKNQRKLGIFNPEDNSW  550
              +G V       A +  KL+ ++ K+  KL +++   NSW
Sbjct  294   HDGMVSGWRNPSATLNGKLYALDCKDGCKLKVYDEATNSW  333



>ref|XP_009368827.1| PREDICTED: F-box/kelch-repeat protein At1g55270-like [Pyrus x 
bretschneideri]
 ref|XP_009368828.1| PREDICTED: F-box/kelch-repeat protein At1g55270-like [Pyrus x 
bretschneideri]
Length=428

 Score =   132 bits (332),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 102/321 (32%), Positives = 149/321 (46%), Gaps = 26/321 (8%)
 Frame = -1

Query  1482  GKKRVTELKMCFSDEMNLD-NPGHSKNISYFTSSVVVDDSYSPLLPGLPDDVAKYCLALV  1306
              KK V   K+C   ++    +P  SK +   +S +      SPLLPGLPDD+A  CL  V
Sbjct  29    AKKYVPGAKLCLQPDIKSSIHPTRSKPLRGESSRI-----QSPLLPGLPDDLAVACLVRV  83

Query  1305  PRYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWLYVLTVDADGKESHWEVLDCLGH  1126
             PR     +  V KRW   + +  F  +R+   + EEW+Y++  D +GK S W   D +  
Sbjct  84    PRVEHRKLRLVCKRWYRLLAANFFYSLRRNLGIAEEWIYLIKRDREGKVS-WHAFDPVYQ  142

Query  1125  KHHQLPQMPAPIRA--GFGVAVLNA-KLLVMGGYSMIDESASVSPEVFQYDSCLNSWSKL  955
                 LP +P    A  GFG AVL    L + GG   +  S      V  YD+  N W + 
Sbjct  143   LWQPLPPVPKEYSAALGFGCAVLGGCHLYLFGGKDPLKGSMR---RVIFYDARTNKWHRA  199

Query  954   ASMNVARYDFACAEVNGMVYAVGG--NGVNGESLSCAEVYDPDTNKWRVIESLRRPRWGC  781
               M   R+ F    +N  +Y  GG   G++  SL  AEVYDP+ N+W  I  +       
Sbjct  200   PDMLRRRHFFGSCVINNCLYVAGGENEGIH-RSLKSAEVYDPNKNRWSFISEMSTAMAPY  258

Query  780   FGCGFEGKLYVMGGRSSFTIGNSRFV--DVYNPERQSWCEMKNGCVM--VTAHAVVGKKL  613
              G  +EGK ++ G      +G+ R V  +VY PE  SW  + +G V         +   L
Sbjct  259   IGVIYEGKWFLKG------LGSHRQVLSEVYQPENDSWYSVYDGMVAGWRNPSVALNGHL  312

Query  612   FCIEWKNQRKLGIFNPEDNSW  550
             +  E K+  KL +++   +SW
Sbjct  313   YASECKDGCKLKVYDKATDSW  333



>ref|XP_007030057.1| Galactose oxidase/kelch repeat superfamily protein [Theobroma 
cacao]
 gb|EOY10559.1| Galactose oxidase/kelch repeat superfamily protein [Theobroma 
cacao]
Length=382

 Score =   131 bits (330),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 75/244 (31%), Positives = 121/244 (50%), Gaps = 17/244 (7%)
 Frame = -1

Query  1356  LLPGLPDDVAKYCLALVPRYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWLYVLTV  1177
             +LPGLPDD+A  CLA +   Y   +  V+KRWR  IRS E+   +     L +WL+V+T 
Sbjct  8     ILPGLPDDLALRCLAKLSHGYDGVLEAVSKRWRDLIRSSEYANYKANQGWLGDWLFVVT-  66

Query  1176  DADGKESHWEVLDCLGHKHHQLPQMPAPIRA----GFGVAVLNAKLLVMGG-YSMIDESA  1012
                 + + W   D      H LP++P         G     +  +LLV+GG Y+  D + 
Sbjct  67    ---ERSNQWVAYDRTADIWHPLPKIPTEYDGLQHFGMSSVCVGKRLLVIGGSYAPRDTAY  123

Query  1011  SVSP-----EVFQYDSCLNSWSKLASMNVARYDFACAEVNGMVYAVGG-NGVNGESLSCA  850
                P     +V Q+D     W++L SM   R  FAC  ++G VY  GG N  +   L+ A
Sbjct  124   PRQPPMITNDVLQFDPFKKQWARLTSMQTPRSHFACCVMSGKVYVAGGRNTAHPRGLALA  183

Query  849   EVYDPDTNKWRVIESLRRPRWGCFGCGFEGKLYVMGGRSSFTIGNSRFVDVYNPERQSWC  670
             EVYDP +++W  +  +  P+  C G  ++GK +V+       +      ++++P  ++WC
Sbjct  184   EVYDPISDRWEELPPMLNPQMDCLGISYKGKFHVLS--DQIGLAEQTPSEIFDPSNETWC  241

Query  669   EMKN  658
              + +
Sbjct  242   TVDD  245



>ref|XP_010688026.1| PREDICTED: F-box/kelch-repeat protein At1g55270-like isoform 
X2 [Beta vulgaris subsp. vulgaris]
 ref|XP_010688027.1| PREDICTED: F-box/kelch-repeat protein At1g55270-like isoform 
X2 [Beta vulgaris subsp. vulgaris]
Length=429

 Score =   132 bits (332),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 95/282 (34%), Positives = 137/282 (49%), Gaps = 20/282 (7%)
 Frame = -1

Query  1368  SYSPLLPGLPDDVAKYCLALVPRYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWLY  1189
             S SPLLPGLPDD+A  CL  VPR     +  V KRW   +    F  +R+   + EEW+Y
Sbjct  63    SQSPLLPGLPDDLAIACLIRVPRVEHRNLRLVCKRWYRLLAGNFFYSLRRSLGIAEEWVY  122

Query  1188  VLTVDADGKESHWEVLDCLGHKHHQLPQMPAPIRA--GFGVAVLNA-KLLVMGGYSMIDE  1018
             V+  D DGK S W   D +      LP +P       GFG AVL+   L + GG   +  
Sbjct  123   VIKRDRDGKIS-WHAFDPVYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGKHPLKG  181

Query  1017  SASVSPEVFQYDSCLNSWSKLASMNVARYDFACAEVNGMVYAVGG--NGVNGESLSCAEV  844
             S      V  Y++  N W +   M   R+ F    +N  +Y  GG   G++  SL  AEV
Sbjct  182   SMR---RVIFYNARTNKWHRAPDMLRRRHFFGACVINNCLYVAGGENEGIH-RSLRSAEV  237

Query  843   YDPDTNKWRVIESLRRPRWGCFGCGFEGKLYVMGGRSSFTIGNSRFV--DVYNPERQSWC  670
             YDP+ N+W +I  +        G  F+GK Y+ G      +G  R V  +VY+PE  +W 
Sbjct  238   YDPNKNRWSIISDMSTAMVPFIGVVFDGKWYLKG------LGTHRQVLSEVYHPESDNWY  291

Query  669   EMKNGCVM--VTAHAVVGKKLFCIEWKNQRKLGIFNPEDNSW  550
              + +G V       A +  KL+ ++ K+  KL +++   +SW
Sbjct  292   PVYDGMVAGWRNPSAAMNGKLYALDCKDGCKLRVYDEASDSW  333



>ref|XP_008385738.1| PREDICTED: F-box/kelch-repeat protein At1g55270-like [Malus domestica]
Length=428

 Score =   132 bits (331),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 103/321 (32%), Positives = 150/321 (47%), Gaps = 26/321 (8%)
 Frame = -1

Query  1482  GKKRVTELKMCFS-DEMNLDNPGHSKNISYFTSSVVVDDSYSPLLPGLPDDVAKYCLALV  1306
              KK V   K+C   D  +  +P  SK     +S +      SPLLPGLPDD+A  CL  V
Sbjct  29    AKKYVPGAKLCLQPDTKSSIHPTRSKPSRGESSRI-----QSPLLPGLPDDLAVACLVRV  83

Query  1305  PRYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWLYVLTVDADGKESHWEVLDCLGH  1126
             PR     +  V KRW   + +  F  +R+   + EEW+Y++  D +GK + W   D +  
Sbjct  84    PRVEHRKLRLVCKRWFRLLAANFFYSLRRNLGIAEEWIYLIKRDREGKIT-WHAFDPVCQ  142

Query  1125  KHHQLPQMPAPIRA--GFGVAVLNA-KLLVMGGYSMIDESASVSPEVFQYDSCLNSWSKL  955
                 LP +P    A  GFG AVL    L + GG   +  S      V  Y++  N W + 
Sbjct  143   LWQPLPPVPKEYSAALGFGCAVLGGCHLYLFGGKDPLKGSMR---RVIFYNARTNKWHRA  199

Query  954   ASMNVARYDFACAEVNGMVYAVGG--NGVNGESLSCAEVYDPDTNKWRVIESLRRPRWGC  781
               M   R+ F    +N  +Y  GG   GVN  SL  AEVYDP+ N+W  I  +       
Sbjct  200   PDMLRRRHFFGSCVINNCLYVAGGENEGVN-RSLKSAEVYDPNKNRWSFISEMSTAMVPF  258

Query  780   FGCGFEGKLYVMGGRSSFTIGNSRFV--DVYNPERQSWCEMKNGCVM--VTAHAVVGKKL  613
              G  +EGK ++ G      +G+ R V  +VY PE  +W  + +G V       A +   L
Sbjct  259   IGVVYEGKWFLKG------LGSHRQVLSEVYQPENDTWNSVYDGMVAGWRNPSASLNXHL  312

Query  612   FCIEWKNQRKLGIFNPEDNSW  550
             + +E K+  KL +++   +SW
Sbjct  313   YALECKDGCKLRVYDEATDSW  333



>ref|XP_010688025.1| PREDICTED: F-box/kelch-repeat protein At1g55270-like isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=443

 Score =   132 bits (331),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 95/282 (34%), Positives = 137/282 (49%), Gaps = 20/282 (7%)
 Frame = -1

Query  1368  SYSPLLPGLPDDVAKYCLALVPRYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWLY  1189
             S SPLLPGLPDD+A  CL  VPR     +  V KRW   +    F  +R+   + EEW+Y
Sbjct  77    SQSPLLPGLPDDLAIACLIRVPRVEHRNLRLVCKRWYRLLAGNFFYSLRRSLGIAEEWVY  136

Query  1188  VLTVDADGKESHWEVLDCLGHKHHQLPQMPAPIRA--GFGVAVLNA-KLLVMGGYSMIDE  1018
             V+  D DGK S W   D +      LP +P       GFG AVL+   L + GG   +  
Sbjct  137   VIKRDRDGKIS-WHAFDPVYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGKHPLKG  195

Query  1017  SASVSPEVFQYDSCLNSWSKLASMNVARYDFACAEVNGMVYAVGG--NGVNGESLSCAEV  844
             S      V  Y++  N W +   M   R+ F    +N  +Y  GG   G++  SL  AEV
Sbjct  196   SMR---RVIFYNARTNKWHRAPDMLRRRHFFGACVINNCLYVAGGENEGIH-RSLRSAEV  251

Query  843   YDPDTNKWRVIESLRRPRWGCFGCGFEGKLYVMGGRSSFTIGNSRFV--DVYNPERQSWC  670
             YDP+ N+W +I  +        G  F+GK Y+ G      +G  R V  +VY+PE  +W 
Sbjct  252   YDPNKNRWSIISDMSTAMVPFIGVVFDGKWYLKG------LGTHRQVLSEVYHPESDNWY  305

Query  669   EMKNGCVM--VTAHAVVGKKLFCIEWKNQRKLGIFNPEDNSW  550
              + +G V       A +  KL+ ++ K+  KL +++   +SW
Sbjct  306   PVYDGMVAGWRNPSAAMNGKLYALDCKDGCKLRVYDEASDSW  347



>ref|XP_008337311.1| PREDICTED: F-box/kelch-repeat protein At1g55270-like [Malus domestica]
 ref|XP_008337312.1| PREDICTED: F-box/kelch-repeat protein At1g55270-like [Malus domestica]
Length=428

 Score =   131 bits (330),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 102/320 (32%), Positives = 147/320 (46%), Gaps = 24/320 (8%)
 Frame = -1

Query  1482  GKKRVTELKMCFSDEMNLD-NPGHSKNISYFTSSVVVDDSYSPLLPGLPDDVAKYCLALV  1306
              KK V   K+C   ++    +P  SK     +S +      SPLLPGLPDD+A  CL  V
Sbjct  29    AKKYVPGAKLCLQPDIKSSIHPTRSKPSRGESSRI-----QSPLLPGLPDDLAVACLVRV  83

Query  1305  PRYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWLYVLTVDADGKESHWEVLDCLGH  1126
             PR     +  V KRW   + +  F  +R+   + EEW+Y++  D +GK S W   D +  
Sbjct  84    PRVEHRKLRLVCKRWYRLLAANFFYSLRRNLGIAEEWIYLIKRDGEGKVS-WHAFDPVYQ  142

Query  1125  KHHQLPQMPAPIRA--GFGVAVLNA-KLLVMGGYSMIDESASVSPEVFQYDSCLNSWSKL  955
                 LP +P    A  GFG AVL    L + GG   +  S      V  Y++  N W + 
Sbjct  143   LWQPLPPVPKEYSAALGFGCAVLGGCHLYLFGGKDPLKGSMR---RVIFYNARTNKWHRA  199

Query  954   ASMNVARYDFACAEVNGMVYAVGG-NGVNGESLSCAEVYDPDTNKWRVIESLRRPRWGCF  778
               M   R+ F    +N  +Y  GG NG    SL  AEVYDP+ N+W  I  +        
Sbjct  200   PDMLRRRHFFGSCVINNCLYVAGGENGGIHRSLKSAEVYDPNKNRWSFISEMSTGMAPYI  259

Query  777   GCGFEGKLYVMGGRSSFTIGNSRFV--DVYNPERQSWCEMKNGCVM--VTAHAVVGKKLF  610
             G  +EGK ++ G      +G+ R V  +VY PE  SW  + +G V         +   L+
Sbjct  260   GVVYEGKWFLKG------LGSHRQVLSEVYQPENDSWYSVYDGMVAGWRNPSVALNGHLY  313

Query  609   CIEWKNQRKLGIFNPEDNSW  550
               E K+  KL +++   +SW
Sbjct  314   ASECKDGCKLRVYDKATDSW  333



>gb|KHG06592.1| hypothetical protein F383_00121 [Gossypium arboreum]
Length=383

 Score =   130 bits (327),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 73/251 (29%), Positives = 127/251 (51%), Gaps = 16/251 (6%)
 Frame = -1

Query  1377  VDDSYSPLLPGLPDDVAKYCLALVPRYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEE  1198
             ++ +   LLPGLPDD+A  CLA +   Y  A+  V+ RW+  +RS E+   +       +
Sbjct  1     MESAQEALLPGLPDDLALRCLARLSHGYHGALESVSNRWKDLVRSPEYANYKANQGWCGD  60

Query  1197  WLYVLTVDADGKESHWEVLDCLGHKHHQLPQMPAPIRA----GFGVAVLNAKLLVMGGYS  1030
             WL+V+T   +   + W   D    + H LP++P         GF    ++ +LLV+GG  
Sbjct  61    WLFVVT---ERSNNQWIAYDREADRWHPLPKIPTDHDGLQHFGFSCVCVHNRLLVIGGSH  117

Query  1029  MIDESA------SVSPEVFQYDSCLNSWSKLASMNVARYDFACAEVNGMVYAVGGNGVN-  871
                ++A       ++  V Q+D     W++L+SM   R  FAC  ++G VY  GG  ++ 
Sbjct  118   APRDTAYPRQTPVITNAVIQFDPYKKQWTRLSSMQTPRSHFACCVMSGKVYVAGGRNLSY  177

Query  870   GESLSCAEVYDPDTNKWRVIESLRRPRWGCFGCGFEGKLYVMGGRSSFTIGNSRFVDVYN  691
                LS AEVYDP +++W  +  +  P+  C G  ++GK +V+  +      N    ++++
Sbjct  178   PRGLSLAEVYDPLSDRWEDMPEMPNPQMDCLGISYKGKFHVLSDQVGLAEQNPS--EIFD  235

Query  690   PERQSWCEMKN  658
             P  ++WC + +
Sbjct  236   PSNKTWCTVND  246



>ref|XP_009590459.1| PREDICTED: F-box/kelch-repeat protein At1g16250 [Nicotiana tomentosiformis]
Length=387

 Score =   130 bits (327),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 78/252 (31%), Positives = 122/252 (48%), Gaps = 16/252 (6%)
 Frame = -1

Query  1380  VVDDSYSPLLPGLPDDVAKYCLALVPRYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLE  1201
             +++  +  ++PGLPDD+A  CLA++   Y   +  V + WR    S E+   +       
Sbjct  4     LMETIHQSIIPGLPDDLALRCLAMISHGYHGILETVCREWRKLFHSAEYSNYKAREGWCG  63

Query  1200  EWLYVLTVDADGKESHWEVLDCLGHKHHQLPQMPAP----IRAGFGVAVLNAKLLVMGG-  1036
              WL+VLT   +G E+ W   D    + H LP++P         GF  A ++ K L++GG 
Sbjct  64    NWLFVLT---EGSENQWIAYDPEADRWHPLPRVPTSHPKQKHLGFSCACVSNKFLLIGGT  120

Query  1035  YSMID-----ESASVSPEVFQYDSCLNSWSKLASMNVARYDFACAEVNGMVYAVGGNGVN  871
             Y   D     + A  + EVFQ+D     W ++ SM   R  FAC+ V+G VY  GG   +
Sbjct  121   YEASDQVFSRQKALTTNEVFQFDPFRKEWRRVTSMKTPRSHFACSVVSGKVYVAGGRDTS  180

Query  870   GE-SLSCAEVYDPDTNKWRVIESLRRPRWGCFGCGFEGKLYVMGGRSSFTIGNSRFVDVY  694
                 L+  EVY+P T+KW  +  L  P+  C G  FEGK YV+          +    V+
Sbjct  181   SRGGLALVEVYNPLTDKWEDLPPLPSPQMDCIGLSFEGKFYVLTDLVGLLEQETSV--VF  238

Query  693   NPERQSWCEMKN  658
             +P  ++W  + +
Sbjct  239   DPSDETWLSVDD  250



>ref|XP_006450966.1| hypothetical protein CICLE_v10008382mg [Citrus clementina]
 ref|XP_006475820.1| PREDICTED: F-box/kelch-repeat protein At1g55270-like [Citrus 
sinensis]
 gb|ESR64206.1| hypothetical protein CICLE_v10008382mg [Citrus clementina]
 gb|KDO80283.1| hypothetical protein CISIN_1g014222mg [Citrus sinensis]
Length=428

 Score =   130 bits (328),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 101/320 (32%), Positives = 147/320 (46%), Gaps = 24/320 (8%)
 Frame = -1

Query  1482  GKKRVTELKMCFSDEMNLD-NPGHSKNISYFTSSVVVDDSYSPLLPGLPDDVAKYCLALV  1306
              KK V   K+C   ++    +P  SK  S   S      + SPLLPGLPDD+A  CL  V
Sbjct  29    AKKYVPGTKLCLQPDIKPSIHPTRSKPASGSRSR-----NQSPLLPGLPDDLAIACLIRV  83

Query  1305  PRYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWLYVLTVDADGKESHWEVLDCLGH  1126
             PR     +  V KRW   +    +  +RK   + EEW+YV+  D +GK S W   D +  
Sbjct  84    PRVEHCKLRLVCKRWHRLLSGNFYYSLRKSLGIAEEWIYVIKRDREGKIS-WHAFDPIYQ  142

Query  1125  KHHQLPQMPAPIRA--GFGVAVLNA-KLLVMGGYSMIDESASVSPEVFQYDSCLNSWSKL  955
                 LP +P       GFG AVL+   L + GG   +  S      V  Y +  N W + 
Sbjct  143   LWQPLPPIPKEYSEALGFGCAVLSGCHLYLFGGKDPLKGSMR---RVIFYSARTNKWHRA  199

Query  954   ASMNVARYDFACAEVNGMVYAVGG-NGVNGESLSCAEVYDPDTNKWRVIESLRRPRWGCF  778
               M   R+ F    +N  +Y  GG NG    SL  AEVYDP+ N+W  I  +        
Sbjct  200   PDMLRRRHFFGSCVINNCLYVAGGENGGVHRSLRSAEVYDPNKNRWSFISDMSTAMVPFI  259

Query  777   GCGFEGKLYVMGGRSSFTIGNSRFV--DVYNPERQSWCEMKNGCVM--VTAHAVVGKKLF  610
             G  +EGK ++ G      +G+ R V  + Y PE  SW  + +G V       A + + L+
Sbjct  260   GVVYEGKWFLKG------LGSHRQVLSEAYQPETDSWFPVYDGMVAGWRNPSASLNRHLY  313

Query  609   CIEWKNQRKLGIFNPEDNSW  550
              ++ K+  K+ +++   +SW
Sbjct  314   ALDCKDGCKIRVYDEVTDSW  333



>ref|XP_003554163.1| PREDICTED: F-box/kelch-repeat protein At1g55270-like [Glycine 
max]
Length=428

 Score =   130 bits (327),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 95/282 (34%), Positives = 135/282 (48%), Gaps = 20/282 (7%)
 Frame = -1

Query  1368  SYSPLLPGLPDDVAKYCLALVPRYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWLY  1189
             S SPLLPGLPDD+A  CL  VPR     +  V KRW   +    F  +RK   + EEW+Y
Sbjct  63    SQSPLLPGLPDDLAIACLIRVPRVEHRKLRLVCKRWYRLLVGNFFYFLRKSLGIAEEWIY  122

Query  1188  VLTVDADGKESHWEVLDCLGHKHHQLPQMPAPIRA--GFGVAVLNA-KLLVMGGYSMIDE  1018
             V+  D DGK S W   D +      LP +P       GFG AVLN   L + GG   +  
Sbjct  123   VIKRDRDGKIS-WHAFDPVYQLWQPLPPVPKEYSGALGFGCAVLNGCHLYLFGGKDPLKG  181

Query  1017  SASVSPEVFQYDSCLNSWSKLASMNVARYDFACAEVNGMVYAVGG--NGVNGESLSCAEV  844
             S      V  Y +  N W +   M   R+ F    +N  +Y  GG   GV+  SL  AEV
Sbjct  182   SMR---RVIFYSARTNKWHRAPDMLRRRHFFGSCVINNCLYVAGGENEGVH-RSLRSAEV  237

Query  843   YDPDTNKWRVIESLRRPRWGCFGCGFEGKLYVMGGRSSFTIGNSRFV--DVYNPERQSWC  670
             YDP+ N+W  I  +        G  ++GK ++ G      +G+ R V  +VY PE  SW 
Sbjct  238   YDPNKNRWSFISDMSTAMVPFIGVVYDGKWFMKG------LGSHRQVLSEVYQPENDSWY  291

Query  669   EMKNGCVM--VTAHAVVGKKLFCIEWKNQRKLGIFNPEDNSW  550
              + +G V         + +KL+ ++ K+  K+ +++   +SW
Sbjct  292   TIYDGMVSGWRNPSCTLNEKLYALDCKDGCKIRVYDEVADSW  333



>ref|XP_011036156.1| PREDICTED: F-box/kelch-repeat protein SKIP4 [Populus euphratica]
Length=342

 Score =   129 bits (324),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 90/303 (30%), Positives = 144/303 (48%), Gaps = 13/303 (4%)
 Frame = -1

Query  1359  PLLPGLPDDVAKYCLALVPRYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWLYVLT  1180
             PL+ GLPDD+A  CLA VPR Y   +  V+KRWR F+ S+E    R++  L E W+Y L 
Sbjct  2     PLICGLPDDIALSCLARVPRKYHAVLKCVSKRWREFVCSEELYDYRRMHSLSETWIYALC  61

Query  1179  VDADGKESHWEVLDCLGHKHHQ-LPQMPAPI--RAGFGVAVLNAKLLVMGGYSMIDESAS  1009
              D  GK   + V      +  + +P +PA    + G G  VL  K+ ++GG   ++    
Sbjct  62    CDKYGKIWFYVVDPNESQRRWKCVPGLPARALNKMGMGFEVLGKKVYLLGGGGWLE----  117

Query  1008  VSPEVFQYDSCLNSWSKLASMNVARYDFACAEVNGMVYAVGGNGVNGESLSCAEVYDPDT  829
              + E F YD   NSW+++AS++ ARYD AC   +G +YA+GG           +++DP T
Sbjct  118   ATNEAFCYDVSRNSWTQVASLSTARYDSACKVYDGKIYAIGGLASTRSDPYSWDIFDPHT  177

Query  828   NKWRVIESLRRPRWGCFGCGFEGKLYVMGGRSSFTIGNSRFVDVYNPERQSW----CEMK  661
             N W    +             +GK+Y+    S+ T+ +  +  VY P    W     +M 
Sbjct  178   NSWEFHSNDCAVPEVEDSVVLDGKIYIRCQASASTMSSPFYAVVYEPSSGMWQHADADMV  237

Query  660   NGCVMVTAHAVVGKKLFCIEWKNQRKLGIFNPEDNSWKMVGVPVTGSSSIGFRLGILDEK  481
             +G        VV   L+ ++  +  KL ++  +   W  V    T  +    +L  + +K
Sbjct  238   SG--WQGPAVVVDGTLYVLDQSSGTKLMMWQKDKGEWVAVKRLATQLTKPPCQLAAIGKK  295

Query  480   LLL  472
             L +
Sbjct  296   LFI  298



>ref|XP_009407660.1| PREDICTED: F-box/kelch-repeat protein At1g55270-like [Musa acuminata 
subsp. malaccensis]
Length=434

 Score =   130 bits (327),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 103/325 (32%), Positives = 149/325 (46%), Gaps = 31/325 (10%)
 Frame = -1

Query  1482  GKKRVTELKMCFSDEMNLD-NPGHSKNISYFTSSVVVDDSYSPLLPGLPDDVAKYCLALV  1306
             GKK V   K+C   ++    +P  SK       +   +   SPLLPGLPDD+A  CL  V
Sbjct  41    GKKYVPGSKLCVQPKIRTSIHPVRSK------PAQERNRCQSPLLPGLPDDLAIACLIRV  94

Query  1305  PRYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWLYVLTVDADGKESHWEVLDCLGH  1126
             PR     +  V KRW+  +    F  +R+   + EEW+YV+  D DG+ S W+  D    
Sbjct  95    PRAEHRKLRLVCKRWQRLLAGNYFYSLRRSLGIAEEWIYVIRRDRDGRIS-WDAFDPRYQ  153

Query  1125  KHHQLPQMPAPIR--AGFGVAVLNA-KLLVMGGYSMIDESASVSPEVFQYDSCLNSWSKL  955
               H LP +P       GFG AVL+   L ++GG    D        V  Y +  N W + 
Sbjct  154   LWHPLPPIPKEYSEATGFGCAVLSGCHLYLLGGK---DRRKGSMRRVIYYSARTNKWHRA  210

Query  954   ASMNVARYDFACAEVNGMVYAVGG--NGVNGESLSCAEVYDPDTNKWRVIESLRRPRWGC  781
               M   R+ F    +N  +Y  GG   GV+  SL  AE YDP+ N+W  I  +       
Sbjct  211   PDMLRRRHLFGSCVINNCLYVAGGESEGVH-RSLRSAEFYDPNKNRWTYISDMSTAMVPF  269

Query  780   FGCGFEGKLYVMGGRSSFTIGNSRFV--DVYNPERQSWCEMKNGCVMVTA----HAVVGK  619
              G  +EGK ++ G      +G  R V  D Y P+   WC + NG  MVT        +  
Sbjct  270   IGVVYEGKWFLKG------LGAQRQVICDAYFPDTDRWCPVFNG--MVTGWRNPSVCLNG  321

Query  618   KLFCIEWKNQRKLGIFNPEDNSWKM  544
             +L+ ++ K+  KL  ++   +SW +
Sbjct  322   QLYALDCKDGCKLRSYDASTDSWSI  346



>gb|KHN23508.1| F-box/kelch-repeat protein [Glycine soja]
Length=428

 Score =   130 bits (327),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 95/282 (34%), Positives = 135/282 (48%), Gaps = 20/282 (7%)
 Frame = -1

Query  1368  SYSPLLPGLPDDVAKYCLALVPRYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWLY  1189
             S SPLLPGLPDD+A  CL  VPR     +  V KRW   +    F  +RK   + EEW+Y
Sbjct  63    SQSPLLPGLPDDLAIACLIRVPRVEHRKLRLVCKRWYRLLVGNFFYFLRKSLGIAEEWIY  122

Query  1188  VLTVDADGKESHWEVLDCLGHKHHQLPQMPAPIRA--GFGVAVLNA-KLLVMGGYSMIDE  1018
             V+  D DGK S W   D +      LP +P       GFG AVLN   L + GG   +  
Sbjct  123   VIKRDRDGKIS-WHAFDPVYQLWQPLPPVPKEYSGALGFGCAVLNGCHLYLFGGKDPLKG  181

Query  1017  SASVSPEVFQYDSCLNSWSKLASMNVARYDFACAEVNGMVYAVGG--NGVNGESLSCAEV  844
             S      V  Y +  N W +   M   R+ F    +N  +Y  GG   GV+  SL  AEV
Sbjct  182   SMR---RVIFYSARTNKWHRAPDMLRRRHFFGSCVINNCLYVAGGENEGVH-RSLRSAEV  237

Query  843   YDPDTNKWRVIESLRRPRWGCFGCGFEGKLYVMGGRSSFTIGNSRFV--DVYNPERQSWC  670
             YDP+ N+W  I  +        G  ++GK ++ G      +G+ R V  +VY PE  SW 
Sbjct  238   YDPNKNRWSFISGMSTAMVPFIGVVYDGKWFMKG------LGSHRQVLSEVYQPENDSWY  291

Query  669   EMKNGCVM--VTAHAVVGKKLFCIEWKNQRKLGIFNPEDNSW  550
              + +G V         + +KL+ ++ K+  K+ +++   +SW
Sbjct  292   TIYDGMVSGWRNPSCTLNEKLYALDCKDGCKIRVYDEVADSW  333



>ref|XP_011084133.1| PREDICTED: F-box/kelch-repeat protein At1g55270-like [Sesamum 
indicum]
 ref|XP_011084134.1| PREDICTED: F-box/kelch-repeat protein At1g55270-like [Sesamum 
indicum]
 ref|XP_011084135.1| PREDICTED: F-box/kelch-repeat protein At1g55270-like [Sesamum 
indicum]
Length=427

 Score =   130 bits (326),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 94/283 (33%), Positives = 132/283 (47%), Gaps = 18/283 (6%)
 Frame = -1

Query  1374  DDSYSPLLPGLPDDVAKYCLALVPRYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEW  1195
             + S SPLLPGLPDD+A  CL  VPR     +  V KRW   +    F  +RK   + EEW
Sbjct  60    NRSQSPLLPGLPDDLAIACLIRVPRIEHFKLRLVCKRWYRLLAGNFFYSLRKNLGIAEEW  119

Query  1194  LYVLTVDADGKESHWEVLDCLGHKHHQLPQMPAPI--RAGFGVAVLNA-KLLVMGGYSMI  1024
             +Y++  D DGK S W   D +      LP +P        FG AVL+   L ++GG   +
Sbjct  120   IYIMKRDRDGKLS-WHAFDPMHQVWQPLPPVPREYCEARDFGCAVLSGCHLYLVGGKDPV  178

Query  1023  DESASVSPEVFQYDSCLNSWSKLASMNVARYDFACAEVNGMVYAVGG-NGVNGESLSCAE  847
               S      V  Y +  N W +   M   R+ F C  +N  +Y  GG N     SL  AE
Sbjct  179   KGSMR---RVVFYSARTNRWHRAPDMLRRRHFFGCCVINNCLYVAGGENEGTHRSLKSAE  235

Query  846   VYDPDTNKWRVIESLRRPRWGCFGCGFEGKLYVMGGRSSFTIGNSRFV--DVYNPERQSW  673
             VYDP+ N+W  I  +        G  + GK ++ G      +G+ R V  +VY PE  SW
Sbjct  236   VYDPNKNRWSFISDMSTAMVPFIGVVYGGKWFLKG------LGSQRQVVCEVYQPETDSW  289

Query  672   CEMKNGCVMVTAH--AVVGKKLFCIEWKNQRKLGIFNPEDNSW  550
               + +G V    H    +   L+ ++ K+  KL I++    SW
Sbjct  290   SPVYDGMVAGWRHPCTTINGHLYALDCKDGCKLRIYDETSGSW  332



>ref|XP_010024901.1| PREDICTED: F-box/kelch-repeat protein At1g16250 [Eucalyptus grandis]
 gb|KCW61421.1| hypothetical protein EUGRSUZ_H04148 [Eucalyptus grandis]
Length=383

 Score =   129 bits (325),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 72/222 (32%), Positives = 114/222 (51%), Gaps = 14/222 (6%)
 Frame = -1

Query  1377  VDDSYSPLLPGLPDDVAKYCLALVPRYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEE  1198
             +D  Y P++PGLPDD+A  CLA V   +   +  V+K+WR   R  E+   +       +
Sbjct  1     MDSLYEPIIPGLPDDLALRCLARVSHGFQGLLETVSKKWREVTRGTEYANFKAREGWSGD  60

Query  1197  WLYVLTVDADGKESHWEVLDCLGHKHHQLPQMPAP----IRAGFGVAVLNAKLLVMGG-Y  1033
             WL+VLT   +G E+ W   D    + H +P+MP         GF    +  + LV+GG Y
Sbjct  61    WLFVLT---EGSENQWIAYDPEADRWHPIPKMPRTHPDWKHTGFSCVCVGGRFLVIGGAY  117

Query  1032  SMID-----ESASVSPEVFQYDSCLNSWSKLASMNVARYDFACAEVNGMVYAVGGNGVN-  871
             +  D     +   ++ EV+Q+D     W+ ++SM + R  FAC  ++G VY  GG  ++ 
Sbjct  118   ASSDPGFPHQKPIITNEVYQFDPFRKEWTAVSSMQMPRSHFACCVISGKVYVAGGRNLSC  177

Query  870   GESLSCAEVYDPDTNKWRVIESLRRPRWGCFGCGFEGKLYVM  745
                L+ AE YDP +NKW  +  +  P+  C G  + GK +V+
Sbjct  178   PRGLTLAECYDPLSNKWEELPPMPNPQTDCIGLSYNGKFHVL  219



>ref|XP_010268086.1| PREDICTED: F-box/kelch-repeat protein At1g16250 isoform X4 [Nelumbo 
nucifera]
 ref|XP_010268087.1| PREDICTED: F-box/kelch-repeat protein At1g16250 isoform X4 [Nelumbo 
nucifera]
 ref|XP_010268088.1| PREDICTED: F-box/kelch-repeat protein At1g16250 isoform X4 [Nelumbo 
nucifera]
Length=391

 Score =   129 bits (325),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 81/242 (33%), Positives = 123/242 (51%), Gaps = 16/242 (7%)
 Frame = -1

Query  1365  YSPLLPGLPDDVAKYCLALVPRYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWLYV  1186
             +  ++PGLPDD+A  CLA V   Y   +  V+KRWR  I S ++  ++        WL+V
Sbjct  17    HQAIIPGLPDDLALRCLAKVSHGYHGLLETVSKRWRDAIHSSDYSNLKAREGWSGNWLFV  76

Query  1185  LTVDADGKESHWEVLDCLGHKHHQLPQMPAPIRA----GFGVAVLNAKLLVMGG-YSMID  1021
             LT   +G + HW   D    + H LP++P+   +    GF    +N   LV+GG Y+  D
Sbjct  77    LT---EGTDVHWIAYDPEADRWHPLPKLPSANPSWHHYGFSCVSVNKMFLVIGGSYAPHD  133

Query  1020  -----ESASVSPEVFQYDSCLNSWSKLASMNVARYDFACAEVNGMVYAVGGNGVN-GESL  859
                  +   V+ +V Q+D     WS+LA+M  AR  FAC+ V G VY  GG   +    L
Sbjct  134   PVFPPQKPLVTNDVMQFDPFKKQWSRLANMRTARSHFACSVVFGKVYVAGGRTSSCTRGL  193

Query  858   SCAEVYDPDTNKWRVIESLRRPRWGCFGCGFEGKLYVMGGRSSFTIGNSRFVDVYNPERQ  679
             + +EVYDP  ++W  +  +  PR  C G   +G L+V+     F   N+   +V+NP   
Sbjct  194   ALSEVYDPLNDRWEELPPMPIPRMDCLGLSCKGCLHVLSDHLGFPDQNTS--EVFNPVEG  251

Query  678   SW  673
             +W
Sbjct  252   TW  253



>ref|XP_003524553.1| PREDICTED: F-box/kelch-repeat protein At1g55270-like [Glycine 
max]
 gb|KHN27455.1| F-box/kelch-repeat protein [Glycine soja]
Length=428

 Score =   130 bits (326),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 95/282 (34%), Positives = 135/282 (48%), Gaps = 20/282 (7%)
 Frame = -1

Query  1368  SYSPLLPGLPDDVAKYCLALVPRYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWLY  1189
             S SPLLPGLPDD+A  CL  VPR     +  V KRW   +    F  +RK   + EEW+Y
Sbjct  63    SQSPLLPGLPDDLAIACLIRVPRVEHRKLRLVCKRWYRLLVGNFFYSLRKSLGIAEEWIY  122

Query  1188  VLTVDADGKESHWEVLDCLGHKHHQLPQMPAPIRA--GFGVAVLNA-KLLVMGGYSMIDE  1018
             V+  D DGK S W   D +      LP +P       GFG AVLN   L + GG   +  
Sbjct  123   VIKRDRDGKIS-WHAFDPVYQLWQPLPPVPKEYSGALGFGCAVLNGCHLYLFGGKDPLKG  181

Query  1017  SASVSPEVFQYDSCLNSWSKLASMNVARYDFACAEVNGMVYAVGG--NGVNGESLSCAEV  844
             S      V  Y++  N W +   M   R+ F    +N  +Y  GG   GV+  SL  AEV
Sbjct  182   SMR---RVIFYNARTNKWHRAPDMLRRRHFFGSCVINNCLYVAGGENEGVH-RSLRSAEV  237

Query  843   YDPDTNKWRVIESLRRPRWGCFGCGFEGKLYVMGGRSSFTIGNSRFV--DVYNPERQSWC  670
             YDP+ N+W  I  +        G  ++GK ++ G      +G+ R V  +VY PE  SW 
Sbjct  238   YDPNKNRWSFISDMSTAMVPFIGVVYDGKWFLKG------LGSHRQVLSEVYQPENDSWY  291

Query  669   EMKNGCVM--VTAHAVVGKKLFCIEWKNQRKLGIFNPEDNSW  550
              + +G V         +  KL+ ++ K+  K+ +++   +SW
Sbjct  292   PIYDGLVSGWRNPSTTLNGKLYALDCKDGCKIRVYDEVADSW  333



>ref|XP_010268084.1| PREDICTED: F-box/kelch-repeat protein At1g16250 isoform X2 [Nelumbo 
nucifera]
Length=402

 Score =   129 bits (325),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 81/242 (33%), Positives = 123/242 (51%), Gaps = 16/242 (7%)
 Frame = -1

Query  1365  YSPLLPGLPDDVAKYCLALVPRYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWLYV  1186
             +  ++PGLPDD+A  CLA V   Y   +  V+KRWR  I S ++  ++        WL+V
Sbjct  28    HQAIIPGLPDDLALRCLAKVSHGYHGLLETVSKRWRDAIHSSDYSNLKAREGWSGNWLFV  87

Query  1185  LTVDADGKESHWEVLDCLGHKHHQLPQMPAPIRA----GFGVAVLNAKLLVMGG-YSMID  1021
             LT   +G + HW   D    + H LP++P+   +    GF    +N   LV+GG Y+  D
Sbjct  88    LT---EGTDVHWIAYDPEADRWHPLPKLPSANPSWHHYGFSCVSVNKMFLVIGGSYAPHD  144

Query  1020  -----ESASVSPEVFQYDSCLNSWSKLASMNVARYDFACAEVNGMVYAVGGNGVN-GESL  859
                  +   V+ +V Q+D     WS+LA+M  AR  FAC+ V G VY  GG   +    L
Sbjct  145   PVFPPQKPLVTNDVMQFDPFKKQWSRLANMRTARSHFACSVVFGKVYVAGGRTSSCTRGL  204

Query  858   SCAEVYDPDTNKWRVIESLRRPRWGCFGCGFEGKLYVMGGRSSFTIGNSRFVDVYNPERQ  679
             + +EVYDP  ++W  +  +  PR  C G   +G L+V+     F   N+   +V+NP   
Sbjct  205   ALSEVYDPLNDRWEELPPMPIPRMDCLGLSCKGCLHVLSDHLGFPDQNTS--EVFNPVEG  262

Query  678   SW  673
             +W
Sbjct  263   TW  264



>ref|XP_001777680.1| predicted protein [Physcomitrella patens]
 gb|EDQ57460.1| predicted protein [Physcomitrella patens]
Length=441

 Score =   130 bits (326),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 93/295 (32%), Positives = 138/295 (47%), Gaps = 28/295 (9%)
 Frame = -1

Query  1362  SPLLPGLPDDVAKYCLALVPRYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWLYVL  1183
             SPL+  LPDDV K   A +PR        V   WR     ++   +R    + E W+YVL
Sbjct  69    SPLIHSLPDDVMKLIFAQLPRQSLAKTRLVCSSWRRVAEDQDIASLRCKMDVAEGWIYVL  128

Query  1182  TVDADGKESHWEVLDCLGHKHHQLPQMPAPIRA------GFGVAVLNAKLLVMGG-----  1036
                  G  + +   D +  K   LP  P P R+      GF    L  KLL++GG     
Sbjct  129   PDFPQG--APFRAYDPIAAKWSVLP--PTPRRSESQQWVGFASVALGHKLLLIGGSRSKS  184

Query  1035  --YSMIDESASVSPEVFQYDSCLNSWSKLASMNVARYDFACAEVNGMVYAVGGNGVNGES  862
                S I  ++ V  +V  YD+  N W K A MN  R  FA + + G VY  GG G N   
Sbjct  185   DAASNIHSTSVVCSDVIIYDALTNKWRKGAKMNTPRSWFASSMIGGKVYVAGGQG-NTRF  243

Query  861   LSCAEVYDPDTNKWRVIESLRRPRWGCFGCGFEGKLYVMGG---RSSFTIGNSRFVDVYN  691
             L  AEVYDP+T+ W+VI S+   R  C G   +G+ +V+ G   ++ +        +VY+
Sbjct  244   LDSAEVYDPETDTWKVIASMAVQRSNCEGVALDGQFWVIAGEYVKNHYNNSQRSSAEVYD  303

Query  690   PERQSWCEMKNGCV----MVTAHAVVGKKLFCIEWKNQRKLGIFNPEDNSWKMVG  538
              E  +W  + N  +    ++   AVV  +L C+   +Q+++  +N   NSW  +G
Sbjct  304   AETDTWRFVPNMYMDDKKVMEPSAVVNGELICV---HQKRVMAYNKTLNSWSQLG  355



>ref|XP_010268085.1| PREDICTED: F-box/kelch-repeat protein At1g16250 isoform X3 [Nelumbo 
nucifera]
Length=395

 Score =   129 bits (324),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 81/242 (33%), Positives = 123/242 (51%), Gaps = 16/242 (7%)
 Frame = -1

Query  1365  YSPLLPGLPDDVAKYCLALVPRYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWLYV  1186
             +  ++PGLPDD+A  CLA V   Y   +  V+KRWR  I S ++  ++        WL+V
Sbjct  21    HQAIIPGLPDDLALRCLAKVSHGYHGLLETVSKRWRDAIHSSDYSNLKAREGWSGNWLFV  80

Query  1185  LTVDADGKESHWEVLDCLGHKHHQLPQMPAPIRA----GFGVAVLNAKLLVMGG-YSMID  1021
             LT   +G + HW   D    + H LP++P+   +    GF    +N   LV+GG Y+  D
Sbjct  81    LT---EGTDVHWIAYDPEADRWHPLPKLPSANPSWHHYGFSCVSVNKMFLVIGGSYAPHD  137

Query  1020  -----ESASVSPEVFQYDSCLNSWSKLASMNVARYDFACAEVNGMVYAVGGNGVN-GESL  859
                  +   V+ +V Q+D     WS+LA+M  AR  FAC+ V G VY  GG   +    L
Sbjct  138   PVFPPQKPLVTNDVMQFDPFKKQWSRLANMRTARSHFACSVVFGKVYVAGGRTSSCTRGL  197

Query  858   SCAEVYDPDTNKWRVIESLRRPRWGCFGCGFEGKLYVMGGRSSFTIGNSRFVDVYNPERQ  679
             + +EVYDP  ++W  +  +  PR  C G   +G L+V+     F   N+   +V+NP   
Sbjct  198   ALSEVYDPLNDRWEELPPMPIPRMDCLGLSCKGCLHVLSDHLGFPDQNTS--EVFNPVEG  255

Query  678   SW  673
             +W
Sbjct  256   TW  257



>ref|XP_008222313.1| PREDICTED: F-box/kelch-repeat protein At1g16250 [Prunus mume]
Length=386

 Score =   129 bits (323),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 76/252 (30%), Positives = 127/252 (50%), Gaps = 18/252 (7%)
 Frame = -1

Query  1377  VDDSYSPLLPGLPDDVAKYCLALVPRYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEE  1198
             ++  +  ++PGLPDD+A  CLA+V   Y   +  V+K WR  IRS ++   +        
Sbjct  1     MESVHQSIIPGLPDDLALRCLAMVSHGYHGLLETVSKTWRDLIRSLDYANYKAREEWCGN  60

Query  1197  WLYVLTVDADGKESHWEVLDCLGHKHHQLPQMPAPIRA-----GFGVAVLNAKLLVMGG-  1036
             WL+VLT   +G  + W   D    + H LP++P  + A     GF    +  +  V+GG 
Sbjct  61    WLFVLT---EGSNNEWVAYDPEADRWHPLPKIPT-VHADWKHFGFSSITVRNRFFVIGGS  116

Query  1035  YSMID-----ESASVSPEVFQYDSCLNSWSKLASMNVARYDFACAEVNGMVYAVGGNGVN  871
             Y+  D     +   ++ EV Q+D     W+ +A+M   R  FAC+ V G +Y  GG  ++
Sbjct  117   YAPHDPAFPHQRPFITNEVMQFDPFKKQWTNVATMLTTRSHFACSAVYGKIYVAGGRNLS  176

Query  870   -GESLSCAEVYDPDTNKWRVIESLRRPRWGCFGCGFEGKLYVMGGRSSFTIGNSRFVDVY  694
                 L+ AEVYDP  +KW  +  +R P+  C G  ++GK +V+  +      N+   DV+
Sbjct  177   CTRGLALAEVYDPVADKWEELPPMRHPQMDCLGLSYKGKFHVLSDQVGLPDQNTS--DVF  234

Query  693   NPERQSWCEMKN  658
             +P   +W  +++
Sbjct  235   SPADGTWRTVED  246



>ref|XP_010268083.1| PREDICTED: F-box/kelch-repeat protein At1g16250 isoform X1 [Nelumbo 
nucifera]
Length=441

 Score =   129 bits (325),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 81/247 (33%), Positives = 126/247 (51%), Gaps = 16/247 (6%)
 Frame = -1

Query  1365  YSPLLPGLPDDVAKYCLALVPRYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWLYV  1186
             +  ++PGLPDD+A  CLA V   Y   +  V+KRWR  I S ++  ++        WL+V
Sbjct  67    HQAIIPGLPDDLALRCLAKVSHGYHGLLETVSKRWRDAIHSSDYSNLKAREGWSGNWLFV  126

Query  1185  LTVDADGKESHWEVLDCLGHKHHQLPQMPAPIRA----GFGVAVLNAKLLVMGG-YSMID  1021
             LT   +G + HW   D    + H LP++P+   +    GF    +N   LV+GG Y+  D
Sbjct  127   LT---EGTDVHWIAYDPEADRWHPLPKLPSANPSWHHYGFSCVSVNKMFLVIGGSYAPHD  183

Query  1020  -----ESASVSPEVFQYDSCLNSWSKLASMNVARYDFACAEVNGMVYAVGGNGVN-GESL  859
                  +   V+ +V Q+D     WS+LA+M  AR  FAC+ V G VY  GG   +    L
Sbjct  184   PVFPPQKPLVTNDVMQFDPFKKQWSRLANMRTARSHFACSVVFGKVYVAGGRTSSCTRGL  243

Query  858   SCAEVYDPDTNKWRVIESLRRPRWGCFGCGFEGKLYVMGGRSSFTIGNSRFVDVYNPERQ  679
             + +EVYDP  ++W  +  +  PR  C G   +G L+V+     F   N+   +V+NP   
Sbjct  244   ALSEVYDPLNDRWEELPPMPIPRMDCLGLSCKGCLHVLSDHLGFPDQNTS--EVFNPVEG  301

Query  678   SWCEMKN  658
             +W  +++
Sbjct  302   TWHTVES  308



>ref|XP_007013402.1| Galactose oxidase/kelch repeat superfamily protein isoform 6, 
partial [Theobroma cacao]
 gb|EOY31021.1| Galactose oxidase/kelch repeat superfamily protein isoform 6, 
partial [Theobroma cacao]
Length=419

 Score =   129 bits (323),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 96/280 (34%), Positives = 132/280 (47%), Gaps = 20/280 (7%)
 Frame = -1

Query  1362  SPLLPGLPDDVAKYCLALVPRYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWLYVL  1183
             SPLLPGLPDD+A  CL  VPR     +  V KRW   +    F  +RK   + EEW+YV+
Sbjct  56    SPLLPGLPDDLAIACLIRVPRVEHRKLRLVCKRWYRLLSGNFFYSLRKSLGIAEEWIYVI  115

Query  1182  TVDADGKESHWEVLDCLGHKHHQLPQMPAPIRA--GFGVAVLNA-KLLVMGGYSMIDESA  1012
               D DGK S W   D +      LP +P       GFG AVL+   L + GG   +  S 
Sbjct  116   KRDRDGKIS-WHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGKDPLKGSM  174

Query  1011  SVSPEVFQYDSCLNSWSKLASMNVARYDFACAEVNGMVYAVGG--NGVNGESLSCAEVYD  838
                  V  Y +  N W +   M   R+ F    +N  +Y  GG   GV+  SL  AEVYD
Sbjct  175   R---RVIYYSARTNKWHRAPDMLRRRHFFGSCVINNCLYVAGGENEGVH-RSLRSAEVYD  230

Query  837   PDTNKWRVIESLRRPRWGCFGCGFEGKLYVMGGRSSFTIGNSRFV--DVYNPERQSWCEM  664
             P+ N+W  I  +        G  +EGK ++ G      +G  R V  +VY PE  SW  +
Sbjct  231   PNKNRWSFISEMSTAMVPFIGVVYEGKWFLKG------LGPHRQVLSEVYRPETDSWYPV  284

Query  663   KNGCVM--VTAHAVVGKKLFCIEWKNQRKLGIFNPEDNSW  550
              NG V       A +   L+ ++ K+  KL +++   +SW
Sbjct  285   YNGMVAGWRNPCAFLNGHLYALDCKDGCKLKVYDEVTDSW  324



>ref|XP_007013397.1| Galactose oxidase/kelch repeat superfamily protein isoform 1 
[Theobroma cacao]
 ref|XP_007013398.1| Galactose oxidase/kelch repeat superfamily protein isoform 1 
[Theobroma cacao]
 ref|XP_007013399.1| Galactose oxidase/kelch repeat superfamily protein isoform 1 
[Theobroma cacao]
 ref|XP_007013400.1| Galactose oxidase/kelch repeat superfamily protein isoform 1 
[Theobroma cacao]
 ref|XP_007013401.1| Galactose oxidase/kelch repeat superfamily protein isoform 1 
[Theobroma cacao]
 gb|EOY31016.1| Galactose oxidase/kelch repeat superfamily protein isoform 1 
[Theobroma cacao]
 gb|EOY31017.1| Galactose oxidase/kelch repeat superfamily protein isoform 1 
[Theobroma cacao]
 gb|EOY31018.1| Galactose oxidase/kelch repeat superfamily protein isoform 1 
[Theobroma cacao]
 gb|EOY31019.1| Galactose oxidase/kelch repeat superfamily protein isoform 1 
[Theobroma cacao]
 gb|EOY31020.1| Galactose oxidase/kelch repeat superfamily protein isoform 1 
[Theobroma cacao]
Length=428

 Score =   129 bits (324),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 96/280 (34%), Positives = 132/280 (47%), Gaps = 20/280 (7%)
 Frame = -1

Query  1362  SPLLPGLPDDVAKYCLALVPRYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWLYVL  1183
             SPLLPGLPDD+A  CL  VPR     +  V KRW   +    F  +RK   + EEW+YV+
Sbjct  65    SPLLPGLPDDLAIACLIRVPRVEHRKLRLVCKRWYRLLSGNFFYSLRKSLGIAEEWIYVI  124

Query  1182  TVDADGKESHWEVLDCLGHKHHQLPQMPAPIRA--GFGVAVLNA-KLLVMGGYSMIDESA  1012
               D DGK S W   D +      LP +P       GFG AVL+   L + GG   +  S 
Sbjct  125   KRDRDGKIS-WHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGKDPLKGSM  183

Query  1011  SVSPEVFQYDSCLNSWSKLASMNVARYDFACAEVNGMVYAVGG--NGVNGESLSCAEVYD  838
                  V  Y +  N W +   M   R+ F    +N  +Y  GG   GV+  SL  AEVYD
Sbjct  184   R---RVIYYSARTNKWHRAPDMLRRRHFFGSCVINNCLYVAGGENEGVH-RSLRSAEVYD  239

Query  837   PDTNKWRVIESLRRPRWGCFGCGFEGKLYVMGGRSSFTIGNSRFV--DVYNPERQSWCEM  664
             P+ N+W  I  +        G  +EGK ++ G      +G  R V  +VY PE  SW  +
Sbjct  240   PNKNRWSFISEMSTAMVPFIGVVYEGKWFLKG------LGPHRQVLSEVYRPETDSWYPV  293

Query  663   KNGCVM--VTAHAVVGKKLFCIEWKNQRKLGIFNPEDNSW  550
              NG V       A +   L+ ++ K+  KL +++   +SW
Sbjct  294   YNGMVAGWRNPCAFLNGHLYALDCKDGCKLKVYDEVTDSW  333



>ref|XP_004287344.1| PREDICTED: F-box/kelch-repeat protein At1g55270-like [Fragaria 
vesca subsp. vesca]
Length=430

 Score =   129 bits (324),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 103/321 (32%), Positives = 147/321 (46%), Gaps = 26/321 (8%)
 Frame = -1

Query  1482  GKKRVTELKMCFSDEMNLD-NPGHSKNISYFTSSVVVDDSYSPLLPGLPDDVAKYCLALV  1306
              KK V   K+C   ++    +P  SK     +S      + SPLLPGLPDD+A  CL  V
Sbjct  31    AKKYVPGAKLCLQPDIKASIHPTRSKPARGESSR-----NQSPLLPGLPDDLAIACLIRV  85

Query  1305  PRYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWLYVLTVDADGKESHWEVLDCLGH  1126
             PR     +  V K+W   +    F  +RK   + EEW+Y++  D DGK S W   D +  
Sbjct  86    PRVEHRKLRLVCKKWYRLLAGNFFYSLRKSIGIAEEWIYLIKRDRDGKIS-WHAFDPVYQ  144

Query  1125  KHHQLPQMPAPIRA--GFGVAVLNA-KLLVMGGYSMIDESASVSPEVFQYDSCLNSWSKL  955
                 LP +P       GFG AVL    L + GG   +  S      V  Y +  N W + 
Sbjct  145   LWQSLPPVPKEYSEALGFGCAVLGGCHLYLFGGKDPLKGSMR---RVIFYSARTNKWHRA  201

Query  954   ASMNVARYDFACAEVNGMVYAVGG--NGVNGESLSCAEVYDPDTNKWRVIESLRRPRWGC  781
               M   R+ F    +N  +Y  GG   GV+  SL  AEVYDP+ N+W  I  +       
Sbjct  202   PDMLRRRHFFGSCVINNCLYVAGGENEGVH-RSLRSAEVYDPNKNRWSFISDMSTAMVPF  260

Query  780   FGCGFEGKLYVMGGRSSFTIGNSRFV--DVYNPERQSWCEMKNGCVM--VTAHAVVGKKL  613
              G  +EGK ++ G      +G+ R V  +VY PE  SW  + +G V       A +   L
Sbjct  261   IGVVYEGKWFLKG------LGSHRQVLSEVYQPENDSWDSVYDGMVAGWRNPSASLKGHL  314

Query  612   FCIEWKNQRKLGIFNPEDNSW  550
             + +E K+  KL +++   +SW
Sbjct  315   YALECKDGCKLRVYDEATDSW  335



>ref|XP_010093732.1| F-box/kelch-repeat protein [Morus notabilis]
 gb|EXB54538.1| F-box/kelch-repeat protein [Morus notabilis]
Length=475

 Score =   129 bits (325),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 104/321 (32%), Positives = 148/321 (46%), Gaps = 24/321 (7%)
 Frame = -1

Query  1482  GKKRVTELKMCFSDEMNLD-NPGHSKNISYFTSSVVVDDSYSPLLPGLPDDVAKYCLALV  1306
              KK V   K+C   ++    +P  +K      S    + + SPLLPGLPDD+A  CL  V
Sbjct  74    AKKYVPGTKLCLQPDIKPSIHPTRNKPSRGDRSR---NPNQSPLLPGLPDDLAIACLIRV  130

Query  1305  PRYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWLYVLTVDADGKESHWEVLDCLGH  1126
             PR     +  V KRW   +    F  +RK   + EEW+Y++  D DGK S W   D +  
Sbjct  131   PRAEHRKLRLVCKRWYRLLAGNFFYSLRKSLGIAEEWIYIIKRDRDGKIS-WHAFDPVYQ  189

Query  1125  KHHQLPQMPAPIRA--GFGVAVLNA-KLLVMGGYSMIDESASVSPEVFQYDSCLNSWSKL  955
                 LP +P       GFG AVL+   L + GG   +  S      V  Y +  N W + 
Sbjct  190   LWQPLPPVPREYSEALGFGCAVLSGCHLYLFGGKDPLKGSMR---RVIFYSARTNKWHRA  246

Query  954   ASMNVARYDFACAEVNGMVYAVGG--NGVNGESLSCAEVYDPDTNKWRVIESLRRPRWGC  781
               M   R+ F    +N  +Y  GG   GV+  SL  AEVYDP+ N+W  I  +       
Sbjct  247   PDMLRRRHFFGSCVINNCLYVAGGENEGVH-RSLRSAEVYDPNKNRWSFISDMSTAMVPF  305

Query  780   FGCGFEGKLYVMGGRSSFTIGNSRFV--DVYNPERQSWCEMKNGCVM--VTAHAVVGKKL  613
              G  +EGK Y+ G      +G+ R V  +VY PE  SW  + +G V       A +   L
Sbjct  306   IGVVYEGKWYLKG------LGSHRQVLSEVYQPENDSWYPVYDGMVAGWRNPSASLNGNL  359

Query  612   FCIEWKNQRKLGIFNPEDNSW  550
             + +E K+  KL +++   +SW
Sbjct  360   YALECKDGCKLRVYDEVTDSW  380



>ref|XP_010250049.1| PREDICTED: F-box/kelch-repeat protein At1g55270-like isoform 
X2 [Nelumbo nucifera]
Length=421

 Score =   128 bits (322),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 93/279 (33%), Positives = 129/279 (46%), Gaps = 18/279 (6%)
 Frame = -1

Query  1362  SPLLPGLPDDVAKYCLALVPRYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWLYVL  1183
             SPLLPGLPDD+A  CL  VPR     +  V KRW   +    F  +RK   + EEW+YV+
Sbjct  58    SPLLPGLPDDLAIACLIRVPRVEHRKLRLVCKRWYRLLAGNFFYSLRKNLGIAEEWIYVI  117

Query  1182  TVDADGKESHWEVLDCLGHKHHQLPQMPAPIRA--GFGVAVLNA-KLLVMGGYSMIDESA  1012
               D DGK S W   D +      LP +P       GFG AVL+   L + GG   I  S 
Sbjct  118   KRDRDGKIS-WHAFDPIYQLWQPLPPVPGEYAEALGFGCAVLSGCHLYLFGGKDPIKGSM  176

Query  1011  SVSPEVFQYDSCLNSWSKLASMNVARYDFACAEVNGMVYAVGGNGVNGES-LSCAEVYDP  835
                  V  Y +  N W +   M   R+ F    +N  +Y  GG        L  AEVYDP
Sbjct  177   R---RVIFYSARTNKWHRAPDMLRRRHFFGSCVINNCLYVAGGESEGAHRFLRSAEVYDP  233

Query  834   DTNKWRVIESLRRPRWGCFGCGFEGKLYVMGGRSSFTIGNSRFV--DVYNPERQSWCEMK  661
             + N+W  I  +        G  +EG+ ++ G      +G  R V  +VY+PE  SW  + 
Sbjct  234   NKNRWSFIADMSTAMVPFIGVVYEGRWFLKG------LGPHRQVLSEVYHPETDSWYPVY  287

Query  660   NGCVM--VTAHAVVGKKLFCIEWKNQRKLGIFNPEDNSW  550
             NG V         +  +L+ ++ K+  KL +F+   +SW
Sbjct  288   NGMVAGWRNPSTALNGQLYALDCKDGCKLRVFDEASDSW  326



>ref|XP_007202129.1| hypothetical protein PRUPE_ppa006078mg [Prunus persica]
 gb|EMJ03328.1| hypothetical protein PRUPE_ppa006078mg [Prunus persica]
Length=428

 Score =   128 bits (322),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 102/320 (32%), Positives = 145/320 (45%), Gaps = 24/320 (8%)
 Frame = -1

Query  1482  GKKRVTELKMCFSDEMNLD-NPGHSKNISYFTSSVVVDDSYSPLLPGLPDDVAKYCLALV  1306
              KK V   K+C   ++    +P  SK      S +      SPLLPGLPDD+A  CL  V
Sbjct  29    AKKYVPGAKLCLQPDIKPSIHPTRSKPSRGDGSRI-----QSPLLPGLPDDLAIACLIRV  83

Query  1305  PRYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWLYVLTVDADGKESHWEVLDCLGH  1126
             PR     +  V KRW   +    F  +RK   + EEW+Y++  D DGK S W   D +  
Sbjct  84    PRVEHRKLRLVCKRWYRLLVGNFFYSLRKSLGIAEEWIYLIKRDRDGKIS-WHAFDPVYQ  142

Query  1125  KHHQLPQMPAPIRA--GFGVAVLNA-KLLVMGGYSMIDESASVSPEVFQYDSCLNSWSKL  955
                 LP +P       GFG AVL+   L + GG   +  S      V  Y +  N W + 
Sbjct  143   LWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGKDPLKGSMR---RVIFYSARTNKWHRA  199

Query  954   ASMNVARYDFACAEVNGMVYAVGG-NGVNGESLSCAEVYDPDTNKWRVIESLRRPRWGCF  778
               M   R+ F    +N  +Y  GG N     SL  AEVYDP+ N+W  I  +        
Sbjct  200   PDMLRRRHFFGSCVINNCLYVAGGENEGMHRSLRSAEVYDPNKNRWSFISDMSTAMVPFI  259

Query  777   GCGFEGKLYVMGGRSSFTIGNSRFV--DVYNPERQSWCEMKNGCVM--VTAHAVVGKKLF  610
             G  +EGK ++ G      +G+ R V  +VY PE  SW  + +G V       A +   L+
Sbjct  260   GVVYEGKWFLKG------LGSHRQVLSEVYQPENDSWYSVYDGMVAGWRNPSAALNGHLY  313

Query  609   CIEWKNQRKLGIFNPEDNSW  550
              ++ K+  KL +++   +SW
Sbjct  314   ALDCKDGCKLRVYDEATDSW  333



>ref|XP_002524469.1| Protein AFR, putative [Ricinus communis]
 gb|EEF37909.1| Protein AFR, putative [Ricinus communis]
Length=436

 Score =   129 bits (323),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 93/279 (33%), Positives = 131/279 (47%), Gaps = 18/279 (6%)
 Frame = -1

Query  1362  SPLLPGLPDDVAKYCLALVPRYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWLYVL  1183
             SPLLPGLPDD+A  CL  VPR     +  V KRW   +    F  +RK   + EEW+Y++
Sbjct  73    SPLLPGLPDDLAIACLIRVPRVEHRKLRLVCKRWYRLLAGNFFYSLRKSLGIAEEWIYII  132

Query  1182  TVDADGKESHWEVLDCLGHKHHQLPQMPAPIRA--GFGVAVLNA-KLLVMGGYSMIDESA  1012
               D DGK S W   D +      LP +P       GFG AVL+   L + GG   +  S 
Sbjct  133   KRDRDGKIS-WHAFDPVYQIWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGKDPLKGSM  191

Query  1011  SVSPEVFQYDSCLNSWSKLASMNVARYDFACAEVNGMVYAVGGNGVNGE-SLSCAEVYDP  835
                  V  Y +  N W +   M   R+ F    +N  +Y  GG    G  SL  AEVYDP
Sbjct  192   R---RVIFYSARTNKWHRAPDMLRRRHFFGSCVINNCLYVAGGENDGGHRSLRSAEVYDP  248

Query  834   DTNKWRVIESLRRPRWGCFGCGFEGKLYVMGGRSSFTIGNSRFV--DVYNPERQSWCEMK  661
             + N+W  I  +        G  +EGK ++ G      +G+ R V  +VY PE  SW  + 
Sbjct  249   NKNRWSFISDMSTAMVPFIGVVYEGKWFLKG------LGSHRQVLSEVYRPETDSWDPVY  302

Query  660   NGCVM--VTAHAVVGKKLFCIEWKNQRKLGIFNPEDNSW  550
             +G V       A +   L+ ++ K+  KL +++   +SW
Sbjct  303   DGMVAGWRNPSASLNGHLYALDCKDGCKLRVYDDVSDSW  341



>ref|XP_010250048.1| PREDICTED: F-box/kelch-repeat protein At1g55270-like isoform 
X1 [Nelumbo nucifera]
Length=428

 Score =   128 bits (322),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 93/279 (33%), Positives = 129/279 (46%), Gaps = 18/279 (6%)
 Frame = -1

Query  1362  SPLLPGLPDDVAKYCLALVPRYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWLYVL  1183
             SPLLPGLPDD+A  CL  VPR     +  V KRW   +    F  +RK   + EEW+YV+
Sbjct  65    SPLLPGLPDDLAIACLIRVPRVEHRKLRLVCKRWYRLLAGNFFYSLRKNLGIAEEWIYVI  124

Query  1182  TVDADGKESHWEVLDCLGHKHHQLPQMPAPIRA--GFGVAVLNA-KLLVMGGYSMIDESA  1012
               D DGK S W   D +      LP +P       GFG AVL+   L + GG   I  S 
Sbjct  125   KRDRDGKIS-WHAFDPIYQLWQPLPPVPGEYAEALGFGCAVLSGCHLYLFGGKDPIKGSM  183

Query  1011  SVSPEVFQYDSCLNSWSKLASMNVARYDFACAEVNGMVYAVGGNGVNGES-LSCAEVYDP  835
                  V  Y +  N W +   M   R+ F    +N  +Y  GG        L  AEVYDP
Sbjct  184   R---RVIFYSARTNKWHRAPDMLRRRHFFGSCVINNCLYVAGGESEGAHRFLRSAEVYDP  240

Query  834   DTNKWRVIESLRRPRWGCFGCGFEGKLYVMGGRSSFTIGNSRFV--DVYNPERQSWCEMK  661
             + N+W  I  +        G  +EG+ ++ G      +G  R V  +VY+PE  SW  + 
Sbjct  241   NKNRWSFIADMSTAMVPFIGVVYEGRWFLKG------LGPHRQVLSEVYHPETDSWYPVY  294

Query  660   NGCVM--VTAHAVVGKKLFCIEWKNQRKLGIFNPEDNSW  550
             NG V         +  +L+ ++ K+  KL +F+   +SW
Sbjct  295   NGMVAGWRNPSTALNGQLYALDCKDGCKLRVFDEASDSW  333



>ref|XP_008242752.1| PREDICTED: F-box/kelch-repeat protein At1g55270-like [Prunus 
mume]
Length=428

 Score =   128 bits (322),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 102/320 (32%), Positives = 145/320 (45%), Gaps = 24/320 (8%)
 Frame = -1

Query  1482  GKKRVTELKMCFSDEMNLD-NPGHSKNISYFTSSVVVDDSYSPLLPGLPDDVAKYCLALV  1306
              KK V   K+C   ++    +P  SK      S +      SPLLPGLPDD+A  CL  V
Sbjct  29    AKKYVPGAKLCLQPDIKPSIHPTRSKPSRGDGSRI-----QSPLLPGLPDDLAIACLIRV  83

Query  1305  PRYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWLYVLTVDADGKESHWEVLDCLGH  1126
             PR     +  V KRW   +    F  +RK   + EEW+Y++  D DGK S W   D +  
Sbjct  84    PRVEHRKLRLVCKRWYRLLVGNFFYSLRKSLGIAEEWIYLIKRDRDGKIS-WHAFDPVYQ  142

Query  1125  KHHQLPQMPAPIRA--GFGVAVLNA-KLLVMGGYSMIDESASVSPEVFQYDSCLNSWSKL  955
                 LP +P       GFG AVL+   L + GG   +  S      V  Y +  N W + 
Sbjct  143   LWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGKDPLKGSMR---RVIFYSARTNKWHRA  199

Query  954   ASMNVARYDFACAEVNGMVYAVGG-NGVNGESLSCAEVYDPDTNKWRVIESLRRPRWGCF  778
               M   R+ F    +N  +Y  GG N     SL  AEVYDP+ N+W  I  +        
Sbjct  200   PDMLRRRHFFGSCVINNCLYVAGGENEGMHRSLRSAEVYDPNKNRWSFISDMSTAMVPFI  259

Query  777   GCGFEGKLYVMGGRSSFTIGNSRFV--DVYNPERQSWCEMKNGCVM--VTAHAVVGKKLF  610
             G  +EGK ++ G      +G+ R V  +VY PE  SW  + +G V       A +   L+
Sbjct  260   GVVYEGKWFLKG------LGSHRQVLSEVYQPENDSWYSVYDGMVAGWRNPSAALNGHLY  313

Query  609   CIEWKNQRKLGIFNPEDNSW  550
              ++ K+  KL +++   +SW
Sbjct  314   ALDCKDGCKLRVYDEATDSW  333



>gb|ADE77005.1| unknown [Picea sitchensis]
Length=389

 Score =   127 bits (320),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 86/249 (35%), Positives = 123/249 (49%), Gaps = 15/249 (6%)
 Frame = -1

Query  1371  DSYSPLLPGLPDDVAKYCLALVPRYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWL  1192
             +SY  ++PGLPDD+A  CLA V   Y   +  V KRWRS IRS E+   +        WL
Sbjct  12    NSYHAIIPGLPDDLALKCLAKVSHGYHGLLEVVCKRWRSLIRSSEYARAKAQEGWCGNWL  71

Query  1191  YVLTVDADGKESHWEVLDCLGHKHHQLPQMPAPI----RAGFGVAVLNAKLLVMGG-YSM  1027
             +VLT   +  +  W   D    + H LP +          GF    +  K LV+GG Y+ 
Sbjct  72    FVLT--EEQIKGPWNAYDPEADRWHALPPISWDSSNYNHRGFSCVTVAKKFLVIGGCYTP  129

Query  1026  ID-----ESASVSPEVFQYDSCLNSWSKLASMNVARYDFACAEVNGMVYAVGGNGV-NGE  865
              D     +  + + EV Q+D     WS++ASM VAR +FACA ++  VY  GG  + N  
Sbjct  130   CDTLGQLKRFTATNEVIQFDPFSKQWSRVASMKVARCNFACAVIHEKVYVAGGCSLSNAS  189

Query  864   SLSCAEVYDPDTNKWRVIESLRRPRWGCFGCGFEGKLYVMGGRSSFTIGNSRFVDVYNPE  685
             +L+ AEVYDP  + W+ I  L   R  C G    G  YV+ G  +      +  +V++P 
Sbjct  190   TLAHAEVYDPVEDSWQDIPPLPSAREDCAGFCCGGLFYVVAGIDN--RAEQKTAEVFDPV  247

Query  684   RQSWCEMKN  658
             + SW   +N
Sbjct  248   KGSWYSHQN  256



>gb|KHG22975.1| hypothetical protein F383_01278 [Gossypium arboreum]
Length=438

 Score =   128 bits (322),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 100/320 (31%), Positives = 149/320 (47%), Gaps = 26/320 (8%)
 Frame = -1

Query  1482  GKKRVTELKMCFSDEMNLDNPGHSKNISYFTSSVVVDDSYSPLLPGLPDDVAKYCLALVP  1303
              +K V   K+C   ++N  N   SK+     S V       PLLPGLPDD+A  CL  VP
Sbjct  42    ARKFVPGSKLCIQPDIN-PNAHKSKSSRKERSRV-----QHPLLPGLPDDLAIACLIRVP  95

Query  1302  RYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWLYVLTVDADGKESHWEVLDCLGHK  1123
             R     +  V KRW   +    F  +RK   + EEW+YVL  D DGK S W   D +   
Sbjct  96    RAEHRKLRLVCKRWYHLLAGNFFFSLRKSLGMAEEWVYVLKRDRDGKIS-WNAFDPIHQL  154

Query  1122  HHQLPQMPAPIRA--GFGVAVLNA-KLLVMGGYSMIDESASVSPEVFQYDSCLNSWSKLA  952
                LP +P       GFG AVL+   L + GG   +  S      V  Y++  N W +  
Sbjct  155   WQPLPPVPREYSEALGFGCAVLSGCHLYLFGGKDPLRGSMR---RVVFYNARTNKWHRAP  211

Query  951   SMNVARYDFACAEVNGMVYAVGG--NGVNGESLSCAEVYDPDTNKWRVIESLRRPRWGCF  778
              M   R+ F    +N  +Y  GG  +G++  +L  AEVYDP+ N+W  ++ +        
Sbjct  212   GMLRKRHFFGSCVINNRLYVAGGECDGIH-RTLRSAEVYDPNKNRWSFVQDMSTAMVPFI  270

Query  777   GCGFEGKLYVMGGRSSFTIGNSRFV--DVYNPERQSWCEMKNGCVM--VTAHAVVGKKLF  610
             G  ++GK +V G      +G+ R V  + Y+PE  SW  +  G V         +  KL+
Sbjct  271   GVVYDGKWFVKG------LGSHREVMSEAYDPESNSWSAVSGGMVSGWRNPSISLNGKLY  324

Query  609   CIEWKNQRKLGIFNPEDNSW  550
              ++ ++  KL +++   +SW
Sbjct  325   ALDCRDGCKLRVYDGATDSW  344



>ref|XP_009353463.1| PREDICTED: F-box/kelch-repeat protein At1g16250-like [Pyrus x 
bretschneideri]
Length=383

 Score =   127 bits (320),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 74/244 (30%), Positives = 121/244 (50%), Gaps = 16/244 (7%)
 Frame = -1

Query  1356  LLPGLPDDVAKYCLALVPRYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWLYVLTV  1177
             ++PGLPDD+A  CLA+V   Y   +  V+K WR  +RS ++   +        WL+VLT 
Sbjct  8     VIPGLPDDLALRCLAMVSHGYHGLLETVSKTWRDLLRSSDYANYKAREEWCGNWLFVLT-  66

Query  1176  DADGKESHWEVLDCLGHKHHQLPQMPAP----IRAGF-GVAVLNAKLLVMGGYSMID---  1021
               +G  + W   D    + H LP++P         GF  ++V N   ++ G Y   D   
Sbjct  67    --EGSNNEWVAYDSEADRWHPLPKIPTVHGDWKHTGFSSISVCNRFFVIGGSYEQNDPPV  124

Query  1020  --ESASVSPEVFQYDSCLNSWSKLASMNVARYDFACAEVNGMVYAVGGNGVN-GESLSCA  850
               +   V+ EV  +D     W+ +ASM   R  FAC+ V+G +Y  GG  ++    L+ A
Sbjct  125   PHKKPLVTNEVMLFDPFKKQWTSVASMITPRTHFACSVVSGKIYVTGGRNLSCTRGLALA  184

Query  849   EVYDPDTNKWRVIESLRRPRWGCFGCGFEGKLYVMGGRSSFTIGNSRFVDVYNPERQSWC  670
             EVYDP  NKW  +  +  P+  C G  ++G+ +V+  +      N+   +V+ P   +WC
Sbjct  185   EVYDPVANKWEELPPMLNPQMDCLGLSYKGRFHVLSDQVGLPDQNTS--EVFTPSEGTWC  242

Query  669   EMKN  658
              +++
Sbjct  243   TVED  246



>ref|XP_008360210.1| PREDICTED: F-box/kelch-repeat protein At1g16250-like [Malus domestica]
Length=386

 Score =   127 bits (320),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 72/244 (30%), Positives = 121/244 (50%), Gaps = 16/244 (7%)
 Frame = -1

Query  1356  LLPGLPDDVAKYCLALVPRYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWLYVLTV  1177
             ++PGLPDD+A  CLA+V   Y   +  V+K WR  + S ++   +        WL+VLT 
Sbjct  8     IIPGLPDDLALRCLAMVSHGYHGLLETVSKTWRDLLHSSDYANYKAREEWCGNWLFVLT-  66

Query  1176  DADGKESHWEVLDCLGHKHHQLPQMPAP----IRAGF-GVAVLNAKLLVMGGYSMID---  1021
               +G  + W   D    + H LP++P         GF  ++V N   ++ G Y+  D   
Sbjct  67    --EGSNNEWVAYDPEADRWHPLPKIPTVHGDWKHTGFSSISVCNQFFVIGGSYAQNDPPV  124

Query  1020  --ESASVSPEVFQYDSCLNSWSKLASMNVARYDFACAEVNGMVYAVGGNGVN-GESLSCA  850
               +   ++ EV Q+D     W+ +ASM   R  FAC+ V+  +Y  GG  ++    L+ A
Sbjct  125   PHKKPLITNEVMQFDPFKKQWTSVASMITPRTHFACSVVSDKIYVAGGRNLSCTRGLALA  184

Query  849   EVYDPDTNKWRVIESLRRPRWGCFGCGFEGKLYVMGGRSSFTIGNSRFVDVYNPERQSWC  670
             EVYDP  NKW  +  +  P+  C G  ++G+ +V+  +      N+   +V+ P   +WC
Sbjct  185   EVYDPXANKWEELPPMLNPQMDCLGLSYKGRFHVLSDQVGLPDQNTS--EVFTPSEGTWC  242

Query  669   EMKN  658
              +++
Sbjct  243   TVEB  246



>emb|CDY54825.1| BnaC03g75770D [Brassica napus]
Length=193

 Score =   123 bits (308),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 68/193 (35%), Positives = 111/193 (58%), Gaps = 11/193 (6%)
 Frame = -1

Query  948  MNVARYDFACAEVNGMVYAVGGNGVNGESLSCAEVYDPDTNKWRVIESLRRPRWGCFGCG  769
            MN+ R+DFACA V+G++Y V G     E +  AEVY+P+TN+W +++   R   G F   
Sbjct  1    MNIPRHDFACAVVDGLLYVVRGKDSCREHILSAEVYNPETNQWSLMDCPDRHVLGDFAFS  60

Query  768  FEGKLYVMGGRSSFTIGNSRFVDVYNPERQSWCEMKNG-CVMVTAHAVVGKKLFCIEWKN  592
            F+ KLY +          SRF+DVY+P+ ++W E+ +G  ++V ++ V+  K++ +++ N
Sbjct  61   FKSKLYAVS-------NGSRFIDVYDPKTKTWEELDSGKSLLVYSYTVIRNKVYFLDY-N  112

Query  591  QRKLGIFNPEDNSWKMVGVPVTGSSSIGFRLGILDEKLLLFSLQENPTYTTLLYDPNAAA  412
               LG+F+ E+NSW  V VP    S   FRL   + K++L +  +   Y  L  D +   
Sbjct  113  MSGLGVFDLEENSWSSVFVPHESRSDSWFRLREWNNKVILIAGFQG--YNALTGDLDKED  170

Query  411  GSEWQTCEIKPSG  373
             S+W   +I+PSG
Sbjct  171  ASKWTVTQIRPSG  183



>emb|CDY02451.1| BnaA08g00580D [Brassica napus]
Length=435

 Score =   127 bits (320),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 97/320 (30%), Positives = 144/320 (45%), Gaps = 25/320 (8%)
 Frame = -1

Query  1482  GKKRVTELKMCFSDEMNLDNPGHSKNISYFTSSVVVDDSYSPLLPGLPDDVAKYCLALVP  1303
              +K V   K+C   ++N +    SKN     + +       PLLPGLPDD+A  CL  VP
Sbjct  42    ARKFVPGSKLCIQPDINPNAHRRSKNSKRERTRI-----QPPLLPGLPDDLAVACLIRVP  96

Query  1302  RYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWLYVLTVDADGKESHWEVLDCLGHK  1123
             R     +  V KRW        F   RKL  + EEW+YV   D DGK S W   D +   
Sbjct  97    RSDHRKLRLVCKRWYRLASGNFFYSQRKLLRMSEEWVYVFKRDRDGKIS-WNTFDPVSQH  155

Query  1122  HHQLPQMPAPIR--AGFGVAVLNA-KLLVMGGYSMIDESASVSPEVFQYDSCLNSWSKLA  952
                LP +P       GFG AVL+   L + GG   +  S      V  Y++  N W +  
Sbjct  156   PQPLPPVPREYSEAVGFGCAVLSGCHLYLFGGKDPLRGSMR---RVIFYNARTNKWHRAP  212

Query  951   SMNVARYDFACAEVNGMVYAVGG--NGVNGESLSCAEVYDPDTNKWRVIESLRRPRWGCF  778
              M   R+ F C  +N  +Y  GG   G+   +L  AEVYDP+ N+W  +  +        
Sbjct  213   DMLRKRHFFGCCVINNCLYVAGGECEGIQ-RTLRSAEVYDPNKNRWSFVADMSTAMVPLI  271

Query  777   GCGFEGKLYVMGGRSSFTIGNSRFVDVYNPERQSWCEMKNGCVMVTAH----AVVGKKLF  610
             G  ++ K ++ G  S   +      + Y+PE  SW  + +G  MVT        +  +L+
Sbjct  272   GVVYDKKWFLKGLGSHQQV----MSEAYDPESNSWSPVSDG--MVTGWRNPCTSLNGRLY  325

Query  609   CIEWKNQRKLGIFNPEDNSW  550
              ++ ++  KL +F+   +SW
Sbjct  326   GLDCRDGCKLRVFDETTDSW  345



>ref|XP_006392663.1| hypothetical protein EUTSA_v10011496mg [Eutrema salsugineum]
 gb|ESQ29949.1| hypothetical protein EUTSA_v10011496mg [Eutrema salsugineum]
Length=434

 Score =   127 bits (320),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 99/320 (31%), Positives = 144/320 (45%), Gaps = 26/320 (8%)
 Frame = -1

Query  1482  GKKRVTELKMCFSDEMNLDNPGHSKNISYFTSSVVVDDSYSPLLPGLPDDVAKYCLALVP  1303
              +K V   K+C   ++N  N    KN     + +       PLLPGLPDD+A  CL  VP
Sbjct  42    ARKFVPGSKLCIQPDIN-PNAHRRKNSKRERTRI-----QPPLLPGLPDDLAVACLIRVP  95

Query  1302  RYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWLYVLTVDADGKESHWEVLDCLGHK  1123
             R     +  V KRW        F   RKL  + EEW+YV   D DGK S W   D + H 
Sbjct  96    RAEHRKLRLVCKRWYRLASGNFFYSQRKLLGMSEEWVYVFKRDRDGKIS-WNTFDPVSHL  154

Query  1122  HHQLPQMPAPIR--AGFGVAVLNA-KLLVMGGYSMIDESASVSPEVFQYDSCLNSWSKLA  952
                LP +P       GFG AVL+   L + GG   +  S      V  Y++  N W +  
Sbjct  155   GQPLPPVPREYSEAVGFGCAVLSGCHLYLFGGKDPLRGSMR---RVVFYNARTNKWHRAP  211

Query  951   SMNVARYDFACAEVNGMVYAVGG--NGVNGESLSCAEVYDPDTNKWRVIESLRRPRWGCF  778
              M   R+ F C  +N  +Y  GG   G+   +L  AEVYDP+ N+W  I  +        
Sbjct  212   DMLRKRHFFGCCVINNCLYVAGGECEGIQ-RTLRSAEVYDPNKNRWSFIADMSTAMVPLI  270

Query  777   GCGFEGKLYVMGGRSSFTIGNSRFVDVYNPERQSWCEMKNGCVMVTAH----AVVGKKLF  610
             G  ++ K ++ G  S   +      + Y+PE  SW  + +G  MVT        +  +L+
Sbjct  271   GVVYDKKWFLKGLGSHQQV----MSEAYDPETNSWSPVSDG--MVTGWRNPCTSLNGRLY  324

Query  609   CIEWKNQRKLGIFNPEDNSW  550
              ++ ++  KL +F+   +SW
Sbjct  325   GLDCRDGCKLRVFDESTDSW  344



>ref|XP_004297025.1| PREDICTED: F-box/kelch-repeat protein At1g16250-like [Fragaria 
vesca subsp. vesca]
Length=379

 Score =   127 bits (318),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 74/247 (30%), Positives = 127/247 (51%), Gaps = 16/247 (6%)
 Frame = -1

Query  1365  YSPLLPGLPDDVAKYCLALVPRYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWLYV  1186
             +  ++PGLPDD+A  CL  +   Y   +  V+K+W+  IRS +F   +    L   WL+V
Sbjct  5     HQAIIPGLPDDLALRCLTKLSHGYHGLVETVSKKWKDLIRSSDFANYKAREGLCGNWLFV  64

Query  1185  LTVDADGKESHWEVLDCLGHKHHQLPQMPAPIRAG--FG---VAVLNAKLLVMGGYSMID  1021
             LT   +G ++ W   D    + H LP++P+    G  +G   ++V N   ++ G YS ++
Sbjct  65    LT---EGSDNEWVAYDPEADRWHPLPKIPSVHAEGRHYGFSCISVCNQFFVIGGSYSRVN  121

Query  1020  ESAS-----VSPEVFQYDSCLNSWSKLASMNVARYDFACAEVNGMVYAVGGNGVN-GESL  859
              +       V+ EV Q+D     W+ +ASM   R  FAC+ V+G +Y  GG  ++    L
Sbjct  122   PAFPHHRPLVTNEVMQFDPFQKQWTNVASMITPRSHFACSVVSGKIYVAGGRNLSCTRGL  181

Query  858   SCAEVYDPDTNKWRVIESLRRPRWGCFGCGFEGKLYVMGGRSSFTIGNSRFVDVYNPERQ  679
             + AEVYDP  +KW  +  +   +  C G  ++GK +V+  +      N+   +V++    
Sbjct  182   ALAEVYDPVADKWEELPPMPHAQMDCLGLSYKGKFHVLSDQVGLRDQNTS--EVFSLSDG  239

Query  678   SWCEMKN  658
             +WC M++
Sbjct  240   TWCTMED  246



>emb|CDY10574.1| BnaC03g70400D [Brassica napus]
Length=435

 Score =   127 bits (319),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 97/320 (30%), Positives = 144/320 (45%), Gaps = 25/320 (8%)
 Frame = -1

Query  1482  GKKRVTELKMCFSDEMNLDNPGHSKNISYFTSSVVVDDSYSPLLPGLPDDVAKYCLALVP  1303
              +K V   K+C   ++N +    SKN     + +       PLLPGLPDD+A  CL  VP
Sbjct  42    ARKFVPGSKLCIQPDINPNAHRRSKNSKRERTRI-----QPPLLPGLPDDLAVACLIRVP  96

Query  1302  RYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWLYVLTVDADGKESHWEVLDCLGHK  1123
             R     +  V KRW        F   RKL  + EEW+YV   D DGK S W   D +   
Sbjct  97    RSDHRKLRLVCKRWYRLASGNFFYSQRKLLKMSEEWVYVFKRDRDGKIS-WNTFDPVSQY  155

Query  1122  HHQLPQMPAPIR--AGFGVAVLNA-KLLVMGGYSMIDESASVSPEVFQYDSCLNSWSKLA  952
                LP +P       GFG AVL+   L + GG   +  S      V  Y++  N W +  
Sbjct  156   PQPLPPVPREYSEAVGFGCAVLSGCHLYLFGGKDPLRGSMR---RVIFYNARTNKWHRAP  212

Query  951   SMNVARYDFACAEVNGMVYAVGG--NGVNGESLSCAEVYDPDTNKWRVIESLRRPRWGCF  778
              M   R+ F C  +N  +Y  GG   G+   +L  AEVYDP+ N+W  +  +        
Sbjct  213   DMLRKRHFFGCCVINNCLYVAGGECEGIQ-RTLRSAEVYDPNKNRWSFVADMSTAMVPLI  271

Query  777   GCGFEGKLYVMGGRSSFTIGNSRFVDVYNPERQSWCEMKNGCVMVTAH----AVVGKKLF  610
             G  ++ K ++ G  S   +      + Y+PE  SW  + +G  MVT        +  +L+
Sbjct  272   GVVYDKKWFLKGLGSHQQV----MSEAYDPESNSWSPVSDG--MVTGWRNPCTSLNGRLY  325

Query  609   CIEWKNQRKLGIFNPEDNSW  550
              ++ ++  KL +F+   +SW
Sbjct  326   GLDCRDGCKLRVFDESTDSW  345



>ref|XP_003529944.1| PREDICTED: F-box/kelch-repeat protein SKIP4-like [Glycine max]
Length=361

 Score =   126 bits (316),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 90/291 (31%), Positives = 145/291 (50%), Gaps = 23/291 (8%)
 Frame = -1

Query  1377  VDDSYSPLLPGLPDDVAKYCLALVPRYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEE  1198
             V+ + SP++ GLPDD++  CLA +PR Y   M  V+KRWR+ I S+E+   R+   L E 
Sbjct  17    VEVTNSPIICGLPDDISLMCLARIPRKYHSVMKCVSKRWRNLICSEEWFCYRRKHKLDET  76

Query  1197  WLYVLTVDADGKESHWEVLDCLGHKHHQL-PQMPAPI--RAGFGVAVLNAKLLVMGGYSM  1027
             W+Y L  D   +   + +   L  ++ +L   +P  I  R G G   L  KL ++GG S 
Sbjct  77    WIYALCRDKSNEIFCYVLDPTLSRRYWKLIDNLPPQISKRKGIGFEALGNKLFLLGGCSE  136

Query  1026  IDESASVSPEVFQYDSCLNSWSKLASMNVARYDFACAEVNGMVYAVGGNGVNGESLSCAE  847
               +S   + EV+ YD+  N W++  S++ ARY+F C  ++  +YA+GG G +  S    E
Sbjct  137   FLDS---TDEVYSYDASSNCWAQATSLSTARYNFGCEVLDKKLYAIGGGG-SKSSYHSWE  192

Query  846   VYDPDTNKW------RVIESLRRPRWGCFGCGFEGKLYVMGGRSSFTIGNSRFVDVYNPE  685
              +DP TN W      +++  ++           +GK+YV   R  + +    F  VY P 
Sbjct  193   TFDPLTNCWTSQTDPKIVNEIKD------SVVLDGKIYVRCSR--YPVTPHVFAVVYEPS  244

Query  684   RQSWCEMKNGCVM-VTAHAV-VGKKLFCIEWKNQRKLGIFNPEDNSWKMVG  538
               +W    +  V   T  AV V   L+ ++     KL +++ E   W +VG
Sbjct  245   SGTWEYADDDMVSGWTGPAVAVDGTLYVLDQSAGTKLMMWHKERREWILVG  295



>ref|XP_009106890.1| PREDICTED: F-box/kelch-repeat protein At1g55270 [Brassica rapa]
Length=435

 Score =   126 bits (317),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 96/320 (30%), Positives = 143/320 (45%), Gaps = 25/320 (8%)
 Frame = -1

Query  1482  GKKRVTELKMCFSDEMNLDNPGHSKNISYFTSSVVVDDSYSPLLPGLPDDVAKYCLALVP  1303
              +K V   K+C   ++N +    SKN     + +       PLLPGLPDD+A  CL  VP
Sbjct  42    ARKFVPGSKLCIQPDINPNAHRRSKNSKRERTRI-----QPPLLPGLPDDLAVACLIRVP  96

Query  1302  RYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWLYVLTVDADGKESHWEVLDCLGHK  1123
             R     +  V KRW        F   RKL  + EEW+YV   D DGK S W   D +   
Sbjct  97    RSDHRKLRLVCKRWYRLASGNFFYSQRKLLRMSEEWVYVFKRDRDGKIS-WNTFDPVSQH  155

Query  1122  HHQLPQMPAPIR--AGFGVAVLNA-KLLVMGGYSMIDESASVSPEVFQYDSCLNSWSKLA  952
                LP +P       GFG  VL+   L + GG   +  S      V  Y++  N W +  
Sbjct  156   PQPLPPVPREYSEAVGFGCGVLSGCHLYLFGGKDPLRGSMR---RVIFYNARTNKWHRAP  212

Query  951   SMNVARYDFACAEVNGMVYAVGG--NGVNGESLSCAEVYDPDTNKWRVIESLRRPRWGCF  778
              M   R+ F C  +N  +Y  GG   G+   +L  AEVYDP+ N+W  +  +        
Sbjct  213   DMLRKRHFFGCCVINNCLYVAGGECEGIQ-RTLRSAEVYDPNKNRWSFVADMSTAMVPLI  271

Query  777   GCGFEGKLYVMGGRSSFTIGNSRFVDVYNPERQSWCEMKNGCVMVTAH----AVVGKKLF  610
             G  ++ K ++ G  S   +      + Y+PE  SW  + +G  MVT        +  +L+
Sbjct  272   GVVYDKKWFLKGLGSHQQV----MSEAYDPESNSWSPVSDG--MVTGWRNPCTSLNGRLY  325

Query  609   CIEWKNQRKLGIFNPEDNSW  550
              ++ ++  KL +F+   +SW
Sbjct  326   GLDCRDGCKLRVFDETTDSW  345



>ref|XP_010534884.1| PREDICTED: F-box/kelch-repeat protein At1g55270 [Tarenaya hassleriana]
Length=436

 Score =   126 bits (316),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 97/318 (31%), Positives = 142/318 (45%), Gaps = 22/318 (7%)
 Frame = -1

Query  1482  GKKRVTELKMCFSDEMNLDNPGHSKNISYFTSSVVVDDSYSPLLPGLPDDVAKYCLALVP  1303
              +K V   K+C   ++N  N    KN     + V       PLLPGLPDD+A  CL  VP
Sbjct  42    ARKFVPGSKLCIQPDIN-PNAHRRKNSRRERTRV-----QPPLLPGLPDDLAVACLIRVP  95

Query  1302  RYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWLYVLTVDADGKESHWEVLDCLGHK  1123
             R     +  V KRW   +    F   RKL  + EEW+YVL  D DGK S W   D +   
Sbjct  96    RAEHRKLRLVCKRWYRLVSGNFFYSQRKLLGMAEEWVYVLKRDRDGKIS-WNAFDTVHQL  154

Query  1122  HHQLPQMPAPIR--AGFGVAVLNA-KLLVMGGYSMIDESASVSPEVFQYDSCLNSWSKLA  952
                LP +P       GFG AVL+   L + GG   +  S      V  Y++  N W +  
Sbjct  155   WQPLPPVPREYSEAVGFGCAVLSGCHLYLFGGKDPLRGSMR---RVVFYNARTNKWHRAP  211

Query  951   SMNVARYDFACAEVNGMVYAVGG--NGVNGESLSCAEVYDPDTNKWRVIESLRRPRWGCF  778
              M   R+ F    +N  +Y  GG   G+   +L  AEVYDP+  +W  +  +        
Sbjct  212   DMLRKRHFFGSCVINNCLYVAGGECEGIQ-RTLRSAEVYDPNKTRWSFVSDMSTAMVPLI  270

Query  777   GCGFEGKLYVMGGRSSFTIGNSRFVDVYNPERQSWCEMKNGCVM--VTAHAVVGKKLFCI  604
             G  ++GK ++ G  S   +      + Y+PE  SW  M +G V         +  +L+ +
Sbjct  271   GVVYDGKWFLKGLGSHQEV----MSEAYDPETNSWSPMSDGMVAGWRNPCTSLDGRLYAL  326

Query  603   EWKNQRKLGIFNPEDNSW  550
             + ++  KL I++   +SW
Sbjct  327   DCRDGCKLRIYDESTDSW  344



>emb|CDX96822.1| BnaA08g23650D [Brassica napus]
Length=432

 Score =   126 bits (316),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 75/254 (30%), Positives = 125/254 (49%), Gaps = 16/254 (6%)
 Frame = -1

Query  1386  SVVVDDSYSPLLPGLPDDVAKYCLALVPRYYFPAMGGVNKRWRSFIRSKEFIMVRKLACL  1207
             S ++D +   ++PGLPDD+A  CLA +   +  A+  V++ WR  +RS ++   +     
Sbjct  47    SQIMDSTEQSIIPGLPDDLALRCLAKLSHGHHGALECVSRGWRDLLRSADYSCFKSRNGW  106

Query  1206  LEEWLYVLTVDADGKESHWEVLDCLGHKHHQLPQMPAPI----RAGFGVAVLNAKLLVMG  1039
                WL+VLT   +  ++ W   D    + H LP+  A       +GF    ++  LLV+G
Sbjct  107   FGTWLFVLT---EQSKNQWVAYDPEADRWHPLPRTRAVQDGWHHSGFACVCVSNCLLVIG  163

Query  1038  G------YSMIDESASVSPEVFQYDSCLNSWSKLASMNVARYDFACAEVNGMVYAVGG-N  880
             G       S   +   V+ +V ++D     W  +ASM   R  FAC  V+G VY  GG N
Sbjct  164   GCYAPSVSSFPHQKPVVTGDVMRFDPFKKEWRMVASMRTPRTHFACCAVSGKVYVAGGRN  223

Query  879   GVNGESLSCAEVYDPDTNKWRVIESLRRPRWGCFGCGFEGKLYVMGGRSSFTIGNSRFVD  700
               +   ++ AEVYDP  ++W  + ++ RP+  C G  + G  +V+  +  F      F +
Sbjct  224   LTHSRGITSAEVYDPVADRWEELPAMPRPQMDCSGLSYRGSFHVLSDQVGF--AEQSFSE  281

Query  699   VYNPERQSWCEMKN  658
             V+NP   SW  +++
Sbjct  282   VFNPLEMSWSTVED  295



>ref|XP_008784962.1| PREDICTED: F-box/kelch-repeat protein At1g55270-like [Phoenix 
dactylifera]
Length=431

 Score =   126 bits (316),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 93/283 (33%), Positives = 133/283 (47%), Gaps = 22/283 (8%)
 Frame = -1

Query  1368  SYSPLLPGLPDDVAKYCLALVPRYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWLY  1189
             S SPLLPGLPDD+A  CL  VPR     +  V KRW   +    F  +RK   + EEW+Y
Sbjct  71    SQSPLLPGLPDDLAIACLIRVPRAEHRKLRLVCKRWYRLLAGNYFYSLRKSLGIAEEWIY  130

Query  1188  VLTVDADGKESHWEVLDCLGHKHHQLPQMPAPIRA--GFGVAVLNA-KLLVMGGYSMIDE  1018
             V+  D DG+ S W+  D + H  H LP +P       GFG AVL+   L + GG    D 
Sbjct  131   VIKRDRDGRIS-WDAFDPVYHLWHPLPPIPGEYSGALGFGCAVLSGCHLYLFGGK---DP  186

Query  1017  SASVSPEVFQYDSCLNSWSKLASMNVARYDFACAEVNGMVYAVGGNGVN-GESLSCAEVY  841
                    V  Y +  N W +   M   R+ F    +N  +Y  GG       SL  AEVY
Sbjct  187   QKGSMRRVIFYSARTNKWHRAPDMLRRRHFFGSCVMNNCLYVAGGESEGFHHSLRSAEVY  246

Query  840   DPDTNKWRVIESLRRPRWGCFGCGFEGKLYVMGGRSSFTIGNSRFV--DVYNPERQSWCE  667
             DP+ N+W  I  +        G  +EGK ++ G      +G+ R V  +VY PE   W  
Sbjct  247   DPNKNRWAFIADMSTAMVPFIGVVYEGKWFLKG------LGSQRQVLSEVYVPEADGWYP  300

Query  666   MKNGCVMVTA----HAVVGKKLFCIEWKNQRKLGIFNPEDNSW  550
               +G  MVT        +  +L+ ++ ++  +L +++   +SW
Sbjct  301   AFDG--MVTGWRNPSVCLNGRLYSLDCEDGCRLRVYDGATDSW  341



>ref|XP_008369571.1| PREDICTED: F-box/kelch-repeat protein At1g16250 [Malus domestica]
Length=386

 Score =   125 bits (314),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 82/289 (28%), Positives = 138/289 (48%), Gaps = 21/289 (7%)
 Frame = -1

Query  1356  LLPGLPDDVAKYCLALVPRYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWLYVLTV  1177
             ++PGL DD+A  CLA V   Y   +  V+K WR  +RS ++   +       +WL+VLT 
Sbjct  8     IIPGLSDDLALRCLAKVSHGYHGLLETVSKTWRDLLRSSDYANYKAREGWCGDWLFVLT-  66

Query  1176  DADGKESHWEVLDCLGHKHHQLPQMPAP----IRAGF-GVAVLNAKLLVMGGYSMID---  1021
               +G  + W   D    + H LP++P         GF  + V N   ++ G Y+  D   
Sbjct  67    --EGSNNEWVAYDPEADRWHPLPKIPTAHGDWKHFGFSSIGVCNRFFVIGGSYAQNDPPV  124

Query  1020  --ESASVSPEVFQYDSCLNSWSKLASMNVARYDFACAEVNGMVYAVGGNGVN-GESLSCA  850
               + + V+ EV Q+D     W+ +ASM   R  FAC+ V+G +Y VGG  ++    L+ A
Sbjct  125   PHQKSLVTNEVMQFDPFKKQWTSVASMLTPRTHFACSVVSGKIYVVGGRNLSCTRGLALA  184

Query  849   EVYDPDTNKWRVIESLRRPRWGCFGCGFEGKLYVMGGRSSFTIGNSRFVDVYNPERQSWC  670
             EVYDP  NKW  +  +  P+  C G  F+G+ +V+  +      N+   +V+ P   +W 
Sbjct  185   EVYDPVANKWEELPPMLNPQMDCLGLSFKGRFHVLSDQVGLPDQNTS--EVFTPSDGTWR  242

Query  669   EMKN----GCVMVTAHAVVG-KKLFCIEWKNQRKLGIFNPEDNSWKMVG  538
              +++       M  A  V+G  +++ +    +  +   + E   W  +G
Sbjct  243   TVEDIWPFSRAMQFAAQVIGDNRIYTVVDWGESLIKTRDTEKGEWYTIG  291



>gb|EPS58278.1| hypothetical protein M569_16536 [Genlisea aurea]
Length=437

 Score =   126 bits (316),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 95/312 (30%), Positives = 145/312 (46%), Gaps = 25/312 (8%)
 Frame = -1

Query  1458  KMCFSDEMNLDNPGHSKNISYFTSSVVVDDSYSPLLPGLPDDVAKYCLALVPRYYFPAMG  1279
             K+C   ++N   P   K+ +     + V     PLLPGLPDD+A  CL  VPR+    + 
Sbjct  49    KLCIQPDIN---PRAHKSKNSRRERIRVQQP--PLLPGLPDDLAIACLIRVPRFEHNKLR  103

Query  1278  GVNKRWRSFIRSKEFIMVRKLACLLEEWLYVLTVDADGKESHWEVLDCLGHKHHQLPQMP  1099
              V KRW   +    F  +RK   + EEW+YV+  D DG+ S W   D +      LP +P
Sbjct  104   LVCKRWFKLLSGNFFYSLRKSLGMAEEWVYVIKRDRDGQIS-WHAFDLIYQMWQPLPPVP  162

Query  1098  APIRA--GFGVAVLNA-KLLVMGGYSMIDESASVSPEVFQYDSCLNSWSKLASMNVARYD  928
                    GFG AVL+   L + GG   +    S+   +F Y++  N W +   M   R+ 
Sbjct  163   VEYSGALGFGCAVLSGCHLYLFGGKDPL--KGSMRRMIF-YNARTNKWHRAPDMLRRRHF  219

Query  927   FACAEVNGMVYAVGG--NGVNGESLSCAEVYDPDTNKWRVIESLRRPRWGCFGCGFEGKL  754
             F C  VN  +Y  GG   G+   +L  AEV+DP+ N+W  I  +        G  ++GK 
Sbjct  220   FGCCVVNNCLYVAGGECEGIQ-RTLRSAEVFDPNRNRWSFISEMSTAMVPFIGVVYDGKW  278

Query  753   YVMGGRSSFTIGNSRFV--DVYNPERQSWCEMKNGCVM--VTAHAVVGKKLFCIEWKNQR  586
             ++ G      +G  R V  + Y PE   W  + NG V         +  KL+ ++ ++  
Sbjct  279   FLKG------LGTHREVLSEAYAPETNVWSRVNNGMVSGWRNPSVSLNGKLYALDCRDGC  332

Query  585   KLGIFNPEDNSW  550
             KL +++   +SW
Sbjct  333   KLRMYDESTDSW  344



>ref|XP_002986564.1| hypothetical protein SELMODRAFT_124089 [Selaginella moellendorffii]
 gb|EFJ12421.1| hypothetical protein SELMODRAFT_124089 [Selaginella moellendorffii]
Length=418

 Score =   125 bits (315),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 94/319 (29%), Positives = 148/319 (46%), Gaps = 30/319 (9%)
 Frame = -1

Query  1356  LLPGLPDDVAKYCLALVPRYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWLYVLTV  1177
             L+PGLP+D+A  C+A +PR  FP +  V+  W+  + S+ F ++R     L+ W+YVL  
Sbjct  49    LIPGLPNDLAILCIARLPRGMFPLLRLVSSAWKRAVSSETFRLLRHQGGFLQGWIYVLVE  108

Query  1176  DADGKESHWEVLDCLGHKHHQLPQMPAPIRA----GFGVAVLNAKLLVMGGYSMIDESAS  1009
              A G  + +   D   ++ + +  +PA I +    GF    L++KL++MGG   I   A+
Sbjct  109   SATG--AAFRAFDPDANRWYNMSPVPANISSETWQGFACVALDSKLILMGGARRIYNEAT  166

Query  1008  -------VSPEVFQYDSCLNSWSKLASMNVARYDFACAEVNGMVYAVGGNGVNGESLSCA  850
                    V  +VF YD+  N W +  S+   R  FA A +   VY  GG G +   L  A
Sbjct  167   QQLGQVEVCGDVFIYDAFRNKWQRGPSLTTPRGWFAAAAIGDFVYVAGGQGRSC-FLDSA  225

Query  849   EVYDPDTNKWRVIESLRRPRWGCFGCGFEGKLYVMGGRSSFTIGN------SRFVDVYNP  688
             EV D    +W  + S+   R  C G    G+ +V+ G     I N          + +NP
Sbjct  226   EVLDYREKRWHQMPSMHCVRSSCRGTVLNGQFWVIAGE--VVINNYGDHPQRASAEFFNP  283

Query  687   ERQSWCEMKNGCVMVTAHAVVGKKLFCIEWKNQRKLGIFNPEDNSWKMVGVPVTG-----  523
               +SW  +    + + +H V   +   +   +Q KL  ++PE N W  +G   TG     
Sbjct  284   ASKSWTLIPE--MWLDSHKVALARSQNLLVVHQSKLMRYDPELNEWDHIGHISTGKLYNR  341

Query  522   -SSSIGFRLGILDEKLLLF  469
              S   GF L  L +KL + 
Sbjct  342   SSYRFGFALECLGDKLYVI  360



>ref|XP_002527061.1| Protein AFR, putative [Ricinus communis]
 gb|EEF35305.1| Protein AFR, putative [Ricinus communis]
Length=437

 Score =   125 bits (315),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 98/320 (31%), Positives = 147/320 (46%), Gaps = 26/320 (8%)
 Frame = -1

Query  1482  GKKRVTELKMCFSDEMNLDNPGHSKNISYFTSSVVVDDSYSPLLPGLPDDVAKYCLALVP  1303
              +K V   K+C   ++N  N   SKN+    + V       PLLPGLPDD+A  CL  VP
Sbjct  41    ARKFVPGSKLCIQPDIN-PNAHKSKNLRRERTRV-----QPPLLPGLPDDLAIACLIRVP  94

Query  1302  RYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWLYVLTVDADGKESHWEVLDCLGHK  1123
             R     +  V KRW   +    F  +RK   + EEW+YV+  D DGK S W   D +   
Sbjct  95    RAEHRKLRLVCKRWYRLLAGNFFYSLRKSLGMAEEWVYVIKRDRDGKIS-WNAFDPIYQL  153

Query  1122  HHQLPQMPAPIRA--GFGVAVLNA-KLLVMGGYSMIDESASVSPEVFQYDSCLNSWSKLA  952
                LP +P       GFG AVL+   L + GG   +  S      V  Y +  N W +  
Sbjct  154   WQPLPPVPREYSEALGFGCAVLSGCHLYLFGGKDPLRGSMR---RVIFYSARTNKWHRAP  210

Query  951   SMNVARYDFACAEVNGMVYAVGG--NGVNGESLSCAEVYDPDTNKWRVIESLRRPRWGCF  778
              M   R+ F    +N  +Y  GG   G+   +L  AEVYDP+ N+W  I  +        
Sbjct  211   DMLRKRHFFGSCVINNCLYVAGGECEGIQ-RTLRSAEVYDPNKNRWSFISDMSTAMVPFI  269

Query  777   GCGFEGKLYVMGGRSSFTIGNSRFV--DVYNPERQSWCEMKNGCV--MVTAHAVVGKKLF  610
             G  ++GK ++ G      +G+ R V  + Y+PE  SW  + +G V         +  +L+
Sbjct  270   GVVYDGKWFLKG------LGSHREVLSEAYDPETNSWTPISDGMVGGWRNPSISLNGQLY  323

Query  609   CIEWKNQRKLGIFNPEDNSW  550
              ++ ++  KL +++   +SW
Sbjct  324   ALDCRDGCKLRVYDGATDSW  343



>gb|KDP32382.1| hypothetical protein JCGZ_13307 [Jatropha curcas]
Length=428

 Score =   125 bits (315),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 101/320 (32%), Positives = 144/320 (45%), Gaps = 24/320 (8%)
 Frame = -1

Query  1482  GKKRVTELKMCFSDEMNLD-NPGHSKNISYFTSSVVVDDSYSPLLPGLPDDVAKYCLALV  1306
              KK V   K+C   ++    +P  SK      S      + SPLLPGLPDD+A  CL  V
Sbjct  29    AKKYVPGSKLCLQPDIKPSIHPTRSK-----PSRGDRSRNQSPLLPGLPDDLAIACLIRV  83

Query  1305  PRYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWLYVLTVDADGKESHWEVLDCLGH  1126
             PR     +  V KRW   +    F  +R+   + EEW+YV+  D D K S W   D +  
Sbjct  84    PRIEHCKLRLVCKRWYRLLAGNFFYSLRRNLGIAEEWIYVIKRDRDRKIS-WHAFDPIYQ  142

Query  1125  KHHQLPQMPAPIRA--GFGVAVLNA-KLLVMGGYSMIDESASVSPEVFQYDSCLNSWSKL  955
                 LP +P       GFG AVL+   L + GG   +  S      V  Y +  N W + 
Sbjct  143   LWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGKDPLKGSMR---RVIFYSARTNKWHRA  199

Query  954   ASMNVARYDFACAEVNGMVYAVGGNGVNGE-SLSCAEVYDPDTNKWRVIESLRRPRWGCF  778
               M   R+ F    +N  +Y  GG    G  SL  AEVYDP+ N+W  I  +        
Sbjct  200   PDMLRRRHFFGSCVINNCLYVAGGENEGGHRSLRSAEVYDPNKNRWSFISDMSTAMVPFI  259

Query  777   GCGFEGKLYVMGGRSSFTIGNSRFV--DVYNPERQSWCEMKNGCVM--VTAHAVVGKKLF  610
             G  +EG+ ++ G      +G+ R V  +VY PE  SW  + +G V       A +   L+
Sbjct  260   GVVYEGRWFLKG------LGSHRQVLSEVYEPETDSWYPVYDGMVSGWRNPSASLNGHLY  313

Query  609   CIEWKNQRKLGIFNPEDNSW  550
              ++ K+  KL +++   NSW
Sbjct  314   ALDCKDGCKLRVYDDVTNSW  333



>gb|KDP26940.1| hypothetical protein JCGZ_21033 [Jatropha curcas]
Length=434

 Score =   125 bits (315),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 97/320 (30%), Positives = 149/320 (47%), Gaps = 26/320 (8%)
 Frame = -1

Query  1482  GKKRVTELKMCFSDEMNLDNPGHSKNISYFTSSVVVDDSYSPLLPGLPDDVAKYCLALVP  1303
              +K V   K+C   ++N  N   SKN+    + V      +PLLPGLPDD+A  CL  VP
Sbjct  38    ARKFVPGSKLCIQPDIN-PNAHKSKNLRRERTRV-----QAPLLPGLPDDLAIACLIRVP  91

Query  1302  RYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWLYVLTVDADGKESHWEVLDCLGHK  1123
             R     +  V KRW   +    F  +RK   + EEW+YV+  D DGK S W   D +   
Sbjct  92    RAEHRKLRLVCKRWYHLLAGNFFYSLRKSLGMAEEWVYVIKRDRDGKIS-WNAFDPVYQL  150

Query  1122  HHQLPQMPAPIRA--GFGVAVLNA-KLLVMGGYSMIDESASVSPEVFQYDSCLNSWSKLA  952
                LP +P       GFG AVL+   L + GG   +  S      V  Y +  N W +  
Sbjct  151   WQPLPPVPREYSEALGFGCAVLSGCHLYLFGGKDPLRGSMR---RVIFYSARTNKWHRAP  207

Query  951   SMNVARYDFACAEVNGMVYAVGG--NGVNGESLSCAEVYDPDTNKWRVIESLRRPRWGCF  778
              M   R+ F    +N  +Y  GG   G+   +L  AEVYDP+ N+W  I  +        
Sbjct  208   DMLRKRHFFGSCVINNCLYVAGGECEGIQ-RTLRSAEVYDPNKNRWSFISDMSTAMVPFI  266

Query  777   GCGFEGKLYVMGGRSSFTIGNSRFV--DVYNPERQSWCEMKNGCVM--VTAHAVVGKKLF  610
             G  ++GK ++ G      +G+ R V  + Y+PE  SW  + +G V+        +  +L+
Sbjct  267   GVVYDGKWFLKG------LGSHREVMSEAYDPETNSWTPVSDGMVVGWRNPSISLNGRLY  320

Query  609   CIEWKNQRKLGIFNPEDNSW  550
              ++ ++  K+ +++   +SW
Sbjct  321   ALDCRDGCKVRVYDGATDSW  340



>ref|XP_002519349.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF43213.1| conserved hypothetical protein [Ricinus communis]
Length=388

 Score =   125 bits (314),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 75/251 (30%), Positives = 127/251 (51%), Gaps = 20/251 (8%)
 Frame = -1

Query  1365  YSPLLPGLPDDVAKYCLALVPRYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWLYV  1186
             + P++PGLPDD+A  CLA +   +   +  V+KRWR+ IRS ++   +        WL+V
Sbjct  10    HQPIIPGLPDDLALRCLAKLSHGHHGLLETVSKRWRNLIRSLDYGHYKSREGWCGNWLFV  69

Query  1185  LTVDADGKESHWEVLDCLGHKHHQLPQMPAPIRA----GFGVAVLNAKLLVMGGYSMIDE  1018
             LT   +  ++ W   D    + H LP            GF    ++ +LLV+GG  M ++
Sbjct  70    LT---EQSKNQWVAYDPEADRWHPLPNSSEDYAGWQHFGFSCVCVSNRLLVIGGSYMPND  126

Query  1017  SA------SVSPEVFQYDSCLNSWSKLASMNVARYDFACAEVNGMVYAVGGNGVN-GESL  859
             S+       ++ +V Q+D     W  +A M   R  FAC+ ++G VY  GG  ++    L
Sbjct  127   SSLPHQKPLITDQVLQFDPFKKEWKSMARMRTPRSHFACSVISGKVYVAGGRNLSCTRGL  186

Query  858   SCAEVYDPDTN----KWRVIESLRRPRWGCFGCGFEGKLYVMGGRSSFTIGNSRFVDVYN  691
             + AEVYDP  +    +W  +  +  P+  C G  ++GKL+V+  +   +  N+    V+ 
Sbjct  187   ALAEVYDPLLDNRNCRWDELPPMPNPQTDCLGLSYKGKLHVLSDQVGLSDMNAS--QVFE  244

Query  690   PERQSWCEMKN  658
             P ++SWC +K+
Sbjct  245   PSKESWCIVKD  255



>ref|XP_004306790.1| PREDICTED: F-box/kelch-repeat protein SKIP4-like [Fragaria vesca 
subsp. vesca]
Length=359

 Score =   124 bits (312),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 82/295 (28%), Positives = 140/295 (47%), Gaps = 42/295 (14%)
 Frame = -1

Query  1359  PLLPGLPDDVAKYCLALVPRYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWLYVL-  1183
             PL+ G+PDD+A +C+A VPR Y   +  V++RWR  + S+E+   R+   L E W+Y L 
Sbjct  20    PLISGIPDDIALFCMARVPRKYHTVLKCVSRRWRHLVGSEEWHSYRRKHTLDETWIYALC  79

Query  1182  ----------TVDADGKESHWEVLDCLGHKHHQLPQMPAPIRAGFGVAVLNAKLLVMGGY  1033
                        +D +     W++++       +LP      R G G  VL  K+ ++GG 
Sbjct  80    RDKLERVCLYVLDPNSARRSWKLVN-------ELPPRTLK-RKGMGFEVLGKKIYLLGGC  131

Query  1032  SMIDESASVSPEVFQYDSCLNSWSKLASMNVARYDFACAEVNGMVYAVGGNGVNGESLSC  853
                +++     EV+ YD+ LN+WS+ A ++ AR  FAC  ++  +Y++GG G N      
Sbjct  132   GWCEDATD---EVYYYDASLNTWSEAAPLSTARCYFACEVLDEKIYSIGGLGSNSSDPHS  188

Query  852   AEVYDPDTNKW------RVIESLRRPRWGCFGCGFEGKLYVMGGRSSFTIGNSRFVDVYN  691
              ++YDP TN W       ++  +            +GK+Y+  G S+ T  +  +  VY 
Sbjct  189   WDIYDPSTNSWIFHSDANIVPEIED------SVVMDGKIYIRCGTSAVT--SHVYAVVYE  240

Query  690   PERQSWCEMKNGCVMVTA----HAVVGKKLFCIEWKNQRKLGIFNPEDNSWKMVG  538
             P   +W        MV+       V+G  L+ ++  +  +L ++  E   W  VG
Sbjct  241   PSSGTWQHADAD--MVSGWRGPAVVIGGTLYVLDQSSGTRLMMWQKETREWIPVG  293



>ref|XP_010656414.1| PREDICTED: F-box/kelch-repeat protein At1g55270-like [Vitis vinifera]
Length=431

 Score =   125 bits (315),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 93/281 (33%), Positives = 133/281 (47%), Gaps = 18/281 (6%)
 Frame = -1

Query  1368  SYSPLLPGLPDDVAKYCLALVPRYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWLY  1189
             S SPLLPGLPDD+A  CL  VPR     +  V KRW   +    +  +RK   + EEW+Y
Sbjct  66    SQSPLLPGLPDDLAIACLIRVPRIEHRKLRLVCKRWYRLLVGNFYYSLRKNLGIAEEWIY  125

Query  1188  VLTVDADGKESHWEVLDCLGHKHHQLPQMPAPIRA--GFGVAVLNA-KLLVMGGYSMIDE  1018
             V+  D +GK S W   D +      LP +P       GFG AVL+   L + GG   +  
Sbjct  126   VIKRDREGKIS-WHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGKDPLKG  184

Query  1017  SASVSPEVFQYDSCLNSWSKLASMNVARYDFACAEVNGMVYAVGG-NGVNGESLSCAEVY  841
             S      V  Y +  N W +   M   R+ F    +N  +Y  GG N     SL  AEVY
Sbjct  185   SMR---RVIFYSARTNKWHRAPDMLRRRHFFGSCVINNCLYVAGGENEGMHRSLRSAEVY  241

Query  840   DPDTNKWRVIESLRRPRWGCFGCGFEGKLYVMGGRSSFTIGNSRFV--DVYNPERQSWCE  667
             DP+ N+W  I  +        G  +EGK ++ G      +G+ R V  +VY PE  SW  
Sbjct  242   DPNRNRWSFISDMSTAMVPFIGVVYEGKWFLKG------LGSHRQVLSEVYQPETDSWYP  295

Query  666   MKNGCVM--VTAHAVVGKKLFCIEWKNQRKLGIFNPEDNSW  550
             + +G V       A +  +L+ ++ K+  KL +++   +SW
Sbjct  296   VYDGMVAGWRNPSASLNGQLYALDCKDGCKLRVYDEVSDSW  336



>ref|XP_010925234.1| PREDICTED: F-box/kelch-repeat protein At1g55270-like isoform 
X2 [Elaeis guineensis]
Length=449

 Score =   125 bits (315),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 92/283 (33%), Positives = 133/283 (47%), Gaps = 18/283 (6%)
 Frame = -1

Query  1374  DDSYSPLLPGLPDDVAKYCLALVPRYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEW  1195
             + S SPLLPGLPDD+A  CL  VPR     +  V KRW   +    F  +RK   + EEW
Sbjct  87    NRSQSPLLPGLPDDLAIACLIRVPRAEHHKLRRVCKRWYRLLAGNYFYSLRKSLGITEEW  146

Query  1194  LYVLTVDADGKESHWEVLDCLGHKHHQLPQMPAPIRA--GFGVAVLNA-KLLVMGGYSMI  1024
             +YV+  D +G+ S W+  D +    H LP +P       GFG AVL+   L + GG    
Sbjct  147   VYVIKRDREGRIS-WDAFDPVYQLWHPLPPIPGEYSGALGFGCAVLSGCHLYLFGGK---  202

Query  1023  DESASVSPEVFQYDSCLNSWSKLASMNVARYDFACAEVNGMVYAVGGNGVN-GESLSCAE  847
             D        V  Y +  N W +   M   R+ F    +N  +Y  GG        L  AE
Sbjct  203   DPHKGSMRRVIFYSARTNKWHRAPDMLRRRHFFGSCVINNCLYVAGGESEGFHHCLRSAE  262

Query  846   VYDPDTNKWRVIESLRRPRWGCFGCGFEGKLYVMGGRSSFTIGNSRFV--DVYNPERQSW  673
             VYDP+ N+W  I  +        G  +EGK ++ G      +G+ R V  +VY PE  SW
Sbjct  263   VYDPNKNRWSFISDMSTAMVPFIGIVYEGKWFLKG------LGSQRQVLSEVYVPETDSW  316

Query  672   CEMKNGCVMVTAHAVVG--KKLFCIEWKNQRKLGIFNPEDNSW  550
                 NG V    +  VG   +L+ ++ ++  +L +++   +SW
Sbjct  317   YPAFNGMVSGWRNPSVGLDGRLYSLDCEDGCRLRVYDGATDSW  359



>ref|XP_002965242.1| hypothetical protein SELMODRAFT_83069 [Selaginella moellendorffii]
 gb|EFJ34080.1| hypothetical protein SELMODRAFT_83069 [Selaginella moellendorffii]
Length=418

 Score =   125 bits (314),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 94/316 (30%), Positives = 146/316 (46%), Gaps = 30/316 (9%)
 Frame = -1

Query  1356  LLPGLPDDVAKYCLALVPRYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWLYVLTV  1177
             L+PGLP+D+A  C+A +PR  FP +  V+  W+  + S+ F ++R     L+ W+YVL  
Sbjct  49    LIPGLPNDLAILCIARLPRGMFPLLRLVSSAWKRAVSSETFRLLRHQGGFLQGWIYVLVE  108

Query  1176  DADGKESHWEVLDCLGHKHHQLPQMPAPIRA----GFGVAVLNAKLLVMGGYSMIDESA-  1012
              A G  + +   D   ++ + +  +PA I +    GF    L++KL++MGG   I   A 
Sbjct  109   SATG--AAFRAFDPDANRWYNMSPVPANISSETWQGFACVALDSKLILMGGARRIYNEAM  166

Query  1011  ------SVSPEVFQYDSCLNSWSKLASMNVARYDFACAEVNGMVYAVGGNGVNGESLSCA  850
                    V  +VF YD+  N W +  S+   R  FA A +   VY  GG G +   L  A
Sbjct  167   QQLGQVEVCGDVFIYDAFRNKWQRGPSLTTPRGWFAAAAMGDFVYVAGGQGRSC-FLDSA  225

Query  849   EVYDPDTNKWRVIESLRRPRWGCFGCGFEGKLYVMGGRSSFTIGN------SRFVDVYNP  688
             EV D    +W  + S+   R  C G    G+ +V+ G     I N          + +NP
Sbjct  226   EVLDYREKRWHQMPSMHCVRSSCRGTVLNGQFWVIAG--EVVINNYGDHPQRASAEFFNP  283

Query  687   ERQSWCEMKNGCVMVTAHAVVGKKLFCIEWKNQRKLGIFNPEDNSWKMVGVPVTG-----  523
               +SW  +    + + +H V   +   +   +Q KL  ++PE N W  +G   TG     
Sbjct  284   ASKSWTLIPE--MWLDSHKVALARFQNLLVVHQSKLMRYDPELNEWDHIGHISTGQLYNR  341

Query  522   -SSSIGFRLGILDEKL  478
              S   GF L  L +KL
Sbjct  342   SSYRFGFALECLGDKL  357



>ref|XP_002894497.1| kelch repeat-containing F-box family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH70756.1| kelch repeat-containing F-box family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=434

 Score =   125 bits (314),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 97/320 (30%), Positives = 144/320 (45%), Gaps = 26/320 (8%)
 Frame = -1

Query  1482  GKKRVTELKMCFSDEMNLDNPGHSKNISYFTSSVVVDDSYSPLLPGLPDDVAKYCLALVP  1303
              +K V   K+C   ++N  N    KN     + +       PLLPGLPDD+A  CL  VP
Sbjct  42    ARKFVPGSKLCIQPDIN-PNAHRRKNSKRERTRI-----QPPLLPGLPDDLAVACLIRVP  95

Query  1302  RYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWLYVLTVDADGKESHWEVLDCLGHK  1123
             R     +  V KRW        F   RKL  + EEW+YV   D DGK S W   D +   
Sbjct  96    RAEHRKLRLVCKRWYRLASGNFFYSQRKLLGMSEEWVYVFKRDRDGKIS-WNTFDPISQL  154

Query  1122  HHQLPQMPAPIR--AGFGVAVLNA-KLLVMGGYSMIDESASVSPEVFQYDSCLNSWSKLA  952
                LP +P       GFG AVL+   L + GG   +  S      V  Y++  N W +  
Sbjct  155   WQPLPPVPREYSEAVGFGCAVLSGCHLYLFGGKDPLRGSMR---RVIFYNARTNKWHRAP  211

Query  951   SMNVARYDFACAEVNGMVYAVGG--NGVNGESLSCAEVYDPDTNKWRVIESLRRPRWGCF  778
              M   R+ F C  +N  +Y  GG   G+   +L  AEVYDP+ N+W  I  +        
Sbjct  212   DMLRKRHFFGCCVINNCLYVAGGECEGIQ-RTLRSAEVYDPNKNRWSFIADMSTAMVPLI  270

Query  777   GCGFEGKLYVMGGRSSFTIGNSRFV--DVYNPERQSWCEMKNGCVM--VTAHAVVGKKLF  610
             G  ++ K ++ G      +G+ + V  + Y+PE  SW  + +G V         +  +L+
Sbjct  271   GVVYDKKWFLKG------LGSHQLVMSEAYDPEVNSWSPVSDGMVAGWRNPCTSLNGRLY  324

Query  609   CIEWKNQRKLGIFNPEDNSW  550
              ++ ++  KL +F+   +SW
Sbjct  325   GLDCRDGCKLRVFDESTDSW  344



>ref|XP_010925232.1| PREDICTED: F-box/kelch-repeat protein At1g55270-like isoform 
X1 [Elaeis guineensis]
Length=468

 Score =   125 bits (315),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 92/283 (33%), Positives = 133/283 (47%), Gaps = 18/283 (6%)
 Frame = -1

Query  1374  DDSYSPLLPGLPDDVAKYCLALVPRYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEW  1195
             + S SPLLPGLPDD+A  CL  VPR     +  V KRW   +    F  +RK   + EEW
Sbjct  106   NRSQSPLLPGLPDDLAIACLIRVPRAEHHKLRRVCKRWYRLLAGNYFYSLRKSLGITEEW  165

Query  1194  LYVLTVDADGKESHWEVLDCLGHKHHQLPQMPAPIRA--GFGVAVLNA-KLLVMGGYSMI  1024
             +YV+  D +G+ S W+  D +    H LP +P       GFG AVL+   L + GG    
Sbjct  166   VYVIKRDREGRIS-WDAFDPVYQLWHPLPPIPGEYSGALGFGCAVLSGCHLYLFGGK---  221

Query  1023  DESASVSPEVFQYDSCLNSWSKLASMNVARYDFACAEVNGMVYAVGGNGVN-GESLSCAE  847
             D        V  Y +  N W +   M   R+ F    +N  +Y  GG        L  AE
Sbjct  222   DPHKGSMRRVIFYSARTNKWHRAPDMLRRRHFFGSCVINNCLYVAGGESEGFHHCLRSAE  281

Query  846   VYDPDTNKWRVIESLRRPRWGCFGCGFEGKLYVMGGRSSFTIGNSRFV--DVYNPERQSW  673
             VYDP+ N+W  I  +        G  +EGK ++ G      +G+ R V  +VY PE  SW
Sbjct  282   VYDPNKNRWSFISDMSTAMVPFIGIVYEGKWFLKG------LGSQRQVLSEVYVPETDSW  335

Query  672   CEMKNGCVMVTAHAVVG--KKLFCIEWKNQRKLGIFNPEDNSW  550
                 NG V    +  VG   +L+ ++ ++  +L +++   +SW
Sbjct  336   YPAFNGMVSGWRNPSVGLDGRLYSLDCEDGCRLRVYDGATDSW  378



>ref|NP_564684.1| Galactose oxidase/kelch repeat superfamily protein [Arabidopsis 
thaliana]
 sp|Q93W93.1|FBK22_ARATH RecName: Full=F-box/kelch-repeat protein At1g55270 [Arabidopsis 
thaliana]
 gb|AAK43953.1|AF370138_1 unknown protein [Arabidopsis thaliana]
 gb|AAK93746.1| unknown protein [Arabidopsis thaliana]
 gb|AEE33217.1| Galactose oxidase/kelch repeat superfamily protein [Arabidopsis 
thaliana]
Length=434

 Score =   125 bits (314),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 97/320 (30%), Positives = 144/320 (45%), Gaps = 26/320 (8%)
 Frame = -1

Query  1482  GKKRVTELKMCFSDEMNLDNPGHSKNISYFTSSVVVDDSYSPLLPGLPDDVAKYCLALVP  1303
              +K V   K+C   ++N  N    KN     + +       PLLPGLPDD+A  CL  VP
Sbjct  42    ARKFVPGSKLCIQPDIN-PNAHRRKNSKRERTRI-----QPPLLPGLPDDLAVACLIRVP  95

Query  1302  RYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWLYVLTVDADGKESHWEVLDCLGHK  1123
             R     +  V KRW        F   RKL  + EEW+YV   D DGK S W   D +   
Sbjct  96    RAEHRKLRLVCKRWYRLASGNFFYSQRKLLGMSEEWVYVFKRDRDGKIS-WNTFDPISQL  154

Query  1122  HHQLPQMPAPIR--AGFGVAVLNA-KLLVMGGYSMIDESASVSPEVFQYDSCLNSWSKLA  952
                LP +P       GFG AVL+   L + GG   +  S      V  Y++  N W +  
Sbjct  155   WQPLPPVPREYSEAVGFGCAVLSGCHLYLFGGKDPLRGSMR---RVIFYNARTNKWHRAP  211

Query  951   SMNVARYDFACAEVNGMVYAVGG--NGVNGESLSCAEVYDPDTNKWRVIESLRRPRWGCF  778
              M   R+ F C  +N  +Y  GG   G+   +L  AEVYDP+ N+W  I  +        
Sbjct  212   DMLRKRHFFGCCVINNCLYVAGGECEGIQ-RTLRSAEVYDPNKNRWSFIADMSTAMVPLI  270

Query  777   GCGFEGKLYVMGGRSSFTIGNSRFV--DVYNPERQSWCEMKNGCVM--VTAHAVVGKKLF  610
             G  ++ K ++ G      +G+ + V  + Y+PE  SW  + +G V         +  +L+
Sbjct  271   GVVYDKKWFLKG------LGSHQLVMSEAYDPEVNSWSPVSDGMVAGWRNPCTSLNGRLY  324

Query  609   CIEWKNQRKLGIFNPEDNSW  550
              ++ ++  KL +F+   +SW
Sbjct  325   GLDCRDGCKLRVFDESTDSW  344



>gb|KHG30540.1| hypothetical protein F383_04954 [Gossypium arboreum]
Length=428

 Score =   125 bits (313),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 103/327 (31%), Positives = 146/327 (45%), Gaps = 38/327 (12%)
 Frame = -1

Query  1482  GKKRVTELKMCFSDEMNLD-NPGHSKNISYFTSSVVVDDSYSPLLPGLPDDVAKYCLALV  1306
              K+ V   K+C   ++    +P  SK      S      + SPLLPGLPDD+A  CL  V
Sbjct  29    AKRYVPGTKLCLQPDIKPSIHPTRSKATRGDRSR-----NQSPLLPGLPDDLAIACLIRV  83

Query  1305  PRYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWLYVLTVDADGKESHWEVLDCLGH  1126
             PR     +  V KRW   +    F  +RK   + EEW+YV+  D DGK S W   D +  
Sbjct  84    PRVEHRKLRLVCKRWYRLLSGNFFYSLRKSLGIAEEWIYVIKRDRDGKIS-WHAFDPVYQ  142

Query  1125  KHHQLPQMPAPIRA--GFGVAVLNA-KLLVMGGYSMIDESASVSPEVFQYDSCLNSWSKL  955
                 LP +P       GFG AVL+   L + GG   +  S      V  Y +  N W + 
Sbjct  143   LWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGKDPLKGSMR---RVIFYSARTNKWHRA  199

Query  954   ASMNVARYDFACAEVNGMVYAVGG--NGVNGESLSCAEVYDPDTNKWRVIESLRRPRWGC  781
               M   R+ F    +N  +Y  GG   GV+  SL  AEVYDP+ N+W  I  +       
Sbjct  200   PDMLRRRHFFGSCVINNCLYVAGGENEGVH-RSLRSAEVYDPNKNRWSYISDMSTAMVPF  258

Query  780   FGCGFEGKLYVMGGRSSFTIGNSRFV--DVYNPERQSWCEMKNG--------CVMVTAHA  631
              G  +EGK ++ G      +G  + V  +VY PE  +W  + NG        C  +  H 
Sbjct  259   IGVVYEGKWFLKG------LGPHQQVMSEVYQPETDNWYPVYNGMVAGWRNPCTSLNGH-  311

Query  630   VVGKKLFCIEWKNQRKLGIFNPEDNSW  550
                  L+ +E K+  KL +++   +SW
Sbjct  312   -----LYALECKDGCKLRVYDEVTDSW  333



>ref|XP_008803430.1| PREDICTED: F-box/kelch-repeat protein At1g55270-like [Phoenix 
dactylifera]
Length=440

 Score =   125 bits (313),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 94/318 (30%), Positives = 146/318 (46%), Gaps = 22/318 (7%)
 Frame = -1

Query  1482  GKKRVTELKMCFSDEMNLDNPGHSKNISYFTSSVVVDDSYSPLLPGLPDDVAKYCLALVP  1303
              +K V   K+C   ++  + P   K+      +       +PLLPGLPDD+A  CL  VP
Sbjct  43    ARKFVPGTKLCLQPDIKPNGPKSRKSRKERCRN------EAPLLPGLPDDLAIACLIRVP  96

Query  1302  RYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWLYVLTVDADGKESHWEVLDCLGHK  1123
             R   P +  V KRW   +    F  +RK   ++EEW+YV+  D DGK S W   D +   
Sbjct  97    RAEHPNLQLVCKRWNRLLTGNYFYSLRKKLGMVEEWVYVIKRDRDGKIS-WHAFDPVHQL  155

Query  1122  HHQLPQMPAPIRA--GFGVAVLNA-KLLVMGGYSMIDESASVSPEVFQYDSCLNSWSKLA  952
                LP +P       GFG AVL+   L + GG   +  S      V  Y++  N W++  
Sbjct  156   WKSLPPVPPEYSEAFGFGCAVLSGCYLYLFGGKDPLRGSMR---RVVFYNARTNKWNRAP  212

Query  951   SMNVARYDFACAEVNGMVYAVGG--NGVNGESLSCAEVYDPDTNKWRVIESLRRPRWGCF  778
              M   R+ F    +N  +Y  GG   G++  +L  AE+YDP+ N+W  I  +        
Sbjct  213   DMLRKRHFFGSCVINNCLYVAGGECEGIH-RNLRSAEIYDPNKNRWTFIGEMNTGMVPLI  271

Query  777   GCGFEGKLYVMGGRSSFTIGNSRFVDVYNPERQSWCEMKNGCVMVTAHAVV--GKKLFCI  604
             G  FEGK ++ G  S   +      +VY P   +W  + +G V    +  +    +L+  
Sbjct  272   GVVFEGKWFLKGLDSHRQV----VSEVYVPTTNTWSAVNDGMVTGWRNPSISFNGRLYAS  327

Query  603   EWKNQRKLGIFNPEDNSW  550
             + K+  KL +++   +SW
Sbjct  328   DCKDGCKLRVYDGATDSW  345



>gb|KHG22974.1| hypothetical protein F383_01277 [Gossypium arboreum]
Length=438

 Score =   125 bits (313),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 97/320 (30%), Positives = 144/320 (45%), Gaps = 26/320 (8%)
 Frame = -1

Query  1482  GKKRVTELKMCFSDEMNLDNPGHSKNISYFTSSVVVDDSYSPLLPGLPDDVAKYCLALVP  1303
              +K V   K+C   ++N  N   SKN     + V       PLLPGLPDD+A  CL  VP
Sbjct  42    ARKFVPGSKLCIQPDIN-PNAHKSKNSRRERTRV-----QPPLLPGLPDDLAIACLIRVP  95

Query  1302  RYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWLYVLTVDADGKESHWEVLDCLGHK  1123
             R     +  V KRW   +    F  +RK   + EEW+YV   D DGK S W   D +   
Sbjct  96    RAEHRKLRVVCKRWYRLLAGNFFYSLRKSLGMAEEWVYVFKRDRDGKIS-WNAFDPIHQL  154

Query  1122  HHQLPQMPAPIR--AGFGVAVLNA-KLLVMGGYSMIDESASVSPEVFQYDSCLNSWSKLA  952
                LP +P       GFG AVL+   L + GG    D        V  Y +  N W +  
Sbjct  155   WQPLPPVPREYSEAVGFGCAVLSGCHLYLFGGK---DRQRGSMRRVIFYSARTNKWHRAP  211

Query  951   SMNVARYDFACAEVNGMVYAVGG--NGVNGESLSCAEVYDPDTNKWRVIESLRRPRWGCF  778
              M   R+ F    +N  +Y  GG   G++  +L  AEVYDP+ N+W  ++ +        
Sbjct  212   DMLRKRHFFGSCVINNCLYVAGGECEGIH-RTLRSAEVYDPNKNRWSFVQDMSTAMVPFI  270

Query  777   GCGFEGKLYVMGGRSSFTIGNSRFV--DVYNPERQSWCEMKNGCVM--VTAHAVVGKKLF  610
             G  ++GK +V G      +G+ R V  + Y+PE  SW     G +         +  +L+
Sbjct  271   GVVYDGKWFVKG------LGSHREVMSEAYDPESNSWSPASGGMISGWRNPSISLNGQLY  324

Query  609   CIEWKNQRKLGIFNPEDNSW  550
              ++ ++  KL +++   +SW
Sbjct  325   ALDCRDGCKLRVYDGATDSW  344



>ref|XP_010257584.1| PREDICTED: F-box/kelch-repeat protein At1g55270-like [Nelumbo 
nucifera]
Length=436

 Score =   125 bits (313),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 97/320 (30%), Positives = 146/320 (46%), Gaps = 26/320 (8%)
 Frame = -1

Query  1482  GKKRVTELKMCFSDEMNLDNPGHSKNISYFTSSVVVDDSYSPLLPGLPDDVAKYCLALVP  1303
              +K V   K+C   ++N  +   SKN     + +       PL+PGLPDD+A  CL  VP
Sbjct  40    ARKFVPGSKLCIQPDIN-PHAHKSKNSRRERTRI-----QPPLIPGLPDDLAIACLIRVP  93

Query  1302  RYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWLYVLTVDADGKESHWEVLDCLGHK  1123
             R+    +  V KRW   +    F  +RK   + EEW+YV+  D DG+ S W   D +   
Sbjct  94    RFEHRKLRLVCKRWYRLLAGNFFYSLRKNLGMAEEWIYVIKRDRDGRIS-WHAFDPIYQL  152

Query  1122  HHQLPQMPAPIRA--GFGVAVLNA-KLLVMGGYSMIDESASVSPEVFQYDSCLNSWSKLA  952
                LP +P    A  GFG AVL+   L + GG   +  S      V  Y +  N W +  
Sbjct  153   WQPLPPVPVEYSAALGFGCAVLSGCHLYLFGGKDPLRGSMR---RVIFYSARTNKWHRAP  209

Query  951   SMNVARYDFACAEVNGMVYAVGG--NGVNGESLSCAEVYDPDTNKWRVIESLRRPRWGCF  778
              M   R+ F    +N  +Y  GG   G+   +L  AEVYDP+ N+W  I  +        
Sbjct  210   DMLRKRHFFGSCVINNCLYVAGGECEGIQ-RTLRSAEVYDPNKNRWSFIADMSTAMVPFI  268

Query  777   GCGFEGKLYVMGGRSSFTIGNSRFV--DVYNPERQSWCEMKNGCVM--VTAHAVVGKKLF  610
             G  + GK ++ G      +G+ R V  + Y PE  SW  + +G V         +  KL+
Sbjct  269   GVVYNGKWFLKG------LGSHRQVMSEAYIPETNSWTPIHDGMVSGWRNPSISLNGKLY  322

Query  609   CIEWKNQRKLGIFNPEDNSW  550
              ++ K+  KL +++   +SW
Sbjct  323   ALDCKDGCKLRVYDEASDSW  342



>ref|XP_010243433.1| PREDICTED: F-box/kelch-repeat protein At1g55270-like [Nelumbo 
nucifera]
Length=436

 Score =   125 bits (313),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 97/320 (30%), Positives = 146/320 (46%), Gaps = 26/320 (8%)
 Frame = -1

Query  1482  GKKRVTELKMCFSDEMNLDNPGHSKNISYFTSSVVVDDSYSPLLPGLPDDVAKYCLALVP  1303
              +K V   K+C   ++N      SKN     + +       PL+PGLPDD+A  CL  VP
Sbjct  40    ARKFVPGSKLCIQPDIN-PRAHKSKNSRRERTRI-----QPPLIPGLPDDLAIACLIRVP  93

Query  1302  RYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWLYVLTVDADGKESHWEVLDCLGHK  1123
             R+    +  V KRW   +    F  +RK   + EEW+YV+  D DG+ S W   D +   
Sbjct  94    RFEHRKLRLVCKRWYRLLSGNFFYSLRKNLGMAEEWVYVIKRDRDGRIS-WHAFDPIYQL  152

Query  1122  HHQLPQMPAPIRA--GFGVAVLNA-KLLVMGGYSMIDESASVSPEVFQYDSCLNSWSKLA  952
                LP +P    A  GFG AVL+   L + GG   +  S      V  Y +  N W +  
Sbjct  153   WQPLPPVPVEYSAALGFGCAVLSGCHLYLFGGKDPLRGSMR---RVIFYSARTNKWHRAP  209

Query  951   SMNVARYDFACAEVNGMVYAVGG--NGVNGESLSCAEVYDPDTNKWRVIESLRRPRWGCF  778
              M   R+ F    +N  +Y  GG   G+   +L  AEVYDP+ N+W  I  +        
Sbjct  210   DMLRKRHFFGSCVINNCLYVAGGECEGIQ-RTLRSAEVYDPNKNRWSFIADMSTAMVPFI  268

Query  777   GCGFEGKLYVMGGRSSFTIGNSRFV--DVYNPERQSWCEMKNGCVM--VTAHAVVGKKLF  610
             G  + GK ++ G      +G+ R V  +VY PE  SW  + +G V         +  KL+
Sbjct  269   GVVYNGKWFLKG------LGSHRQVMSEVYIPENNSWAPVHDGMVSGWRNPSISLNGKLY  322

Query  609   CIEWKNQRKLGIFNPEDNSW  550
              ++ ++  KL +++   +SW
Sbjct  323   ALDCRDGCKLRVYDEASDSW  342



>ref|XP_007014726.1| Galactose oxidase/kelch repeat superfamily protein [Theobroma 
cacao]
 gb|EOY32345.1| Galactose oxidase/kelch repeat superfamily protein [Theobroma 
cacao]
Length=438

 Score =   124 bits (312),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 98/320 (31%), Positives = 146/320 (46%), Gaps = 26/320 (8%)
 Frame = -1

Query  1482  GKKRVTELKMCFSDEMNLDNPGHSKNISYFTSSVVVDDSYSPLLPGLPDDVAKYCLALVP  1303
              +K V   K+C   ++N  N   SKN     + V       PLLPGLPDD+A  CL  VP
Sbjct  42    ARKFVPGSKLCIQPDIN-PNAHKSKNSRRERTRV-----QPPLLPGLPDDLAIACLIRVP  95

Query  1302  RYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWLYVLTVDADGKESHWEVLDCLGHK  1123
             R     +  V KRW   +    F  +RK   + EEW+YV   D DGK S W   D +   
Sbjct  96    RAEHRKLRLVCKRWCRLLAGNFFYSLRKSLGMAEEWVYVFKRDRDGKIS-WNAFDPIHQL  154

Query  1122  HHQLPQMPAPIRA--GFGVAVLNA-KLLVMGGYSMIDESASVSPEVFQYDSCLNSWSKLA  952
                LP +P       GFG AVL+   L + GG   +  S      V  Y +  N W +  
Sbjct  155   WQPLPPVPREYSEALGFGCAVLSGCHLYLFGGKDPLRGSMR---RVIFYSARTNKWHRAP  211

Query  951   SMNVARYDFACAEVNGMVYAVGG--NGVNGESLSCAEVYDPDTNKWRVIESLRRPRWGCF  778
              M   R+ F    +N  +Y  GG   G+   +L  AEVYDP+ N+W  I+ +        
Sbjct  212   DMLRKRHFFGSCVINNCLYVAGGECEGIQ-RTLRSAEVYDPNRNRWSFIQDMSTAMVPFI  270

Query  777   GCGFEGKLYVMGGRSSFTIGNSRFV--DVYNPERQSWCEMKNGCVM--VTAHAVVGKKLF  610
             G  ++GK ++ G      +G+ R V  + Y+PE  SW  + +G V         +  +L+
Sbjct  271   GVVYDGKWFLKG------LGSHREVMSEAYDPETNSWTSVSDGMVSGWRNPSISLNGRLY  324

Query  609   CIEWKNQRKLGIFNPEDNSW  550
              ++ ++  KL +++   +SW
Sbjct  325   ALDCRDGCKLRVYDGATDSW  344



>ref|XP_004228650.1| PREDICTED: F-box/kelch-repeat protein At1g55270 [Solanum lycopersicum]
Length=437

 Score =   124 bits (312),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 97/320 (30%), Positives = 147/320 (46%), Gaps = 26/320 (8%)
 Frame = -1

Query  1482  GKKRVTELKMCFSDEMNLDNPGHSKNISYFTSSVVVDDSYSPLLPGLPDDVAKYCLALVP  1303
              +K V+  K+C   ++N  +   +KN     S V      SPLLPGLPDD+A  CL  VP
Sbjct  41    ARKFVSGSKICIQPDIN-PHAHKTKNSRRERSRV-----QSPLLPGLPDDLAIACLIRVP  94

Query  1302  RYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWLYVLTVDADGKESHWEVLDCLGHK  1123
             R     +  V KRW   +    F  +RK   + EEW+YV+  D DG+ S W   D     
Sbjct  95    RVEHNKLRLVCKRWYRLLAGNFFYSLRKSLGMAEEWVYVIKRDRDGRIS-WHAFDPTYQL  153

Query  1122  HHQLPQMPAPIRA--GFGVAVLNA-KLLVMGGYSMIDESASVSPEVFQYDSCLNSWSKLA  952
                LP +P       GFG AVL+   L + GG   I  S      V  Y +  N W +  
Sbjct  154   WQPLPPLPGEYSEALGFGCAVLSGCHLYLFGGKDPIKGSMR---RVIFYSARTNKWHRAP  210

Query  951   SMNVARYDFACAEVNGMVYAVGG--NGVNGESLSCAEVYDPDTNKWRVIESLRRPRWGCF  778
              M   R+ F    +N  +Y  GG   G+   +L  AEVYDP+ N+W  +  +        
Sbjct  211   DMLRKRHFFGSCVINNCLYVAGGECEGIQ-RTLRSAEVYDPNRNRWTFVADMSTAMVPFI  269

Query  777   GCGFEGKLYVMGGRSSFTIGNSRFV--DVYNPERQSWCEMKNGCVMVTAHAVVGK--KLF  610
             G  ++GK ++ G      +G+ R V  + YNPE   W  + +G V    +  +    +L+
Sbjct  270   GVIYDGKWFLKG------LGSHREVLSEAYNPETNGWSPVTDGMVAGWRNPSISMNGRLY  323

Query  609   CIEWKNQRKLGIFNPEDNSW  550
              ++ ++  KL +++   +SW
Sbjct  324   ALDCRDGCKLRVYDGASDSW  343



>ref|XP_006445823.1| hypothetical protein CICLE_v10015292mg [Citrus clementina]
 ref|XP_006492713.1| PREDICTED: F-box/kelch-repeat protein At1g55270-like [Citrus 
sinensis]
 gb|ESR59063.1| hypothetical protein CICLE_v10015292mg [Citrus clementina]
 gb|KDO63008.1| hypothetical protein CISIN_1g013863mg [Citrus sinensis]
Length=435

 Score =   124 bits (312),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 97/320 (30%), Positives = 145/320 (45%), Gaps = 26/320 (8%)
 Frame = -1

Query  1482  GKKRVTELKMCFSDEMNLDNPGHSKNISYFTSSVVVDDSYSPLLPGLPDDVAKYCLALVP  1303
              +K V   K+C   ++N  N   SKN     S +       PLLPGLPDD+A  CL  VP
Sbjct  39    ARKFVPGSKLCIQPDIN-PNAHKSKNSRRERSRI-----QPPLLPGLPDDLAIACLIRVP  92

Query  1302  RYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWLYVLTVDADGKESHWEVLDCLGHK  1123
             R     +  V KRW   +    F  +RK   + EEW+YV   D DGK S W   D +   
Sbjct  93    RAEHRKLRLVCKRWYRLLAGNYFYSLRKSLGMAEEWVYVFKRDRDGKIS-WNAFDPVYQL  151

Query  1122  HHQLPQMPAPIRA--GFGVAVLNA-KLLVMGGYSMIDESASVSPEVFQYDSCLNSWSKLA  952
                LP +P       GFG AVL+   L + GG   +  S      V  Y +  N W +  
Sbjct  152   WQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGKDPLRGSMR---RVIFYSARTNKWHRAP  208

Query  951   SMNVARYDFACAEVNGMVYAVGG--NGVNGESLSCAEVYDPDTNKWRVIESLRRPRWGCF  778
              M   R+ F    +N  +Y  GG   G+   +L  AE+YDP+ N+W  I  +        
Sbjct  209   DMLRKRHFFGSCVLNNCLYVAGGECEGIQ-RTLRSAEIYDPNKNRWSFIADMSTAMVPFI  267

Query  777   GCGFEGKLYVMGGRSSFTIGNSRFV--DVYNPERQSWCEMKNGCVM--VTAHAVVGKKLF  610
             G  ++GK ++ G      +G+ R V  + Y+PE  SW  + +G V         +  +L+
Sbjct  268   GVIYDGKWFLKG------LGSHREVMSEAYDPETNSWTPISDGLVAGWRNPSVSLNGRLY  321

Query  609   CIEWKNQRKLGIFNPEDNSW  550
              ++ ++  KL +++   +SW
Sbjct  322   ALDCRDGCKLRVYDEATDSW  341



>ref|XP_009388524.1| PREDICTED: F-box/kelch-repeat protein At1g55270-like [Musa acuminata 
subsp. malaccensis]
Length=437

 Score =   124 bits (312),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 92/319 (29%), Positives = 139/319 (44%), Gaps = 22/319 (7%)
 Frame = -1

Query  1482  GKKRVTELKMCFSDEMNLDNPGHSKNISYFTSSVVVDDSYSPLLPGLPDDVAKYCLALVP  1303
              KK V   K+C    +         N ++  + +      SPLLPGLPDD+A  CL  VP
Sbjct  40    AKKYVPSTKLCVQPRIRTSIHPVRPNPAFDRNRI-----QSPLLPGLPDDLAIACLIRVP  94

Query  1302  RYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWLYVLTVDADGKESHWEVLDCLGHK  1123
             R     +  V KRW+  +    F  +RK   + EEW+Y++  D +G+ S W+  D     
Sbjct  95    RPEHRKLRLVCKRWQRLLAGNYFYSLRKSLSVAEEWIYIIRRDREGRIS-WDAFDPRFQL  153

Query  1122  HHQLPQMPAPIRA--GFGVAVLNA-KLLVMGGYSMIDESASVSPEVFQYDSCLNSWSKLA  952
              H LP +P       GFG AVL+   L + GG    D        V  Y++  N W +  
Sbjct  154   WHPLPPVPKEYSKAIGFGCAVLHGCHLYLFGGK---DPCKGSMRRVIYYNARTNKWHRAP  210

Query  951   SMNVARYDFACAEVNGMVYAVGG--NGVNGESLSCAEVYDPDTNKWRVIESLRRPRWGCF  778
              M   R+ F    +N  +Y  GG   GV+   L  AE YDP  N+W  +  +        
Sbjct  211   DMLRRRHFFGACVINNCLYVAGGESEGVH-RFLRSAEFYDPSKNRWSFVSEMSAAMVPFI  269

Query  777   GCGFEGKLYVMGGRSSFTIGNSRFVDVYNPERQSWCEMKNGCVMV---TAHAVVGKKLFC  607
             G  +EGK ++ G             DVY PE  +WC   +G ++         +  +LF 
Sbjct  270   GVVYEGKWFLKG----LGPQQQLLTDVYFPETDTWCPASSGGMVAGWRNPSVCLNGRLFA  325

Query  606   IEWKNQRKLGIFNPEDNSW  550
             ++ ++  KL +++    SW
Sbjct  326   LDCRDGCKLRVYDAGAGSW  344



>gb|AAG51566.1|AC027034_12 unknown protein; 58496-60308 [Arabidopsis thaliana]
Length=478

 Score =   125 bits (313),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 97/320 (30%), Positives = 144/320 (45%), Gaps = 26/320 (8%)
 Frame = -1

Query  1482  GKKRVTELKMCFSDEMNLDNPGHSKNISYFTSSVVVDDSYSPLLPGLPDDVAKYCLALVP  1303
              +K V   K+C   ++N  N    KN     + +       PLLPGLPDD+A  CL  VP
Sbjct  42    ARKFVPGSKLCIQPDIN-PNAHRRKNSKRERTRI-----QPPLLPGLPDDLAVACLIRVP  95

Query  1302  RYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWLYVLTVDADGKESHWEVLDCLGHK  1123
             R     +  V KRW        F   RKL  + EEW+YV   D DGK S W   D +   
Sbjct  96    RAEHRKLRLVCKRWYRLASGNFFYSQRKLLGMSEEWVYVFKRDRDGKIS-WNTFDPISQL  154

Query  1122  HHQLPQMPAPIR--AGFGVAVLNA-KLLVMGGYSMIDESASVSPEVFQYDSCLNSWSKLA  952
                LP +P       GFG AVL+   L + GG   +  S      V  Y++  N W +  
Sbjct  155   WQPLPPVPREYSEAVGFGCAVLSGCHLYLFGGKDPLRGSMR---RVIFYNARTNKWHRAP  211

Query  951   SMNVARYDFACAEVNGMVYAVGG--NGVNGESLSCAEVYDPDTNKWRVIESLRRPRWGCF  778
              M   R+ F C  +N  +Y  GG   G+   +L  AEVYDP+ N+W  I  +        
Sbjct  212   DMLRKRHFFGCCVINNCLYVAGGECEGIQ-RTLRSAEVYDPNKNRWSFIADMSTAMVPLI  270

Query  777   GCGFEGKLYVMGGRSSFTIGNSRFV--DVYNPERQSWCEMKNGCVM--VTAHAVVGKKLF  610
             G  ++ K ++ G      +G+ + V  + Y+PE  SW  + +G V         +  +L+
Sbjct  271   GVVYDKKWFLKG------LGSHQLVMSEAYDPEVNSWSPVSDGMVAGWRNPCTSLNGRLY  324

Query  609   CIEWKNQRKLGIFNPEDNSW  550
              ++ ++  KL +F+   +SW
Sbjct  325   GLDCRDGCKLRVFDESTDSW  344



>ref|XP_001770303.1| predicted protein [Physcomitrella patens]
 gb|EDQ64978.1| predicted protein [Physcomitrella patens]
Length=373

 Score =   123 bits (309),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 94/300 (31%), Positives = 145/300 (48%), Gaps = 13/300 (4%)
 Frame = -1

Query  1356  LLPGLPDDVAKYCLALVPRYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWLYVLTV  1177
             L+PGLP+D+A  CLA VPR +   +  V K WR+ I S+ +  +RK   + E W+Y  + 
Sbjct  32    LIPGLPNDLALQCLARVPRRHHLNLRCVCKEWRNMIASEYYYSLRKRLEVTEGWIYAFSR  91

Query  1176  DADGKESHWEVLDCLGHKHHQLPQMPAPIRAGFGV--AVLNAKLLVMGGYSMIDESASVS  1003
             D   +  HW VLD +     +LP MP      +GV  +V+  +L VMGG    +     +
Sbjct  92    DY-FECLHWHVLDPVTRLWKELPSMPVDCLRRYGVTCSVVQRELYVMGGGGGGNFHVP-T  149

Query  1002  PEVFQYDSCLNSWSKLASMNVARYDFACAEVNGMVYAVGGNGVNGESLSCAEVYDPDTNK  823
             PEV+++D   N W++ A+M  AR       +NG +YAVGG GV   +L   EV++P TN+
Sbjct  150   PEVYKFDPVKNEWTEAAAMETARCYIVSGALNGRLYAVGGMGVTSSALRSWEVFNPQTNE  209

Query  822   WRVIESLR-RPRWGCFGCGFEGKLYV--MGGRSSFTIGNSRFVDVYNPERQSWCEMKNGC  652
                 E     P  G      +GK+YV     RS +      +  V++P   SW  + N  
Sbjct  210   RLFREDPNVVPDLG-ESLVMDGKIYVRHASARSGYM---GSYAAVFDPVESSWAAVDNEM  265

Query  651   VM--VTAHAVVGKKLFCIEWKNQRKLGIFNPEDNSWKMVGVPVTGSSSIGFRLGILDEKL  478
             V       AV G  ++ ++     KL + + E   W  +G     S  +  RL  +++ L
Sbjct  266   VKKWCGPTAVTGNDVYMLDQSFGIKLMVLDKESGEWDRIGRFSPLSIRLPCRLAAIEKNL  325



>ref|XP_009603914.1| PREDICTED: F-box/kelch-repeat protein At1g55270-like isoform 
X2 [Nicotiana tomentosiformis]
Length=437

 Score =   124 bits (311),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 98/320 (31%), Positives = 145/320 (45%), Gaps = 26/320 (8%)
 Frame = -1

Query  1482  GKKRVTELKMCFSDEMNLDNPGHSKNISYFTSSVVVDDSYSPLLPGLPDDVAKYCLALVP  1303
              +K V   K+C   ++N      +KN     S V       PLLPGLPDD+A  CL  VP
Sbjct  41    ARKFVPGSKICIQPDIN-PRAHKTKNSRRERSRV-----QPPLLPGLPDDLAIACLIRVP  94

Query  1302  RYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWLYVLTVDADGKESHWEVLDCLGHK  1123
             R     +  V KRW   +    F  +RK   + EEW+YV+  D DG+ S W   D     
Sbjct  95    RVEHNKLRLVCKRWYRLLAGNFFYSLRKSLGMAEEWVYVMKRDRDGRIS-WHAFDSTYQL  153

Query  1122  HHQLPQMPAPIRA--GFGVAVLNA-KLLVMGGYSMIDESASVSPEVFQYDSCLNSWSKLA  952
                LP +P       GFG AVL+   L + GG   I  S      V  Y +  N W +  
Sbjct  154   WQPLPPVPGEYSEALGFGCAVLSGCHLYLFGGKDPIKGSMR---RVIFYSARTNKWHRAP  210

Query  951   SMNVARYDFACAEVNGMVYAVGG--NGVNGESLSCAEVYDPDTNKWRVIESLRRPRWGCF  778
              M   R+ F    +N  +Y  GG   G+   +L  AEVYDP+ N+W  I  +        
Sbjct  211   DMLRRRHFFGSCVINNCLYVAGGECEGIQ-RTLRSAEVYDPNRNRWSFIADMSTAMVPFI  269

Query  777   GCGFEGKLYVMGGRSSFTIGNSRFV--DVYNPERQSWCEMKNGCVMVTAHAVVGK--KLF  610
             G  ++GK ++ G      +G+ R V  + YNPE  +W  + NG V    +  +    +L+
Sbjct  270   GVVYDGKWFLKG------LGSHREVLSESYNPEMNAWSPVNNGMVAGWRNPSISMDGRLY  323

Query  609   CIEWKNQRKLGIFNPEDNSW  550
              ++ ++  KL +++   +SW
Sbjct  324   ALDCRDGCKLRVYDEATHSW  343



>ref|XP_009785252.1| PREDICTED: F-box/kelch-repeat protein At1g55270-like isoform 
X2 [Nicotiana sylvestris]
Length=437

 Score =   124 bits (311),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 98/320 (31%), Positives = 145/320 (45%), Gaps = 26/320 (8%)
 Frame = -1

Query  1482  GKKRVTELKMCFSDEMNLDNPGHSKNISYFTSSVVVDDSYSPLLPGLPDDVAKYCLALVP  1303
              +K V   K+C   ++N      +KN     S V       PLLPGLPDD+A  CL  VP
Sbjct  41    ARKFVPGSKICIQPDIN-PRAHKTKNSRRERSRV-----QPPLLPGLPDDLAIACLIRVP  94

Query  1302  RYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWLYVLTVDADGKESHWEVLDCLGHK  1123
             R     +  V KRW   +    F  +RK   + EEW+YV+  D DG+ S W   D     
Sbjct  95    RVEHNKLRLVCKRWYRLLAGNFFYSLRKSLGMAEEWVYVMKRDRDGRIS-WHAFDSTYQL  153

Query  1122  HHQLPQMPAPIRA--GFGVAVLNA-KLLVMGGYSMIDESASVSPEVFQYDSCLNSWSKLA  952
                LP +P       GFG AVL+   L + GG   I  S      V  Y +  N W +  
Sbjct  154   WQPLPPVPGEYSEALGFGCAVLSGCHLYLFGGKDPIKGSMR---RVIFYSARTNKWHRAP  210

Query  951   SMNVARYDFACAEVNGMVYAVGG--NGVNGESLSCAEVYDPDTNKWRVIESLRRPRWGCF  778
              M   R+ F    +N  +Y  GG   G+   +L  AEVYDP+ N+W  I  +        
Sbjct  211   DMLRRRHFFGSCVINNCLYVAGGECEGIQ-RTLRSAEVYDPNRNRWSFIADMSTAMVPFI  269

Query  777   GCGFEGKLYVMGGRSSFTIGNSRFV--DVYNPERQSWCEMKNGCVMVTAHAVVGK--KLF  610
             G  ++GK ++ G      +G+ R V  + YNPE  +W  + NG V    +  +    +L+
Sbjct  270   GVVYDGKWFLKG------LGSHREVLSESYNPEMNAWSPVNNGMVAGWRNPSISMDGRLY  323

Query  609   CIEWKNQRKLGIFNPEDNSW  550
              ++ ++  KL +++   +SW
Sbjct  324   ALDCRDGCKLRVYDEATHSW  343



>emb|CDY08233.1| BnaA05g13860D [Brassica napus]
Length=435

 Score =   124 bits (311),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 96/320 (30%), Positives = 143/320 (45%), Gaps = 25/320 (8%)
 Frame = -1

Query  1482  GKKRVTELKMCFSDEMNLDNPGHSKNISYFTSSVVVDDSYSPLLPGLPDDVAKYCLALVP  1303
              +K V   K+C   ++N +    SKN     + +       PLLPGLPDD+A  CL  VP
Sbjct  42    ARKFVPGSKLCIQPDINPNAHRRSKNSKRERTRI-----QPPLLPGLPDDLAVACLIRVP  96

Query  1302  RYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWLYVLTVDADGKESHWEVLDCLGHK  1123
             R     +  V KRW        F   RKL  + EEW+YV   D DGK S W   D +   
Sbjct  97    RAEHRKLRLVCKRWYRLASGNFFYSQRKLLGMSEEWVYVFKRDRDGKIS-WNTFDPVSQH  155

Query  1122  HHQLPQMPAPIR--AGFGVAVLNA-KLLVMGGYSMIDESASVSPEVFQYDSCLNSWSKLA  952
                LP +P       GFG AVL+   L + GG   +  S      V  Y++  N W +  
Sbjct  156   PQPLPPVPREYSEAVGFGCAVLSGCHLYLFGGKDPLRGSMR---RVIFYNARTNKWHRAP  212

Query  951   SMNVARYDFACAEVNGMVYAVGG--NGVNGESLSCAEVYDPDTNKWRVIESLRRPRWGCF  778
              M   R+ F    +N  +Y  GG   G+   +L  AEVYDP+ N+W  +  +        
Sbjct  213   DMLRKRHFFGSCVINNCLYVAGGECEGIQ-RTLRSAEVYDPNKNRWSFVADMSTAMVPLI  271

Query  777   GCGFEGKLYVMGGRSSFTIGNSRFVDVYNPERQSWCEMKNGCVMVTAH----AVVGKKLF  610
             G  ++ K ++ G  S   +      + Y+PE  SW  + +G  MVT        +  +L+
Sbjct  272   GVVYDKKWFLKGLGSHQQV----MSEAYDPETNSWRPVSDG--MVTGWRNPCTSLNGRLY  325

Query  609   CIEWKNQRKLGIFNPEDNSW  550
              ++ ++  KL +F+   +SW
Sbjct  326   GLDCRDGCKLRVFDETTDSW  345



>ref|XP_009359825.1| PREDICTED: F-box/kelch-repeat protein At1g16250-like [Pyrus x 
bretschneideri]
Length=386

 Score =   123 bits (309),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 83/289 (29%), Positives = 138/289 (48%), Gaps = 21/289 (7%)
 Frame = -1

Query  1356  LLPGLPDDVAKYCLALVPRYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWLYVLTV  1177
             ++PGL DD+A  CLA +   Y   +  V+K WR  +RS E+   +       +WL+VLT 
Sbjct  8     IIPGLSDDLALRCLAKLSHGYHGLLETVSKAWRDLLRSSEYANYKARKGWCGDWLFVLT-  66

Query  1176  DADGKESHWEVLDCLGHKHHQLPQMPAP----IRAGF-GVAVLNAKLLVMGGYSMID---  1021
               +G  + W   D    + H LP++P         GF  +AV N   ++ G Y+  D   
Sbjct  67    --EGSNNEWVAYDPEADRWHPLPKIPTAHGDWKHFGFSSIAVCNRFFVIGGSYAQNDPPV  124

Query  1020  --ESASVSPEVFQYDSCLNSWSKLASMNVARYDFACAEVNGMVYAVGGNGVN-GESLSCA  850
               + + V+ EV Q+D     W+ +ASM   R  FAC+ V+G +Y VGG  ++    L+ A
Sbjct  125   PHQKSLVTNEVMQFDPFKKQWTSVASMLTPRTHFACSVVSGKIYVVGGRNLSCTRGLALA  184

Query  849   EVYDPDTNKWRVIESLRRPRWGCFGCGFEGKLYVMGGRSSFTIGNSRFVDVYNPERQSWC  670
             EVYDP  NKW  +  +  P+  C G   +G+ +V+  +      N+   +V+ P   +W 
Sbjct  185   EVYDPVANKWEELPPMLNPQMDCLGLSCKGRFHVLSDQVGLPDQNTS--EVFTPSDGTWR  242

Query  669   EMKN----GCVMVTAHAVVG-KKLFCIEWKNQRKLGIFNPEDNSWKMVG  538
              +++       M  A  V+G  +++ +    +  +   + E   W  VG
Sbjct  243   TVEDIWPFSRAMQFAAQVIGDNRIYTVVDWGESLIKTRDTEKGEWYTVG  291



>ref|XP_009603913.1| PREDICTED: F-box/kelch-repeat protein At1g55270-like isoform 
X1 [Nicotiana tomentosiformis]
Length=445

 Score =   124 bits (311),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 98/320 (31%), Positives = 145/320 (45%), Gaps = 26/320 (8%)
 Frame = -1

Query  1482  GKKRVTELKMCFSDEMNLDNPGHSKNISYFTSSVVVDDSYSPLLPGLPDDVAKYCLALVP  1303
              +K V   K+C   ++N      +KN     S V       PLLPGLPDD+A  CL  VP
Sbjct  49    ARKFVPGSKICIQPDIN-PRAHKTKNSRRERSRV-----QPPLLPGLPDDLAIACLIRVP  102

Query  1302  RYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWLYVLTVDADGKESHWEVLDCLGHK  1123
             R     +  V KRW   +    F  +RK   + EEW+YV+  D DG+ S W   D     
Sbjct  103   RVEHNKLRLVCKRWYRLLAGNFFYSLRKSLGMAEEWVYVMKRDRDGRIS-WHAFDSTYQL  161

Query  1122  HHQLPQMPAPIRA--GFGVAVLNA-KLLVMGGYSMIDESASVSPEVFQYDSCLNSWSKLA  952
                LP +P       GFG AVL+   L + GG   I  S      V  Y +  N W +  
Sbjct  162   WQPLPPVPGEYSEALGFGCAVLSGCHLYLFGGKDPIKGSMR---RVIFYSARTNKWHRAP  218

Query  951   SMNVARYDFACAEVNGMVYAVGG--NGVNGESLSCAEVYDPDTNKWRVIESLRRPRWGCF  778
              M   R+ F    +N  +Y  GG   G+   +L  AEVYDP+ N+W  I  +        
Sbjct  219   DMLRRRHFFGSCVINNCLYVAGGECEGIQ-RTLRSAEVYDPNRNRWSFIADMSTAMVPFI  277

Query  777   GCGFEGKLYVMGGRSSFTIGNSRFV--DVYNPERQSWCEMKNGCVMVTAHAVVGK--KLF  610
             G  ++GK ++ G      +G+ R V  + YNPE  +W  + NG V    +  +    +L+
Sbjct  278   GVVYDGKWFLKG------LGSHREVLSESYNPEMNAWSPVNNGMVAGWRNPSISMDGRLY  331

Query  609   CIEWKNQRKLGIFNPEDNSW  550
              ++ ++  KL +++   +SW
Sbjct  332   ALDCRDGCKLRVYDEATHSW  351



>emb|CDY26117.1| BnaC06g10790D [Brassica napus]
Length=435

 Score =   124 bits (310),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 96/320 (30%), Positives = 143/320 (45%), Gaps = 25/320 (8%)
 Frame = -1

Query  1482  GKKRVTELKMCFSDEMNLDNPGHSKNISYFTSSVVVDDSYSPLLPGLPDDVAKYCLALVP  1303
              +K V   K+C   ++N +    SKN     + +       PLLPGLPDD+A  CL  VP
Sbjct  42    ARKFVPGSKLCIQPDINPNAHRRSKNSKRERTRI-----QPPLLPGLPDDLAVACLIRVP  96

Query  1302  RYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWLYVLTVDADGKESHWEVLDCLGHK  1123
             R     +  V KRW        F   RKL  + EEW+YV   D DGK S W   D +   
Sbjct  97    RAEHRKLRLVCKRWYRLASGNFFYSQRKLLGMSEEWVYVFKRDRDGKIS-WNTFDPVSQH  155

Query  1122  HHQLPQMPAPIR--AGFGVAVLNA-KLLVMGGYSMIDESASVSPEVFQYDSCLNSWSKLA  952
                LP +P       GFG AVL+   L + GG   +  S      V  Y++  N W +  
Sbjct  156   PQPLPPVPREYSEAVGFGCAVLSGCHLYLFGGKDPLRGSMR---RVIFYNARTNKWHRAP  212

Query  951   SMNVARYDFACAEVNGMVYAVGG--NGVNGESLSCAEVYDPDTNKWRVIESLRRPRWGCF  778
              M   R+ F    +N  +Y  GG   G+   +L  AEVYDP+ N+W  +  +        
Sbjct  213   DMLRKRHFFGSCVINNCLYVAGGECEGIQ-RTLRSAEVYDPNKNRWSFVADMSTAMVPLI  271

Query  777   GCGFEGKLYVMGGRSSFTIGNSRFVDVYNPERQSWCEMKNGCVMVTAH----AVVGKKLF  610
             G  ++ K ++ G  S   +      + Y+PE  SW  + +G  MVT        +  +L+
Sbjct  272   GVVYDKKWFLKGLGSHQQV----MSEAYDPETNSWRPVSDG--MVTGWRNPCTSLNGRLY  325

Query  609   CIEWKNQRKLGIFNPEDNSW  550
              ++ ++  KL +F+   +SW
Sbjct  326   GLDCRDGCKLRVFDETTDSW  345



>ref|XP_009103742.1| PREDICTED: F-box/kelch-repeat protein At1g55270-like [Brassica 
rapa]
Length=435

 Score =   124 bits (310),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 96/320 (30%), Positives = 143/320 (45%), Gaps = 25/320 (8%)
 Frame = -1

Query  1482  GKKRVTELKMCFSDEMNLDNPGHSKNISYFTSSVVVDDSYSPLLPGLPDDVAKYCLALVP  1303
              +K V   K+C   ++N +    SKN     + +       PLLPGLPDD+A  CL  VP
Sbjct  42    ARKFVPGSKLCIQPDINPNAHRRSKNSKRERTRI-----QPPLLPGLPDDLAVACLIRVP  96

Query  1302  RYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWLYVLTVDADGKESHWEVLDCLGHK  1123
             R     +  V KRW        F   RKL  + EEW+YV   D DGK S W   D +   
Sbjct  97    RAEHRKLRLVCKRWYRLASGNFFYSQRKLLGMSEEWVYVFKRDRDGKIS-WNTFDPVSQH  155

Query  1122  HHQLPQMPAPIR--AGFGVAVLNA-KLLVMGGYSMIDESASVSPEVFQYDSCLNSWSKLA  952
                LP +P       GFG AVL+   L + GG   +  S      V  Y++  N W +  
Sbjct  156   PQPLPPVPREYSEAVGFGCAVLSGCHLYLFGGKDPLRGSMR---RVIFYNARTNKWHRAP  212

Query  951   SMNVARYDFACAEVNGMVYAVGG--NGVNGESLSCAEVYDPDTNKWRVIESLRRPRWGCF  778
              M   R+ F    +N  +Y  GG   G+   +L  AEVYDP+ N+W  +  +        
Sbjct  213   DMLRKRHFFGSCVINNCLYVAGGECEGIQ-RTLRSAEVYDPNKNRWSFVADMSTAMVPLI  271

Query  777   GCGFEGKLYVMGGRSSFTIGNSRFVDVYNPERQSWCEMKNGCVMVTAH----AVVGKKLF  610
             G  ++ K ++ G  S   +      + Y+PE  SW  + +G  MVT        +  +L+
Sbjct  272   GVVYDKKWFLKGLGSHQQV----MSEAYDPETNSWRPVSDG--MVTGWRNPCTSLNGRLY  325

Query  609   CIEWKNQRKLGIFNPEDNSW  550
              ++ ++  KL +F+   +SW
Sbjct  326   GLDCRDGCKLRVFDETTDSW  345



>ref|XP_009785251.1| PREDICTED: F-box/kelch-repeat protein At1g55270-like isoform 
X1 [Nicotiana sylvestris]
Length=445

 Score =   124 bits (311),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 98/320 (31%), Positives = 145/320 (45%), Gaps = 26/320 (8%)
 Frame = -1

Query  1482  GKKRVTELKMCFSDEMNLDNPGHSKNISYFTSSVVVDDSYSPLLPGLPDDVAKYCLALVP  1303
              +K V   K+C   ++N      +KN     S V       PLLPGLPDD+A  CL  VP
Sbjct  49    ARKFVPGSKICIQPDIN-PRAHKTKNSRRERSRV-----QPPLLPGLPDDLAIACLIRVP  102

Query  1302  RYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWLYVLTVDADGKESHWEVLDCLGHK  1123
             R     +  V KRW   +    F  +RK   + EEW+YV+  D DG+ S W   D     
Sbjct  103   RVEHNKLRLVCKRWYRLLAGNFFYSLRKSLGMAEEWVYVMKRDRDGRIS-WHAFDSTYQL  161

Query  1122  HHQLPQMPAPIRA--GFGVAVLNA-KLLVMGGYSMIDESASVSPEVFQYDSCLNSWSKLA  952
                LP +P       GFG AVL+   L + GG   I  S      V  Y +  N W +  
Sbjct  162   WQPLPPVPGEYSEALGFGCAVLSGCHLYLFGGKDPIKGSMR---RVIFYSARTNKWHRAP  218

Query  951   SMNVARYDFACAEVNGMVYAVGG--NGVNGESLSCAEVYDPDTNKWRVIESLRRPRWGCF  778
              M   R+ F    +N  +Y  GG   G+   +L  AEVYDP+ N+W  I  +        
Sbjct  219   DMLRRRHFFGSCVINNCLYVAGGECEGIQ-RTLRSAEVYDPNRNRWSFIADMSTAMVPFI  277

Query  777   GCGFEGKLYVMGGRSSFTIGNSRFV--DVYNPERQSWCEMKNGCVMVTAHAVVGK--KLF  610
             G  ++GK ++ G      +G+ R V  + YNPE  +W  + NG V    +  +    +L+
Sbjct  278   GVVYDGKWFLKG------LGSHREVLSESYNPEMNAWSPVNNGMVAGWRNPSISMDGRLY  331

Query  609   CIEWKNQRKLGIFNPEDNSW  550
              ++ ++  KL +++   +SW
Sbjct  332   ALDCRDGCKLRVYDEATHSW  351



>ref|XP_004955477.1| PREDICTED: F-box/kelch-repeat protein At1g30090-like [Setaria 
italica]
Length=408

 Score =   123 bits (309),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 97/307 (32%), Positives = 140/307 (46%), Gaps = 14/307 (5%)
 Frame = -1

Query  1362  SPLLPGLPDDVAKYCLALVPRYYFPAMGGVNKRWRSFIRSK-EFIMVRKLACLLEEWLYV  1186
             +PL+PGLPDD A  CL  +P     A   V +RW   +  K  F   R+   L   WL+ 
Sbjct  51    TPLIPGLPDDAALTCLLRLPVAAHGACRLVCRRWHHLLADKARFFSQRRALGLRSPWLFT  110

Query  1185  LTVDADGKESHWEVLDCLGH-KHHQLPQMPAPIRA---GFGVAVL--NAKLLVMGGYSMI  1024
             L       +  W+VLD LGH   H +P MP   RA   GFG   +  +  LLV GG  ++
Sbjct  111   LAFHRCTGKIQWKVLD-LGHLAWHAIPAMPCRDRACPRGFGCVAVPGDGALLVCGG--LV  167

Query  1023  DESASVSPEVFQYDSCLNSWSKLASMNVARYDFACAEVNGMVYAVGGNGVNGESLSCAEV  844
              +       V +YD   N W+ +  M  AR  FA   ++G VY  GG   N   L+ AEV
Sbjct  168   SDMDCPLHLVLRYDVYRNRWTVVTRMLAARSFFAGGVIDGRVYVAGGYSTNQFELNSAEV  227

Query  843   YDPDTNKWRVIESLRRPRWGCFGCGFEGKLYVMGGRSSFTIGNSRFVDVYNPERQSWCEM  664
              DPD   W+ I S+             G+LYV  G  ++   +S    +Y+P+   W  M
Sbjct  228   LDPDKGVWQPIASMGINMASSDSAVISGRLYVTEG-CAWPFFSSPRGQIYDPKINQWEAM  286

Query  663   KNGCV--MVTAHAVVGKKLFCIEWKNQRKLGIFNPEDNSWKMV-GVPVTGSSSIGFRLGI  493
               G          V+  +LF I    + K+ I++PE +SW  V G P+       F +  
Sbjct  287   PVGMREGWTGQSVVIDGRLFVISEYERMKVKIYDPETDSWDSVSGPPMPERIMKPFSVSC  346

Query  492   LDEKLLL  472
             LD ++++
Sbjct  347   LDSRIVV  353



>emb|CAN63498.1| hypothetical protein VITISV_011673 [Vitis vinifera]
Length=428

 Score =   124 bits (310),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 92/281 (33%), Positives = 132/281 (47%), Gaps = 18/281 (6%)
 Frame = -1

Query  1368  SYSPLLPGLPDDVAKYCLALVPRYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWLY  1189
             S SPLLPGLPDD+A  CL  VPR     +  V KRW   +    +  +RK   + EEW+Y
Sbjct  63    SQSPLLPGLPDDLAIACLIRVPRIEHRKLRLVCKRWYRLLVGNFYYSLRKNLGIAEEWIY  122

Query  1188  VLTVDADGKESHWEVLDCLGHKHHQLPQMPAPIRA--GFGVAVLNA-KLLVMGGYSMIDE  1018
             V+  D +GK S W   D +      LP +P       GFG AVL+   L + GG   +  
Sbjct  123   VIKRDREGKIS-WHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGKDPLKG  181

Query  1017  SASVSPEVFQYDSCLNSWSKLASMNVARYDFACAEVNGMVYAVGG-NGVNGESLSCAEVY  841
             S      V  Y +  N W +   M   R+ F    +N  +Y  GG N     SL  AE Y
Sbjct  182   SMR---RVIFYSARTNKWHRAPDMLRRRHFFGSCVINNCLYVAGGENEGMHRSLRSAEXY  238

Query  840   DPDTNKWRVIESLRRPRWGCFGCGFEGKLYVMGGRSSFTIGNSRFV--DVYNPERQSWCE  667
             DP+ N+W  I  +        G  +EGK ++ G      +G+ R V  +VY PE  SW  
Sbjct  239   DPNRNRWSFISDMSTAMVPFIGVVYEGKWFLKG------LGSHRQVLSEVYQPETDSWYP  292

Query  666   MKNGCVM--VTAHAVVGKKLFCIEWKNQRKLGIFNPEDNSW  550
             + +G V       A +  +L+ ++ K+  KL +++   +SW
Sbjct  293   VYDGMVAGWRNPSASLNGQLYALDCKDGCKLRVYDEVSDSW  333



>ref|XP_006307563.1| hypothetical protein CARUB_v10009185mg [Capsella rubella]
 gb|EOA40461.1| hypothetical protein CARUB_v10009185mg [Capsella rubella]
Length=434

 Score =   124 bits (310),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 97/320 (30%), Positives = 143/320 (45%), Gaps = 26/320 (8%)
 Frame = -1

Query  1482  GKKRVTELKMCFSDEMNLDNPGHSKNISYFTSSVVVDDSYSPLLPGLPDDVAKYCLALVP  1303
              +K V   K+C   ++N  N    KN     + +       PLLPGLPDD+A  CL  VP
Sbjct  42    ARKFVPGSKLCIQPDIN-PNAHRRKNSKRERTRI-----QPPLLPGLPDDLAVACLIRVP  95

Query  1302  RYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWLYVLTVDADGKESHWEVLDCLGHK  1123
             R     +  V KRW        F   RKL  + EEW+YV   D DGK S W   D     
Sbjct  96    RAEHRKLRQVCKRWYRLASGNFFYSQRKLLGMSEEWVYVFKRDRDGKIS-WNTFDPSSQI  154

Query  1122  HHQLPQMPAPIR--AGFGVAVLNA-KLLVMGGYSMIDESASVSPEVFQYDSCLNSWSKLA  952
                LP +P       GFG AVL+   L + GG   +  S      V  Y++  N W +  
Sbjct  155   WQPLPPVPREYSEAVGFGCAVLSGCHLYLFGGKDPLRGSMR---RVIFYNARTNKWHRAP  211

Query  951   SMNVARYDFACAEVNGMVYAVGG--NGVNGESLSCAEVYDPDTNKWRVIESLRRPRWGCF  778
              M   R+ F C  +N  +Y  GG   G+   +L  AEVYDP+ N+W  I  +        
Sbjct  212   DMLRKRHFFGCCVINNCLYVAGGECEGIQ-RTLRSAEVYDPNKNRWSFIADMSTAMVPLI  270

Query  777   GCGFEGKLYVMGGRSSFTIGNSRFV--DVYNPERQSWCEMKNGCVM--VTAHAVVGKKLF  610
             G  ++ K ++ G      +G+ + V  + Y+PE  SW  + +G V         +  +L+
Sbjct  271   GVVYDKKWFLKG------LGSHQLVMSEAYDPEVNSWSPVSDGMVAGWRNPCTSLNGRLY  324

Query  609   CIEWKNQRKLGIFNPEDNSW  550
              ++ ++  KL +F+   +SW
Sbjct  325   GLDCRDGCKLRVFDETADSW  344



>ref|XP_006354154.1| PREDICTED: F-box/kelch-repeat protein At1g55270-like [Solanum 
tuberosum]
Length=437

 Score =   124 bits (310),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 98/320 (31%), Positives = 145/320 (45%), Gaps = 26/320 (8%)
 Frame = -1

Query  1482  GKKRVTELKMCFSDEMNLDNPGHSKNISYFTSSVVVDDSYSPLLPGLPDDVAKYCLALVP  1303
              +K V   K+C   ++N  +   +KN     S V      SPLLPGLPDD+A  CL  VP
Sbjct  41    ARKFVAGSKICIQPDIN-PHAHKTKNSRRERSRV-----QSPLLPGLPDDLAIACLIRVP  94

Query  1302  RYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWLYVLTVDADGKESHWEVLDCLGHK  1123
             R     +  V KRW   +    F  +RK   + EEW+YV+  D DG+ S W   D     
Sbjct  95    RVEHNKLRLVCKRWYRLLAGNFFYSLRKSLGMAEEWVYVIKRDRDGRIS-WHAFDPTYQL  153

Query  1122  HHQLPQMPAPIRA--GFGVAVLNA-KLLVMGGYSMIDESASVSPEVFQYDSCLNSWSKLA  952
                LP +P       GFG AVL+   L + GG   I  S      V  Y +  N W +  
Sbjct  154   WQPLPPLPGEYSEALGFGCAVLSGCHLYLFGGKDPIKGSMR---RVIFYSARTNKWHRAP  210

Query  951   SMNVARYDFACAEVNGMVYAVGG--NGVNGESLSCAEVYDPDTNKWRVIESLRRPRWGCF  778
              M   R+ F    +N  +Y  GG   G+   +L  AEVYDP+ N+W  I  +        
Sbjct  211   DMLRKRHFFGSCVINNCLYVAGGECEGIQ-RTLRSAEVYDPNRNRWTFITDMSTAMVPFI  269

Query  777   GCGFEGKLYVMGGRSSFTIGNSRFV--DVYNPERQSWCEMKNGCVMVTAHAVVGKK--LF  610
             G  ++GK ++ G      +G+ R V  + YNPE   W  + +G V    +  +     L+
Sbjct  270   GVIYDGKWFLKG------LGSHREVLSEAYNPETNGWSPVTDGMVAGWRNPSISMNGCLY  323

Query  609   CIEWKNQRKLGIFNPEDNSW  550
              ++ ++  KL +++   +SW
Sbjct  324   ALDCRDGCKLRVYDGASDSW  343



>ref|XP_009110457.1| PREDICTED: F-box/kelch-repeat protein At1g16250 [Brassica rapa]
Length=383

 Score =   123 bits (308),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 74/251 (29%), Positives = 123/251 (49%), Gaps = 16/251 (6%)
 Frame = -1

Query  1377  VDDSYSPLLPGLPDDVAKYCLALVPRYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEE  1198
             +D +   ++PGLPDD+A  CLA +   +  A+  V++ WR  +RS ++   +        
Sbjct  1     MDSTEQSIIPGLPDDLALRCLAKLSHGHHGALECVSRGWRDLLRSADYSCFKSRNGWSGT  60

Query  1197  WLYVLTVDADGKESHWEVLDCLGHKHHQLPQMPAPI----RAGFGVAVLNAKLLVMGG--  1036
             WL+VLT   +  ++ W   D    + H LP+  A       +GF    ++  LLV+GG  
Sbjct  61    WLFVLT---EQSKNQWVAYDPEADRWHPLPRTRAVQDGWHHSGFACVCVSNCLLVIGGCY  117

Query  1035  ----YSMIDESASVSPEVFQYDSCLNSWSKLASMNVARYDFACAEVNGMVYAVGG-NGVN  871
                  S   +   V+ +V ++D     W  +ASM   R  FAC  V+G VY  GG N  +
Sbjct  118   APSVSSFPHQKPVVTGDVMRFDPFKKEWRMVASMRTPRTHFACCAVSGKVYVAGGRNLTH  177

Query  870   GESLSCAEVYDPDTNKWRVIESLRRPRWGCFGCGFEGKLYVMGGRSSFTIGNSRFVDVYN  691
                ++ AEVYDP  ++W  + ++ RP+  C G  + G  +V+  +  F      F +V+N
Sbjct  178   SRGITSAEVYDPVADRWEELPAMPRPQMDCSGLSYRGSFHVLSDQVGF--AEQSFSEVFN  235

Query  690   PERQSWCEMKN  658
             P   SW  +++
Sbjct  236   PLEMSWSTVED  246



>ref|XP_007223086.1| hypothetical protein PRUPE_ppa007000mg [Prunus persica]
 gb|EMJ24285.1| hypothetical protein PRUPE_ppa007000mg [Prunus persica]
Length=386

 Score =   122 bits (307),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 74/251 (29%), Positives = 126/251 (50%), Gaps = 16/251 (6%)
 Frame = -1

Query  1377  VDDSYSPLLPGLPDDVAKYCLALVPRYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEE  1198
             ++  +  ++PGLPDD+A  CLA+V   Y   +  V+K WR  IRS ++   +        
Sbjct  1     MESVHQSIIPGLPDDLALRCLAMVSHGYHGLLETVSKTWRYLIRSLDYANYKAREEWCGN  60

Query  1197  WLYVLTVDADGKESHWEVLDCLGHKHHQLPQMPA--PIRAGFG---VAVLNAKLLVMGGY  1033
             WL+VLT   +G  + W   D    + H LP++      R  FG   ++V N   ++ G Y
Sbjct  61    WLFVLT---EGSNNEWVAYDPEADRWHPLPKILTVHADRKHFGFSSISVGNRFFVIGGSY  117

Query  1032  SMID-----ESASVSPEVFQYDSCLNSWSKLASMNVARYDFACAEVNGMVYAVGGNGVN-  871
             +  D     +   ++ EV Q+D     W+ +A+M   R  FAC+ V G +Y  GG  ++ 
Sbjct  118   APHDPAFPHQRPFITNEVMQFDPFKKQWTNVATMLTPRSHFACSAVYGKIYVAGGRNLSC  177

Query  870   GESLSCAEVYDPDTNKWRVIESLRRPRWGCFGCGFEGKLYVMGGRSSFTIGNSRFVDVYN  691
                L+ AEVYDP  +KW  +  +R P+  C G  ++GK +V+  +      N+   +V++
Sbjct  178   TRGLALAEVYDPVADKWEELPPMRNPQMDCLGLSYKGKFHVLSDQVGLPDQNTS--EVFS  235

Query  690   PERQSWCEMKN  658
             P   +W  +++
Sbjct  236   PSDGTWRTVED  246



>ref|XP_010047816.1| PREDICTED: F-box/kelch-repeat protein At1g55270-like [Eucalyptus 
grandis]
 gb|KCW79805.1| hypothetical protein EUGRSUZ_C01139 [Eucalyptus grandis]
Length=432

 Score =   123 bits (309),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 93/280 (33%), Positives = 133/280 (48%), Gaps = 20/280 (7%)
 Frame = -1

Query  1362  SPLLPGLPDDVAKYCLALVPRYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWLYVL  1183
             SPLLPGLPDD+A  CL  VPR     +  V K+W   +    F  +RK   + EEW+YV+
Sbjct  69    SPLLPGLPDDLAIACLIRVPRVEHCKLRLVCKKWYKLLSGNFFYSLRKSLGIAEEWVYVI  128

Query  1182  TVDADGKESHWEVLDCLGHKHHQLPQMPAPIRA--GFGVAVLNA-KLLVMGGYSMIDESA  1012
               D DGK S W   D +      LP +P       GFG AVL+   L + GG   +  S 
Sbjct  129   KRDRDGKIS-WHAFDPIYQLWQPLPPVPKEYSEALGFGCAVLSGCHLYLFGGKDPLKGSM  187

Query  1011  SVSPEVFQYDSCLNSWSKLASMNVARYDFACAEVNGMVYAVGG--NGVNGESLSCAEVYD  838
                  V  Y +  N W +   M   R+ F    +N  +Y  GG   GV+  ++  AEVYD
Sbjct  188   R---RVVFYSARTNKWHRAPDMLRRRHFFGSCVINNCLYVAGGENEGVH-RTMRSAEVYD  243

Query  837   PDTNKWRVIESLRRPRWGCFGCGFEGKLYVMGGRSSFTIGNSRFV--DVYNPERQSWCEM  664
             P+ N+W  I  +        G  +EGK Y+ G      +G+ R V  +VY PE  SW  +
Sbjct  244   PNRNRWSFISEMSTAMVPFIGVVYEGKWYLKG------LGSHRQVLSEVYQPETDSWFPV  297

Query  663   KNGCVMVTAHAVVG--KKLFCIEWKNQRKLGIFNPEDNSW  550
              +G V    +  V     L+ ++ K+  KL +++   +SW
Sbjct  298   YDGMVAGWRNPSVSFNGHLYALDCKDGCKLRVYDEVTDSW  337



>ref|XP_010914885.1| PREDICTED: F-box/kelch-repeat protein At1g55270-like [Elaeis 
guineensis]
Length=426

 Score =   123 bits (308),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 92/282 (33%), Positives = 133/282 (47%), Gaps = 20/282 (7%)
 Frame = -1

Query  1368  SYSPLLPGLPDDVAKYCLALVPRYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWLY  1189
             S SPLLPGLPDD+A  CL  VPR     +  V KRW   +    F  +RK   + EEW+Y
Sbjct  63    SQSPLLPGLPDDLAIACLIRVPRAEHRKLRLVCKRWHRLLAGNYFYSLRKSLGIAEEWIY  122

Query  1188  VLTVDADGKESHWEVLDCLGHKHHQLPQMPAPIRA--GFGVAVLNA-KLLVMGGYSMIDE  1018
             V+  D DG+ S W+  D +    H LP +P       GFG AVL+   L + GG    D 
Sbjct  123   VIKRDRDGRIS-WDAFDPVYQLWHPLPPVPGEYSEALGFGCAVLSGCHLYLFGGK---DP  178

Query  1017  SASVSPEVFQYDSCLNSWSKLASMNVARYDFACAEVNGMVYAVGG--NGVNGESLSCAEV  844
                    V  Y +  N W +   M   R+ F    +N  +Y  GG   GV+   L  AEV
Sbjct  179   HKGSMRRVIFYSARTNKWHRAPDMLRRRHFFGSCVINNCLYVAGGESEGVH-RFLRSAEV  237

Query  843   YDPDTNKWRVIESLRRPRWGCFGCGFEGKLYVMGGRSSFTIGNSRFV--DVYNPERQSWC  670
             YDP+ N+W  I  +        G  +EGK ++ G      +G+ R V  +VY PE  +W 
Sbjct  238   YDPNKNRWSFISDMSTAMVPFIGVVYEGKWFLKG------LGSQRQVLSEVYVPETGNWY  291

Query  669   EMKNGCVM--VTAHAVVGKKLFCIEWKNQRKLGIFNPEDNSW  550
                +G V         +  +L+ ++ K+  +L +++   +SW
Sbjct  292   PAFDGMVSGWRNPSVCLNGQLYALDCKDGCRLRVYDGATDSW  333



>ref|XP_002320790.1| SKP1 INTERACTING PARTNER 4 family protein [Populus trichocarpa]
 gb|EEE99105.1| SKP1 INTERACTING PARTNER 4 family protein [Populus trichocarpa]
Length=347

 Score =   122 bits (306),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 89/318 (28%), Positives = 147/318 (46%), Gaps = 31/318 (10%)
 Frame = -1

Query  1377  VDDSYSPLLPGLPDDVAKYCLALVPRYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEE  1198
             ++++   L+ GLPDD+A  CLA VPR Y   +  V+KRWR F+ S E    R++  L E 
Sbjct  1     MEENQMSLICGLPDDIALSCLARVPRKYHAVLKCVSKRWREFVCSDELYDYRRMHSLSET  60

Query  1197  WLYVLTVDADGKESHWEVLDCLGHKHHQ-LPQMPAPI--RAGFGVAVLNAKLLVMGGYSM  1027
             W+Y L  D  GK   + V      +  + +P +PA    + G G  VL  K+ ++GG   
Sbjct  61    WIYALCCDKYGKIWFYVVDPNESQRRWKCVPGLPARALNKMGMGFEVLGKKVYLLGGGGW  120

Query  1026  IDESASVSPEVFQYDSCLNSWSKLASMNVARYDFACAEVNGMVYAVGGNGVNGESLSCAE  847
             ++     + E F YD   NSW+++AS++ ARYD AC   +G +YA+GG           +
Sbjct  121   LE----ATNEAFCYDVSRNSWTQVASLSTARYDSACQVYDGKIYAIGGLASTSNDPYSWD  176

Query  846   VYDPDTNKWRVIESLRRPRWGCFGCG---------FEGKLYVMGGRSSFTIGNSRFVDVY  694
             ++ P TN W    +          C           +GK+Y+    S+ T+ +  +  VY
Sbjct  177   IFYPRTNSWEFHSN---------DCAVPEVEDCVVLDGKIYIRCQASASTMSSPFYAVVY  227

Query  693   NPERQSWCEMKNGCVMVTA----HAVVGKKLFCIEWKNQRKLGIFNPEDNSWKMVGVPVT  526
              P    W   +    MV+       VV   L+ ++  +  KL ++  +   W +V    T
Sbjct  228   EPSSGMW--QRADADMVSGWQGPAIVVDGTLYVLDQSSGTKLMMWQKDKREWVVVKRLST  285

Query  525   GSSSIGFRLGILDEKLLL  472
               +    +L  + +KL +
Sbjct  286   LLTKPPCQLAAIGKKLFI  303



>ref|XP_011025173.1| PREDICTED: F-box/kelch-repeat protein At1g55270 [Populus euphratica]
Length=438

 Score =   123 bits (309),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 94/320 (29%), Positives = 147/320 (46%), Gaps = 26/320 (8%)
 Frame = -1

Query  1482  GKKRVTELKMCFSDEMNLDNPGHSKNISYFTSSVVVDDSYSPLLPGLPDDVAKYCLALVP  1303
              +K V   K+C   ++N +   H    S    + V      PLLPGLPDD+A  CL  VP
Sbjct  42    ARKFVPGSKLCIQPDINPN--AHKSKTSRRERTRV----QPPLLPGLPDDLAIACLIRVP  95

Query  1302  RYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWLYVLTVDADGKESHWEVLDCLGHK  1123
             R     +  V KRW   +    F  +RK   + EEW+YV+  D DGK S W   D +   
Sbjct  96    RAEHRKLRLVCKRWYRLLAGNFFYSLRKSLGMAEEWVYVIKRDRDGKIS-WNAFDPVHQI  154

Query  1122  HHQLPQMPAPIRA--GFGVAVLNA-KLLVMGGYSMIDESASVSPEVFQYDSCLNSWSKLA  952
                LP +P       GFG AVL++  L + GG   +  S      V  Y +  N W +  
Sbjct  155   WQPLPPVPREYSGALGFGCAVLSSCHLYLFGGKDPLRGSMR---RVIFYSARTNKWHRAP  211

Query  951   SMNVARYDFACAEVNGMVYAVGG--NGVNGESLSCAEVYDPDTNKWRVIESLRRPRWGCF  778
              M   R+ F    +N  +Y  GG   G+   +L  AEVYDP+ N+W  I  +        
Sbjct  212   DMLRKRHFFGSCVINNCLYVAGGECEGIQ-RTLRSAEVYDPNKNRWSFISDMSTAMVPFI  270

Query  777   GCGFEGKLYVMGGRSSFTIGNSRFV--DVYNPERQSWCEMKNGCVMVTAHAVVG--KKLF  610
             G  ++GK ++ G      +G+ R V  + Y+PE  +W  + +G V    +  +    +L+
Sbjct  271   GVVYDGKWFLKG------LGSHREVMSEAYDPETSTWTPISDGMVAGWRNPSISLDGRLY  324

Query  609   CIEWKNQRKLGIFNPEDNSW  550
              ++ ++  KL +++   ++W
Sbjct  325   ALDCRDGCKLRVYDEASDTW  344



>ref|XP_010032898.1| PREDICTED: F-box/kelch-repeat protein At1g55270 [Eucalyptus grandis]
 gb|KCW52391.1| hypothetical protein EUGRSUZ_J01801 [Eucalyptus grandis]
Length=438

 Score =   123 bits (308),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 91/317 (29%), Positives = 146/317 (46%), Gaps = 20/317 (6%)
 Frame = -1

Query  1482  GKKRVTELKMCFSDEMNLDNPGHSKNISYFTSSVVVDDSYSPLLPGLPDDVAKYCLALVP  1303
              +K V   K+C   ++N  N   +KN     + V       PLLPGLPDD+A  CL  VP
Sbjct  42    ARKFVPGSKICIQPDIN-PNAHRTKNSRRERTRV-----QPPLLPGLPDDLAILCLIRVP  95

Query  1302  RYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWLYVLTVDADGKESHWEVLDCLGHK  1123
             R     +  V +RW++ +RS  F  +RK   L EEW+YV+  D DG+ S W   D     
Sbjct  96    RIEHIKLRHVCQRWKNVVRSSYFYNLRKSLGLAEEWVYVMKRDRDGRIS-WHAFDPTYQL  154

Query  1122  HHQLPQMPAPIR--AGFGVAVLNA-KLLVMGGYSMIDESASVSPEVFQYDSCLNSWSKLA  952
                LP +P+      GFG AVL+  +L + GG   +  S      V  Y++  N W K  
Sbjct  155   WQPLPPVPSEYSEAVGFGCAVLSGHRLYLFGGKDPLRGSMR---RVVFYNAWTNRWQKAP  211

Query  951   SMNVARYDFACAEVNGMVYAVGGNGVNGE-SLSCAEVYDPDTNKWRVIESLRRPRWGCFG  775
              M   R+ F    +N  +Y  GG     + +L   EV+DP+  +W  I  +        G
Sbjct  212   EMLRKRHFFGFCVINNCLYVAGGECEGTQRTLRSGEVFDPNKRRWSPITDMSTAMVPFIG  271

Query  774   CGFEGKLYVMGGRSSFTIGNSRFVDVYNPERQSWCEMKNGCVM--VTAHAVVGKKLFCIE  601
               ++GK ++ G  S   +      + Y PE  +W  + +G +         +  +L+ ++
Sbjct  272   VVYDGKWFLKGLGSHQEV----MSEAYVPETNTWTAVSDGMIAGWRNPSISLNGQLYALD  327

Query  600   WKNQRKLGIFNPEDNSW  550
              ++  KL +++ + +SW
Sbjct  328   CRDGCKLRVYDRDTDSW  344



>ref|XP_007154990.1| hypothetical protein PHAVU_003G163600g [Phaseolus vulgaris]
 gb|ESW26984.1| hypothetical protein PHAVU_003G163600g [Phaseolus vulgaris]
Length=428

 Score =   122 bits (307),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 91/280 (33%), Positives = 131/280 (47%), Gaps = 20/280 (7%)
 Frame = -1

Query  1362  SPLLPGLPDDVAKYCLALVPRYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWLYVL  1183
             SPLLPGLPDD+A  CL  VPR     +  V KRW   +    F  +RK   + EEW+YV+
Sbjct  65    SPLLPGLPDDLAIACLIRVPRVEHRKLRLVCKRWYRLLVGNFFYSLRKSLGIAEEWIYVI  124

Query  1182  TVDADGKESHWEVLDCLGHKHHQLPQMPAPIRA--GFGVAVLNA-KLLVMGGYSMIDESA  1012
               D D K S W   D +      LP +P       GFG AVLN   L + GG   +  S 
Sbjct  125   KRDRDAKIS-WHAFDPVYQLWQPLPPVPREYSGALGFGCAVLNGCHLYLFGGKDPLKGSM  183

Query  1011  SVSPEVFQYDSCLNSWSKLASMNVARYDFACAEVNGMVYAVGG--NGVNGESLSCAEVYD  838
                  V  Y +  N W +   M   R+ F    +N  +Y  GG   GV+  SL  AEVYD
Sbjct  184   R---RVIFYSARTNKWHRAPDMLRRRHFFGSCVINNCLYVAGGENEGVH-RSLRSAEVYD  239

Query  837   PDTNKWRVIESLRRPRWGCFGCGFEGKLYVMGGRSSFTIGNSRFV--DVYNPERQSWCEM  664
             P+ N+W  +  +        G  ++GK ++ G      +G  + V  +VY PE  SW  +
Sbjct  240   PNKNRWSFVSDMSTAMVPFIGVVYDGKWFLKG------LGPHQQVLSEVYQPENDSWYPI  293

Query  663   KNGCVM--VTAHAVVGKKLFCIEWKNQRKLGIFNPEDNSW  550
              +G V         +  KL+ ++ K+  K+ +++   +SW
Sbjct  294   YDGMVSGWRNPSTTLNGKLYALDCKDGCKVRVYDEVTDSW  333



>ref|XP_010932959.1| PREDICTED: F-box/kelch-repeat protein At1g55270 [Elaeis guineensis]
Length=441

 Score =   122 bits (307),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 88/278 (32%), Positives = 134/278 (48%), Gaps = 16/278 (6%)
 Frame = -1

Query  1362  SPLLPGLPDDVAKYCLALVPRYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWLYVL  1183
             +PLLPGLPDD+A  CL  VPR   P +  V KRW   +    F  +RK   ++EEW+YV+
Sbjct  78    APLLPGLPDDLAIACLIRVPRAEHPNLRLVCKRWNRLLSGNYFYSLRKKLGMVEEWVYVI  137

Query  1182  TVDADGKESHWEVLDCLGHKHHQLPQMPAPIRA--GFGVAVLNA-KLLVMGGYSMIDESA  1012
               D DGK S W   D +      LP +PA      GFG AVL+   L + GG   +  S 
Sbjct  138   KRDRDGKIS-WHAFDPIYQLWKPLPPVPAEYSEALGFGCAVLSGCYLYLFGGKDPLRGSM  196

Query  1011  SVSPEVFQYDSCLNSWSKLASMNVARYDFACAEVNGMVYAVGG--NGVNGESLSCAEVYD  838
                  V  Y++  N W++   M   R+ F    +N  +Y  GG   G++  +L  AEVYD
Sbjct  197   R---RVVFYNARTNKWNRAPDMLRKRHFFGSCVINNCLYVAGGECEGIH-RNLRSAEVYD  252

Query  837   PDTNKWRVIESLRRPRWGCFGCGFEGKLYVMGGRSSFTIGNSRFVDVYNPERQSWCEMKN  658
             P+ N+W  I  +        G  F+GK ++ G  S   +      +VY P   +W  + +
Sbjct  253   PNRNRWTFIGEMNTGMVPLIGVVFDGKWFLKGLDSHRQV----VSEVYVPTTNAWSPVND  308

Query  657   GCVMVTAHAVV--GKKLFCIEWKNQRKLGIFNPEDNSW  550
             G V    +  +    +L+  + ++  KL +++   +SW
Sbjct  309   GMVTGWRNPSISFNGRLYASDCRDGCKLRVYDRATDSW  346



>ref|XP_008812564.1| PREDICTED: F-box/kelch-repeat protein At1g30090-like [Phoenix 
dactylifera]
Length=411

 Score =   122 bits (306),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 89/281 (32%), Positives = 128/281 (46%), Gaps = 11/281 (4%)
 Frame = -1

Query  1359  PLLPGLPDDVAKYCLALVPRYYFPAMGGVNKRWRSFIRSKE-FIMVRKLACLLEEWLYVL  1183
             PL+PGLPDD+A  CL  +P     A   V +RW   + +KE F   RK       WL+ L
Sbjct  55    PLIPGLPDDIALDCLLRLPVEAHSAGRLVCRRWHRLLANKERFFSQRKALGFRNPWLFTL  114

Query  1182  TVDADGKESHWEVLDCLGHKHHQLPQMPAPIRA---GFGVAVL--NAKLLVMGGYSMIDE  1018
                    +  W+VLD      H +P MP   R    GFG   +  +  LLV GG  ++ +
Sbjct  115   AFHRCTGKIQWQVLDLTHFSWHTIPAMPCKDRVCPCGFGCIAIPPDGTLLVCGG--LVSD  172

Query  1017  SASVSPEVFQYDSCLNSWSKLASMNVARYDFACAEVNGMVYAVGGNGVNGESLSCAEVYD  838
                    V +Y+   N W+ ++ M  AR  FA   +NGMVY  GG   +   L+ AEV D
Sbjct  173   MDCPLHLVLKYEMYKNRWTIMSRMLAARSFFAGGVINGMVYVAGGYSKDQYELNSAEVLD  232

Query  837   PDTNKWRVIESLRRPRWGCFGCGFEGKLYVMGGRSSFTIGNSRFVDVYNPERQSWCEMKN  658
             P    WR + S+R            G+LY   G   +   +S    VY+P+  SW +M  
Sbjct  233   PVKGNWRPVASMRANMVAYDSAVLNGRLYATEG-CVWPFLSSPTGQVYDPKTDSWGDMAV  291

Query  657   GCV--MVTAHAVVGKKLFCIEWKNQRKLGIFNPEDNSWKMV  541
             G       +  VV   LF I    + K+ +++ E +SW +V
Sbjct  292   GMREGWTGSSVVVDGHLFVISEYERMKVKVYDGESDSWDVV  332



>emb|CDP17358.1| unnamed protein product [Coffea canephora]
Length=437

 Score =   122 bits (306),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 96/320 (30%), Positives = 143/320 (45%), Gaps = 26/320 (8%)
 Frame = -1

Query  1482  GKKRVTELKMCFSDEMNLDNPGHSKNISYFTSSVVVDDSYSPLLPGLPDDVAKYCLALVP  1303
              +K V   K+C   ++N   P   K+ +Y      V     PL+PGLPDD+A  CL  VP
Sbjct  41    ARKFVPGSKLCIQPDIN---PRAHKSKNYRRERTRVQ---PPLIPGLPDDLAIACLIRVP  94

Query  1302  RYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWLYVLTVDADGKESHWEVLDCLGHK  1123
             R     +  V KRW   +    F  +RK   + EEW+YV+  D DG+ S W   D     
Sbjct  95    RVEHNKLRLVCKRWYRLLAGNYFYSLRKSLGMAEEWVYVIKRDRDGRIS-WHAFDPTYQL  153

Query  1122  HHQLPQMPAPIRA--GFGVAVLNA-KLLVMGGYSMIDESASVSPEVFQYDSCLNSWSKLA  952
                LP +P       GFG AVL+   L + GG   +  S      V  Y +  N W +  
Sbjct  154   WQPLPPVPVEYSEALGFGCAVLSGCHLYLFGGKDQLKGSMR---RVIFYSARTNKWHRAP  210

Query  951   SMNVARYDFACAEVNGMVYAVGG--NGVNGESLSCAEVYDPDTNKWRVIESLRRPRWGCF  778
              M   R+ F    +N  +Y  GG   G+   +L  AEVYDP+ N+W  +  +        
Sbjct  211   DMLRKRHFFGSCVINNCLYVAGGECEGIQ-RTLRSAEVYDPNKNRWSFVADMSTAMVPFI  269

Query  777   GCGFEGKLYVMGGRSSFTIGNSRFV--DVYNPERQSWCEMKNGCVMVTAHAVVGK--KLF  610
             G  ++GK ++ G      +G+ R V  + Y PE   W    +G V    +  V    KL+
Sbjct  270   GVVYDGKWFLKG------LGSHREVLSEAYIPESNKWMPADDGMVAGWRNPSVSMNGKLY  323

Query  609   CIEWKNQRKLGIFNPEDNSW  550
              ++ ++  KL +++   NSW
Sbjct  324   ALDCRDGCKLRVYDESTNSW  343



>ref|XP_011089119.1| PREDICTED: F-box/kelch-repeat protein At1g55270 [Sesamum indicum]
Length=437

 Score =   122 bits (306),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 89/279 (32%), Positives = 130/279 (47%), Gaps = 20/279 (7%)
 Frame = -1

Query  1359  PLLPGLPDDVAKYCLALVPRYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWLYVLT  1180
             PLLPGLPDD+A  CL  VPR     +  V KRW   +    F  +RK   + EEW+YV+ 
Sbjct  76    PLLPGLPDDLAIACLIRVPRIEHNKLRLVCKRWFKLLAGNFFYSLRKSLGMAEEWVYVIK  135

Query  1179  VDADGKESHWEVLDCLGHKHHQLPQMPAPIRA--GFGVAVLNA-KLLVMGGYSMIDESAS  1009
              D DG+ S W   D        LP +P    A  GFG AVL+   L + GG   +  S  
Sbjct  136   RDRDGRIS-WHAFDPTYQLWQPLPPVPVEYSAALGFGCAVLSGCHLYLFGGKDPLKGSMR  194

Query  1008  VSPEVFQYDSCLNSWSKLASMNVARYDFACAEVNGMVYAVGG--NGVNGESLSCAEVYDP  835
                 V  Y +  N W +   M   R+ F    +N  +Y  GG   G+   +L  AEVYDP
Sbjct  195   ---RVIFYSARTNKWHRAPDMLRRRHFFGSCVINNCLYVAGGECEGIQ-RTLRSAEVYDP  250

Query  834   DTNKWRVIESLRRPRWGCFGCGFEGKLYVMGGRSSFTIGNSRFV--DVYNPERQSWCEMK  661
             + N+W  I  +        G  ++GK ++ G      +G  R V  + Y PE  +W  M 
Sbjct  251   NRNRWSFISDMSTAMVPFIGVVYDGKWFLKG------LGTHREVLSEAYTPETNTWSPMN  304

Query  660   NGCVMVTAHAVVGK--KLFCIEWKNQRKLGIFNPEDNSW  550
             +G V    +  +    KL+ ++ ++  KL +++   +SW
Sbjct  305   DGMVAGWRNPSISMNGKLYALDCRDGCKLRVYDEGTDSW  343



>emb|CDX83957.1| BnaC08g16880D [Brassica napus]
Length=821

 Score =   125 bits (314),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 76/271 (28%), Positives = 131/271 (48%), Gaps = 16/271 (6%)
 Frame = -1

Query  1437  MNLDNPGHSKNISYFTSSVVVDDSYSPLLPGLPDDVAKYCLALVPRYYFPAMGGVNKRWR  1258
             +N    G  K     + + ++D +   ++PGLPDD+A  C+A +   +  A+  V++ WR
Sbjct  419   LNQVREGDRKVHLTISRAQIMDSTEQSIIPGLPDDLALICIAKLSHGHHGALECVSRGWR  478

Query  1257  SFIRSKEFIMVRKLACLLEEWLYVLTVDADGKESHWEVLDCLGHKHHQLPQMPAPI----  1090
               +RS ++   +        WL+VLT   +  ++ W   D    + H LP+  A      
Sbjct  479   DLLRSADYSCFKARNGWSGTWLFVLT---EQSKNQWVAYDPEADRWHPLPRTRAVQDGWH  535

Query  1089  RAGFGVAVLNAKLLVMGG------YSMIDESASVSPEVFQYDSCLNSWSKLASMNVARYD  928
              +GF    ++  LLV+GG       S   +   V+ +V ++D     W  +ASM   R  
Sbjct  536   HSGFACVCVSNCLLVIGGCYAPSLSSFPHQKPVVTGDVMRFDPFKKEWKMVASMRTPRTH  595

Query  927   FACAEVNGMVYAVGG-NGVNGESLSCAEVYDPDTNKWRVIESLRRPRWGCFGCGFEGKLY  751
             FAC+ V+G VY  GG N  +   ++ AEVYDP  ++W  + ++ RP+  C G  + G  +
Sbjct  596   FACSAVSGKVYVAGGRNLTHSRGITSAEVYDPVADRWEDLPAMPRPQMDCLGLSYRGSFH  655

Query  750   VMGGRSSFTIGNSRFVDVYNPERQSWCEMKN  658
             V+  +  F      F +V+NP   SW  +++
Sbjct  656   VLSDQVGF--AEQSFSEVFNPLEMSWSTVED  684



>ref|XP_008232912.1| PREDICTED: F-box/kelch-repeat protein SKIP4-like [Prunus mume]
Length=346

 Score =   121 bits (303),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 84/292 (29%), Positives = 136/292 (47%), Gaps = 38/292 (13%)
 Frame = -1

Query  1356  LLPGLPDDVAKYCLALVPRYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWLYVL--  1183
             L+ GLPDD+A +CLA VPR Y   +  V+KRWR  + S+E+   R+   L+E W+Y L  
Sbjct  8     LISGLPDDIALFCLARVPRKYHTLLKCVSKRWRDLVCSEEWHSYRQKHKLVETWIYALCR  67

Query  1182  ---------TVDADGKESHWEVLDCLGHKHHQLPQMPAPIRAGFGVAVLNAKLLVMGGYS  1030
                       +D +     W+++       H LP      R G G  VL  K+ ++GG  
Sbjct  68    DKLDRLCCYVLDPNSSRKSWKLV-------HGLPPRVLK-RKGMGFEVLGNKVYLLGGCG  119

Query  1029  MIDESASVSPEVFQYDSCLNSWSKLASMNVARYDFACAEVNGMVYAVGGNGVNGESLSCA  850
               +++     EV++YD  LN+WS+   ++ AR  FAC  ++G +Y++GG G N       
Sbjct  120   WCEDATG---EVYRYDVSLNAWSEACPLSTARCYFACEVLDGKIYSIGGLGSNSSDPHSW  176

Query  849   EVYDPDTNKWR------VIESLRRPRWGCFGCGFEGKLYVMGGRSSFTIGNSRFVDVYNP  688
             ++YDP T+ W+      ++  +             GK+Y+  G S+ T  +  +  VY P
Sbjct  177   DIYDPCTDSWKFHSDPNIVPEIED------SVVMGGKIYIRCGTSAVT--SHVYAVVYEP  228

Query  687   ERQSWCEMKNGCVM--VTAHAVVGKKLFCIEWKNQRKLGIFNPEDNSWKMVG  538
                +W       V        VV   L+ ++  +  +L I+  E   W  VG
Sbjct  229   SSGTWQHADADMVAGWRGPAVVVDGTLYVLDQSSGTRLMIWQKESREWIPVG  280



>ref|XP_008778886.1| PREDICTED: F-box/kelch-repeat protein At1g55270-like, partial 
[Phoenix dactylifera]
Length=417

 Score =   122 bits (305),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 86/277 (31%), Positives = 132/277 (48%), Gaps = 14/277 (5%)
 Frame = -1

Query  1362  SPLLPGLPDDVAKYCLALVPRYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWLYVL  1183
             +PLLPGLPDD+A  CL  VPR   P +  V KRW   +    F  +RK   ++EEW+YV+
Sbjct  54    APLLPGLPDDLAIACLIRVPRAEHPNLRLVCKRWNRLLSGNYFYSLRKKLGMVEEWVYVI  113

Query  1182  TVDADGKESHWEVLDCLGHKHHQLPQMPAPIRA--GFGVAVLNAKLLVMGGYSMIDESAS  1009
               D DGK S W   D +      LP +PA      GFG AVL+   L + G    D+   
Sbjct  114   KRDRDGKIS-WHAFDPIYQLWKPLPPVPAEYSEALGFGCAVLSGCYLYLFGGK--DQLRG  170

Query  1008  VSPEVFQYDSCLNSWSKLASMNVARYDFACAEVNGMVYAVGG--NGVNGESLSCAEVYDP  835
                 V  Y++  N W++   M   R+ F    +N  +Y  GG   G++  +L  AEVYDP
Sbjct  171   SMRRVVFYNARTNKWNRAPDMLRKRHFFGSCVINNCLYVAGGECEGIH-RNLRSAEVYDP  229

Query  834   DTNKWRVIESLRRPRWGCFGCGFEGKLYVMGGRSSFTIGNSRFVDVYNPERQSWCEMKNG  655
             + N+W  I  +        G  F+G  ++ G  S   +      +VY P   +W  + +G
Sbjct  230   NKNRWTFIGEMNTGMVPLIGVVFDGNWFLKGLDSHRQV----VSEVYVPTTNTWSPVNDG  285

Query  654   CVMVTAHAVV--GKKLFCIEWKNQRKLGIFNPEDNSW  550
              V    +  +    +L+  + ++  KL +++   +SW
Sbjct  286   MVTGWRNPSISFNGRLYASDCRDGCKLRVYDGATDSW  322



>ref|XP_008232906.1| PREDICTED: LOW QUALITY PROTEIN: F-box/kelch-repeat protein SKIP4-like 
[Prunus mume]
Length=359

 Score =   121 bits (303),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 85/296 (29%), Positives = 136/296 (46%), Gaps = 38/296 (13%)
 Frame = -1

Query  1368  SYSPLLPGLPDDVAKYCLALVPRYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWLY  1189
             S   L+ GLPDD+A +CLA VPR Y   +  V+KRWR  + S+E+   R+   L E W+Y
Sbjct  17    SQQSLISGLPDDIALFCLARVPRKYHTLLKCVSKRWRDLVCSEEWQSYRQKHKLDETWIY  76

Query  1188  VL-----------TVDADGKESHWEVLDCLGHKHHQLPQMPAPIRAGFGVAVLNAKLLVM  1042
              L            +D +     W+++       H LP      R G G  VL  K+ ++
Sbjct  77    ALCRDKLDRLCCYVLDPNSSRKSWKLV-------HGLPPRVLK-RKGMGFEVLGNKVYLL  128

Query  1041  GGYSMIDESASVSPEVFQYDSCLNSWSKLASMNVARYDFACAEVNGMVYAVGGNGVNGES  862
             GG    +++     EV+ YD  LN+WS+ + ++ AR  FAC  ++G +Y++GG G N   
Sbjct  129   GGCGWCEDATG---EVYCYDVSLNAWSEASPLSTARCYFACEVLDGKIYSIGGLGSNSSD  185

Query  861   LSCAEVYDPDTNKWR------VIESLRRPRWGCFGCGFEGKLYVMGGRSSFTIGNSRFVD  700
              +  ++YDP TN WR      ++  +            +GK+Y+  G S+ T  +  +  
Sbjct  186   PNSWDIYDPCTNSWRFHSDPSIVPEIED------SVVMDGKIYIRCGTSALT--SHVYAV  237

Query  699   VYNPERQSWCEMKNGCV--MVTAHAVVGKKLFCIEWKNQRKLGIFNPEDNSWKMVG  538
              Y P   +W       V         V   L+ ++  +  +L I+  E   W  VG
Sbjct  238   FYEPSSGTWQHADADMVGGRRGPAVAVDGTLYVLDQSSGTRLMIWQKESREWIPVG  293



>ref|XP_004983256.1| PREDICTED: F-box/kelch-repeat protein SKIP30-like [Setaria italica]
Length=348

 Score =   120 bits (302),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 81/216 (38%), Positives = 116/216 (54%), Gaps = 13/216 (6%)
 Frame = -1

Query  1362  SPLLPGLPDDVAKYCLALVPRYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWLYVL  1183
             S LL GLP++VA  CLA VP  + P +  V + WR+ +RS + + +R      EE L VL
Sbjct  3     STLLDGLPNEVALQCLARVPFLFHPMLQLVCRSWRASVRSGDLLKIRNQIGATEELLCVL  62

Query  1182  TVDADGKESHWEVLDCLGHKHHQLPQMPAPIR--AGFGVAVLNAKLLVMGGYS-MID---  1021
               +    E+ W++ D L  K   LP MP+ IR  A FGVA +  KL V+GG S  +D   
Sbjct  63    AFE---PENMWQLYDPLRDKWITLPVMPSQIRNIARFGVASVAGKLYVIGGGSDRVDPLT  119

Query  1020  ---ESASVSPEVFQYDSCLNSWSKLASMNVARYDFACAEVNGMVYAVGGNGVNGESLSCA  850
                +    S EV+ YD     WS+ A M VAR  FAC  ++G +   GG     +S+S A
Sbjct  120   GDHDRIFASNEVWSYDPLQRVWSQRAPMLVARAMFACCALDGKIIVAGGFTNCRKSISKA  179

Query  849   EVYDPDTNKWRVIESLRRPR-WGCFGCGFEGKLYVM  745
             E+YDP+ + W  +  LR+     C G   +GK++V+
Sbjct  180   EIYDPEADMWEPLPDLRQAHSSACSGLVIKGKMHVL  215



>ref|XP_010024899.1| PREDICTED: F-box/kelch-repeat protein At1g16250-like isoform 
X2 [Eucalyptus grandis]
 gb|KCW61419.1| hypothetical protein EUGRSUZ_H04146 [Eucalyptus grandis]
Length=381

 Score =   121 bits (303),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 68/225 (30%), Positives = 113/225 (50%), Gaps = 14/225 (6%)
 Frame = -1

Query  1377  VDDSYSPLLPGLPDDVAKYCLALVPRYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEE  1198
             ++  + P++PGLPDD+A  CLA V   +   +  V+K+WR  IR  E+   +       +
Sbjct  1     MEPPHEPIIPGLPDDLALRCLARVSHGFHGLLERVSKKWREVIRGTEYANFKAWEGWSGD  60

Query  1197  WLYVLTVDADGKESHWEVLDCLGHKHHQLPQMPAPI----RAGFGVAVLNAKLLVMGG-Y  1033
             WL+VLT D+   E  W   D    + H +P+MP         GF    +  + LV+GG Y
Sbjct  61    WLFVLTEDS---EDQWIAYDPEADRWHPIPKMPRTHPDWEHTGFSCVCVGDRFLVIGGAY  117

Query  1032  SMID-----ESASVSPEVFQYDSCLNSWSKLASMNVARYDFACAEVNGMVYAVGGNGVNG  868
              + D     +   ++ EV+Q+D     W+ ++SM   R  FAC  ++G VY  GG  +  
Sbjct  118   ELSDPGFPHQEPIITNEVYQFDPFRKKWTAVSSMQTPRSHFACRVISGKVYVAGGCNLQC  177

Query  867   ES-LSCAEVYDPDTNKWRVIESLRRPRWGCFGCGFEGKLYVMGGR  736
              + L+ AE Y+P +N+W  +  +  P+  C G  +  K +V+  +
Sbjct  178   PTGLTLAECYNPLSNRWEELPPMPNPQMDCIGLSYNRKFHVLSDQ  222



>ref|XP_010024895.1| PREDICTED: F-box/kelch-repeat protein At1g16250-like isoform 
X1 [Eucalyptus grandis]
 ref|XP_010024896.1| PREDICTED: F-box/kelch-repeat protein At1g16250-like isoform 
X1 [Eucalyptus grandis]
 ref|XP_010024897.1| PREDICTED: F-box/kelch-repeat protein At1g16250-like isoform 
X1 [Eucalyptus grandis]
 ref|XP_010024898.1| PREDICTED: F-box/kelch-repeat protein At1g16250-like isoform 
X1 [Eucalyptus grandis]
Length=384

 Score =   121 bits (303),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 68/221 (31%), Positives = 111/221 (50%), Gaps = 14/221 (6%)
 Frame = -1

Query  1365  YSPLLPGLPDDVAKYCLALVPRYYFPAMGGVNKRWRSFIRSKEFIMVRKLACLLEEWLYV  1186
             + P++PGLPDD+A  CLA V   +   +  V+K+WR  IR  E+   +       +WL+V
Sbjct  8     HEPIIPGLPDDLALRCLARVSHGFHGLLERVSKKWREVIRGTEYANFKAWEGWSGDWLFV  67

Query  1185  LTVDADGKESHWEVLDCLGHKHHQLPQMPAPI----RAGFGVAVLNAKLLVMGG-YSMID  1021
             LT D+   E  W   D    + H +P+MP         GF    +  + LV+GG Y + D
Sbjct  68    LTEDS---EDQWIAYDPEADRWHPIPKMPRTHPDWEHTGFSCVCVGDRFLVIGGAYELSD  124

Query  1020  -----ESASVSPEVFQYDSCLNSWSKLASMNVARYDFACAEVNGMVYAVGGNGVNGES-L  859
                  +   ++ EV+Q+D     W+ ++SM   R  FAC  ++G VY  GG  +   + L
Sbjct  125   PGFPHQEPIITNEVYQFDPFRKKWTAVSSMQTPRSHFACRVISGKVYVAGGCNLQCPTGL  184

Query  858   SCAEVYDPDTNKWRVIESLRRPRWGCFGCGFEGKLYVMGGR  736
             + AE Y+P +N+W  +  +  P+  C G  +  K +V+  +
Sbjct  185   TLAECYNPLSNRWEELPPMPNPQMDCIGLSYNRKFHVLSDQ  225



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 6255940127256