BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c24218_g2_i4 len=2939 path=[8571:0-61 8843:62-64 1200:65-1154
8264:1155-1155 @2290@!:1156-1581 2716:1582-1914 3049:1915-2122
3257:2123-2938]

Length=2939
                                                                      Score     E

ref|XP_002306988.2|  Glutamate receptor 3.3 precursor family protein    589   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_011041194.1|  PREDICTED: glutamate receptor 3.3-like             587   0.0      
gb|KHN33784.1|  Glutamate receptor 3.3                                  572   0.0      
gb|KCW70331.1|  hypothetical protein EUGRSUZ_F03574                     569   0.0      
ref|XP_011034843.1|  PREDICTED: glutamate receptor 3.3-like isofo...    556   0.0      
ref|XP_011034842.1|  PREDICTED: glutamate receptor 3.3-like isofo...    556   0.0      
ref|XP_011034844.1|  PREDICTED: glutamate receptor 3.3-like isofo...    556   0.0      
ref|XP_002301908.2|  Glutamate receptor 3.3 precursor family protein    553   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_008804484.1|  PREDICTED: glutamate receptor 3.1-like isofo...    533   0.0      
ref|XP_008804475.1|  PREDICTED: glutamate receptor 3.1-like isofo...    533   0.0      
ref|XP_002891241.1|  predicted protein                                  573   0.0      
ref|XP_010478979.1|  PREDICTED: glutamate receptor 3.3-like             572   0.0      
ref|XP_010500221.1|  PREDICTED: glutamate receptor 3.3                  572   0.0      
ref|XP_006306244.1|  hypothetical protein CARUB_v10012075mg             567   0.0      
ref|XP_009107640.1|  PREDICTED: glutamate receptor 3.3 isoform X1       562   0.0      
ref|XP_006396004.1|  hypothetical protein EUTSA_v10003614mg             564   0.0      
ref|XP_010463180.1|  PREDICTED: glutamate receptor 3.3-like             556   0.0      
gb|KHG10460.1|  Glutamate receptor 3.6 -like protein                    520   0.0      
emb|CDY35797.1|  BnaA08g04580D                                          563   0.0      
gb|KGN48998.1|  hypothetical protein Csa_6G509670                       528   0.0      
ref|XP_004134824.1|  PREDICTED: glutamate receptor 3.6-like             528   0.0      
ref|XP_004158839.1|  PREDICTED: glutamate receptor 3.6-like             527   0.0      
ref|XP_010316485.1|  PREDICTED: glutamate receptor 3.6 isoform X3       502   0.0      
ref|XP_010316484.1|  PREDICTED: glutamate receptor 3.6 isoform X2       502   0.0      
ref|XP_004232576.1|  PREDICTED: glutamate receptor 3.6 isoform X1       501   0.0      
ref|XP_007046473.1|  Glutamate receptor 3.6                             503   0.0      
ref|XP_006587552.1|  PREDICTED: glutamate receptor 3.6-like isofo...    522   0.0      
gb|KDP43780.1|  hypothetical protein JCGZ_22407                         482   0.0      
ref|XP_006858062.1|  hypothetical protein AMTR_s00062p00050250          486   0.0      
ref|XP_009107641.1|  PREDICTED: glutamate receptor 3.3 isoform X2       475   0.0      
ref|XP_011092253.1|  PREDICTED: glutamate receptor 3.2-like             497   0.0      
ref|XP_009403107.1|  PREDICTED: glutamate receptor 3.5-like             492   0.0      
ref|XP_003533408.1|  PREDICTED: glutamate receptor 3.3-like             493   0.0      
ref|XP_003533409.1|  PREDICTED: glutamate receptor 3.3-like isofo...    482   0.0      
ref|XP_008230073.1|  PREDICTED: glutamate receptor 3.4-like             472   0.0      
ref|XP_006447543.1|  hypothetical protein CICLE_v10014175mg             463   0.0      
ref|XP_008353536.1|  PREDICTED: glutamate receptor 3.4-like             473   0.0      
ref|XP_004976611.1|  PREDICTED: glutamate receptor 3.1-like             463   0.0      
ref|XP_011008405.1|  PREDICTED: glutamate receptor 3.4 isoform X1       461   0.0      
ref|XP_009353269.1|  PREDICTED: glutamate receptor 3.4-like             468   0.0      
ref|XP_007217063.1|  hypothetical protein PRUPE_ppa001079mg             473   0.0      
gb|KDO41668.1|  hypothetical protein CISIN_1g002267mg                   459   0.0      
ref|XP_002301627.1|  Glutamate receptor 3.5 precursor family protein    467   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_004487403.1|  PREDICTED: glutamate receptor 3.4-like isofo...    456   0.0      
ref|XP_007149970.1|  hypothetical protein PHAVU_005G114800g             454   0.0      
ref|NP_190716.3|  glutamate receptor 3.6                                469   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_009115834.1|  PREDICTED: glutamate receptor 3.6 isoform X1       467   0.0      
ref|XP_002876089.1|  ATGLR3.6                                           471   0.0      
ref|XP_004487406.1|  PREDICTED: glutamate receptor 3.4-like isofo...    452   0.0      
ref|XP_004289164.1|  PREDICTED: glutamate receptor 3.4-like             455   0.0      
ref|XP_010515556.1|  PREDICTED: glutamate receptor 3.6-like isofo...    466   0.0      
ref|XP_002321123.2|  hypothetical protein POPTR_0014s15030g             454   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_011005110.1|  PREDICTED: glutamate receptor 3.4 isoform X2       456   0.0      
ref|XP_010426704.1|  PREDICTED: glutamate receptor 3.6 isoform X1       466   0.0      
ref|XP_006292183.1|  hypothetical protein CARUB_v10018389mg             473   0.0      
ref|XP_009399220.1|  PREDICTED: glutamate receptor 3.5-like             457   0.0      
ref|XP_011005108.1|  PREDICTED: glutamate receptor 3.4 isoform X1       456   0.0      
ref|XP_003563011.1|  PREDICTED: glutamate receptor 3.4-like isofo...    474   0.0      
ref|XP_010503841.1|  PREDICTED: glutamate receptor 3.6-like isofo...    464   0.0      
ref|XP_002437454.1|  hypothetical protein SORBIDRAFT_10g027370          449   0.0      Sorghum bicolor [broomcorn]
ref|XP_008348134.1|  PREDICTED: glutamate receptor 3.4-like             453   0.0      
ref|XP_008670454.1|  PREDICTED: glutamate receptor 3.4-like             467   0.0      
ref|XP_004952127.1|  PREDICTED: glutamate receptor 3.1-like isofo...    457   0.0      
ref|XP_011034846.1|  PREDICTED: glutamate receptor 3.3-like isofo...    555   0.0      
ref|XP_010323822.1|  PREDICTED: glutamate receptor 3.4 isoform X2       462   0.0      
ref|XP_010090700.1|  Glutamate receptor 3.2                             475   0.0      
ref|XP_010548165.1|  PREDICTED: glutamate receptor 3.1-like isofo...    471   0.0      
gb|AFW69063.1|  hypothetical protein ZEAMMB73_044126                    448   0.0      
ref|XP_008644923.1|  PREDICTED: glutamate receptor 3.4-like isofo...    449   0.0      
ref|XP_006412122.1|  hypothetical protein EUTSA_v10024351mg             473   0.0      
ref|XP_006383781.1|  hypothetical protein POPTR_0005s27520g             573   0.0      
ref|XP_008379924.1|  PREDICTED: glutamate receptor 3.4-like             453   0.0      
ref|XP_006383780.1|  hypothetical protein POPTR_0005s27520g             574   0.0      
dbj|BAJ99508.1|  predicted protein                                      446   0.0      
ref|XP_004966219.1|  PREDICTED: glutamate receptor 3.4-like             447   0.0      
ref|XP_004151885.1|  PREDICTED: glutamate receptor 3.4-like             447   0.0      
ref|XP_004952125.1|  PREDICTED: glutamate receptor 3.1-like isofo...    443   0.0      
ref|XP_002869097.1|  hypothetical protein ARALYDRAFT_491120             456   0.0      
ref|XP_004158559.1|  PREDICTED: glutamate receptor 3.4-like             444   0.0      
ref|XP_009353273.1|  PREDICTED: glutamate receptor 3.4-like isofo...    440   0.0      
ref|XP_009353274.1|  PREDICTED: glutamate receptor 3.4-like isofo...    440   0.0      
ref|XP_008455858.1|  PREDICTED: glutamate receptor 3.4-like isofo...    442   0.0      
ref|XP_008455860.1|  PREDICTED: glutamate receptor 3.4-like isofo...    442   0.0      
ref|XP_004957886.1|  PREDICTED: glutamate receptor 3.4-like             463   0.0      
ref|XP_008379927.1|  PREDICTED: glutamate receptor 3.4-like             438   0.0      
emb|CDX69127.1|  BnaC01g03260D                                          465   0.0      
emb|CDY52597.1|  BnaCnng22760D                                          459   0.0      
ref|XP_004151932.1|  PREDICTED: glutamate receptor 3.4-like             452   0.0      
ref|XP_008379630.1|  PREDICTED: glutamate receptor 3.4                  444   0.0      
ref|XP_009103268.1|  PREDICTED: glutamate receptor 3.2                  465   0.0      
emb|CDY24327.1|  BnaA07g02520D                                          457   0.0      
ref|XP_004171803.1|  PREDICTED: LOW QUALITY PROTEIN: glutamate re...    449   0.0      
ref|XP_009118614.1|  PREDICTED: glutamate receptor 3.4-like             439   0.0      
ref|XP_006283116.1|  hypothetical protein CARUB_v10004138mg             466   0.0      
gb|AET03597.2|  glutamate receptor 3.2                                  459   0.0      
ref|XP_009121142.1|  PREDICTED: glutamate receptor 3.1 isoform X1       459   0.0      
gb|AAF21901.1|AF109392_1  ligand gated channel-like protein             460   0.0      Brassica napus [oilseed rape]
ref|XP_003527492.1|  PREDICTED: glutamate receptor 3.4-like isofo...    433   0.0      
ref|XP_002460792.1|  hypothetical protein SORBIDRAFT_02g034960          462   0.0      Sorghum bicolor [broomcorn]
ref|XP_008455862.1|  PREDICTED: glutamate receptor 3.4-like             442   0.0      
ref|XP_008644922.1|  PREDICTED: glutamate receptor 3.4-like isofo...    444   0.0      
ref|XP_010109511.1|  Glutamate receptor 3.4                             458   0.0      
ref|XP_003540841.1|  PREDICTED: glutamate receptor 3.4-like isofo...    438   0.0      
ref|XP_006582348.1|  PREDICTED: glutamate receptor 3.4-like isofo...    433   0.0      
gb|KHN41219.1|  Glutamate receptor 3.4                                  433   0.0      
ref|XP_007156250.1|  hypothetical protein PHAVU_003G270600g             439   0.0      
ref|XP_010237634.1|  PREDICTED: glutamate receptor 3.4-like isofo...    433   0.0      
gb|KHN21237.1|  Glutamate receptor 3.4                                  432   0.0      
ref|XP_010515365.1|  PREDICTED: glutamate receptor 3.1                  456   0.0      
ref|XP_006592378.1|  PREDICTED: glutamate receptor 3.4-like isofo...    437   0.0      
ref|XP_007132553.1|  hypothetical protein PHAVU_011G104300g             444   0.0      
ref|XP_004966221.1|  PREDICTED: glutamate receptor 3.5-like             435   0.0      
gb|AAQ02674.1|  glutamate receptor                                      453   0.0      Raphanus sativus var. sativus
ref|XP_006296930.1|  hypothetical protein CARUB_v10012924mg             453   0.0      
ref|XP_006447544.1|  hypothetical protein CICLE_v10014175mg             463   0.0      
gb|AGN92471.1|  glutamate receptor 1                                    428   0.0      
ref|XP_004966220.1|  PREDICTED: glutamate receptor 3.5-like             432   0.0      
ref|XP_010690549.1|  PREDICTED: glutamate receptor 3.2-like             436   0.0      
ref|XP_004987272.1|  PREDICTED: glutamate receptor 3.4-like             481   0.0      
ref|XP_010276019.1|  PREDICTED: glutamate receptor 3.7-like isofo...    447   0.0      
dbj|BAK02402.1|  predicted protein                                      459   0.0      
ref|XP_010276025.1|  PREDICTED: glutamate receptor 3.7-like isofo...    441   0.0      
ref|XP_010515558.1|  PREDICTED: glutamate receptor 3.6-like isofo...    435   0.0      
ref|XP_003561526.1|  PREDICTED: glutamate receptor 3.4-like             467   0.0      
ref|XP_003608176.1|  Glutamate receptor 3.3                             458   0.0      
gb|EMS63860.1|  Glutamate receptor 3.4                                  440   0.0      
ref|XP_010267706.1|  PREDICTED: glutamate receptor 3.7-like isofo...    439   0.0      
ref|XP_010267707.1|  PREDICTED: glutamate receptor 3.7-like isofo...    439   0.0      
ref|XP_008644925.1|  PREDICTED: glutamate receptor 3.5-like isofo...    416   0.0      
gb|EMT02012.1|  Glutamate receptor 3.4                                  436   0.0      
emb|CAB63012.1|  putative glutamate receptor                            437   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_008644926.1|  PREDICTED: glutamate receptor 3.5-like isofo...    411   0.0      
ref|XP_003629121.1|  Glutamate receptor                                 457   0.0      
ref|XP_009121143.1|  PREDICTED: glutamate receptor 3.1 isoform X2       409   0.0      
ref|XP_008447826.1|  PREDICTED: glutamate receptor 3.2                  448   0.0      
gb|EAZ02474.1|  hypothetical protein OsI_24580                          436   0.0      Oryza sativa Indica Group [Indian rice]
ref|NP_001058687.1|  Os07g0103100                                       435   0.0      Oryza sativa Japonica Group [Japonica rice]
dbj|BAC10393.1|  glutamate receptor, ionotropic kainate 5 precurs...    435   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_010680624.1|  PREDICTED: glutamate receptor 3.6-like             442   0.0      
ref|XP_010515559.1|  PREDICTED: glutamate receptor 3.6-like isofo...    435   0.0      
gb|EMT06987.1|  Glutamate receptor 3.3                                  427   0.0      
ref|XP_010426706.1|  PREDICTED: glutamate receptor 3.6 isoform X2       434   0.0      
ref|XP_008230072.1|  PREDICTED: glutamate receptor 3.7                  426   0.0      
ref|XP_010503844.1|  PREDICTED: glutamate receptor 3.6-like isofo...    433   0.0      
ref|XP_002273713.1|  PREDICTED: glutamate receptor 3.7                  422   0.0      Vitis vinifera
emb|CBI28942.3|  unnamed protein product                                421   0.0      
ref|XP_006409331.1|  hypothetical protein EUTSA_v10022533mg             403   0.0      
gb|KHN36533.1|  Glutamate receptor 3.7                                  430   0.0      
ref|XP_003541946.1|  PREDICTED: glutamate receptor 3.7-like isofo...    429   0.0      
ref|XP_010276026.1|  PREDICTED: glutamate receptor 3.7-like isofo...    398   0.0      
ref|XP_002301626.1|  Glutamate receptor 3.7 precursor family protein    424   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_003540305.1|  PREDICTED: glutamate receptor 3.7-like isofo...    428   0.0      
gb|KHN44876.1|  Glutamate receptor 3.7                                  428   0.0      
ref|XP_008455863.1|  PREDICTED: glutamate receptor 3.7-like             425   0.0      
ref|XP_007045627.1|  Glutamate receptor isoform 1                       418   0.0      
tpg|DAA59325.1|  TPA: hypothetical protein ZEAMMB73_375779              421   0.0      
ref|XP_011008403.1|  PREDICTED: glutamate receptor 3.7                  421   0.0      
ref|XP_006592814.1|  PREDICTED: glutamate receptor 3.7-like isofo...    428   0.0      
gb|KGN63257.1|  hypothetical protein Csa_2G418920                       422   0.0      
ref|XP_008341999.1|  PREDICTED: glutamate receptor 3.7-like             423   0.0      
ref|XP_007217061.1|  hypothetical protein PRUPE_ppa001093mg             410   0.0      
ref|XP_004151886.1|  PREDICTED: glutamate receptor 3.7-like             421   0.0      
ref|XP_007149971.1|  hypothetical protein PHAVU_005G114900g             431   0.0      
ref|XP_009353277.1|  PREDICTED: glutamate receptor 3.7 isoform X2       423   0.0      
ref|XP_008812267.1|  PREDICTED: glutamate receptor 3.7 isoform X1       423   0.0      
ref|XP_009353276.1|  PREDICTED: glutamate receptor 3.7 isoform X1       423   0.0      
ref|XP_010909025.1|  PREDICTED: glutamate receptor 3.7                  430   0.0      
ref|XP_004287941.1|  PREDICTED: glutamate receptor 3.7-like             409   0.0      
ref|XP_009786332.1|  PREDICTED: glutamate receptor 3.3 isoform X2       639   0.0      
gb|KDP25837.1|  hypothetical protein JCGZ_22867                         416   0.0      
ref|XP_009618635.1|  PREDICTED: glutamate receptor 3.3-like             645   0.0      
ref|XP_006592379.1|  PREDICTED: glutamate receptor 3.4-like isofo...    437   0.0      
ref|XP_009786331.1|  PREDICTED: glutamate receptor 3.3 isoform X1       642   0.0      
ref|XP_006447547.1|  hypothetical protein CICLE_v10014190mg             408   0.0      
ref|XP_009399221.1|  PREDICTED: glutamate receptor 3.7-like             410   0.0      
ref|XP_004487409.1|  PREDICTED: glutamate receptor 3.7-like             421   0.0      
gb|KHG04010.1|  Glutamate receptor 3.7 -like protein                    410   0.0      
ref|XP_002524180.1|  glutamate receptor 3 plant, putative               407   0.0      Ricinus communis
ref|XP_010035563.1|  PREDICTED: glutamate receptor 3.7                  422   0.0      
ref|XP_011100274.1|  PREDICTED: glutamate receptor 3.3                  632   0.0      
gb|EPS72603.1|  glutamate receptor                                      383   0.0      
emb|CDP11784.1|  unnamed protein product                                403   0.0      
dbj|BAL15056.1|  glutamate receptor 3.3                                 623   0.0      
ref|XP_003596995.1|  Glutamate receptor 3.7                             407   0.0      
ref|XP_004238633.2|  PREDICTED: glutamate receptor 3.3                  624   0.0      
ref|XP_006342151.1|  PREDICTED: glutamate receptor 3.3-like isofo...    622   0.0      
gb|AFW69068.1|  hypothetical protein ZEAMMB73_591659                    418   0.0      
gb|KDO41665.1|  hypothetical protein CISIN_1g003633mg                   405   0.0      
ref|XP_008455424.1|  PREDICTED: glutamate receptor 3.7 isoform X1       407   0.0      
ref|XP_002459200.1|  hypothetical protein SORBIDRAFT_02g000440          411   0.0      Sorghum bicolor [broomcorn]
ref|XP_008455425.1|  PREDICTED: glutamate receptor 3.7 isoform X2       407   0.0      
ref|XP_004144586.1|  PREDICTED: glutamate receptor 3.7-like             404   0.0      
ref|XP_004164856.1|  PREDICTED: LOW QUALITY PROTEIN: glutamate re...    404   0.0      
ref|XP_007045629.1|  Glutamate receptor isoform 3                       366   0.0      
ref|XP_008812269.1|  PREDICTED: glutamate receptor 3.7 isoform X2       423   0.0      
gb|EYU41186.1|  hypothetical protein MIMGU_mgv1a000937mg                607   0.0      
emb|CDP07274.1|  unnamed protein product                                600   0.0      
ref|XP_007210370.1|  hypothetical protein PRUPE_ppa001283mg             593   0.0      
ref|XP_008237957.1|  PREDICTED: glutamate receptor 3.3                  594   0.0      
ref|XP_002510703.1|  glutamate receptor 3 plant, putative               589   0.0      Ricinus communis
ref|XP_007045628.1|  Glutamate receptor isoform 2                       367   0.0      
ref|XP_010094542.1|  Glutamate receptor 3.3                             588   0.0      
ref|XP_004500849.1|  PREDICTED: glutamate receptor 3.3-like isofo...    582   0.0      
ref|XP_008373417.1|  PREDICTED: glutamate receptor 3.3                  585   0.0      
ref|XP_004500848.1|  PREDICTED: glutamate receptor 3.3-like isofo...    583   0.0      
emb|CAN72607.1|  hypothetical protein VITISV_021339                     581   0.0      Vitis vinifera
emb|CBI40741.3|  unnamed protein product                                582   0.0      
ref|XP_002272859.2|  PREDICTED: glutamate receptor 3.3                  582   0.0      Vitis vinifera
ref|XP_007018097.1|  Glutamate receptor 3.3 isoform 4                   577   0.0      
gb|KDP36767.1|  hypothetical protein JCGZ_08058                         580   0.0      
ref|XP_009372603.1|  PREDICTED: glutamate receptor 3.3-like             579   0.0      
ref|XP_007018099.1|  Glutamate receptor 3.3 isoform 6                   576   0.0      
ref|XP_003527293.1|  PREDICTED: glutamate receptor 3.3-like isofo...    577   0.0      
ref|XP_007018094.1|  Glutamate receptor 3.3 isoform 1                   577   0.0      
ref|XP_007018096.1|  Glutamate receptor 3.3 isoform 3                   576   0.0      
ref|XP_003603849.1|  Glutamate-gated kainate-type ion channel rec...    574   0.0      
ref|XP_007135963.1|  hypothetical protein PHAVU_009G006500g             574   0.0      
gb|KEH36346.1|  glutamate receptor 3.2                                  575   0.0      
ref|XP_006577929.1|  PREDICTED: glutamate receptor 3.3-like             574   0.0      
ref|NP_174978.1|  glutamate receptor 3.3                                574   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_009143982.1|  PREDICTED: glutamate receptor 3.7 isoform X1       357   0.0      
gb|AAR27949.1|  GLR3.3                                                  574   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_011008408.1|  PREDICTED: glutamate receptor 3.4 isoform X2       449   0.0      
emb|CDY48270.1|  BnaA05g10840D                                          355   0.0      
ref|XP_010530328.1|  PREDICTED: glutamate receptor 3.3                  573   0.0      
emb|CDY12210.1|  BnaC04g12400D                                          355   0.0      
ref|XP_010063139.1|  PREDICTED: LOW QUALITY PROTEIN: glutamate re...    571   0.0      
ref|XP_006410372.1|  hypothetical protein EUTSA_v10016204mg             360   0.0      
ref|XP_006293358.1|  hypothetical protein CARUB_v10022600mg             363   0.0      
gb|KHG26328.1|  Glutamate receptor 3.3 -like protein                    565   0.0      
gb|KDO85161.1|  hypothetical protein CISIN_1g002309mg                   565   0.0      
ref|XP_006473826.1|  PREDICTED: glutamate receptor 3.3-like isofo...    565   0.0      
ref|XP_006435401.1|  hypothetical protein CICLE_v10000195mg             564   0.0      
ref|XP_002881225.1|  hypothetical protein ARALYDRAFT_482168             362   0.0      
ref|XP_010522333.1|  PREDICTED: glutamate receptor 3.7                  358   0.0      
ref|NP_565744.1|  glutamate receptor 5                                  364   0.0      Arabidopsis thaliana [mouse-ear cress]
gb|AAF21042.1|AF210701_1  Glr5                                          362   1e-180   Arabidopsis thaliana [mouse-ear cress]
emb|CDY66699.1|  BnaCnng51950D                                          349   3e-180   
ref|XP_010923978.1|  PREDICTED: glutamate receptor 3.5-like             456   4e-180   
ref|XP_010414001.1|  PREDICTED: glutamate receptor 3.7 isoform X1       360   1e-179   
ref|XP_001762626.1|  predicted protein                                  376   2e-179   
ref|XP_010266234.1|  PREDICTED: glutamate receptor 3.3-like isofo...    557   3e-179   
ref|XP_010266235.1|  PREDICTED: glutamate receptor 3.3-like isofo...    556   4e-179   
ref|XP_010469592.1|  PREDICTED: glutamate receptor 3.7-like isofo...    365   4e-179   
ref|XP_010266233.1|  PREDICTED: glutamate receptor 3.3-like isofo...    557   6e-179   
ref|XP_010266230.1|  PREDICTED: glutamate receptor 3.3-like isofo...    557   7e-179   
gb|KDO85160.1|  hypothetical protein CISIN_1g002309mg                   556   9e-179   
ref|XP_006594897.1|  PREDICTED: glutamate receptor 3.7-like isofo...    362   3e-178   
emb|CDX84734.1|  BnaA03g14960D                                          345   8e-178   
ref|XP_009132849.1|  PREDICTED: glutamate receptor 3.7-like             345   1e-177   
ref|XP_011022205.1|  PREDICTED: glutamate receptor 3.6-like isofo...    546   6e-176   
ref|XP_008453000.1|  PREDICTED: glutamate receptor 3.3 isoform X2       545   8e-176   
ref|XP_011022202.1|  PREDICTED: glutamate receptor 3.6-like isofo...    546   5e-175   
ref|XP_011022201.1|  PREDICTED: glutamate receptor 3.6-like isofo...    547   6e-175   
ref|XP_008452999.1|  PREDICTED: glutamate receptor 3.3 isoform X1       545   7e-175   
ref|XP_011022199.1|  PREDICTED: glutamate receptor 3.6-like isofo...    547   8e-175   
gb|KHN20098.1|  Glutamate receptor 3.3                                  541   5e-174   
ref|XP_002306436.1|  glutamate receptor family protein                  544   6e-174   Populus trichocarpa [western balsam poplar]
ref|XP_004145549.1|  PREDICTED: glutamate receptor 3.3-like             542   2e-173   
ref|NP_001059814.1|  Os07g0522600                                       417   4e-173   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010270512.1|  PREDICTED: glutamate receptor 3.2-like isofo...    541   5e-173   
gb|KDO85164.1|  hypothetical protein CISIN_1g002309mg                   531   6e-173   
ref|XP_009418664.1|  PREDICTED: glutamate receptor 3.3-like             539   2e-172   
ref|XP_010266236.1|  PREDICTED: glutamate receptor 3.2-like             538   9e-172   
emb|CDY15337.1|  BnaC04g42860D                                          350   1e-171   
gb|KDO85163.1|  hypothetical protein CISIN_1g002309mg                   532   2e-171   
ref|XP_008440920.1|  PREDICTED: glutamate receptor 3.6 isoform X1       535   2e-170   
gb|KDP43782.1|  hypothetical protein JCGZ_22409                         534   4e-170   
ref|XP_010935350.1|  PREDICTED: glutamate receptor 3.1                  533   4e-170   
ref|XP_002276999.1|  PREDICTED: glutamate receptor 3.6                  532   2e-169   Vitis vinifera
emb|CBI21566.3|  unnamed protein product                                532   2e-169   
gb|KEH36348.1|  glutamate receptor 3.2                                  521   8e-169   
gb|KEH36347.1|  glutamate receptor 3.2                                  522   2e-168   
gb|KEH36349.1|  glutamate receptor 3.2                                  522   2e-167   
emb|CDP01776.1|  unnamed protein product                                526   2e-167   
gb|KHN38860.1|  Glutamate receptor 3.6                                  525   6e-167   
ref|XP_010270507.1|  PREDICTED: glutamate receptor 3.3-like isofo...    525   8e-167   
ref|XP_009401867.1|  PREDICTED: glutamate receptor 3.1-like             524   2e-166   
ref|XP_003533407.2|  PREDICTED: glutamate receptor 3.6-like isofo...    524   2e-166   
ref|XP_004509457.1|  PREDICTED: glutamate receptor 3.6-like isofo...    521   3e-166   
ref|XP_009392853.1|  PREDICTED: glutamate receptor 3.1-like isofo...    522   5e-166   
ref|XP_010110512.1|  Glutamate receptor 3.6                             523   8e-166   
ref|XP_009392852.1|  PREDICTED: glutamate receptor 3.1-like isofo...    523   9e-166   
gb|KHN12498.1|  Glutamate receptor 3.6                                  521   1e-165   
ref|XP_004509455.1|  PREDICTED: glutamate receptor 3.6-like isofo...    522   2e-165   
ref|XP_003547880.2|  PREDICTED: glutamate receptor 3.6-like             521   2e-165   
gb|KDO71524.1|  hypothetical protein CISIN_1g002301mg                   518   2e-165   
ref|XP_006467103.1|  PREDICTED: glutamate receptor 3.6-like isofo...    521   2e-165   
ref|XP_006425257.1|  hypothetical protein CICLE_v10024813mg             521   3e-165   
ref|XP_008786666.1|  PREDICTED: glutamate receptor 3.1                  519   8e-165   
gb|KDO71521.1|  hypothetical protein CISIN_1g002301mg                   520   1e-164   
ref|XP_010414003.1|  PREDICTED: glutamate receptor 3.7 isoform X2       308   5e-164   
ref|XP_010469594.1|  PREDICTED: glutamate receptor 3.7-like isofo...    315   6e-164   
ref|XP_007156253.1|  hypothetical protein PHAVU_003G270900g             517   7e-164   
emb|CDY68928.1|  BnaA08g29720D                                          472   1e-163   
ref|XP_010686867.1|  PREDICTED: glutamate receptor 3.3                  516   1e-163   
ref|XP_009796243.1|  PREDICTED: LOW QUALITY PROTEIN: glutamate re...    503   2e-163   
gb|KEH27628.1|  glutamate receptor 3.2                                  516   3e-163   
ref|XP_003629105.1|  Glutamate receptor 3.6                             509   4e-163   
ref|XP_009359612.1|  PREDICTED: glutamate receptor 3.6-like isofo...    516   4e-163   
ref|XP_009359614.1|  PREDICTED: glutamate receptor 3.6-like isofo...    515   4e-163   
emb|CDY70557.1|  BnaC08g46160D                                          472   5e-163   
ref|XP_009359613.1|  PREDICTED: glutamate receptor 3.6-like isofo...    515   7e-163   
ref|XP_003612376.1|  Glutamate receptor 3.6                             516   1e-162   
gb|KDO71522.1|  hypothetical protein CISIN_1g002301mg                   514   2e-162   
gb|ABO28526.1|  glutamate receptor                                      513   5e-162   
ref|XP_010266354.1|  PREDICTED: glutamate receptor 3.3-like             505   2e-161   
ref|XP_010029575.1|  PREDICTED: glutamate receptor 3.6                  511   2e-161   
ref|XP_010270514.1|  PREDICTED: glutamate receptor 3.2-like isofo...    504   4e-161   
ref|XP_002520606.1|  glutamate receptor 3 plant, putative               509   4e-161   
gb|AET03581.2|  glutamate receptor 3.2                                  510   4e-161   
ref|XP_008337897.1|  PREDICTED: glutamate receptor 3.6-like             510   7e-161   
ref|XP_008241921.1|  PREDICTED: glutamate receptor 3.6-like isofo...    509   1e-160   
ref|XP_008241916.1|  PREDICTED: glutamate receptor 3.6-like isofo...    509   1e-160   
ref|XP_008245275.1|  PREDICTED: LOW QUALITY PROTEIN: glutamate re...    503   1e-160   
ref|XP_009605827.1|  PREDICTED: glutamate receptor 3.6-like             508   2e-160   
ref|XP_009417233.1|  PREDICTED: glutamate receptor 3.4-like             508   2e-160   
ref|XP_004512282.1|  PREDICTED: glutamate receptor 3.6-like isofo...    508   2e-160   
ref|XP_010918356.1|  PREDICTED: glutamate receptor 3.1                  508   3e-160   
ref|XP_004512281.1|  PREDICTED: glutamate receptor 3.6-like isofo...    508   4e-160   
ref|XP_006422389.1|  hypothetical protein CICLE_v10027770mg             504   6e-160   
gb|KCW56490.1|  hypothetical protein EUGRSUZ_I02216                     507   1e-159   
ref|XP_007200076.1|  hypothetical protein PRUPE_ppa021130mg             504   2e-159   
ref|XP_007203996.1|  hypothetical protein PRUPE_ppa000995mg             505   3e-159   
ref|XP_006422390.1|  hypothetical protein CICLE_v10027770mg             504   5e-159   
ref|XP_008235912.1|  PREDICTED: glutamate receptor 3.2-like             504   6e-159   
ref|XP_006486565.1|  PREDICTED: glutamate receptor 3.2-like isofo...    504   6e-159   
gb|KDO68407.1|  hypothetical protein CISIN_1g002211mg                   505   6e-159   
ref|XP_008337223.1|  PREDICTED: glutamate receptor 3.3-like             494   7e-159   
ref|XP_007203235.1|  hypothetical protein PRUPE_ppa001033mg             504   1e-158   
ref|XP_007158022.1|  hypothetical protein PHAVU_002G117500g             501   2e-158   
ref|XP_011000874.1|  PREDICTED: glutamate receptor 3.2                  503   2e-158   
ref|XP_010923968.1|  PREDICTED: glutamate receptor 3.4-like             503   3e-158   
ref|XP_003517130.1|  PREDICTED: glutamate receptor 3.6-like isofo...    502   7e-158   
ref|XP_006340926.1|  PREDICTED: glutamate receptor 3.6-like             503   8e-158   
gb|KHN35947.1|  Glutamate receptor 3.6                                  501   1e-157   
ref|XP_007043075.1|  Glutamate receptor 2 isoform 1                     501   1e-157   
ref|XP_002279899.1|  PREDICTED: glutamate receptor 3.2                  500   1e-157   
gb|KCW55682.1|  hypothetical protein EUGRSUZ_I01532                     500   2e-157   
ref|XP_007203104.1|  hypothetical protein PRUPE_ppa023817mg             501   2e-157   
ref|XP_010028854.1|  PREDICTED: glutamate receptor 3.2-like isofo...    500   2e-157   
ref|XP_007158020.1|  hypothetical protein PHAVU_002G117500g             501   2e-157   
ref|XP_006590755.1|  PREDICTED: glutamate receptor 3.6-like isofo...    501   2e-157   
ref|XP_007203997.1|  hypothetical protein PRUPE_ppa001054mg             499   3e-157   
ref|XP_008803655.1|  PREDICTED: glutamate receptor 3.5-like             500   4e-157   
gb|KHG05232.1|  Glutamate receptor 3.2 -like protein                    499   4e-157   
ref|XP_007158021.1|  hypothetical protein PHAVU_002G117500g             500   4e-157   
ref|XP_010270511.1|  PREDICTED: glutamate receptor 3.3-like isofo...    494   5e-157   
ref|XP_002313575.2|  Glutamate receptor 3.1 precursor family protein    498   5e-157   
ref|XP_003608144.1|  Glutamate receptor 3.3                             483   6e-157   
gb|KDP47011.1|  hypothetical protein JCGZ_10738                         498   8e-157   
ref|XP_010270508.1|  PREDICTED: glutamate receptor 3.3-like isofo...    497   2e-156   
ref|XP_010270510.1|  PREDICTED: glutamate receptor 3.3-like isofo...    495   2e-156   
ref|XP_009369789.1|  PREDICTED: glutamate receptor 3.6-like             497   5e-156   
gb|KHN41809.1|  Glutamate receptor 3.6                                  498   6e-156   
ref|XP_007046474.1|  Glutamate receptor isoform 1                       496   1e-155   
ref|XP_009416682.1|  PREDICTED: glutamate receptor 3.4-like             496   1e-155   
ref|XP_002521736.1|  glutamate receptor 3 plant, putative               489   2e-155   
emb|CDP16877.1|  unnamed protein product                                494   3e-155   
gb|KDO71514.1|  hypothetical protein CISIN_1g002505mg                   493   6e-155   
ref|XP_006855692.1|  hypothetical protein AMTR_s00044p00137040          494   8e-155   
emb|CBI37733.3|  unnamed protein product                                499   1e-154   
ref|XP_010276016.1|  PREDICTED: glutamate receptor 3.4-like             493   2e-154   
gb|KHN46864.1|  Glutamate receptor 3.2                                  489   2e-154   
ref|XP_007043076.1|  Glutamate receptor 2 isoform 2                     493   2e-154   
emb|CAN64711.1|  hypothetical protein VITISV_043726                     493   3e-154   
ref|XP_004166015.1|  PREDICTED: LOW QUALITY PROTEIN: glutamate re...    359   4e-154   
ref|XP_006425261.1|  hypothetical protein CICLE_v10024825mg             491   6e-154   
ref|XP_007046476.1|  Glutamate receptor 3.4, putative isoform 3         486   6e-154   
gb|KHG21169.1|  Glutamate receptor 3.2 -like protein                    491   6e-154   
ref|XP_010266353.1|  PREDICTED: glutamate receptor 3.6-like             489   8e-154   
ref|XP_006595634.1|  PREDICTED: glutamate receptor 3.2-like isofo...    489   1e-153   
tpg|DAA59326.1|  TPA: hypothetical protein ZEAMMB73_375779              365   1e-153   
ref|XP_006467098.1|  PREDICTED: glutamate receptor 3.6-like isofo...    489   2e-153   
ref|XP_003545055.1|  PREDICTED: glutamate receptor 3.2-like isofo...    489   3e-153   
ref|XP_006467097.1|  PREDICTED: glutamate receptor 3.6-like isofo...    490   3e-153   
ref|XP_010267713.1|  PREDICTED: glutamate receptor 3.5-like isofo...    487   3e-153   
ref|NP_001169913.1|  uncharacterized protein LOC100383810               363   6e-153   
gb|KDO71523.1|  hypothetical protein CISIN_1g002301mg                   484   6e-153   
ref|XP_010267711.1|  PREDICTED: glutamate receptor 3.5-like isofo...    489   7e-153   
ref|XP_010267710.1|  PREDICTED: glutamate receptor 3.5-like isofo...    488   9e-153   
ref|XP_009143985.1|  PREDICTED: glutamate receptor 3.7 isoform X2       322   2e-152   
ref|XP_011087613.1|  PREDICTED: glutamate receptor 3.2-like isofo...    487   2e-152   
ref|XP_010267709.1|  PREDICTED: glutamate receptor 3.5-like isofo...    488   2e-152   
ref|XP_009333813.1|  PREDICTED: glutamate receptor 3.2-like             487   3e-152   
ref|XP_008667840.1|  PREDICTED: hypothetical protein isoform X3         483   6e-152   
ref|XP_004290072.1|  PREDICTED: glutamate receptor 3.2-like             486   8e-152   
ref|XP_009341487.1|  PREDICTED: glutamate receptor 3.2-like             486   1e-151   
gb|EYU33298.1|  hypothetical protein MIMGU_mgv1a001051mg                484   1e-151   
ref|XP_008667839.1|  PREDICTED: hypothetical protein isoform X2         484   2e-151   
ref|XP_010907850.1|  PREDICTED: glutamate receptor 3.4-like             485   2e-151   
ref|XP_008667836.1|  PREDICTED: hypothetical protein isoform X1         484   2e-151   
ref|XP_008377883.1|  PREDICTED: glutamate receptor 3.2-like             484   2e-151   
ref|XP_008440927.1|  PREDICTED: glutamate receptor 3.6 isoform X2       483   4e-151   
ref|XP_004287716.1|  PREDICTED: glutamate receptor 3.3-like             484   4e-151   
ref|XP_010680623.1|  PREDICTED: glutamate receptor 3.6-like             484   5e-151   
gb|EYU35042.1|  hypothetical protein MIMGU_mgv1a001148mg                481   1e-150   
ref|XP_010550505.1|  PREDICTED: glutamate receptor 3.6 isoform X1       481   2e-150   
ref|XP_002985245.1|  hypothetical protein SELMODRAFT_121973             327   1e-149   
ref|XP_006652702.1|  PREDICTED: glutamate receptor 3.1-like isofo...    479   4e-149   
ref|XP_002970053.1|  hypothetical protein SELMODRAFT_92810              327   4e-149   
sp|Q7XP59.1|GLR31_ORYSJ  RecName: Full=Glutamate receptor 3.1; Al...    478   7e-149   
ref|XP_002306435.2|  hypothetical protein POPTR_0005s10560g             477   1e-148   
ref|XP_002524179.1|  glutamate receptor 3 plant, putative               477   2e-148   
ref|XP_008812266.1|  PREDICTED: glutamate receptor 3.4 isoform X2       471   2e-148   
ref|XP_008358485.1|  PREDICTED: LOW QUALITY PROTEIN: glutamate re...    462   2e-148   
ref|XP_010657306.1|  PREDICTED: glutamate receptor 3.4 isoform X3       472   3e-148   
ref|XP_010657305.1|  PREDICTED: glutamate receptor 3.4 isoform X2       472   3e-148   
emb|CAH66856.1|  H0307D04.1                                             476   4e-148   
ref|XP_007203444.1|  hypothetical protein PRUPE_ppa022019mg             474   5e-148   
ref|XP_006646788.1|  PREDICTED: glutamate receptor 3.1-like             476   6e-148   
ref|XP_008651910.1|  PREDICTED: glutamate receptor 3.4-like             476   8e-148   
ref|XP_010103244.1|  Glutamate receptor 3.6                             476   3e-147   
ref|XP_008812265.1|  PREDICTED: glutamate receptor 3.4 isoform X1       473   7e-147   
ref|XP_010240316.1|  PREDICTED: glutamate receptor 3.1-like             473   7e-147   
ref|XP_002273744.3|  PREDICTED: glutamate receptor 3.4 isoform X1       472   8e-147   
ref|XP_010233709.1|  PREDICTED: glutamate receptor 3.1 isoform X2       469   1e-146   
ref|XP_008382743.1|  PREDICTED: glutamate receptor 3.2-like             471   1e-146   
ref|XP_010548171.1|  PREDICTED: glutamate receptor 3.1-like isofo...    470   1e-146   
ref|XP_009589005.1|  PREDICTED: glutamate receptor 3.4 isoform X2       468   2e-146   
ref|NP_001045687.1|  Os02g0117500                                       472   2e-146   
emb|CDX73718.1|  BnaC08g22850D                                          470   2e-146   
ref|XP_010530965.1|  PREDICTED: glutamate receptor 3.2-like             471   2e-146   
ref|XP_006403911.1|  hypothetical protein EUTSA_v10010111mg             470   2e-146   
ref|XP_008337899.1|  PREDICTED: glutamate receptor 3.6-like             471   3e-146   
dbj|BAK04480.1|  predicted protein                                      471   3e-146   
emb|CAN66741.1|  hypothetical protein VITISV_021644                     471   3e-146   
ref|XP_010432300.1|  PREDICTED: glutamate receptor 3.2                  470   3e-146   
gb|KHG01323.1|  Glutamate receptor 3.4 -like protein                    471   4e-146   
ref|XP_003573352.1|  PREDICTED: glutamate receptor 3.1 isoform X1       470   4e-146   
ref|XP_008241922.1|  PREDICTED: glutamate receptor 3.6-like             470   7e-146   
ref|XP_006364369.1|  PREDICTED: glutamate receptor 3.2-like             469   7e-146   
gb|EEE67292.1|  hypothetical protein OsJ_24491                          469   9e-146   
ref|XP_008241924.1|  PREDICTED: LOW QUALITY PROTEIN: glutamate re...    469   1e-145   
ref|XP_009359749.1|  PREDICTED: glutamate receptor 3.6-like             469   1e-145   
ref|XP_008242065.1|  PREDICTED: glutamate receptor 3.6-like             467   2e-145   
ref|XP_009589003.1|  PREDICTED: glutamate receptor 3.4 isoform X1       469   2e-145   
ref|XP_002459199.1|  hypothetical protein SORBIDRAFT_02g000430          470   2e-145   
gb|EMS61084.1|  Glutamate receptor 3.4                                  469   3e-145   
ref|XP_010437494.1|  PREDICTED: glutamate receptor 3.2-like             468   4e-145   
ref|XP_007043077.1|  Glutamate receptor 2 isoform 3                     459   4e-145   
ref|XP_009359611.1|  PREDICTED: glutamate receptor 3.6-like             468   4e-145   
ref|XP_010446945.1|  PREDICTED: glutamate receptor 3.2-like             467   4e-145   
gb|KEH39010.1|  glutamate receptor 3.2                                  460   5e-145   
ref|XP_010550509.1|  PREDICTED: glutamate receptor 3.6 isoform X2       466   5e-145   
gb|KEH39012.1|  glutamate receptor 3.2                                  459   7e-145   
ref|XP_009115836.1|  PREDICTED: glutamate receptor 3.6 isoform X2       466   1e-144   
gb|KDP25838.1|  hypothetical protein JCGZ_22868                         466   1e-144   
ref|XP_008337900.1|  PREDICTED: glutamate receptor 3.6-like             466   1e-144   
ref|XP_009763348.1|  PREDICTED: glutamate receptor 3.2-like             466   1e-144   
ref|XP_009765170.1|  PREDICTED: glutamate receptor 3.4                  466   2e-144   
gb|KDP43779.1|  hypothetical protein JCGZ_22406                         464   3e-144   
gb|KEH39015.1|  glutamate receptor 3.2                                  453   3e-144   
gb|KEH39014.1|  glutamate receptor 3.2                                  454   3e-144   
gb|KDO71518.1|  hypothetical protein CISIN_1g002505mg                   454   4e-144   
ref|XP_011022198.1|  PREDICTED: glutamate receptor 3.6-like             465   7e-144   
ref|XP_009608800.1|  PREDICTED: glutamate receptor 3.2-like             464   8e-144   
emb|CBI28943.3|  unnamed protein product                                473   1e-143   
ref|XP_007202847.1|  hypothetical protein PRUPE_ppa014700mg             459   2e-143   
ref|XP_007045620.1|  Glutamate receptor isoform 1                       464   3e-143   
gb|AFW69814.1|  hypothetical protein ZEAMMB73_405216                    462   3e-143   
ref|XP_004289032.1|  PREDICTED: glutamate receptor 3.6-like             456   3e-143   
ref|XP_008379928.1|  PREDICTED: LOW QUALITY PROTEIN: glutamate re...    336   4e-143   
ref|XP_008645171.1|  PREDICTED: LOW QUALITY PROTEIN: glutamate re...    462   4e-143   
ref|XP_007046477.1|  Glutamate receptor isoform 4                       457   6e-143   
ref|XP_004243468.1|  PREDICTED: glutamate receptor 3.4 isoform X1       462   7e-143   
gb|KDO71515.1|  hypothetical protein CISIN_1g002505mg                   452   8e-143   
gb|AAK13248.1|AF159498_1  putative glutamate receptor like-protein      461   9e-143   
ref|XP_006657772.1|  PREDICTED: glutamate receptor 3.4-like             462   9e-143   
gb|KEH39011.1|  glutamate receptor 3.2                                  460   1e-142   
ref|NP_567981.1|  glutamate receptor 3.2                                461   1e-142   
emb|CDP11785.1|  unnamed protein product                                460   2e-142   
ref|XP_010035564.1|  PREDICTED: glutamate receptor 3.4                  461   2e-142   
gb|EPS59173.1|  glutamate receptor                                      454   2e-142   
ref|XP_003596996.1|  Glutamate receptor 3.4                             461   2e-142   
ref|XP_010109788.1|  Glutamate receptor 3.7                             350   4e-142   
ref|XP_006367285.1|  PREDICTED: glutamate receptor 3.4-like isofo...    460   4e-142   
ref|XP_009794415.1|  PREDICTED: glutamate receptor 3.4-like isofo...    457   5e-142   
gb|KEH20344.1|  glutamate receptor 3.2                                  447   5e-142   
ref|XP_010689636.1|  PREDICTED: glutamate receptor 3.4-like             460   6e-142   
gb|AAL24126.1|  unknown protein                                         459   8e-142   
gb|KHG17978.1|  Glutamate receptor 3.4 -like protein                    459   8e-142   
ref|XP_002451392.1|  hypothetical protein SORBIDRAFT_04g001300          457   8e-142   
dbj|BAJ34460.1|  unnamed protein product                                445   9e-142   
ref|XP_009625697.1|  PREDICTED: glutamate receptor 3.4-like isofo...    456   2e-141   
ref|XP_006425259.1|  hypothetical protein CICLE_v10024825mg             448   2e-141   
gb|EMT00479.1|  Glutamate receptor 3.1                                  468   2e-141   
ref|XP_007045625.1|  Glutamate receptor isoform 6                       450   3e-141   
ref|XP_009794414.1|  PREDICTED: glutamate receptor 3.4-like isofo...    458   3e-141   
ref|XP_006467099.1|  PREDICTED: glutamate receptor 3.6-like isofo...    448   3e-141   
ref|XP_006425260.1|  hypothetical protein CICLE_v10024825mg             448   3e-141   
ref|XP_011079012.1|  PREDICTED: glutamate receptor 3.4                  457   3e-141   
gb|KEH39013.1|  glutamate receptor 3.2                                  454   4e-141   
ref|XP_010467485.1|  PREDICTED: glutamate receptor 3.1-like isofo...    457   5e-141   
ref|XP_011100303.1|  PREDICTED: glutamate receptor 3.5-like             454   5e-141   
ref|XP_010467484.1|  PREDICTED: glutamate receptor 3.1-like isofo...    457   7e-141   
ref|XP_010426721.1|  PREDICTED: glutamate receptor 3.6-like isofo...    450   8e-141   
ref|XP_010515566.1|  PREDICTED: glutamate receptor 3.6-like isofo...    449   8e-141   
ref|XP_009625694.1|  PREDICTED: glutamate receptor 3.4-like isofo...    457   9e-141   
dbj|BAK06938.1|  predicted protein                                      456   1e-140   



>ref|XP_002306988.2| Glutamate receptor 3.3 precursor family protein [Populus trichocarpa]
 gb|EEE93984.2| Glutamate receptor 3.3 precursor family protein [Populus trichocarpa]
Length=932

 Score =   589 bits (1518),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 349/469 (74%), Positives = 405/469 (86%), Gaps = 0/469 (0%)
 Frame = +3

Query  1164  PRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYAVPFQFV  1343
             PRGW F NNGKQLRIGVPIRVS++EF+SQV GT+TFKGF +DVFTAAVNLLPY V +QFV
Sbjct  457   PRGWAFANNGKQLRIGVPIRVSFREFVSQVQGTDTFKGFCIDVFTAAVNLLPYPVQYQFV  516

Query  1344  PFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPFKKL  1523
             PFG+G+ENPSY+ELV  ++TG+FD A+GDIAIVT RTKV+DFTQPYVASGL+VVAPF+KL
Sbjct  517   PFGDGKENPSYTELVNKITTGFFDAAVGDIAIVTKRTKVIDFTQPYVASGLVVVAPFRKL  576

Query  1524  NTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSLSTL  1703
             N+GAWAFL PFSA+MW VTA FF+VVG+VVWILEHR+NDEFRG PK+Q+IT+LWFSLSTL
Sbjct  577   NSGAWAFLRPFSARMWIVTACFFLVVGLVVWILEHRINDEFRGPPKRQVITVLWFSLSTL  636

Query  1704  FFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESLKEGNDP  1883
             FFAHRENT+STL R VL+IWLFVVLIINSSYTASLTSI TVQQL SPIKG+ESLKE N+P
Sbjct  637   FFAHRENTMSTLARFVLLIWLFVVLIINSSYTASLTSIFTVQQLSSPIKGIESLKESNEP  696

Query  1884  IGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERPYVENFL  2063
             +GYQ+GSFAE+YL EE+GI KSRL+ALGSPEAYA AL+ GP KGGV+AIVDE PYVE FL
Sbjct  697   VGYQVGSFAEYYLREEVGIPKSRLVALGSPEAYANALQLGPEKGGVAAIVDELPYVELFL  756

Query  2064  STQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLtrtscss  2243
             S QC FRIVGQEFTKSGWGFAFPRDSPLA+DMSTAIL+LSENGDLQRIHDKWLT+++CSS
Sbjct  757   SRQCTFRIVGQEFTKSGWGFAFPRDSPLALDMSTAILALSENGDLQRIHDKWLTQSTCSS  816

Query  2244  estelesDRLHLKSFWglfllcgaacflalfIYFVQIMLKFRRVARAEPVADGssstrsr  2423
             E++ELESDRLHLKSFWGLFL+CG ACF++L I+F QI  +  R A  E  + G  S RS 
Sbjct  817   ETSELESDRLHLKSFWGLFLICGLACFISLLIHFCQITRQLYRTAPVESPSAGQGSLRSG  876

Query  2424  rlqtllslIDEksdpskrdkkrrkidrslsdENSGSNLARDPGGGSSER  2570
             RL  L SL+DEK+   K   KRRK++RSLS+ +    L R+P    +ER
Sbjct  877   RLHRLFSLMDEKASQEKSAVKRRKLERSLSENDRDCELGRNPTRKETER  925


 Score =   576 bits (1485),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 265/376 (70%), Positives = 322/376 (86%), Gaps = 1/376 (0%)
 Frame = +2

Query  56    LVAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTT  235
             L  ALKF + DV+AI+GPQSSVVAH ISHVANELQVPLLSFAATDPTL SLQFP+F+RTT
Sbjct  87    LAEALKFTENDVIAIIGPQSSVVAHIISHVANELQVPLLSFAATDPTLNSLQFPFFVRTT  146

Query  236   QSDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGA  415
             QSD YQM AI++V+DHYGWK+V A+FID+DYGRNG++AL D LA +RC+ISYK GIPP +
Sbjct  147   QSDFYQMAAISEVVDHYGWKQVTAIFIDNDYGRNGVSALGDRLAERRCRISYKVGIPPDS  206

Query  416   -TTRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVL  592
                R +IMDILV++ALMESRV+++H YP  GF +FS+A++L MMG+G+VWI+TDWLS+VL
Sbjct  207   GVNRGDIMDILVKVALMESRVVIVHVYPDMGFKIFSMANHLEMMGNGWVWIATDWLSSVL  266

Query  593   DSSSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLTGGSLGLNSYALYAYDSVWL  772
             DS+SPLPSE M+ +QGVLVLRQHTPDS+  RAF+SRW  LTGG LGL+SY LYAYDSVWL
Sbjct  267   DSASPLPSETMDSVQGVLVLRQHTPDSDRNRAFSSRWHKLTGGYLGLHSYGLYAYDSVWL  326

Query  773   IAHAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLTGQ  952
             IAHA+D+F N+GG+ISFSNDS+L S EGS+LHLEA+SIFD G LLLNN+LQSD VGLTG+
Sbjct  327   IAHALDAFFNQGGIISFSNDSRLPSGEGSSLHLEAISIFDDGKLLLNNILQSDLVGLTGR  386

Query  953   FKFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKLYG  1132
              KF  D+SL+LP+YD++NVIGTG+R IG+W NYSGLS  PPETLY++PPN SSANQKLY 
Sbjct  387   IKFGIDRSLILPAYDVVNVIGTGYRRIGYWSNYSGLSITPPETLYTKPPNRSSANQKLYN  446

Query  1133  VVWPGQSVKKAPGVGF  1180
              +WPG ++    G  F
Sbjct  447   AIWPGDTLLTPRGWAF  462



>ref|XP_011041194.1| PREDICTED: glutamate receptor 3.3-like [Populus euphratica]
 ref|XP_011041195.1| PREDICTED: glutamate receptor 3.3-like [Populus euphratica]
 ref|XP_011041196.1| PREDICTED: glutamate receptor 3.3-like [Populus euphratica]
 ref|XP_011041197.1| PREDICTED: glutamate receptor 3.3-like [Populus euphratica]
 ref|XP_011041198.1| PREDICTED: glutamate receptor 3.3-like [Populus euphratica]
 ref|XP_011041199.1| PREDICTED: glutamate receptor 3.3-like [Populus euphratica]
 ref|XP_011041200.1| PREDICTED: glutamate receptor 3.3-like [Populus euphratica]
Length=933

 Score =   587 bits (1514),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 325/410 (79%), Positives = 375/410 (91%), Gaps = 3/410 (1%)
 Frame = +3

Query  1164  PRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYAVPFQFV  1343
             PRGW F NNGKQLRIGVPIRVS++EF+SQVPGT+TFKGF +DVFTAAV+LLPY V +QF+
Sbjct  457   PRGWAFANNGKQLRIGVPIRVSFQEFVSQVPGTDTFKGFCIDVFTAAVSLLPYPVQYQFI  516

Query  1344  PFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPFKKL  1523
             PFG+G+ENPSY+ELV  ++TG+FD A+GDIAIVT RTKV+DFTQPYVASGL+VVAPF+KL
Sbjct  517   PFGDGKENPSYTELVNKITTGFFDAAVGDIAIVTKRTKVLDFTQPYVASGLVVVAPFRKL  576

Query  1524  NTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSLSTL  1703
             N+GAWAFL PFSA+MW VTA FF+VVG+VVWILEHR+NDEFRG PK+Q+IT+LWFSLSTL
Sbjct  577   NSGAWAFLRPFSARMWIVTACFFLVVGLVVWILEHRINDEFRGPPKRQVITVLWFSLSTL  636

Query  1704  FFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESLKEGNDP  1883
             FFAHRENT+STL R VL+IWLFVVLIINSSYTASLTSI TVQQL SPIKG+ESLKE N+P
Sbjct  637   FFAHRENTMSTLARFVLLIWLFVVLIINSSYTASLTSIFTVQQLSSPIKGIESLKESNEP  696

Query  1884  IGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERPYVENFL  2063
             +GYQ+GSFAE+YL EE+GISKSRL+ALGSPEAYA AL+ GP KGGV+AIVDE PYV+ FL
Sbjct  697   VGYQVGSFAEYYLREEVGISKSRLVALGSPEAYANALQLGPEKGGVAAIVDELPYVQLFL  756

Query  2064  STQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLtrtscss  2243
             S QC FRIVGQEFTKSGWGFAFPRDSPLA+DMSTAIL+LSENGDLQRIHDKWLT++SCSS
Sbjct  757   SRQCTFRIVGQEFTKSGWGFAFPRDSPLALDMSTAILALSENGDLQRIHDKWLTQSSCSS  816

Query  2244  estelesDRLHLKSFWglfllcgaacflalfIYFVQIMLKFRRVARAEPV  2393
             E++ELESDRLHLKSFWGLFL+CG ACF++L I+F QI    R++ RA PV
Sbjct  817   ETSELESDRLHLKSFWGLFLICGLACFISLLIHFCQIT---RQLYRATPV  863


 Score =   572 bits (1475),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 263/376 (70%), Positives = 321/376 (85%), Gaps = 1/376 (0%)
 Frame = +2

Query  56    LVAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTT  235
             L  ALKF + DV+AI+GPQSSVVAH ISHVANELQVPLLSFAATDPTL SLQFP+F+RTT
Sbjct  87    LAEALKFTENDVIAIIGPQSSVVAHIISHVANELQVPLLSFAATDPTLNSLQFPFFVRTT  146

Query  236   QSDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGA  415
              SD YQM AI++V+DHYGWK+V A+FID+DYGRNG++AL D LA +RC+ISYK GIPP +
Sbjct  147   HSDFYQMAAISEVVDHYGWKQVTAIFIDNDYGRNGVSALGDRLAERRCRISYKVGIPPDS  206

Query  416   -TTRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVL  592
                R +I DILV++ALMESRV+++H YP  GF +FS+A++L MMG+G+VWI+TDWLS+VL
Sbjct  207   GVNRGDITDILVKVALMESRVVIVHVYPDMGFKIFSMANHLEMMGNGWVWIATDWLSSVL  266

Query  593   DSSSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLTGGSLGLNSYALYAYDSVWL  772
             DS+SPLPSE ++ +QGVLVLRQHTPDS+ KRAF+SRW  LTGGSLGL+SY LYAYDSVWL
Sbjct  267   DSASPLPSETIDSVQGVLVLRQHTPDSDRKRAFSSRWHKLTGGSLGLHSYGLYAYDSVWL  326

Query  773   IAHAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLTGQ  952
             IAHA+D+F N+GG+ISFSNDS+L S EGS+LHLEA+SIFD G LLLNN+LQSD  GLTG+
Sbjct  327   IAHALDAFFNQGGIISFSNDSRLPSGEGSSLHLEAISIFDDGKLLLNNILQSDLDGLTGR  386

Query  953   FKFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKLYG  1132
              KF  D+SL+LP+YD++NVIGTG+R IG+W NYSGLST PPETLY++PPN SS NQKLY 
Sbjct  387   IKFGIDRSLILPAYDVINVIGTGYRRIGYWSNYSGLSTTPPETLYTKPPNRSSTNQKLYA  446

Query  1133  VVWPGQSVKKAPGVGF  1180
              +WPG ++    G  F
Sbjct  447   AIWPGDTLLTPRGWAF  462



>gb|KHN33784.1| Glutamate receptor 3.3 [Glycine soja]
Length=882

 Score =   572 bits (1473),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 304/402 (76%), Positives = 364/402 (91%), Gaps = 0/402 (0%)
 Frame = +3

Query  1161  KPRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYAVPFQF  1340
             KPRGWVFPNNG+QLRIGVPIRVSY+EF++ V GT  FKGF VDVFTAAVNLLPYAVP++F
Sbjct  415   KPRGWVFPNNGRQLRIGVPIRVSYREFVAPVQGTEMFKGFCVDVFTAAVNLLPYAVPYRF  474

Query  1341  VPFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPFKK  1520
             VPFG+G +NPSY++LV L++TGYFDGAIGDIAIVTNRT++VDFTQPY ASGL+VVAPFKK
Sbjct  475   VPFGDGHKNPSYTQLVNLITTGYFDGAIGDIAIVTNRTRIVDFTQPYAASGLVVVAPFKK  534

Query  1521  LNTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSLST  1700
             +N+G W+FL PF+  MW VT   F+ +GIVVWILEHR+NDEFRG P+QQ+IT+LWFSLST
Sbjct  535   INSGGWSFLQPFTPLMWIVTGCLFLFIGIVVWILEHRINDEFRGPPRQQIITMLWFSLST  594

Query  1701  LFFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESLKEGND  1880
             LFF+HRENT+S+LGR+V++IWLFVVLI+ SSYTASLTSILTVQQLYSPI G+ESLK  ++
Sbjct  595   LFFSHRENTMSSLGRLVMLIWLFVVLILTSSYTASLTSILTVQQLYSPISGIESLKASDE  654

Query  1881  PIGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERPYVENF  2060
             PIG+ +GSFAEHYLI+++GI+KSRLI LGSPE YA+AL+ GP +GGV+AIVDERPYVE F
Sbjct  655   PIGFPVGSFAEHYLIQDLGIAKSRLIPLGSPEEYAKALQLGPKRGGVAAIVDERPYVEIF  714

Query  2061  LSTQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLtrtscs  2240
             LS+QC FRIVGQEFT+SGWGFAFPRDSPLAVD+STAIL LSE GDLQRIHDKW+TR+SCS
Sbjct  715   LSSQCTFRIVGQEFTRSGWGFAFPRDSPLAVDISTAILQLSETGDLQRIHDKWMTRSSCS  774

Query  2241  sestelesDRLHLKSFWglfllcgaacflalfIYFVQIMLKF  2366
              E+ E++SDRL LKSFWGLFL+CG ACF+AL ++F+Q+M + 
Sbjct  775   LENAEIDSDRLQLKSFWGLFLICGIACFIALVLHFMQLMFQL  816


 Score =   519 bits (1337),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 248/377 (66%), Positives = 313/377 (83%), Gaps = 2/377 (1%)
 Frame = +2

Query  56    LVAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTT  235
             +V AL+FM+TDV+AI+GPQSSV AH ISHVANEL+VPL+SFAATDPTL+SLQFP+F+RTT
Sbjct  47    MVQALRFMETDVIAIIGPQSSVTAHIISHVANELRVPLVSFAATDPTLSSLQFPFFVRTT  106

Query  236   QSDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGA  415
             QSD+YQM A+A++ID+YGWKEVIA+++DDDYGRNG+AALDD LA++RC+IS+K GI  G 
Sbjct  107   QSDLYQMKAVAEIIDYYGWKEVIAIYVDDDYGRNGVAALDDELASRRCRISFKEGIKSGT  166

Query  416   TT-RAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVL  592
                R EI  +LV++ALM+SRV+VLHA   +GFM+F++A YLGM  +GYVWI TDWLS+ L
Sbjct  167   KVDRGEITSLLVKVALMQSRVIVLHAQTDSGFMIFNLARYLGMTDNGYVWIVTDWLSSFL  226

Query  593   DSSSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLTGGSLGLNSYALYAYDSVWL  772
             DSSS   SE M+++QGVLVLRQHTPDS+ KRAF SRWK LTGGSLGL+SY LYAYDSVWL
Sbjct  227   DSSSLP-SETMDVLQGVLVLRQHTPDSDRKRAFLSRWKKLTGGSLGLHSYGLYAYDSVWL  285

Query  773   IAHAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLTGQ  952
             +A AID+F ++GG++S +N + L   +G  L+L+A+SIFD G LLL N+LQSDFVGL+GQ
Sbjct  286   VARAIDAFFSQGGIVSCTNYTSLGGDKGGDLNLDAMSIFDNGTLLLKNILQSDFVGLSGQ  345

Query  953   FKFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKLYG  1132
              KF  D+SLV P+YD+LNV+G G R +G+W NYSGLS   PE  Y++PPN SSANQKLY 
Sbjct  346   MKFEPDRSLVHPAYDVLNVVGNGLRRVGYWSNYSGLSIVSPEIFYAKPPNRSSANQKLYS  405

Query  1133  VVWPGQSVKKAPGVGFP  1183
             V+WPG+++ K  G  FP
Sbjct  406   VIWPGETLSKPRGWVFP  422



>gb|KCW70331.1| hypothetical protein EUGRSUZ_F03574 [Eucalyptus grandis]
Length=808

 Score =   569 bits (1467),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 318/415 (77%), Positives = 367/415 (88%), Gaps = 2/415 (0%)
 Frame = +3

Query  1161  KPRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGT-NTFKGFSVDVFTAAVNLLPYAVPFQ  1337
             KPRGWVFPNNGKQLRIGVP R S+++F+S+V GT N FKGF +DVF AAVNLLPYAVP+Q
Sbjct  330   KPRGWVFPNNGKQLRIGVPDRASFRQFVSKVRGTDNMFKGFCIDVFAAAVNLLPYAVPYQ  389

Query  1338  FVPFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPFK  1517
             FVPFGNG ENPSY++LV  ++TG FD A+GDIAI TNRTK+VDFTQPYVASGL+VVAPF+
Sbjct  390   FVPFGNGHENPSYTDLVNSITTGLFDAAVGDIAITTNRTKIVDFTQPYVASGLVVVAPFR  449

Query  1518  KLNTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSLS  1697
             K+NTGAWAFL PF+ QMW VT  FF+ +GIV+WILEHR NDEFRGSP+QQ++TILWFS S
Sbjct  450   KMNTGAWAFLRPFTPQMWIVTGAFFLAIGIVIWILEHRTNDEFRGSPRQQVMTILWFSFS  509

Query  1698  TLFFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESLKEGN  1877
             TLFFAHRENT STLGR+VLIIWLFVVLIINSSYTASLTSILTVQQL SPIKG++SL +G+
Sbjct  510   TLFFAHRENTASTLGRVVLIIWLFVVLIINSSYTASLTSILTVQQLSSPIKGIDSLIKGD  569

Query  1878  DPIGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERPYVEN  2057
             +PIG+Q+GSFAEHYL +E+ IS+SRL  LGSP+AYA+AL  GP KGGV+A+VDE PYVE 
Sbjct  570   EPIGFQVGSFAEHYLTQELKISRSRLKPLGSPDAYAKALRDGPGKGGVAALVDELPYVEM  629

Query  2058  FLSTQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLtrtsc  2237
             FLSTQC FRIVG EFTKSGWGFAFPRDSPLAVD+STAIL+LSENGDLQRIHDKWL +TSC
Sbjct  630   FLSTQCSFRIVGPEFTKSGWGFAFPRDSPLAVDLSTAILALSENGDLQRIHDKWLMQTSC  689

Query  2238  ssestelesDRLHLKSFWglfllcgaacflalfIYFVQIMLKFRRVARAEPVADG  2402
              S+S E+ESDRLHLKSFWGLFL+CG ACF+ALFIYF+QI+ +      AE V +G
Sbjct  690   LSDSAEIESDRLHLKSFWGLFLICGIACFVALFIYFLQILHQLCTTP-AESVPEG  743


 Score =   495 bits (1275),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 225/339 (66%), Positives = 281/339 (83%), Gaps = 2/339 (1%)
 Frame = +2

Query  167   LLSFAATDPTLASLQFPYFLRTTQSDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIA  346
             +LSFAATDPTL+ L+FPYFLRTTQSD+ QM A+A+++D YGWKEV A+++DDDYGRN ++
Sbjct  1     MLSFAATDPTLSYLEFPYFLRTTQSDLNQMSAVAELVDFYGWKEVTAIYLDDDYGRNAVS  60

Query  347   ALDDALAAKRCKISYKAGIPPGATTRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVA  526
             AL+D LA +RCKISYK GI PG   R EIMDILV++ALMESRV+VLH  P +GF VF++A
Sbjct  61    ALNDKLAERRCKISYKVGIQPGPAKRGEIMDILVKVALMESRVIVLHVTPESGFEVFAIA  120

Query  527   HYLGMMGDGYVWISTDWLSTVLDSSSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWK  706
              YL MMG+GYVWI+TDWLS+VLDS+SPLPSE M+ +QGVLVLRQHT +S+ KRAF SRW 
Sbjct  121   RYLAMMGNGYVWIATDWLSSVLDSASPLPSETMDSLQGVLVLRQHTAESDKKRAFASRWN  180

Query  707   HLTGGSLGLNSYALYAYDSVWLIAHAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSI  886
              LT GS GLNSY LYAYDSVWL+AHA+++F  +GGV+SFSNDS+++SIE   LHLE +S 
Sbjct  181   RLTRGSPGLNSYGLYAYDSVWLVAHALEAFFEQGGVLSFSNDSRIKSIESGGLHLEEMSF  240

Query  887   FDGGPLLLNNLLQSDFVGLTGQFKFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLST  1066
             FD GPLLL N+LQ++FVGLTG F+FN+D+ L+ P+YDI+NV+GTG R IG+W NY+GLST
Sbjct  241   FDTGPLLLKNILQTNFVGLTGPFQFNSDRCLIHPAYDIINVVGTGVRRIGYWSNYTGLST  300

Query  1067  APPETLYSRPPNSSSANQKLYGVVWPGQSVKKAPGVGFP  1183
              PPE LY R PN SS  Q+LY V+WPG+++ K  G  FP
Sbjct  301   LPPEELYERAPNRSS--QQLYSVIWPGETLSKPRGWVFP  337



>ref|XP_011034843.1| PREDICTED: glutamate receptor 3.3-like isoform X2 [Populus euphratica]
Length=951

 Score =   556 bits (1434),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 254/376 (68%), Positives = 321/376 (85%), Gaps = 1/376 (0%)
 Frame = +2

Query  56    LVAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTT  235
             +V AL+FM+TD+VAI+GPQSSVVA  ISHVAN+LQVPLLSFAATDP+L SLQFP+F++TT
Sbjct  107   MVEALRFMETDIVAIIGPQSSVVARIISHVANQLQVPLLSFAATDPSLNSLQFPFFVQTT  166

Query  236   QSDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGA  415
             QSD++QM AI+DV+D+YGWK+V A++IDDDYGRNG++AL D LA +RC+ISYK G+PP +
Sbjct  167   QSDLHQMAAISDVVDYYGWKQVTAIYIDDDYGRNGMSALGDKLAERRCRISYKVGVPPDS  226

Query  416   TTRA-EIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVL  592
                  +I+D+L+++A MESRV+VLH  P  GF VFSVA+ L MMG+G+VWI+T+WLS+VL
Sbjct  227   GVNGTDILDMLIKVASMESRVIVLHVNPDVGFEVFSVANRLQMMGNGWVWIATNWLSSVL  286

Query  593   DSSSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLTGGSLGLNSYALYAYDSVWL  772
             DS+SPLPSE M+ +QGVL LRQHTPDS+ KRAF SRW+ LTGGSLGLNSY LYAYDSVWL
Sbjct  287   DSASPLPSETMDSIQGVLFLRQHTPDSDRKRAFYSRWRKLTGGSLGLNSYGLYAYDSVWL  346

Query  773   IAHAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLTGQ  952
             IAHAID+F N+GG+ISFSNDS+L+S++ S LHLEA+SIFD G LLLNN+LQSD VGLTG+
Sbjct  347   IAHAIDAFFNQGGIISFSNDSRLRSVKDSGLHLEAMSIFDDGKLLLNNILQSDLVGLTGR  406

Query  953   FKFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKLYG  1132
              KF+ ++SL+LP+YD+ NV GTGF+ IG+W NYSGL+  PPE LY++PPN SSANQ+LY 
Sbjct  407   IKFDTERSLILPAYDVNNVFGTGFKRIGYWSNYSGLTVVPPEMLYTKPPNRSSANQELYK  466

Query  1133  VVWPGQSVKKAPGVGF  1180
             V+WPG ++    G  F
Sbjct  467   VIWPGDTLFTPRGWAF  482


 Score =   545 bits (1405),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 300/413 (73%), Positives = 363/413 (88%), Gaps = 1/413 (0%)
 Frame = +3

Query  1164  PRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYAVPFQFV  1343
             PRGW F NNGKQLRIGVP+RVS++EF+SQ  GT+TFKGF +DVFT+A+ LLPY V +QF+
Sbjct  477   PRGWAFANNGKQLRIGVPLRVSFREFVSQARGTDTFKGFCIDVFTSAITLLPYPVQYQFI  536

Query  1344  PFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPFKKL  1523
             PFG+G+ NPSY+ELV  ++TG FD  +GD+AIVTNRTK++DFTQPYVASGL+VVAPF+K 
Sbjct  537   PFGDGKNNPSYTELVYKITTGLFDAVVGDVAIVTNRTKILDFTQPYVASGLVVVAPFRKS  596

Query  1524  NTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSLSTL  1703
             N+GAWAFL PFSA++W VT  FF VVG+VVWILEHR+NDEFRG PK+Q+IT++WFSLSTL
Sbjct  597   NSGAWAFLGPFSARLWIVTGCFFFVVGLVVWILEHRINDEFRGPPKRQIITVIWFSLSTL  656

Query  1704  FFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESLKEGNDP  1883
             F  HRENT+STL R VL+IWLFVVLIINS+YTASLTSILTV QL S IKG+ESLKE ++P
Sbjct  657   FSTHRENTMSTLARFVLLIWLFVVLIINSNYTASLTSILTVHQLSSHIKGIESLKESDEP  716

Query  1884  IGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERPYVENFL  2063
             +GYQ+GSFAE+YL EE+GISKSRL+ALGSPE YA+AL+ GP KGGV+AIVDERPYVE FL
Sbjct  717   VGYQVGSFAEYYLSEEVGISKSRLVALGSPEEYAKALKLGPGKGGVAAIVDERPYVELFL  776

Query  2064  STQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLtrtscss  2243
             + QC FRIVG+EFTKSGWGFAFP DSPLAVDMSTAIL+LSENGDLQRIHDKWL +++CSS
Sbjct  777   AGQCTFRIVGREFTKSGWGFAFPSDSPLAVDMSTAILALSENGDLQRIHDKWLMQSTCSS  836

Query  2244  estelesDRLHLKSFWglfllcgaacflalfIYFVQIMLKFRRVARAEPVADG  2402
             +++ELE+D+L+L+SFWGLFLLCG ACF++L I+ +QI+  F   A AE  + G
Sbjct  837   DTSELEADKLYLRSFWGLFLLCGLACFISLVIHVLQIIRLF-YAAPAESASPG  888



>ref|XP_011034842.1| PREDICTED: glutamate receptor 3.3-like isoform X1 [Populus euphratica]
Length=969

 Score =   556 bits (1433),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 254/376 (68%), Positives = 321/376 (85%), Gaps = 1/376 (0%)
 Frame = +2

Query  56    LVAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTT  235
             +V AL+FM+TD+VAI+GPQSSVVA  ISHVAN+LQVPLLSFAATDP+L SLQFP+F++TT
Sbjct  125   MVEALRFMETDIVAIIGPQSSVVARIISHVANQLQVPLLSFAATDPSLNSLQFPFFVQTT  184

Query  236   QSDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGA  415
             QSD++QM AI+DV+D+YGWK+V A++IDDDYGRNG++AL D LA +RC+ISYK G+PP +
Sbjct  185   QSDLHQMAAISDVVDYYGWKQVTAIYIDDDYGRNGMSALGDKLAERRCRISYKVGVPPDS  244

Query  416   TTRA-EIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVL  592
                  +I+D+L+++A MESRV+VLH  P  GF VFSVA+ L MMG+G+VWI+T+WLS+VL
Sbjct  245   GVNGTDILDMLIKVASMESRVIVLHVNPDVGFEVFSVANRLQMMGNGWVWIATNWLSSVL  304

Query  593   DSSSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLTGGSLGLNSYALYAYDSVWL  772
             DS+SPLPSE M+ +QGVL LRQHTPDS+ KRAF SRW+ LTGGSLGLNSY LYAYDSVWL
Sbjct  305   DSASPLPSETMDSIQGVLFLRQHTPDSDRKRAFYSRWRKLTGGSLGLNSYGLYAYDSVWL  364

Query  773   IAHAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLTGQ  952
             IAHAID+F N+GG+ISFSNDS+L+S++ S LHLEA+SIFD G LLLNN+LQSD VGLTG+
Sbjct  365   IAHAIDAFFNQGGIISFSNDSRLRSVKDSGLHLEAMSIFDDGKLLLNNILQSDLVGLTGR  424

Query  953   FKFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKLYG  1132
              KF+ ++SL+LP+YD+ NV GTGF+ IG+W NYSGL+  PPE LY++PPN SSANQ+LY 
Sbjct  425   IKFDTERSLILPAYDVNNVFGTGFKRIGYWSNYSGLTVVPPEMLYTKPPNRSSANQELYK  484

Query  1133  VVWPGQSVKKAPGVGF  1180
             V+WPG ++    G  F
Sbjct  485   VIWPGDTLFTPRGWAF  500


 Score =   544 bits (1402),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 300/413 (73%), Positives = 363/413 (88%), Gaps = 1/413 (0%)
 Frame = +3

Query  1164  PRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYAVPFQFV  1343
             PRGW F NNGKQLRIGVP+RVS++EF+SQ  GT+TFKGF +DVFT+A+ LLPY V +QF+
Sbjct  495   PRGWAFANNGKQLRIGVPLRVSFREFVSQARGTDTFKGFCIDVFTSAITLLPYPVQYQFI  554

Query  1344  PFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPFKKL  1523
             PFG+G+ NPSY+ELV  ++TG FD  +GD+AIVTNRTK++DFTQPYVASGL+VVAPF+K 
Sbjct  555   PFGDGKNNPSYTELVYKITTGLFDAVVGDVAIVTNRTKILDFTQPYVASGLVVVAPFRKS  614

Query  1524  NTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSLSTL  1703
             N+GAWAFL PFSA++W VT  FF VVG+VVWILEHR+NDEFRG PK+Q+IT++WFSLSTL
Sbjct  615   NSGAWAFLGPFSARLWIVTGCFFFVVGLVVWILEHRINDEFRGPPKRQIITVIWFSLSTL  674

Query  1704  FFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESLKEGNDP  1883
             F  HRENT+STL R VL+IWLFVVLIINS+YTASLTSILTV QL S IKG+ESLKE ++P
Sbjct  675   FSTHRENTMSTLARFVLLIWLFVVLIINSNYTASLTSILTVHQLSSHIKGIESLKESDEP  734

Query  1884  IGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERPYVENFL  2063
             +GYQ+GSFAE+YL EE+GISKSRL+ALGSPE YA+AL+ GP KGGV+AIVDERPYVE FL
Sbjct  735   VGYQVGSFAEYYLSEEVGISKSRLVALGSPEEYAKALKLGPGKGGVAAIVDERPYVELFL  794

Query  2064  STQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLtrtscss  2243
             + QC FRIVG+EFTKSGWGFAFP DSPLAVDMSTAIL+LSENGDLQRIHDKWL +++CSS
Sbjct  795   AGQCTFRIVGREFTKSGWGFAFPSDSPLAVDMSTAILALSENGDLQRIHDKWLMQSTCSS  854

Query  2244  estelesDRLHLKSFWglfllcgaacflalfIYFVQIMLKFRRVARAEPVADG  2402
             +++ELE+D+L+L+SFWGLFLLCG ACF++L I+ +QI+  F   A AE  + G
Sbjct  855   DTSELEADKLYLRSFWGLFLLCGLACFISLVIHVLQIIRLF-YAAPAESASPG  906



>ref|XP_011034844.1| PREDICTED: glutamate receptor 3.3-like isoform X3 [Populus euphratica]
 ref|XP_011034845.1| PREDICTED: glutamate receptor 3.3-like isoform X3 [Populus euphratica]
Length=931

 Score =   556 bits (1432),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 254/376 (68%), Positives = 321/376 (85%), Gaps = 1/376 (0%)
 Frame = +2

Query  56    LVAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTT  235
             +V AL+FM+TD+VAI+GPQSSVVA  ISHVAN+LQVPLLSFAATDP+L SLQFP+F++TT
Sbjct  87    MVEALRFMETDIVAIIGPQSSVVARIISHVANQLQVPLLSFAATDPSLNSLQFPFFVQTT  146

Query  236   QSDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGA  415
             QSD++QM AI+DV+D+YGWK+V A++IDDDYGRNG++AL D LA +RC+ISYK G+PP +
Sbjct  147   QSDLHQMAAISDVVDYYGWKQVTAIYIDDDYGRNGMSALGDKLAERRCRISYKVGVPPDS  206

Query  416   TTRA-EIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVL  592
                  +I+D+L+++A MESRV+VLH  P  GF VFSVA+ L MMG+G+VWI+T+WLS+VL
Sbjct  207   GVNGTDILDMLIKVASMESRVIVLHVNPDVGFEVFSVANRLQMMGNGWVWIATNWLSSVL  266

Query  593   DSSSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLTGGSLGLNSYALYAYDSVWL  772
             DS+SPLPSE M+ +QGVL LRQHTPDS+ KRAF SRW+ LTGGSLGLNSY LYAYDSVWL
Sbjct  267   DSASPLPSETMDSIQGVLFLRQHTPDSDRKRAFYSRWRKLTGGSLGLNSYGLYAYDSVWL  326

Query  773   IAHAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLTGQ  952
             IAHAID+F N+GG+ISFSNDS+L+S++ S LHLEA+SIFD G LLLNN+LQSD VGLTG+
Sbjct  327   IAHAIDAFFNQGGIISFSNDSRLRSVKDSGLHLEAMSIFDDGKLLLNNILQSDLVGLTGR  386

Query  953   FKFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKLYG  1132
              KF+ ++SL+LP+YD+ NV GTGF+ IG+W NYSGL+  PPE LY++PPN SSANQ+LY 
Sbjct  387   IKFDTERSLILPAYDVNNVFGTGFKRIGYWSNYSGLTVVPPEMLYTKPPNRSSANQELYK  446

Query  1133  VVWPGQSVKKAPGVGF  1180
             V+WPG ++    G  F
Sbjct  447   VIWPGDTLFTPRGWAF  462


 Score =   545 bits (1403),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 300/413 (73%), Positives = 363/413 (88%), Gaps = 1/413 (0%)
 Frame = +3

Query  1164  PRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYAVPFQFV  1343
             PRGW F NNGKQLRIGVP+RVS++EF+SQ  GT+TFKGF +DVFT+A+ LLPY V +QF+
Sbjct  457   PRGWAFANNGKQLRIGVPLRVSFREFVSQARGTDTFKGFCIDVFTSAITLLPYPVQYQFI  516

Query  1344  PFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPFKKL  1523
             PFG+G+ NPSY+ELV  ++TG FD  +GD+AIVTNRTK++DFTQPYVASGL+VVAPF+K 
Sbjct  517   PFGDGKNNPSYTELVYKITTGLFDAVVGDVAIVTNRTKILDFTQPYVASGLVVVAPFRKS  576

Query  1524  NTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSLSTL  1703
             N+GAWAFL PFSA++W VT  FF VVG+VVWILEHR+NDEFRG PK+Q+IT++WFSLSTL
Sbjct  577   NSGAWAFLGPFSARLWIVTGCFFFVVGLVVWILEHRINDEFRGPPKRQIITVIWFSLSTL  636

Query  1704  FFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESLKEGNDP  1883
             F  HRENT+STL R VL+IWLFVVLIINS+YTASLTSILTV QL S IKG+ESLKE ++P
Sbjct  637   FSTHRENTMSTLARFVLLIWLFVVLIINSNYTASLTSILTVHQLSSHIKGIESLKESDEP  696

Query  1884  IGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERPYVENFL  2063
             +GYQ+GSFAE+YL EE+GISKSRL+ALGSPE YA+AL+ GP KGGV+AIVDERPYVE FL
Sbjct  697   VGYQVGSFAEYYLSEEVGISKSRLVALGSPEEYAKALKLGPGKGGVAAIVDERPYVELFL  756

Query  2064  STQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLtrtscss  2243
             + QC FRIVG+EFTKSGWGFAFP DSPLAVDMSTAIL+LSENGDLQRIHDKWL +++CSS
Sbjct  757   AGQCTFRIVGREFTKSGWGFAFPSDSPLAVDMSTAILALSENGDLQRIHDKWLMQSTCSS  816

Query  2244  estelesDRLHLKSFWglfllcgaacflalfIYFVQIMLKFRRVARAEPVADG  2402
             +++ELE+D+L+L+SFWGLFLLCG ACF++L I+ +QI+  F   A AE  + G
Sbjct  817   DTSELEADKLYLRSFWGLFLLCGLACFISLVIHVLQIIRLF-YAAPAESASPG  868



>ref|XP_002301908.2| Glutamate receptor 3.3 precursor family protein [Populus trichocarpa]
 gb|EEE81181.2| Glutamate receptor 3.3 precursor family protein [Populus trichocarpa]
Length=931

 Score =   553 bits (1424),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 304/413 (74%), Positives = 366/413 (89%), Gaps = 1/413 (0%)
 Frame = +3

Query  1164  PRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYAVPFQFV  1343
             PRGW F NNGKQLRIGVP+RVS++EF+SQ  GT+TFKGF +DVFT+A+ LLPY V +QF+
Sbjct  457   PRGWAFANNGKQLRIGVPLRVSFREFVSQARGTDTFKGFCIDVFTSAITLLPYPVQYQFI  516

Query  1344  PFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPFKKL  1523
             PFG+G+ NPSY+ELV  ++TG+FD  +GD+AIVTNRTK++DFTQPYVASGL+VVAPF+K 
Sbjct  517   PFGDGKNNPSYTELVYKITTGFFDAVVGDVAIVTNRTKILDFTQPYVASGLVVVAPFRKS  576

Query  1524  NTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSLSTL  1703
             N+GAWAFL PFSA++W VT  FF VVG+VVWILEHR+NDEFRG PK+Q+IT++WFSLSTL
Sbjct  577   NSGAWAFLGPFSARLWIVTGCFFFVVGLVVWILEHRINDEFRGPPKRQIITVIWFSLSTL  636

Query  1704  FFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESLKEGNDP  1883
             F  HRENT+STL R VL+IWLFVVLIINS+YTASLTSILTVQQL S IKG+ESLKE ++P
Sbjct  637   FSTHRENTMSTLARFVLLIWLFVVLIINSNYTASLTSILTVQQLSSHIKGIESLKESDEP  696

Query  1884  IGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERPYVENFL  2063
             +GYQ+GSFAE+YL EEIGISKSRL+ALGSPE YA+AL+ GP KGGV+AIVDERPYVE FL
Sbjct  697   VGYQVGSFAEYYLSEEIGISKSRLVALGSPEEYAKALQLGPGKGGVAAIVDERPYVELFL  756

Query  2064  STQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLtrtscss  2243
             + QC FRIVG+EFTKSGWGFAFPRDSPLAVDMSTAIL+LSENGDLQRIHDKWL +++CSS
Sbjct  757   AGQCTFRIVGREFTKSGWGFAFPRDSPLAVDMSTAILALSENGDLQRIHDKWLMQSTCSS  816

Query  2244  estelesDRLHLKSFWglfllcgaacflalfIYFVQIMLKFRRVARAEPVADG  2402
             +++ELE+D+L+L+SFWGLFLLCG ACF++L IY +QI+  F   A AE  + G
Sbjct  817   DTSELEADKLYLRSFWGLFLLCGLACFISLVIYVLQIIRLF-YAAPAESASPG  868


 Score =   548 bits (1412),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 249/376 (66%), Positives = 317/376 (84%), Gaps = 1/376 (0%)
 Frame = +2

Query  56    LVAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTT  235
             +V AL+FM+TD+VAI+GPQSSVVA  ISHV N+LQVPLLSFAATDP+L SLQFP+F++TT
Sbjct  87    MVEALRFMETDIVAIIGPQSSVVARIISHVTNQLQVPLLSFAATDPSLNSLQFPFFVQTT  146

Query  236   QSDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGA  415
              SD++QM AI+DV+D+YGWK+V A++IDDDYGRNG++AL D LA +RC+ISYK G+PP +
Sbjct  147   HSDLHQMAAISDVVDYYGWKQVTAIYIDDDYGRNGMSALGDKLAERRCRISYKVGVPPDS  206

Query  416   -TTRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVL  592
                R +I+D+L+++A MESRV+VLH  P  GF VFSVA+ L MMG+G+VWI+T+WLS+VL
Sbjct  207   GVNRTDILDMLIKVASMESRVIVLHVNPDVGFEVFSVANRLQMMGNGWVWIATNWLSSVL  266

Query  593   DSSSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLTGGSLGLNSYALYAYDSVWL  772
             DS+SPLPSE M+ +QGVL  RQHTPDS+ KRAF SRW+ LTGGSLGLNSY LYAYDSVWL
Sbjct  267   DSASPLPSETMDSIQGVLFFRQHTPDSDRKRAFYSRWRKLTGGSLGLNSYGLYAYDSVWL  326

Query  773   IAHAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLTGQ  952
             IAHAID+F N+GG+ISF+N S+L+S++ S LHLEA+ IFD G LLLNN+LQS+ VGLTG+
Sbjct  327   IAHAIDAFFNQGGIISFTNYSRLRSVKDSGLHLEAMGIFDDGKLLLNNILQSNLVGLTGR  386

Query  953   FKFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKLYG  1132
              KF+ D+SL+LP+YD+ NV GTGF+ IG+W NYSGL+  PPE LY++PPN SSANQ+LY 
Sbjct  387   IKFDTDRSLILPAYDVNNVFGTGFKRIGYWSNYSGLTVVPPEILYTKPPNRSSANQELYK  446

Query  1133  VVWPGQSVKKAPGVGF  1180
             V+WPG ++    G  F
Sbjct  447   VIWPGDTLFTPRGWAF  462



>ref|XP_008804484.1| PREDICTED: glutamate receptor 3.1-like isoform X2 [Phoenix dactylifera]
Length=916

 Score =   533 bits (1374),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 293/417 (70%), Positives = 354/417 (85%), Gaps = 3/417 (1%)
 Frame = +3

Query  1161  KPRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYAVPFQF  1340
             KPRGWVFPN+GK+LRIGVP RVSYK+F+S+ P T T KG+ +DVFTAAV+LLPYAVP++ 
Sbjct  456   KPRGWVFPNSGKELRIGVPNRVSYKQFVSKDPVTGTVKGYCIDVFTAAVSLLPYAVPYKL  515

Query  1341  VPFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPFKK  1520
             +PFGNGRENPSY+ L  +V++  FD A+GDI IVTNRTK+VD+TQPY+ SGL+V+AP K+
Sbjct  516   IPFGNGRENPSYAGLANMVASNVFDAAVGDITIVTNRTKIVDYTQPYIESGLVVLAPVKR  575

Query  1521  LNTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSLST  1700
              ++ AWAFL PF+ +MW VT  FF+VVG VVWILEHR+NDEFRG P++QL T+ WFS ST
Sbjct  576   HHSNAWAFLQPFTVEMWCVTGLFFLVVGAVVWILEHRINDEFRGPPRKQLATVFWFSFST  635

Query  1701  LFFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESLKEGND  1880
             LFFAHRENTVSTLGR VLIIWLFVVLII SSYTASLTSILTVQQL SPI+G++SL+  N+
Sbjct  636   LFFAHRENTVSTLGRAVLIIWLFVVLIIQSSYTASLTSILTVQQLSSPIRGIDSLRTTNE  695

Query  1881  PIGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERPYVENF  2060
             PIG+Q+GSFAE+Y++EE+ IS+SRL ALGSPE YA ALE GP  GGV+A+VDERPY+E F
Sbjct  696   PIGFQVGSFAENYMVEELNISRSRLKALGSPEEYARALELGPDNGGVAAVVDERPYIEMF  755

Query  2061  LSTQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLtrtscs  2240
             L   CKF I+G EFTKSGWGF FPRDSPLAVD+STAILSLSENGDLQRIHDKWLT  +CS
Sbjct  756   LEANCKFSIIGSEFTKSGWGFIFPRDSPLAVDLSTAILSLSENGDLQRIHDKWLTTGTCS  815

Query  2241  sestelesDRLHLKSFWglfllcgaacflalfIYFVQIMLKFRRVA---RAEPVADG  2402
             + + EL+SDRLHL SFWGLFL+CG ACFLALFI+F+ ++ ++ + A    AEP + G
Sbjct  816   TATDELDSDRLHLNSFWGLFLICGVACFLALFIFFMLMLRQYLQHASEGEAEPSSQG  872


 Score =   519 bits (1337),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 235/380 (62%), Positives = 305/380 (80%), Gaps = 5/380 (1%)
 Frame = +2

Query  56    LVAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTT  235
             +V AL+FM+ D++AI+GPQ S +AH + HV NELQVP+LSFAATDP+L+SLQFP+F+RTT
Sbjct  85    IVEALQFMEVDIIAIVGPQCSTIAHILCHVGNELQVPMLSFAATDPSLSSLQFPFFVRTT  144

Query  236   QSDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGA  415
             QSD +QM AIA+++++Y WK+VIAVF DDDYGRNGIAAL D LA +RC+ISYKA +PP A
Sbjct  145   QSDAFQMAAIAEMLEYYQWKQVIAVFFDDDYGRNGIAALGDELAERRCRISYKAALPPEA  204

Query  416   TTRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVLD  595
             T R++I ++LV++ALMES V+VLHA P  G  V  VAH+L MMG+GYVWI+TDWL++ LD
Sbjct  205   T-RSDITELLVKVALMESHVIVLHANPTTGLEVLYVAHFLEMMGNGYVWIATDWLASRLD  263

Query  596   SSSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLT----GGSLGLNSYALYAYDS  763
             S +PL  E M  MQGVL LRQHTPDS+ K A  S+W+ LT     G+  LNSY LYAYD+
Sbjct  264   SFAPLAPETMSTMQGVLTLRQHTPDSKRKSALVSKWRMLTKKENSGNFQLNSYGLYAYDT  323

Query  764   VWLIAHAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGL  943
             VW+IA AID+F N GG ISFSNDS+L  ++G  LHLEA+S+FDGG LLL+ + +++F G+
Sbjct  324   VWMIARAIDAFFNDGGRISFSNDSRLHDVKGGALHLEAMSVFDGGKLLLDEIRKTNFTGI  383

Query  944   TGQFKFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQK  1123
             TGQ +F++D +L+ P+YDI+NV+GTG RT+G+W NYSGLS  PPETLYS+PPN S+ANQ+
Sbjct  384   TGQVQFDSDGNLIHPAYDIINVVGTGMRTVGYWSNYSGLSVVPPETLYSKPPNHSAANQQ  443

Query  1124  LYGVVWPGQSVKKAPGVGFP  1183
             LY V+WPG++  K  G  FP
Sbjct  444   LYSVIWPGETTTKPRGWVFP  463



>ref|XP_008804475.1| PREDICTED: glutamate receptor 3.1-like isoform X1 [Phoenix dactylifera]
Length=932

 Score =   533 bits (1373),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 293/417 (70%), Positives = 354/417 (85%), Gaps = 3/417 (1%)
 Frame = +3

Query  1161  KPRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYAVPFQF  1340
             KPRGWVFPN+GK+LRIGVP RVSYK+F+S+ P T T KG+ +DVFTAAV+LLPYAVP++ 
Sbjct  472   KPRGWVFPNSGKELRIGVPNRVSYKQFVSKDPVTGTVKGYCIDVFTAAVSLLPYAVPYKL  531

Query  1341  VPFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPFKK  1520
             +PFGNGRENPSY+ L  +V++  FD A+GDI IVTNRTK+VD+TQPY+ SGL+V+AP K+
Sbjct  532   IPFGNGRENPSYAGLANMVASNVFDAAVGDITIVTNRTKIVDYTQPYIESGLVVLAPVKR  591

Query  1521  LNTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSLST  1700
              ++ AWAFL PF+ +MW VT  FF+VVG VVWILEHR+NDEFRG P++QL T+ WFS ST
Sbjct  592   HHSNAWAFLQPFTVEMWCVTGLFFLVVGAVVWILEHRINDEFRGPPRKQLATVFWFSFST  651

Query  1701  LFFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESLKEGND  1880
             LFFAHRENTVSTLGR VLIIWLFVVLII SSYTASLTSILTVQQL SPI+G++SL+  N+
Sbjct  652   LFFAHRENTVSTLGRAVLIIWLFVVLIIQSSYTASLTSILTVQQLSSPIRGIDSLRTTNE  711

Query  1881  PIGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERPYVENF  2060
             PIG+Q+GSFAE+Y++EE+ IS+SRL ALGSPE YA ALE GP  GGV+A+VDERPY+E F
Sbjct  712   PIGFQVGSFAENYMVEELNISRSRLKALGSPEEYARALELGPDNGGVAAVVDERPYIEMF  771

Query  2061  LSTQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLtrtscs  2240
             L   CKF I+G EFTKSGWGF FPRDSPLAVD+STAILSLSENGDLQRIHDKWLT  +CS
Sbjct  772   LEANCKFSIIGSEFTKSGWGFIFPRDSPLAVDLSTAILSLSENGDLQRIHDKWLTTGTCS  831

Query  2241  sestelesDRLHLKSFWglfllcgaacflalfIYFVQIMLKFRRVA---RAEPVADG  2402
             + + EL+SDRLHL SFWGLFL+CG ACFLALFI+F+ ++ ++ + A    AEP + G
Sbjct  832   TATDELDSDRLHLNSFWGLFLICGVACFLALFIFFMLMLRQYLQHASEGEAEPSSQG  888


 Score =   519 bits (1337),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 235/380 (62%), Positives = 305/380 (80%), Gaps = 5/380 (1%)
 Frame = +2

Query  56    LVAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTT  235
             +V AL+FM+ D++AI+GPQ S +AH + HV NELQVP+LSFAATDP+L+SLQFP+F+RTT
Sbjct  101   IVEALQFMEVDIIAIVGPQCSTIAHILCHVGNELQVPMLSFAATDPSLSSLQFPFFVRTT  160

Query  236   QSDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGA  415
             QSD +QM AIA+++++Y WK+VIAVF DDDYGRNGIAAL D LA +RC+ISYKA +PP A
Sbjct  161   QSDAFQMAAIAEMLEYYQWKQVIAVFFDDDYGRNGIAALGDELAERRCRISYKAALPPEA  220

Query  416   TTRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVLD  595
             T R++I ++LV++ALMES V+VLHA P  G  V  VAH+L MMG+GYVWI+TDWL++ LD
Sbjct  221   T-RSDITELLVKVALMESHVIVLHANPTTGLEVLYVAHFLEMMGNGYVWIATDWLASRLD  279

Query  596   SSSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLT----GGSLGLNSYALYAYDS  763
             S +PL  E M  MQGVL LRQHTPDS+ K A  S+W+ LT     G+  LNSY LYAYD+
Sbjct  280   SFAPLAPETMSTMQGVLTLRQHTPDSKRKSALVSKWRMLTKKENSGNFQLNSYGLYAYDT  339

Query  764   VWLIAHAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGL  943
             VW+IA AID+F N GG ISFSNDS+L  ++G  LHLEA+S+FDGG LLL+ + +++F G+
Sbjct  340   VWMIARAIDAFFNDGGRISFSNDSRLHDVKGGALHLEAMSVFDGGKLLLDEIRKTNFTGI  399

Query  944   TGQFKFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQK  1123
             TGQ +F++D +L+ P+YDI+NV+GTG RT+G+W NYSGLS  PPETLYS+PPN S+ANQ+
Sbjct  400   TGQVQFDSDGNLIHPAYDIINVVGTGMRTVGYWSNYSGLSVVPPETLYSKPPNHSAANQQ  459

Query  1124  LYGVVWPGQSVKKAPGVGFP  1183
             LY V+WPG++  K  G  FP
Sbjct  460   LYSVIWPGETTTKPRGWVFP  479



>ref|XP_002891241.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH67500.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=937

 Score =   573 bits (1478),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 312/413 (76%), Positives = 362/413 (88%), Gaps = 1/413 (0%)
 Frame = +3

Query  1161  KPRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGT-NTFKGFSVDVFTAAVNLLPYAVPFQ  1337
             KPRGWVF NNGK+L+IGVP RVSYKEF+SQ+ GT N FKGF +DVFTAAVNLLPYAVP +
Sbjct  456   KPRGWVFSNNGKELKIGVPRRVSYKEFVSQIRGTENMFKGFCIDVFTAAVNLLPYAVPVK  515

Query  1338  FVPFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPFK  1517
             F+P+GNG+ENPSY+ +V +++TG FDG +GD+AIVTNRTK+VDFTQPY ASGL+VVAPFK
Sbjct  516   FIPYGNGKENPSYTHMVEMITTGNFDGVVGDVAIVTNRTKIVDFTQPYAASGLVVVAPFK  575

Query  1518  KLNTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSLS  1697
             KLN+GAWAFL PF+  MW VT   F+ VGIVVWILEHR NDEFRG PK+Q +TILWFS S
Sbjct  576   KLNSGAWAFLRPFNRLMWAVTGCCFLFVGIVVWILEHRTNDEFRGPPKRQCVTILWFSFS  635

Query  1698  TLFFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESLKEGN  1877
             T+FFAHRENTVSTLGR+VLIIWLFVVLIINSSYTASLTSILTVQQL SPIKG+ESLKE +
Sbjct  636   TMFFAHRENTVSTLGRLVLIIWLFVVLIINSSYTASLTSILTVQQLSSPIKGIESLKERD  695

Query  1878  DPIGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERPYVEN  2057
             DPIGYQ+GSFAE YL  E+ IS+SRL+ LG+PEAYA+AL+ GP KGGV+AIVDERPYVE 
Sbjct  696   DPIGYQVGSFAESYLRNELNISESRLVPLGTPEAYAKALKDGPSKGGVAAIVDERPYVEL  755

Query  2058  FLSTQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLtrtsc  2237
             FLST C +RIVGQEFTKSGWGFAFPRDSPLA+D+STAIL L+ENGDLQRIHDKWL + +C
Sbjct  756   FLSTNCAYRIVGQEFTKSGWGFAFPRDSPLAIDLSTAILELAENGDLQRIHDKWLMKNAC  815

Query  2238  ssestelesDRLHLKSFWglfllcgaacflalfIYFVQIMLKFRRVARAEPVA  2396
             + E+ ELESDRLHLKSFWGLFL+CG AC LALF+YFVQI+ +  +    + +A
Sbjct  816   TLENAELESDRLHLKSFWGLFLICGVACLLALFLYFVQIIRQLYKKPSNDAIA  868


 Score =   475 bits (1223),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 225/377 (60%), Positives = 289/377 (77%), Gaps = 5/377 (1%)
 Frame = +2

Query  56    LVAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTT  235
             +V AL+FM+ D+V I+GPQ SVVAH ISH+ANEL VPLLSFA TDP ++ LQFPYF+RTT
Sbjct  83    MVEALRFMEKDIVGIIGPQCSVVAHMISHMANELHVPLLSFAVTDPVMSPLQFPYFIRTT  142

Query  236   QSDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGI-PPG  412
             QSD+YQM AIA ++D YGWKEVIAVF+DDD+GRNG+AAL+D LA++R +I+YKAG+ P  
Sbjct  143   QSDLYQMDAIASIVDFYGWKEVIAVFVDDDFGRNGVAALNDKLASRRLRITYKAGLHPDT  202

Query  413   ATTRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVL  592
                + EIM++L++I L++ R++V+H Y   GF VF  A YLGMMG+GYVWI+TDWLST L
Sbjct  203   VVNKNEIMNMLIKIMLLQPRIIVIHVYSELGFAVFKEAKYLGMMGNGYVWIATDWLSTNL  262

Query  593   DSSSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLTGGSLGLNSYALYAYDSVWL  772
             DSSSPLP+E++E +QGVLVLR HTPDS LKR F  RW+ ++G SL LN+YALYAYDSV L
Sbjct  263   DSSSPLPAERLETIQGVLVLRPHTPDSSLKREFFKRWRKVSGASLDLNTYALYAYDSVML  322

Query  773   IAHAIDSFLNKGGVISFSNDSKLQSIEGS-TLHLEALSIFDGGPLLLNNLLQSDFVGLTG  949
             +   +D F   GG ISFSN S L ++  S  L+LEA+++FDGG  L  ++L +  VGLTG
Sbjct  323   LVRGLDKFFKDGGKISFSNHSMLNTLGKSGNLNLEAMTVFDGGETLRKDILGTRMVGLTG  382

Query  950   QFKFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRP-PNSSSA--NQ  1120
             Q +F  D+S   P+YDI+NV GTG R IG+W NYSGLST  PE+LY++  PN SS   +Q
Sbjct  383   QLQFTPDRSRTRPAYDIINVAGTGVRQIGYWSNYSGLSTISPESLYTKEQPNMSSGTTSQ  442

Query  1121  KLYGVVWPGQSVKKAPG  1171
             KL  V+WPG++  K  G
Sbjct  443   KLRHVIWPGETFTKPRG  459



>ref|XP_010478979.1| PREDICTED: glutamate receptor 3.3-like [Camelina sativa]
 ref|XP_010478980.1| PREDICTED: glutamate receptor 3.3-like [Camelina sativa]
Length=936

 Score =   572 bits (1474),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 308/413 (75%), Positives = 363/413 (88%), Gaps = 1/413 (0%)
 Frame = +3

Query  1161  KPRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGT-NTFKGFSVDVFTAAVNLLPYAVPFQ  1337
             KPRGWVF NNGK+L+IGVP RVSYKEF+SQ+ GT N FKGF +DVFTAAVNLLPYAVP +
Sbjct  455   KPRGWVFSNNGKELKIGVPRRVSYKEFVSQIRGTENMFKGFCIDVFTAAVNLLPYAVPVK  514

Query  1338  FVPFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPFK  1517
             F+P+GNG+ENPSY+ +V ++++G FDG +GD+AIVTNRTK+VDFTQPY ASGL+VVAPFK
Sbjct  515   FIPYGNGKENPSYTHMVEMITSGNFDGVVGDVAIVTNRTKIVDFTQPYAASGLVVVAPFK  574

Query  1518  KLNTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSLS  1697
             KLN+GAWAFL PF+  MW VT   F+ VGIVVWILEHR NDEFRG PK+Q +TILWFS S
Sbjct  575   KLNSGAWAFLRPFNRLMWAVTGCCFLFVGIVVWILEHRTNDEFRGPPKRQCVTILWFSFS  634

Query  1698  TLFFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESLKEGN  1877
             T+FFAHRENT+STLGR+VLIIWLFVVLIINSSYTASLTSILTVQQL SPIKG+ESL+E +
Sbjct  635   TMFFAHRENTISTLGRLVLIIWLFVVLIINSSYTASLTSILTVQQLSSPIKGIESLRERD  694

Query  1878  DPIGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERPYVEN  2057
             DPIGYQ+GSFAE+YL  E+ IS+SRL+ALG+PEAYA+AL+ GP KGGV+AIVDERPYVE 
Sbjct  695   DPIGYQVGSFAEYYLRNELNISESRLLALGTPEAYAKALKDGPSKGGVAAIVDERPYVEL  754

Query  2058  FLSTQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLtrtsc  2237
             FLS+ C +RIVGQEFTKSGWGFAFPRDSPLA+D+STAIL L+ENGDLQRIHDKWL + +C
Sbjct  755   FLSSNCAYRIVGQEFTKSGWGFAFPRDSPLAIDLSTAILELAENGDLQRIHDKWLMKNAC  814

Query  2238  ssestelesDRLHLKSFWglfllcgaacflalfIYFVQIMLKFRRVARAEPVA  2396
             + E+ ELESDRLHLKSFWGLFL+CG AC LAL +YFVQI+ +  +    + +A
Sbjct  815   TLENAELESDRLHLKSFWGLFLICGVACLLALLLYFVQIIRQLYKKPSDDAIA  867


 Score =   471 bits (1211),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 222/377 (59%), Positives = 291/377 (77%), Gaps = 5/377 (1%)
 Frame = +2

Query  56    LVAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTT  235
             +V AL+FM+ D+V I+GPQ SVVAH ISH+ANEL+VPLLSFA TDP ++ LQFPYF+RTT
Sbjct  82    MVEALRFMEKDIVGIIGPQCSVVAHMISHMANELRVPLLSFAVTDPVMSPLQFPYFIRTT  141

Query  236   QSDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGI-PPG  412
             QSD+YQM AIA ++D+YGWKEVIAVF+DDD+GRNG+AAL+D LA++R +I+YKAG+ P  
Sbjct  142   QSDLYQMDAIASIVDYYGWKEVIAVFVDDDFGRNGVAALNDKLASRRLRITYKAGLHPDT  201

Query  413   ATTRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVL  592
             A  + EIM++L++I L++ R++V+H Y   GF VF  A YLGMMG+GYVWI+TDWLST L
Sbjct  202   AVNKNEIMNMLIKIMLLQPRIIVIHVYSELGFAVFKEAKYLGMMGNGYVWIATDWLSTNL  261

Query  593   DSSSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLTGGSLGLNSYALYAYDSVWL  772
             DSSSPLPSE++E +QGVLV+R HTPDS LKR F  RW+ ++   L LN+YALYAYDSV +
Sbjct  262   DSSSPLPSERLETIQGVLVMRPHTPDSSLKREFFKRWRKISDAPLALNTYALYAYDSVMI  321

Query  773   IAHAIDSFLNKGGVISFSNDSKLQSIEGS-TLHLEALSIFDGGPLLLNNLLQSDFVGLTG  949
             +A A+D F   GG ISFSN S L ++  S  L+LEA+++FD G  LL ++L +  VGLTG
Sbjct  322   LASALDKFFKDGGNISFSNHSMLNTLGKSGNLNLEAMTVFDSGETLLKDILGTHIVGLTG  381

Query  950   QFKFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSR-PPNSS--SANQ  1120
             Q +F  D+S   P+YDI+NV GTG R IG+W N+SGLST  PE+LY++  PN S  + + 
Sbjct  382   QLQFAPDRSRTRPAYDIINVAGTGVRQIGYWSNHSGLSTVSPESLYTKGRPNMSYVTTSP  441

Query  1121  KLYGVVWPGQSVKKAPG  1171
             KL  V+WPG++  K  G
Sbjct  442   KLRNVIWPGETFTKPRG  458



>ref|XP_010500221.1| PREDICTED: glutamate receptor 3.3 [Camelina sativa]
 ref|XP_010500222.1| PREDICTED: glutamate receptor 3.3 [Camelina sativa]
Length=936

 Score =   572 bits (1473),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 308/413 (75%), Positives = 363/413 (88%), Gaps = 1/413 (0%)
 Frame = +3

Query  1161  KPRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGT-NTFKGFSVDVFTAAVNLLPYAVPFQ  1337
             KPRGWVF NNGK+L+IGVP RVSYKEF+SQ+ GT N FKGF +DVFTAAVNLLPYAVP +
Sbjct  455   KPRGWVFSNNGKELKIGVPRRVSYKEFVSQIRGTENMFKGFCIDVFTAAVNLLPYAVPVK  514

Query  1338  FVPFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPFK  1517
             F+P+GNG+ENPSY+ +V ++++G FDG +GD+AIVTNRTK+VDFTQPY ASGL+VVAPFK
Sbjct  515   FIPYGNGKENPSYTHMVEMITSGNFDGVVGDVAIVTNRTKIVDFTQPYAASGLVVVAPFK  574

Query  1518  KLNTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSLS  1697
             KLN+GAWAFL PF+  MW VT   F+ VGIVVWILEHR NDEFRG PK+Q +TILWFS S
Sbjct  575   KLNSGAWAFLRPFNRLMWAVTGCCFLFVGIVVWILEHRTNDEFRGPPKRQCVTILWFSFS  634

Query  1698  TLFFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESLKEGN  1877
             T+FFAHRENT+STLGR+VLIIWLFVVLIINSSYTASLTSILTVQQL SPIKG+ESL+E +
Sbjct  635   TMFFAHRENTISTLGRLVLIIWLFVVLIINSSYTASLTSILTVQQLSSPIKGIESLRERD  694

Query  1878  DPIGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERPYVEN  2057
             DPIGYQ+GSFAE+YL  E+ IS+SRL+ALG+PEAYA+AL+ GP KGGV+AIVDERPYVE 
Sbjct  695   DPIGYQVGSFAEYYLRNELNISESRLLALGTPEAYAKALKDGPSKGGVAAIVDERPYVEL  754

Query  2058  FLSTQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLtrtsc  2237
             FLS+ C +RIVGQEFTKSGWGFAFPRDSPLA+D+STAIL L+ENGDLQRIHDKWL + +C
Sbjct  755   FLSSNCAYRIVGQEFTKSGWGFAFPRDSPLAIDLSTAILELAENGDLQRIHDKWLMKNAC  814

Query  2238  ssestelesDRLHLKSFWglfllcgaacflalfIYFVQIMLKFRRVARAEPVA  2396
             + E+ ELESDRLHLKSFWGLFL+CG AC LAL +YFVQI+ +  +    + +A
Sbjct  815   TLENAELESDRLHLKSFWGLFLICGVACLLALLLYFVQIIRQLYKKPSDDAIA  867


 Score =   470 bits (1210),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 222/377 (59%), Positives = 291/377 (77%), Gaps = 5/377 (1%)
 Frame = +2

Query  56    LVAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTT  235
             +V AL+FM+ D+V I+GPQ SVVAH ISH+ANEL+VPLLSFA TDP ++ LQFPYF+RTT
Sbjct  82    MVEALRFMEKDIVGIIGPQCSVVAHMISHMANELRVPLLSFAVTDPVMSPLQFPYFIRTT  141

Query  236   QSDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGI-PPG  412
             QSD+YQM AIA ++D+YGWKEVIAVF+DDD+GRNG+AAL+D LA++R +I+YKAG+ P  
Sbjct  142   QSDLYQMDAIASIVDYYGWKEVIAVFVDDDFGRNGVAALNDKLASRRLRITYKAGLHPDT  201

Query  413   ATTRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVL  592
             A  + EIM++L++I L++ R++V+H Y   GF VF  A YLGMMG+GYVWI+TDWLST L
Sbjct  202   AVNKNEIMNMLIKIMLLQPRIIVIHVYSELGFAVFKEAKYLGMMGNGYVWIATDWLSTNL  261

Query  593   DSSSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLTGGSLGLNSYALYAYDSVWL  772
             DSSSPLPSE++E +QGVLV+R HTPDS LKR F  RW+ ++   L LN+YALYAYDSV +
Sbjct  262   DSSSPLPSERLETIQGVLVMRPHTPDSSLKREFFKRWRKISDAPLALNTYALYAYDSVMI  321

Query  773   IAHAIDSFLNKGGVISFSNDSKLQSIEGS-TLHLEALSIFDGGPLLLNNLLQSDFVGLTG  949
             +A A+D F   GG ISFSN S L ++  S  L+LEA+++FD G  LL ++L +  VGLTG
Sbjct  322   LASALDKFFKDGGNISFSNHSMLNTLGKSGNLNLEAMTVFDSGETLLKDILGTHIVGLTG  381

Query  950   QFKFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSR-PPNSS--SANQ  1120
             Q +F  D+S   P+YDI+NV GTG R IG+W N+SGLST  PE+LY++  PN S  + + 
Sbjct  382   QLQFAPDRSRTRPAYDIINVAGTGVRQIGYWSNHSGLSTVSPESLYTKGRPNMSYVTTSP  441

Query  1121  KLYGVVWPGQSVKKAPG  1171
             KL  V+WPG++  K  G
Sbjct  442   KLRNVIWPGETFTKPRG  458



>ref|XP_006306244.1| hypothetical protein CARUB_v10012075mg [Capsella rubella]
 gb|EOA39142.1| hypothetical protein CARUB_v10012075mg [Capsella rubella]
Length=941

 Score =   567 bits (1461),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 305/413 (74%), Positives = 361/413 (87%), Gaps = 1/413 (0%)
 Frame = +3

Query  1161  KPRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGT-NTFKGFSVDVFTAAVNLLPYAVPFQ  1337
             KPRGWVF NNGK+LRIGVP RVSYKEF+SQ+ GT N FKGF +DVFTAAVNLLPYAVPF+
Sbjct  460   KPRGWVFSNNGKELRIGVPRRVSYKEFVSQIRGTENLFKGFCIDVFTAAVNLLPYAVPFK  519

Query  1338  FVPFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPFK  1517
             FVP+G+G+ENPSY+ ++ ++++G FDG +GDIAIVTNRTK+VDFTQPY ASGL+VVAPFK
Sbjct  520   FVPYGDGKENPSYTHMIEMITSGNFDGVVGDIAIVTNRTKIVDFTQPYAASGLVVVAPFK  579

Query  1518  KLNTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSLS  1697
             KLN+GAWAFL PF+  MW VT   F+ VGIVVWILEHR NDEFRG PK+Q +TILWFS S
Sbjct  580   KLNSGAWAFLRPFNRLMWAVTGCCFLFVGIVVWILEHRTNDEFRGPPKRQCVTILWFSFS  639

Query  1698  TLFFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESLKEGN  1877
             T+FFAHRENTVSTLGR+VLIIWLFVVLIINSSYTASLTSILTVQQL SPIKG+ESL+E +
Sbjct  640   TMFFAHRENTVSTLGRLVLIIWLFVVLIINSSYTASLTSILTVQQLSSPIKGIESLRERD  699

Query  1878  DPIGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERPYVEN  2057
             D IG+Q+GSFAE YL  E+ IS+SRL+ LG+P+AYA+AL+ GP+KGGV+AIVDERPYVE 
Sbjct  700   DKIGFQVGSFAESYLRNELNISESRLVPLGTPDAYAKALKDGPNKGGVAAIVDERPYVEL  759

Query  2058  FLSTQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLtrtsc  2237
             FLS+ C +RIVGQEFTKSGWGFAFPRDSPLA+D+STAIL L+ENGDLQRIHDKWL + +C
Sbjct  760   FLSSNCAYRIVGQEFTKSGWGFAFPRDSPLAIDLSTAILELAENGDLQRIHDKWLMKNAC  819

Query  2238  ssestelesDRLHLKSFWglfllcgaacflalfIYFVQIMLKFRRVARAEPVA  2396
             + E+ ELESDRLHLKSFWGLFL+CG AC  AL +YF+QI+ +  +    + +A
Sbjct  820   TLENAELESDRLHLKSFWGLFLICGVACIFALLLYFIQILRQLYKKPNDDAIA  872


 Score =   469 bits (1208),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 222/378 (59%), Positives = 290/378 (77%), Gaps = 6/378 (2%)
 Frame = +2

Query  56    LVAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTT  235
             +V AL+FM+ D+V I+GPQ SVVAH ISH+ANEL+VPLLSFA TDP ++ LQFPYF+RTT
Sbjct  86    MVEALRFMEKDIVGIIGPQCSVVAHMISHMANELRVPLLSFAVTDPVMSPLQFPYFIRTT  145

Query  236   QSDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGI-PPG  412
             QSD+YQM AIA ++D YGWKEVIAVF+DDD+GRNG+AAL+D LA++R +I+YKAG+ P  
Sbjct  146   QSDLYQMDAIASIVDFYGWKEVIAVFVDDDFGRNGVAALNDKLASRRLRITYKAGLHPDT  205

Query  413   ATTRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVL  592
             A  + EIM++L++I L++ R++V+H Y   GF VF  A YLGMMG+GYVWI+TDWLST L
Sbjct  206   AVNKNEIMNMLIKIMLLQPRIIVIHVYSELGFAVFKEAKYLGMMGNGYVWIATDWLSTTL  265

Query  593   DSSSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLTGGSLGLNSYALYAYDSVWL  772
             DSSSPLPSE+++ +QGVLVLR HTPDS LKR F  RW+  +G SL LN+YALYAYDSV L
Sbjct  266   DSSSPLPSERLDTIQGVLVLRPHTPDSSLKREFFKRWRKDSGSSLALNTYALYAYDSVML  325

Query  773   IAHAIDSFLNKGGVISFSNDSKLQSIEGS-TLHLEALSIFDGGPLLLNNLLQSDFVGLTG  949
             +A A+D F   GG ISFSN S L ++  S  L+LEA+++FD G  LL  +L +  VGL+G
Sbjct  326   LARALDKFFKDGGNISFSNHSMLNTLGKSGNLNLEAMTVFDSGETLLKAILTTHMVGLSG  385

Query  950   QFKFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSR-PPNSS---SAN  1117
             Q +F  ++S   P+YDI+NV GTG R IG+W N+SGLST  PE+ Y++  PN S   +++
Sbjct  386   QLQFTQERSRTRPAYDIINVAGTGVRQIGYWSNHSGLSTVSPESFYTKGRPNMSVGGTSS  445

Query  1118  QKLYGVVWPGQSVKKAPG  1171
              KL  V+WPG++  K  G
Sbjct  446   PKLRHVIWPGETFTKPRG  463



>ref|XP_009107640.1| PREDICTED: glutamate receptor 3.3 isoform X1 [Brassica rapa]
Length=929

 Score =   562 bits (1448),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 306/401 (76%), Positives = 357/401 (89%), Gaps = 1/401 (0%)
 Frame = +3

Query  1158  KKPRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGT-NTFKGFSVDVFTAAVNLLPYAVPF  1334
             +KPRGW F NNGK+L+IGVP RVSYKEF+SQ+ GT N FKGF +DVFTAAVNLLPYAVP 
Sbjct  449   QKPRGWAFSNNGKELKIGVPRRVSYKEFVSQIRGTENMFKGFCIDVFTAAVNLLPYAVPV  508

Query  1335  QFVPFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPF  1514
             +F+P+GNG+ENPSY+ +V ++++G FDG +GDIAIVTNRTK+VDFTQPY ASGL+VVAPF
Sbjct  509   KFIPYGNGKENPSYTHMVEMITSGNFDGVVGDIAIVTNRTKIVDFTQPYAASGLVVVAPF  568

Query  1515  KKLNTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSL  1694
             KKLN+GAW FL PF+  MW VTA  F+ VGIVVWILEHR+NDEFRG PK+Q +TILWFS 
Sbjct  569   KKLNSGAWVFLRPFNRLMWAVTACCFLFVGIVVWILEHRINDEFRGPPKRQCVTILWFSF  628

Query  1695  STLFFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESLKEG  1874
             ST+FFAHRENTVSTLGR+VLIIWLFVVLIINSSYTASLTSILTVQQL SPIKG++SL+E 
Sbjct  629   STMFFAHRENTVSTLGRLVLIIWLFVVLIINSSYTASLTSILTVQQLSSPIKGIDSLREM  688

Query  1875  NDPIGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERPYVE  2054
             +D IGYQ+GSFAE YL +E+ IS+SRL+ LGS EAYA+AL+ GP KGGV+AIVDERPYVE
Sbjct  689   DDRIGYQVGSFAERYLRDELNISESRLVPLGSREAYAKALKDGPRKGGVAAIVDERPYVE  748

Query  2055  NFLSTQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLtrts  2234
              FLS+ C +RIVGQEFTKSGWGFAFPRDSPLA+D+STAIL L+ENGDLQRIHDKWL + +
Sbjct  749   LFLSSNCAYRIVGQEFTKSGWGFAFPRDSPLAIDLSTAILELAENGDLQRIHDKWLMKNA  808

Query  2235  cssestelesDRLHLKSFWglfllcgaacflalfIYFVQIM  2357
             C+ E+ ELESDRLHLKSFWGLFL+CG AC LALF+YFVQI+
Sbjct  809   CTLENAELESDRLHLKSFWGLFLICGVACVLALFLYFVQII  849


 Score =   473 bits (1216),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 223/377 (59%), Positives = 292/377 (77%), Gaps = 5/377 (1%)
 Frame = +2

Query  56    LVAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTT  235
             +V AL+FM+ D+V I+GPQ SVVAH ISH+ANEL+VPLLSFA TDP ++ LQFPYF+RT+
Sbjct  83    MVEALRFMEKDIVGIIGPQCSVVAHMISHMANELRVPLLSFAVTDPVMSPLQFPYFIRTS  142

Query  236   QSDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGI-PPG  412
             QSD+YQM AIA ++D YGWKEVIAVF+DDDYGRNG+AAL+D LA++R +I+YKAG+ P  
Sbjct  143   QSDLYQMEAIASIVDLYGWKEVIAVFVDDDYGRNGVAALNDKLASRRLRITYKAGLHPDN  202

Query  413   ATTRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVL  592
             A  + EIM++L++I L++ R++V+H Y   GF VF  A YLGMMG+GYVWI+TDWLST L
Sbjct  203   AVNKNEIMNMLIKIMLLQPRIIVIHVYSELGFAVFKEAKYLGMMGNGYVWIATDWLSTTL  262

Query  593   DSSSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLTGGSLGLNSYALYAYDSVWL  772
             DSSSPLPSE++E +QG LVLR HTPDS+LKR F +RW+      L L++Y LYAYDSV L
Sbjct  263   DSSSPLPSERLESIQGALVLRPHTPDSKLKREFFARWRKNPDAPLALHTYGLYAYDSVML  322

Query  773   IAHAIDSFLNKGGVISFSNDSKLQSIEGS-TLHLEALSIFDGGPLLLNNLLQSDFVGLTG  949
             +A A+D +   GG +SFSNDS L ++  S +L+LEA+++FDGG  LL ++L +  VGLTG
Sbjct  323   LARALDKYFKHGGKVSFSNDSMLDALGKSGSLNLEAMTVFDGGEALLKDILGTHMVGLTG  382

Query  950   QFKFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKLY  1129
             Q +F  D+S + P+YDI+NV GTG R IG+W N+SGLS  PPE+L    PN  SA+QKL 
Sbjct  383   QLQFTTDRSRIRPAYDIINVAGTGVRQIGYWSNHSGLSVLPPESLTK--PN-MSASQKLR  439

Query  1130  GVVWPGQSVKKAPGVGF  1180
              V+WPG++ +K  G  F
Sbjct  440   HVIWPGEAFQKPRGWAF  456



>ref|XP_006396004.1| hypothetical protein EUTSA_v10003614mg [Eutrema salsugineum]
 gb|ESQ33290.1| hypothetical protein EUTSA_v10003614mg [Eutrema salsugineum]
Length=937

 Score =   564 bits (1453),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 308/412 (75%), Positives = 364/412 (88%), Gaps = 4/412 (1%)
 Frame = +3

Query  1158  KKPRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGT-NTFKGFSVDVFTAAVNLLPYAVPF  1334
             +KPRGWVF NNGK+L+IGVP R+SYKEF+SQ+ GT N FKGF +DVFTAAVNLLPYAVP 
Sbjct  455   QKPRGWVFSNNGKELKIGVPRRISYKEFVSQIRGTENMFKGFCIDVFTAAVNLLPYAVPV  514

Query  1335  QFVPFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPF  1514
             +F P+G+G+ENPSY+ +V +++TG FDG +GD+AIVTNRTK+VDFTQPY ASGL+VVAPF
Sbjct  515   KFFPYGDGKENPSYTHMVEMITTGNFDGVVGDVAIVTNRTKIVDFTQPYAASGLVVVAPF  574

Query  1515  KKLNTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSL  1694
             KKLN+GAWAFL PF+  MW VT   F+ VGIVVWILEHR+NDEFRG PK+Q +TILWFS 
Sbjct  575   KKLNSGAWAFLRPFNRLMWAVTGCCFLFVGIVVWILEHRINDEFRGPPKRQCVTILWFSF  634

Query  1695  STLFFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESLKEG  1874
             ST+FFAHRENTVSTLGR+VLIIWLFVVLIINSSYTASLTSILTVQQL SPIKG++SL+E 
Sbjct  635   STMFFAHRENTVSTLGRLVLIIWLFVVLIINSSYTASLTSILTVQQLSSPIKGIDSLREM  694

Query  1875  NDPIGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERPYVE  2054
             ++ IGYQ+GSFAE YL +E+ IS+SRL+ LGSPEAYA+AL+ GP KGGV+AIVDERPYVE
Sbjct  695   DERIGYQVGSFAERYLRDELNISESRLVPLGSPEAYAKALKDGPRKGGVAAIVDERPYVE  754

Query  2055  NFLSTQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLtrts  2234
              FLS+ C +RIVGQEFTKSGWGFAFPRDSPLA+D+STAIL L+ENGDLQRIHDKWL + +
Sbjct  755   LFLSSNCAYRIVGQEFTKSGWGFAFPRDSPLAIDLSTAILELAENGDLQRIHDKWLMKNA  814

Query  2235  cssestelesDRLHLKSFWglfllcgaacflalfIYFVQIMLKFRRVARAEP  2390
             C+ E+ ELESDRLHLKSFWGLFL+CG AC LALF+YFVQI+   R++  A+P
Sbjct  815   CTLENAELESDRLHLKSFWGLFLICGVACVLALFLYFVQII---RQLYNAKP  863


 Score =   471 bits (1211),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 220/377 (58%), Positives = 291/377 (77%), Gaps = 5/377 (1%)
 Frame = +2

Query  56    LVAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTT  235
             +V AL+FM+ D+V I+GPQ SVVAH ISH+AN+L+VPLLSFA TDP ++ LQFPYF+RT+
Sbjct  83    MVEALRFMEKDIVGIIGPQCSVVAHMISHMANQLRVPLLSFAVTDPVMSPLQFPYFIRTS  142

Query  236   QSDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGI-PPG  412
             QSD+YQM AIA ++D YGWKEVIAVF+DDDYGRNG+AAL+D LA++R +I+YKAG+ P  
Sbjct  143   QSDLYQMDAIASIVDFYGWKEVIAVFVDDDYGRNGVAALNDKLASRRLRITYKAGLHPDN  202

Query  413   ATTRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVL  592
                + EIM+IL++I L++ R++V+H Y   GF VF  A YLGMMG+GYVWI+TDWLST L
Sbjct  203   VANKNEIMNILIKIMLLQPRIIVIHVYSELGFAVFKEAKYLGMMGNGYVWIATDWLSTTL  262

Query  593   DSSSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLTGGSLGLNSYALYAYDSVWL  772
             DS SPLP+E++E +QGVLVLR HTPDS LKR F SRW+ + G  L L++Y LYAYDSV +
Sbjct  263   DSLSPLPAERLETIQGVLVLRPHTPDSNLKREFFSRWRKIRGAPLALHTYGLYAYDSVLV  322

Query  773   IAHAIDSFLNKGGVISFSNDSKLQSIEGS-TLHLEALSIFDGGPLLLNNLLQSDFVGLTG  949
             +A A+D +   GG ISFSNDS L ++  S  L+LEA+++FDGG  LL ++L++  VGLTG
Sbjct  323   LARALDKYFKHGGKISFSNDSMLDAVGKSGNLNLEAMTVFDGGETLLKDILRTHMVGLTG  382

Query  950   QFKFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYS-RPPNSS--SANQ  1120
               +F  D+S + P YDI+NV GTG R IG+W N+SGLS  PPE+LY+ + PN S  + + 
Sbjct  383   LLQFTPDRSRIRPVYDIINVAGTGVRQIGYWSNHSGLSIVPPESLYTNKQPNMSFGTTSP  442

Query  1121  KLYGVVWPGQSVKKAPG  1171
             KL  V+WPG++ +K  G
Sbjct  443   KLRHVIWPGETFQKPRG  459



>ref|XP_010463180.1| PREDICTED: glutamate receptor 3.3-like [Camelina sativa]
Length=892

 Score =   556 bits (1432),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 303/413 (73%), Positives = 358/413 (87%), Gaps = 5/413 (1%)
 Frame = +3

Query  1161  KPRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGT-NTFKGFSVDVFTAAVNLLPYAVPFQ  1337
             KPRGWVF NNGK+L+IGVP RVSYKEF+SQ+ GT N FKGF +DVFTAAVNLLPYAVP +
Sbjct  415   KPRGWVFSNNGKELKIGVPRRVSYKEFVSQIRGTENMFKGFCIDVFTAAVNLLPYAVPVK  474

Query  1338  FVPFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPFK  1517
             F+P+GNG+ENPSY+ +V ++++G FDG +GD+AIVTNRTK+VDFTQPY ASGL+VVAPFK
Sbjct  475   FIPYGNGKENPSYTHMVEMITSGNFDGVVGDVAIVTNRTKIVDFTQPYAASGLVVVAPFK  534

Query  1518  KLNTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSLS  1697
             KLN+GAWAFL PF+  MW VT   F+ VGIVVWILEHR NDEFRG PK+Q +TILWFS S
Sbjct  535   KLNSGAWAFLRPFNRLMWAVTGCCFLFVGIVVWILEHRTNDEFRGPPKRQCVTILWFSFS  594

Query  1698  TLFFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESLKEGN  1877
             T+FFAH     +TLGR+VLIIWLFVVLIINSSYTASLTSILTVQQL SPIKG+ESL+E +
Sbjct  595   TMFFAHS----TTLGRLVLIIWLFVVLIINSSYTASLTSILTVQQLSSPIKGIESLRERD  650

Query  1878  DPIGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERPYVEN  2057
             DPIGYQ+GSFAE+YL  E+ IS+SRL+ALG+PEAYA+AL+ GP KGGV+AIVDERPYVE 
Sbjct  651   DPIGYQVGSFAEYYLRNELNISESRLLALGTPEAYAKALKDGPSKGGVAAIVDERPYVEL  710

Query  2058  FLSTQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLtrtsc  2237
             FLS+ C +RIVGQEFTKSGWGFAFPRDSPLA+D+STAIL L+ENGDLQRIHDKWL + +C
Sbjct  711   FLSSNCAYRIVGQEFTKSGWGFAFPRDSPLAIDLSTAILELAENGDLQRIHDKWLMKNAC  770

Query  2238  ssestelesDRLHLKSFWglfllcgaacflalfIYFVQIMLKFRRVARAEPVA  2396
             + E+ ELESDRLHLKSFWGLFL+CG AC LAL +YFVQI+ +  +    + +A
Sbjct  771   TLENAELESDRLHLKSFWGLFLICGVACLLALLLYFVQIIRQLYKKPSDDAIA  823


 Score =   464 bits (1193),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 221/377 (59%), Positives = 289/377 (77%), Gaps = 5/377 (1%)
 Frame = +2

Query  56    LVAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTT  235
             +V AL+FM+ D+V I+GPQ SVVAH ISH+ANEL+VPLLSFA TDP ++ LQFPYF+RTT
Sbjct  42    MVEALRFMEKDIVGIIGPQCSVVAHMISHMANELRVPLLSFAVTDPVMSPLQFPYFIRTT  101

Query  236   QSDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGI-PPG  412
             QSD+YQM AIA ++D+YGWKEVIAVF+DDD+GRNG+AAL+D LA++R +I+YKAG+ P  
Sbjct  102   QSDLYQMDAIASIVDYYGWKEVIAVFVDDDFGRNGVAALNDKLASRRLRITYKAGLHPDT  161

Query  413   ATTRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVL  592
             A  + EIM++L++I L++ R++V+H Y   GF VF  A YLGMMG+GYVWI+TDWLST L
Sbjct  162   AVNKNEIMNMLIKIMLLQPRIIVIHVYSELGFAVFKEAKYLGMMGNGYVWIATDWLSTNL  221

Query  593   DSSSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLTGGS-LGLNSYALYAYDSVW  769
             DSS PLPSE++E +QGVLV+R HTPDS LKR F  RW+ ++  + L LN+YALYAYDSV 
Sbjct  222   DSSLPLPSERLETIQGVLVMRPHTPDSSLKRDFFKRWRKISDHAPLALNTYALYAYDSVM  281

Query  770   LIAHAIDSFLNKGGVISFSNDSKLQSIEGS-TLHLEALSIFDGGPLLLNNLLQSDFVGLT  946
             ++A A+D F   GG ISFSN S L ++  S  L+LEA+++FD G  LL ++L +  VGLT
Sbjct  282   ILASALDKFFKDGGNISFSNHSMLNTLGKSGNLNLEAMTVFDSGETLLKDILGTHIVGLT  341

Query  947   GQFKFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYS--RPPNSSSANQ  1120
             GQ +F  D+S   P+YDI+NV GTG R IG+W N+SGLST  PE+LY+  RP  S   + 
Sbjct  342   GQLQFAPDRSRTRPAYDIINVAGTGVRQIGYWSNHSGLSTVSPESLYTKGRPNMSFGTSP  401

Query  1121  KLYGVVWPGQSVKKAPG  1171
             KL  V+WPG++  K  G
Sbjct  402   KLRNVIWPGETFTKPRG  418



>gb|KHG10460.1| Glutamate receptor 3.6 -like protein [Gossypium arboreum]
Length=947

 Score =   520 bits (1339),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 284/405 (70%), Positives = 346/405 (85%), Gaps = 1/405 (0%)
 Frame = +3

Query  1158  KKPRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYAVPFQ  1337
             +KPRGWVFPN+G+ L+IGVP RVSY+EF+S V G +   G+ +DVFTAA+NLLPYAVP++
Sbjct  459   QKPRGWVFPNSGRHLKIGVPHRVSYREFVS-VRGPDVITGYCIDVFTAALNLLPYAVPYK  517

Query  1338  FVPFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPFK  1517
              +PFG+GR NPS +ELVRL++ G FD AIGDIAI+TNRTK+ DFTQPY+ SGL+VVAP  
Sbjct  518   LIPFGDGRTNPSGTELVRLITAGVFDAAIGDIAIITNRTKMADFTQPYIESGLVVVAPVW  577

Query  1518  KLNTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSLS  1697
             + N+ A+AFL PF+ +MW VTA FF++VG VVWILEHRMNDEFRG P++Q++TILWFS S
Sbjct  578   RKNSNAFAFLRPFTGRMWAVTAIFFLLVGTVVWILEHRMNDEFRGPPRRQVVTILWFSFS  637

Query  1698  TLFFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESLKEGN  1877
             T FFAHRENTVS LGR++LIIWLFVVLIINSSYTASLTSILTVQQL SPIKG+E+L    
Sbjct  638   TWFFAHRENTVSVLGRIILIIWLFVVLIINSSYTASLTSILTVQQLSSPIKGIETLVSSK  697

Query  1878  DPIGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERPYVEN  2057
             DPIGYQ GSFA +YLI+E+ I  SRL+AL SPE  A+AL+ GPHKGGV+A+VD+R Y+E 
Sbjct  698   DPIGYQQGSFARNYLIDELKIDASRLVALNSPEECAKALKDGPHKGGVAAMVDDRAYIEL  757

Query  2058  FLSTQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLtrtsc  2237
             FLST+C+F IVGQEFTK+GWGFAFPRDSPLAVDMSTAIL LSENGDLQRIHDKWL R +C
Sbjct  758   FLSTRCEFSIVGQEFTKNGWGFAFPRDSPLAVDMSTAILKLSENGDLQRIHDKWLLRRAC  817

Query  2238  ssestelesDRLHLKSFWglfllcgaacflalfIYFVQIMLKFRR  2372
             S +  ++E DRL L+SFWGLFL+CG AC +ALF+YF++++ +F R
Sbjct  818   SYQGAKMEVDRLQLRSFWGLFLICGLACLIALFLYFLKMVRQFSR  862


 Score =   491 bits (1264),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 225/377 (60%), Positives = 302/377 (80%), Gaps = 2/377 (1%)
 Frame = +2

Query  56    LVAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTT  235
             +V AL FM+ D VAI+GPQSSV AH ISH+AN L+VPLLSF++TDPTL+ +QFP+F+RT 
Sbjct  92    VVEALLFMERDTVAIIGPQSSVTAHVISHIANVLRVPLLSFSSTDPTLSPIQFPFFVRTA  151

Query  236   QSDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGA  415
             Q+D+YQM AIA++IDHY W+EVIA++ DDD+GRNGIAAL D LA +RC+ISYKA + P  
Sbjct  152   QNDLYQMSAIAEIIDHYEWREVIAIYEDDDHGRNGIAALGDKLAERRCRISYKARLSP-E  210

Query  416   TTRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVLD  595
              TR EI D+LV++AL ESR++V+H   + G  VFSVA YLGM+G GYVWI+T+WLSTVL+
Sbjct  211   PTRDEITDVLVKVALRESRILVVHVPGSWGLKVFSVAQYLGMLGTGYVWIATNWLSTVLE  270

Query  596   SSSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLTGGS-LGLNSYALYAYDSVWL  772
             ++SPL  + M+ +QGV+ LR +TPDS+LKR F SRW +LT G  +GLN+Y+LYAYD+VWL
Sbjct  271   TNSPLSQDAMDDIQGVVTLRMYTPDSQLKRRFVSRWSNLTRGKPIGLNTYSLYAYDTVWL  330

Query  773   IAHAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLTGQ  952
             +AHAI+ F N+GG ISF N+S+   +    LHL+ALS+F GG LLL+N+L  +  G+TG 
Sbjct  331   LAHAINEFFNQGGNISFLNNSRASELSEGNLHLDALSVFQGGNLLLDNILNVNMKGVTGD  390

Query  953   FKFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKLYG  1132
             F+F +D++L+ P+++I+NVIGTG+R +G+W N+SGLSTA PETL+ +PPN SS +Q L+G
Sbjct  391   FRFTSDRNLIHPAFEIINVIGTGYRRVGYWSNHSGLSTALPETLWEKPPNRSSTSQMLHG  450

Query  1133  VVWPGQSVKKAPGVGFP  1183
             VVWPGQ+ +K  G  FP
Sbjct  451   VVWPGQTTQKPRGWVFP  467



>emb|CDY35797.1| BnaA08g04580D [Brassica napus]
Length=822

 Score =   563 bits (1452),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 307/401 (77%), Positives = 358/401 (89%), Gaps = 1/401 (0%)
 Frame = +3

Query  1158  KKPRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTN-TFKGFSVDVFTAAVNLLPYAVPF  1334
             +KPRGW F NNGK+L+IGVP RVSYKEF+SQ+ GT   FKGF +DVFTAAVNLLPYAVP 
Sbjct  342   QKPRGWAFSNNGKELKIGVPRRVSYKEFVSQIRGTEYMFKGFCIDVFTAAVNLLPYAVPV  401

Query  1335  QFVPFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPF  1514
             +F+P+GNG+ENPSY+ +V ++++G FDG +GDIAIVTNRTK+VDFTQPY ASGL+VVAPF
Sbjct  402   KFIPYGNGKENPSYTHMVEMITSGNFDGVVGDIAIVTNRTKIVDFTQPYAASGLVVVAPF  461

Query  1515  KKLNTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSL  1694
             KKLN+GAWAFL PF+  MW VTA  F+ VGIVVWILEHR+NDEFRG PK+Q +TILWFS 
Sbjct  462   KKLNSGAWAFLRPFNRLMWAVTACCFLFVGIVVWILEHRINDEFRGPPKRQCVTILWFSF  521

Query  1695  STLFFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESLKEG  1874
             ST+FFAHRENTVSTLGR+VLIIWLFVVLIINSSYTASLTSILTVQQL SPIKG++SL+E 
Sbjct  522   STMFFAHRENTVSTLGRLVLIIWLFVVLIINSSYTASLTSILTVQQLSSPIKGIDSLREM  581

Query  1875  NDPIGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERPYVE  2054
             +D IGYQ+GSFAE YL +E+ IS+SRL+ LGSPEAYA+AL+ GP KGGV+AIVDERPYVE
Sbjct  582   DDRIGYQVGSFAERYLRDELNISESRLVPLGSPEAYAKALKDGPRKGGVAAIVDERPYVE  641

Query  2055  NFLSTQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLtrts  2234
              FLS+ C +RIVGQEFTKSGWGFAFPRDSPLA+D+STAIL L+ENGDLQRIHDKWL + +
Sbjct  642   LFLSSNCAYRIVGQEFTKSGWGFAFPRDSPLAIDLSTAILELAENGDLQRIHDKWLMKNA  701

Query  2235  cssestelesDRLHLKSFWglfllcgaacflalfIYFVQIM  2357
             C+ E+ ELESDRLHLKSFWGLFL+CG AC LALF+YFVQI+
Sbjct  702   CTLENAELESDRLHLKSFWGLFLICGVACVLALFLYFVQII  742


 Score =   436 bits (1122),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 208/351 (59%), Positives = 271/351 (77%), Gaps = 5/351 (1%)
 Frame = +2

Query  134   ISHVANELQVPLLSFAATDPTLASLQFPYFLRTTQSDMYQMMAIADVIDHYGWKEVIAVF  313
             ISH+ANEL+VPLLSFA TDP ++ LQFPYF+RT+QSD+YQM AIA ++D YGWKEVIAVF
Sbjct  2     ISHMANELRVPLLSFAVTDPVMSPLQFPYFIRTSQSDLYQMEAIASIVDLYGWKEVIAVF  61

Query  314   IDDDYGRNGIAALDDALAAKRCKISYKAGI-PPGATTRAEIMDILVQIALMESRVMVLHA  490
             +DDDYGRNG+AAL+D LA++R +I+YKAG+ P  A  + EIM++L++I L++ R++V+H 
Sbjct  62    VDDDYGRNGVAALNDKLASRRLRITYKAGLHPDNAVNKNEIMNMLIKIMLLQPRIIVIHV  121

Query  491   YPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVLDSSSPLPSEKMEIMQGVLVLRQHTPD  670
             Y   GF VF  A YLGMMG+GYVWI+TDWLST LDSSSPLPSE++E +QG LVLR HTPD
Sbjct  122   YSELGFAVFKEAKYLGMMGNGYVWIATDWLSTTLDSSSPLPSERLESIQGALVLRPHTPD  181

Query  671   SELKRAFTSRWKHLTGGSLGLNSYALYAYDSVWLIAHAIDSFLNKGGVISFSNDSKLQSI  850
             S+LKR F +RW+      L L++Y LYAYDSV L+A A+D +   GG ISFSNDS L ++
Sbjct  182   SKLKREFFARWRKNPDAPLALHTYGLYAYDSVMLLARALDKYFKHGGKISFSNDSMLDAL  241

Query  851   EGS-TLHLEALSIFDGGPLLLNNLLQSDFVGLTGQFKFNNDKSLVLPSYDILNVIGTGFR  1027
               S +L+LEA+++FDGG  LL ++L +  VGLTGQ +F  D+S + P+YDI+NV GTG R
Sbjct  242   GKSGSLNLEAMTVFDGGEALLKDILGTHMVGLTGQLQFTTDRSRIRPAYDIINVAGTGVR  301

Query  1028  TIGFWCNYSGLSTAPPETLYSRPPNSSSANQKLYGVVWPGQSVKKAPGVGF  1180
              IG+W N+SGLS  PPE+L    PN  SA+QKL  V+WPG++ +K  G  F
Sbjct  302   QIGYWSNHSGLSVLPPESLTK--PN-MSASQKLRHVIWPGEAFQKPRGWAF  349



>gb|KGN48998.1| hypothetical protein Csa_6G509670 [Cucumis sativus]
Length=890

 Score =   528 bits (1361),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 283/403 (70%), Positives = 344/403 (85%), Gaps = 0/403 (0%)
 Frame = +3

Query  1158  KKPRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYAVPFQ  1337
             +KPRGW FPN G+ LRIGVP RVSY+EF+SQV GT+ F GF +DVFTAA+N LPYAVP++
Sbjct  415   QKPRGWAFPNTGRYLRIGVPRRVSYQEFVSQVEGTDMFTGFCIDVFTAAINFLPYAVPYK  474

Query  1338  FVPFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPFK  1517
              +PFG+G  NPS +EL+RL++TG +DGAIGDIAI+TNRT++ DFTQPY+ SGL+VVAP K
Sbjct  475   LIPFGDGLTNPSGTELIRLITTGVYDGAIGDIAIITNRTRMADFTQPYIESGLVVVAPVK  534

Query  1518  KLNTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSLS  1697
             KLN+ AWAFL PF+A+MW  TA  F+V+G VVWILEHR+ND+FRG PK+Q+ITILWFS S
Sbjct  535   KLNSSAWAFLRPFTARMWCATAASFIVIGAVVWILEHRINDDFRGPPKKQVITILWFSFS  594

Query  1698  TLFFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESLKEGN  1877
             TLFF+HR+NTVS LGR+VLIIWLFVVLIINSSYTASLTSILTVQQL SP+KG+E+L   N
Sbjct  595   TLFFSHRQNTVSALGRLVLIIWLFVVLIINSSYTASLTSILTVQQLSSPVKGIETLISNN  654

Query  1878  DPIGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERPYVEN  2057
             +PIGYQ GSFA +YLIEE+GI +SRL+ L S E Y +AL  GP   GV+AIVDER YVE 
Sbjct  655   EPIGYQQGSFARNYLIEELGIHESRLVPLISAEHYVKALNDGPTNNGVAAIVDERAYVEL  714

Query  2058  FLSTQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLtrtsc  2237
             FLST+C++ IVGQEFTK+GWGFAFPRDSPLAVDMSTAIL LSE GDLQRIHDKWL +++C
Sbjct  715   FLSTRCEYSIVGQEFTKNGWGFAFPRDSPLAVDMSTAILRLSETGDLQRIHDKWLMKSAC  774

Query  2238  ssestelesDRLHLKSFWglfllcgaacflalfIYFVQIMLKF  2366
             +S+++++E DRL L SFWGLFL+CG AC LAL IY  Q++ ++
Sbjct  775   TSQASKIEVDRLQLNSFWGLFLICGVACVLALSIYLFQMVRQY  817


 Score =   471 bits (1212),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 217/381 (57%), Positives = 301/381 (79%), Gaps = 6/381 (2%)
 Frame = +2

Query  56    LVAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTT  235
             ++ +L+FM+T  +AI+GPQ+SV AH ISH+ANELQVPLLSF+ATDPTL+SLQFP+F+RT+
Sbjct  44    IIESLRFMETKTMAIIGPQNSVTAHVISHIANELQVPLLSFSATDPTLSSLQFPFFIRTS  103

Query  236   QSDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGA  415
             Q+D+YQM A+A+++D++ WKEVIA+F+DDD+GRNGIAAL D L  +RCKIS K  + P A
Sbjct  104   QNDLYQMAAVAEIVDYFQWKEVIAIFVDDDHGRNGIAALGDQLNERRCKISLKVPLKPDA  163

Query  416   TTRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVLD  595
             + R  + D LV++AL ESR++V+H Y   G +V SVA YLG+ G GYVWI+T+WLS +LD
Sbjct  164   S-RDVVTDALVKVALTESRILVIHTYETTGMVVLSVAQYLGLTGPGYVWIATNWLSLLLD  222

Query  596   SSSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLTG-----GSLGLNSYALYAYD  760
             ++SPLP+  ME +QG++ LR +TPDS LKR F SRW + T      GSLGL++Y LYAYD
Sbjct  223   TNSPLPTTSMENIQGLVALRLYTPDSVLKRNFVSRWTNFTDVKSSSGSLGLSTYGLYAYD  282

Query  761   SVWLIAHAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVG  940
             +VW++AHAI++FLN+GG +SFS  SKL  ++  TL+L +++IF+GG  LL+ +L+ +F G
Sbjct  283   TVWILAHAINAFLNEGGNLSFSTLSKLTGVDVRTLNLNSMNIFNGGKTLLDKILEVNFTG  342

Query  941   LTGQFKFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQ  1120
             +TG  +F  ++ L+ P+++++N+IGTG R IG+W NYSGLS  PPETLYS+PPN +S+NQ
Sbjct  343   ITGSVEFTPERDLIHPAFEVINIIGTGERRIGYWSNYSGLSIVPPETLYSKPPNRTSSNQ  402

Query  1121  KLYGVVWPGQSVKKAPGVGFP  1183
             KLY VVWPGQ+ +K  G  FP
Sbjct  403   KLYDVVWPGQATQKPRGWAFP  423



>ref|XP_004134824.1| PREDICTED: glutamate receptor 3.6-like [Cucumis sativus]
Length=932

 Score =   528 bits (1359),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 283/403 (70%), Positives = 344/403 (85%), Gaps = 0/403 (0%)
 Frame = +3

Query  1158  KKPRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYAVPFQ  1337
             +KPRGW FPN G+ LRIGVP RVSY+EF+SQV GT+ F GF +DVFTAA+N LPYAVP++
Sbjct  457   QKPRGWAFPNTGRYLRIGVPRRVSYQEFVSQVEGTDMFTGFCIDVFTAAINFLPYAVPYK  516

Query  1338  FVPFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPFK  1517
              +PFG+G  NPS +EL+RL++TG +DGAIGDIAI+TNRT++ DFTQPY+ SGL+VVAP K
Sbjct  517   LIPFGDGLTNPSGTELIRLITTGVYDGAIGDIAIITNRTRMADFTQPYIESGLVVVAPVK  576

Query  1518  KLNTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSLS  1697
             KLN+ AWAFL PF+A+MW  TA  F+V+G VVWILEHR+ND+FRG PK+Q+ITILWFS S
Sbjct  577   KLNSSAWAFLRPFTARMWCATAASFIVIGAVVWILEHRINDDFRGPPKKQVITILWFSFS  636

Query  1698  TLFFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESLKEGN  1877
             TLFF+HR+NTVS LGR+VLIIWLFVVLIINSSYTASLTSILTVQQL SP+KG+E+L   N
Sbjct  637   TLFFSHRQNTVSALGRLVLIIWLFVVLIINSSYTASLTSILTVQQLSSPVKGIETLISNN  696

Query  1878  DPIGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERPYVEN  2057
             +PIGYQ GSFA +YLIEE+GI +SRL+ L S E Y +AL  GP   GV+AIVDER YVE 
Sbjct  697   EPIGYQQGSFARNYLIEELGIHESRLVPLISAEHYVKALNDGPTNNGVAAIVDERAYVEL  756

Query  2058  FLSTQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLtrtsc  2237
             FLST+C++ IVGQEFTK+GWGFAFPRDSPLAVDMSTAIL LSE GDLQRIHDKWL +++C
Sbjct  757   FLSTRCEYSIVGQEFTKNGWGFAFPRDSPLAVDMSTAILRLSETGDLQRIHDKWLMKSAC  816

Query  2238  ssestelesDRLHLKSFWglfllcgaacflalfIYFVQIMLKF  2366
             +S+++++E DRL L SFWGLFL+CG AC LAL IY  Q++ ++
Sbjct  817   TSQASKIEVDRLQLNSFWGLFLICGVACVLALSIYLFQMVRQY  859


 Score =   471 bits (1211),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 217/381 (57%), Positives = 301/381 (79%), Gaps = 6/381 (2%)
 Frame = +2

Query  56    LVAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTT  235
             ++ +L+FM+T  +AI+GPQ+SV AH ISH+ANELQVPLLSF+ATDPTL+SLQFP+F+RT+
Sbjct  86    IIESLRFMETKTMAIIGPQNSVTAHVISHIANELQVPLLSFSATDPTLSSLQFPFFIRTS  145

Query  236   QSDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGA  415
             Q+D+YQM A+A+++D++ WKEVIA+F+DDD+GRNGIAAL D L  +RCKIS K  + P A
Sbjct  146   QNDLYQMAAVAEIVDYFQWKEVIAIFVDDDHGRNGIAALGDQLNERRCKISLKVPLKPDA  205

Query  416   TTRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVLD  595
             + R  + D LV++AL ESR++V+H Y   G +V SVA YLG+ G GYVWI+T+WLS +LD
Sbjct  206   S-RDVVTDALVKVALTESRILVIHTYETTGMVVLSVAQYLGLTGPGYVWIATNWLSLLLD  264

Query  596   SSSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLTG-----GSLGLNSYALYAYD  760
             ++SPLP+  ME +QG++ LR +TPDS LKR F SRW + T      GSLGL++Y LYAYD
Sbjct  265   TNSPLPTTSMENIQGLVALRLYTPDSVLKRNFVSRWTNFTDVKSSSGSLGLSTYGLYAYD  324

Query  761   SVWLIAHAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVG  940
             +VW++AHAI++FLN+GG +SFS  SKL  ++  TL+L +++IF+GG  LL+ +L+ +F G
Sbjct  325   TVWILAHAINAFLNEGGNLSFSTLSKLTGVDVRTLNLNSMNIFNGGKTLLDKILEVNFTG  384

Query  941   LTGQFKFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQ  1120
             +TG  +F  ++ L+ P+++++N+IGTG R IG+W NYSGLS  PPETLYS+PPN +S+NQ
Sbjct  385   ITGSVEFTPERDLIHPAFEVINIIGTGERRIGYWSNYSGLSIVPPETLYSKPPNRTSSNQ  444

Query  1121  KLYGVVWPGQSVKKAPGVGFP  1183
             KLY VVWPGQ+ +K  G  FP
Sbjct  445   KLYDVVWPGQATQKPRGWAFP  465



>ref|XP_004158839.1| PREDICTED: glutamate receptor 3.6-like [Cucumis sativus]
Length=943

 Score =   527 bits (1357),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 282/403 (70%), Positives = 343/403 (85%), Gaps = 0/403 (0%)
 Frame = +3

Query  1158  KKPRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYAVPFQ  1337
             +KPRGW FPN G+ LRIGVP RVSY+EF+SQV GT+ F GF +DVFTAA+N LPYAVP++
Sbjct  457   QKPRGWAFPNTGRYLRIGVPRRVSYQEFVSQVEGTDMFTGFCIDVFTAAINFLPYAVPYK  516

Query  1338  FVPFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPFK  1517
              +PFG+G  NPS +EL+RL++TG +DGAIGDIAI+TNRT++ DFTQPY+ SGL+VVAP K
Sbjct  517   LIPFGDGLTNPSGTELIRLITTGVYDGAIGDIAIITNRTRMADFTQPYIESGLVVVAPVK  576

Query  1518  KLNTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSLS  1697
             KLN+ AWAFL PF+A+MW  TA  F+V+G VVWILEHR+ND+FRG PK+Q+ITILWF  S
Sbjct  577   KLNSSAWAFLRPFTARMWCATAASFIVIGAVVWILEHRINDDFRGPPKKQVITILWFGFS  636

Query  1698  TLFFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESLKEGN  1877
             TLFF+HR+NTVS LGR+VLIIWLFVVLIINSSYTASLTSILTVQQL SP+KG+E+L   N
Sbjct  637   TLFFSHRQNTVSALGRLVLIIWLFVVLIINSSYTASLTSILTVQQLSSPVKGIETLISNN  696

Query  1878  DPIGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERPYVEN  2057
             +PIGYQ GSFA +YLIEE+GI +SRL+ L S E Y +AL  GP   GV+AIVDER YVE 
Sbjct  697   EPIGYQQGSFARNYLIEELGIHESRLVPLISAEHYVKALNDGPTNNGVAAIVDERAYVEL  756

Query  2058  FLSTQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLtrtsc  2237
             FLST+C++ IVGQEFTK+GWGFAFPRDSPLAVDMSTAIL LSE GDLQRIHDKWL +++C
Sbjct  757   FLSTRCEYSIVGQEFTKNGWGFAFPRDSPLAVDMSTAILRLSETGDLQRIHDKWLMKSAC  816

Query  2238  ssestelesDRLHLKSFWglfllcgaacflalfIYFVQIMLKF  2366
             +S+++++E DRL L SFWGLFL+CG AC LAL IY  Q++ ++
Sbjct  817   TSQASKIEVDRLQLNSFWGLFLICGVACVLALSIYLFQMVRQY  859


 Score =   471 bits (1213),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 217/381 (57%), Positives = 301/381 (79%), Gaps = 6/381 (2%)
 Frame = +2

Query  56    LVAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTT  235
             ++ +L+FM+T  +AI+GPQ+SV AH ISH+ANELQVPLLSF+ATDPTL+SLQFP+F+RT+
Sbjct  86    IIESLRFMETKTMAIIGPQNSVTAHVISHIANELQVPLLSFSATDPTLSSLQFPFFIRTS  145

Query  236   QSDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGA  415
             Q+D+YQM A+A+++D++ WKEVIA+F+DDD+GRNGIAAL D L  +RCKIS K  + P A
Sbjct  146   QNDLYQMAAVAEIVDYFQWKEVIAIFVDDDHGRNGIAALGDQLNERRCKISLKVPLKPDA  205

Query  416   TTRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVLD  595
             + R  + D LV++AL ESR++V+H Y   G +V SVA YLG+ G GYVWI+T+WLS +LD
Sbjct  206   S-RDVVTDALVKVALTESRILVIHTYETTGMVVLSVAQYLGLTGPGYVWIATNWLSLLLD  264

Query  596   SSSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLTG-----GSLGLNSYALYAYD  760
             ++SPLP+  ME +QG++ LR +TPDS LKR F SRW + T      GSLGL++Y LYAYD
Sbjct  265   TNSPLPTTSMENIQGLVALRLYTPDSVLKRNFVSRWTNFTDVKSSSGSLGLSTYGLYAYD  324

Query  761   SVWLIAHAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVG  940
             +VW++AHAI++FLN+GG +SFS  SKL  ++  TL+L +++IF+GG  LL+ +L+ +F G
Sbjct  325   TVWILAHAINAFLNEGGNLSFSTLSKLTGVDVRTLNLNSMNIFNGGKTLLDKILEVNFTG  384

Query  941   LTGQFKFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQ  1120
             +TG  +F  ++ L+ P+++++N+IGTG R IG+W NYSGLS  PPETLYS+PPN +S+NQ
Sbjct  385   ITGSVEFTPERDLIHPAFEVINIIGTGERRIGYWSNYSGLSIVPPETLYSKPPNRTSSNQ  444

Query  1121  KLYGVVWPGQSVKKAPGVGFP  1183
             KLY VVWPGQ+ +K  G  FP
Sbjct  445   KLYDVVWPGQATQKPRGWAFP  465



>ref|XP_010316485.1| PREDICTED: glutamate receptor 3.6 isoform X3 [Solanum lycopersicum]
Length=937

 Score =   502 bits (1293),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 271/403 (67%), Positives = 341/403 (85%), Gaps = 0/403 (0%)
 Frame = +3

Query  1158  KKPRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYAVPFQ  1337
             +KPRGWVFPNNG+QL+IGVP R S++EF+ +VPG ++F+G+ ++VFT A++LLPYA+P++
Sbjct  457   EKPRGWVFPNNGRQLKIGVPNRASFREFVGKVPGVDSFRGYCIEVFTTAIDLLPYALPYK  516

Query  1338  FVPFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPFK  1517
              V FG+G  NP  +EL+RL++ G +D AIGDIAI TNRTK+VDFTQPY+ SGL+VVAP K
Sbjct  517   LVAFGDGHNNPDDTELIRLITAGVYDAAIGDIAITTNRTKMVDFTQPYIESGLVVVAPVK  576

Query  1518  KLNTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSLS  1697
             + N+ AWAFL+PF+ +MW VT  FF++VG V+WILEHR+NDEFRG P +Q++T+LWFS S
Sbjct  577   EQNSNAWAFLSPFTPKMWCVTGVFFLIVGTVIWILEHRLNDEFRGPPSKQIVTVLWFSFS  636

Query  1698  TLFFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESLKEGN  1877
             TLF A RENTVST GR+VL+IWLFVVLIINSSYTASLTSILTVQ+L SPI G+ESL    
Sbjct  637   TLFTAQRENTVSTFGRIVLLIWLFVVLIINSSYTASLTSILTVQKLSSPITGIESLVNTK  696

Query  1878  DPIGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERPYVEN  2057
             +PIGYQ GSFA +YLI+E+ I +SRL+ L  PE YA+AL+ GP +GGV+A+VDER Y+E 
Sbjct  697   EPIGYQWGSFARNYLIQELRIDESRLVPLNLPEDYAKALKDGPSRGGVAAVVDERAYMEL  756

Query  2058  FLSTQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLtrtsc  2237
             FLS++C+F I+GQEFTK+GWGFAFPRDSPLAVDMSTAIL LSENG+LQRIHDKWL+  +C
Sbjct  757   FLSSRCQFSILGQEFTKNGWGFAFPRDSPLAVDMSTAILKLSENGELQRIHDKWLSGIAC  816

Query  2238  ssestelesDRLHLKSFWglfllcgaacflalfIYFVQIMLKF  2366
             +S+ST+LE DRL LKSF GLF LCG ACFLAL IYFV +  ++
Sbjct  817   TSQSTKLEVDRLQLKSFSGLFFLCGLACFLALLIYFVMLACQY  859


 Score =   483 bits (1243),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 215/381 (56%), Positives = 298/381 (78%), Gaps = 6/381 (2%)
 Frame = +2

Query  56    LVAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTT  235
             +V A++FM+TD +AI+GPQSSV+AH +S++ANELQVPLLSFAATDP+L+SLQ+P+F+RT+
Sbjct  86    IVEAIRFMETDTMAIVGPQSSVIAHVVSNIANELQVPLLSFAATDPSLSSLQYPFFVRTS  145

Query  236   QSDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGA  415
              SD YQM AIA+++++Y W+EVIA++IDDD+GRNGIAAL D LA +RC ISYKA + PGA
Sbjct  146   PSDKYQMEAIAEMVEYYEWREVIAIYIDDDFGRNGIAALADQLAKRRCSISYKAAMRPGA  205

Query  416   TTRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVLD  595
             T   +  D LVQ+AL ESR+MV+H YP  G  +FS+A YLGM+  GYVWI+T+WLST+LD
Sbjct  206   TL-DDARDALVQVALRESRIMVVHTYPTKGLEIFSMARYLGMIDKGYVWIATNWLSTILD  264

Query  596   SSSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLT-----GGSLGLNSYALYAYD  760
             + SPLPS++ E ++G + LR HTP SELK+ F SRW +LT      GS  +++YALYAYD
Sbjct  265   AGSPLPSDEKENLEGAITLRIHTPGSELKQKFVSRWSNLTRKAGLAGSSRMSTYALYAYD  324

Query  761   SVWLIAHAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVG  940
             +VWL+A AI+ F N+GG +SFS D +L  +   +++L+++SIF+GG LL +N+ + +  G
Sbjct  325   TVWLLARAINEFFNQGGKVSFSKDPRLTELNSGSMNLDSMSIFNGGKLLRDNIFKVNMTG  384

Query  941   LTGQFKFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQ  1120
             +TG F F ++K L  P+++++NV+GTGFR +G+W  YSGLS  PPETLYS+PPN SS+NQ
Sbjct  385   VTGPFSFTSEKELFRPTFEVINVVGTGFRKVGYWSEYSGLSIVPPETLYSKPPNRSSSNQ  444

Query  1121  KLYGVVWPGQSVKKAPGVGFP  1183
             +L  ++WPGQ  +K  G  FP
Sbjct  445   QLQSIIWPGQITEKPRGWVFP  465



>ref|XP_010316484.1| PREDICTED: glutamate receptor 3.6 isoform X2 [Solanum lycopersicum]
Length=951

 Score =   502 bits (1292),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 271/403 (67%), Positives = 341/403 (85%), Gaps = 0/403 (0%)
 Frame = +3

Query  1158  KKPRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYAVPFQ  1337
             +KPRGWVFPNNG+QL+IGVP R S++EF+ +VPG ++F+G+ ++VFT A++LLPYA+P++
Sbjct  471   EKPRGWVFPNNGRQLKIGVPNRASFREFVGKVPGVDSFRGYCIEVFTTAIDLLPYALPYK  530

Query  1338  FVPFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPFK  1517
              V FG+G  NP  +EL+RL++ G +D AIGDIAI TNRTK+VDFTQPY+ SGL+VVAP K
Sbjct  531   LVAFGDGHNNPDDTELIRLITAGVYDAAIGDIAITTNRTKMVDFTQPYIESGLVVVAPVK  590

Query  1518  KLNTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSLS  1697
             + N+ AWAFL+PF+ +MW VT  FF++VG V+WILEHR+NDEFRG P +Q++T+LWFS S
Sbjct  591   EQNSNAWAFLSPFTPKMWCVTGVFFLIVGTVIWILEHRLNDEFRGPPSKQIVTVLWFSFS  650

Query  1698  TLFFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESLKEGN  1877
             TLF A RENTVST GR+VL+IWLFVVLIINSSYTASLTSILTVQ+L SPI G+ESL    
Sbjct  651   TLFTAQRENTVSTFGRIVLLIWLFVVLIINSSYTASLTSILTVQKLSSPITGIESLVNTK  710

Query  1878  DPIGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERPYVEN  2057
             +PIGYQ GSFA +YLI+E+ I +SRL+ L  PE YA+AL+ GP +GGV+A+VDER Y+E 
Sbjct  711   EPIGYQWGSFARNYLIQELRIDESRLVPLNLPEDYAKALKDGPSRGGVAAVVDERAYMEL  770

Query  2058  FLSTQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLtrtsc  2237
             FLS++C+F I+GQEFTK+GWGFAFPRDSPLAVDMSTAIL LSENG+LQRIHDKWL+  +C
Sbjct  771   FLSSRCQFSILGQEFTKNGWGFAFPRDSPLAVDMSTAILKLSENGELQRIHDKWLSGIAC  830

Query  2238  ssestelesDRLHLKSFWglfllcgaacflalfIYFVQIMLKF  2366
             +S+ST+LE DRL LKSF GLF LCG ACFLAL IYFV +  ++
Sbjct  831   TSQSTKLEVDRLQLKSFSGLFFLCGLACFLALLIYFVMLACQY  873


 Score =   483 bits (1243),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 215/381 (56%), Positives = 298/381 (78%), Gaps = 6/381 (2%)
 Frame = +2

Query  56    LVAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTT  235
             +V A++FM+TD +AI+GPQSSV+AH +S++ANELQVPLLSFAATDP+L+SLQ+P+F+RT+
Sbjct  100   IVEAIRFMETDTMAIVGPQSSVIAHVVSNIANELQVPLLSFAATDPSLSSLQYPFFVRTS  159

Query  236   QSDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGA  415
              SD YQM AIA+++++Y W+EVIA++IDDD+GRNGIAAL D LA +RC ISYKA + PGA
Sbjct  160   PSDKYQMEAIAEMVEYYEWREVIAIYIDDDFGRNGIAALADQLAKRRCSISYKAAMRPGA  219

Query  416   TTRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVLD  595
             T   +  D LVQ+AL ESR+MV+H YP  G  +FS+A YLGM+  GYVWI+T+WLST+LD
Sbjct  220   TL-DDARDALVQVALRESRIMVVHTYPTKGLEIFSMARYLGMIDKGYVWIATNWLSTILD  278

Query  596   SSSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLT-----GGSLGLNSYALYAYD  760
             + SPLPS++ E ++G + LR HTP SELK+ F SRW +LT      GS  +++YALYAYD
Sbjct  279   AGSPLPSDEKENLEGAITLRIHTPGSELKQKFVSRWSNLTRKAGLAGSSRMSTYALYAYD  338

Query  761   SVWLIAHAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVG  940
             +VWL+A AI+ F N+GG +SFS D +L  +   +++L+++SIF+GG LL +N+ + +  G
Sbjct  339   TVWLLARAINEFFNQGGKVSFSKDPRLTELNSGSMNLDSMSIFNGGKLLRDNIFKVNMTG  398

Query  941   LTGQFKFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQ  1120
             +TG F F ++K L  P+++++NV+GTGFR +G+W  YSGLS  PPETLYS+PPN SS+NQ
Sbjct  399   VTGPFSFTSEKELFRPTFEVINVVGTGFRKVGYWSEYSGLSIVPPETLYSKPPNRSSSNQ  458

Query  1121  KLYGVVWPGQSVKKAPGVGFP  1183
             +L  ++WPGQ  +K  G  FP
Sbjct  459   QLQSIIWPGQITEKPRGWVFP  479



>ref|XP_004232576.1| PREDICTED: glutamate receptor 3.6 isoform X1 [Solanum lycopersicum]
 dbj|BAL15058.1| glutamate receptor 3.5 [Solanum lycopersicum]
Length=958

 Score =   501 bits (1291),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 271/403 (67%), Positives = 341/403 (85%), Gaps = 0/403 (0%)
 Frame = +3

Query  1158  KKPRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYAVPFQ  1337
             +KPRGWVFPNNG+QL+IGVP R S++EF+ +VPG ++F+G+ ++VFT A++LLPYA+P++
Sbjct  478   EKPRGWVFPNNGRQLKIGVPNRASFREFVGKVPGVDSFRGYCIEVFTTAIDLLPYALPYK  537

Query  1338  FVPFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPFK  1517
              V FG+G  NP  +EL+RL++ G +D AIGDIAI TNRTK+VDFTQPY+ SGL+VVAP K
Sbjct  538   LVAFGDGHNNPDDTELIRLITAGVYDAAIGDIAITTNRTKMVDFTQPYIESGLVVVAPVK  597

Query  1518  KLNTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSLS  1697
             + N+ AWAFL+PF+ +MW VT  FF++VG V+WILEHR+NDEFRG P +Q++T+LWFS S
Sbjct  598   EQNSNAWAFLSPFTPKMWCVTGVFFLIVGTVIWILEHRLNDEFRGPPSKQIVTVLWFSFS  657

Query  1698  TLFFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESLKEGN  1877
             TLF A RENTVST GR+VL+IWLFVVLIINSSYTASLTSILTVQ+L SPI G+ESL    
Sbjct  658   TLFTAQRENTVSTFGRIVLLIWLFVVLIINSSYTASLTSILTVQKLSSPITGIESLVNTK  717

Query  1878  DPIGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERPYVEN  2057
             +PIGYQ GSFA +YLI+E+ I +SRL+ L  PE YA+AL+ GP +GGV+A+VDER Y+E 
Sbjct  718   EPIGYQWGSFARNYLIQELRIDESRLVPLNLPEDYAKALKDGPSRGGVAAVVDERAYMEL  777

Query  2058  FLSTQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLtrtsc  2237
             FLS++C+F I+GQEFTK+GWGFAFPRDSPLAVDMSTAIL LSENG+LQRIHDKWL+  +C
Sbjct  778   FLSSRCQFSILGQEFTKNGWGFAFPRDSPLAVDMSTAILKLSENGELQRIHDKWLSGIAC  837

Query  2238  ssestelesDRLHLKSFWglfllcgaacflalfIYFVQIMLKF  2366
             +S+ST+LE DRL LKSF GLF LCG ACFLAL IYFV +  ++
Sbjct  838   TSQSTKLEVDRLQLKSFSGLFFLCGLACFLALLIYFVMLACQY  880


 Score =   483 bits (1243),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 215/381 (56%), Positives = 298/381 (78%), Gaps = 6/381 (2%)
 Frame = +2

Query  56    LVAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTT  235
             +V A++FM+TD +AI+GPQSSV+AH +S++ANELQVPLLSFAATDP+L+SLQ+P+F+RT+
Sbjct  107   IVEAIRFMETDTMAIVGPQSSVIAHVVSNIANELQVPLLSFAATDPSLSSLQYPFFVRTS  166

Query  236   QSDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGA  415
              SD YQM AIA+++++Y W+EVIA++IDDD+GRNGIAAL D LA +RC ISYKA + PGA
Sbjct  167   PSDKYQMEAIAEMVEYYEWREVIAIYIDDDFGRNGIAALADQLAKRRCSISYKAAMRPGA  226

Query  416   TTRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVLD  595
             T   +  D LVQ+AL ESR+MV+H YP  G  +FS+A YLGM+  GYVWI+T+WLST+LD
Sbjct  227   TL-DDARDALVQVALRESRIMVVHTYPTKGLEIFSMARYLGMIDKGYVWIATNWLSTILD  285

Query  596   SSSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLT-----GGSLGLNSYALYAYD  760
             + SPLPS++ E ++G + LR HTP SELK+ F SRW +LT      GS  +++YALYAYD
Sbjct  286   AGSPLPSDEKENLEGAITLRIHTPGSELKQKFVSRWSNLTRKAGLAGSSRMSTYALYAYD  345

Query  761   SVWLIAHAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVG  940
             +VWL+A AI+ F N+GG +SFS D +L  +   +++L+++SIF+GG LL +N+ + +  G
Sbjct  346   TVWLLARAINEFFNQGGKVSFSKDPRLTELNSGSMNLDSMSIFNGGKLLRDNIFKVNMTG  405

Query  941   LTGQFKFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQ  1120
             +TG F F ++K L  P+++++NV+GTGFR +G+W  YSGLS  PPETLYS+PPN SS+NQ
Sbjct  406   VTGPFSFTSEKELFRPTFEVINVVGTGFRKVGYWSEYSGLSIVPPETLYSKPPNRSSSNQ  465

Query  1121  KLYGVVWPGQSVKKAPGVGFP  1183
             +L  ++WPGQ  +K  G  FP
Sbjct  466   QLQSIIWPGQITEKPRGWVFP  486



>ref|XP_007046473.1| Glutamate receptor 3.6 [Theobroma cacao]
 gb|EOX90630.1| Glutamate receptor 3.6 [Theobroma cacao]
Length=939

 Score =   503 bits (1295),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 278/405 (69%), Positives = 341/405 (84%), Gaps = 1/405 (0%)
 Frame = +3

Query  1158  KKPRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYAVPFQ  1337
             +KPRGWVFPN+G++L +GVP RVSY+EF+S V G +   G+ VDVFTAA+NLLPYAVP++
Sbjct  459   QKPRGWVFPNSGRRLNVGVPHRVSYREFVS-VRGPDAITGYCVDVFTAALNLLPYAVPYK  517

Query  1338  FVPFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPFK  1517
              +PFG+GR +PS +ELV L++ G FD AIGDIAI+TNRT + DFTQPY+ SGL+VVAP +
Sbjct  518   LIPFGDGRTSPSGTELVSLITAGVFDAAIGDIAIITNRTNMADFTQPYIESGLVVVAPVR  577

Query  1518  KLNTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSLS  1697
             + N+ A +FL PF+ +MW VTA FF+VVG VVW LEHRMNDEFRG P++Q++TILWFS S
Sbjct  578   RKNSDALSFLRPFTRRMWAVTAIFFLVVGTVVWFLEHRMNDEFRGPPRRQVVTILWFSFS  637

Query  1698  TLFFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESLKEGN  1877
             T FFAHRE TVS LGR++L+IWLFVVLIINSSYTASLTSILTVQQL SPIKG+E+L    
Sbjct  638   TWFFAHRETTVSALGRIILVIWLFVVLIINSSYTASLTSILTVQQLTSPIKGIETLVLSK  697

Query  1878  DPIGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERPYVEN  2057
             DPIGYQ GSFA +YLI+E+ I +SRL+ L SPE  A+ALE GPHKGGV+A+VD+R Y+E 
Sbjct  698   DPIGYQQGSFARNYLIDELKIDESRLVPLNSPEESAKALEDGPHKGGVAAMVDDRAYIEL  757

Query  2058  FLSTQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLtrtsc  2237
             FLST+C+F IVGQEFTK+GWGFAFPRDSPLA+DMSTAIL LSENGDLQRIHDKWL R +C
Sbjct  758   FLSTRCEFSIVGQEFTKNGWGFAFPRDSPLAMDMSTAILRLSENGDLQRIHDKWLLRRAC  817

Query  2238  ssestelesDRLHLKSFWglfllcgaacflalfIYFVQIMLKFRR  2372
             S +  ++E D L LKSFWGLFL+CG ACF+AL IYF++++ +F R
Sbjct  818   SYQGAKMEVDELQLKSFWGLFLICGLACFIALLIYFLKMVRQFSR  862


 Score =   478 bits (1229),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 218/377 (58%), Positives = 297/377 (79%), Gaps = 2/377 (1%)
 Frame = +2

Query  56    LVAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTT  235
             +V AL FM+ D VAI+GPQSSV AH ISH+AN L+VPLLSF++TDPTL+ +QFP+F+RT 
Sbjct  92    MVEALLFMERDTVAIIGPQSSVTAHVISHIANALRVPLLSFSSTDPTLSPIQFPFFVRTA  151

Query  236   QSDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGA  415
             Q+D+YQM AIA++IDH+ W+E IA++ DDD+GRNGIAAL D LA +RC+ISYKA + P  
Sbjct  152   QNDLYQMAAIAEIIDHFEWREAIAIYEDDDHGRNGIAALGDKLAERRCRISYKARLSPDP  211

Query  416   TTRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVLD  595
               + EI D+LV++AL ESR++V+H   + G  +FSVA YLGM+G GYVWI+T WLSTVLD
Sbjct  212   K-QDEIADVLVKVALRESRILVVHVPGSWGLKLFSVAQYLGMLGTGYVWIATTWLSTVLD  270

Query  596   SSSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLTGGS-LGLNSYALYAYDSVWL  772
             ++SPL  + M+ +QGV+ LR +TPDSELKR F SRW +LT G+ +GLN+Y+LYAYD+VWL
Sbjct  271   ANSPLSQDAMDDIQGVVTLRMYTPDSELKRRFVSRWSNLTSGNPVGLNAYSLYAYDTVWL  330

Query  773   IAHAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLTGQ  952
             +AHAI+ F N+GG ISF  +S+   + G  LHL+AL +F GG LLL+N+L++D  G+TG 
Sbjct  331   LAHAINEFFNQGGNISFLYNSRSPELRGGNLHLDALGVFQGGNLLLDNILKTDMKGVTGT  390

Query  953   FKFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKLYG  1132
              +F +D++L+ P+Y+++NVIG G R IG+W N+SGLS  PPETL+++PPN S  ++ L+G
Sbjct  391   VRFTSDRNLIHPAYEVINVIGNGHRRIGYWSNHSGLSIVPPETLWAKPPNGSRPSKTLHG  450

Query  1133  VVWPGQSVKKAPGVGFP  1183
             VVWPGQ+ +K  G  FP
Sbjct  451   VVWPGQTTQKPRGWVFP  467



>ref|XP_006587552.1| PREDICTED: glutamate receptor 3.6-like isoform X2 [Glycine max]
Length=845

 Score =   522 bits (1345),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 281/404 (70%), Positives = 340/404 (84%), Gaps = 0/404 (0%)
 Frame = +3

Query  1161  KPRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYAVPFQF  1340
             +PRGWVFPNNG+ L+IGVP RVSY+EF+SQV GT+ FKGF +DVF +AVNLLPYAVP++F
Sbjct  366   RPRGWVFPNNGRMLKIGVPKRVSYREFVSQVQGTDMFKGFCIDVFLSAVNLLPYAVPYKF  425

Query  1341  VPFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPFKK  1520
             V +G+G  NPS +ELVRL++ G FD A+GDI I T RTK+VDFTQPY+ SGL+VVA  KK
Sbjct  426   VSYGDGDSNPSNTELVRLITAGVFDAAVGDITITTERTKMVDFTQPYIESGLVVVASVKK  485

Query  1521  LNTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSLST  1700
              ++ AWAFLTPF+  MW VTA FF++VG VVWILEHR+ND+FRG PKQQ++TILWFS ST
Sbjct  486   TDSNAWAFLTPFTPMMWTVTAVFFLLVGAVVWILEHRLNDDFRGPPKQQMVTILWFSFST  545

Query  1701  LFFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESLKEGND  1880
             +FFAHRENTVSTLGR VL+IWLFVVLIINSSYTASLTSILTVQQL SP+KG+ESL    +
Sbjct  546   MFFAHRENTVSTLGRFVLLIWLFVVLIINSSYTASLTSILTVQQLSSPVKGIESLISSKE  605

Query  1881  PIGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERPYVENF  2060
             PIGY  GSF   YLI+EIGI +SRL+ L +PE   EAL+KGP KGGV+A VDER Y+E F
Sbjct  606   PIGYLQGSFTRTYLIDEIGIDESRLVPLKTPEETTEALKKGPQKGGVAAYVDERAYIELF  665

Query  2061  LSTQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLtrtscs  2240
             LS++C + IVGQEFT++GWGFAFPRDSPLAVD+STAIL L+ENGDLQRIHDKWL  ++C 
Sbjct  666   LSSRCDYSIVGQEFTRNGWGFAFPRDSPLAVDLSTAILELAENGDLQRIHDKWLLSSACL  725

Query  2241  sestelesDRLHLKSFWglfllcgaacflalfIYFVQIMLKFRR  2372
             S+  +LE DRL+L+SFWGL+L+CG AC LAL IYF+Q M ++ +
Sbjct  726   SQGAKLEVDRLNLRSFWGLYLVCGLACVLALLIYFIQTMRQYSK  769


 Score =   443 bits (1140),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 213/374 (57%), Positives = 278/374 (74%), Gaps = 6/374 (2%)
 Frame = +2

Query  77    MQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTTQSDMYQM  256
             M T  VAI+GPQ+S  AH ISH+ANELQVPLLSF ATDPTL+SLQFP+F+RT  SD+Y+M
Sbjct  1     MATQTVAIIGPQTSTTAHVISHIANELQVPLLSFTATDPTLSSLQFPFFIRTAFSDIYEM  60

Query  257   MAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGATTRAEIM  436
              AIAD ++++GW+EVIAV+ DDD+GRNGI AL D LA +RCKIS+KA + P  TTR EI 
Sbjct  61    TAIADFVNYFGWREVIAVYGDDDHGRNGIGALGDKLAERRCKISFKAPMTP-ETTREEIT  119

Query  437   DILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVLDSSSPLPS  616
             D+LVQ+AL ESRV+VLH   A G  V SVA  LGMM +GYVWI+T +LST LD  SPL S
Sbjct  120   DVLVQVALAESRVIVLHTSTAWGPKVLSVAKSLGMMENGYVWITTTFLSTWLDIGSPLSS  179

Query  617   EKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLT-----GGSLGLNSYALYAYDSVWLIAH  781
             +  + MQGV+ LR + PDSE KR F SRWK+LT      GS GL++Y ++AYD+V+ +AH
Sbjct  180   DATDDMQGVITLRMYIPDSERKRWFFSRWKNLTTGKTANGSQGLSTYGIFAYDTVYALAH  239

Query  782   AIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLTGQFKF  961
             A+D+F  +G  I+FS D KL  + G  +HL+A+ IF+ G LL   + + +  G++G FK+
Sbjct  240   ALDAFFKQGNQITFSRDPKLSQLRGDNMHLDAVKIFNEGKLLRKYIYEVNMTGVSGLFKY  299

Query  962   NNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKLYGVVW  1141
              +D +LV P+Y+I+NVIGTG R +G+W NY+GLS  PPE LYS+PPN SSA+QKL  V+W
Sbjct  300   TSDGNLVNPAYEIINVIGTGTRRVGYWSNYTGLSIVPPEALYSKPPNRSSASQKLLPVLW  359

Query  1142  PGQSVKKAPGVGFP  1183
             PG++  +  G  FP
Sbjct  360   PGETTHRPRGWVFP  373



>gb|KDP43780.1| hypothetical protein JCGZ_22407 [Jatropha curcas]
Length=919

 Score =   482 bits (1241),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 228/376 (61%), Positives = 289/376 (77%), Gaps = 6/376 (2%)
 Frame = +2

Query  59    VAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTTQ  238
             + AL  + ++VVAILGPQ S  AH ISH+A+ELQVPLLSFAATDPTL+SLQ+P+F+RTTQ
Sbjct  76    LEALSLIGSEVVAILGPQFSTTAHVISHIADELQVPLLSFAATDPTLSSLQYPFFVRTTQ  135

Query  239   SDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGAT  418
             SD++QM AIAD+ID+YGW+ V+A+++DDDYGRNGIAAL D L  KRCKISYKA + P   
Sbjct  136   SDIFQMAAIADIIDYYGWRTVVAIYVDDDYGRNGIAALGDKLTEKRCKISYKAPLSPKGK  195

Query  419   TRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVLDS  598
                EI D+LV++ALMESR++VL AY   G  V  VA  LGMM  GYVWI TDWLST++D+
Sbjct  196   RSNEITDVLVKVALMESRIIVLLAYSDWGQQVLRVARNLGMMEAGYVWIVTDWLSTIIDT  255

Query  599   SSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLT-----GGSLGLNSYALYAYDS  763
              SPLPS+ M+ +QGVL LR HTPDSELK+ FTSRW +LT     G +  LN+Y LYAYD+
Sbjct  256   YSPLPSQNMDDIQGVLTLRMHTPDSELKKKFTSRWSNLTTGKEAGATFRLNTYGLYAYDT  315

Query  764   VWLIAHAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGL  943
             VWL+A+AI +F N+GG ISFS D +L  ++   L  +AL IFDGG LLL ++LQ +F GL
Sbjct  316   VWLLAYAISAFFNQGGNISFSYDPRLSKLQRDNLQADALKIFDGGNLLLQSILQVNFTGL  375

Query  944   TGQFKFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQK  1123
             TG  KF +D+ L+ PSY+++NVIGTGFR IG+W NYSGLS  PPE  Y+  PN+ S++Q+
Sbjct  376   TGSIKF-SDRHLIHPSYEVINVIGTGFRRIGYWSNYSGLSRDPPEKFYTMSPNNLSSSQQ  434

Query  1124  LYGVVWPGQSVKKAPG  1171
             LY V+WPGQ+V K  G
Sbjct  435   LYSVIWPGQTVSKPRG  450


 Score =   482 bits (1241),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 252/377 (67%), Positives = 309/377 (82%), Gaps = 1/377 (0%)
 Frame = +3

Query  1161  KPRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYAVPFQF  1340
             KPRGWVF NNG+ LRIGVP RV Y EF+S V G N F+G+ +DVFTAA  +LPYA+PF+F
Sbjct  447   KPRGWVFANNGRHLRIGVPNRVFYHEFVS-VNGANGFRGYCIDVFTAATGMLPYALPFEF  505

Query  1341  VPFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPFKK  1520
             + FG+G  NP+ +EL+RLVSTG FD A+GDI+I T RT++VDFTQPY+ SGL+VVAP +K
Sbjct  506   IAFGDGHTNPNTTELLRLVSTGVFDVAVGDISITTERTRMVDFTQPYIESGLVVVAPVRK  565

Query  1521  LNTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSLST  1700
             LN+ AWAFL PF+  MW VTA FF++ G+VVWILEHR+ND+FRG+ K+Q++TILWFS ST
Sbjct  566   LNSSAWAFLRPFTPMMWLVTAVFFLITGVVVWILEHRVNDDFRGTRKKQIVTILWFSFST  625

Query  1701  LFFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESLKEGND  1880
             LFF+H+E   STLGR V+IIWLFVVLI+NSSY ASLTSILTV+QL SPIKG+ESL   N+
Sbjct  626   LFFSHKETIRSTLGRFVVIIWLFVVLILNSSYMASLTSILTVEQLSSPIKGIESLVSSNE  685

Query  1881  PIGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERPYVENF  2060
              IGYQ GSFA HYL+ E  IS+SRL+ L S E    AL+ GP KGGV+A+VDER Y+E F
Sbjct  686   RIGYQRGSFAGHYLVNEYQISRSRLVPLNSAEDCVRALKDGPQKGGVAAVVDERAYIELF  745

Query  2061  LSTQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLtrtscs  2240
             LS+QC+F IVGQEF+K+GWGFAFPRDSPLA+DMS AIL LSE GDLQR+HDKWL  ++C 
Sbjct  746   LSSQCEFSIVGQEFSKNGWGFAFPRDSPLALDMSNAILKLSEGGDLQRMHDKWLLGSACR  805

Query  2241  sestelesDRLHLKSFW  2291
             SE  + +++RLHL SFW
Sbjct  806   SEGAKEDANRLHLTSFW  822



>ref|XP_006858062.1| hypothetical protein AMTR_s00062p00050250 [Amborella trichopoda]
 gb|ERN19529.1| hypothetical protein AMTR_s00062p00050250 [Amborella trichopoda]
Length=940

 Score =   486 bits (1251),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 271/403 (67%), Positives = 334/403 (83%), Gaps = 1/403 (0%)
 Frame = +3

Query  1164  PRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYAVPFQFV  1343
             PRGWVFPNNGK LRIG+P R+SY +F+S V G+   +GF +DVF AAVNLLPYAVP  F+
Sbjct  459   PRGWVFPNNGKPLRIGIPNRMSYTDFVS-VKGSGKPEGFCIDVFDAAVNLLPYAVPHTFI  517

Query  1344  PFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPFKKL  1523
             PFGNG +NPSY ELVR V+   FD A+GDI+IVTNRT++VDFTQP+V SGLL+VAP +K 
Sbjct  518   PFGNGIKNPSYDELVRKVALDDFDAAVGDISIVTNRTRIVDFTQPFVESGLLIVAPVRKR  577

Query  1524  NTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSLSTL  1703
             ++ AWAFL PF+ +MW VT  FF++VG V+WILEHR+N EFRG P +QL+TI WFS ST+
Sbjct  578   SSSAWAFLKPFTLEMWFVTGTFFLIVGAVIWILEHRINTEFRGPPSKQLVTIFWFSFSTM  637

Query  1704  FFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESLKEGNDP  1883
             FFAHRENT STLGRMVLIIWLFVVLIINSSYTASLTSILTVQQL S I+G++SL   NDP
Sbjct  638   FFAHRENTSSTLGRMVLIIWLFVVLIINSSYTASLTSILTVQQLSSRIEGIDSLISSNDP  697

Query  1884  IGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERPYVENFL  2063
             IGYQ GSFA  YL EE+ I+  RL  L +PE +A+ALE+GP  GGV AI+DE PY+E  L
Sbjct  698   IGYQTGSFARDYLTEELNIAAWRLKPLNTPEEFADALERGPRNGGVVAIIDESPYIELLL  757

Query  2064  STQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLtrtscss  2243
             S+ CKF++VGQEFTKSGWGFAF RDSPLA+DMSTA+L+LSENG+LQR+HDKWLTR  C++
Sbjct  758   SSNCKFQVVGQEFTKSGWGFAFQRDSPLAIDMSTALLTLSENGELQRLHDKWLTRRGCNT  817

Query  2244  estelesDRLHLKSFWglfllcgaacflalfIYFVQIMLKFRR  2372
             ++T++E  +L L+SFWGLFL+CG AC LALF++ V++  ++R+
Sbjct  818   QTTQVEPSKLGLESFWGLFLICGVACGLALFLFLVRLACQYRK  860


 Score =   462 bits (1188),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 221/380 (58%), Positives = 286/380 (75%), Gaps = 4/380 (1%)
 Frame = +2

Query  59    VAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTTQ  238
             V AL+ M  DVVA++GPQSSV+AH ISHV NEL +PL+SFAATDPTL+SLQ+PYFLRTTQ
Sbjct  89    VEALQLMGKDVVAMIGPQSSVIAHVISHVVNELHIPLVSFAATDPTLSSLQYPYFLRTTQ  148

Query  239   SDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGAT  418
             SD+YQM AIADVI+HYGWK++IA+F+D+DYGRNG+AAL DALA KR  IS+KA + PGA 
Sbjct  149   SDLYQMNAIADVIEHYGWKQIIAIFVDNDYGRNGVAALGDALAKKRSTISFKAALRPGAG  208

Query  419   TRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVLDS  598
             +  EI D+L  +  MESRV VLH  P +G  +FS A+YL MM +GYVWI+TDWL+T LDS
Sbjct  209   S-DEIKDLLANVNRMESRVYVLHVNPDSGLNIFSNAYYLHMMENGYVWITTDWLTTNLDS  267

Query  599   SSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHL---TGGSLGLNSYALYAYDSVW  769
             SS    +   ++QGV+ LRQ+TP S  KR F SRW  L        GL SYALYAYD+VW
Sbjct  268   SSLSNPDTHSLIQGVVSLRQYTPGSSAKRRFMSRWSDLLRNEKADTGLTSYALYAYDTVW  327

Query  770   LIAHAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLTG  949
             L+A AID +L+ GG +SF+ND +++++ GSTL++ +L IF+GGP L + LL+ +F GLTG
Sbjct  328   LVARAIDEYLHSGGSVSFANDPRIKNVNGSTLNVSSLKIFNGGPKLRDILLKMNFSGLTG  387

Query  950   QFKFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKLY  1129
              F+FN ++SL+ P+++I+N+ GTG R +GFW NYSGLS   PE LY +P N S++ Q+LY
Sbjct  388   PFQFNAERSLIHPAFEIINIGGTGSRRVGFWSNYSGLSVVTPEILYQKPLNISTSGQQLY  447

Query  1130  GVVWPGQSVKKAPGVGFPEQ  1189
              VVWPGQ+     G  FP  
Sbjct  448   SVVWPGQTTDTPRGWVFPNN  467



>ref|XP_009107641.1| PREDICTED: glutamate receptor 3.3 isoform X2 [Brassica rapa]
Length=775

 Score =   475 bits (1222),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 245/324 (76%), Positives = 286/324 (88%), Gaps = 1/324 (0%)
 Frame = +3

Query  1158  KKPRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGT-NTFKGFSVDVFTAAVNLLPYAVPF  1334
             +KPRGW F NNGK+L+IGVP RVSYKEF+SQ+ GT N FKGF +DVFTAAVNLLPYAVP 
Sbjct  449   QKPRGWAFSNNGKELKIGVPRRVSYKEFVSQIRGTENMFKGFCIDVFTAAVNLLPYAVPV  508

Query  1335  QFVPFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPF  1514
             +F+P+GNG+ENPSY+ +V ++++G FDG +GDIAIVTNRTK+VDFTQPY ASGL+VVAPF
Sbjct  509   KFIPYGNGKENPSYTHMVEMITSGNFDGVVGDIAIVTNRTKIVDFTQPYAASGLVVVAPF  568

Query  1515  KKLNTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSL  1694
             KKLN+GAW FL PF+  MW VTA  F+ VGIVVWILEHR+NDEFRG PK+Q +TILWFS 
Sbjct  569   KKLNSGAWVFLRPFNRLMWAVTACCFLFVGIVVWILEHRINDEFRGPPKRQCVTILWFSF  628

Query  1695  STLFFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESLKEG  1874
             ST+FFAHRENTVSTLGR+VLIIWLFVVLIINSSYTASLTSILTVQQL SPIKG++SL+E 
Sbjct  629   STMFFAHRENTVSTLGRLVLIIWLFVVLIINSSYTASLTSILTVQQLSSPIKGIDSLREM  688

Query  1875  NDPIGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERPYVE  2054
             +D IGYQ+GSFAE YL +E+ IS+SRL+ LGS EAYA+AL+ GP KGGV+AIVDERPYVE
Sbjct  689   DDRIGYQVGSFAERYLRDELNISESRLVPLGSREAYAKALKDGPRKGGVAAIVDERPYVE  748

Query  2055  NFLSTQCKFRIVGQEFTKSGWGFA  2126
              FLS+ C +RIVGQEFTKSGWGF 
Sbjct  749   LFLSSNCAYRIVGQEFTKSGWGFV  772


 Score =   472 bits (1214),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 223/377 (59%), Positives = 292/377 (77%), Gaps = 5/377 (1%)
 Frame = +2

Query  56    LVAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTT  235
             +V AL+FM+ D+V I+GPQ SVVAH ISH+ANEL+VPLLSFA TDP ++ LQFPYF+RT+
Sbjct  83    MVEALRFMEKDIVGIIGPQCSVVAHMISHMANELRVPLLSFAVTDPVMSPLQFPYFIRTS  142

Query  236   QSDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGI-PPG  412
             QSD+YQM AIA ++D YGWKEVIAVF+DDDYGRNG+AAL+D LA++R +I+YKAG+ P  
Sbjct  143   QSDLYQMEAIASIVDLYGWKEVIAVFVDDDYGRNGVAALNDKLASRRLRITYKAGLHPDN  202

Query  413   ATTRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVL  592
             A  + EIM++L++I L++ R++V+H Y   GF VF  A YLGMMG+GYVWI+TDWLST L
Sbjct  203   AVNKNEIMNMLIKIMLLQPRIIVIHVYSELGFAVFKEAKYLGMMGNGYVWIATDWLSTTL  262

Query  593   DSSSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLTGGSLGLNSYALYAYDSVWL  772
             DSSSPLPSE++E +QG LVLR HTPDS+LKR F +RW+      L L++Y LYAYDSV L
Sbjct  263   DSSSPLPSERLESIQGALVLRPHTPDSKLKREFFARWRKNPDAPLALHTYGLYAYDSVML  322

Query  773   IAHAIDSFLNKGGVISFSNDSKLQSIEGS-TLHLEALSIFDGGPLLLNNLLQSDFVGLTG  949
             +A A+D +   GG +SFSNDS L ++  S +L+LEA+++FDGG  LL ++L +  VGLTG
Sbjct  323   LARALDKYFKHGGKVSFSNDSMLDALGKSGSLNLEAMTVFDGGEALLKDILGTHMVGLTG  382

Query  950   QFKFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKLY  1129
             Q +F  D+S + P+YDI+NV GTG R IG+W N+SGLS  PPE+L    PN  SA+QKL 
Sbjct  383   QLQFTTDRSRIRPAYDIINVAGTGVRQIGYWSNHSGLSVLPPESLTK--PN-MSASQKLR  439

Query  1130  GVVWPGQSVKKAPGVGF  1180
              V+WPG++ +K  G  F
Sbjct  440   HVIWPGEAFQKPRGWAF  456



>ref|XP_011092253.1| PREDICTED: glutamate receptor 3.2-like [Sesamum indicum]
 ref|XP_011092254.1| PREDICTED: glutamate receptor 3.2-like [Sesamum indicum]
 ref|XP_011092255.1| PREDICTED: glutamate receptor 3.2-like [Sesamum indicum]
Length=931

 Score =   497 bits (1280),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 272/404 (67%), Positives = 334/404 (83%), Gaps = 5/404 (1%)
 Frame = +3

Query  1161  KPRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYAVPFQF  1340
             KPRGWVFP NG+ LRIGVP RVSYK+F+S+   TN   G+ +DVF AAVNLL YAVP++F
Sbjct  455   KPRGWVFPYNGRNLRIGVPNRVSYKDFVSKDESTNEIHGYCIDVFVAAVNLLSYAVPYEF  514

Query  1341  VPFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPFKK  1520
             + +G+G +NPSY+ELVR++++G FD  +GDIAIVTNRTK+VDFTQPY+ SGL+VVAP +K
Sbjct  515   ILYGDGHKNPSYTELVRMMTSGVFDAVVGDIAIVTNRTKIVDFTQPYIESGLVVVAPVRK  574

Query  1521  LNTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSLST  1700
             LN+  WAFL PFS  MW +TA FF+++G+V+WILEHR+NDEFRG PKQQL+TILWF  ST
Sbjct  575   LNSSPWAFLRPFSPLMWAITAAFFLIIGVVIWILEHRINDEFRGPPKQQLVTILWFGFST  634

Query  1701  LFFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESLKEGND  1880
             +FFAHRENT+STLGRMVLI+WLFVVLII SSYTASLTSILTVQQL   I+G++SL   ND
Sbjct  635   MFFAHRENTMSTLGRMVLILWLFVVLIITSSYTASLTSILTVQQLAPSIRGIDSLITSND  694

Query  1881  PIGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERPYVENF  2060
              IG+Q+GSFAE+YLI+E+ I+KSRLI L SPE YA+AL +G     V+A+VDERPYV+ F
Sbjct  695   HIGFQVGSFAENYLIDELNIAKSRLIPLNSPEEYADALRRGR----VAAVVDERPYVDVF  750

Query  2061  LSTQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLtrtscs  2240
             LS  C  ++VG+EFTKSGWGFAFPRDSPLA+DMSTAIL+LSENG+LQ+IH KWL      
Sbjct  751   LSKYCMSQVVGREFTKSGWGFAFPRDSPLAMDMSTAILTLSENGELQKIHKKWL-NARAC  809

Query  2241  sestelesDRLHLKSFWglfllcgaacflalfIYFVQIMLKFRR  2372
                +  +SD+L LKSFWGLFL+CG ACFLAL IYF  ++ KF+R
Sbjct  810   HRPSSDDSDQLQLKSFWGLFLICGIACFLALIIYFCLMVWKFKR  853


 Score =   441 bits (1133),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 208/377 (55%), Positives = 285/377 (76%), Gaps = 2/377 (1%)
 Frame = +2

Query  56    LVAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTT  235
             ++  L++M+TD VAI+GPQ S +AH +SH+ANEL VP+LSF A DP+L+SLQ+PYF++T 
Sbjct  87    IIGGLQYMETDTVAIIGPQVSGMAHILSHLANELHVPMLSFTALDPSLSSLQYPYFVQTA  146

Query  236   QSDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGA  415
              +D++QM AIAD+I ++G+KEV+A++ DD+  R  + AL + LA KRCKISYKA + P A
Sbjct  147   PNDLFQMAAIADMISYFGYKEVVAIYTDDEQSRGTMIALGNKLAEKRCKISYKAVLSPEA  206

Query  416   -TTRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVL  592
               T +EI + LV+++LMESRV+++H+Y   G  VF +AH L MM  GYVWI+T WLSTVL
Sbjct  207   FATDSEISNELVKVSLMESRVIIVHSYAVIGRKVFDLAHKLRMMEKGYVWIATAWLSTVL  266

Query  593   DSSSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLTGGSLGLNSYALYAYDSVWL  772
             DS+ P+  E  + +QGVL +R HT DS+ K+AF SRW  L+ GS+GLN Y LYAYD+VW+
Sbjct  267   DST-PVSGEVAKSIQGVLTVRPHTADSKRKKAFISRWNKLSNGSIGLNPYGLYAYDTVWI  325

Query  773   IAHAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLTGQ  952
             IA+A+  FL++GG ISFSN+S L  + G TL+L ALS FDGG  LL N+LQ++  GLTG+
Sbjct  326   IANAVKVFLDQGGTISFSNNSNLNGVGGGTLNLGALSTFDGGSQLLRNILQTNMTGLTGR  385

Query  953   FKFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKLYG  1132
               F++DKS++ P++DILNV+G G++ IG+W NYSGLS   PE LY++ PN SS+NQ+L  
Sbjct  386   IAFDSDKSVIRPAFDILNVVGKGYKQIGYWSNYSGLSVVSPEILYTKAPNRSSSNQQLDH  445

Query  1133  VVWPGQSVKKAPGVGFP  1183
             VVWPGQ+  K  G  FP
Sbjct  446   VVWPGQTTVKPRGWVFP  462



>ref|XP_009403107.1| PREDICTED: glutamate receptor 3.5-like [Musa acuminata subsp. 
malaccensis]
Length=925

 Score =   492 bits (1267),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 264/411 (64%), Positives = 332/411 (81%), Gaps = 0/411 (0%)
 Frame = +3

Query  1164  PRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYAVPFQFV  1343
             PRGWVFPN+GK LRIGVP R S+ EF+S+  G +  KG+ +DVF AAVNLLPY VP  F+
Sbjct  457   PRGWVFPNSGKSLRIGVPYRTSFTEFVSKDNGPDNVKGYCIDVFKAAVNLLPYPVPLSFI  516

Query  1344  PFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPFKKL  1523
              FGNG +NPSY ELV  V   YFD A+GDI+IVTNRT++VDFTQPY  SGL++VAP K+ 
Sbjct  517   LFGNGSKNPSYDELVEKVHENYFDAAVGDISIVTNRTRIVDFTQPYAESGLVIVAPAKEQ  576

Query  1524  NTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSLSTL  1703
             ++ AWAFL PF+  MW  T  FF+ VG+VVWILEHR+N +FRGSPKQQ+ TI WFSLST+
Sbjct  577   HSNAWAFLKPFNTTMWCATGAFFLFVGLVVWILEHRLNQDFRGSPKQQIATIFWFSLSTM  636

Query  1704  FFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESLKEGNDP  1883
             FFAHRE TVSTLGR VLI+W+FVVLIINSSYTA+LTSILTVQQL S I G+++L  G+DP
Sbjct  637   FFAHRETTVSTLGRFVLIVWMFVVLIINSSYTANLTSILTVQQLSSRIAGIDTLMSGSDP  696

Query  1884  IGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERPYVENFL  2063
             IGYQ+GSF+++Y+IE++ I +SRL+ L  P+ YA AL+ GP  GGV+AIVDE PY+E FL
Sbjct  697   IGYQVGSFSKNYMIEDLNIDESRLVPLNDPDEYARALDLGPRGGGVAAIVDELPYIEVFL  756

Query  2064  STQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLtrtscss  2243
             S  CK+  VGQEFTKSGWGFAFPRDSPLA+D+STAIL+LSENGDLQRIHDKWLT++ C+S
Sbjct  757   SDNCKYITVGQEFTKSGWGFAFPRDSPLALDLSTAILTLSENGDLQRIHDKWLTQSGCTS  816

Query  2244  estelesDRLHLKSFWglfllcgaacflalfIYFVQIMLKFRRVARAEPVA  2396
             + ++ +S++L   SFWGLFL+CG AC +AL I+F++ + ++R+ +    V 
Sbjct  817   QDSDTDSNQLSFASFWGLFLICGLACLMALMIFFLKTLCQYRKYSTQAKVG  867


 Score =   445 bits (1145),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 214/381 (56%), Positives = 282/381 (74%), Gaps = 6/381 (2%)
 Frame = +2

Query  56    LVAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTT  235
             ++ +L+ ++ +VVAI+GPQSS +AH +SHVANEL VPLLSFAATDP L+SL+  YF+R T
Sbjct  86    IIESLQLIEKNVVAIIGPQSSGIAHVVSHVANELHVPLLSFAATDPALSSLEHSYFIRMT  145

Query  236   QSDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGA  415
             QSD +QM AIAD++ +YGW+EV A+F DDD+GR GI AL DALA +  KISYKA IPP A
Sbjct  146   QSDYFQMNAIADLVGNYGWREVTAIFTDDDFGRGGIDALGDALAKRHTKISYKAAIPPNA  205

Query  416   TTRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVLD  595
                A I D+LV++  MESR+ V+H  P +G  VFS+A Y GMM  GYVWI++DWL++VLD
Sbjct  206   NESA-IDDLLVRVNFMESRIYVVHVNPDSGLKVFSIAKYRGMMATGYVWITSDWLTSVLD  264

Query  596   S-SSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLT---GGSLGLNSYALYAYDS  763
             S  SP P + M+++QGV+ LRQH PDS++K++F SRW  +      +  LN+YALYAYDS
Sbjct  265   SFGSPNP-DTMDLIQGVIALRQHVPDSDVKQSFISRWSDMRRRGNTTSSLNTYALYAYDS  323

Query  764   VWLIAHAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGL  943
             VWL+AHAID  L  G   +FS+D KLQ   GS+LHL A+  F+ G  LL+ LL + F GL
Sbjct  324   VWLVAHAIDQLLKGGQTFNFSDDPKLQDANGSSLHLTAIKNFNTGDNLLHELLLTKFTGL  383

Query  944   TGQFKFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQK  1123
             TGQ +F++D +L+ P+YDILN+ GTGFR IGFW NYSGLS   PE+LYS+ PN+S  +Q+
Sbjct  384   TGQVQFDSDGNLIHPAYDILNIGGTGFRRIGFWSNYSGLSVISPESLYSKRPNTSDGSQQ  443

Query  1124  LYGVVWPGQSVKKAPGVGFPE  1186
             LY V+WPG+++    G  FP 
Sbjct  444   LYSVIWPGETMTTPRGWVFPN  464



>ref|XP_003533408.1| PREDICTED: glutamate receptor 3.3-like [Glycine max]
 gb|KHN38861.1| Glutamate receptor 3.3 [Glycine soja]
Length=930

 Score =   493 bits (1268),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 269/409 (66%), Positives = 332/409 (81%), Gaps = 0/409 (0%)
 Frame = +3

Query  1146  GSR*KKPRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYA  1325
             G   + PRGWVF +NG+ LRIGVP+R+SY+EF+S++ GT  F G+ +DVFTAA+NLLPY 
Sbjct  451   GQTTQTPRGWVFASNGRHLRIGVPLRISYREFVSKIEGTEMFGGYCIDVFTAALNLLPYP  510

Query  1326  VPFQFVPFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVV  1505
             VPF+F+PFG+G+ NP   +L+ +++TG FD  +GDI I TNRTK+ DFTQPY+ SGL+VV
Sbjct  511   VPFKFIPFGDGKTNPLNLDLLHMITTGAFDAVVGDITITTNRTKIADFTQPYIESGLVVV  570

Query  1506  APFKKLNTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILW  1685
             AP KKL + AWAFLTPF+  MW VT  FF+VVG VVWILE R+ND+FRG P++Q +TI+W
Sbjct  571   APIKKLKSSAWAFLTPFTPMMWFVTGMFFLVVGAVVWILERRINDDFRGPPRRQFVTIVW  630

Query  1686  FSLSTLFFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESL  1865
             FS STLFFAHRE TVSTLGR+VLIIWLFVVLI+NSSY ASLTSILTV+QL SP+KG+ESL
Sbjct  631   FSFSTLFFAHREKTVSTLGRLVLIIWLFVVLILNSSYIASLTSILTVEQLSSPVKGIESL  690

Query  1866  KEGNDPIGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERP  2045
                +D IG+  GSFAE+YL EE+ I +SRL+ L SP  Y +AL+ GP  GGV+AI+DER 
Sbjct  691   VISSDRIGFLRGSFAENYLTEELNIHRSRLVPLNSPSEYEKALKDGPANGGVAAIIDERA  750

Query  2046  YVENFLSTQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLt  2225
             Y+E FL+T+C+F IVGQEFTK GWGF FPR+SPLA+DMSTAIL LSENGDLQRIHDKWLT
Sbjct  751   YMELFLATRCEFGIVGQEFTKMGWGFGFPRESPLAIDMSTAILKLSENGDLQRIHDKWLT  810

Query  2226  rtscssestelesDRLHLKSFWglfllcgaacflalfIYFVQIMLKFRR  2372
             R++CSSE  +   DRL LKSFWGLFLL G ACF+AL  Y +++  +F R
Sbjct  811   RSACSSEGAKQGIDRLELKSFWGLFLLSGIACFIALLCYVIRMAYRFSR  859


 Score =   429 bits (1103),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 208/380 (55%), Positives = 269/380 (71%), Gaps = 15/380 (4%)
 Frame = +2

Query  56    LVAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTT  235
             ++ +   M+ D VAI+GPQ SV+AH ISH+ANE+QVPLLSFAATDPTL SLQFPYF+RTT
Sbjct  87    IIDSFLLMEKDTVAIIGPQYSVMAHVISHIANEMQVPLLSFAATDPTLTSLQFPYFVRTT  146

Query  236   QSDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGA  415
             QSD+YQM A+A+++DH+ W++VIA+F+DDD+GRNGIAAL D LA KRCKISYK    P  
Sbjct  147   QSDLYQMAAVAEIVDHFQWRDVIAIFVDDDHGRNGIAALGDKLAEKRCKISYKVPFKPDN  206

Query  416   TTRAEIMDILVQIALMESRVMVLHAYPAAGFMVF-SVAHYLGMMGDGYVWISTDWLSTVL  592
              +  EI   LV++ALMESRV+VLH YP++G  V    A  LGMMG GYVWI+TDWLSTVL
Sbjct  207   ISHEEINSALVKVALMESRVIVLHIYPSSGLEVLHHAAQSLGMMGSGYVWIATDWLSTVL  266

Query  593   DSSSPL-PSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLTGGS------LGLNSYALY  751
             DS   L  S  M  +QGV+ LR H PDS++K+ F SRWK L+          G+N + LY
Sbjct  267   DSEPSLFSSSAMNDIQGVITLRMHAPDSDMKKQFVSRWKKLSQKEDSNQDPFGVNIFGLY  326

Query  752   AYDSVWLIAHAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSD  931
             AYD+VWL+A A+DSF   GG +SFSNDS L  + G +L+L+ + +F  G +LL  +L+ +
Sbjct  327   AYDTVWLLASALDSFFKSGGTLSFSNDSSLNMLRGDSLNLDTIGVFVNGSMLLQKILEVN  386

Query  932   FVGLTGQFKFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSS  1111
               GLTGQ  F+ D +LV PSY+I+NVIGTG R IG+W   SGL T          PN S+
Sbjct  387   RTGLTGQMMFSPDGNLVHPSYEIINVIGTGIRRIGYWSETSGLHTG-------EGPNHSN  439

Query  1112  ANQKLYGVVWPGQSVKKAPG  1171
              ++ L+GV+WPGQ+ +   G
Sbjct  440   FSEGLFGVIWPGQTTQTPRG  459



>ref|XP_003533409.1| PREDICTED: glutamate receptor 3.3-like isoform X1 [Glycine max]
 ref|XP_006587553.1| PREDICTED: glutamate receptor 3.3-like isoform X2 [Glycine max]
 ref|XP_006587554.1| PREDICTED: glutamate receptor 3.3-like isoform X3 [Glycine max]
 ref|XP_006587555.1| PREDICTED: glutamate receptor 3.3-like isoform X4 [Glycine max]
 gb|KHN38862.1| Glutamate receptor 3.3 [Glycine soja]
Length=930

 Score =   482 bits (1240),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 262/411 (64%), Positives = 330/411 (80%), Gaps = 0/411 (0%)
 Frame = +3

Query  1158  KKPRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYAVPFQ  1337
             + PRGWVF +NG+ LRIGVP+R+SY+EF+S+  GT  F G+ +DVFTAA+NLLPY VP++
Sbjct  453   QTPRGWVFASNGRHLRIGVPLRISYREFVSRTEGTEMFGGYCIDVFTAALNLLPYPVPYK  512

Query  1338  FVPFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPFK  1517
             FVPFG+G+ NP  ++L+  ++ G FD  +GDI I TNRTK+VDFTQPY+ SGL+VVAP +
Sbjct  513   FVPFGDGKTNPLNTKLLNKITAGEFDAVVGDITITTNRTKIVDFTQPYIESGLVVVAPIR  572

Query  1518  KLNTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSLS  1697
             K+ + AWAFL PF+  MW VT  FF+ VG+VVWILE R+N++FRG  ++Q +TI+WFS S
Sbjct  573   KMKSSAWAFLRPFTPMMWFVTGMFFLAVGVVVWILERRLNEDFRGPSRRQFVTIIWFSFS  632

Query  1698  TLFFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESLKEGN  1877
             TLFFAHRE TVSTLGR+VLIIWLFVVLI+NSSY ASLTSILTV+QL S +KG+ESL   N
Sbjct  633   TLFFAHREKTVSTLGRLVLIIWLFVVLILNSSYIASLTSILTVEQLSSSVKGIESLATSN  692

Query  1878  DPIGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERPYVEN  2057
             + IG+  GSFAE+YL EE+ I +SRL+ L SP  Y +AL+ GP  GGV+AI+DER Y+E 
Sbjct  693   ERIGFLSGSFAENYLTEELNIHRSRLVPLNSPSEYEKALKDGPANGGVTAIIDERAYMEL  752

Query  2058  FLSTQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLtrtsc  2237
             FL+T+C++ IVGQEFTK GWGFAFPRDSPLA+DMSTAIL LSENGDLQRIHDKWLTR++C
Sbjct  753   FLATRCEYGIVGQEFTKMGWGFAFPRDSPLAIDMSTAILKLSENGDLQRIHDKWLTRSAC  812

Query  2238  ssestelesDRLHLKSFWglfllcgaacflalfIYFVQIMLKFRRVARAEP  2390
             SSE  +   DRL L+SFWGLFLL G ACF+AL  Y +++  +F R   + P
Sbjct  813   SSEGAKQGIDRLELESFWGLFLLSGIACFIALLCYVIRMAYRFSRHPNSNP  863


 Score =   439 bits (1129),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 211/379 (56%), Positives = 280/379 (74%), Gaps = 14/379 (4%)
 Frame = +2

Query  56    LVAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTT  235
             ++ +L+ M+ D VAI+GPQ SV+AH ISH+ANE+QVPLLSFAATDPTL SLQFPYF+RTT
Sbjct  86    IIDSLRLMEKDTVAIIGPQFSVMAHVISHIANEMQVPLLSFAATDPTLTSLQFPYFVRTT  145

Query  236   QSDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGA  415
             QSD+YQM A+A+++DH+ W++VIA++IDDD+GRNG+AAL D LA KR KISYKA   P  
Sbjct  146   QSDLYQMAAVAEIVDHFQWRDVIAIYIDDDHGRNGVAALGDKLAEKRGKISYKAPFRPNN  205

Query  416   TTRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVLD  595
              TR EI + LV+IAL+ESRV+VLH YP+ G  V  VA  LGMMG GYVWI+TDWLST+LD
Sbjct  206   ITREEINNALVKIALIESRVIVLHIYPSFGLQVLHVARSLGMMGSGYVWIATDWLSTLLD  265

Query  596   SSSPL-PSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLTG------GSLGLNSYALYA  754
             S+  L  ++ M  +QGV+ LR +TP+SE+KR F+SRW  L+       G   LN++ LYA
Sbjct  266   SNPSLFTTQAMNDIQGVITLRMYTPESEIKRNFSSRWNKLSQKKDPEEGPFALNTFGLYA  325

Query  755   YDSVWLIAHAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDF  934
             YD+VWL+A A+D+F   GG +SFSNDS L  ++G TL L+ + +F  G +LL  +L+ + 
Sbjct  326   YDTVWLLASALDAFFKSGGTLSFSNDSSLNMLKGDTLKLDTMGVFVDGVMLLEKILEVNR  385

Query  935   VGLTGQFKFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSA  1114
              GLTGQ  F+ D +LV PSY+++NVIGTG R IG+W   SGL T   ET     PN S++
Sbjct  386   TGLTGQMMFSPDGNLVHPSYEVINVIGTGIRRIGYWSETSGLHTG--ET-----PNHSNS  438

Query  1115  NQKLYGVVWPGQSVKKAPG  1171
             ++ L+GV+WPGQ+ +   G
Sbjct  439   SEGLFGVIWPGQTTQTPRG  457



>ref|XP_008230073.1| PREDICTED: glutamate receptor 3.4-like [Prunus mume]
 ref|XP_008230074.1| PREDICTED: glutamate receptor 3.4-like [Prunus mume]
Length=944

 Score =   472 bits (1215),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 267/404 (66%), Positives = 324/404 (80%), Gaps = 1/404 (0%)
 Frame = +3

Query  1164  PRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYAVPFQFV  1343
             PRGWVFPNNG  LRI VP RVSY++F+++       +G+ +DVF AAVNLLPYAVP  +V
Sbjct  470   PRGWVFPNNGTPLRIAVPYRVSYQDFVAKDKSPPGVRGYCIDVFEAAVNLLPYAVPRNYV  529

Query  1344  PFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPFKKL  1523
              +GNG+ NP YS LV  V+   FD A+GD+ I TNRT++VDFTQPY+ SGL+VV P K+ 
Sbjct  530   LYGNGKRNPEYSNLVFEVAQNNFDAAVGDVTITTNRTRIVDFTQPYMESGLVVVVPVKEQ  589

Query  1524  NTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSLSTL  1703
              T  WAFL PF+ QMW VT  FF+ VG VVWILEHRMN EFRG P++QL+TI WFS ST+
Sbjct  590   KTSPWAFLKPFTYQMWLVTGAFFLFVGAVVWILEHRMNQEFRGPPRKQLMTIFWFSFSTM  649

Query  1704  FFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESLKEGNDP  1883
             FF+HRENTVSTLGR+VLIIWLFVVLIINSSYTASLTSILTVQQL S I+G++SL   NDP
Sbjct  650   FFSHRENTVSTLGRLVLIIWLFVVLIINSSYTASLTSILTVQQLTSRIEGIDSLIASNDP  709

Query  1884  IGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERPYVENFL  2063
             IG Q GSFA  YL++E+ I++SRL+ L + E Y EAL+ GP +GGV+AIVDE PY+E F+
Sbjct  710   IGVQDGSFAWKYLVDELNIAESRLVKLKTMENYIEALQYGPKRGGVAAIVDELPYIELFM  769

Query  2064  S-TQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLtrtscs  2240
             S T+CKFR VGQEFTKSGWGFAF RDSPLAVD+STAIL LSENGDLQ+IH+KWLT   CS
Sbjct  770   SNTKCKFRTVGQEFTKSGWGFAFQRDSPLAVDLSTAILQLSENGDLQKIHNKWLTHNECS  829

Query  2241  sestelesDRLHLKSFWglfllcgaacflalfIYFVQIMLKFRR  2372
              +  E++SDRL L SFWGLFL+CG ACFL+L ++F +I+ ++RR
Sbjct  830   IQMNEVDSDRLSLTSFWGLFLICGVACFLSLTVFFCRILCQYRR  873


 Score =   446 bits (1147),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 216/378 (57%), Positives = 280/378 (74%), Gaps = 3/378 (1%)
 Frame = +2

Query  59    VAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTTQ  238
             V AL+ ++ DVVA +GPQSS +AH ISHV NEL VPLLSFAATDP+LA+LQ+PYF+RTTQ
Sbjct  103   VEALQLIENDVVAAIGPQSSGIAHVISHVVNELHVPLLSFAATDPSLAALQYPYFVRTTQ  162

Query  239   SDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGAT  418
             SD +QM A+ADV++++GW+EVIA+F+DDD GRNG++ L DALA KR KISYKA   PGA 
Sbjct  163   SDHFQMYAVADVVEYFGWREVIAIFVDDDCGRNGVSILGDALAKKRSKISYKAAFSPGA-  221

Query  419   TRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVLDS  598
             ++  I ++LV + LMESRV V+H  P +G  +FSVA  LGMM  GYVWI+TDWL + LDS
Sbjct  222   SKNTITELLVGVNLMESRVFVVHVNPDSGLTIFSVAKSLGMMTAGYVWIATDWLPSHLDS  281

Query  599   SSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLT-GGSLGLNSYALYAYDSVWLI  775
               P   + M ++QGV+ LR HTPD++LK++F SRWK L   GS G NSYALYAYDS+WL 
Sbjct  282   LEPPGLDTMNLVQGVVALRHHTPDTDLKKSFMSRWKKLKHEGSSGFNSYALYAYDSIWLA  341

Query  776   AHAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLTGQF  955
             A A++ F N+GG ISFSND KL+    STLHL +L IFDGG   L  +L+ +F G++GQ 
Sbjct  342   ARALEVFFNEGGKISFSNDPKLKDTNRSTLHLTSLRIFDGGQQYLQTILKMNFTGVSGQI  401

Query  956   KFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKLYGV  1135
             +F+ DK LV P+Y+ILN+ GTG R IGFW N +GLS   PE LY +P +++++ Q LY V
Sbjct  402   QFDQDKYLVHPAYEILNIGGTGSRRIGFWSNSTGLSVIAPEILYKKPFSANTSAQ-LYSV  460

Query  1136  VWPGQSVKKAPGVGFPEQ  1189
             +WPG++     G  FP  
Sbjct  461   IWPGETTAIPRGWVFPNN  478



>ref|XP_006447543.1| hypothetical protein CICLE_v10014175mg [Citrus clementina]
 ref|XP_006447545.1| hypothetical protein CICLE_v10014175mg [Citrus clementina]
 ref|XP_006469691.1| PREDICTED: glutamate receptor 3.4-like [Citrus sinensis]
 gb|ESR60783.1| hypothetical protein CICLE_v10014175mg [Citrus clementina]
 gb|ESR60785.1| hypothetical protein CICLE_v10014175mg [Citrus clementina]
 gb|KDO41667.1| hypothetical protein CISIN_1g002267mg [Citrus sinensis]
Length=945

 Score =   463 bits (1192),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 222/380 (58%), Positives = 280/380 (74%), Gaps = 5/380 (1%)
 Frame = +2

Query  59    VAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTTQ  238
             + AL+ M+ +VVA +GPQSS +AH ISHV NEL VPLLSF ATDPTL SLQ+PYFLRTTQ
Sbjct  106   MEALQLMENEVVAAIGPQSSGIAHVISHVVNELNVPLLSFGATDPTLTSLQYPYFLRTTQ  165

Query  239   SDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGAT  418
             SD YQM A+AD++++YGW+EVIA+F+DDDYGRNGI+ L DAL+ KR KISYKA   PGA 
Sbjct  166   SDYYQMHAVADLVEYYGWREVIAIFVDDDYGRNGISVLGDALSKKRAKISYKAPFSPGA-  224

Query  419   TRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVLDS  598
             +R+ I  +LV   LMESRV V+H  P  G  +FSVA  LGM    YVWI+TDWL +VLDS
Sbjct  225   SRSAINSLLVGANLMESRVFVVHVNPDTGLTIFSVAKSLGMTAGSYVWIATDWLPSVLDS  284

Query  599   SSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLT---GGSLGLNSYALYAYDSVW  769
             + P+  + M ++QGV+ LR HTPD++LK+ F SRWK+L        G NSYALYAYDSVW
Sbjct  285   TEPVDIDTMNLLQGVVALRHHTPDTDLKKNFISRWKNLKYKENSPSGFNSYALYAYDSVW  344

Query  770   LIAHAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLTG  949
             L+AHA+D+ LN+GG  +FSND KL    GS L+L +L +FDGG   L  LL+ +F GL+G
Sbjct  345   LVAHALDALLNEGGKFTFSNDPKLHDTNGSMLNLSSLRVFDGGQQFLQTLLRMNFTGLSG  404

Query  950   QFKFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKLY  1129
             + +F+ DK+LV P+YD+LN+ GTG R IG+W NYSGLS   PE LY++PPNSSS N+ LY
Sbjct  405   EIRFDADKNLVNPAYDVLNIGGTGSRRIGYWSNYSGLSVVAPEILYTKPPNSSS-NRHLY  463

Query  1130  GVVWPGQSVKKAPGVGFPEQ  1189
              V+WPG+      G  FP  
Sbjct  464   SVIWPGEITATPRGWVFPNN  483


 Score =   451 bits (1161),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 260/406 (64%), Positives = 319/406 (79%), Gaps = 3/406 (1%)
 Frame = +3

Query  1164  PRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYAVPFQFV  1343
             PRGWVFPNNG  LRI VP RVSY EF+++       KG+ +DVF AAVNLLPY VP  ++
Sbjct  475   PRGWVFPNNGMPLRIAVPNRVSYNEFVAKDKSPPGVKGYCIDVFEAAVNLLPYPVPHNYI  534

Query  1344  PFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPFKKL  1523
              +GNG+ NP Y+++V+ V+   FD A+GDI IVTNRTK+VDFTQPY+ SGL+VVAP +KL
Sbjct  535   MYGNGKRNPIYNDIVQQVALNKFDAAVGDITIVTNRTKLVDFTQPYMESGLVVVAPVQKL  594

Query  1524  NTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSLSTL  1703
              +  WAFL PF+  MW VT  FF+ VG VVWILEHR N+EFRG P QQL+TI WFS ST+
Sbjct  595   KSSPWAFLKPFTIPMWLVTGGFFLFVGAVVWILEHRFNNEFRGPPSQQLVTIFWFSFSTM  654

Query  1704  FFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESLKEGNDP  1883
             FF+HRENTVS+LGR+VLI+WLFVVLIINSSYTASLTSILTVQQL S I+G++SL    +P
Sbjct  655   FFSHRENTVSSLGRVVLIVWLFVVLIINSSYTASLTSILTVQQLTSQIEGIDSLISSTEP  714

Query  1884  IGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERPYVENFL  2063
             IG Q GSFA +YL++E+ I++SRL+ L + E Y+ AL +GP  GGV+AIVDE PY+E F+
Sbjct  715   IGVQDGSFAWNYLVDELKIAESRLVKLKNMEEYSIALARGPKGGGVAAIVDELPYIELFM  774

Query  2064  S-TQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLtrtscs  2240
             S T C+FR VGQEFTKSGWGFAF RDSPLA+D+STAIL LSENGDLQ+IH+KWLT   CS
Sbjct  775   SKTNCEFRTVGQEFTKSGWGFAFQRDSPLAIDLSTAILQLSENGDLQKIHNKWLTYNECS  834

Query  2241  sestele--sDRLHLKSFWglfllcgaacflalfIYFVQIMLKFRR  2372
              + +  +    RL LKSFWGLFL+CG ACFLAL  +F ++  +FRR
Sbjct  835   MDLSPADGGGSRLSLKSFWGLFLICGIACFLALIFFFCRVCGQFRR  880



>ref|XP_008353536.1| PREDICTED: glutamate receptor 3.4-like [Malus domestica]
 ref|XP_008353537.1| PREDICTED: glutamate receptor 3.4-like [Malus domestica]
 ref|XP_008353538.1| PREDICTED: glutamate receptor 3.4-like [Malus domestica]
Length=946

 Score =   473 bits (1216),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 269/411 (65%), Positives = 324/411 (79%), Gaps = 2/411 (0%)
 Frame = +3

Query  1164  PRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYAVPFQFV  1343
             PRGWVFPNNG+ LRI VP RVSY++F+++       +G+ +DVF AAVNLLPYAVP  +V
Sbjct  471   PRGWVFPNNGRPLRIAVPYRVSYQDFVAKDNSPPGVRGYCIDVFEAAVNLLPYAVPRTYV  530

Query  1344  PFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPFKKL  1523
              +GNG+ NP YS+LV  V+   FD A+GD+ I TNRT++VDFTQPY+ SGL+VV P K+ 
Sbjct  531   LYGNGKRNPEYSDLVFQVAQNNFDAAVGDVTITTNRTRIVDFTQPYMESGLVVVVPVKQA  590

Query  1524  NTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSLSTL  1703
              +  WAFL PF+ QMW VT  FF+ VG VVWILEHRMN EFRG P+QQLITI WFS ST+
Sbjct  591   KSKPWAFLKPFTYQMWMVTGAFFLFVGAVVWILEHRMNHEFRGPPRQQLITIFWFSFSTM  650

Query  1704  FFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESLKEGNDP  1883
             FF+HRENTVSTLGR+VL+IWLFVVLIINSSYTASLTSILTVQQL S I+G+ SL   NDP
Sbjct  651   FFSHRENTVSTLGRLVLVIWLFVVLIINSSYTASLTSILTVQQLTSRIEGINSLVSSNDP  710

Query  1884  IGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERPYVENFL  2063
             IG Q GSF   YL++E+ I++SRL+ L   EAY +AL  GP +GGV+AIVDE PY+E F+
Sbjct  711   IGVQDGSFIWKYLVDELNIAESRLVKLKDMEAYIKALTDGPRRGGVAAIVDELPYIELFM  770

Query  2064  -STQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLtrtscs  2240
              ST+C FR VGQEFTKSGWGFAF RDSPLAVD+STAIL LSENGDLQ+IH+KWLT   CS
Sbjct  771   SSTKCAFRTVGQEFTKSGWGFAFQRDSPLAVDLSTAILQLSENGDLQKIHNKWLTHNECS  830

Query  2241  sestelesDRLHLKSFWglfllcgaacflalfIYFVQIMLKFRRVARAEPV  2393
              +  + E DRL L SFWGLFL+CG ACFLAL ++F +I+L++RR    EPV
Sbjct  831   IQLNDDEDDRLSLTSFWGLFLICGIACFLALTVFFCRILLQYRRFT-PEPV  880


 Score =   441 bits (1134),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 211/378 (56%), Positives = 277/378 (73%), Gaps = 3/378 (1%)
 Frame = +2

Query  59    VAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTTQ  238
             V AL+ ++ DVVA +GPQSS +AH ISHV NEL VPLLSF ATDP+LA+LQ+PYF+RTTQ
Sbjct  104   VEALQLIENDVVAAIGPQSSGIAHVISHVVNELHVPLLSFGATDPSLAALQYPYFVRTTQ  163

Query  239   SDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGAT  418
             SD +QM A+AD+++++GW+EVIA+F+DDDYGRNGI+ L DALA KR KISYKA   PGA 
Sbjct  164   SDYFQMYAVADLVEYFGWREVIAIFVDDDYGRNGISILGDALAKKRSKISYKAAFSPGA-  222

Query  419   TRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVLDS  598
              +++I ++LV + LMESRV ++H  P +G  +FS+A  LGMM  GYVWI+TDWL + LDS
Sbjct  223   PKSDINELLVGVNLMESRVYIVHVNPDSGLTIFSLAKALGMMTGGYVWIATDWLPSHLDS  282

Query  599   SSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLT-GGSLGLNSYALYAYDSVWLI  775
              +P   + M ++QGV+ LR HTPD++LK+ F SRW  L   GS   NSYALYAYDSVWL 
Sbjct  283   LNPPGPDTMNLLQGVVALRHHTPDTDLKKRFMSRWSKLKHEGSPSFNSYALYAYDSVWLA  342

Query  776   AHAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLTGQF  955
             A A+D F N+GG +SFS+D +L+    STLHL +L IFDGG   L  +L+++F G++GQ 
Sbjct  343   ARALDDFFNEGGNVSFSDDPRLKDTNRSTLHLTSLRIFDGGQKYLQTILKTNFTGISGQI  402

Query  956   KFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKLYGV  1135
             +F+ +K LV P+YDILN+ GTG R IG+W N +GLS   PE LY +P N ++  Q LY V
Sbjct  403   EFDQEKYLVRPAYDILNIGGTGSRRIGYWSNSTGLSVIAPEILYKKPFNKNNTAQ-LYSV  461

Query  1136  VWPGQSVKKAPGVGFPEQ  1189
             +WPG+      G  FP  
Sbjct  462   IWPGEVTATPRGWVFPNN  479



>ref|XP_004976611.1| PREDICTED: glutamate receptor 3.1-like [Setaria italica]
Length=926

 Score =   463 bits (1191),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 237/355 (67%), Positives = 287/355 (81%), Gaps = 0/355 (0%)
 Frame = +3

Query  1158  KKPRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYAVPFQ  1337
             K+PRGWVF NNG +LRIGVP RVSY++F+S    T    G  +DVF AA+NLL Y V ++
Sbjct  455   KRPRGWVFANNGDELRIGVPNRVSYRQFVSDDNQTGMVGGLCIDVFAAAINLLQYPVAYR  514

Query  1338  FVPFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPFK  1517
             F+PFGNG ENPSY++L+  + T  FD  +GD+AIVTNRT++VDFTQPYV SGL+++   K
Sbjct  515   FIPFGNGLENPSYTQLINQIVTNEFDAVVGDVAIVTNRTRLVDFTQPYVGSGLVILTSVK  574

Query  1518  KLNTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSLS  1697
                +  WAFL PF+ +MW VT  FF++VG V+W+LEHR+ND+FRG P +Q+IT+ WFS S
Sbjct  575   PQGSNGWAFLQPFTIRMWLVTGVFFLIVGTVIWLLEHRINDDFRGPPVKQVITVFWFSFS  634

Query  1698  TLFFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESLKEGN  1877
             TLFFAHRE+T STLGR V+IIWLFVVLII SSYTA+LTSILTVQQL SPI+G++SL   +
Sbjct  635   TLFFAHREDTRSTLGRFVIIIWLFVVLIIQSSYTANLTSILTVQQLTSPIRGIDSLIASD  694

Query  1878  DPIGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERPYVEN  2057
             +PIG+Q+GSFAE YL+ E+G+S SRL  LGSP+ Y  ALE GP KGGV AIVDERPYVE 
Sbjct  695   EPIGFQVGSFAESYLVHELGVSPSRLRKLGSPDEYEAALELGPRKGGVVAIVDERPYVEL  754

Query  2058  FLSTQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWL  2222
             FL+   KF IVG EFTKSGWGFAFPRDSPLAVD+STAIL+LSENGDLQRIHDKWL
Sbjct  755   FLTNHDKFAIVGAEFTKSGWGFAFPRDSPLAVDLSTAILALSENGDLQRIHDKWL  809


 Score =   449 bits (1154),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 216/379 (57%), Positives = 283/379 (75%), Gaps = 6/379 (2%)
 Frame = +2

Query  50    ILLVAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLR  229
             I +V AL+FM+ D VAI+GPQSSVVAH ISHVANELQVPL+SFAATDPTL SLQ+P+F+R
Sbjct  82    IGIVQALQFMEKDTVAIIGPQSSVVAHVISHVANELQVPLMSFAATDPTLTSLQYPFFVR  141

Query  230   TTQSDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPP  409
             T  SD +QM ++AD++ +YGWK V AV+IDDDYGRNGI+ L D LA +R KI +KA I P
Sbjct  142   TIHSDQFQMASVADLVYYYGWKMVTAVYIDDDYGRNGISTLGDELAKRRLKILHKAAIRP  201

Query  410   GATTRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTV  589
             GA  ++EI  +LV+ A+MESRV VLHAY   G  VFS+A+ L M   GYVWI+TDWLS  
Sbjct  202   GAK-KSEIAAVLVKAAMMESRVFVLHAYDHTGLDVFSLAYNLTMTSGGYVWIATDWLSAA  260

Query  590   LDSSSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHL----TGGS-LGLNSYALYA  754
             LDS+  L S  +  MQGVL LRQHT ++  K+   S+W  L    +GGS   LNSY LYA
Sbjct  261   LDSAPRLDSGLLSTMQGVLTLRQHTGNTNRKKTLVSQWSTLVKEDSGGSRFLLNSYGLYA  320

Query  755   YDSVWLIAHAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDF  934
             YD+VW++A+A+D+F N GG ISFS D +L ++ G  L+L+AL++FDGG LLL  + + +F
Sbjct  321   YDTVWMLAYALDAFFNGGGNISFSPDPRLHAVSGGALNLDALTVFDGGMLLLERIRKVNF  380

Query  935   VGLTGQFKFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSA  1114
             +G TG  K ++D +L+ P+YDI+N+IG+G RTIG+W NYSGLS   PETLY +PPN +  
Sbjct  381   MGATGTVKLDSDGNLINPAYDIINIIGSGLRTIGYWSNYSGLSIVSPETLYKKPPNDTIE  440

Query  1115  NQKLYGVVWPGQSVKKAPG  1171
             NQKL+  +WPG+++K+  G
Sbjct  441   NQKLHTAIWPGETIKRPRG  459



>ref|XP_011008405.1| PREDICTED: glutamate receptor 3.4 isoform X1 [Populus euphratica]
 ref|XP_011008406.1| PREDICTED: glutamate receptor 3.4 isoform X1 [Populus euphratica]
 ref|XP_011008407.1| PREDICTED: glutamate receptor 3.4 isoform X1 [Populus euphratica]
Length=966

 Score =   461 bits (1185),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 258/404 (64%), Positives = 324/404 (80%), Gaps = 1/404 (0%)
 Frame = +3

Query  1164  PRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYAVPFQFV  1343
             PRGWVFP NGK LRI VP R+SY +F+S+       +G+ +DVF AA+NLLPY VP  ++
Sbjct  484   PRGWVFPENGKPLRIAVPNRISYVQFVSKDKNPPGVRGYCIDVFEAAINLLPYPVPHIYM  543

Query  1344  PFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPFKKL  1523
               G+G+ NP Y+E+V+ V+   +D A+GD+ IVTNRTK+VDFTQP+  SGL+VVAP K++
Sbjct  544   LHGDGKRNPVYNEIVQAVAEDRYDAAVGDVTIVTNRTKIVDFTQPFKESGLVVVAPVKEV  603

Query  1524  NTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSLSTL  1703
              +  WAFL PF+ QMW VT  FF++VG VVWILEHR+N EFRGSP+QQL TI WFS ST+
Sbjct  604   KSSPWAFLKPFTFQMWLVTGAFFLLVGAVVWILEHRINHEFRGSPRQQLTTIFWFSFSTM  663

Query  1704  FFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESLKEGNDP  1883
             FF+HRENTVSTLGR VLIIWLFVVLIINSSYTASLTSILTVQQL S I+G++SL  GN+P
Sbjct  664   FFSHRENTVSTLGRFVLIIWLFVVLIINSSYTASLTSILTVQQLTSRIEGIDSLAAGNEP  723

Query  1884  IGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERPYVENFL  2063
             IG Q GSFA +YLI+E+ I++SR++ L S E Y+  L+ GP+ GGV+AIVDE PY+E FL
Sbjct  724   IGVQDGSFARNYLIDELNIAESRIVTLKSQEEYSSFLQLGPNHGGVAAIVDELPYIELFL  783

Query  2064  S-TQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLtrtscs  2240
             S + C F+IVGQEFTKSGWGFAF RDSPLAVD+STAIL LSENGDLQ+IH+KWLT   CS
Sbjct  784   SASDCAFKIVGQEFTKSGWGFAFQRDSPLAVDLSTAILQLSENGDLQKIHNKWLTHADCS  843

Query  2241  sestelesDRLHLKSFWglfllcgaacflalfIYFVQIMLKFRR  2372
             ++  E++ + L LKSFWGLFL+CG ACF++L ++F  I+ ++RR
Sbjct  844   AQVNEIDENHLSLKSFWGLFLICGIACFISLVVFFCNIICQYRR  887


 Score =   451 bits (1159),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 215/381 (56%), Positives = 283/381 (74%), Gaps = 5/381 (1%)
 Frame = +2

Query  59    VAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTTQ  238
             V  L+ M  DVVA++GPQSS VAH ISHV NEL VPLLSFAATDPTL++LQ+PYFLRTTQ
Sbjct  113   VEVLQLMVNDVVAVIGPQSSGVAHIISHVVNELHVPLLSFAATDPTLSALQYPYFLRTTQ  172

Query  239   SDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGAT  418
             +D YQM AIAD++ ++GW+EVIA+F+DDDYGR GI+ L DALA KR KISYKA + PGA+
Sbjct  173   NDYYQMYAIADLVTYFGWREVIAIFVDDDYGRTGISILGDALAMKRAKISYKAALTPGAS  232

Query  419   TRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVLDS  598
             T ++I D+L+++  MESRV V+H  P +G  +FS A  L MM  GYVWI+TDWL +VLD+
Sbjct  233   T-SQISDLLLKVNQMESRVYVVHVNPDSGLSLFSTAKSLHMMTKGYVWIATDWLPSVLDA  291

Query  599   SSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLTG----GSLGLNSYALYAYDSV  766
               P+ ++ M ++QGV+ LR HT D++LK+ F S+W  L      G+ G NSYALYAYD+V
Sbjct  292   LEPVDTDTMNLLQGVIALRHHTQDTDLKKKFMSKWSSLNHKNSIGASGFNSYALYAYDTV  351

Query  767   WLIAHAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLT  946
             WL A A+D FL +G  +S+S+D KL    GS L+L ++ IFDGG   L  LL+ +F GL+
Sbjct  352   WLAARALDVFLGEGRNLSYSSDPKLHETNGSALNLSSMRIFDGGQEFLQTLLRMNFTGLS  411

Query  947   GQFKFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKL  1126
             GQ +F+ DK+LV P+YD+LN+ GTG R IG+W NYSGLST  PE LY++P N+S+++Q L
Sbjct  412   GQIQFDMDKNLVHPAYDVLNIGGTGSRRIGYWSNYSGLSTVTPEVLYTKPKNTSASSQHL  471

Query  1127  YGVVWPGQSVKKAPGVGFPEQ  1189
             Y V+WPG++     G  FPE 
Sbjct  472   YSVIWPGETSLVPRGWVFPEN  492



>ref|XP_009353269.1| PREDICTED: glutamate receptor 3.4-like [Pyrus x bretschneideri]
Length=952

 Score =   468 bits (1203),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 268/411 (65%), Positives = 329/411 (80%), Gaps = 2/411 (0%)
 Frame = +3

Query  1164  PRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYAVPFQFV  1343
             PRGWVFPNNG+ LRIGVP RVSYKEF+++       +G+ +DVF AAVNLLPYAVP  ++
Sbjct  471   PRGWVFPNNGRPLRIGVPYRVSYKEFVAKDKSPPGVRGYCIDVFEAAVNLLPYAVPRTYM  530

Query  1344  PFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPFKKL  1523
              +G+G+ NP YS LV  V+   FD A+GD+ I TNRT++VDFTQPY+ SGL+VV P K+ 
Sbjct  531   LYGDGKRNPEYSSLVAQVAQNNFDAAVGDVTITTNRTRIVDFTQPYMESGLVVVVPVKEA  590

Query  1524  NTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSLSTL  1703
              +  WAFL PF+ QMW VT  FF++VG VVWILEHR+N EFRG P QQL+TI WFS ST+
Sbjct  591   KSNPWAFLKPFTYQMWLVTGAFFLLVGAVVWILEHRINHEFRGPPSQQLMTIFWFSFSTM  650

Query  1704  FFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESLKEGNDP  1883
             FF+HRENTVSTLGR+VLIIWLFVVLIINSSYTASLTSILTVQQL S I+G++SL   ND 
Sbjct  651   FFSHRENTVSTLGRLVLIIWLFVVLIINSSYTASLTSILTVQQLTSRIEGIDSLISSNDR  710

Query  1884  IGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERPYVENFL  2063
             IG Q GSFA  YL++E+ I++SRL+ L   EAY +AL  GP +GGV+AIVDE PY+E F+
Sbjct  711   IGVQDGSFAWRYLVDEMNIAESRLVKLKDMEAYFKALTDGPRRGGVAAIVDELPYIELFM  770

Query  2064  S-TQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLtrtscs  2240
             S T+C FR VGQEFTKSGWGFAF RDSPLAVD+STAIL LSENGDLQ+IH+KWLT + CS
Sbjct  771   SNTKCAFRTVGQEFTKSGWGFAFQRDSPLAVDLSTAILQLSENGDLQKIHNKWLTHSECS  830

Query  2241  sestelesDRLHLKSFWglfllcgaacflalfIYFVQIMLKFRRVARAEPV  2393
             ++ TE+++D+L L SFWGLFL+CG ACFLAL ++F +I+ ++RR    EPV
Sbjct  831   TQLTEIDADQLSLTSFWGLFLICGIACFLALAVFFCRILCQYRRFT-PEPV  880


 Score =   444 bits (1141),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 209/378 (55%), Positives = 277/378 (73%), Gaps = 3/378 (1%)
 Frame = +2

Query  59    VAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTTQ  238
             V AL+ ++ DVVA +GPQSS +AH ISHV NEL VPLLSF ATDP+LA+LQ+PYF+RTTQ
Sbjct  104   VEALELVENDVVAAIGPQSSGIAHVISHVVNELHVPLLSFGATDPSLAALQYPYFVRTTQ  163

Query  239   SDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGAT  418
             SD++QM A+AD+++++GW+EVIA+F+DDDYGRNGI+ L DALA KR KISYKA   PGA 
Sbjct  164   SDLFQMHAVADLVEYFGWREVIAIFVDDDYGRNGISILGDALATKRSKISYKAAFSPGA-  222

Query  419   TRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVLDS  598
              +++I ++LV + LMESRV ++H  P +G  +FS+A  LGMM  GYVWI+TDWL + LDS
Sbjct  223   LKSDINELLVGVNLMESRVYIVHVNPDSGLTIFSIAKSLGMMTSGYVWIATDWLPSHLDS  282

Query  599   SSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLT-GGSLGLNSYALYAYDSVWLI  775
              +P   + M ++QGV+ LR HTPD++LK+ F SRW  L   G+   NSYALYAYDS+WL 
Sbjct  283   LNPPGPDTMNLLQGVVALRHHTPDTDLKKRFMSRWSKLKHEGTPSFNSYALYAYDSIWLA  342

Query  776   AHAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLTGQF  955
             A A+D F N+GG +SFSND +L+    STLHL +L IFDGG   L  +L+ +F G++GQ 
Sbjct  343   ARALDVFFNEGGNVSFSNDPRLKDTNRSTLHLTSLRIFDGGQKYLQTILKMNFTGISGQI  402

Query  956   KFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKLYGV  1135
             +F+ DK L+ P+YDILN+ GTG R +G+W N +GLS   PE LY +P N ++  Q LY V
Sbjct  403   EFDQDKYLLRPAYDILNIGGTGSRRVGYWSNSTGLSVIAPERLYKKPSNRNTTAQ-LYSV  461

Query  1136  VWPGQSVKKAPGVGFPEQ  1189
             +WPG+      G  FP  
Sbjct  462   IWPGEVTATPRGWVFPNN  479



>ref|XP_007217063.1| hypothetical protein PRUPE_ppa001079mg [Prunus persica]
 gb|EMJ18262.1| hypothetical protein PRUPE_ppa001079mg [Prunus persica]
Length=916

 Score =   473 bits (1217),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 267/404 (66%), Positives = 324/404 (80%), Gaps = 1/404 (0%)
 Frame = +3

Query  1164  PRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYAVPFQFV  1343
             PRGWVFPNNG  LRI VP RVSY++F+++       +G+ +DVF AAVNLLPYAVP  +V
Sbjct  442   PRGWVFPNNGTPLRIAVPYRVSYQDFVAKDKSPPGVRGYCIDVFEAAVNLLPYAVPRNYV  501

Query  1344  PFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPFKKL  1523
              +GNG+ NP YS LV  V+   FD A+GD+ I TNRT++VDFTQPY+ SGL+VV P K+ 
Sbjct  502   LYGNGKRNPEYSNLVFDVAQNNFDAAVGDVTITTNRTRIVDFTQPYMESGLVVVVPVKEQ  561

Query  1524  NTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSLSTL  1703
              T  WAFL PF+ QMW VT  FF+ VG VVWILEHRMN EFRG P++QL+TI WFS ST+
Sbjct  562   KTSPWAFLKPFTYQMWLVTGAFFLFVGAVVWILEHRMNQEFRGPPRKQLMTIFWFSFSTM  621

Query  1704  FFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESLKEGNDP  1883
             FF+HRENTVSTLGR+VLIIWLFVVLIINSSYTASLTSILTVQQL S I+G++SL   NDP
Sbjct  622   FFSHRENTVSTLGRLVLIIWLFVVLIINSSYTASLTSILTVQQLTSRIEGIDSLIASNDP  681

Query  1884  IGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERPYVENFL  2063
             IG Q GSFA  YL++E+ I++SRL+ L + E Y EAL+ GP +GGV+AIVDE PY+E F+
Sbjct  682   IGVQDGSFAWKYLVDELNIAESRLVKLKTMENYIEALQYGPKRGGVAAIVDELPYIELFM  741

Query  2064  S-TQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLtrtscs  2240
             S T+CKFR VGQEFTKSGWGFAF RDSPLAVD+STAIL LSENGDLQ+IH+KWLT   CS
Sbjct  742   SNTKCKFRTVGQEFTKSGWGFAFQRDSPLAVDLSTAILQLSENGDLQKIHNKWLTHNECS  801

Query  2241  sestelesDRLHLKSFWglfllcgaacflalfIYFVQIMLKFRR  2372
              +  E++SDRL L SFWGLFL+CG ACFL+L ++F +I+ ++RR
Sbjct  802   IQMNEVDSDRLSLTSFWGLFLICGVACFLSLTVFFCRILCQYRR  845


 Score =   438 bits (1127),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 215/378 (57%), Positives = 277/378 (73%), Gaps = 3/378 (1%)
 Frame = +2

Query  59    VAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTTQ  238
             V AL+ ++ DVVA +GPQSS +AH ISHV NEL VPLLSFAATDP+LA+LQ+PYF+RTTQ
Sbjct  75    VEALQLIEDDVVAAIGPQSSGIAHVISHVVNELHVPLLSFAATDPSLAALQYPYFVRTTQ  134

Query  239   SDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGAT  418
             SD +QM A+ADV++++GW+EVIA+F+DDD GRNGI+ L DALA KR KISYKA   PGA+
Sbjct  135   SDHFQMYAVADVVEYFGWREVIAIFVDDDCGRNGISILGDALAKKRSKISYKAAFSPGAS  194

Query  419   TRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVLDS  598
               A I ++LV + LMESRV V+H  P +G  +FSVA  LGMM  GYVWI+TDWL + LDS
Sbjct  195   KNA-ITELLVGVNLMESRVFVVHVNPDSGLTIFSVAKSLGMMTAGYVWIATDWLPSHLDS  253

Query  599   SSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLT-GGSLGLNSYALYAYDSVWLI  775
                   + M ++QGV+ LR HTPD++LK++F SRWK L   GS G NSYALYAYDS+WL 
Sbjct  254   LESPGLDTMNLVQGVVALRHHTPDTDLKKSFMSRWKKLKHEGSSGFNSYALYAYDSIWLA  313

Query  776   AHAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLTGQF  955
             A A++ F N+GG ISFS+D KL+    STLHL +L IFDGG   L  +L+ +F G++GQ 
Sbjct  314   ARALEVFFNEGGKISFSDDPKLKDTNRSTLHLTSLRIFDGGQQYLQTILKMNFTGVSGQI  373

Query  956   KFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKLYGV  1135
             +F+ DK LV P+Y+ILN+ GTG R IG+W N +GLS   PE LY + P S++   +LY V
Sbjct  374   QFDQDKYLVHPAYEILNIGGTGSRRIGYWSNSTGLSAIAPEILY-KMPFSANTTAQLYTV  432

Query  1136  VWPGQSVKKAPGVGFPEQ  1189
             +WPG++     G  FP  
Sbjct  433   IWPGETTAIPRGWVFPNN  450



>gb|KDO41668.1| hypothetical protein CISIN_1g002267mg [Citrus sinensis]
Length=834

 Score =   459 bits (1182),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 220/374 (59%), Positives = 276/374 (74%), Gaps = 5/374 (1%)
 Frame = +2

Query  77    MQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTTQSDMYQM  256
             M+ +VVA +GPQSS +AH ISHV NEL VPLLSF ATDPTL SLQ+PYFLRTTQSD YQM
Sbjct  1     MENEVVAAIGPQSSGIAHVISHVVNELNVPLLSFGATDPTLTSLQYPYFLRTTQSDYYQM  60

Query  257   MAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGATTRAEIM  436
              A+AD++++YGW+EVIA+F+DDDYGRNGI+ L DAL+ KR KISYKA   PGA +R+ I 
Sbjct  61    HAVADLVEYYGWREVIAIFVDDDYGRNGISVLGDALSKKRAKISYKAPFSPGA-SRSAIN  119

Query  437   DILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVLDSSSPLPS  616
              +LV   LMESRV V+H  P  G  +FSVA  LGM    YVWI+TDWL +VLDS+ P+  
Sbjct  120   SLLVGANLMESRVFVVHVNPDTGLTIFSVAKSLGMTAGSYVWIATDWLPSVLDSTEPVDI  179

Query  617   EKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLT---GGSLGLNSYALYAYDSVWLIAHAI  787
             + M ++QGV+ LR HTPD++LK+ F SRWK+L        G NSYALYAYDSVWL+AHA+
Sbjct  180   DTMNLLQGVVALRHHTPDTDLKKNFISRWKNLKYKENSPSGFNSYALYAYDSVWLVAHAL  239

Query  788   DSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLTGQFKFNN  967
             D+ LN+GG  +FSND KL    GS L+L +L +FDGG   L  LL+ +F GL+G+ +F+ 
Sbjct  240   DALLNEGGKFTFSNDPKLHDTNGSMLNLSSLRVFDGGQQFLQTLLRMNFTGLSGEIRFDA  299

Query  968   DKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKLYGVVWPG  1147
             DK+LV P+YD+LN+ GTG R IG+W NYSGLS   PE LY++PPNSSS N+ LY V+WPG
Sbjct  300   DKNLVNPAYDVLNIGGTGSRRIGYWSNYSGLSVVAPEILYTKPPNSSS-NRHLYSVIWPG  358

Query  1148  QSVKKAPGVGFPEQ  1189
             +      G  FP  
Sbjct  359   EITATPRGWVFPNN  372


 Score =   451 bits (1161),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 260/406 (64%), Positives = 319/406 (79%), Gaps = 3/406 (1%)
 Frame = +3

Query  1164  PRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYAVPFQFV  1343
             PRGWVFPNNG  LRI VP RVSY EF+++       KG+ +DVF AAVNLLPY VP  ++
Sbjct  364   PRGWVFPNNGMPLRIAVPNRVSYNEFVAKDKSPPGVKGYCIDVFEAAVNLLPYPVPHNYI  423

Query  1344  PFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPFKKL  1523
              +GNG+ NP Y+++V+ V+   FD A+GDI IVTNRTK+VDFTQPY+ SGL+VVAP +KL
Sbjct  424   MYGNGKRNPIYNDIVQQVALNKFDAAVGDITIVTNRTKLVDFTQPYMESGLVVVAPVQKL  483

Query  1524  NTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSLSTL  1703
              +  WAFL PF+  MW VT  FF+ VG VVWILEHR N+EFRG P QQL+TI WFS ST+
Sbjct  484   KSSPWAFLKPFTIPMWLVTGGFFLFVGAVVWILEHRFNNEFRGPPSQQLVTIFWFSFSTM  543

Query  1704  FFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESLKEGNDP  1883
             FF+HRENTVS+LGR+VLI+WLFVVLIINSSYTASLTSILTVQQL S I+G++SL    +P
Sbjct  544   FFSHRENTVSSLGRVVLIVWLFVVLIINSSYTASLTSILTVQQLTSQIEGIDSLISSTEP  603

Query  1884  IGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERPYVENFL  2063
             IG Q GSFA +YL++E+ I++SRL+ L + E Y+ AL +GP  GGV+AIVDE PY+E F+
Sbjct  604   IGVQDGSFAWNYLVDELKIAESRLVKLKNMEEYSIALARGPKGGGVAAIVDELPYIELFM  663

Query  2064  S-TQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLtrtscs  2240
             S T C+FR VGQEFTKSGWGFAF RDSPLA+D+STAIL LSENGDLQ+IH+KWLT   CS
Sbjct  664   SKTNCEFRTVGQEFTKSGWGFAFQRDSPLAIDLSTAILQLSENGDLQKIHNKWLTYNECS  723

Query  2241  sestele--sDRLHLKSFWglfllcgaacflalfIYFVQIMLKFRR  2372
              + +  +    RL LKSFWGLFL+CG ACFLAL  +F ++  +FRR
Sbjct  724   MDLSPADGGGSRLSLKSFWGLFLICGIACFLALIFFFCRVCGQFRR  769



>ref|XP_002301627.1| Glutamate receptor 3.5 precursor family protein [Populus trichocarpa]
 gb|EEE80900.1| Glutamate receptor 3.5 precursor family protein [Populus trichocarpa]
Length=956

 Score =   467 bits (1201),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 259/404 (64%), Positives = 326/404 (81%), Gaps = 1/404 (0%)
 Frame = +3

Query  1164  PRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYAVPFQFV  1343
             PRGWVFP NGK LRI VP R+SY +F+S+       +G+ +DVF AA+NLLPY VP  +V
Sbjct  484   PRGWVFPENGKPLRIAVPNRISYVQFVSKDRNPPGVRGYCIDVFEAAINLLPYPVPHMYV  543

Query  1344  PFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPFKKL  1523
               GNG+ NP Y+E+V+ V+   +D A+GD+ IVTNRTK+VDFTQP++ SGL+VVAP K++
Sbjct  544   LHGNGKRNPVYNEIVQAVAEDRYDAAVGDVTIVTNRTKIVDFTQPFMESGLVVVAPVKEV  603

Query  1524  NTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSLSTL  1703
              +  WAFL PF+ QMW VT  FF++VG VVWILEHR+N EFRGSP+QQL+TI WFS ST+
Sbjct  604   QSSPWAFLKPFTFQMWLVTGAFFLLVGAVVWILEHRINHEFRGSPRQQLMTIFWFSFSTM  663

Query  1704  FFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESLKEGNDP  1883
             FF+HRENT+STLGR VLIIWLFVVLIINSSYTASLTSILTVQQL S I+G++SL  GN+P
Sbjct  664   FFSHRENTLSTLGRFVLIIWLFVVLIINSSYTASLTSILTVQQLTSRIEGIDSLAAGNEP  723

Query  1884  IGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERPYVENFL  2063
             IG Q GSFA +YLI+E+ I++SRL+ L S E Y+  L+ GP++GGV+AIVDE PY+E FL
Sbjct  724   IGVQDGSFARNYLIDELNIAESRLVILKSQEEYSTFLQLGPNRGGVAAIVDELPYIELFL  783

Query  2064  S-TQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLtrtscs  2240
             S + C F+IVGQEFTKSGWGFAF RDSPLAVD+STAIL LSENGDLQ+IH+KWLT   CS
Sbjct  784   SASNCAFKIVGQEFTKSGWGFAFQRDSPLAVDLSTAILQLSENGDLQKIHNKWLTHADCS  843

Query  2241  sestelesDRLHLKSFWglfllcgaacflalfIYFVQIMLKFRR  2372
             ++  E++ + L LKSFWGLFL+CG AC ++L ++F  I+ ++RR
Sbjct  844   AQGNEIDENHLSLKSFWGLFLICGIACSISLVVFFCNIICQYRR  887


 Score =   442 bits (1136),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 211/381 (55%), Positives = 281/381 (74%), Gaps = 5/381 (1%)
 Frame = +2

Query  59    VAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTTQ  238
             V  L+ M  DVVA++GPQSS VAH ISHV NEL V LLSFAATDPTL++LQ+PYFLRTTQ
Sbjct  113   VEVLQLMVNDVVAVIGPQSSGVAHIISHVVNELHVTLLSFAATDPTLSALQYPYFLRTTQ  172

Query  239   SDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGAT  418
             +D +QM AIAD++ ++GW+EVIA+F+DDDYGR+GI+ L DALA KR KISYKA + P A+
Sbjct  173   NDYFQMYAIADIVTYFGWREVIAIFVDDDYGRSGISILGDALAMKRAKISYKAALAPRAS  232

Query  419   TRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVLDS  598
              R++I D+L+++  MESRV V+H  P +G  +FS A  L MM  GYVWI+TDWL +VLD+
Sbjct  233   -RSQISDLLLKVNQMESRVYVVHVNPDSGLSLFSTAKSLHMMTKGYVWIATDWLPSVLDA  291

Query  599   SSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLTG----GSLGLNSYALYAYDSV  766
               P  ++ M ++QGV+ LR HT D++LK+ F S+W  L      G+ G NSYALYAYD+V
Sbjct  292   LEPDDTDTMNLLQGVIALRHHTQDTDLKKKFMSKWSSLNHKNSIGASGFNSYALYAYDTV  351

Query  767   WLIAHAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLT  946
             WL A A+D FLN+G  +S+S+D KL    GS L+L ++ IFDGG   L  LL+ +F GL+
Sbjct  352   WLAARALDVFLNEGRNLSYSSDPKLNDTNGSALNLSSMRIFDGGQEFLQTLLRMNFTGLS  411

Query  947   GQFKFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKL  1126
             GQ +F+ DK+LV P+YD+LN+ GTG R IG+W +YSGLST  PE LY++P N+S+++Q L
Sbjct  412   GQIQFDMDKNLVHPAYDVLNIGGTGSRRIGYWSDYSGLSTVTPEVLYTKPKNTSASSQHL  471

Query  1127  YGVVWPGQSVKKAPGVGFPEQ  1189
             Y  +WPG++     G  FPE 
Sbjct  472   YSAIWPGETSLVPRGWVFPEN  492



>ref|XP_004487403.1| PREDICTED: glutamate receptor 3.4-like isoform X1 [Cicer arietinum]
 ref|XP_004487404.1| PREDICTED: glutamate receptor 3.4-like isoform X2 [Cicer arietinum]
 ref|XP_004487405.1| PREDICTED: glutamate receptor 3.4-like isoform X3 [Cicer arietinum]
Length=932

 Score =   456 bits (1172),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 214/378 (57%), Positives = 284/378 (75%), Gaps = 2/378 (1%)
 Frame = +2

Query  59    VAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTTQ  238
             V AL+ M+ +VVA +GPQSS +AH ISHV NEL VPLLSF ATDPTL+SLQ+PYF+RTTQ
Sbjct  97    VEALQLMENEVVAAIGPQSSGIAHVISHVVNELHVPLLSFGATDPTLSSLQYPYFVRTTQ  156

Query  239   SDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGAT  418
             +D +QM AIAD++D+Y W+EVIA+F+DDD GRNGI+ L DAL+ KR KISYKA + PGAT
Sbjct  157   NDYFQMYAIADIVDYYRWREVIAIFVDDDNGRNGISVLGDALSKKRAKISYKAALSPGAT  216

Query  419   TRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVLDS  598
               ++I D+L  + LMESRV ++H  P +G ++FS+A  LGMM  GYVWI+TDWL + LDS
Sbjct  217   -ESDIGDLLNGVNLMESRVFIIHVNPDSGLVIFSIAKKLGMMTSGYVWIATDWLPSTLDS  275

Query  599   SSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLTG-GSLGLNSYALYAYDSVWLI  775
                + S  + ++QGV+ LR HTPD+ LK++F SR K++ G  +   NSYALYAYD+VWL 
Sbjct  276   METVDSNTLSLLQGVVALRHHTPDTNLKKSFFSRLKNMKGMETSSFNSYALYAYDAVWLA  335

Query  776   AHAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLTGQF  955
             A+A+D+F+ +GG ISFS+D KL   +GS LHL +L +F+GGPL L  + + +F GL+GQ 
Sbjct  336   AYALDTFIKEGGNISFSSDPKLLDTKGSMLHLSSLRVFEGGPLFLPTIFRMNFTGLSGQI  395

Query  956   KFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKLYGV  1135
             +F+ +K+LV PSYDILN+   G R IG+W NYSGLS   PE LY +PPN+S++NQKL+ V
Sbjct  396   QFDAEKNLVHPSYDILNIGDAGSRRIGYWSNYSGLSVLSPENLYKKPPNTSTSNQKLFSV  455

Query  1136  VWPGQSVKKAPGVGFPEQ  1189
             VWPG++     G  FP  
Sbjct  456   VWPGETTATPRGWVFPNN  473


 Score =   452 bits (1162),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 241/377 (64%), Positives = 298/377 (79%), Gaps = 1/377 (0%)
 Frame = +3

Query  1164  PRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYAVPFQFV  1343
             PRGWVFPNNG+QLRI VP R+SY EF+S+       +G+ +DVF AA+NLLPY VP +++
Sbjct  465   PRGWVFPNNGRQLRIAVPHRISYLEFVSKDKNPPGVRGYCIDVFEAAINLLPYPVPRRYI  524

Query  1344  PFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPFKKL  1523
              +G+G  NP+Y++LV  V+   +D  +GDI IV NRT+++DFTQP++ SGL+VV P K++
Sbjct  525   LYGDGNRNPNYNQLVNDVALNIYDATVGDITIVPNRTRILDFTQPFMESGLVVVVPVKEI  584

Query  1524  NTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSLSTL  1703
              +  W+FL PF+AQMW VT  FF+ VGIVVWILEHR N EFRGSPK+QL+TI WF+ ST+
Sbjct  585   KSSPWSFLKPFTAQMWCVTGAFFLFVGIVVWILEHRHNPEFRGSPKKQLMTIFWFTFSTM  644

Query  1704  FFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESLKEGNDP  1883
             FF+HRENTVS LGR VLIIWLFVVLIINSSYTASLTSILTVQQL S I+G++SL  G  P
Sbjct  645   FFSHRENTVSGLGRFVLIIWLFVVLIINSSYTASLTSILTVQQLSSQIEGIDSLISGTQP  704

Query  1884  IGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERPYVENFL  2063
             IG Q GSFA  YLI+E+ I  SR++ L  P+AY +AL +GP  GGV AIVDE PY+E F+
Sbjct  705   IGIQDGSFARRYLIDELNIQPSRIVTLRDPKAYIDALMRGPSGGGVMAIVDELPYIELFM  764

Query  2064  -STQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLtrtscs  2240
              ST CKFR VGQEFTKSGWGFAF RDSPLAVDMSTAIL LSENGDLQ+IHDKWL +  C+
Sbjct  765   SSTNCKFRTVGQEFTKSGWGFAFQRDSPLAVDMSTAILQLSENGDLQKIHDKWLLKHDCT  824

Query  2241  sestelesDRLHLKSFW  2291
             ++  +++S+ L L SFW
Sbjct  825   AKVDDVDSNELSLNSFW  841



>ref|XP_007149970.1| hypothetical protein PHAVU_005G114800g [Phaseolus vulgaris]
 gb|ESW21964.1| hypothetical protein PHAVU_005G114800g [Phaseolus vulgaris]
Length=946

 Score =   454 bits (1169),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 212/376 (56%), Positives = 281/376 (75%), Gaps = 2/376 (1%)
 Frame = +2

Query  59    VAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTTQ  238
             + AL+ M+ +V+A +GPQSS +AH ISHVANEL VPL+SF ATDP+L+SLQ+PYF+R+TQ
Sbjct  107   MEALQLMEDEVIAAIGPQSSGIAHVISHVANELHVPLVSFGATDPSLSSLQYPYFVRSTQ  166

Query  239   SDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGAT  418
             SD YQM AIA ++D+Y W+E+IA+++DDD GRNGI+ L DALA KR KISYKA  PPGA 
Sbjct  167   SDYYQMYAIATLVDYYRWREIIAIYVDDDNGRNGISVLGDALAKKRAKISYKAAFPPGAL  226

Query  419   TRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVLDS  598
              + +I D+L  + LMESRV VLHA P     +FS+A  LGMM DGYVWI+TD L++ LDS
Sbjct  227   -KKDISDLLNGVNLMESRVFVLHANPETCLSIFSIAEKLGMMDDGYVWIATDSLASALDS  285

Query  599   SSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLTGGSL-GLNSYALYAYDSVWLI  775
               P+  + + ++QGVL LR HTPD+  K+ F SR K L        NSYALYAYD+VWL+
Sbjct  286   IEPVDPKTLNLLQGVLALRHHTPDTNEKKNFFSRMKRLINKETPSFNSYALYAYDTVWLV  345

Query  776   AHAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLTGQF  955
             A A+D+FL +GGV+SFS D KL    GSTLHLE+L +FD GP  L  +L++++ GLTG  
Sbjct  346   ARALDAFLKEGGVVSFSPDPKLSDTNGSTLHLESLHVFDEGPTFLQTILRTNYTGLTGLV  405

Query  956   KFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKLYGV  1135
             +F+N+++ + P+YDILN+ G+G R IG+W NYSGLS   PE LY +PPN+S+++QKLY V
Sbjct  406   QFDNERNRIHPAYDILNIGGSGMRRIGYWSNYSGLSVVAPEILYKKPPNTSTSSQKLYDV  465

Query  1136  VWPGQSVKKAPGVGFP  1183
             +WPG++  K  G  FP
Sbjct  466   IWPGETAVKPRGWVFP  481


 Score =   452 bits (1164),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 254/405 (63%), Positives = 312/405 (77%), Gaps = 1/405 (0%)
 Frame = +3

Query  1161  KPRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYAVPFQF  1340
             KPRGWVFPNNGK LRI VP RVSY EF+S+       +G+ +DVF AA+NLLPY VP ++
Sbjct  474   KPRGWVFPNNGKPLRIAVPNRVSYLEFVSKDKNPPGVRGYCIDVFEAAINLLPYPVPREY  533

Query  1341  VPFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPFKK  1520
             + FG G  NPSY +L   V    +D A+GD+ IV NRT+ +DFTQPY+ SGL+VV P K+
Sbjct  534   ILFGPGNRNPSYDDLASQVELNTYDAAVGDVTIVPNRTRFLDFTQPYIESGLVVVVPVKE  593

Query  1521  LNTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSLST  1700
             + +  W+FL PF+AQMW VT  FFV+VG VVWILEHR N EFRG PK+QL+T+ WFS ST
Sbjct  594   IKSSPWSFLKPFTAQMWCVTGAFFVLVGTVVWILEHRHNPEFRGRPKKQLMTVFWFSFST  653

Query  1701  LFFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESLKEGND  1880
             +FF+HRENTVS LGR+VLIIWLFVVLIINSSYTASLTSILTVQQL S I+G++SL   N 
Sbjct  654   MFFSHRENTVSGLGRLVLIIWLFVVLIINSSYTASLTSILTVQQLSSQIEGIDSLISSNQ  713

Query  1881  PIGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERPYVENF  2060
             PIG Q GSFA  YL EE+ +  SR++ L + EAY +ALE+GP  GGV A+VDE PY+E  
Sbjct  714   PIGIQEGSFARKYLTEELNVQPSRIVTLKNMEAYIDALERGPKDGGVVAVVDELPYIEIL  773

Query  2061  LS-TQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLtrtsc  2237
             +S T CKFR VGQEFTKSGWGFAF RDSPLAVDMSTAIL LSENGDLQ+IHDKWL +  C
Sbjct  774   MSNTNCKFRTVGQEFTKSGWGFAFQRDSPLAVDMSTAILQLSENGDLQKIHDKWLLKQDC  833

Query  2238  ssestelesDRLHLKSFWglfllcgaacflalfIYFVQIMLKFRR  2372
             S++   ++ ++L L SFWGLFL+CG AC LAL  +F +++ ++ +
Sbjct  834   STQENNVDLNKLSLSSFWGLFLICGIACLLALIAFFTRVLCQYTK  878



>ref|NP_190716.3| glutamate receptor 3.6 [Arabidopsis thaliana]
 sp|Q84W41.1|GLR36_ARATH RecName: Full=Glutamate receptor 3.6; AltName: Full=Ligand-gated 
ion channel 3.6; Flags: Precursor [Arabidopsis thaliana]
 gb|AAO42266.1| putative glutamate receptor [Arabidopsis thaliana]
 gb|AEE78797.1| glutamate receptor 3.6 [Arabidopsis thaliana]
Length=903

 Score =   469 bits (1206),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 263/403 (65%), Positives = 315/403 (78%), Gaps = 1/403 (0%)
 Frame = +3

Query  1158  KKPRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYAVPFQ  1337
             K PRGWVF NNG+ LRIGVP R  ++E +S V       GF VDVF AA+NLLPYAVPF+
Sbjct  444   KIPRGWVFSNNGRHLRIGVPNRYRFEEVVS-VKSNGMITGFCVDVFIAAINLLPYAVPFE  502

Query  1338  FVPFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPFK  1517
              V FGNG +NPS SELVRL++TG +D  +GDI I+T RTK+ DFTQPYV SGL+VVAP +
Sbjct  503   LVAFGNGHDNPSNSELVRLITTGVYDAGVGDITIITERTKMADFTQPYVESGLVVVAPVR  562

Query  1518  KLNTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSLS  1697
             KL + A AFL PF+ QMW + A  F++VG V+W LEH+ NDEFRG P++Q+IT  WFS S
Sbjct  563   KLGSSAMAFLRPFTPQMWLIAAASFLIVGAVIWCLEHKHNDEFRGPPRRQVITTFWFSFS  622

Query  1698  TLFFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESLKEGN  1877
             TLFF+HRE T S LGR+VLIIWLFVVLIINSSYTASLTSILTV QL SPIKG+E+L+  +
Sbjct  623   TLFFSHRETTTSNLGRIVLIIWLFVVLIINSSYTASLTSILTVHQLSSPIKGIETLQTNH  682

Query  1878  DPIGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERPYVEN  2057
             DPIGY  GSF   YLI E+ I  SRL+ L SPE Y +AL  GP KGGV+A+VDER Y+E 
Sbjct  683   DPIGYPQGSFVRDYLIHELNIHVSRLVPLRSPEEYDKALRDGPGKGGVAAVVDERAYIEL  742

Query  2058  FLSTQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLtrtsc  2237
             FLS +C+F IVGQEFTK+GWGFAFPR+SPLAVD+S AIL LSENGD+QRI DKWL R +C
Sbjct  743   FLSNRCEFGIVGQEFTKNGWGFAFPRNSPLAVDVSAAILQLSENGDMQRIRDKWLLRKAC  802

Query  2238  ssestelesDRLHLKSFWglfllcgaacflalfIYFVQIMLKF  2366
             S +  E+E DRL LKSFWGLF++CG AC LAL +Y V ++ +F
Sbjct  803   SLQGAEIEVDRLELKSFWGLFVVCGVACVLALAVYTVLMIRQF  845


 Score =   437 bits (1125),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 199/372 (53%), Positives = 283/372 (76%), Gaps = 7/372 (2%)
 Frame = +2

Query  56    LVAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTT  235
             ++  L+FM+++ VAI+GPQ S  A  ++HVA EL++P+LSF+ATDPT++ LQFP+F+RT+
Sbjct  84    IMEPLQFMESETVAIIGPQRSTTARVVAHVATELKIPILSFSATDPTMSPLQFPFFIRTS  143

Query  236   QSDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGA  415
             Q+D++QM AIAD++  YGW+EV+A++ DDDYGRNG+AAL D L+ KRC+ISYKA +PP A
Sbjct  144   QNDLFQMAAIADIVQFYGWREVVAIYGDDDYGRNGVAALGDRLSEKRCRISYKAALPP-A  202

Query  416   TTRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVLD  595
              TR  I D+L+++AL ESR++V+HA    G  +F+VA  LGMM  GYVWI+T+WLST++D
Sbjct  203   PTRENITDLLIKVALSESRIIVVHASFIWGLELFNVARNLGMMSTGYVWIATNWLSTIID  262

Query  596   SSSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLTGGSLGLNSYALYAYDSVWLI  775
             + SPLP + +  +QGV+ LR HTP+S +K+ F  RW +LT   +GL++YALYAYD+VWL+
Sbjct  263   TDSPLPLDTINNIQGVITLRLHTPNSIMKQNFVQRWHNLT--HVGLSTYALYAYDTVWLL  320

Query  776   AHAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLTGQF  955
             A AID F  KGG +SFS +  +  + G  LHL+AL +FDGG + L ++LQ D +GLTG+ 
Sbjct  321   AQAIDDFFKKGGNVSFSKNPIISELGGGNLHLDALKVFDGGKIFLESILQVDRIGLTGRM  380

Query  956   KFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKLYGV  1135
             KF +D++LV P++D+LNVIGTG+ TIG+W N+SGLS  P + +     N+S + QKL+ V
Sbjct  381   KFTSDRNLVNPAFDVLNVIGTGYTTIGYWFNHSGLSVMPADEM----ENTSFSGQKLHSV  436

Query  1136  VWPGQSVKKAPG  1171
             VWPG S+K   G
Sbjct  437   VWPGHSIKIPRG  448



>ref|XP_009115834.1| PREDICTED: glutamate receptor 3.6 isoform X1 [Brassica rapa]
 ref|XP_009115835.1| PREDICTED: glutamate receptor 3.6 isoform X1 [Brassica rapa]
Length=940

 Score =   467 bits (1201),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 261/408 (64%), Positives = 316/408 (77%), Gaps = 1/408 (0%)
 Frame = +3

Query  1164  PRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYAVPFQFV  1343
             PRGWVF NNG+ LRIGVP R  ++E +S V       GF VDVF AA++LLPYAVP++ V
Sbjct  492   PRGWVFSNNGRHLRIGVPNRYRFEEVVS-VQSNGIITGFCVDVFVAALSLLPYAVPYELV  550

Query  1344  PFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPFKKL  1523
               G+G +NPS SELVRL++ G FD  +GDI I+T RTK+ DFTQPYV SGL+VVAP +KL
Sbjct  551   ALGDGHDNPSNSELVRLITAGVFDAGVGDITIITERTKMADFTQPYVESGLVVVAPVRKL  610

Query  1524  NTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSLSTL  1703
              + A AFL PF+ QMW + A  F++VG V+W LEH+ NDEFRG P++Q+IT  WFS STL
Sbjct  611   GSNAMAFLRPFTPQMWLIAASSFLIVGAVIWCLEHKHNDEFRGPPRRQVITTFWFSFSTL  670

Query  1704  FFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESLKEGNDP  1883
             FF+HRE TVS LGR+VL+IWLF+VLIINSSYTASLTSILTV QL SPIKG+E+L+  NDP
Sbjct  671   FFSHRETTVSNLGRIVLLIWLFIVLIINSSYTASLTSILTVHQLSSPIKGIETLQTNNDP  730

Query  1884  IGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERPYVENFL  2063
             IGY  GSF   YL+ E+ I +SRL+ L SPE Y +AL  GP KGGV+AIV ER Y+E FL
Sbjct  731   IGYPQGSFVRDYLVNELRIHESRLVPLWSPEEYEKALRDGPGKGGVAAIVGERAYIELFL  790

Query  2064  STQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLtrtscss  2243
             S +C+F IVGQEFTK+GWGFAFPR+SPLAVD+STAIL LSENGDLQRI DKWL R +CS 
Sbjct  791   SNRCEFGIVGQEFTKTGWGFAFPRNSPLAVDVSTAILQLSENGDLQRIRDKWLLRKACSL  850

Query  2244  estelesDRLHLKSFWglfllcgaacflalfIYFVQIMLKFRRVARAE  2387
             +  E+E DRL LKSFWGLF++CG AC +AL +Y V ++ KF R    E
Sbjct  851   QGAEIEVDRLELKSFWGLFVVCGLACVVALAVYIVMMIRKFGRHCPVE  898


 Score =   438 bits (1126),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 201/373 (54%), Positives = 282/373 (76%), Gaps = 12/373 (3%)
 Frame = +2

Query  56    LVAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTT  235
             ++  L+FM+   VAI+GPQ    A  +SHVA EL++P+LSF ATDPT++  QFP+F+RT+
Sbjct  133   IMEPLRFMENKTVAIIGPQRPTSARVVSHVATELKIPILSFTATDPTMSPRQFPFFIRTS  192

Query  236   QSDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGA  415
             Q+D++QM AIAD++ HYGW+EVIA++ DDDYG+NG+AAL D LA KRC+ISYKA +PP  
Sbjct  193   QNDLFQMAAIADIVHHYGWREVIAIYGDDDYGQNGVAALGDKLAEKRCRISYKAALPP-E  251

Query  416   TTRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVLD  595
              TR  I ++L+++AL ESR++V+HAY   G  VF+VA YLGMM  GYVWI+T+WLST++D
Sbjct  252   PTRENITNLLIKVALSESRIIVVHAYFIWGLEVFNVAQYLGMMSSGYVWIATNWLSTIID  311

Query  596   SSS-PLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLTGGSLGLNSYALYAYDSVWL  772
             ++S PLP+     +QGV+ LR HTPDS +K++F  RW+++T  ++GL++Y LYAYD+VWL
Sbjct  312   TNSPPLPNN----IQGVIALRLHTPDSVMKKSFVQRWRNVT--NVGLSTYGLYAYDTVWL  365

Query  773   IAHAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLTGQ  952
             +AHAID +L +GG +SFS    +  + G  LHL+AL +FDGG + L ++L+ D VGLTG+
Sbjct  366   LAHAIDDYLQRGGNVSFSTSPIVSELRGGNLHLDALKVFDGGNVFLESILKVDRVGLTGR  425

Query  953   FKFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKLYG  1132
              KF  D++LV PS+D++NVIGTG RT+G+W ++ GLS  PPE L     N+SS+ QKL+ 
Sbjct  426   MKFTKDRNLVNPSFDVINVIGTGHRTVGYWSDHLGLSVMPPEEL----ENASSSGQKLHS  481

Query  1133  VVWPGQSVKKAPG  1171
             VVWPGQ+     G
Sbjct  482   VVWPGQTTHTPRG  494



>ref|XP_002876089.1| ATGLR3.6 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH52348.1| ATGLR3.6 [Arabidopsis lyrata subsp. lyrata]
Length=903

 Score =   471 bits (1212),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 265/408 (65%), Positives = 317/408 (78%), Gaps = 1/408 (0%)
 Frame = +3

Query  1164  PRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYAVPFQFV  1343
             PRGWVF NNG+ LRIGVP R  ++E +S V       GF VDVF AA+NLLPYAVPF+ V
Sbjct  446   PRGWVFSNNGRHLRIGVPNRYRFEEVVS-VKSNGMITGFCVDVFIAAINLLPYAVPFELV  504

Query  1344  PFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPFKKL  1523
              FGNG +NPS SELVRL++TG +D  +GDI I+T RTK+ DFTQPYV SGL+VVAP +KL
Sbjct  505   AFGNGHDNPSNSELVRLITTGVYDAGVGDITIITERTKMADFTQPYVESGLVVVAPVRKL  564

Query  1524  NTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSLSTL  1703
              + A AFL PF+ QMW V A  F++VG V+W LEH+ NDEFRG P++Q+IT  WFS STL
Sbjct  565   GSSAMAFLRPFTPQMWLVAAASFLIVGAVIWCLEHKHNDEFRGPPRRQVITTFWFSFSTL  624

Query  1704  FFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESLKEGNDP  1883
             FF+HRE T S LGR+VLIIWLFVVLIINSSYTASLTSILTV QL SPIKG+E+L+  +DP
Sbjct  625   FFSHRETTTSNLGRIVLIIWLFVVLIINSSYTASLTSILTVHQLSSPIKGIETLQTNHDP  684

Query  1884  IGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERPYVENFL  2063
             IGY  GSF   YL+ E+ I  SRL+ L SPE Y +AL  GP KGGV+A+VDER Y+E FL
Sbjct  685   IGYPQGSFVRDYLVNELNIHVSRLVPLRSPEEYDKALRDGPGKGGVAAVVDERAYIELFL  744

Query  2064  STQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLtrtscss  2243
             S +C+F IVGQEFTK+GWGFAFPR+SPLAVD+S AIL LSENGD+QRI DKWL R +CS 
Sbjct  745   SNRCEFGIVGQEFTKNGWGFAFPRNSPLAVDVSAAILQLSENGDMQRIRDKWLLRKACSL  804

Query  2244  estelesDRLHLKSFWglfllcgaacflalfIYFVQIMLKFRRVARAE  2387
             +  E+E DRL LKSFWGLF++CG AC LAL +Y V ++ +FRR    E
Sbjct  805   QGAEIEVDRLELKSFWGLFVVCGVACVLALAVYTVLMIRQFRRQCPEE  852


 Score =   432 bits (1112),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 196/372 (53%), Positives = 279/372 (75%), Gaps = 7/372 (2%)
 Frame = +2

Query  56    LVAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTT  235
             ++  L+FM+++ VAI+GPQ S  A  ++HVA EL++P+LSF+ATDPT++ LQFP+F+RT+
Sbjct  84    IMEPLQFMESETVAIIGPQRSTTARVVAHVATELKIPILSFSATDPTMSPLQFPFFIRTS  143

Query  236   QSDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGA  415
             Q+D++QM AIAD++  YGW+EV+A++ DDDYGRNG+AAL D LA KRC+ISYKA +PP  
Sbjct  144   QNDLFQMAAIADIVQFYGWREVVAIYGDDDYGRNGVAALGDRLAEKRCRISYKAALPP-Q  202

Query  416   TTRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVLD  595
              TR  I D+L+++AL ESR++V+HA    G  +F VA  LGMM  GYVWI+T+WLST++D
Sbjct  203   PTRENITDLLIKVALSESRIIVVHASFIWGLELFHVAQNLGMMSTGYVWIATNWLSTIID  262

Query  596   SSSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLTGGSLGLNSYALYAYDSVWLI  775
             + SPLP + +  +QGV+ LR HTP+S +K+ F  RW +LT   +GL++Y LYAYD+VWL+
Sbjct  263   TDSPLPVDTINNIQGVIALRLHTPNSIMKQNFVQRWHNLT--HVGLSTYGLYAYDTVWLL  320

Query  776   AHAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLTGQF  955
             AHAID F  KGG +SFS +  +  + G  LHL+AL +FDGG + L ++LQ D +GLTG+ 
Sbjct  321   AHAIDDFFQKGGSVSFSKNPIISELGGGNLHLDALKVFDGGNIFLESILQVDRIGLTGRM  380

Query  956   KFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKLYGV  1135
             KF  D++LV P++D+LNVIGTG+ TIG+W N+ GLS  P + L     N+S + QKL+ V
Sbjct  381   KFTRDRNLVNPAFDVLNVIGTGYTTIGYWYNHLGLSAMPADEL----ENTSFSGQKLHSV  436

Query  1136  VWPGQSVKKAPG  1171
             +WPG +++   G
Sbjct  437   IWPGHTIQIPRG  448



>ref|XP_004487406.1| PREDICTED: glutamate receptor 3.4-like isoform X4 [Cicer arietinum]
 ref|XP_004487407.1| PREDICTED: glutamate receptor 3.4-like isoform X5 [Cicer arietinum]
Length=904

 Score =   452 bits (1162),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 212/374 (57%), Positives = 281/374 (75%), Gaps = 2/374 (1%)
 Frame = +2

Query  71    KFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTTQSDMY  250
             K M+ +VVA +GPQSS +AH ISHV NEL VPLLSF ATDPTL+SLQ+PYF+RTTQ+D +
Sbjct  73    KLMENEVVAAIGPQSSGIAHVISHVVNELHVPLLSFGATDPTLSSLQYPYFVRTTQNDYF  132

Query  251   QMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGATTRAE  430
             QM AIAD++D+Y W+EVIA+F+DDD GRNGI+ L DAL+ KR KISYKA + PGAT  ++
Sbjct  133   QMYAIADIVDYYRWREVIAIFVDDDNGRNGISVLGDALSKKRAKISYKAALSPGAT-ESD  191

Query  431   IMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVLDSSSPL  610
             I D+L  + LMESRV ++H  P +G ++FS+A  LGMM  GYVWI+TDWL + LDS   +
Sbjct  192   IGDLLNGVNLMESRVFIIHVNPDSGLVIFSIAKKLGMMTSGYVWIATDWLPSTLDSMETV  251

Query  611   PSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLTG-GSLGLNSYALYAYDSVWLIAHAI  787
              S  + ++QGV+ LR HTPD+ LK++F SR K++ G  +   NSYALYAYD+VWL A+A+
Sbjct  252   DSNTLSLLQGVVALRHHTPDTNLKKSFFSRLKNMKGMETSSFNSYALYAYDAVWLAAYAL  311

Query  788   DSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLTGQFKFNN  967
             D+F+ +GG ISFS+D KL   +GS LHL +L +F+GGPL L  + + +F GL+GQ +F+ 
Sbjct  312   DTFIKEGGNISFSSDPKLLDTKGSMLHLSSLRVFEGGPLFLPTIFRMNFTGLSGQIQFDA  371

Query  968   DKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKLYGVVWPG  1147
             +K+LV PSYDILN+   G R IG+W NYSGLS   PE LY +PPN+S++NQKL+ VVWPG
Sbjct  372   EKNLVHPSYDILNIGDAGSRRIGYWSNYSGLSVLSPENLYKKPPNTSTSNQKLFSVVWPG  431

Query  1148  QSVKKAPGVGFPEQ  1189
             ++     G  FP  
Sbjct  432   ETTATPRGWVFPNN  445


 Score =   451 bits (1161),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 241/377 (64%), Positives = 298/377 (79%), Gaps = 1/377 (0%)
 Frame = +3

Query  1164  PRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYAVPFQFV  1343
             PRGWVFPNNG+QLRI VP R+SY EF+S+       +G+ +DVF AA+NLLPY VP +++
Sbjct  437   PRGWVFPNNGRQLRIAVPHRISYLEFVSKDKNPPGVRGYCIDVFEAAINLLPYPVPRRYI  496

Query  1344  PFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPFKKL  1523
              +G+G  NP+Y++LV  V+   +D  +GDI IV NRT+++DFTQP++ SGL+VV P K++
Sbjct  497   LYGDGNRNPNYNQLVNDVALNIYDATVGDITIVPNRTRILDFTQPFMESGLVVVVPVKEI  556

Query  1524  NTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSLSTL  1703
              +  W+FL PF+AQMW VT  FF+ VGIVVWILEHR N EFRGSPK+QL+TI WF+ ST+
Sbjct  557   KSSPWSFLKPFTAQMWCVTGAFFLFVGIVVWILEHRHNPEFRGSPKKQLMTIFWFTFSTM  616

Query  1704  FFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESLKEGNDP  1883
             FF+HRENTVS LGR VLIIWLFVVLIINSSYTASLTSILTVQQL S I+G++SL  G  P
Sbjct  617   FFSHRENTVSGLGRFVLIIWLFVVLIINSSYTASLTSILTVQQLSSQIEGIDSLISGTQP  676

Query  1884  IGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERPYVENFL  2063
             IG Q GSFA  YLI+E+ I  SR++ L  P+AY +AL +GP  GGV AIVDE PY+E F+
Sbjct  677   IGIQDGSFARRYLIDELNIQPSRIVTLRDPKAYIDALMRGPSGGGVMAIVDELPYIELFM  736

Query  2064  -STQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLtrtscs  2240
              ST CKFR VGQEFTKSGWGFAF RDSPLAVDMSTAIL LSENGDLQ+IHDKWL +  C+
Sbjct  737   SSTNCKFRTVGQEFTKSGWGFAFQRDSPLAVDMSTAILQLSENGDLQKIHDKWLLKHDCT  796

Query  2241  sestelesDRLHLKSFW  2291
             ++  +++S+ L L SFW
Sbjct  797   AKVDDVDSNELSLNSFW  813



>ref|XP_004289164.1| PREDICTED: glutamate receptor 3.4-like [Fragaria vesca subsp. 
vesca]
Length=940

 Score =   455 bits (1171),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 259/404 (64%), Positives = 323/404 (80%), Gaps = 1/404 (0%)
 Frame = +3

Query  1164  PRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYAVPFQFV  1343
             PRGWVFPNNGK LRI VP RVSYKEF+S+       +G+ +DVF AA+NLLPYAVP  +V
Sbjct  467   PRGWVFPNNGKPLRIAVPDRVSYKEFVSKDKSPPGVRGYCIDVFEAAINLLPYAVPRTYV  526

Query  1344  PFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPFKKL  1523
              +G G+ NP Y++LV  V+   FD A+GD+ I TNRT++VDFTQPY+ SGL+VV P K++
Sbjct  527   LYGGGKRNPQYNDLVSQVALNNFDAAVGDVTITTNRTRMVDFTQPYMESGLVVVVPVKQV  586

Query  1524  NTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSLSTL  1703
              T  WAFL PF+ QMW VT  FF++VG VVWILEHR+N EFRG P+QQL+TI WFS ST+
Sbjct  587   KTDTWAFLKPFTYQMWLVTGAFFLLVGAVVWILEHRINHEFRGPPRQQLMTIFWFSFSTM  646

Query  1704  FFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESLKEGNDP  1883
             FF+HRENTVSTLGR+VLIIWLFVVLIINSSYTASLTSILTVQQL S I+G++SL   NDP
Sbjct  647   FFSHRENTVSTLGRLVLIIWLFVVLIINSSYTASLTSILTVQQLASRIEGIDSLISSNDP  706

Query  1884  IGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERPYVENFL  2063
             IG Q G+FA  +L++E+ I+++RL+ L + E Y +AL+ GP +GGV AIVDE PY+E F+
Sbjct  707   IGIQDGTFARKFLVDELNIAEARLVTLKTMEDYGKALQNGPKRGGVVAIVDELPYIELFM  766

Query  2064  -STQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLtrtscs  2240
              ST+C FRIVGQEFTKSGWGFAF RDSPLAVD+STAIL LSENGDLQ+I +KWL  + CS
Sbjct  767   TSTKCAFRIVGQEFTKSGWGFAFQRDSPLAVDLSTAILQLSENGDLQKIRNKWLGSSECS  826

Query  2241  sestelesDRLHLKSFWglfllcgaacflalfIYFVQIMLKFRR  2372
              +  E +++RL L SFWGLFL+CG AC +AL ++F +I+ ++RR
Sbjct  827   MQPNEHDANRLSLTSFWGLFLICGIACAIALAVFFCRILCQYRR  870


 Score =   447 bits (1149),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 211/378 (56%), Positives = 278/378 (74%), Gaps = 2/378 (1%)
 Frame = +2

Query  59    VAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTTQ  238
             V AL+ ++ DVV  +GPQSS ++H ISHV NEL+VPLLSF ATDP+L++LQ+PYF+RTTQ
Sbjct  99    VEALQLIENDVVVAIGPQSSGISHVISHVVNELRVPLLSFGATDPSLSALQYPYFVRTTQ  158

Query  239   SDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGAT  418
             SD +QM AIAD+++++GW+EVIA+F+DDDYGRNGI+ L DALA KR KI+YKA   PGA 
Sbjct  159   SDYFQMYAIADMVEYFGWREVIAIFVDDDYGRNGISVLGDALAKKRSKIAYKAAFSPGAP  218

Query  419   TRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVLDS  598
               ++I D+LV + L+ESRV ++H  P +G  +FSVA  LGMM  GYVWI+TDWL T LDS
Sbjct  219   L-SDINDLLVGVNLLESRVYIVHVNPDSGLSIFSVAKDLGMMTSGYVWIATDWLPTHLDS  277

Query  599   SSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLT-GGSLGLNSYALYAYDSVWLI  775
               P   +KM ++QGV+ +R HTPD++LK++F S+W  L   GS G NSYALYAYDSVWL 
Sbjct  278   LVPPDPDKMNLLQGVVAVRHHTPDTDLKKSFASKWNKLKHEGSPGFNSYALYAYDSVWLA  337

Query  776   AHAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLTGQF  955
             A A+D FLN GG +SFSND KL+    S LHL +L IFD G   L  +L+ +F G++GQ 
Sbjct  338   ARALDVFLNDGGTVSFSNDPKLKDTNTSALHLSSLRIFDEGQHYLQTILKMNFTGVSGQL  397

Query  956   KFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKLYGV  1135
             +F+ DK+L+ P+YDILN+ GTGFR IG+W N + LST  PE LY +  N+S +   LY V
Sbjct  398   QFDLDKNLIHPAYDILNIGGTGFRKIGYWSNSTSLSTTEPEILYEKSLNTSGSTPHLYSV  457

Query  1136  VWPGQSVKKAPGVGFPEQ  1189
             +WPG+++    G  FP  
Sbjct  458   IWPGETITTPRGWVFPNN  475



>ref|XP_010515556.1| PREDICTED: glutamate receptor 3.6-like isoform X1 [Camelina sativa]
 ref|XP_010515557.1| PREDICTED: glutamate receptor 3.6-like isoform X1 [Camelina sativa]
Length=903

 Score =   466 bits (1200),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 264/407 (65%), Positives = 317/407 (78%), Gaps = 1/407 (0%)
 Frame = +3

Query  1146  GSR*KKPRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYA  1325
             G   K PRGWVF NNG+ LRIGVP R   +E +S V       GF VDVFTAA+NLLPYA
Sbjct  440   GQTTKVPRGWVFSNNGRHLRIGVPNRYRSEEVVS-VKSNGMITGFCVDVFTAALNLLPYA  498

Query  1326  VPFQFVPFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVV  1505
             VPF+ V FGNG +NPS SELVRL++TG +D  +GDI I+T RTK+ DFTQPYV SGL+VV
Sbjct  499   VPFELVAFGNGHDNPSNSELVRLITTGVYDAGVGDITIITERTKMADFTQPYVESGLVVV  558

Query  1506  APFKKLNTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILW  1685
             AP +KL + A AFL PF+ QMW +TA  F++VG V+W LEH+ NDEFRG P +Q IT  W
Sbjct  559   APVRKLGSSAMAFLRPFTPQMWLITAASFLIVGAVIWCLEHKHNDEFRGPPCRQFITTFW  618

Query  1686  FSLSTLFFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESL  1865
             FS STLFF+HRE T S+LGR+VLIIWLFVVLIINSSYTASLTSILTV QL SPIKG+E+L
Sbjct  619   FSFSTLFFSHRETTTSSLGRIVLIIWLFVVLIINSSYTASLTSILTVHQLSSPIKGIETL  678

Query  1866  KEGNDPIGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERP  2045
             +  +DPIGY  GSF   YL+ E+ I +SRL+ L SPE Y +AL  GP KGGV+A+VDER 
Sbjct  679   QANHDPIGYPKGSFVRDYLVHELSIHESRLVPLSSPEEYDKALRDGPGKGGVAAVVDERA  738

Query  2046  YVENFLSTQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLt  2225
             Y+E FLS +C+F IVG+EFTK+GWGFAFPR+SPLAVD+S AIL LSENGD+QRI DKWL 
Sbjct  739   YIELFLSNRCEFGIVGKEFTKNGWGFAFPRNSPLAVDVSAAILQLSENGDMQRIRDKWLL  798

Query  2226  rtscssestelesDRLHLKSFWglfllcgaacflalfIYFVQIMLKF  2366
             R +CS +  E+E DRL LKSFWGLF++CG AC LAL +Y V ++ +F
Sbjct  799   RKACSLQGAEIEVDRLELKSFWGLFVVCGVACVLALAVYTVLMIRQF  845


 Score =   436 bits (1120),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 199/372 (53%), Positives = 277/372 (74%), Gaps = 7/372 (2%)
 Frame = +2

Query  56    LVAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTT  235
             ++  L FM+++ VAI+GPQ S  A  ++HVA EL+VP+LSF+ATDPT++ LQFP+F+RT 
Sbjct  84    IMEPLHFMESETVAIIGPQRSTTARVVAHVATELKVPILSFSATDPTMSPLQFPFFIRTA  143

Query  236   QSDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGA  415
              +D++QM AIAD++  YGW+EV+A++ DDDYGRNGIA+L D LA KRC+ISYKA +PPG 
Sbjct  144   HNDLFQMAAIADIVQFYGWREVVAIYGDDDYGRNGIASLGDRLAEKRCRISYKAALPPGP  203

Query  416   TTRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVLD  595
              TR  I D+L+++AL ESR++V+HA    G  +F+VA  LGMM  GYVWI+T+WLST++D
Sbjct  204   -TRENITDLLIKVALSESRIIVIHASFIWGLELFNVAQNLGMMSTGYVWIATNWLSTIID  262

Query  596   SSSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLTGGSLGLNSYALYAYDSVWLI  775
             + SPLP + +  +QGV+ LR HTP+S +K+ F  RW++LT   +GL++Y LYAYD+VWL+
Sbjct  263   TDSPLPLDTINNIQGVIALRPHTPNSIMKQNFVQRWRNLT--RVGLSTYGLYAYDTVWLL  320

Query  776   AHAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLTGQF  955
             A AI+ F  KGG +SFS +  L  + G  LHL+AL +FDGG + L ++LQ D +GLTG+ 
Sbjct  321   AQAIEDFFQKGGNVSFSKNPILSELVGGNLHLDALKVFDGGKMFLESILQVDRIGLTGRM  380

Query  956   KFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKLYGV  1135
             KF  D++LV P +D+LNVIGTG+RTIG+W N+ GLS  P +       N+S + QKL+ V
Sbjct  381   KFTRDRNLVNPEFDVLNVIGTGYRTIGYWSNHLGLSVVPAD----ERQNTSFSGQKLHSV  436

Query  1136  VWPGQSVKKAPG  1171
             VWPGQ+ K   G
Sbjct  437   VWPGQTTKVPRG  448



>ref|XP_002321123.2| hypothetical protein POPTR_0014s15030g [Populus trichocarpa]
 gb|EEE99438.2| hypothetical protein POPTR_0014s15030g [Populus trichocarpa]
Length=964

 Score =   454 bits (1169),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 255/404 (63%), Positives = 317/404 (78%), Gaps = 1/404 (0%)
 Frame = +3

Query  1164  PRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYAVPFQFV  1343
             PRGWVFP NGK LRI VP R+SY++F+++       +G+ +DVF AA+NLLPY VP  ++
Sbjct  491   PRGWVFPENGKPLRIAVPNRISYQQFVAKDKNPPGVRGYCIDVFEAAINLLPYPVPRTYM  550

Query  1344  PFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPFKKL  1523
               G+G+ NP Y+E+V+ V+   +D A+GD+ IVTNRTK+VDFTQP++ SGL+VVAP K+ 
Sbjct  551   LHGDGKRNPEYNEIVQAVAQDRYDAAVGDVTIVTNRTKIVDFTQPFMESGLVVVAPVKEQ  610

Query  1524  NTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSLSTL  1703
              +  WAFL PF+ QMW VT  FF+ VG VVWILEHRMN EFRG P QQ++TI WFS ST+
Sbjct  611   KSSPWAFLKPFTIQMWLVTGAFFLFVGAVVWILEHRMNREFRGPPSQQIMTIFWFSFSTM  670

Query  1704  FFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESLKEGNDP  1883
             FF+HRENTVSTLGR VLIIWLFVVLIINSSYTASLTSILTVQQL S I+G++SL   N+P
Sbjct  671   FFSHRENTVSTLGRFVLIIWLFVVLIINSSYTASLTSILTVQQLTSRIEGIDSLVSSNEP  730

Query  1884  IGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERPYVENFL  2063
             IG Q GSFA +YL++E+ I+ SRL+ L S + Y+ AL+ GP  GGV+AIVDE PY+E FL
Sbjct  731   IGIQDGSFARNYLMDELNIAGSRLVILKSQQEYSTALQLGPKNGGVAAIVDELPYIELFL  790

Query  2064  -STQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLtrtscs  2240
              ST CKFR VGQEFTKSGWGFAF RDSPLAVD+STAIL LSENGDLQ+IH+KWLT   C 
Sbjct  791   SSTSCKFRTVGQEFTKSGWGFAFQRDSPLAVDLSTAILQLSENGDLQKIHNKWLTHGDCM  850

Query  2241  sestelesDRLHLKSFWglfllcgaacflalfIYFVQIMLKFRR  2372
              +  E++  RL L SFWGLFL+CG +CF+AL  +  +++ +FRR
Sbjct  851   EQINEIDDSRLSLTSFWGLFLICGISCFIALTTFCCKVIFQFRR  894


 Score =   447 bits (1150),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 214/381 (56%), Positives = 282/381 (74%), Gaps = 5/381 (1%)
 Frame = +2

Query  59    VAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTTQ  238
             V AL+ M+  VVA++GPQSS +AH ISHV NEL VPLLSFAATDP+L++LQ+PYFLRTTQ
Sbjct  120   VEALQLMENRVVAVIGPQSSGIAHIISHVVNELHVPLLSFAATDPSLSALQYPYFLRTTQ  179

Query  239   SDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGAT  418
             +D +QM AIAD++  YGW+EVIA+F+DDD GRNGI+ L DALA KR KI+YKA + PG  
Sbjct  180   NDYFQMYAIADLVTSYGWREVIAIFVDDDCGRNGISILGDALAKKRAKIAYKAALTPGVP  239

Query  419   TRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVLDS  598
              R++I D+L+++  MESRV V+H  P +G  +FSVA  L MM  GYVWI+TDWL +VLDS
Sbjct  240   -RSQISDLLLEVNQMESRVYVVHVNPDSGLSIFSVAKSLHMMTKGYVWIATDWLPSVLDS  298

Query  599   SSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLTG----GSLGLNSYALYAYDSV  766
               P  ++ M ++QGV+ LR H P+++LKR+F SRW +L      G+ G NSYALYAYD+V
Sbjct  299   LEPDDTDTMNLLQGVVSLRHHNPETDLKRSFMSRWSNLNHKKSIGASGFNSYALYAYDTV  358

Query  767   WLIAHAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLT  946
             WL A A+D FLN+GG +S S D KL   +GS ++L +L +FDGG   L  LL+ +F G +
Sbjct  359   WLAARALDVFLNEGGNLSHSTDPKLSDTKGSAMNLASLRVFDGGQQFLQTLLRMNFSGPS  418

Query  947   GQFKFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKL  1126
             GQ +F+ D++LV P+YD+LN+ GTG R IG+W NYSGLST  PE LY++P N+SS+NQ L
Sbjct  419   GQIQFDLDRNLVRPAYDVLNIGGTGSRRIGYWSNYSGLSTISPEVLYTKPRNNSSSNQHL  478

Query  1127  YGVVWPGQSVKKAPGVGFPEQ  1189
               V+WPG++     G  FPE 
Sbjct  479   SSVIWPGETSLVPRGWVFPEN  499



>ref|XP_011005110.1| PREDICTED: glutamate receptor 3.4 isoform X2 [Populus euphratica]
Length=964

 Score =   456 bits (1174),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 256/404 (63%), Positives = 317/404 (78%), Gaps = 1/404 (0%)
 Frame = +3

Query  1164  PRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYAVPFQFV  1343
             PRGWVFP NGK LRI VP R+SY++F+++       +G+ +DVF AA+NLLPY VP  ++
Sbjct  492   PRGWVFPENGKPLRIAVPNRISYQQFVAKDKNPPGVRGYCIDVFEAAINLLPYPVPRTYM  551

Query  1344  PFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPFKKL  1523
               G+G+ NP Y+E+V+ V+   +D A+GD+ IVTNRTK+VDFTQP++ SGL+VVAP K+ 
Sbjct  552   LHGDGKRNPVYNEIVQAVAQDRYDAAVGDVTIVTNRTKIVDFTQPFMESGLVVVAPVKEQ  611

Query  1524  NTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSLSTL  1703
              +  WAFL PF+ QMW VT  FF+ VG VVWILEHRMN EFRG P QQ++TILWFS ST+
Sbjct  612   KSNPWAFLKPFTIQMWLVTGAFFLFVGAVVWILEHRMNHEFRGPPSQQIMTILWFSFSTM  671

Query  1704  FFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESLKEGNDP  1883
             FF+HRENTVSTLGR VLIIWLFVVLIINSSYTASLTSILTVQQL S I+G++SL   N+P
Sbjct  672   FFSHRENTVSTLGRFVLIIWLFVVLIINSSYTASLTSILTVQQLTSRIEGIDSLVSSNEP  731

Query  1884  IGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERPYVENFL  2063
             IG Q GSFA +YL++E+ I+ SRL+ L S + Y+ AL+ GP  GGV+AIVDE PY+E FL
Sbjct  732   IGIQDGSFARNYLMDELNIAGSRLVILKSQQEYSTALQLGPKNGGVAAIVDELPYIELFL  791

Query  2064  -STQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLtrtscs  2240
              ST CKFR VGQEFTKSGWGFAF RDSPLAVD+STAIL LSENGDLQ+IH+KWLT   C 
Sbjct  792   SSTNCKFRTVGQEFTKSGWGFAFQRDSPLAVDLSTAILQLSENGDLQKIHNKWLTHGDCM  851

Query  2241  sestelesDRLHLKSFWglfllcgaacflalfIYFVQIMLKFRR  2372
              +  E+   RL L SFWGLFL+CG +CF+AL  +  +++ +FRR
Sbjct  852   EQINEINDSRLSLTSFWGLFLICGISCFIALTTFCCKVIFQFRR  895


 Score =   445 bits (1144),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 213/381 (56%), Positives = 282/381 (74%), Gaps = 5/381 (1%)
 Frame = +2

Query  59    VAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTTQ  238
             V AL+ M+  VVA++GPQSS +AH ISHV +ELQVPLLSFAATDPTL++LQ+PYFLRTTQ
Sbjct  121   VEALQLMENSVVAVIGPQSSGIAHIISHVVSELQVPLLSFAATDPTLSALQYPYFLRTTQ  180

Query  239   SDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGAT  418
             +D +QM AIAD++ +YGW+EVIA+F+DDD GRNGI+ L DALA KR KI+YKA + PG  
Sbjct  181   NDYFQMYAIADLVTYYGWREVIAIFVDDDCGRNGISILGDALAKKRAKITYKAALTPGE-  239

Query  419   TRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVLDS  598
              R+++ D+L+++  MESRV V+H  P +G  +FSVA  L MM  GYVWI+TDWL +VLDS
Sbjct  240   PRSQVSDLLLEVNQMESRVYVVHVNPDSGLSIFSVAKSLHMMTKGYVWIATDWLPSVLDS  299

Query  599   SSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLTG----GSLGLNSYALYAYDSV  766
               P  ++ M ++QGV+ LR H P+++LKR+F SRW +L      G+ G NSYALYAYD+V
Sbjct  300   LEPDDTDTMNLLQGVVSLRHHNPETDLKRSFMSRWSNLNHKKSIGASGFNSYALYAYDTV  359

Query  767   WLIAHAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLT  946
             WL A A+D FLN+GG +S S D KL   + S ++L +L +FDGG   L  LL+ +F G +
Sbjct  360   WLAARALDVFLNEGGNLSHSTDPKLSDTKRSAMNLASLRVFDGGQQFLQTLLRMNFSGPS  419

Query  947   GQFKFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKL  1126
             GQ +F+ DK+LV P+YD+LN+ GTG R IG+W NYSGLST  P  LY++P N+SS+NQ L
Sbjct  420   GQIQFDLDKNLVRPAYDVLNIGGTGSRRIGYWSNYSGLSTISPVVLYTKPRNNSSSNQHL  479

Query  1127  YGVVWPGQSVKKAPGVGFPEQ  1189
               V+WPG++     G  FPE 
Sbjct  480   SSVIWPGETSLVPRGWVFPEN  500



>ref|XP_010426704.1| PREDICTED: glutamate receptor 3.6 isoform X1 [Camelina sativa]
 ref|XP_010426705.1| PREDICTED: glutamate receptor 3.6 isoform X1 [Camelina sativa]
Length=903

 Score =   466 bits (1200),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 268/419 (64%), Positives = 322/419 (77%), Gaps = 3/419 (1%)
 Frame = +3

Query  1146  GSR*KKPRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYA  1325
             G   K PRGWVF NNG+ LRIGVP R   +E +S V       GF VDVFTAA+NLLPYA
Sbjct  440   GQTTKVPRGWVFSNNGRHLRIGVPNRYRSEEVVS-VKSNGMITGFCVDVFTAALNLLPYA  498

Query  1326  VPFQFVPFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVV  1505
             VPF+ V FGNG +NPS SELVRL++TG +D  +GDI I+T RTK+ DFTQPYV SGL+VV
Sbjct  499   VPFELVAFGNGHDNPSNSELVRLITTGVYDAGVGDITIITERTKMADFTQPYVESGLVVV  558

Query  1506  APFKKLNTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILW  1685
             AP +KL + A AFL PF+ QMW +TA  F++VG V+W LEH+ NDEFRG P +Q IT  W
Sbjct  559   APVRKLGSSAMAFLRPFTPQMWLITAASFLIVGAVIWCLEHKHNDEFRGPPCRQFITTFW  618

Query  1686  FSLSTLFFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESL  1865
             FS STLFF+HRE T S+LG++VLIIWLFVVLIINSSYTASLTSILTV QL SPIKG+E+L
Sbjct  619   FSFSTLFFSHRETTTSSLGKIVLIIWLFVVLIINSSYTASLTSILTVHQLSSPIKGIETL  678

Query  1866  KEGNDPIGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERP  2045
             +  +DPIGY  GSF   YL+ E+ I +SRL+ L SPE Y +AL  GP KGGV+A+VDER 
Sbjct  679   QANHDPIGYPKGSFVRDYLVHELNIHESRLVPLSSPEEYDKALRDGPGKGGVAAVVDERA  738

Query  2046  YVENFLSTQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLt  2225
             Y+E FLS +C+F IVGQEFTK+GWGFAFPR+SPLAVD+S AIL LSENGD+QRI DKWL 
Sbjct  739   YIELFLSNRCEFGIVGQEFTKNGWGFAFPRNSPLAVDVSAAILQLSENGDMQRIRDKWLL  798

Query  2226  rtscssestelesDRLHLKSFWglfllcgaacflalfIYFVQIMLKFRRVARAEPVADG  2402
             R +CS +  E+E DRL LKSFWGLF++CG AC LAL +Y V ++ +F +    E  ADG
Sbjct  799   RKACSLQGAEIEVDRLELKSFWGLFVVCGVACVLALAVYTVLMIRQFGKQYPEE--ADG  855


 Score =   434 bits (1117),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 199/372 (53%), Positives = 276/372 (74%), Gaps = 7/372 (2%)
 Frame = +2

Query  56    LVAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTT  235
             ++  L FM+++ VAI+GPQ S  A  ++HVA EL+VP+LSF+ATDPT++ LQFP+F+RT 
Sbjct  84    IMEPLHFMESETVAIIGPQRSTTARVVAHVATELRVPILSFSATDPTMSPLQFPFFIRTA  143

Query  236   QSDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGA  415
              +D++QM AIAD++  YGW+EV+A++ DDDYGRNG+A+L D LA KRC+ISYKA +PPG 
Sbjct  144   HNDLFQMAAIADIVQFYGWREVVAIYGDDDYGRNGVASLGDRLAEKRCRISYKAALPPGP  203

Query  416   TTRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVLD  595
              TR  I D+L+++AL ESR++V+HA    G  +F+VA  LGMM  GYVWI+T+WLST++D
Sbjct  204   -TRENITDLLIKVALSESRIIVIHASFIWGLELFNVAQNLGMMSTGYVWIATNWLSTIID  262

Query  596   SSSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLTGGSLGLNSYALYAYDSVWLI  775
             + SPLP + +  +QGV+ LR HTP+S +K+ F  RW +LT   +GL++Y LYAYD+VWL+
Sbjct  263   TDSPLPLDTINNIQGVIALRPHTPNSIMKQNFIQRWHNLT--HVGLSTYGLYAYDTVWLL  320

Query  776   AHAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLTGQF  955
             A AID F  KGG +SFS +  L  + G  LHL+AL +FDGG + L ++LQ D +GLTG+ 
Sbjct  321   AQAIDDFFQKGGNVSFSKNPILSELVGGNLHLDALKVFDGGKMFLESILQVDRIGLTGRM  380

Query  956   KFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKLYGV  1135
             KF  D++LV P +D+LNVIGTG+RTIG+W N+ GLS  P +       N+S + QKL+ V
Sbjct  381   KFTRDRNLVNPEFDVLNVIGTGYRTIGYWSNHLGLSVVPAD----ERQNTSFSGQKLHSV  436

Query  1136  VWPGQSVKKAPG  1171
             VWPGQ+ K   G
Sbjct  437   VWPGQTTKVPRG  448



>ref|XP_006292183.1| hypothetical protein CARUB_v10018389mg [Capsella rubella]
 gb|EOA25081.1| hypothetical protein CARUB_v10018389mg [Capsella rubella]
Length=903

 Score =   473 bits (1217),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 265/407 (65%), Positives = 318/407 (78%), Gaps = 1/407 (0%)
 Frame = +3

Query  1146  GSR*KKPRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYA  1325
             G   K PRGWVF NNG+ LRIGVP R  ++E +S V       GF VDVFTAA+NLLPYA
Sbjct  440   GQTTKIPRGWVFSNNGRHLRIGVPNRYRFEEVVS-VKSNGMITGFCVDVFTAAINLLPYA  498

Query  1326  VPFQFVPFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVV  1505
             VPF+ V FGNG +NPS SELVRL++ G +D  +GDI I+T RTK+ DFTQPYV SGL+VV
Sbjct  499   VPFELVAFGNGHDNPSNSELVRLITAGVYDAGVGDITIITERTKIADFTQPYVESGLVVV  558

Query  1506  APFKKLNTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILW  1685
             AP +KL T A AFL PF+ QMW + A  F++VG V+W LEH+ NDEFRGSP++Q+IT  W
Sbjct  559   APVRKLGTSAMAFLRPFTPQMWLIAAASFLIVGAVIWCLEHKHNDEFRGSPRRQVITTFW  618

Query  1686  FSLSTLFFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESL  1865
             FS STLFF+HRE T S LGR+VLIIWLFVVLIINSSYTASLTSILTV QL SPIKG+E+L
Sbjct  619   FSFSTLFFSHRETTTSNLGRIVLIIWLFVVLIINSSYTASLTSILTVHQLSSPIKGIETL  678

Query  1866  KEGNDPIGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERP  2045
             +  +DPIGY  GSF   YL+ E+ I +SRL+ L SPE Y +AL  GP KGGV+A+VDER 
Sbjct  679   QTNHDPIGYPQGSFVRDYLVHELNIHESRLVPLRSPEEYDKALRDGPGKGGVAAVVDERA  738

Query  2046  YVENFLSTQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLt  2225
             Y+E FLS +C+F IVGQEFTK+GWGFAFPR+SPLAVD+S AIL LSENGD+QRI DKWL 
Sbjct  739   YIELFLSNRCEFGIVGQEFTKNGWGFAFPRNSPLAVDVSAAILQLSENGDMQRIRDKWLL  798

Query  2226  rtscssestelesDRLHLKSFWglfllcgaacflalfIYFVQIMLKF  2366
             R +CS +  E+E DRL LKSFWGLF++CG AC LAL +Y V ++ +F
Sbjct  799   RKACSLQGAEIEVDRLELKSFWGLFVVCGVACILALAVYTVLMIRQF  845


 Score =   428 bits (1100),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 196/372 (53%), Positives = 274/372 (74%), Gaps = 7/372 (2%)
 Frame = +2

Query  56    LVAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTT  235
             ++  L+FM+++ VAI+GPQ S  A  ++HVA EL++P+LSF+ATDPT++ LQFP+F+RT 
Sbjct  84    IMEPLQFMESETVAIIGPQRSTTARVVAHVATELKIPILSFSATDPTMSPLQFPFFIRTA  143

Query  236   QSDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGA  415
             Q+D++QM AIAD++  YGW+EV+A++ DDDYGRNG+A+L D LA KRC+ISYKA +PP  
Sbjct  144   QNDLFQMAAIADIVQFYGWREVVAIYGDDDYGRNGVASLGDRLAEKRCRISYKAALPP-K  202

Query  416   TTRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVLD  595
              TR  I D+L+++AL ESR++V+HA    G  +F+VA  LGMM  GYVWI+T+WLST++D
Sbjct  203   PTRENITDLLIKVALSESRIIVIHASFIWGLELFNVAQNLGMMSTGYVWIATNWLSTIID  262

Query  596   SSSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLTGGSLGLNSYALYAYDSVWLI  775
             + SPLP   +  +QGV+ LR HTP+S +K+ F  RW +LT   +GL++Y LYAYD+VWL+
Sbjct  263   TDSPLPLNTINNIQGVIALRPHTPNSIMKQDFVQRWHNLT--HVGLSTYGLYAYDTVWLL  320

Query  776   AHAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLTGQF  955
             A AID F  KGG +SFS +     + G  LHL+AL +FDGG + L ++LQ D +GLTG+ 
Sbjct  321   AQAIDDFFQKGGNVSFSKNPIRSELGGGNLHLDALKVFDGGKIFLESILQVDRIGLTGRM  380

Query  956   KFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKLYGV  1135
             KF  D++LV P++D+LNVIGTG+RTIG+W N+ GLS  P         N+S +  KL+ V
Sbjct  381   KFTRDRNLVNPAFDVLNVIGTGYRTIGYWSNHLGLSVVPANEW----KNTSFSGLKLHSV  436

Query  1136  VWPGQSVKKAPG  1171
             VWPGQ+ K   G
Sbjct  437   VWPGQTTKIPRG  448



>ref|XP_009399220.1| PREDICTED: glutamate receptor 3.5-like [Musa acuminata subsp. 
malaccensis]
Length=992

 Score =   457 bits (1175),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 260/408 (64%), Positives = 313/408 (77%), Gaps = 0/408 (0%)
 Frame = +3

Query  1164  PRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYAVPFQFV  1343
             PRGWVFPN+GK LRIGVP R S+KEF++    ++   GF +DVF AA+ LLPY VP  FV
Sbjct  517   PRGWVFPNDGKPLRIGVPNRASFKEFVTNSSNSDDLGGFCIDVFNAAIKLLPYPVPCSFV  576

Query  1344  PFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPFKKL  1523
               G+G  NP+Y E+V +V+    D A+GDIAIV NR K+VDFTQPY  SGL++V   +  
Sbjct  577   LIGDGSRNPNYDEIVNMVARNELDAAVGDIAIVRNRIKIVDFTQPYTESGLVIVTRVRGS  636

Query  1524  NTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSLSTL  1703
             ++ AWAFL PF+ +MW  T  FF+VVG  VWILEHR N EFRG+PKQQ+ T+ WFS ST+
Sbjct  637   SSSAWAFLKPFTLEMWCATGAFFLVVGAAVWILEHRENPEFRGTPKQQIATMFWFSFSTM  696

Query  1704  FFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESLKEGNDP  1883
             FF HRENTVSTLGR VLI+WLFVVLIINSSYTASLTSILTVQQL S I G++SL   +DP
Sbjct  697   FFVHRENTVSTLGRFVLIVWLFVVLIINSSYTASLTSILTVQQLSSGITGLDSLLSTSDP  756

Query  1884  IGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERPYVENFL  2063
             IGYQ G FA +Y+IE++ I +SRL  L SPE YA+ALE GP  GGV+AIVDE PYVE  L
Sbjct  757   IGYQEGKFARNYMIEDLNIPESRLKPLNSPEEYAKALELGPKGGGVAAIVDEIPYVEILL  816

Query  2064  STQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLtrtscss  2243
             S  C FRIVG EFTK+GWGFAF RDSPLAVD+STAIL+LSENGDLQRIHDKWL+RT CSS
Sbjct  817   SVYCHFRIVGPEFTKNGWGFAFQRDSPLAVDLSTAILTLSENGDLQRIHDKWLSRTECSS  876

Query  2244  estelesDRLHLKSFWglfllcgaacflalfIYFVQIMLKFRRVARAE  2387
             + T+LE++RL L SFWGLFLL G  C LAL +Y ++   ++ + +  E
Sbjct  877   QDTDLEANRLSLSSFWGLFLLSGIVCVLALIVYIIKTSCQYSKFSSTE  924


 Score =   443 bits (1140),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 216/380 (57%), Positives = 272/380 (72%), Gaps = 6/380 (2%)
 Frame = +2

Query  59    VAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTTQ  238
             + AL+ M+  VVA++GPQSS + H ISHV  EL VPLLSFAATDPTL+ L+ PYF+RTT 
Sbjct  147   IEALRLMEKKVVAVVGPQSSGIGHVISHVVTELHVPLLSFAATDPTLSPLEHPYFIRTTH  206

Query  239   SDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGAT  418
             SD +QM AIAD+++H+GW+EV A+F+DDDYGR G+ AL DALA KR +ISYKAG PP A 
Sbjct  207   SDYFQMNAIADLVEHFGWREVTAIFVDDDYGRGGVIALGDALAKKRSRISYKAGFPPNAG  266

Query  419   TRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVLDS  598
               A I D+LV+  LMESRV V+H  P  G  VFS+A  +GMM  GYVWI+TDWL++ LDS
Sbjct  267   PTA-INDLLVRANLMESRVFVVHVNPDTGMNVFSLAKNMGMMATGYVWIATDWLASTLDS  325

Query  599   SSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLT---GGSLGLNSYALYAYDSVW  769
                     M ++QG +VLR HTPDS  KR FT+RW  +      S GLNSY LYAYDS+W
Sbjct  326   VVQPDPNAMSLLQGAIVLRHHTPDSASKRRFTARWNAMIRAGNASSGLNSYGLYAYDSLW  385

Query  770   LIAHAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLTG  949
             ++A AID FL+ G  I+FS D +L    GSTLHL  L IFDGG  LL  LL ++F GLTG
Sbjct  386   VVARAIDRFLSAGNTINFSADPRLHEANGSTLHLSTLRIFDGGESLLQQLLLTNFTGLTG  445

Query  950   QFKFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPN-SSSANQKL  1126
             Q +F+++++L+ PSYDILN IG G R IG+W NYSGLS   PE LY +PPN S+++ Q+L
Sbjct  446   QIEFDSERNLIRPSYDILN-IGGGPRLIGYWSNYSGLSVIAPEILYQQPPNTSTTSQQQL  504

Query  1127  YGVVWPGQSVKKAPGVGFPE  1186
             +GVVWPG++     G  FP 
Sbjct  505   FGVVWPGETTAPPRGWVFPN  524



>ref|XP_011005108.1| PREDICTED: glutamate receptor 3.4 isoform X1 [Populus euphratica]
 ref|XP_011005109.1| PREDICTED: glutamate receptor 3.4 isoform X1 [Populus euphratica]
Length=981

 Score =   456 bits (1174),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 256/404 (63%), Positives = 317/404 (78%), Gaps = 1/404 (0%)
 Frame = +3

Query  1164  PRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYAVPFQFV  1343
             PRGWVFP NGK LRI VP R+SY++F+++       +G+ +DVF AA+NLLPY VP  ++
Sbjct  509   PRGWVFPENGKPLRIAVPNRISYQQFVAKDKNPPGVRGYCIDVFEAAINLLPYPVPRTYM  568

Query  1344  PFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPFKKL  1523
               G+G+ NP Y+E+V+ V+   +D A+GD+ IVTNRTK+VDFTQP++ SGL+VVAP K+ 
Sbjct  569   LHGDGKRNPVYNEIVQAVAQDRYDAAVGDVTIVTNRTKIVDFTQPFMESGLVVVAPVKEQ  628

Query  1524  NTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSLSTL  1703
              +  WAFL PF+ QMW VT  FF+ VG VVWILEHRMN EFRG P QQ++TILWFS ST+
Sbjct  629   KSNPWAFLKPFTIQMWLVTGAFFLFVGAVVWILEHRMNHEFRGPPSQQIMTILWFSFSTM  688

Query  1704  FFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESLKEGNDP  1883
             FF+HRENTVSTLGR VLIIWLFVVLIINSSYTASLTSILTVQQL S I+G++SL   N+P
Sbjct  689   FFSHRENTVSTLGRFVLIIWLFVVLIINSSYTASLTSILTVQQLTSRIEGIDSLVSSNEP  748

Query  1884  IGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERPYVENFL  2063
             IG Q GSFA +YL++E+ I+ SRL+ L S + Y+ AL+ GP  GGV+AIVDE PY+E FL
Sbjct  749   IGIQDGSFARNYLMDELNIAGSRLVILKSQQEYSTALQLGPKNGGVAAIVDELPYIELFL  808

Query  2064  -STQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLtrtscs  2240
              ST CKFR VGQEFTKSGWGFAF RDSPLAVD+STAIL LSENGDLQ+IH+KWLT   C 
Sbjct  809   SSTNCKFRTVGQEFTKSGWGFAFQRDSPLAVDLSTAILQLSENGDLQKIHNKWLTHGDCM  868

Query  2241  sestelesDRLHLKSFWglfllcgaacflalfIYFVQIMLKFRR  2372
              +  E+   RL L SFWGLFL+CG +CF+AL  +  +++ +FRR
Sbjct  869   EQINEINDSRLSLTSFWGLFLICGISCFIALTTFCCKVIFQFRR  912


 Score =   442 bits (1138),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 212/379 (56%), Positives = 281/379 (74%), Gaps = 5/379 (1%)
 Frame = +2

Query  65    ALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTTQSD  244
             AL+ M+  VVA++GPQSS +AH ISHV +ELQVPLLSFAATDPTL++LQ+PYFLRTTQ+D
Sbjct  140   ALQLMENSVVAVIGPQSSGIAHIISHVVSELQVPLLSFAATDPTLSALQYPYFLRTTQND  199

Query  245   MYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGATTR  424
              +QM AIAD++ +YGW+EVIA+F+DDD GRNGI+ L DALA KR KI+YKA + PG   R
Sbjct  200   YFQMYAIADLVTYYGWREVIAIFVDDDCGRNGISILGDALAKKRAKITYKAALTPGEP-R  258

Query  425   AEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVLDSSS  604
             +++ D+L+++  MESRV V+H  P +G  +FSVA  L MM  GYVWI+TDWL +VLDS  
Sbjct  259   SQVSDLLLEVNQMESRVYVVHVNPDSGLSIFSVAKSLHMMTKGYVWIATDWLPSVLDSLE  318

Query  605   PLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLTG----GSLGLNSYALYAYDSVWL  772
             P  ++ M ++QGV+ LR H P+++LKR+F SRW +L      G+ G NSYALYAYD+VWL
Sbjct  319   PDDTDTMNLLQGVVSLRHHNPETDLKRSFMSRWSNLNHKKSIGASGFNSYALYAYDTVWL  378

Query  773   IAHAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLTGQ  952
              A A+D FLN+GG +S S D KL   + S ++L +L +FDGG   L  LL+ +F G +GQ
Sbjct  379   AARALDVFLNEGGNLSHSTDPKLSDTKRSAMNLASLRVFDGGQQFLQTLLRMNFSGPSGQ  438

Query  953   FKFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKLYG  1132
              +F+ DK+LV P+YD+LN+ GTG R IG+W NYSGLST  P  LY++P N+SS+NQ L  
Sbjct  439   IQFDLDKNLVRPAYDVLNIGGTGSRRIGYWSNYSGLSTISPVVLYTKPRNNSSSNQHLSS  498

Query  1133  VVWPGQSVKKAPGVGFPEQ  1189
             V+WPG++     G  FPE 
Sbjct  499   VIWPGETSLVPRGWVFPEN  517



>ref|XP_003563011.1| PREDICTED: glutamate receptor 3.4-like isoform X1 [Brachypodium 
distachyon]
Length=925

 Score =   474 bits (1221),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 258/405 (64%), Positives = 320/405 (79%), Gaps = 0/405 (0%)
 Frame = +3

Query  1158  KKPRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYAVPFQ  1337
             +KPRGW FP +GK LRIGVP+R SYKEF+ Q  G +  KGFSVDVF +AV+LLPY V F 
Sbjct  459   EKPRGWAFPYHGKPLRIGVPLRTSYKEFVMQDNGPDGVKGFSVDVFKSAVSLLPYPVAFN  518

Query  1338  FVPFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPFK  1517
             FV FG+G +NPSYS+LV+ VS  YFD AIGDI IVTNRT++VDFTQPY  SGL++VAP +
Sbjct  519   FVLFGDGLKNPSYSDLVQKVSENYFDAAIGDITIVTNRTRLVDFTQPYTESGLIIVAPAR  578

Query  1518  KLNTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSLS  1697
             ++ + AWAFL PF+ QMW V    F+ VG VVWILEHR N EFRG+P+QQ++T+ WFS S
Sbjct  579   EIESNAWAFLKPFTFQMWCVLGLLFLFVGAVVWILEHRTNTEFRGTPRQQIMTVCWFSFS  638

Query  1698  TLFFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESLKEGN  1877
             T+FFAHRENT S LGR VL++WLFVVLI+NSSYTASLTS+LTVQ+L S +KG++SL   +
Sbjct  639   TMFFAHRENTSSALGRFVLLVWLFVVLIVNSSYTASLTSLLTVQELTSGVKGLDSLISSS  698

Query  1878  DPIGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERPYVEN  2057
              PIGYQ+GSFA +YL++E+ I+ SRL+ L SP  YA ALE G   GGV+AI+DE PYVE 
Sbjct  699   SPIGYQVGSFARNYLVDELNIADSRLVPLNSPSDYARALELGSGNGGVAAIIDELPYVEI  758

Query  2058  FLSTQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLtrtsc  2237
             FLS  CKF+ VGQ FTK GWGFAFPRDSPLA D+STAIL+LSENG+LQRIHD+WL+   C
Sbjct  759   FLSKYCKFKTVGQVFTKGGWGFAFPRDSPLAEDLSTAILALSENGNLQRIHDEWLSGEGC  818

Query  2238  ssestelesDRLHLKSFWglfllcgaacflalfIYFVQIMLKFRR  2372
             S++  E+ S+ L L SFWGLF++CG  C +AL I+F +I  ++ R
Sbjct  819   STDDIEIASNSLSLSSFWGLFVICGLTCAIALLIFFWRIFFQYSR  863


 Score =   423 bits (1087),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 198/377 (53%), Positives = 275/377 (73%), Gaps = 3/377 (1%)
 Frame = +2

Query  59    VAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTTQ  238
             + AL+ +  DV+A+LGPQSS +AH ISH  NEL VPL+SFAA+DPTL+SL++PYF+RTT 
Sbjct  92    IEALQLLAKDVIAVLGPQSSTIAHVISHAVNELHVPLISFAASDPTLSSLEYPYFVRTTL  151

Query  239   SDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGAT  418
             SD YQM A+A +I  Y W+EVIA+++DDDYGR GI AL DALA ++ KI+YKA +PPGA 
Sbjct  152   SDYYQMAAVASIISQYQWREVIAIYVDDDYGRGGITALGDALAKRKSKIAYKAKLPPGA-  210

Query  419   TRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVLDS  598
              R+ I DIL+++  MESRV V+H  P +G  VFS A  LGMM +GYVWI+TDWLS V+DS
Sbjct  211   GRSTIQDILMRVNEMESRVYVVHVNPDSGLAVFSAAKSLGMMSNGYVWIATDWLSAVIDS  270

Query  599   SSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLT--GGSLGLNSYALYAYDSVWL  772
             S     + ME  QGV++L+QH  DS+++ +   +  + T  G    ++SY ++AYDSVWL
Sbjct  271   SRHDNPDAMEHTQGVIMLQQHVADSDIQHSLLRKLNNQTREGNRSSVSSYTVHAYDSVWL  330

Query  773   IAHAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLTGQ  952
             +A AI+ FL++G  +SFS +  LQ ++ S+L L++L  F+ G  LL  + +++F G++GQ
Sbjct  331   VARAIEQFLSEGNAVSFSANQNLQPVKRSSLQLDSLRRFNNGDKLLEKVWRANFTGVSGQ  390

Query  953   FKFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKLYG  1132
              +F  D++L+ P+YDILN+ GTGFRTIG+W N+SGLS   PE L+S PPNSS+ N +L  
Sbjct  391   VQFTLDRNLIHPAYDILNIGGTGFRTIGYWSNFSGLSVVAPENLHSAPPNSSTNNIQLRS  450

Query  1133  VVWPGQSVKKAPGVGFP  1183
             V+WPGQ+ +K  G  FP
Sbjct  451   VIWPGQTAEKPRGWAFP  467



>ref|XP_010503841.1| PREDICTED: glutamate receptor 3.6-like isoform X1 [Camelina sativa]
 ref|XP_010503842.1| PREDICTED: glutamate receptor 3.6-like isoform X1 [Camelina sativa]
 ref|XP_010503843.1| PREDICTED: glutamate receptor 3.6-like isoform X1 [Camelina sativa]
Length=903

 Score =   464 bits (1194),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 263/407 (65%), Positives = 316/407 (78%), Gaps = 1/407 (0%)
 Frame = +3

Query  1146  GSR*KKPRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYA  1325
             G   K PRGWVF NNG+ LRIGVP R   +E +S V       GF VDVFTAA+NLLPYA
Sbjct  440   GQTTKVPRGWVFSNNGRHLRIGVPNRYRSEEVVS-VKSNGMITGFCVDVFTAALNLLPYA  498

Query  1326  VPFQFVPFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVV  1505
             VPF+ V FGNG +NPS SELVRL++TG +D  +GDI I+T RTK+ DFTQPYV SGL+VV
Sbjct  499   VPFELVAFGNGHDNPSNSELVRLITTGVYDAGVGDITIITERTKMADFTQPYVESGLVVV  558

Query  1506  APFKKLNTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILW  1685
             AP +KL + A AFL PF+ QMW +TA  F++VG V+W LEH+ ND FRG P +Q IT  W
Sbjct  559   APVRKLGSSAMAFLRPFTPQMWLITAASFLIVGAVIWCLEHKHNDAFRGPPCRQFITTFW  618

Query  1686  FSLSTLFFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESL  1865
             FS STLFF+HRE T S+LGR+VLIIWLFVVLIINSSYTASLTSILTV QL SPIKG+E+L
Sbjct  619   FSFSTLFFSHRETTTSSLGRIVLIIWLFVVLIINSSYTASLTSILTVHQLSSPIKGIETL  678

Query  1866  KEGNDPIGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERP  2045
             +  +DPIGY  GSF   YL+ E+ I +SRL+ L SPE Y +AL  GP KGGV+A+VDER 
Sbjct  679   QANHDPIGYPKGSFVRDYLVHELNIHESRLVPLSSPEEYDKALRDGPGKGGVAAVVDERA  738

Query  2046  YVENFLSTQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLt  2225
             Y+E FLS +C+F IVG+EFTK+GWGFAFPR+SPLAVD+S AIL LSENGD+QRI DKWL 
Sbjct  739   YIELFLSNRCEFGIVGKEFTKNGWGFAFPRNSPLAVDVSAAILQLSENGDMQRIRDKWLL  798

Query  2226  rtscssestelesDRLHLKSFWglfllcgaacflalfIYFVQIMLKF  2366
             R +CS +  E+E DRL LKSFWGLF++CG AC LAL +Y V ++ +F
Sbjct  799   RKACSLQGAEIEVDRLELKSFWGLFVVCGVACILALAVYTVLMIRQF  845


 Score =   433 bits (1113),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 198/372 (53%), Positives = 277/372 (74%), Gaps = 7/372 (2%)
 Frame = +2

Query  56    LVAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTT  235
             ++  L FM+++ VAI+GPQ S  A  ++HVA EL+VP+LSF+ATDPT++ LQFP+F+RT 
Sbjct  84    IMEPLHFMESETVAIIGPQRSTTARVVAHVATELKVPILSFSATDPTMSPLQFPFFIRTA  143

Query  236   QSDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGA  415
              +D++QM AIAD++  YGW+EV+A++ DDDYGRNG+A+L D LA KRC+ISYKA +PP  
Sbjct  144   HNDLFQMAAIADIVQFYGWREVVAIYGDDDYGRNGVASLGDRLAEKRCRISYKAALPP-R  202

Query  416   TTRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVLD  595
              TR  I D+L+++AL ESR++V+HA    G  +F+VA  LGMM  GYVWI+T+WLST++D
Sbjct  203   PTRENITDLLIKVALSESRIIVIHASFIWGLELFNVAQNLGMMSTGYVWIATNWLSTIID  262

Query  596   SSSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLTGGSLGLNSYALYAYDSVWLI  775
             + SPLP + +  +QGV+ LR HTP+S +K+ F  RW++LT   +GL++Y LYAYD+VWL+
Sbjct  263   TDSPLPLDTINNIQGVIALRPHTPNSIMKQNFVQRWRNLT--HVGLSTYGLYAYDTVWLL  320

Query  776   AHAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLTGQF  955
             A AI+ F  KGG +SFS +  L  + G  LHL+AL +FDGG + L ++LQ D +GLTG+ 
Sbjct  321   AQAIEDFFQKGGNVSFSKNPILSELVGGNLHLDALKVFDGGKMFLESILQVDRIGLTGRM  380

Query  956   KFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKLYGV  1135
             KFN D++LV P +D+LNVIGTG+RTIG+W N+ GLS  P +   S    +S + QKL+ V
Sbjct  381   KFNRDRNLVNPEFDVLNVIGTGYRTIGYWSNHLGLSVVPADERQS----TSFSGQKLHSV  436

Query  1136  VWPGQSVKKAPG  1171
             VWPGQ+ K   G
Sbjct  437   VWPGQTTKVPRG  448



>ref|XP_002437454.1| hypothetical protein SORBIDRAFT_10g027370 [Sorghum bicolor]
 gb|EER88821.1| hypothetical protein SORBIDRAFT_10g027370 [Sorghum bicolor]
Length=948

 Score =   449 bits (1154),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 247/412 (60%), Positives = 315/412 (76%), Gaps = 0/412 (0%)
 Frame = +3

Query  1164  PRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYAVPFQFV  1343
             P+GWVFPNNG+ LR+GVPI+ S+KE ++   G +   G+ +D+F AAV LLPY VP QF+
Sbjct  459   PKGWVFPNNGQPLRVGVPIKPSFKELVAGGKGPDNVTGYCIDIFNAAVKLLPYPVPCQFI  518

Query  1344  PFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPFKKL  1523
               G+GR+NP+Y  ++ +V+    D A+GD AIV NRTK+ +FTQPY+ SGL++VAP K+ 
Sbjct  519   TVGDGRKNPNYDAIINMVAANSLDAAVGDFAIVRNRTKIAEFTQPYIESGLVIVAPVKQA  578

Query  1524  NTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSLSTL  1703
              + AWAFL PF+ +MW VT   F+ VGIVVWILEHR N+EFRGSP++QLITI WFS ST+
Sbjct  579   TSSAWAFLKPFTLEMWCVTGALFIFVGIVVWILEHRSNEEFRGSPRRQLITIFWFSFSTM  638

Query  1704  FFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESLKEGNDP  1883
             FF+HR+NTVS LGR VLIIWLFVVLIINSSYTASLTSILTVQQL + I G++SL     P
Sbjct  639   FFSHRQNTVSALGRFVLIIWLFVVLIINSSYTASLTSILTVQQLATGITGIDSLVSSGLP  698

Query  1884  IGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERPYVENFL  2063
             IGYQ G F ++YLI+E+ I + RL+ L + + YA+AL++GP  GGV+AIVDE PYVE FL
Sbjct  699   IGYQDGKFTKNYLIDELNIPEYRLVPLNTIQEYADALKRGPKDGGVAAIVDEMPYVEIFL  758

Query  2064  STQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLtrtscss  2243
             S  C FRIVGQEFTK GWGFAF RDSPLA D+STAIL LSE+G LQRIHD+W T  SCSS
Sbjct  759   SYHCNFRIVGQEFTKEGWGFAFKRDSPLAADLSTAILQLSESGQLQRIHDEWFTGPSCSS  818

Query  2244  estelesDRLHLKSFWglfllcgaacflalfIYFVQIMLKFRRVARAEPVAD  2399
             + +E+ + RL L SFWGLFL C   C LAL ++F++I  ++ + + +E   +
Sbjct  819   DDSEVGATRLGLGSFWGLFLACALICLLALVVFFIRICWQYNKYSNSEAAGE  870


 Score =   448 bits (1153),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 215/380 (57%), Positives = 272/380 (72%), Gaps = 4/380 (1%)
 Frame = +2

Query  59    VAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTTQ  238
             + AL+ M+ +VVA++GPQSS + H ISHV NEL VPLLSFAATDPTL++ ++PYF+RTT 
Sbjct  89    IEALQLMERNVVAVIGPQSSGIGHVISHVVNELHVPLLSFAATDPTLSASEYPYFIRTTI  148

Query  239   SDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGAT  418
             SD +QM A+A ++D+Y WKEV A+F+DDDYGR G++AL DALAAKR +ISYKA IPP + 
Sbjct  149   SDYFQMNAVASIVDYYQWKEVTAIFVDDDYGRGGVSALGDALAAKRARISYKAAIPPNSN  208

Query  419   TRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVLDS  598
             T   I D+L +  +MESRVMV+H  P  G  +FSVA+ L MM  GYVWI TDWL+ VLDS
Sbjct  209   TDV-INDVLFKANMMESRVMVVHVNPDTGMRIFSVANKLQMMASGYVWIVTDWLAAVLDS  267

Query  599   SSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLTGG---SLGLNSYALYAYDSVW  769
             S P   + M  +QG++VLRQHTP+S+ K+ F S+W +       + GLNSY  YAYDSVW
Sbjct  268   SMPRDRKDMSHLQGLIVLRQHTPESDAKKKFISKWNNAARNRSITYGLNSYGFYAYDSVW  327

Query  770   LIAHAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLTG  949
              +A  ID FLN G  I+FS D  L    GSTLHL  L IFDGG  +L  LL ++F GLTG
Sbjct  328   AVARGIDQFLNSGQQINFSPDPMLHDSNGSTLHLSTLKIFDGGEQMLQQLLLTNFTGLTG  387

Query  950   QFKFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKLY  1129
               +FN+D++LV P+YDILN+ G+  R IG+W NYSGLS APPE LY +PPN+SS  Q+L+
Sbjct  388   PVQFNSDRNLVHPAYDILNLGGSESRLIGYWSNYSGLSVAPPEILYQKPPNTSSLVQRLH  447

Query  1130  GVVWPGQSVKKAPGVGFPEQ  1189
              VVWPG S     G  FP  
Sbjct  448   NVVWPGDSTTTPKGWVFPNN  467



>ref|XP_008348134.1| PREDICTED: glutamate receptor 3.4-like [Malus domestica]
Length=944

 Score =   453 bits (1165),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 265/411 (64%), Positives = 325/411 (79%), Gaps = 2/411 (0%)
 Frame = +3

Query  1164  PRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYAVPFQFV  1343
             PRGWVFPNNG+ LRIGVP RVSYK+F+++       +G+ +DVF AAVNLLPYAVP  ++
Sbjct  471   PRGWVFPNNGRPLRIGVPYRVSYKDFVAKDKSPPGVRGYCIDVFEAAVNLLPYAVPRMYM  530

Query  1344  PFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPFKKL  1523
              +G+G+ NP YS LV  V+   FD A+GD+ I  NRT++VDFTQPY+ SGL+VV P K  
Sbjct  531   LYGDGKRNPEYSSLVAQVAQNXFDAAVGDVTITXNRTRIVDFTQPYMESGLVVVVPVKXA  590

Query  1524  NTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSLSTL  1703
              +  W FL PF+ QMW VT  FF++VG VVWILEHR+N EFRG P QQL+TI WFS ST+
Sbjct  591   KSNPWXFLKPFTYQMWLVTGAFFLLVGAVVWILEHRINHEFRGPPSQQLMTIFWFSFSTM  650

Query  1704  FFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESLKEGNDP  1883
             FF+HRENTVSTLGR+VLIIWLFVVLIINSSYTASLTSILTVQQL S I+G++SL   ND 
Sbjct  651   FFSHRENTVSTLGRLVLIIWLFVVLIINSSYTASLTSILTVQQLTSRIEGIDSLISSNDR  710

Query  1884  IGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERPYVENFL  2063
             IG Q GSFA  YLI+E+ I++SRL+ L   EAY +AL  GP +GGV+AIVDE PY+E F+
Sbjct  711   IGVQDGSFAWRYLIDEMNIAESRLVKLKDMEAYIKALTDGPRRGGVAAIVDELPYIELFM  770

Query  2064  S-TQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLtrtscs  2240
             S T+C FR VGQEFTKSGWGFAF RDSPLAVD+STAIL LSENG+LQ+IH+KWLT   CS
Sbjct  771   SNTKCAFRTVGQEFTKSGWGFAFQRDSPLAVDLSTAILQLSENGELQKIHNKWLTHNECS  830

Query  2241  sestelesDRLHLKSFWglfllcgaacflalfIYFVQIMLKFRRVARAEPV  2393
             ++ TE+++D+L L SFWGLFL+CG ACFLAL ++F +I+ ++RR    EPV
Sbjct  831   TQLTEVDADQLSLTSFWGLFLICGIACFLALAVFFCRILCQYRRFT-PEPV  880


 Score =   444 bits (1141),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 210/378 (56%), Positives = 276/378 (73%), Gaps = 3/378 (1%)
 Frame = +2

Query  59    VAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTTQ  238
             V AL+ ++ DVVA +GPQSS +AH ISHV NEL VPLLSF ATDP+LA+LQ+PYF+RTTQ
Sbjct  104   VEALELIENDVVAAIGPQSSGIAHVISHVVNELHVPLLSFGATDPSLAALQYPYFVRTTQ  163

Query  239   SDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGAT  418
             SD +QM A+AD+++++GW+EVIA+F+DDD GRNGI+ L DALA KR KISYKA   PGA 
Sbjct  164   SDYFQMYAVADLVEYFGWREVIAIFVDDDCGRNGISILGDALATKRSKISYKAAFSPGA-  222

Query  419   TRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVLDS  598
              +++I ++LV + LMESRV ++H  P +G  +FS+A  LGMM  GYVWI+TDWL + LDS
Sbjct  223   PKSDINELLVGVNLMESRVYIVHVNPDSGLTIFSIAKALGMMTSGYVWIATDWLPSHLDS  282

Query  599   SSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLT-GGSLGLNSYALYAYDSVWLI  775
              +P   + M ++QGV+ LR HTPD++LK+ F SRW  L   G+   NSYALYAYDS+WL 
Sbjct  283   LNPPGPDTMNLLQGVVALRHHTPDTDLKKRFMSRWSKLKHEGTPSFNSYALYAYDSIWLA  342

Query  776   AHAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLTGQF  955
             A A+D F N+GG +SFSND +L+    STLHL +L IFDGG   L  +L+ +F G++GQ 
Sbjct  343   ARALDVFFNEGGNVSFSNDPRLKDTNRSTLHLTSLRIFDGGQKYLQTILKMNFTGISGQI  402

Query  956   KFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKLYGV  1135
             +F+ DK LV P+YDILN+ GTG R +G+W N +GLS   PE LY +P N ++  Q LYGV
Sbjct  403   EFDQDKYLVRPAYDILNIGGTGSRRVGYWSNSTGLSVTAPEILYKKPSNRNTTAQ-LYGV  461

Query  1136  VWPGQSVKKAPGVGFPEQ  1189
             +WPG+      G  FP  
Sbjct  462   IWPGEVTATPRGWVFPNN  479



>ref|XP_008670454.1| PREDICTED: glutamate receptor 3.4-like [Zea mays]
 tpg|DAA41016.1| TPA: hypothetical protein ZEAMMB73_300661 [Zea mays]
Length=923

 Score =   467 bits (1201),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 259/409 (63%), Positives = 324/409 (79%), Gaps = 0/409 (0%)
 Frame = +3

Query  1146  GSR*KKPRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYA  1325
             G   +KPRGWVF ++G  +RIGVP+R SYKEF+ Q  G +  KGF+VDVF AA++LLPY 
Sbjct  448   GQTSEKPRGWVFSHHGMPMRIGVPLRTSYKEFVMQDDGPDGVKGFAVDVFKAAISLLPYP  507

Query  1326  VPFQFVPFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVV  1505
             V  +FV FG+G +NPSYSELV+ VS  YFD A+GDIAIVTNRT++VDFTQPY+ SGL++V
Sbjct  508   VSCKFVLFGDGLKNPSYSELVQKVSENYFDAAVGDIAIVTNRTRLVDFTQPYIESGLIIV  567

Query  1506  APFKKLNTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILW  1685
             AP + + + AWAFL PF+ QMW V    F+ VG VVWILEHR N EFRG P QQ++T+ W
Sbjct  568   APARVIESNAWAFLKPFTFQMWCVLVVIFLFVGAVVWILEHRSNTEFRGPPSQQIMTVCW  627

Query  1686  FSLSTLFFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESL  1865
             FS ST+FFAHRENTVS LGR VL+IWLF VLIINSSYTA+LTS+LTVQ+L S I+G++SL
Sbjct  628   FSFSTMFFAHRENTVSALGRFVLLIWLFAVLIINSSYTANLTSLLTVQELTSGIQGLDSL  687

Query  1866  KEGNDPIGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERP  2045
                +  IGYQ+GSF+ +YL++E+ I++SRL+AL SP  YA ALE G   GGV+AI+DE P
Sbjct  688   ISSSSAIGYQVGSFSRNYLVDELSIAESRLVALNSPSDYARALELGSGNGGVAAIIDELP  747

Query  2046  YVENFLSTQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLt  2225
             YVE FLS  CKF+ VGQ FTKSGWGFAFPRDSPLA D+STAIL+LSENG LQ++HD+WL+
Sbjct  748   YVEIFLSKYCKFKTVGQVFTKSGWGFAFPRDSPLAEDLSTAILALSENGKLQKMHDEWLS  807

Query  2226  rtscssestelesDRLHLKSFWglfllcgaacflalfIYFVQIMLKFRR  2372
              T CS+++    S+ L L SFWGLFL+CG ACFLAL I+F++I  ++ R
Sbjct  808   GTECSADNGAGPSNSLSLSSFWGLFLICGLACFLALVIFFLRIFCQYSR  856


 Score =   430 bits (1105),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 210/371 (57%), Positives = 271/371 (73%), Gaps = 4/371 (1%)
 Frame = +2

Query  59    VAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTTQ  238
             + AL+ +  DVVA+LGPQSS VAH ISH  NEL VPL+SFAATDPTL+SL++PYF+R TQ
Sbjct  90    IEALQLLAKDVVAVLGPQSSAVAHVISHAVNELHVPLISFAATDPTLSSLEYPYFVRATQ  149

Query  239   SDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGAT  418
             SD YQM AIA +I  Y WK+VIA+++DDDYGR GI AL DALA ++CKISYKA +PPGA 
Sbjct  150   SDYYQMGAIAAIISQYEWKQVIAIYVDDDYGRGGITALGDALAKRKCKISYKAKLPPGA-  208

Query  419   TRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVLDS  598
              +  I DIL+Q+  MESRV V+H  P +G  VFS A  LGMM  GYVWI+TDWLS V+DS
Sbjct  209   AKTTIEDILMQVNDMESRVYVIHVNPDSGLNVFSAAKSLGMMSSGYVWIATDWLSAVIDS  268

Query  599   SSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLTGGSLGLNSYALYAYDSVWLIA  778
             S     + ME+ QGVLVLRQH  DS+++ AF S+W +LT      +SY ++AYDSVWL+A
Sbjct  269   SVHGIPDVMELTQGVLVLRQHIADSDIQHAFLSKWNNLTRNG---SSYFMHAYDSVWLVA  325

Query  779   HAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLTGQFK  958
             HA++ FL +G  +SFS D KLQ+ +GS+L L++L IF+ G  LL  +  ++F G++G  +
Sbjct  326   HAVERFLREGNAMSFSADPKLQAKKGSSLQLDSLRIFNSGDKLLEKVWSANFSGVSGPVQ  385

Query  959   FNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKLYGVV  1138
             F  D+ LV P+YDILN+ GTG RTIG+W N SGLS   PE L S   +SS+ N +L GV+
Sbjct  386   FTLDRDLVHPAYDILNIGGTGLRTIGYWSNSSGLSAVAPENLSSSARDSSANNVQLRGVI  445

Query  1139  WPGQSVKKAPG  1171
             WPGQ+ +K  G
Sbjct  446   WPGQTSEKPRG  456



>ref|XP_004952127.1| PREDICTED: glutamate receptor 3.1-like isoform X3 [Setaria italica]
Length=934

 Score =   457 bits (1176),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 265/411 (64%), Positives = 330/411 (80%), Gaps = 4/411 (1%)
 Frame = +3

Query  1161  KPRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYAVPFQF  1340
             KPRGWVFP+N K+L IGVP R S+K F++    T    G+ +DVFT A++LLPY V ++F
Sbjct  457   KPRGWVFPSNAKELIIGVPNRHSFKAFVTLDNATGKMTGYCIDVFTQALSLLPYPVTYRF  516

Query  1341  VPFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPFKK  1520
              PFG+G ENP Y++L++ V    FD AIGDIAI  +RT+ +DFTQP++ SGL+++AP KK
Sbjct  517   EPFGSGNENPHYNQLIQKVVDNEFDAAIGDIAITMSRTQTLDFTQPFIESGLVILAPVKK  576

Query  1521  LNTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSLST  1700
               T +WAFL PF+  MW VT   F+VVG+V+W+LEHR+NDEFRGSP+QQLITI+WFS ST
Sbjct  577   HITNSWAFLQPFTLGMWCVTGLSFLVVGVVIWVLEHRINDEFRGSPRQQLITIVWFSFST  636

Query  1701  LFFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESLKEGND  1880
             LFFAHRENT+STLGR VLIIWLFVVLII SSYTASLTSILTVQQL + I+G++ LK  + 
Sbjct  637   LFFAHRENTMSTLGRGVLIIWLFVVLIIQSSYTASLTSILTVQQLDTSIRGLDDLKNSDY  696

Query  1881  PIGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERPYVENF  2060
             PIG+Q+GSFAE Y+++E+ IS+SRL ALGSP+ YAE L++GP +GGV AIVDERPYVE F
Sbjct  697   PIGFQVGSFAEEYMVKELNISRSRLKALGSPDEYAENLKQGPKRGGVMAIVDERPYVELF  756

Query  2061  LSTQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLtrtscs  2240
             LST CK  + G +FT  GWGFAFPRDSPL VD+STAIL+LSENG+LQRIHDKWL  + CS
Sbjct  757   LSTYCKIAVAGSDFTSRGWGFAFPRDSPLQVDLSTAILTLSENGELQRIHDKWLRTSDCS  816

Query  2241  seste-lesDRLHLKSFWglfllcgaacflalfIYFVQIMLKFRRVARAEP  2390
             +++TE ++S++L L+SF GLFL+CGAAC LAL IYF  IML  RR  R EP
Sbjct  817   ADNTEFVDSNQLRLESFMGLFLICGAACVLALLIYF-GIML--RRYLRHEP  864


 Score =   439 bits (1128),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 208/381 (55%), Positives = 282/381 (74%), Gaps = 7/381 (2%)
 Frame = +2

Query  56    LVAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTT  235
             +V AL+FM+TDV+AI+GPQ S +AH IS+VANELQVPL+SFA +D TL+S+QFP+F+RT 
Sbjct  86    MVEALQFMETDVIAIIGPQCSTIAHIISYVANELQVPLMSFA-SDATLSSIQFPFFVRTM  144

Query  236   QSDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGA  415
              SD+Y+M A+A V+D+Y WK V A++IDDDYGRNGIAALDD L A+RCKISYK G P  A
Sbjct  145   PSDLYEMAAVAAVVDYYQWKIVTAIYIDDDYGRNGIAALDDELTARRCKISYKVGFPSNA  204

Query  416   TTRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVLD  595
               R+E++ +LV ++ MESRV++LH     G  + S+A+ L MMG+GYVWI+TDWLS+ LD
Sbjct  205   R-RSELLHLLVTVSNMESRVIILHTGADPGLKLLSLANGLNMMGNGYVWIATDWLSSYLD  263

Query  596   SSSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLTG----GSLGLNSYALYAYDS  763
             ++S +P+E +  MQGVL +R H P+S++K    S+W+ L+      +L L++Y  Y YDS
Sbjct  264   ANSSVPAETINAMQGVLTVRPHIPESKMKSNLMSKWRSLSKKYNHSNLRLSAYGFYVYDS  323

Query  764   VWLIAHAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGL  943
             VW +A A+D+F + GG ISF+NDS+L    G +LHLEA+S+FD G  LL  + Q +F G 
Sbjct  324   VWAVARALDAFFDDGGRISFTNDSRLHDETGGSLHLEAMSVFDMGKRLLGKIRQVNFTGA  383

Query  944   TGQFKFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSG-LSTAPPETLYSRPPNSSSANQ  1120
             +GQ +FN    L+ P+YDI+++IG G RTIGFW NY+  LST  PE LYS+PPN+S ANQ
Sbjct  384   SGQVQFNAQGELIHPAYDIISIIGNGVRTIGFWSNYTRLLSTVLPEDLYSKPPNTSLANQ  443

Query  1121  KLYGVVWPGQSVKKAPGVGFP  1183
              LY V+WPG++  K  G  FP
Sbjct  444   HLYDVIWPGETAHKPRGWVFP  464



>ref|XP_011034846.1| PREDICTED: glutamate receptor 3.3-like isoform X4 [Populus euphratica]
Length=764

 Score =   555 bits (1431),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 254/376 (68%), Positives = 321/376 (85%), Gaps = 1/376 (0%)
 Frame = +2

Query  56    LVAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTT  235
             +V AL+FM+TD+VAI+GPQSSVVA  ISHVAN+LQVPLLSFAATDP+L SLQFP+F++TT
Sbjct  125   MVEALRFMETDIVAIIGPQSSVVARIISHVANQLQVPLLSFAATDPSLNSLQFPFFVQTT  184

Query  236   QSDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGA  415
             QSD++QM AI+DV+D+YGWK+V A++IDDDYGRNG++AL D LA +RC+ISYK G+PP +
Sbjct  185   QSDLHQMAAISDVVDYYGWKQVTAIYIDDDYGRNGMSALGDKLAERRCRISYKVGVPPDS  244

Query  416   TTRA-EIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVL  592
                  +I+D+L+++A MESRV+VLH  P  GF VFSVA+ L MMG+G+VWI+T+WLS+VL
Sbjct  245   GVNGTDILDMLIKVASMESRVIVLHVNPDVGFEVFSVANRLQMMGNGWVWIATNWLSSVL  304

Query  593   DSSSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLTGGSLGLNSYALYAYDSVWL  772
             DS+SPLPSE M+ +QGVL LRQHTPDS+ KRAF SRW+ LTGGSLGLNSY LYAYDSVWL
Sbjct  305   DSASPLPSETMDSIQGVLFLRQHTPDSDRKRAFYSRWRKLTGGSLGLNSYGLYAYDSVWL  364

Query  773   IAHAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLTGQ  952
             IAHAID+F N+GG+ISFSNDS+L+S++ S LHLEA+SIFD G LLLNN+LQSD VGLTG+
Sbjct  365   IAHAIDAFFNQGGIISFSNDSRLRSVKDSGLHLEAMSIFDDGKLLLNNILQSDLVGLTGR  424

Query  953   FKFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKLYG  1132
              KF+ ++SL+LP+YD+ NV GTGF+ IG+W NYSGL+  PPE LY++PPN SSANQ+LY 
Sbjct  425   IKFDTERSLILPAYDVNNVFGTGFKRIGYWSNYSGLTVVPPEMLYTKPPNRSSANQELYK  484

Query  1133  VVWPGQSVKKAPGVGF  1180
             V+WPG ++    G  F
Sbjct  485   VIWPGDTLFTPRGWAF  500


 Score =   340 bits (871),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 178/244 (73%), Positives = 215/244 (88%), Gaps = 0/244 (0%)
 Frame = +3

Query  1164  PRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYAVPFQFV  1343
             PRGW F NNGKQLRIGVP+RVS++EF+SQ  GT+TFKGF +DVFT+A+ LLPY V +QF+
Sbjct  495   PRGWAFANNGKQLRIGVPLRVSFREFVSQARGTDTFKGFCIDVFTSAITLLPYPVQYQFI  554

Query  1344  PFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPFKKL  1523
             PFG+G+ NPSY+ELV  ++TG FD  +GD+AIVTNRTK++DFTQPYVASGL+VVAPF+K 
Sbjct  555   PFGDGKNNPSYTELVYKITTGLFDAVVGDVAIVTNRTKILDFTQPYVASGLVVVAPFRKS  614

Query  1524  NTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSLSTL  1703
             N+GAWAFL PFSA++W VT  FF VVG+VVWILEHR+NDEFRG PK+Q+IT++WFSLSTL
Sbjct  615   NSGAWAFLGPFSARLWIVTGCFFFVVGLVVWILEHRINDEFRGPPKRQIITVIWFSLSTL  674

Query  1704  FFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESLKEGNDP  1883
             F  HRENT+STL R VL+IWLFVVLIINS+YTASLTSILTV QL S IKG+ESLKE ++P
Sbjct  675   FSTHRENTMSTLARFVLLIWLFVVLIINSNYTASLTSILTVHQLSSHIKGIESLKESDEP  734

Query  1884  IGYQ  1895
             +GYQ
Sbjct  735   VGYQ  738



>ref|XP_010323822.1| PREDICTED: glutamate receptor 3.4 isoform X2 [Solanum lycopersicum]
Length=836

 Score =   462 bits (1188),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 261/405 (64%), Positives = 320/405 (79%), Gaps = 1/405 (0%)
 Frame = +3

Query  1161  KPRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYAVPFQF  1340
             +PRGWVFP+NGK LRI VP RV++KEF+ +  G +  KG+ +DVF AA++LLPYAVP  +
Sbjct  363   QPRGWVFPHNGKPLRIVVPYRVTFKEFVHKDKGPSGVKGYCIDVFEAAIDLLPYAVPHVY  422

Query  1341  VPFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPFKK  1520
             + +G+G+ NPS+  LV  V    +D A+GD+ I TNRT++VDFTQPY+ SGL+VVAP K+
Sbjct  423   ILYGDGQRNPSFKNLVNDVVANKYDAAVGDVTITTNRTRIVDFTQPYMESGLVVVAPIKE  482

Query  1521  LNTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSLST  1700
             L + AWAFL PF+ QMW VT  FF+ VG VVWILEHR N EFRGSP+QQL+T+ WFS ST
Sbjct  483   LKSSAWAFLQPFTLQMWCVTGVFFLFVGTVVWILEHRHNPEFRGSPRQQLVTVFWFSFST  542

Query  1701  LFFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESLKEGND  1880
             +FFAHRENT+STLGR+VLI WLFVVLIINSSYTASLTSILTV+QL S I+G++SL   +D
Sbjct  543   MFFAHRENTMSTLGRLVLIFWLFVVLIINSSYTASLTSILTVRQLSSGIQGIDSLIASSD  602

Query  1881  PIGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERPYVENF  2060
             PIG Q GSFA  YLIEE+G+ +SRL  L + + Y  ALEKGP  GGV+ IVDE PYVE F
Sbjct  603   PIGVQDGSFAYSYLIEELGVLESRLRILKTEDEYTSALEKGPQGGGVAGIVDELPYVELF  662

Query  2061  LS-TQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLtrtsc  2237
             LS + C FR VGQEFTK GWGFAF RDSPLAVD+STAIL LSENG+LQRIHDKWL++  C
Sbjct  663   LSNSNCVFRTVGQEFTKGGWGFAFQRDSPLAVDLSTAILQLSENGELQRIHDKWLSKKVC  722

Query  2238  ssestelesDRLHLKSFWglfllcgaacflalfIYFVQIMLKFRR  2372
             SS+S + +  +L LKSFWGLFL+C  ACFLAL  +F ++  +FRR
Sbjct  723   SSQSNQADDSQLSLKSFWGLFLICAVACFLALVAFFYRVYCQFRR  767


 Score =   432 bits (1110),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 204/371 (55%), Positives = 271/371 (73%), Gaps = 3/371 (1%)
 Frame = +2

Query  74    FMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTTQSDMYQ  253
              M+ +V+A +GPQSS +AH ISHV NELQVPLLSFA TDPTL+SLQ+ YFLRT  +D +Q
Sbjct  2     LMEKEVIAAIGPQSSGIAHVISHVMNELQVPLLSFA-TDPTLSSLQYSYFLRTVPNDHFQ  60

Query  254   MMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGATTRAEI  433
             M AIADV+D++GWKEVIA+F+DDD GRNGI+ L DALA KR K++YKA   P A + +EI
Sbjct  61    MHAIADVVDYFGWKEVIAIFVDDDNGRNGISVLGDALAKKRAKLTYKAAFSPEANS-SEI  119

Query  434   MDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVLDSSSPLP  613
              D+LV + LME+RV V+H  P  G  +FS A  LGMM  GYVWI+TDWL + LDSS  + 
Sbjct  120   DDLLVSVNLMEARVFVVHVNPDTGLSIFSKAKNLGMMVGGYVWITTDWLPSFLDSSDSVN  179

Query  614   SEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLTG-GSLGLNSYALYAYDSVWLIAHAID  790
              E M+++QGV+ LR HT DS+ K+ F SRWK+     +   NSYALYAYD++WL+A A+D
Sbjct  180   PETMDLIQGVVALRHHTADSDQKKKFASRWKNFKNVETSSFNSYALYAYDTIWLLARALD  239

Query  791   SFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLTGQFKFNND  970
              +   GG I+FS+D +L+   GS LHL ++ +FD G  L   L+  +F GL+GQ +F+++
Sbjct  240   LYFKNGGKITFSDDPRLRDTNGSALHLSSMQVFDQGQKLFQTLIGMNFTGLSGQIQFDSE  299

Query  971   KSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKLYGVVWPGQ  1150
             K+L  P+YD+LN+ GTG RT+G+W NYS LS  PPE LYS+PPN+S++ Q LY V+WPG+
Sbjct  300   KNLGRPAYDVLNIGGTGSRTVGYWSNYSSLSVVPPEILYSKPPNTSTSTQHLYNVIWPGE  359

Query  1151  SVKKAPGVGFP  1183
              V +  G  FP
Sbjct  360   MVTQPRGWVFP  370



>ref|XP_010090700.1| Glutamate receptor 3.2 [Morus notabilis]
 gb|EXB40419.1| Glutamate receptor 3.2 [Morus notabilis]
Length=927

 Score =   475 bits (1222),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 253/403 (63%), Positives = 328/403 (81%), Gaps = 4/403 (1%)
 Frame = +3

Query  1164  PRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYAVPFQFV  1343
             PRGWVF +NG+QL IGVP RVSYK F+SQV GTN  +G+ +DVF AA+ LLPY VP++F+
Sbjct  452   PRGWVFRDNGRQLLIGVPNRVSYKNFVSQVNGTNIVQGYCIDVFLAAIKLLPYTVPYRFL  511

Query  1344  PFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPFKKL  1523
              FG+G +NPSY+ELV  ++ G FD  +GDI IVTNRTK+VDFTQPY+ SGL+VV P KKL
Sbjct  512   LFGDGHKNPSYTELVNKITIGEFDAVVGDITIVTNRTKIVDFTQPYIESGLVVVTPVKKL  571

Query  1524  NTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSLSTL  1703
             N+ AWAFL PF+   W + A FF+ VG VVWILEHR+NDEFRG P+QQ+ITILWFS ST+
Sbjct  572   NSIAWAFLRPFTPLTWAIIASFFLFVGTVVWILEHRVNDEFRGPPRQQIITILWFSFSTM  631

Query  1704  FFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESLKEGNDP  1883
             FFAHRENT+STLG+MV++IWLFVVLI+ SSYTASLTSILT++ L SPI G+++L   N+P
Sbjct  632   FFAHRENTMSTLGKMVMLIWLFVVLILTSSYTASLTSILTIRHLSSPITGIDTLITSNEP  691

Query  1884  IGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERPYVENFL  2063
             IG+Q+GSFAE+YL +E+ I + RL+ALGSP  YA+ALE G     V+A+VDERPY+E FL
Sbjct  692   IGFQVGSFAENYLSKELDIPQFRLVALGSPNEYAKALENGT----VAAVVDERPYIELFL  747

Query  2064  STQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLtrtscss  2243
             S  C F + GQEFTKSGWGFAFP+ SP+AVDMSTAIL+LSENG+LQRIH++WL++  C+ 
Sbjct  748   SDHCMFAVRGQEFTKSGWGFAFPKGSPIAVDMSTAILNLSENGELQRIHNRWLSKKGCAL  807

Query  2244  estelesDRLHLKSFWglfllcgaacflalfIYFVQIMLKFRR  2372
               ++++S++L L+SFWGLF++C   C ++L IYF +++ +F +
Sbjct  808   HGSDIQSEQLPLESFWGLFVICAIVCLVSLIIYFWKMIHEFSK  850


 Score =   418 bits (1075),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 201/366 (55%), Positives = 265/366 (72%), Gaps = 3/366 (1%)
 Frame = +2

Query  56    LVAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTT  235
             ++ AL FM +D VAI+GPQ++V+AH +SH+ANEL VPLLSF A DPTLASLQ+P+FL+T 
Sbjct  82    ILGALTFMGSDTVAIIGPQNAVMAHALSHLANELHVPLLSFTALDPTLASLQYPFFLQTA  141

Query  236   QSDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPG-  412
              +D +QM AIAD++ ++GW +V+A+F DDD  RNG+ AL D L  +RCKISYKA +PP  
Sbjct  142   PNDHFQMTAIADMVSYFGWSKVVALFSDDDQSRNGVTALADKLVERRCKISYKAALPPDP  201

Query  413   ATTRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVL  592
               T  ++ + L +I + E RV+VL  Y A G +VF VA  LGMM  GYVWI++ WLSTVL
Sbjct  202   RATPNDVAEQLSKIRMRECRVIVLLTYSATGLLVFDVAKELGMMERGYVWIASTWLSTVL  261

Query  593   DSSSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLTGGSLGLNSYALYAYDSVWL  772
             DS+SPL       +QG L LR HTPDSE KRAF +RW  L+ G++GLN Y LYAYD+VWL
Sbjct  262   DSNSPLSPRIANSIQGALTLRPHTPDSERKRAFVARWDQLSNGTVGLNPYGLYAYDTVWL  321

Query  773   IAHAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLTGQ  952
             IA A+   L++GG ISFSN++    ++G T++L AL  FDGG  LL+N+L+++ +GLTG 
Sbjct  322   IARALKRLLDQGGKISFSNNTSFTGVQGGTINLGALRRFDGGKQLLSNILETNMIGLTGP  381

Query  953   FKFNNDKSLVLPSYDILNVIGTG-FRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKLY  1129
               F  D+S + P+++I+NVIG G F+ IG+W NYSGLS  PPE LY + P  S ANQ L 
Sbjct  382   IGF-PDRSALRPAFEIINVIGNGEFKQIGYWSNYSGLSVVPPEVLYIKEPVRSIANQHLD  440

Query  1130  GVVWPG  1147
              VVWPG
Sbjct  441   TVVWPG  446



>ref|XP_010548165.1| PREDICTED: glutamate receptor 3.1-like isoform X1 [Tarenaya hassleriana]
 ref|XP_010548166.1| PREDICTED: glutamate receptor 3.1-like isoform X1 [Tarenaya hassleriana]
 ref|XP_010548167.1| PREDICTED: glutamate receptor 3.1-like isoform X1 [Tarenaya hassleriana]
 ref|XP_010548168.1| PREDICTED: glutamate receptor 3.1-like isoform X1 [Tarenaya hassleriana]
 ref|XP_010548169.1| PREDICTED: glutamate receptor 3.1-like isoform X1 [Tarenaya hassleriana]
 ref|XP_010548170.1| PREDICTED: glutamate receptor 3.1-like isoform X1 [Tarenaya hassleriana]
Length=922

 Score =   471 bits (1212),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 265/404 (66%), Positives = 332/404 (82%), Gaps = 7/404 (2%)
 Frame = +3

Query  1164  PRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGT-NTFKGFSVDVFTAAVNLLPYAVPFQF  1340
             PRGWVFPNNG++LRIGVP R S+K+F+ ++ G+ N  +G+ +++F  AV LLPYA P +F
Sbjct  454   PRGWVFPNNGRKLRIGVPNRASFKDFVQRINGSSNKVQGYCIEIFERAVKLLPYAAPHEF  513

Query  1341  VPFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPFKK  1520
             + FG+G +NP+Y+ELV  ++TG FD  +GD+AIVT RT+VVDFTQPY+ SGL+V+AP  K
Sbjct  514   ILFGDGIKNPNYNELVNKITTGVFDAVVGDVAIVTKRTRVVDFTQPYIESGLVVIAPVTK  573

Query  1521  LNTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSLST  1700
             LN  AWAFL PF+ QMW VTA FF++VG+V+WILEHR+NDEFRG P++Q++TILWFS ST
Sbjct  574   LNRNAWAFLRPFTPQMWAVTAAFFIIVGVVIWILEHRINDEFRGPPRRQIMTILWFSFST  633

Query  1701  LFFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESLKEGND  1880
             +FF+HRENTVSTLGRMVL+IWLFVVLII SSYTASLTSILTVQQL SPIKGV++L     
Sbjct  634   MFFSHRENTVSTLGRMVLLIWLFVVLIITSSYTASLTSILTVQQLISPIKGVDTLISSTG  693

Query  1881  PIGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERPYVENF  2060
              IG+QIGSFAE+Y+++E+ I+KSRLI L SPE +A ALE G     VSAIVDERPYV+ F
Sbjct  694   RIGFQIGSFAENYMVDELNIAKSRLIPLSSPEEFAAALENGT----VSAIVDERPYVDLF  749

Query  2061  LSTQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLtrtscs  2240
             LS  C F I GQEFT+SGWGFAFPRDSPLAVD+STAILSLSE+G LQ+IHDKWL++++CS
Sbjct  750   LSDYCNFAIRGQEFTRSGWGFAFPRDSPLAVDLSTAILSLSESGQLQKIHDKWLSKSNCS  809

Query  2241  --sestelesDRLHLKSFWglfllcgaacflalfIYFVQIMLKF  2366
                +S    S++L+L SFWGLFL+CG  C +ALFIYF +I+  F
Sbjct  810   DPQDSQLANSEQLNLHSFWGLFLVCGIVCSIALFIYFGKIVHDF  853


 Score =   422 bits (1084),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 201/379 (53%), Positives = 268/379 (71%), Gaps = 1/379 (0%)
 Frame = +2

Query  56    LVAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTT  235
             L+ AL+FM+TD VAI+GPQ+S +AH +SH++NEL VPLLSF A DP+L+ LQ+P+F++T 
Sbjct  84    LMGALQFMETDTVAIIGPQTSTMAHVLSHLSNELHVPLLSFMALDPSLSPLQYPFFVQTA  143

Query  236   QSDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGA  415
              SD++ M AIA+++  YGW +VIAV  DD+  RNGI  L D L  +R KISYKA +P   
Sbjct  144   PSDLFLMRAIAEMVSFYGWSDVIAVHTDDEGSRNGITTLGDELEERRSKISYKAVLPIDL  203

Query  416   T-TRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVL  592
             T + + I D L +I  MESR++V++ +P  G ++F  A  LGM+  GYVWI+T WLS +L
Sbjct  204   THSGSRIRDELGKIQRMESRIIVVNTFPRTGALIFEEAQRLGMIEKGYVWIATTWLSALL  263

Query  593   DSSSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLTGGSLGLNSYALYAYDSVWL  772
             D+S PLP+E  + ++GVL LR HTPDS  KR F +RW  L+ GS+G N  ALYAYD+VW+
Sbjct  264   DASWPLPTETAKSLRGVLTLRLHTPDSRKKRDFMARWNKLSNGSVGFNVNALYAYDTVWI  323

Query  773   IAHAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLTGQ  952
             +A AI + L+ GG ISFSND+ L  +EG  L+L ALSIFD G  LL N+L++   GLTGQ
Sbjct  324   VAQAIKTLLDSGGNISFSNDTNLMKLEGGALNLAALSIFDQGSQLLKNVLKTKMSGLTGQ  383

Query  953   FKFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKLYG  1132
              +FN+D+S++ PSYDI+NV+  GFR IG+W N+SGLS  PPE  Y  PPN SS+NQ L  
Sbjct  384   IQFNSDRSMLQPSYDIINVLDDGFREIGYWSNHSGLSVVPPEPFYHSPPNRSSSNQHLNN  443

Query  1133  VVWPGQSVKKAPGVGFPEQ  1189
             V WPG +     G  FP  
Sbjct  444   VTWPGGTSVTPRGWVFPNN  462



>gb|AFW69063.1| hypothetical protein ZEAMMB73_044126, partial [Zea mays]
Length=943

 Score =   448 bits (1153),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 248/412 (60%), Positives = 316/412 (77%), Gaps = 0/412 (0%)
 Frame = +3

Query  1164  PRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYAVPFQFV  1343
             P+GWVFPNNG+ LR+GVPI+ S+KE ++   G +   G+ +D+F AA+ LLPY VP QF+
Sbjct  459   PKGWVFPNNGQPLRVGVPIKPSFKELVAAGKGPDNVTGYCIDIFNAAIRLLPYPVPCQFI  518

Query  1344  PFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPFKKL  1523
               G+GR+NP+Y +++ +V+    D A+GD AIV NRTK+ +FTQPY+ SGL++VAP K+ 
Sbjct  519   AIGDGRKNPNYDDIISMVAANSLDAAVGDFAIVRNRTKIAEFTQPYIESGLVIVAPVKQA  578

Query  1524  NTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSLSTL  1703
              + AWAFL PF+ +MW VT   F+ VGIVVWILEHR N+EFRGSP++QLITI WFS ST+
Sbjct  579   TSSAWAFLKPFTLEMWCVTGALFIFVGIVVWILEHRSNEEFRGSPRRQLITIFWFSFSTM  638

Query  1704  FFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESLKEGNDP  1883
             FF+HR+NTVS LGR VLIIWLFVVLIINSSYTASLTSILTVQQL + I G++SL     P
Sbjct  639   FFSHRQNTVSALGRFVLIIWLFVVLIINSSYTASLTSILTVQQLATGITGIDSLISSGLP  698

Query  1884  IGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERPYVENFL  2063
             IGYQ G F  +YLIEE+ I +SRL+ L + + YA+AL++GP  GGV AIVDE PYVE FL
Sbjct  699   IGYQAGKFTRNYLIEELNIPESRLVPLNTIQEYADALKRGPKDGGVVAIVDEMPYVEIFL  758

Query  2064  STQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLtrtscss  2243
             S  C FRIVGQEFTK GWGFAF RD PLA D+STAIL LSE+G LQRIHD+W TR SCSS
Sbjct  759   SYHCNFRIVGQEFTKEGWGFAFKRDFPLAADLSTAILQLSESGQLQRIHDEWFTRPSCSS  818

Query  2244  estelesDRLHLKSFWglfllcgaacflalfIYFVQIMLKFRRVARAEPVAD  2399
             + +E+ + RL L SFWGLFL+C   C LAL ++F++I  ++ + + +E   +
Sbjct  819   DDSEVGATRLGLGSFWGLFLVCALICLLALLVFFIRICWQYNKYSNSEAAGE  870


 Score =   444 bits (1142),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 213/380 (56%), Positives = 272/380 (72%), Gaps = 4/380 (1%)
 Frame = +2

Query  59    VAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTTQ  238
             V AL+ M+ +VVA++GPQSS + H ISHV NEL VPLLSFAATDPTL++ ++PYF+RTT 
Sbjct  89    VEALQLMERNVVAVIGPQSSGIGHVISHVVNELHVPLLSFAATDPTLSASEYPYFIRTTI  148

Query  239   SDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGAT  418
             SD +QM A+A ++D+Y WKEV A+F+DDDYGR G++AL DALAAKR +ISYKA IPP + 
Sbjct  149   SDYFQMNAVASIVDYYQWKEVTAIFVDDDYGRGGVSALGDALAAKRARISYKAAIPPNSN  208

Query  419   TRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVLDS  598
             T   I D+L +  +MESRVMV+H  P  G  +FSVA+ L MM  GYVWI TDWL+ VLDS
Sbjct  209   TDV-INDVLFKANMMESRVMVVHVNPDTGTRIFSVANKLQMMATGYVWIVTDWLAAVLDS  267

Query  599   SSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLTGG---SLGLNSYALYAYDSVW  769
             S+    ++M  +QG++VLRQHTP+S  K  F S+W +       + GLNSY  YAYDSVW
Sbjct  268   STSRDRKEMSHIQGLIVLRQHTPESVAKNKFISKWNNAARNRSITSGLNSYGFYAYDSVW  327

Query  770   LIAHAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLTG  949
              IA  +D FLN G  I+FS D  L    GS+LHL  L IFDGG  +L  LL ++F GLTG
Sbjct  328   AIARGVDQFLNNGQQINFSTDPVLHDTNGSSLHLSTLKIFDGGEQMLQQLLLTNFTGLTG  387

Query  950   QFKFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKLY  1129
             + +FN+D++LV P+YDILN+ G+G R IG+W NYSGLS A PE LY +PP++SS  Q+L+
Sbjct  388   RVQFNSDRNLVHPAYDILNIGGSGSRLIGYWSNYSGLSVAAPEILYQKPPDTSSIAQRLH  447

Query  1130  GVVWPGQSVKKAPGVGFPEQ  1189
              VVWPG S     G  FP  
Sbjct  448   NVVWPGDSTTTPKGWVFPNN  467



>ref|XP_008644923.1| PREDICTED: glutamate receptor 3.4-like isoform X2 [Zea mays]
Length=947

 Score =   449 bits (1154),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 248/412 (60%), Positives = 316/412 (77%), Gaps = 0/412 (0%)
 Frame = +3

Query  1164  PRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYAVPFQFV  1343
             P+GWVFPNNG+ LR+GVPI+ S+KE ++   G +   G+ +D+F AA+ LLPY VP QF+
Sbjct  461   PKGWVFPNNGQPLRVGVPIKPSFKELVAAGKGPDNVTGYCIDIFNAAIRLLPYPVPCQFI  520

Query  1344  PFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPFKKL  1523
               G+GR+NP+Y +++ +V+    D A+GD AIV NRTK+ +FTQPY+ SGL++VAP K+ 
Sbjct  521   AIGDGRKNPNYDDIISMVAANSLDAAVGDFAIVRNRTKIAEFTQPYIESGLVIVAPVKQA  580

Query  1524  NTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSLSTL  1703
              + AWAFL PF+ +MW VT   F+ VGIVVWILEHR N+EFRGSP++QLITI WFS ST+
Sbjct  581   TSSAWAFLKPFTLEMWCVTGALFIFVGIVVWILEHRSNEEFRGSPRRQLITIFWFSFSTM  640

Query  1704  FFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESLKEGNDP  1883
             FF+HR+NTVS LGR VLIIWLFVVLIINSSYTASLTSILTVQQL + I G++SL     P
Sbjct  641   FFSHRQNTVSALGRFVLIIWLFVVLIINSSYTASLTSILTVQQLATGITGIDSLISSGLP  700

Query  1884  IGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERPYVENFL  2063
             IGYQ G F  +YLIEE+ I +SRL+ L + + YA+AL++GP  GGV AIVDE PYVE FL
Sbjct  701   IGYQAGKFTRNYLIEELNIPESRLVPLNTIQEYADALKRGPKDGGVVAIVDEMPYVEIFL  760

Query  2064  STQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLtrtscss  2243
             S  C FRIVGQEFTK GWGFAF RD PLA D+STAIL LSE+G LQRIHD+W TR SCSS
Sbjct  761   SYHCNFRIVGQEFTKEGWGFAFKRDFPLAADLSTAILQLSESGQLQRIHDEWFTRPSCSS  820

Query  2244  estelesDRLHLKSFWglfllcgaacflalfIYFVQIMLKFRRVARAEPVAD  2399
             + +E+ + RL L SFWGLFL+C   C LAL ++F++I  ++ + + +E   +
Sbjct  821   DDSEVGATRLGLGSFWGLFLVCALICLLALLVFFIRICWQYNKYSNSEAAGE  872


 Score =   444 bits (1141),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 213/380 (56%), Positives = 272/380 (72%), Gaps = 4/380 (1%)
 Frame = +2

Query  59    VAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTTQ  238
             V AL+ M+ +VVA++GPQSS + H ISHV NEL VPLLSFAATDPTL++ ++PYF+RTT 
Sbjct  91    VEALQLMERNVVAVIGPQSSGIGHVISHVVNELHVPLLSFAATDPTLSASEYPYFIRTTI  150

Query  239   SDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGAT  418
             SD +QM A+A ++D+Y WKEV A+F+DDDYGR G++AL DALAAKR +ISYKA IPP + 
Sbjct  151   SDYFQMNAVASIVDYYQWKEVTAIFVDDDYGRGGVSALGDALAAKRARISYKAAIPPNSN  210

Query  419   TRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVLDS  598
             T   I D+L +  +MESRVMV+H  P  G  +FSVA+ L MM  GYVWI TDWL+ VLDS
Sbjct  211   TDV-INDVLFKANMMESRVMVVHVNPDTGTRIFSVANKLQMMATGYVWIVTDWLAAVLDS  269

Query  599   SSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLTGG---SLGLNSYALYAYDSVW  769
             S+    ++M  +QG++VLRQHTP+S  K  F S+W +       + GLNSY  YAYDSVW
Sbjct  270   STSRDRKEMSHIQGLIVLRQHTPESVAKNKFISKWNNAARNRSITSGLNSYGFYAYDSVW  329

Query  770   LIAHAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLTG  949
              IA  +D FLN G  I+FS D  L    GS+LHL  L IFDGG  +L  LL ++F GLTG
Sbjct  330   AIARGVDQFLNNGQQINFSTDPVLHDTNGSSLHLSTLKIFDGGEQMLQQLLLTNFTGLTG  389

Query  950   QFKFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKLY  1129
             + +FN+D++LV P+YDILN+ G+G R IG+W NYSGLS A PE LY +PP++SS  Q+L+
Sbjct  390   RVQFNSDRNLVHPAYDILNIGGSGSRLIGYWSNYSGLSVAAPEILYQKPPDTSSIAQRLH  449

Query  1130  GVVWPGQSVKKAPGVGFPEQ  1189
              VVWPG S     G  FP  
Sbjct  450   NVVWPGDSTTTPKGWVFPNN  469



>ref|XP_006412122.1| hypothetical protein EUTSA_v10024351mg [Eutrema salsugineum]
 gb|ESQ53575.1| hypothetical protein EUTSA_v10024351mg [Eutrema salsugineum]
Length=911

 Score =   473 bits (1218),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 267/414 (64%), Positives = 335/414 (81%), Gaps = 7/414 (2%)
 Frame = +3

Query  1164  PRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYAVPFQFV  1343
             PRGWVFPNNG++LRIGVP R S+K+F+S V G+N  +G+S+DVF AA+ LL Y VP +F+
Sbjct  454   PRGWVFPNNGRRLRIGVPNRASFKDFVSSVNGSNRVQGYSIDVFEAAIKLLSYPVPHEFI  513

Query  1344  PFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPFKKL  1523
              FG+G +NP+++ELV  V+TG FD  +GDIAIVT RT++VDFTQPY+ SGL+VVAP  KL
Sbjct  514   LFGDGLKNPNFNELVNNVTTGVFDAVVGDIAIVTKRTRIVDFTQPYIESGLVVVAPVTKL  573

Query  1524  NTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSLSTL  1703
             N   WAFL PF+  MW VTA FF++VG V+WILEHR+NDEFRG P++Q++TILWFS ST+
Sbjct  574   NDTPWAFLRPFTPPMWAVTASFFLIVGSVIWILEHRINDEFRGPPRRQIVTILWFSFSTM  633

Query  1704  FFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESLKEGNDP  1883
             FF+HRENTVSTLGR+VL+IWLFVVLII SSYTASLTSILTVQQL SPIKGV++L   ++ 
Sbjct  634   FFSHRENTVSTLGRVVLLIWLFVVLIITSSYTASLTSILTVQQLNSPIKGVDTLISSSER  693

Query  1884  IGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERPYVENFL  2063
             +G+Q+GS+AE+Y+I+E+ I++SRL+ LGSP+ YA ALE G     VSAIVDERPYV+ FL
Sbjct  694   VGFQVGSYAENYMIDELNIARSRLVPLGSPKEYATALENGT----VSAIVDERPYVDLFL  749

Query  2064  STQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLtrtscss  2243
             S  C F I GQEFT+SGWGFAFPRDSPLAVDMSTAIL LSE G LQ+IHDKWL++++CS+
Sbjct  750   SEFCGFAIRGQEFTRSGWGFAFPRDSPLAVDMSTAILGLSETGQLQKIHDKWLSKSNCSN  809

Query  2244  estelesD---RLHLKSFWglfllcgaacflalfIYFVQIMLKFRRVARAEPVA  2396
              +     D   +L L+SFWGLFL+CG ACF+AL IYFV+I+  F    + E  A
Sbjct  810   LNGSESDDDQEQLKLRSFWGLFLVCGIACFIALLIYFVKIVRDFCNNHKPEEEA  863


 Score =   419 bits (1077),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 197/380 (52%), Positives = 277/380 (73%), Gaps = 2/380 (1%)
 Frame = +2

Query  56    LVAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTT  235
             ++ AL+FM+TD VAI+GPQ+S++AH +SH+ANEL VP+LSF A DP+L++LQFP+F++T 
Sbjct  83    IMGALQFMETDAVAIIGPQTSIMAHVLSHLANELNVPMLSFTALDPSLSALQFPFFVQTA  142

Query  236   QSDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGA  415
              SD++ M AIA++I +YGW +VIA++ DDD  RNG+ +L D L  +RCKISYKA +P   
Sbjct  143   PSDLFLMRAIAEMITYYGWSDVIALYNDDDNSRNGVTSLGDELEGRRCKISYKAVLPLDV  202

Query  416   --TTRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTV  589
               T+  EI+D LV+I  MESRV++++ +P  G M+F  A  LGMM +GYVWI+T WLS++
Sbjct  203   VITSPREIIDELVKIQGMESRVIIVNTFPKTGRMIFEEAWKLGMMDNGYVWIATTWLSSL  262

Query  590   LDSSSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLTGGSLGLNSYALYAYDSVW  769
             LDS +PL  +K + ++GVL LR HTP+S  KR F +RW  L+ G++GLN Y LYAYD+VW
Sbjct  263   LDSFTPLALKKAKSIRGVLTLRLHTPESRKKRDFVARWNKLSNGTVGLNVYGLYAYDTVW  322

Query  770   LIAHAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLTG  949
             +IA A+ + L+ G  ISFS+DSKL S++G +L+L ALSIFD G   L+ ++++   G+TG
Sbjct  323   IIARAVKNLLDSGANISFSSDSKLNSLQGGSLNLSALSIFDQGSKFLDYIVKTKMSGVTG  382

Query  950   QFKFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKLY  1129
               +F  D+S+  P+YDI+NV+  GF  IG+W N+SGLS  PPE+LYS+P N SS+NQ L 
Sbjct  383   PVQFLPDRSMNQPAYDIINVVNDGFNQIGYWSNHSGLSITPPESLYSKPSNRSSSNQHLS  442

Query  1130  GVVWPGQSVKKAPGVGFPEQ  1189
              V WPG +     G  FP  
Sbjct  443   NVTWPGGASVTPRGWVFPNN  462



>ref|XP_006383781.1| hypothetical protein POPTR_0005s27520g [Populus trichocarpa]
 gb|ERP61578.1| hypothetical protein POPTR_0005s27520g [Populus trichocarpa]
Length=684

 Score =   573 bits (1478),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 265/376 (70%), Positives = 322/376 (86%), Gaps = 1/376 (0%)
 Frame = +2

Query  56    LVAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTT  235
             L  ALKF + DV+AI+GPQSSVVAH ISHVANELQVPLLSFAATDPTL SLQFP+F+RTT
Sbjct  87    LAEALKFTENDVIAIIGPQSSVVAHIISHVANELQVPLLSFAATDPTLNSLQFPFFVRTT  146

Query  236   QSDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGA  415
             QSD YQM AI++V+DHYGWK+V A+FID+DYGRNG++AL D LA +RC+ISYK GIPP +
Sbjct  147   QSDFYQMAAISEVVDHYGWKQVTAIFIDNDYGRNGVSALGDRLAERRCRISYKVGIPPDS  206

Query  416   -TTRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVL  592
                R +IMDILV++ALMESRV+++H YP  GF +FS+A++L MMG+G+VWI+TDWLS+VL
Sbjct  207   GVNRGDIMDILVKVALMESRVVIVHVYPDMGFKIFSMANHLEMMGNGWVWIATDWLSSVL  266

Query  593   DSSSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLTGGSLGLNSYALYAYDSVWL  772
             DS+SPLPSE M+ +QGVLVLRQHTPDS+  RAF+SRW  LTGG LGL+SY LYAYDSVWL
Sbjct  267   DSASPLPSETMDSVQGVLVLRQHTPDSDRNRAFSSRWHKLTGGYLGLHSYGLYAYDSVWL  326

Query  773   IAHAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLTGQ  952
             IAHA+D+F N+GG+ISFSNDS+L S EGS+LHLEA+SIFD G LLLNN+LQSD VGLTG+
Sbjct  327   IAHALDAFFNQGGIISFSNDSRLPSGEGSSLHLEAISIFDDGKLLLNNILQSDLVGLTGR  386

Query  953   FKFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKLYG  1132
              KF  D+SL+LP+YD++NVIGTG+R IG+W NYSGLS  PPETLY++PPN SSANQKLY 
Sbjct  387   IKFGIDRSLILPAYDVVNVIGTGYRRIGYWSNYSGLSITPPETLYTKPPNRSSANQKLYN  446

Query  1133  VVWPGQSVKKAPGVGF  1180
              +WPG ++    G  F
Sbjct  447   AIWPGDTLLTPRGWAF  462


 Score =   297 bits (761),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 146/186 (78%), Positives = 171/186 (92%), Gaps = 0/186 (0%)
 Frame = +3

Query  1164  PRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYAVPFQFV  1343
             PRGW F NNGKQLRIGVPIRVS++EF+SQV GT+TFKGF +DVFTAAVNLLPY V +QFV
Sbjct  457   PRGWAFANNGKQLRIGVPIRVSFREFVSQVQGTDTFKGFCIDVFTAAVNLLPYPVQYQFV  516

Query  1344  PFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPFKKL  1523
             PFG+G+ENPSY+ELV  ++TG+FD A+GDIAIVT RTKV+DFTQPYVASGL+VVAPF+KL
Sbjct  517   PFGDGKENPSYTELVNKITTGFFDAAVGDIAIVTKRTKVIDFTQPYVASGLVVVAPFRKL  576

Query  1524  NTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSLSTL  1703
             N+GAWAFL PFSA+MW VTA FF+VVG+VVWILEHR+NDEFRG PK+Q+IT+LWFSLSTL
Sbjct  577   NSGAWAFLRPFSARMWIVTACFFLVVGLVVWILEHRINDEFRGPPKRQVITVLWFSLSTL  636

Query  1704  FFAHRE  1721
             FFAH +
Sbjct  637   FFAHSK  642


 Score = 43.5 bits (101),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 21/42 (50%), Positives = 28/42 (67%), Gaps = 0/42 (0%)
 Frame = +2

Query  1718  REYCEHPWSNGVNHMALRGLDH*LQLHRKFDLYPHSATAIFS  1843
             +++ EHP S    +MAL GL++ L+LH KFD   HSA  IFS
Sbjct  642   KKHYEHPCSVCATYMALCGLNNQLKLHCKFDFNFHSAATIFS  683



>ref|XP_008379924.1| PREDICTED: glutamate receptor 3.4-like [Malus domestica]
Length=866

 Score =   453 bits (1166),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 265/411 (64%), Positives = 325/411 (79%), Gaps = 2/411 (0%)
 Frame = +3

Query  1164  PRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYAVPFQFV  1343
             PRGWVFPNNG+ LRIGVP RVSYK+F+++       +G+ +DVF AAVNLLPYAVP  ++
Sbjct  393   PRGWVFPNNGRPLRIGVPYRVSYKDFVAKDKSPXGVRGYCIDVFEAAVNLLPYAVPRXYM  452

Query  1344  PFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPFKKL  1523
              +G+G+ NP YS LV  V+   FD A+GD+ I  NRT++VDFTQPY+ SGL+VV P K  
Sbjct  453   LYGDGKRNPEYSSLVAQVAQNXFDAAVGDVTITXNRTRIVDFTQPYMESGLVVVVPVKXA  512

Query  1524  NTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSLSTL  1703
              +  W FL PF+ QMW VT  FF++VG VVWILEHR+N EFRG P QQL+TI WFS ST+
Sbjct  513   KSNPWXFLKPFTYQMWLVTGAFFLLVGAVVWILEHRINHEFRGPPSQQLMTIFWFSFSTM  572

Query  1704  FFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESLKEGNDP  1883
             FF+HRENTVSTLGR+VLIIWLFVVLIINSSYTASLTSILTVQQL S I+G++SL   ND 
Sbjct  573   FFSHRENTVSTLGRLVLIIWLFVVLIINSSYTASLTSILTVQQLTSRIEGIDSLISSNDR  632

Query  1884  IGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERPYVENFL  2063
             IG Q GSFA  YLI+E+ I++SRL+ L   EAY +AL  GP +GGV+AIVDE PY+E F+
Sbjct  633   IGVQDGSFAWRYLIDEMNIAESRLVKLKDMEAYIKALTDGPRRGGVAAIVDELPYIELFM  692

Query  2064  S-TQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLtrtscs  2240
             S T+C FR VGQEFTKSGWGFAF RDSPLAVD+STAIL LSENG+LQ+IH+KWLT   CS
Sbjct  693   SNTKCAFRTVGQEFTKSGWGFAFQRDSPLAVDLSTAILQLSENGELQKIHNKWLTHNECS  752

Query  2241  sestelesDRLHLKSFWglfllcgaacflalfIYFVQIMLKFRRVARAEPV  2393
             ++ TE+++D+L L SFWGLFL+CG ACFLAL ++F +I+ ++RR    EPV
Sbjct  753   TQLTEVDADQLSLTSFWGLFLICGIACFLALAVFFCRILCQYRRFT-PEPV  802


 Score =   435 bits (1118),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 206/381 (54%), Positives = 276/381 (72%), Gaps = 3/381 (1%)
 Frame = +2

Query  50    ILLVAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLR  229
             + LVAA++ +  DVVA +GPQSS +AH ISHV NEL VPLLSF ATDP+LA+L++PYF+R
Sbjct  23    VFLVAAMELINNDVVAAVGPQSSGIAHVISHVVNELHVPLLSFGATDPSLAALKYPYFVR  82

Query  230   TTQSDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPP  409
             TTQSD +QM A+AD+++++GW+EVIA+F+DDDYGRNGI+ L DALA KR KISYKA   P
Sbjct  83    TTQSDYFQMYAVADLVEYFGWREVIAIFVDDDYGRNGISILADALAVKRSKISYKAAFSP  142

Query  410   GATTRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTV  589
             GA  +++I ++L+ + LMESRV ++H +P +G  +FS+A  LGMM  GYVWI+TDWL + 
Sbjct  143   GA-LKSDINELLMGVNLMESRVYIVHVHPDSGLTIFSIAKALGMMTSGYVWIATDWLPSY  201

Query  590   LDSSSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLT-GGSLGLNSYALYAYDSV  766
             LDS +P   +   ++QGV+ LR HTPD++LK+ F SRW  L   G+   NSYALYAYDS+
Sbjct  202   LDSLNPPGPDTTNLLQGVVALRHHTPDTDLKKRFMSRWSKLKHEGTPSFNSYALYAYDSI  261

Query  767   WLIAHAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLT  946
             WL A A+D F N+GG +SFSN  +L+    STLHL +L IF GG   L  +L+ +F G++
Sbjct  262   WLAARALDVFFNEGGNVSFSNYPRLKDTNRSTLHLTSLRIFYGGQKYLQTILKMNFTGIS  321

Query  947   GQFKFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKL  1126
             GQ +F+ DK LV P+YDILN+ GTG R +G+W N +GLS   PE LY +P N ++  Q L
Sbjct  322   GQIEFDQDKYLVRPAYDILNIGGTGSRRVGYWSNSTGLSVXAPEILYKKPXNRNTTAQ-L  380

Query  1127  YGVVWPGQSVKKAPGVGFPEQ  1189
             Y V+WPG+      G  FP  
Sbjct  381   YXVIWPGEVTATPRGWVFPNN  401



>ref|XP_006383780.1| hypothetical protein POPTR_0005s27520g [Populus trichocarpa]
 gb|ERP61577.1| hypothetical protein POPTR_0005s27520g [Populus trichocarpa]
Length=661

 Score =   574 bits (1480),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 265/376 (70%), Positives = 322/376 (86%), Gaps = 1/376 (0%)
 Frame = +2

Query  56    LVAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTT  235
             L  ALKF + DV+AI+GPQSSVVAH ISHVANELQVPLLSFAATDPTL SLQFP+F+RTT
Sbjct  87    LAEALKFTENDVIAIIGPQSSVVAHIISHVANELQVPLLSFAATDPTLNSLQFPFFVRTT  146

Query  236   QSDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGA  415
             QSD YQM AI++V+DHYGWK+V A+FID+DYGRNG++AL D LA +RC+ISYK GIPP +
Sbjct  147   QSDFYQMAAISEVVDHYGWKQVTAIFIDNDYGRNGVSALGDRLAERRCRISYKVGIPPDS  206

Query  416   -TTRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVL  592
                R +IMDILV++ALMESRV+++H YP  GF +FS+A++L MMG+G+VWI+TDWLS+VL
Sbjct  207   GVNRGDIMDILVKVALMESRVVIVHVYPDMGFKIFSMANHLEMMGNGWVWIATDWLSSVL  266

Query  593   DSSSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLTGGSLGLNSYALYAYDSVWL  772
             DS+SPLPSE M+ +QGVLVLRQHTPDS+  RAF+SRW  LTGG LGL+SY LYAYDSVWL
Sbjct  267   DSASPLPSETMDSVQGVLVLRQHTPDSDRNRAFSSRWHKLTGGYLGLHSYGLYAYDSVWL  326

Query  773   IAHAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLTGQ  952
             IAHA+D+F N+GG+ISFSNDS+L S EGS+LHLEA+SIFD G LLLNN+LQSD VGLTG+
Sbjct  327   IAHALDAFFNQGGIISFSNDSRLPSGEGSSLHLEAISIFDDGKLLLNNILQSDLVGLTGR  386

Query  953   FKFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKLYG  1132
              KF  D+SL+LP+YD++NVIGTG+R IG+W NYSGLS  PPETLY++PPN SSANQKLY 
Sbjct  387   IKFGIDRSLILPAYDVVNVIGTGYRRIGYWSNYSGLSITPPETLYTKPPNRSSANQKLYN  446

Query  1133  VVWPGQSVKKAPGVGF  1180
              +WPG ++    G  F
Sbjct  447   AIWPGDTLLTPRGWAF  462


 Score =   313 bits (802),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 154/194 (79%), Positives = 179/194 (92%), Gaps = 0/194 (0%)
 Frame = +3

Query  1164  PRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYAVPFQFV  1343
             PRGW F NNGKQLRIGVPIRVS++EF+SQV GT+TFKGF +DVFTAAVNLLPY V +QFV
Sbjct  457   PRGWAFANNGKQLRIGVPIRVSFREFVSQVQGTDTFKGFCIDVFTAAVNLLPYPVQYQFV  516

Query  1344  PFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPFKKL  1523
             PFG+G+ENPSY+ELV  ++TG+FD A+GDIAIVT RTKV+DFTQPYVASGL+VVAPF+KL
Sbjct  517   PFGDGKENPSYTELVNKITTGFFDAAVGDIAIVTKRTKVIDFTQPYVASGLVVVAPFRKL  576

Query  1524  NTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSLSTL  1703
             N+GAWAFL PFSA+MW VTA FF+VVG+VVWILEHR+NDEFRG PK+Q+IT+LWFSLSTL
Sbjct  577   NSGAWAFLRPFSARMWIVTACFFLVVGLVVWILEHRINDEFRGPPKRQVITVLWFSLSTL  636

Query  1704  FFAHRENTVSTLGR  1745
             FFAHRENT+STL R
Sbjct  637   FFAHRENTMSTLAR  650



>dbj|BAJ99508.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=933

 Score =   446 bits (1148),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 213/380 (56%), Positives = 275/380 (72%), Gaps = 4/380 (1%)
 Frame = +2

Query  59    VAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTTQ  238
             + AL+ M+ +VVA++GPQSS + H ISHV NEL VPLLSFAATDPTL++ ++PYF+RTT 
Sbjct  88    IEALELMEKNVVAVIGPQSSGIGHVISHVVNELHVPLLSFAATDPTLSASEYPYFIRTTI  147

Query  239   SDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGAT  418
             +D++QM A+A ++D+Y WKEV A+F+DDDYGR G++AL DALAAKR KIS+KA IPP + 
Sbjct  148   NDLFQMNAVASIVDYYQWKEVTAIFVDDDYGRGGVSALGDALAAKRAKISHKAAIPPNSN  207

Query  419   TRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVLDS  598
             T   I D+L +  +MESRVMV+HA P  G  +FSVA+ L MM +GYVWI TDWL+ VLDS
Sbjct  208   TEV-INDVLFRANMMESRVMVVHANPDTGMRIFSVANKLQMMANGYVWIVTDWLAAVLDS  266

Query  599   SSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLT---GGSLGLNSYALYAYDSVW  769
             S+    + M  +QG++VLRQHTP+S+ K  F ++W +     G + GLNSY  YAYDSVW
Sbjct  267   SASGDLKDMSHIQGLIVLRQHTPESDAKDKFITKWNNAARSRGITSGLNSYGFYAYDSVW  326

Query  770   LIAHAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLTG  949
              +A  ID FL+ G  ++FS D KL S   STL L  L +FDGG  +L  LL ++F GLTG
Sbjct  327   AVARGIDKFLDNGQQVNFSTDPKLHSSNDSTLQLSTLKVFDGGEQMLQQLLLTNFTGLTG  386

Query  950   QFKFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKLY  1129
               +FN+D++LV P+YDILNV G+G R IG+W NYS LS A PETLY +PPN+SS  Q+LY
Sbjct  387   PVRFNSDRNLVRPAYDILNVGGSGSRLIGYWSNYSDLSVAAPETLYQKPPNASSVAQRLY  446

Query  1130  GVVWPGQSVKKAPGVGFPEQ  1189
              VVWPG S     G  FP  
Sbjct  447   NVVWPGDSTTTPKGWVFPNN  466


 Score =   437 bits (1125),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 240/401 (60%), Positives = 313/401 (78%), Gaps = 0/401 (0%)
 Frame = +3

Query  1164  PRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYAVPFQFV  1343
             P+GWVFPNNG+ LR+GVPI+ S+KE ++   G++   G+ VD+F AA+ LLPY VP QF+
Sbjct  458   PKGWVFPNNGQPLRVGVPIKASFKELVAGDRGSDHVTGYCVDIFNAAIKLLPYPVPCQFI  517

Query  1344  PFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPFKKL  1523
               G+GR+NP+Y +++ +V+    D A+GD AIV NRTK+ +FTQPY+ SGL++VA  ++ 
Sbjct  518   TIGDGRKNPNYDDIISMVADNSLDAAVGDFAIVRNRTKMAEFTQPYIESGLVIVASVQRA  577

Query  1524  NTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSLSTL  1703
              + AWAFL PF+ +MW VT   F+ VGIVVWILEHR N+EFRGSP++Q+ITI+WFS ST+
Sbjct  578   ASSAWAFLKPFTLEMWCVTGALFIFVGIVVWILEHRTNEEFRGSPRRQIITIIWFSFSTM  637

Query  1704  FFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESLKEGNDP  1883
             FF+HR+NT S LGR VLIIWLFVVLIINSSYTASLTSILTVQQL + I G+++L     P
Sbjct  638   FFSHRQNTGSALGRFVLIIWLFVVLIINSSYTASLTSILTVQQLSTGITGIDNLISSGLP  697

Query  1884  IGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERPYVENFL  2063
             IGYQ G F ++YL+EE+ I +SRL+AL + + YA+AL +G   GGV+AIVDE PYVE FL
Sbjct  698   IGYQAGKFTKNYLVEELSIPESRLVALNTIKEYADALTRGSEDGGVAAIVDEMPYVEIFL  757

Query  2064  STQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLtrtscss  2243
             S  C FRIVG+EFTK GWGFAF RDSPLA D+STAIL LSE+G LQRIHD+W TR SCSS
Sbjct  758   SYHCDFRIVGREFTKEGWGFAFQRDSPLAADLSTAILQLSESGQLQRIHDEWFTRPSCSS  817

Query  2244  estelesDRLHLKSFWglfllcgaacflalfIYFVQIMLKF  2366
             + +E+ +  L L+SFWGLFL+C   C LAL ++F+++  ++
Sbjct  818   DDSEVAATSLGLRSFWGLFLVCALICLLALVVFFIRVCWQY  858



>ref|XP_004966219.1| PREDICTED: glutamate receptor 3.4-like [Setaria italica]
Length=938

 Score =   447 bits (1151),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 244/412 (59%), Positives = 315/412 (76%), Gaps = 0/412 (0%)
 Frame = +3

Query  1164  PRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYAVPFQFV  1343
             P+GWVFPNNG+ LR+GVPI+ S+KE +S   G +   G+ +D+F AA+ LLPY VP QF+
Sbjct  455   PKGWVFPNNGQPLRVGVPIKASFKELVSGGRGPDNVTGYCIDIFNAAIKLLPYPVPCQFI  514

Query  1344  PFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPFKKL  1523
               G+G +NP+Y +++++++    D A+GD AIV NRTK+ +FTQPY+ SGL++VAP K+ 
Sbjct  515   TIGDGTKNPNYDDIIKMIAANSLDAAVGDFAIVRNRTKIAEFTQPYIESGLVIVAPVKQA  574

Query  1524  NTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSLSTL  1703
              + AWAFL PF+ +MW VT   F+ VGIVVWILEHR N+EFRGSP++Q+ITI WFS ST+
Sbjct  575   TSSAWAFLKPFTLEMWCVTGALFIFVGIVVWILEHRTNEEFRGSPRRQVITIFWFSFSTM  634

Query  1704  FFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESLKEGNDP  1883
             FF+HR+NTVS LGR VLIIWLFVVLIINSSYTASLTSILTVQQL + I G++ L     P
Sbjct  635   FFSHRQNTVSALGRFVLIIWLFVVLIINSSYTASLTSILTVQQLATGITGIDDLISSALP  694

Query  1884  IGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERPYVENFL  2063
             IGYQ G F  +YLIEE+ I +SRL+ L + + YA+AL++GP  GGV AIVDE PYV+ FL
Sbjct  695   IGYQAGKFTRNYLIEELNIPESRLVPLNTIQEYADALKRGPKDGGVGAIVDETPYVQIFL  754

Query  2064  STQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLtrtscss  2243
             S  C FRIVGQEFTK GWGFAF RDSPLA D+STAIL LSE+G LQRIHD+W TR SCSS
Sbjct  755   SYHCNFRIVGQEFTKEGWGFAFQRDSPLAADLSTAILQLSESGQLQRIHDEWFTRPSCSS  814

Query  2244  estelesDRLHLKSFWglfllcgaacflalfIYFVQIMLKFRRVARAEPVAD  2399
             + +E+ + RL L SFWGLFL+C   C  AL ++F++I  ++ + + +E   +
Sbjct  815   DDSEVGATRLGLGSFWGLFLVCALICLFALLVFFIRICWQYSKYSNSEAAGE  866


 Score =   435 bits (1118),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 209/380 (55%), Positives = 268/380 (71%), Gaps = 5/380 (1%)
 Frame = +2

Query  59    VAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTTQ  238
             + AL+ M+ +VV ++GPQSS + H ISHV NEL VPLLSFAATDPTL++ ++PYF+RTT 
Sbjct  86    IEALQLMEKNVVTVIGPQSSGIGHVISHVVNELHVPLLSFAATDPTLSASEYPYFIRTTI  145

Query  239   SDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGAT  418
             SD +QM A+A ++D+Y WKEV A+F+DDDYGR G+ AL DALA KR +ISYKA IPP + 
Sbjct  146   SDYFQMNAVASIVDYYQWKEVTAIFVDDDYGRGGVTALGDALAEKRARISYKAAIPPNSN  205

Query  419   TRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVLDS  598
             +   I D+L +  +MESRVMV+H  P  G  +FS+A+ L MM  GYVWI TDWL+ VLDS
Sbjct  206   SDV-ISDVLFRANMMESRVMVVHVNPDTGMRIFSIANKLQMMASGYVWIVTDWLAAVLDS  264

Query  599   SSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLTGG---SLGLNSYALYAYDSVW  769
             S P    K   +QG++VLRQHTP+S+ K  F S+W  +      + GLNSY  YAYD+VW
Sbjct  265   SVPR-DLKYSHIQGLIVLRQHTPESDAKNKFISKWNVVARNRSVTSGLNSYGFYAYDTVW  323

Query  770   LIAHAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLTG  949
              +AHAID FLN G  I+FS D +L    GSTL L  L IFDGG  +L  LL ++F GLTG
Sbjct  324   TVAHAIDQFLNGGQQINFSTDPRLHDSNGSTLRLSTLKIFDGGEQMLQQLLLTNFTGLTG  383

Query  950   QFKFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKLY  1129
               +FN+D++LV P+YDILN+ G+G + IG+W NYSGLS   PE LY +PPN+SS  Q+L+
Sbjct  384   PVQFNSDRNLVHPAYDILNIGGSGSQLIGYWSNYSGLSVTAPEILYQKPPNTSSNAQRLH  443

Query  1130  GVVWPGQSVKKAPGVGFPEQ  1189
              VVWPG S     G  FP  
Sbjct  444   NVVWPGDSTTTPKGWVFPNN  463



>ref|XP_004151885.1| PREDICTED: glutamate receptor 3.4-like [Cucumis sativus]
 gb|KGN63259.1| hypothetical protein Csa_2G418940 [Cucumis sativus]
Length=935

 Score =   447 bits (1151),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 262/419 (63%), Positives = 322/419 (77%), Gaps = 9/419 (2%)
 Frame = +3

Query  1164  PRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYAVPFQFV  1343
             PRGWVFP+NGK L+I VP RVSYK F+++       KG+ +DVF AA+NLLPY VP  ++
Sbjct  469   PRGWVFPHNGKPLQIVVPNRVSYKAFVAKDNNPLGVKGYCIDVFEAAINLLPYPVPHTYI  528

Query  1344  PFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPFKKL  1523
              +G+G++ P YS+LV  VS   +D A+GDI IVTNRTK+VDFTQP++ SGL+VV   K  
Sbjct  529   LYGDGKDTPEYSDLVYEVSQNKYDAAVGDITIVTNRTKIVDFTQPFMESGLVVVTVVKGE  588

Query  1524  NTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSLSTL  1703
              +  WAFL PF+ QMW VTA FF+ VG VVWILEHR N+EFRG P+QQLITI WFS ST+
Sbjct  589   KSSPWAFLRPFTIQMWAVTALFFIFVGAVVWILEHRTNEEFRGPPRQQLITIFWFSFSTM  648

Query  1704  FFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESLKEGNDP  1883
             FF+H+ENTVSTLGR+VLIIWLFVVLIINSSYTASLTSILTVQQL S I+G++SL    D 
Sbjct  649   FFSHKENTVSTLGRLVLIIWLFVVLIINSSYTASLTSILTVQQLTSKIEGIDSLISSTDA  708

Query  1884  IGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERPYVENFL  2063
             IG Q GSFA +YLI+E+ I  SR+I L + + Y +AL +GP  GGV+AIVDE PYVE FL
Sbjct  709   IGVQEGSFALNYLIDELNIVASRIIKLKNQDEYDDALRRGPGNGGVAAIVDELPYVELFL  768

Query  2064  S-TQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLtrtscs  2240
             S T C F+ VGQEFTKSGWGFAF RDSPLAVD+STAIL LSENGDLQ+IHDKWL+RT CS
Sbjct  769   SGTNCVFKTVGQEFTKSGWGFAFQRDSPLAVDLSTAILQLSENGDLQKIHDKWLSRTECS  828

Query  2241  sestelesDRLHLKSFWglfllcgaacflalfIYFVQIMLKFRR--------VARAEPV  2393
                 + + ++L L SFWGLFL+CG +CF+AL I+F +++ ++RR        V + EPV
Sbjct  829   LGLNQADLNQLSLSSFWGLFLICGISCFIALSIFFFRVLFQYRRFTPETQSEVEQIEPV  887


 Score =   434 bits (1117),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 209/378 (55%), Positives = 274/378 (72%), Gaps = 3/378 (1%)
 Frame = +2

Query  59    VAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTTQ  238
             V AL+ MQ +VVA +GPQSS +AH ISHV NEL +PLLSF ATDP L++ ++ YF+RTTQ
Sbjct  102   VEALQLMQDEVVAAIGPQSSGIAHVISHVINELHIPLLSFGATDPALSAHEYQYFVRTTQ  161

Query  239   SDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGAT  418
             SD +QM AIAD++D++GW+EV+A+F+DDD GR+GI+AL DALA KR KISY+A  PPG+ 
Sbjct  162   SDYFQMNAIADIVDYFGWREVVAIFVDDDNGRSGISALSDALAKKRAKISYRAAFPPGSP  221

Query  419   TRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVLDS  598
             + A I D+LV I LMESRV ++H  P  G  VFS+A  L M+G GYVWI+TDWL + LDS
Sbjct  222   SSA-ISDLLVSINLMESRVYIVHVNPDTGLSVFSMAKKLQMLGSGYVWITTDWLPSFLDS  280

Query  599   SSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLT-GGSLGLNSYALYAYDSVWLI  775
                   + M  +QGV+ LR HTPD  LK+ F S+WK+L    S   NSYALYAYDSVWL 
Sbjct  281   FETNSPDVMNQLQGVVALRHHTPDGNLKKNFISKWKNLKLKKSPNFNSYALYAYDSVWLA  340

Query  776   AHAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLTGQF  955
             A A+D+F+ +GG ISFSND KL    GS LHL++L +F+GG  LL  + +++F G++G+ 
Sbjct  341   ARALDTFIKEGGNISFSNDPKLSENNGSMLHLKSLRVFNGGEQLLQTIKRTNFTGVSGRI  400

Query  956   KFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKLYGV  1135
             +F +D++L+ P+YDILN+ GTG R IG+W NYSGLST  PE LY++P N +S N  LY V
Sbjct  401   QFGDDRNLINPTYDILNIGGTGSRRIGYWSNYSGLSTIAPENLYTKPLN-ASPNNHLYSV  459

Query  1136  VWPGQSVKKAPGVGFPEQ  1189
             +WPG+      G  FP  
Sbjct  460   IWPGEITTVPRGWVFPHN  477



>ref|XP_004952125.1| PREDICTED: glutamate receptor 3.1-like isoform X1 [Setaria italica]
 ref|XP_004952126.1| PREDICTED: glutamate receptor 3.1-like isoform X2 [Setaria italica]
Length=965

 Score =   443 bits (1139),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 266/442 (60%), Positives = 332/442 (75%), Gaps = 35/442 (8%)
 Frame = +3

Query  1161  KPRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYAVPFQF  1340
             KPRGWVFP+N K+L IGVP R S+K F++    T    G+ +DVFT A++LLPY V ++F
Sbjct  457   KPRGWVFPSNAKELIIGVPNRHSFKAFVTLDNATGKMTGYCIDVFTQALSLLPYPVTYRF  516

Query  1341  VPFGNGRENPSYSELVRLV-----------STGY--------------------FDGAIG  1427
              PFG+G ENP Y++L++ V             G+                    FD AIG
Sbjct  517   EPFGSGNENPHYNQLIQKVVDNVSMDKQFFCRGFSSCTFLHVIMNEQSYLILQEFDAAIG  576

Query  1428  DIAIVTNRTKVVDFTQPYVASGLLVVAPFKKLNTGAWAFLTPFSAQMWGvtafffvvvgi  1607
             DIAI  +RT+ +DFTQP++ SGL+++AP KK  T +WAFL PF+  MW VT   F+VVG+
Sbjct  577   DIAITMSRTQTLDFTQPFIESGLVILAPVKKHITNSWAFLQPFTLGMWCVTGLSFLVVGV  636

Query  1608  vvWILEHRMNDEFRGSPKQQLITILWFSLSTLFFAHRENTVSTLGRMvliiwlfvvliiN  1787
             V+W+LEHR+NDEFRGSP+QQLITI+WFS STLFFAHRENT+STLGR VLIIWLFVVLII 
Sbjct  637   VIWVLEHRINDEFRGSPRQQLITIVWFSFSTLFFAHRENTMSTLGRGVLIIWLFVVLIIQ  696

Query  1788  SSYTASLTSILTVQQLYSPIKGVESLKEGNDPIGYQIGSFAEHYLIEEIGISKSRLIALG  1967
             SSYTASLTSILTVQQL + I+G++ LK  + PIG+Q+GSFAE Y+++E+ IS+SRL ALG
Sbjct  697   SSYTASLTSILTVQQLDTSIRGLDDLKNSDYPIGFQVGSFAEEYMVKELNISRSRLKALG  756

Query  1968  SPEAYAEALEKGPHKGGVSAIVDERPYVENFLSTQCKFRIVGQEFTKSGWGFAFPRDSPL  2147
             SP+ YAE L++GP +GGV AIVDERPYVE FLST CK  + G +FT  GWGFAFPRDSPL
Sbjct  757   SPDEYAENLKQGPKRGGVMAIVDERPYVELFLSTYCKIAVAGSDFTSRGWGFAFPRDSPL  816

Query  2148  AVDMSTAILSLSENGDLQRIHDKWLtrtscsseste-lesDRLHLKSFWglfllcgaacf  2324
              VD+STAIL+LSENG+LQRIHDKWL  + CS+++TE ++S++L L+SF GLFL+CGAAC 
Sbjct  817   QVDLSTAILTLSENGELQRIHDKWLRTSDCSADNTEFVDSNQLRLESFMGLFLICGAACV  876

Query  2325  lalfIYFVQIMLKFRRVARAEP  2390
             LAL IYF  IML  RR  R EP
Sbjct  877   LALLIYF-GIML--RRYLRHEP  895


 Score =   439 bits (1128),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 208/381 (55%), Positives = 282/381 (74%), Gaps = 7/381 (2%)
 Frame = +2

Query  56    LVAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTT  235
             +V AL+FM+TDV+AI+GPQ S +AH IS+VANELQVPL+SFA +D TL+S+QFP+F+RT 
Sbjct  86    MVEALQFMETDVIAIIGPQCSTIAHIISYVANELQVPLMSFA-SDATLSSIQFPFFVRTM  144

Query  236   QSDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGA  415
              SD+Y+M A+A V+D+Y WK V A++IDDDYGRNGIAALDD L A+RCKISYK G P  A
Sbjct  145   PSDLYEMAAVAAVVDYYQWKIVTAIYIDDDYGRNGIAALDDELTARRCKISYKVGFPSNA  204

Query  416   TTRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVLD  595
               R+E++ +LV ++ MESRV++LH     G  + S+A+ L MMG+GYVWI+TDWLS+ LD
Sbjct  205   R-RSELLHLLVTVSNMESRVIILHTGADPGLKLLSLANGLNMMGNGYVWIATDWLSSYLD  263

Query  596   SSSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLTG----GSLGLNSYALYAYDS  763
             ++S +P+E +  MQGVL +R H P+S++K    S+W+ L+      +L L++Y  Y YDS
Sbjct  264   ANSSVPAETINAMQGVLTVRPHIPESKMKSNLMSKWRSLSKKYNHSNLRLSAYGFYVYDS  323

Query  764   VWLIAHAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGL  943
             VW +A A+D+F + GG ISF+NDS+L    G +LHLEA+S+FD G  LL  + Q +F G 
Sbjct  324   VWAVARALDAFFDDGGRISFTNDSRLHDETGGSLHLEAMSVFDMGKRLLGKIRQVNFTGA  383

Query  944   TGQFKFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSG-LSTAPPETLYSRPPNSSSANQ  1120
             +GQ +FN    L+ P+YDI+++IG G RTIGFW NY+  LST  PE LYS+PPN+S ANQ
Sbjct  384   SGQVQFNAQGELIHPAYDIISIIGNGVRTIGFWSNYTRLLSTVLPEDLYSKPPNTSLANQ  443

Query  1121  KLYGVVWPGQSVKKAPGVGFP  1183
              LY V+WPG++  K  G  FP
Sbjct  444   HLYDVIWPGETAHKPRGWVFP  464



>ref|XP_002869097.1| hypothetical protein ARALYDRAFT_491120 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45356.1| hypothetical protein ARALYDRAFT_491120 [Arabidopsis lyrata subsp. 
lyrata]
Length=913

 Score =   456 bits (1173),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 263/413 (64%), Positives = 335/413 (81%), Gaps = 9/413 (2%)
 Frame = +3

Query  1164  PRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYAVPFQFV  1343
             PRGWVFPNNG++LRIGVP R S+KEF+S+V G+N  +G+++DVF AAV L+ Y VP +FV
Sbjct  455   PRGWVFPNNGRRLRIGVPDRASFKEFVSRVDGSNKVQGYAIDVFEAAVKLISYPVPHEFV  514

Query  1344  PFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPFKKL  1523
              FG+G +NP+++E V  V+TG FD  +GDIAIVT RT++VDFTQPY+ SGL+VVAP  KL
Sbjct  515   LFGDGLKNPNFNEFVNNVTTGLFDAVVGDIAIVTKRTRIVDFTQPYIESGLVVVAPVTKL  574

Query  1524  NTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWF--SLS  1697
             N   WAFL PF+  MW VTA FF++VG V+WILEHR+NDEFRG P++Q++TILW   S S
Sbjct  575   NDTPWAFLRPFTPPMWAVTAAFFLIVGSVIWILEHRINDEFRGPPRKQIVTILWLVNSFS  634

Query  1698  TLFFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESLKEGN  1877
             T+FF+HRENTVSTLGR VL+IWLFVVLII SSYTASLTSILTVQQL SPI+GV++L   +
Sbjct  635   TMFFSHRENTVSTLGRAVLLIWLFVVLIITSSYTASLTSILTVQQLNSPIRGVDTLISSS  694

Query  1878  DPIGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERPYVEN  2057
               +G+Q+GS+AE+Y+I+E+ I++SRL+ LGSP+ YA AL      G V+AIVDERPYV+ 
Sbjct  695   GRVGFQVGSYAENYMIDELNIARSRLVPLGSPKEYAAAL----LNGTVAAIVDERPYVDL  750

Query  2058  FLSTQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLtrtsc  2237
             FLS  C F I GQEFT+SGWGFAFPRDSPLA+DMSTAIL LSE G LQ+IHDKWL+R++C
Sbjct  751   FLSDFCGFAIRGQEFTRSGWGFAFPRDSPLAIDMSTAILGLSETGQLQKIHDKWLSRSNC  810

Query  2238  ss---estelesDRLHLKSFWglfllcgaacflalfIYFVQIMLKFRRVARAE  2387
             S+     ++ +S++L L+SFWGLFL+CG ACF+ALFIYF +I+  F R ++ E
Sbjct  811   SNLNGSESDEDSEQLKLRSFWGLFLVCGIACFIALFIYFFRIVRDFWRHSKPE  863


 Score =   423 bits (1088),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 200/383 (52%), Positives = 278/383 (73%), Gaps = 3/383 (1%)
 Frame = +2

Query  50    ILLVAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLR  229
             + ++ AL+FM+TD VAI+GPQ+S++AH +SH+ANEL VP+LSF A DP+L++LQFP+F++
Sbjct  81    LTIMGALQFMETDAVAIIGPQTSIMAHVLSHLANELSVPMLSFTALDPSLSALQFPFFVQ  140

Query  230   TTQSDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPP  409
             T  SD++ M AIA++I +YGW EV+A++ DDD  RNGI AL D L  +RCKISYKA +P 
Sbjct  141   TAPSDLFLMRAIAEMISYYGWSEVVALYNDDDNSRNGITALGDELEGRRCKISYKAVLPL  200

Query  410   GA--TTRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLS  583
                 T+  EI+D LV+I  MESRV++++ +P  G M+F  A  LGMM  GYVWI+T WL+
Sbjct  201   DVVITSPREIIDELVKIQGMESRVIIVNTFPRTGGMIFEEAQKLGMMEKGYVWIATTWLT  260

Query  584   TVLDSSSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLTGGSLGLNSYALYAYDS  763
             ++LDS +PLPS+  E  +GVL LR HTP+S  K+ F +RW  L+ G++GLN Y LYAYD+
Sbjct  261   SLLDSVNPLPSKNAESFRGVLTLRIHTPNSRKKKDFVARWNKLSNGTVGLNVYGLYAYDT  320

Query  764   VWLIAHAIDSFLNKGGVISFSNDSKLQSIE-GSTLHLEALSIFDGGPLLLNNLLQSDFVG  940
             VW+IA A+ + L+ G  ISFS+D KL ++  G +L+L ALSIFD G   L+ ++ ++  G
Sbjct  321   VWIIARAVKTLLDSGANISFSSDPKLTTMTGGGSLNLGALSIFDQGSQFLDYIVNTNMTG  380

Query  941   LTGQFKFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQ  1120
             LTGQ +F  D+S++ PSYDI+NV+  GFR IG+W N+SGLS  PPE+LY++P N SS+NQ
Sbjct  381   LTGQIQFLPDRSMIQPSYDIINVVDDGFRQIGYWSNHSGLSIIPPESLYNKPSNRSSSNQ  440

Query  1121  KLYGVVWPGQSVKKAPGVGFPEQ  1189
              L  V WPG +     G  FP  
Sbjct  441   HLNNVTWPGGTSVTPRGWVFPNN  463



>ref|XP_004158559.1| PREDICTED: glutamate receptor 3.4-like [Cucumis sativus]
Length=935

 Score =   444 bits (1143),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 261/419 (62%), Positives = 321/419 (77%), Gaps = 9/419 (2%)
 Frame = +3

Query  1164  PRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYAVPFQFV  1343
             PRGWVFP+NGK L+I VP RVSYK F+++       KG+ +DVF AA+NLL Y VP  ++
Sbjct  469   PRGWVFPHNGKPLQIVVPNRVSYKAFVAKDNNPLGVKGYCIDVFEAAINLLSYPVPHTYI  528

Query  1344  PFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPFKKL  1523
              +G+G++ P YS+LV  VS   +D A+GDI IVTNRTK+VDFTQP++ SGL+VV   K  
Sbjct  529   LYGDGKDTPEYSDLVYEVSQNKYDAAVGDITIVTNRTKIVDFTQPFMESGLVVVTVVKGE  588

Query  1524  NTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSLSTL  1703
              +  WAFL PF+ QMW VTA FF+ VG VVWILEHR N+EFRG P+QQLITI WFS ST+
Sbjct  589   KSSPWAFLRPFTIQMWAVTALFFIFVGAVVWILEHRTNEEFRGPPRQQLITIFWFSFSTM  648

Query  1704  FFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESLKEGNDP  1883
             FF+H+ENTVSTLGR+VLIIWLFVVLIINSSYTASLTSILTVQQL S I+G++SL    D 
Sbjct  649   FFSHKENTVSTLGRLVLIIWLFVVLIINSSYTASLTSILTVQQLTSKIEGIDSLISSTDA  708

Query  1884  IGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERPYVENFL  2063
             IG Q GSFA +YLI+E+ I  SR+I L + + Y +AL +GP  GGV+AIVDE PYVE FL
Sbjct  709   IGVQEGSFALNYLIDELNIVASRIIKLKNQDEYDDALRRGPGNGGVAAIVDELPYVELFL  768

Query  2064  S-TQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLtrtscs  2240
             S T C F+ VGQEFTKSGWGFAF RDSPLAVD+STAIL LSENGDLQ+IHDKWL+RT CS
Sbjct  769   SGTNCVFKTVGQEFTKSGWGFAFQRDSPLAVDLSTAILQLSENGDLQKIHDKWLSRTECS  828

Query  2241  sestelesDRLHLKSFWglfllcgaacflalfIYFVQIMLKFRR--------VARAEPV  2393
                 + + ++L L SFWGLFL+CG +CF+AL I+F +++ ++RR        V + EPV
Sbjct  829   LGLNQADLNQLSLSSFWGLFLICGISCFIALSIFFFRVLFQYRRFTPETQSEVEQIEPV  887


 Score =   434 bits (1117),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 209/378 (55%), Positives = 274/378 (72%), Gaps = 3/378 (1%)
 Frame = +2

Query  59    VAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTTQ  238
             V AL+ MQ +VVA +GPQSS +AH ISHV NEL +PLLSF ATDP L++ ++ YF+RTTQ
Sbjct  102   VEALQLMQDEVVAAIGPQSSGIAHVISHVINELHIPLLSFGATDPALSAHEYQYFVRTTQ  161

Query  239   SDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGAT  418
             SD +QM AIAD++D++GW+EV+A+F+DDD GR+GI+AL DALA KR KISY+A  PPG+ 
Sbjct  162   SDYFQMNAIADIVDYFGWREVVAIFVDDDNGRSGISALSDALAKKRAKISYRAAFPPGSP  221

Query  419   TRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVLDS  598
             + A I D+LV I LMESRV ++H  P  G  VFS+A  L M+G GYVWI+TDWL + LDS
Sbjct  222   SSA-ISDLLVSINLMESRVYIVHVNPDTGLSVFSMAKKLQMLGSGYVWITTDWLPSFLDS  280

Query  599   SSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLT-GGSLGLNSYALYAYDSVWLI  775
                   + M  +QGV+ LR HTPD  LK+ F S+WK+L    S   NSYALYAYDSVWL 
Sbjct  281   FETNSPDVMNQLQGVVALRHHTPDGNLKKNFISKWKNLKLKKSPNFNSYALYAYDSVWLA  340

Query  776   AHAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLTGQF  955
             A A+D+F+ +GG ISFSND KL    GS LHL++L +F+GG  LL  + +++F G++G+ 
Sbjct  341   ARALDTFIKEGGNISFSNDPKLSENNGSMLHLKSLRVFNGGEQLLQTIKRTNFTGVSGRI  400

Query  956   KFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKLYGV  1135
             +F +D++L+ P+YDILN+ GTG R IG+W NYSGLST  PE LY++P N +S N  LY V
Sbjct  401   QFGDDRNLINPTYDILNIGGTGSRRIGYWSNYSGLSTIAPENLYTKPLN-ASPNNHLYSV  459

Query  1136  VWPGQSVKKAPGVGFPEQ  1189
             +WPG+      G  FP  
Sbjct  460   IWPGEITTVPRGWVFPHN  477



>ref|XP_009353273.1| PREDICTED: glutamate receptor 3.4-like isoform X1 [Pyrus x bretschneideri]
Length=1009

 Score =   440 bits (1132),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 258/411 (63%), Positives = 319/411 (78%), Gaps = 2/411 (0%)
 Frame = +3

Query  1164  PRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYAVPFQFV  1343
             PRGWVFPNNG+ LRIGVP RVSY++F+ +       +G+ +DVF AAVNLLPYAVP  ++
Sbjct  521   PRGWVFPNNGRPLRIGVPYRVSYEDFVVKDKSPPGVRGYCIDVFEAAVNLLPYAVPRTYI  580

Query  1344  PFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPFKKL  1523
              +G+G+ NP YS LV  V+   FD A+GDI I TNRT++VDFTQPY+ SGL+VV P K+ 
Sbjct  581   LYGDGKRNPEYSSLVAQVAQNKFDAAVGDITITTNRTRIVDFTQPYMESGLVVVVPVKEE  640

Query  1524  NTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSLSTL  1703
              + AWAFL PF+ QMW VT  FF+ VG VVWILEHRMN EFRG P QQLITI WFS ST+
Sbjct  641   KSNAWAFLKPFTYQMWLVTGAFFLFVGAVVWILEHRMNHEFRGPPSQQLITIFWFSFSTM  700

Query  1704  FFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESLKEGNDP  1883
             FF+ RENTVSTLGR+VLIIWLFVVLIINSSYTASLTSILTVQ+L S I+G+++L   ND 
Sbjct  701   FFSQRENTVSTLGRLVLIIWLFVVLIINSSYTASLTSILTVQRLTSRIEGIDNLISSNDR  760

Query  1884  IGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERPYVENFL  2063
             IG Q GSF   YL++E+ I++SRL+ L   EAY +AL  GP +GGV+AIVDE PY+E F+
Sbjct  761   IGVQDGSFVWRYLVDEMNIAESRLVKLEDMEAYIKALTDGPTRGGVAAIVDELPYIELFM  820

Query  2064  -STQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLtrtscs  2240
              ST+C FR VG EF+KSGWGFAF +DSPLAVD+STAIL LSENGDLQ+I +KWLT   C 
Sbjct  821   SSTKCAFRTVGPEFSKSGWGFAFQKDSPLAVDLSTAILQLSENGDLQKIRNKWLTHNDCP  880

Query  2241  sestelesDRLHLKSFWglfllcgaacflalfIYFVQIMLKFRRVARAEPV  2393
             ++  +++  +L L SFWGLFL+CG ACFLAL ++F +I+ ++RR    EPV
Sbjct  881   TQLNKVDGGQLSLTSFWGLFLICGIACFLALAVFFCRILCQYRRFT-PEPV  930


 Score =   437 bits (1125),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 209/378 (55%), Positives = 273/378 (72%), Gaps = 3/378 (1%)
 Frame = +2

Query  59    VAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTTQ  238
             V A++ ++ DVVA +GPQSS +AH ISHV NEL VPLLSF ATDP+LA+LQ+PYF+RTTQ
Sbjct  154   VEAMELIENDVVAAVGPQSSGIAHVISHVVNELHVPLLSFGATDPSLAALQYPYFVRTTQ  213

Query  239   SDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGAT  418
             SD +QM A+AD+++++GW+EVIA+F+DDDYGRNGI+ L DALA KR KISYKA   PGA 
Sbjct  214   SDYFQMYAVADLVEYFGWREVIAIFVDDDYGRNGISILSDALAVKRSKISYKAAFSPGA-  272

Query  419   TRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVLDS  598
              +++I ++LV + LMESRV ++H  P +G  +FS+A  LGMM  GYVWI+TDWL + LDS
Sbjct  273   PKSDINELLVGVNLMESRVYIVHVNPDSGLTIFSIAKSLGMMTSGYVWIATDWLPSHLDS  332

Query  599   SSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLT-GGSLGLNSYALYAYDSVWLI  775
              +P   E M ++QGV+ LR HTPD++LK+ F SRW  L   GS   NSYALYAYDS+WL 
Sbjct  333   LNPPGPETMNLLQGVVALRHHTPDTDLKKRFMSRWSKLQHDGSPSFNSYALYAYDSIWLA  392

Query  776   AHAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLTGQF  955
             A A+D F N+GG +SFSND +L     STLHL +L IF GG   L  +L+ +F G++GQ 
Sbjct  393   ARALDVFFNEGGNVSFSNDRRLNDTNRSTLHLTSLRIFYGGQKYLQTILKMNFTGISGQI  452

Query  956   KFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKLYGV  1135
             +F+ DK LV P+YDILN+ GTG R +G+W N +GLS   PE  Y +P N ++  Q LY V
Sbjct  453   EFDQDKYLVRPAYDILNIGGTGSRRVGYWSNSTGLSVNAPEISYKKPFNRNTTAQ-LYSV  511

Query  1136  VWPGQSVKKAPGVGFPEQ  1189
             +WPG+      G  FP  
Sbjct  512   IWPGEVTAIPRGWVFPNN  529



>ref|XP_009353274.1| PREDICTED: glutamate receptor 3.4-like isoform X2 [Pyrus x bretschneideri]
 ref|XP_009353275.1| PREDICTED: glutamate receptor 3.4-like isoform X2 [Pyrus x bretschneideri]
Length=959

 Score =   440 bits (1131),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 258/411 (63%), Positives = 319/411 (78%), Gaps = 2/411 (0%)
 Frame = +3

Query  1164  PRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYAVPFQFV  1343
             PRGWVFPNNG+ LRIGVP RVSY++F+ +       +G+ +DVF AAVNLLPYAVP  ++
Sbjct  471   PRGWVFPNNGRPLRIGVPYRVSYEDFVVKDKSPPGVRGYCIDVFEAAVNLLPYAVPRTYI  530

Query  1344  PFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPFKKL  1523
              +G+G+ NP YS LV  V+   FD A+GDI I TNRT++VDFTQPY+ SGL+VV P K+ 
Sbjct  531   LYGDGKRNPEYSSLVAQVAQNKFDAAVGDITITTNRTRIVDFTQPYMESGLVVVVPVKEE  590

Query  1524  NTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSLSTL  1703
              + AWAFL PF+ QMW VT  FF+ VG VVWILEHRMN EFRG P QQLITI WFS ST+
Sbjct  591   KSNAWAFLKPFTYQMWLVTGAFFLFVGAVVWILEHRMNHEFRGPPSQQLITIFWFSFSTM  650

Query  1704  FFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESLKEGNDP  1883
             FF+ RENTVSTLGR+VLIIWLFVVLIINSSYTASLTSILTVQ+L S I+G+++L   ND 
Sbjct  651   FFSQRENTVSTLGRLVLIIWLFVVLIINSSYTASLTSILTVQRLTSRIEGIDNLISSNDR  710

Query  1884  IGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERPYVENFL  2063
             IG Q GSF   YL++E+ I++SRL+ L   EAY +AL  GP +GGV+AIVDE PY+E F+
Sbjct  711   IGVQDGSFVWRYLVDEMNIAESRLVKLEDMEAYIKALTDGPTRGGVAAIVDELPYIELFM  770

Query  2064  -STQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLtrtscs  2240
              ST+C FR VG EF+KSGWGFAF +DSPLAVD+STAIL LSENGDLQ+I +KWLT   C 
Sbjct  771   SSTKCAFRTVGPEFSKSGWGFAFQKDSPLAVDLSTAILQLSENGDLQKIRNKWLTHNDCP  830

Query  2241  sestelesDRLHLKSFWglfllcgaacflalfIYFVQIMLKFRRVARAEPV  2393
             ++  +++  +L L SFWGLFL+CG ACFLAL ++F +I+ ++RR    EPV
Sbjct  831   TQLNKVDGGQLSLTSFWGLFLICGIACFLALAVFFCRILCQYRRFT-PEPV  880


 Score =   437 bits (1125),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 209/378 (55%), Positives = 273/378 (72%), Gaps = 3/378 (1%)
 Frame = +2

Query  59    VAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTTQ  238
             V A++ ++ DVVA +GPQSS +AH ISHV NEL VPLLSF ATDP+LA+LQ+PYF+RTTQ
Sbjct  104   VEAMELIENDVVAAVGPQSSGIAHVISHVVNELHVPLLSFGATDPSLAALQYPYFVRTTQ  163

Query  239   SDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGAT  418
             SD +QM A+AD+++++GW+EVIA+F+DDDYGRNGI+ L DALA KR KISYKA   PGA 
Sbjct  164   SDYFQMYAVADLVEYFGWREVIAIFVDDDYGRNGISILSDALAVKRSKISYKAAFSPGA-  222

Query  419   TRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVLDS  598
              +++I ++LV + LMESRV ++H  P +G  +FS+A  LGMM  GYVWI+TDWL + LDS
Sbjct  223   PKSDINELLVGVNLMESRVYIVHVNPDSGLTIFSIAKSLGMMTSGYVWIATDWLPSHLDS  282

Query  599   SSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLT-GGSLGLNSYALYAYDSVWLI  775
              +P   E M ++QGV+ LR HTPD++LK+ F SRW  L   GS   NSYALYAYDS+WL 
Sbjct  283   LNPPGPETMNLLQGVVALRHHTPDTDLKKRFMSRWSKLQHDGSPSFNSYALYAYDSIWLA  342

Query  776   AHAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLTGQF  955
             A A+D F N+GG +SFSND +L     STLHL +L IF GG   L  +L+ +F G++GQ 
Sbjct  343   ARALDVFFNEGGNVSFSNDRRLNDTNRSTLHLTSLRIFYGGQKYLQTILKMNFTGISGQI  402

Query  956   KFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKLYGV  1135
             +F+ DK LV P+YDILN+ GTG R +G+W N +GLS   PE  Y +P N ++  Q LY V
Sbjct  403   EFDQDKYLVRPAYDILNIGGTGSRRVGYWSNSTGLSVNAPEISYKKPFNRNTTAQ-LYSV  461

Query  1136  VWPGQSVKKAPGVGFPEQ  1189
             +WPG+      G  FP  
Sbjct  462   IWPGEVTAIPRGWVFPNN  479



>ref|XP_008455858.1| PREDICTED: glutamate receptor 3.4-like isoform X1 [Cucumis melo]
 ref|XP_008455859.1| PREDICTED: glutamate receptor 3.4-like isoform X1 [Cucumis melo]
Length=865

 Score =   442 bits (1138),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 259/419 (62%), Positives = 319/419 (76%), Gaps = 9/419 (2%)
 Frame = +3

Query  1164  PRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYAVPFQFV  1343
             PRGWVFP+NGK L+I VP RVSYK F+S+       KG+ +DVF AA+NLL Y VP  ++
Sbjct  399   PRGWVFPHNGKPLQIVVPNRVSYKAFVSKDNNPLGVKGYCIDVFEAAINLLSYPVPHTYI  458

Query  1344  PFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPFKKL  1523
              +G+G++ P YS LV  VS   +D A+GDI IVTNRTK+VDFTQP++ SGL+VV   K  
Sbjct  459   LYGDGKDTPEYSNLVYEVSQNKYDAAVGDITIVTNRTKIVDFTQPFMESGLVVVTVVKGE  518

Query  1524  NTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSLSTL  1703
              +  WAFL PF+ QMW VTA FF+ VG VVWILEHR N+EFRG P+QQLITI WFS ST+
Sbjct  519   KSSPWAFLRPFTIQMWAVTALFFIFVGAVVWILEHRTNEEFRGPPRQQLITIFWFSFSTM  578

Query  1704  FFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESLKEGNDP  1883
             FF+H+ENTVSTLGR+VLIIWLFVVLIINSSYTASLTSILTVQQL S I+G++SL    D 
Sbjct  579   FFSHKENTVSTLGRLVLIIWLFVVLIINSSYTASLTSILTVQQLTSKIEGIDSLISSKDA  638

Query  1884  IGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERPYVENFL  2063
             IG Q GSFA +YL +E+ I  SR+I L + + Y +AL +GP  GGV+AIVDE PYVE FL
Sbjct  639   IGVQEGSFALNYLTDELNIEGSRIIKLKNQDEYDDALRRGPENGGVAAIVDELPYVELFL  698

Query  2064  S-TQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLtrtscs  2240
             + T C F+ VGQEFTKSGWGFAF RDSPLAVD+STAIL LSENGDLQ+IHDKWL+R+ CS
Sbjct  699   AGTNCVFKTVGQEFTKSGWGFAFQRDSPLAVDLSTAILQLSENGDLQKIHDKWLSRSECS  758

Query  2241  sestelesDRLHLKSFWglfllcgaacflalfIYFVQIMLKFRR--------VARAEPV  2393
                 + + ++L L SFWGLFL+CG +CF+AL I+F +++ ++RR        V + EPV
Sbjct  759   LGLNQADINQLSLSSFWGLFLICGISCFIALLIFFFRVLFQYRRFTPETQPEVEQIEPV  817


 Score =   434 bits (1115),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 208/378 (55%), Positives = 274/378 (72%), Gaps = 3/378 (1%)
 Frame = +2

Query  59    VAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTTQ  238
             V AL+ MQ +VVA +GPQSS +AH ISHV NEL +PLLSF ATDP L++ ++ YF+RTTQ
Sbjct  32    VEALQLMQDEVVAAIGPQSSGIAHVISHVINELHIPLLSFGATDPALSAQEYQYFVRTTQ  91

Query  239   SDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGAT  418
             SD +QM AIAD++DH+GW+EV+A+F+DDD GR+GI+AL DALA KR KISYKA +PPG+ 
Sbjct  92    SDYFQMNAIADIVDHFGWREVVAIFVDDDNGRSGISALSDALAKKRAKISYKAALPPGSP  151

Query  419   TRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVLDS  598
               A I D+LV I LMESRV ++H  P +G  VFS+A  L M+  GYVWI+TDWL + LDS
Sbjct  152   NSA-ISDLLVSINLMESRVYIVHVNPDSGLSVFSIAKKLQMLDSGYVWIATDWLPSFLDS  210

Query  599   SSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLT-GGSLGLNSYALYAYDSVWLI  775
                   + M  +QGV+ LR HTPD  LK+ F S+W++L    S   NSYALYAYDSVWL 
Sbjct  211   FETNSPDVMNQLQGVVALRHHTPDGNLKKNFISKWRNLKFKKSPNFNSYALYAYDSVWLA  270

Query  776   AHAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLTGQF  955
             A A+D+F+ +GG ISFSND KL+   GS LHL++L +F+GG  LL  + +++F G++G+ 
Sbjct  271   ARALDTFIKEGGNISFSNDPKLRENNGSMLHLKSLRVFNGGEQLLQTIKKTNFTGVSGRI  330

Query  956   KFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKLYGV  1135
             +F +D++L+ P+YDILN+ GTG R IG+W NYSGLS   PE LY++P N +S N  LY V
Sbjct  331   QFGDDRNLINPTYDILNIGGTGSRRIGYWSNYSGLSAIAPEKLYTKPLN-ASPNNHLYSV  389

Query  1136  VWPGQSVKKAPGVGFPEQ  1189
             +WPG+      G  FP  
Sbjct  390   IWPGEITTIPRGWVFPHN  407



>ref|XP_008455860.1| PREDICTED: glutamate receptor 3.4-like isoform X2 [Cucumis melo]
Length=837

 Score =   442 bits (1137),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 259/419 (62%), Positives = 319/419 (76%), Gaps = 9/419 (2%)
 Frame = +3

Query  1164  PRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYAVPFQFV  1343
             PRGWVFP+NGK L+I VP RVSYK F+S+       KG+ +DVF AA+NLL Y VP  ++
Sbjct  371   PRGWVFPHNGKPLQIVVPNRVSYKAFVSKDNNPLGVKGYCIDVFEAAINLLSYPVPHTYI  430

Query  1344  PFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPFKKL  1523
              +G+G++ P YS LV  VS   +D A+GDI IVTNRTK+VDFTQP++ SGL+VV   K  
Sbjct  431   LYGDGKDTPEYSNLVYEVSQNKYDAAVGDITIVTNRTKIVDFTQPFMESGLVVVTVVKGE  490

Query  1524  NTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSLSTL  1703
              +  WAFL PF+ QMW VTA FF+ VG VVWILEHR N+EFRG P+QQLITI WFS ST+
Sbjct  491   KSSPWAFLRPFTIQMWAVTALFFIFVGAVVWILEHRTNEEFRGPPRQQLITIFWFSFSTM  550

Query  1704  FFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESLKEGNDP  1883
             FF+H+ENTVSTLGR+VLIIWLFVVLIINSSYTASLTSILTVQQL S I+G++SL    D 
Sbjct  551   FFSHKENTVSTLGRLVLIIWLFVVLIINSSYTASLTSILTVQQLTSKIEGIDSLISSKDA  610

Query  1884  IGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERPYVENFL  2063
             IG Q GSFA +YL +E+ I  SR+I L + + Y +AL +GP  GGV+AIVDE PYVE FL
Sbjct  611   IGVQEGSFALNYLTDELNIEGSRIIKLKNQDEYDDALRRGPENGGVAAIVDELPYVELFL  670

Query  2064  S-TQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLtrtscs  2240
             + T C F+ VGQEFTKSGWGFAF RDSPLAVD+STAIL LSENGDLQ+IHDKWL+R+ CS
Sbjct  671   AGTNCVFKTVGQEFTKSGWGFAFQRDSPLAVDLSTAILQLSENGDLQKIHDKWLSRSECS  730

Query  2241  sestelesDRLHLKSFWglfllcgaacflalfIYFVQIMLKFRR--------VARAEPV  2393
                 + + ++L L SFWGLFL+CG +CF+AL I+F +++ ++RR        V + EPV
Sbjct  731   LGLNQADINQLSLSSFWGLFLICGISCFIALLIFFFRVLFQYRRFTPETQPEVEQIEPV  789


 Score =   432 bits (1112),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 207/379 (55%), Positives = 274/379 (72%), Gaps = 3/379 (1%)
 Frame = +2

Query  56    LVAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTT  235
             +  AL+ MQ +VVA +GPQSS +AH ISHV NEL +PLLSF ATDP L++ ++ YF+RTT
Sbjct  3     MYVALQLMQDEVVAAIGPQSSGIAHVISHVINELHIPLLSFGATDPALSAQEYQYFVRTT  62

Query  236   QSDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGA  415
             QSD +QM AIAD++DH+GW+EV+A+F+DDD GR+GI+AL DALA KR KISYKA +PPG+
Sbjct  63    QSDYFQMNAIADIVDHFGWREVVAIFVDDDNGRSGISALSDALAKKRAKISYKAALPPGS  122

Query  416   TTRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVLD  595
                A I D+LV I LMESRV ++H  P +G  VFS+A  L M+  GYVWI+TDWL + LD
Sbjct  123   PNSA-ISDLLVSINLMESRVYIVHVNPDSGLSVFSIAKKLQMLDSGYVWIATDWLPSFLD  181

Query  596   SSSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLT-GGSLGLNSYALYAYDSVWL  772
             S      + M  +QGV+ LR HTPD  LK+ F S+W++L    S   NSYALYAYDSVWL
Sbjct  182   SFETNSPDVMNQLQGVVALRHHTPDGNLKKNFISKWRNLKFKKSPNFNSYALYAYDSVWL  241

Query  773   IAHAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLTGQ  952
              A A+D+F+ +GG ISFSND KL+   GS LHL++L +F+GG  LL  + +++F G++G+
Sbjct  242   AARALDTFIKEGGNISFSNDPKLRENNGSMLHLKSLRVFNGGEQLLQTIKKTNFTGVSGR  301

Query  953   FKFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKLYG  1132
              +F +D++L+ P+YDILN+ GTG R IG+W NYSGLS   PE LY++P N +S N  LY 
Sbjct  302   IQFGDDRNLINPTYDILNIGGTGSRRIGYWSNYSGLSAIAPEKLYTKPLN-ASPNNHLYS  360

Query  1133  VVWPGQSVKKAPGVGFPEQ  1189
             V+WPG+      G  FP  
Sbjct  361   VIWPGEITTIPRGWVFPHN  379



>ref|XP_004957886.1| PREDICTED: glutamate receptor 3.4-like [Setaria italica]
Length=932

 Score =   463 bits (1191),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 260/405 (64%), Positives = 324/405 (80%), Gaps = 0/405 (0%)
 Frame = +3

Query  1158  KKPRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYAVPFQ  1337
             + PRGWVF  +GK +RIGVP+R SYKEF+ Q  G +  KGF+VDVF AA++LLPY V   
Sbjct  454   ETPRGWVFSYHGKPMRIGVPLRTSYKEFVMQDDGPDGVKGFAVDVFKAAISLLPYPVSCN  513

Query  1338  FVPFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPFK  1517
             FV FG+G +NPSYS+LV+ VS  YFD AIGDIAIVTNRT++VDFTQPY+ SGL++VAP +
Sbjct  514   FVLFGDGLKNPSYSDLVQKVSENYFDAAIGDIAIVTNRTRLVDFTQPYIESGLIIVAPAR  573

Query  1518  KLNTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSLS  1697
             ++ + AWAFL PF+ QMW V    F+ VG VVW+LEHR N EFRG P+QQ++T+ WFS S
Sbjct  574   EIESNAWAFLKPFTFQMWCVLGVIFLFVGAVVWVLEHRTNTEFRGPPRQQIMTVCWFSFS  633

Query  1698  TLFFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESLKEGN  1877
             T+FFAHRENTVSTLGR VL+IWLFVVLIINSSYTASLTS+LTVQ+L S I+G++SL   +
Sbjct  634   TMFFAHRENTVSTLGRFVLLIWLFVVLIINSSYTASLTSLLTVQELTSGIQGLDSLISSS  693

Query  1878  DPIGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERPYVEN  2057
               IGYQ+GSF+ +YL++E+ I++SRL+ L SP  YA ALE G   GGV+AI+DE PYVE 
Sbjct  694   STIGYQVGSFSRNYLVDELNIAESRLVPLNSPSDYARALELGSGNGGVAAIIDELPYVEI  753

Query  2058  FLSTQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLtrtsc  2237
             FLS  CKF+ VGQ FTKSGWGFAFPRDSPLA D+STAIL+LSENG+LQRIHD+WL+ T C
Sbjct  754   FLSKYCKFKTVGQVFTKSGWGFAFPRDSPLAEDLSTAILTLSENGNLQRIHDEWLSGTEC  813

Query  2238  ssestelesDRLHLKSFWglfllcgaacflalfIYFVQIMLKFRR  2372
             S+++    S+ L L SFWGLFL+CG AC LAL I+F++I  ++ R
Sbjct  814   SADNNAAASNSLSLSSFWGLFLICGLACLLALVIFFLRIFCQYSR  858


 Score =   412 bits (1058),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 202/370 (55%), Positives = 264/370 (71%), Gaps = 5/370 (1%)
 Frame = +2

Query  59    VAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTTQ  238
             + AL+ +  DVVA+LGPQSS VAH I H  NEL VPL+SF+ATDPTL+SL++PYF+R TQ
Sbjct  92    IEALQLLAKDVVAVLGPQSSAVAHVICHAVNELHVPLVSFSATDPTLSSLEYPYFVRATQ  151

Query  239   SDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGAT  418
             SD YQM AIA +I +Y WK+VIA+++DDDYGR GI AL DALA ++CKI+YKA +PPGA 
Sbjct  152   SDYYQMGAIASIISYYRWKQVIAIYVDDDYGRGGIMALGDALAKRKCKIAYKAKLPPGAA  211

Query  419   TRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVLDS  598
                 + DIL+Q+  MESRV V+H  P +G  VFS A  LGMM  GYVWI+TDWLS V+DS
Sbjct  212   N-TTVEDILMQVNEMESRVYVVHVNPDSGLNVFSAAKSLGMMSSGYVWIATDWLSEVIDS  270

Query  599   SSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLTGGSLGLNSYALYAYDSVWLIA  778
             S       ME  QGVLVLRQH P SE++ A   +W +LT   +   +Y++ AYDSVWL+A
Sbjct  271   SVHDNPAVMEHTQGVLVLRQHVPVSEIQHALLPKWNNLTRNGI---AYSMRAYDSVWLVA  327

Query  779   HAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLTGQFK  958
             HAI+ FL++G  ISFS D  L + +GS+L L++L IF+ G  LL  +  ++F G++G  +
Sbjct  328   HAIERFLSEGNAISFSADPNLVTTKGSSLQLDSLRIFNNGNKLLEKVWSANFSGVSGPVQ  387

Query  959   FNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKLYGVV  1138
             F  D++LV P+YDILN+ GTG RTIG+W N+SGLS   PE L     NSS+ N +L+  +
Sbjct  388   FTLDRNLVHPAYDILNIGGTGLRTIGYWSNFSGLSVVAPEKLNLSSLNSSTNNVQLHSAI  447

Query  1139  WPGQSVKKAP  1168
             WPGQ V + P
Sbjct  448   WPGQ-VSETP  456



>ref|XP_008379927.1| PREDICTED: glutamate receptor 3.4-like [Malus domestica]
Length=960

 Score =   438 bits (1126),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 254/412 (62%), Positives = 315/412 (76%), Gaps = 3/412 (1%)
 Frame = +3

Query  1164  PRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYAVPFQFV  1343
             PRGWVFPNNG+ LRIGVP RVSYK+F+ +        G+ +DVF AAVNLLPYAVP  ++
Sbjct  471   PRGWVFPNNGRPLRIGVPYRVSYKDFVVKDKSPPGVTGYCIDVFEAAVNLLPYAVPRTYM  530

Query  1344  PFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPFKKL  1523
              +G+G+ NP YS L   V+   FD A+GD+ I TNRT++VDFTQPY+ SGL VV P K+ 
Sbjct  531   LYGDGKRNPEYSSLXAQVAQNKFDAAVGDVTITTNRTRIVDFTQPYMESGLXVVVPVKEA  590

Query  1524  NTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSLSTL  1703
              +  W FL PF+ QMW VT  FF++VG VVWILEHR+N EFRG P QQLITI WFS ST+
Sbjct  591   KSNPWVFLKPFTYQMWLVTGAFFLLVGAVVWILEHRINHEFRGPPSQQLITIFWFSFSTM  650

Query  1704  FFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESLKEGNDP  1883
             FF+ RENTVSTLGR+VLIIWLFVVLIINSSYTASLTSILTVQ+L S I+G++SL   ND 
Sbjct  651   FFSQRENTVSTLGRLVLIIWLFVVLIINSSYTASLTSILTVQRLTSRIEGIDSLISSNDR  710

Query  1884  IGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERPYVENFL  2063
             IG Q GSF   YL++E+ I++SRL+ L   EAY +AL  GP +GGV+AIVDE PY+E F+
Sbjct  711   IGVQDGSFVWRYLVDEMNIAESRLVKLEDMEAYIKALTDGPRRGGVAAIVDELPYIELFM  770

Query  2064  -STQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLtrtscs  2240
              ST+C FR VG EF+ SGWGFAF +DSP AVD+STA L LSENGDLQ+IH+KWLT   C 
Sbjct  771   SSTKCAFRTVGLEFSNSGWGFAFQKDSPXAVDLSTAXLQLSENGDLQKIHNKWLTHNECP  830

Query  2241  sestelesD-RLHLKSFWglfllcgaacflalfIYFVQIMLKFRRVARAEPV  2393
             ++  ++++D +L L SFWGLFL+CG ACFLAL ++F +I+ ++RR    EPV
Sbjct  831   TQLNDVDADXQLSLTSFWGLFLICGIACFLALAVFFCRILCQYRRFT-PEPV  881


 Score =   437 bits (1123),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 209/378 (55%), Positives = 271/378 (72%), Gaps = 3/378 (1%)
 Frame = +2

Query  59    VAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTTQ  238
             V A++ ++ DVVA +GPQSS +AH ISHV NEL VPLLSF ATDP+LA+LQ+PYF+RTTQ
Sbjct  104   VEAMELIENDVVAAVGPQSSGIAHVISHVVNELHVPLLSFGATDPSLAALQYPYFVRTTQ  163

Query  239   SDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGAT  418
             SD +QM A+AD++ ++GW+EVIA+F+DDDYGRNGI+ L D LA KR KISYKA   PGA 
Sbjct  164   SDYFQMYAVADLVGYFGWREVIAIFVDDDYGRNGISILGDTLAVKRSKISYKAAFSPGA-  222

Query  419   TRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVLDS  598
              ++ I ++LV + LMESRV ++H  P +G  +FS+A  LGMM  GYVWI+TDWL + LDS
Sbjct  223   PKSNINELLVGVNLMESRVYIVHVNPDSGLTIFSIAKALGMMTSGYVWIATDWLPSHLDS  282

Query  599   SSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLT-GGSLGLNSYALYAYDSVWLI  775
              +P   + M ++QGV+ LR HTPD++LK+ F SRW  L   GS   NSYALYAYDS+WL 
Sbjct  283   LNPPGPDIMNLLQGVVALRHHTPDTDLKKRFMSRWSKLQHDGSPSFNSYALYAYDSIWLA  342

Query  776   AHAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLTGQF  955
             A A+D F N+GG +SFSND +L+    STLHL +L IFDGG   L  +L+ +F G++GQ 
Sbjct  343   ARALDVFFNEGGNVSFSNDPRLKDTNRSTLHLTSLRIFDGGQKYLQTILKMNFTGISGQI  402

Query  956   KFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKLYGV  1135
             +F+ DK LV P YDILN+ GTG R +G+W N SGLS   PE  Y +P N ++  Q LY V
Sbjct  403   EFDQDKYLVRPXYDILNIGGTGSRRVGYWSNSSGLSVIAPERXYKKPSNRNTTAQ-LYSV  461

Query  1136  VWPGQSVKKAPGVGFPEQ  1189
             +WPG+      G  FP  
Sbjct  462   IWPGEVTAIPRGWVFPNN  479



>emb|CDX69127.1| BnaC01g03260D [Brassica napus]
Length=912

 Score =   465 bits (1197),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 264/404 (65%), Positives = 331/404 (82%), Gaps = 7/404 (2%)
 Frame = +3

Query  1164  PRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYAVPFQFV  1343
             PRGWVFPNNG++LRIGVP R S+K+F+S+V G+N   G+S++VF AAV LL Y VP +FV
Sbjct  457   PRGWVFPNNGRRLRIGVPNRASFKDFVSRVNGSNQIDGYSINVFEAAVKLLSYPVPHEFV  516

Query  1344  PFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPFKKL  1523
              FG+G +NP+Y++LV  ++TG FD  +GDIAIVT RT++VDFTQPY+ SGL+VVAP  KL
Sbjct  517   LFGDGLKNPNYNDLVNNLTTGVFDAVVGDIAIVTKRTRIVDFTQPYIESGLVVVAPVTKL  576

Query  1524  NTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSLSTL  1703
             N   WAFL PF+  MW VTA FF++VG V+WILEHR+ND+FRG P++Q++TILWFS ST+
Sbjct  577   NDTPWAFLRPFTPPMWAVTAVFFLIVGSVIWILEHRINDDFRGPPRRQIVTILWFSFSTM  636

Query  1704  FFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESLKEGNDP  1883
             FF+HRENTVSTLGR+VL+IWLFVVLII SSYTASLTSILTVQQL SPIKGV++L   +  
Sbjct  637   FFSHRENTVSTLGRIVLLIWLFVVLIITSSYTASLTSILTVQQLNSPIKGVDTLIRSSGR  696

Query  1884  IGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERPYVENFL  2063
             +G+Q+GS+AE+Y+I+E+ I++SRL+ALGSP+ YA AL+ G     V+AIVDERPYV+ FL
Sbjct  697   VGFQVGSYAENYMIDELNIARSRLVALGSPKEYATALQNGT----VAAIVDERPYVDLFL  752

Query  2064  STQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLtrtscss  2243
             S  C F I GQEFT+SGWGFAFPRDSPLAVDMSTAIL LSE G LQ+IHDKWL++++CS+
Sbjct  753   SEFCGFAIRGQEFTRSGWGFAFPRDSPLAVDMSTAILGLSETGKLQKIHDKWLSKSNCSN  812

Query  2244  estelesD---RLHLKSFWglfllcgaacflalfIYFVQIMLKF  2366
              +     D   +L L+SFWGLFLLCG ACF+ALFIYF  I+  F
Sbjct  813   LNGSQSDDDPEQLKLRSFWGLFLLCGIACFIALFIYFFMIVRDF  856


 Score =   409 bits (1051),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 191/381 (50%), Positives = 274/381 (72%), Gaps = 3/381 (1%)
 Frame = +2

Query  56    LVAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTT  235
             ++ AL+FM+TD VAI+GPQ+S++AH +S++ NEL VP+ SF A DP+L+ LQFP+F++T 
Sbjct  85    IMKALQFMETDSVAIIGPQTSIMAHVLSYLGNELHVPMCSFTALDPSLSPLQFPFFVQTA  144

Query  236   QSDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGA  415
              SD++ M A+A++I +YGW +VIA++ DDD  RNG+ +L D L  +RCKISYKA +P   
Sbjct  145   PSDLFLMRAVAEMITYYGWSDVIALYNDDDNSRNGVTSLGDELEGRRCKISYKAVLPLDV  204

Query  416   TTRA--EIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTV  589
                +  EI+D LV+I  MESRV++++ +P  G M+F  A  LGMMG GYVWI+T W++++
Sbjct  205   VIESPREIVDELVKIQGMESRVIIVNTFPKTGRMIFKEAKRLGMMGRGYVWIATTWMTSL  264

Query  590   LDSSSPLPSEKM-EIMQGVLVLRQHTPDSELKRAFTSRWKHLTGGSLGLNSYALYAYDSV  766
             LDS++PL   K+ + + GVL LR HTP+S  KR F +RWK L+ G++GLN Y LYAYD+V
Sbjct  265   LDSANPLSLPKVAKSLTGVLTLRIHTPESRKKRDFAARWKKLSNGTVGLNVYGLYAYDTV  324

Query  767   WLIAHAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLT  946
             W+IA A+ S L+ G  ISFS+DS+L  ++G TL+L ALS+FD G   L+ ++++   G+T
Sbjct  325   WIIARAVKSLLDSGANISFSSDSRLNHLKGGTLNLAALSMFDQGQQFLDYIVETKMSGVT  384

Query  947   GQFKFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKL  1126
             G+ +F  D+S++ P+YDI+NV+G G R IG+W N+SGLS  PPE L+S+P N SS+NQ L
Sbjct  385   GRVQFLPDRSMIQPAYDIINVVGDGLRQIGYWSNHSGLSVIPPELLFSKPSNRSSSNQHL  444

Query  1127  YGVVWPGQSVKKAPGVGFPEQ  1189
               V WPG       G  FP  
Sbjct  445   KNVTWPGGGSVTPRGWVFPNN  465



>emb|CDY52597.1| BnaCnng22760D [Brassica napus]
Length=912

 Score =   459 bits (1181),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 263/408 (64%), Positives = 329/408 (81%), Gaps = 9/408 (2%)
 Frame = +3

Query  1164  PRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFK--GFSVDVFTAAVNLLPYAVPFQ  1337
             PRGWVFPNNGK LRIGVP R S+K+F+S+V G++  K  G+ +DVF AAV LL Y VP +
Sbjct  450   PRGWVFPNNGKLLRIGVPNRASFKDFVSRVNGSSNHKVQGYCIDVFEAAVKLLSYPVPHE  509

Query  1338  FVPFGNGRENPSYSELVRLVSTGY-FDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPF  1514
             F+ FG+G +NP+Y++LV  V+ G  FD A+GDIAIVT RT++VD+TQPY+ SGL+VVAP 
Sbjct  510   FIFFGDGLQNPNYNDLVNKVAIGVGFDAAVGDIAIVTKRTRIVDYTQPYIESGLVVVAPV  569

Query  1515  KKLNTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSL  1694
               LN   WAFL PF+  MW VTA FF+VVG V+WILEHR NDEFRG P++Q+ITILWF+ 
Sbjct  570   TALNENPWAFLRPFTPPMWAVTASFFMVVGAVIWILEHRTNDEFRGPPRRQIITILWFTF  629

Query  1695  STLFFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESLKEG  1874
             ST+FF+HRENT STLGRMVL+IWLFVVLII SSYTASLTS+LTVQQL SPIKGV++L   
Sbjct  630   STMFFSHRENTTSTLGRMVLLIWLFVVLIITSSYTASLTSMLTVQQLNSPIKGVDTLISS  689

Query  1875  NDPIGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERPYVE  2054
             +  IG+Q+GSFAE+Y+I+E+ I++SRL+ALGSP+ YA AL+ G     VSAIVDERPYV+
Sbjct  690   SGRIGFQVGSFAENYMIDELNIARSRLVALGSPQEYATALQNGT----VSAIVDERPYVD  745

Query  2055  NFLSTQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLtrts  2234
              FLS  CKF I GQEFT+ GWGFAFPRDSPLAVDMSTAIL LSE G+LQRIHD+WL++++
Sbjct  746   LFLSDYCKFAIRGQEFTRCGWGFAFPRDSPLAVDMSTAILGLSETGELQRIHDRWLSKSN  805

Query  2235  cssestelesD--RLHLKSFWglfllcgaacflalfIYFVQIMLKFRR  2372
             CSS       D  +L++ SFWG+FL+CG AC +ALFI+FV+++  F +
Sbjct  806   CSSPHGSQSGDSEQLNVHSFWGMFLVCGIACLVALFIHFVKVVRNFLK  853


 Score =   415 bits (1066),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 197/380 (52%), Positives = 274/380 (72%), Gaps = 7/380 (2%)
 Frame = +2

Query  56    LVAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTT  235
             ++ AL+FM+TDVVAI+GPQ+S++AH +SH+ANEL VP+LSF A DPTL+ LQFP+F++T 
Sbjct  84    IMGALQFMETDVVAIIGPQTSIMAHVLSHLANELTVPMLSFTALDPTLSPLQFPFFVQTA  143

Query  236   QSDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGA  415
              +D++ M AIA++I +YGW +V+A++ DDD  RNG+ AL D L  +RCKISYKA +P   
Sbjct  144   PNDLFLMRAIAEMITYYGWSDVVALYNDDDNSRNGVTALGDELEERRCKISYKAVLPLDV  203

Query  416   --TTRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTV  589
               T+ AEI++ L +I  MESR++V++ +P  G M+F  A  LGMM  GYVWI+T WLS++
Sbjct  204   VITSPAEIIEELTKIRGMESRIIVVNTFPNTGKMIFEEAERLGMMEKGYVWIATTWLSSL  263

Query  590   LDSSSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLTGGSLGLNSYALYAYDSVW  769
             +DS  PL    ++ + GVL LR HTPDS  KR F +RWK     ++GLN Y LYAYD+VW
Sbjct  264   VDSDLPL---DLKSLNGVLTLRLHTPDSRKKRDFAARWKK--NKTIGLNVYGLYAYDTVW  318

Query  770   LIAHAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLTG  949
             +IA A+ SFL  GG ++FS+D+KL +++G  L+L ALS FD GP LL+ ++++   GLTG
Sbjct  319   IIAQAVKSFLEAGGNLTFSHDAKLSNLKGEALNLSALSRFDEGPQLLDYIMRTKMSGLTG  378

Query  950   QFKFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKLY  1129
               +F+ D+S+  PSYDI+NV+  GFR IG+W N+SGLST PPE+ Y++P N SS+NQ L 
Sbjct  379   PVQFHRDRSMAQPSYDIINVVDGGFRQIGYWSNHSGLSTVPPESFYNKPSNRSSSNQHLN  438

Query  1130  GVVWPGQSVKKAPGVGFPEQ  1189
              V WPG +     G  FP  
Sbjct  439   SVTWPGGTSVTPRGWVFPNN  458



>ref|XP_004151932.1| PREDICTED: glutamate receptor 3.4-like [Cucumis sativus]
 gb|KGN63258.1| hypothetical protein Csa_2G418930 [Cucumis sativus]
Length=935

 Score =   452 bits (1163),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 258/404 (64%), Positives = 321/404 (79%), Gaps = 1/404 (0%)
 Frame = +3

Query  1164  PRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYAVPFQFV  1343
             PRGWVFP++GK L+I VP RVSYK F+S+       KG+ +DVF AA+NLLPY VP  ++
Sbjct  470   PRGWVFPHSGKPLQIVVPNRVSYKAFVSKDKNHPGVKGYCIDVFEAAINLLPYPVPHTYI  529

Query  1344  PFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPFKKL  1523
              +G+G++ P YS LV  VS   +D  +GDI IVTNRTK+VDFTQP++ SGL+VV    + 
Sbjct  530   LYGDGKDTPEYSNLVYEVSQNKYDAVVGDITIVTNRTKIVDFTQPFMESGLVVVTVVNEE  589

Query  1524  NTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSLSTL  1703
              +  WAFL PF+ QMW VTA FF+ VG VVWILEHR N+EFRG P+QQLITI WFS ST+
Sbjct  590   KSSPWAFLRPFTIQMWAVTAIFFIFVGAVVWILEHRTNEEFRGPPRQQLITIFWFSFSTM  649

Query  1704  FFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESLKEGNDP  1883
             FF+H+ENTVSTLGR+VLIIWLFVVLIINSSYTASLTSILTVQQL S IKG++SL    D 
Sbjct  650   FFSHKENTVSTLGRLVLIIWLFVVLIINSSYTASLTSILTVQQLTSKIKGIDSLISRTDV  709

Query  1884  IGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERPYVENFL  2063
             IG Q GSFA HYLI+++G++ SR+I L   E YA+AL +GP  GGV+AIVDE PYVE FL
Sbjct  710   IGVQEGSFALHYLIDDLGVAASRIIKLKDQEEYADALRRGPENGGVAAIVDELPYVELFL  769

Query  2064  S-TQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLtrtscs  2240
             + T C +RIVG+EFTKSGWGFAF RDSPLAVD+STAIL LSENGDLQ+IHDKWL+RT CS
Sbjct  770   AGTNCMYRIVGEEFTKSGWGFAFQRDSPLAVDLSTAILQLSENGDLQKIHDKWLSRTECS  829

Query  2241  sestelesDRLHLKSFWglfllcgaacflalfIYFVQIMLKFRR  2372
             ++  +++ ++L L SFWGLFL+CG ACF+AL ++F +++ ++RR
Sbjct  830   TDLNQVDVNQLSLSSFWGLFLICGIACFIALSVFFFRVLFQYRR  873


 Score =   421 bits (1083),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 204/377 (54%), Positives = 267/377 (71%), Gaps = 3/377 (1%)
 Frame = +2

Query  59    VAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTTQ  238
             + AL+ M+ +VVA +GPQSS +AH ISHV NEL +PLLSF ATDP L++ Q+ YF+RTTQ
Sbjct  103   MEALQLMEDEVVAAIGPQSSGIAHVISHVINELHIPLLSFGATDPALSAQQYQYFVRTTQ  162

Query  239   SDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGAT  418
             SD +QM AIAD++  +GWKEV+A+F+DDD GR+GI+AL DALA KR KI+YKA  P G++
Sbjct  163   SDYFQMNAIADMVAKFGWKEVVAIFVDDDNGRSGISALSDALAKKRAKIAYKAAFPSGSS  222

Query  419   TRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVLDS  598
               + I D+LV + +MESRV ++H  P  G  VFSVA  L MMG GYVWI+TDWL + LDS
Sbjct  223   I-STISDLLVSVNMMESRVYIVHVNPDTGLSVFSVAKKLQMMGSGYVWIATDWLPSFLDS  281

Query  599   SSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLT-GGSLGLNSYALYAYDSVWLI  775
                   + M  +QGV+ LR HTPD  LK+ F S+W++L    S   NSYALYAYDSVWLI
Sbjct  282   FETNSPDVMNQLQGVVALRHHTPDGNLKKNFISKWRNLKYKKSPNFNSYALYAYDSVWLI  341

Query  776   AHAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLTGQF  955
             A A+D+F  +GG ISFSND KL+   GS  + ++  +F+GG  LL  + +++F GL+GQ 
Sbjct  342   ARALDTFFKEGGNISFSNDPKLRENNGSMFYYKSFKVFNGGEQLLQTIKRTNFTGLSGQI  401

Query  956   KFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKLYGV  1135
             +F + K L+ P+YDILN+ GTG R IG+W NYSGLST  PE LY +P N +S N  LY V
Sbjct  402   QFGDGKHLIHPAYDILNIGGTGVRRIGYWSNYSGLSTIAPENLYVKPLN-ASPNNNLYSV  460

Query  1136  VWPGQSVKKAPGVGFPE  1186
             +WPG++     G  FP 
Sbjct  461   IWPGETTTIPRGWVFPH  477



>ref|XP_008379630.1| PREDICTED: glutamate receptor 3.4 [Malus domestica]
Length=952

 Score =   444 bits (1141),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 260/412 (63%), Positives = 319/412 (77%), Gaps = 3/412 (1%)
 Frame = +3

Query  1164  PRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYAVPFQFV  1343
             PRGWVFPNNG+ LRIGVP RVSYK+F+++       +G+ +DVF AAVNLLPYAVP  ++
Sbjct  470   PRGWVFPNNGRPLRIGVPYRVSYKDFVAKDKSPAGVRGYCIDVFEAAVNLLPYAVPRTYM  529

Query  1344  PFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPFKKL  1523
              +G+G+ NP YS LV  V+   FD A+GD+ I  NRT++VDFTQPY+ SGL+VV P KK 
Sbjct  530   LYGDGKRNPEYSSLVAQVAQNKFDAAVGDVTITNNRTRIVDFTQPYMESGLVVVVPVKKA  589

Query  1524  NTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSLSTL  1703
              +  W FL PF+ QMW VT  FF+ VG VVWILEHR N EFRG P QQLITI WFS ST+
Sbjct  590   KSNPWVFLKPFTYQMWLVTGAFFLFVGAVVWILEHRFNHEFRGPPSQQLITIFWFSFSTM  649

Query  1704  FFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESLKEGNDP  1883
             FF+HRENTVSTLGR+V+IIWLFVVLIINSSYTASLTSILTVQQL S I+G++SL   ND 
Sbjct  650   FFSHRENTVSTLGRLVVIIWLFVVLIINSSYTASLTSILTVQQLTSRIEGIDSLISSNDR  709

Query  1884  IGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERPYVENFL  2063
             IG Q GSFA  YL++E+ I++SRL+ L   EAY +AL  GP +GGV+AIVDE PY+E F+
Sbjct  710   IGVQDGSFAWRYLVDEMNIAESRLVKLKDMEAYIKALTDGPRRGGVAAIVDELPYIELFM  769

Query  2064  S-TQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLtrtscs  2240
             S T+C FR VG EFTKSGWGFAF +DSPLAVD+STAIL LSENGDLQ+IHDKW     C 
Sbjct  770   SXTKCAFRTVGXEFTKSGWGFAFQKDSPLAVDLSTAILQLSENGDLQKIHDKWFKHNECP  829

Query  2241  sestelesD-RLHLKSFWglfllcgaacflalfIYFVQIMLKFRRVARAEPV  2393
             ++  ++++D +L L SFWGLFL+CG ACFLAL ++F +I+ ++RR    EPV
Sbjct  830   TQLNDVDADLQLSLTSFWGLFLICGIACFLALAVFFCRILCQYRRFT-PEPV  880


 Score =   430 bits (1105),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 204/378 (54%), Positives = 273/378 (72%), Gaps = 3/378 (1%)
 Frame = +2

Query  59    VAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTTQ  238
             V A++ +  DVVA +GPQSS +AH ISHV NEL VPLLSF ATDP+LA+L++PYF+RTTQ
Sbjct  103   VEAMELINNDVVAAVGPQSSGIAHVISHVVNELHVPLLSFGATDPSLAALKYPYFVRTTQ  162

Query  239   SDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGAT  418
             SD +QM A+AD+++++GW+EVIA+F+DDDYGRNGI+ L DALA KR KISYKA   PGA 
Sbjct  163   SDYFQMYAVADLVEYFGWREVIAIFVDDDYGRNGISILADALAVKRSKISYKAAFSPGA-  221

Query  419   TRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVLDS  598
              +++I ++L+ + LMESRV ++H +P +G  +FS+A  LGMM  GYVWI+TDWL + LDS
Sbjct  222   LKSDINELLMGVNLMESRVYIVHVHPDSGLTIFSIAKALGMMTSGYVWIATDWLPSYLDS  281

Query  599   SSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLT-GGSLGLNSYALYAYDSVWLI  775
              +P   +   ++QGV+ LR HTPD++LK+ F SRW  L   G+   NSYALYAYDS+WL 
Sbjct  282   LNPPGPDTTNLLQGVVALRHHTPDTDLKKRFMSRWSKLKHEGTPSFNSYALYAYDSIWLA  341

Query  776   AHAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLTGQF  955
             A A+D F N+GG +SFSN  +L+    STLHL +L IF GG   L  +L+ +F G++GQ 
Sbjct  342   ARALDVFFNEGGNVSFSNYPRLKDTNRSTLHLTSLRIFYGGQKYLQTILKMNFTGISGQI  401

Query  956   KFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKLYGV  1135
             +F+ DK LV P+YDILN+ GTG R +G+W N +GLS   PE LY +P N ++  Q LY V
Sbjct  402   EFDQDKYLVRPAYDILNIGGTGSRRVGYWSNSTGLSVIAPEILYKKPFNRNTTAQ-LYSV  460

Query  1136  VWPGQSVKKAPGVGFPEQ  1189
             +WPG+      G  FP  
Sbjct  461   IWPGEVTATPRGWVFPNN  478



>ref|XP_009103268.1| PREDICTED: glutamate receptor 3.2 [Brassica rapa]
Length=913

 Score =   465 bits (1196),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 264/404 (65%), Positives = 331/404 (82%), Gaps = 7/404 (2%)
 Frame = +3

Query  1164  PRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYAVPFQFV  1343
             PRGWVFP+NG++LRIGVP R S+K+F+S+V G+N   G+S++VF AAV LL Y VP +FV
Sbjct  458   PRGWVFPDNGRRLRIGVPNRASFKDFVSKVNGSNQIDGYSINVFEAAVKLLSYPVPHEFV  517

Query  1344  PFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPFKKL  1523
              FG+G +NP+Y++LV  ++TG FD  +GDIAIVT RT++VDFTQPY+ SGL+VVAP  KL
Sbjct  518   LFGDGLKNPNYNDLVNNLTTGVFDAVVGDIAIVTKRTRIVDFTQPYIESGLVVVAPVTKL  577

Query  1524  NTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSLSTL  1703
             N   WAFL PF+  MW VTA FF++VG V+WILEHR+NDEFRG P++Q++TILWFS ST+
Sbjct  578   NDTPWAFLRPFTPPMWAVTAAFFLIVGSVIWILEHRINDEFRGPPRRQIVTILWFSFSTM  637

Query  1704  FFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESLKEGNDP  1883
             FF+HRENTVSTLGR+VL+IWLFVVLII SSYTASLTSILTVQQL SPIKGV++L   +  
Sbjct  638   FFSHRENTVSTLGRIVLLIWLFVVLIITSSYTASLTSILTVQQLNSPIKGVDTLISSSGR  697

Query  1884  IGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERPYVENFL  2063
             +G+Q+GS+AE+Y+I+E+ I++SRL+ALGSP+ YA AL+ G     V+AIVDERPYV+ FL
Sbjct  698   VGFQVGSYAENYMIDELNIARSRLVALGSPKEYATALQNGT----VAAIVDERPYVDLFL  753

Query  2064  STQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLtrtscss  2243
             S  C F I GQEFT+SGWGFAFPRDSPLAVDMSTAIL LSE G LQ+IHDKWL++++CS+
Sbjct  754   SEFCGFAIRGQEFTRSGWGFAFPRDSPLAVDMSTAILGLSEAGKLQKIHDKWLSKSNCSN  813

Query  2244  estelesD---RLHLKSFWglfllcgaacflalfIYFVQIMLKF  2366
              +     D   +L L+SFWGLFLLCG ACF+ALFIYF  I+  F
Sbjct  814   VNGSASDDDPEQLKLRSFWGLFLLCGIACFIALFIYFFMIVRDF  857


 Score =   408 bits (1049),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 192/381 (50%), Positives = 274/381 (72%), Gaps = 3/381 (1%)
 Frame = +2

Query  56    LVAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTT  235
             ++ AL+FM+TD VAI+GPQ+S++AH +S++ NEL VP+ SF A DPTL+ LQFP+F++T 
Sbjct  86    IMKALQFMETDSVAIIGPQTSIMAHVLSYLGNELNVPMCSFTALDPTLSPLQFPFFVQTA  145

Query  236   QSDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGA  415
              SD++ M A+A++I +YGW +VIA++ DDD  RNG+ +L D L  +RCKISYKA +P   
Sbjct  146   PSDLFLMRAVAEMITYYGWSDVIALYNDDDNSRNGVTSLGDELEGRRCKISYKAVLPLDV  205

Query  416   T--TRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTV  589
                +  EI+D LV+I  MESRV++++ +P  G M+F  A  LGMMG GYVWI+T W++++
Sbjct  206   VIGSPREIVDELVKIQGMESRVIIVNTFPKTGRMIFKEAKRLGMMGRGYVWIATTWMTSL  265

Query  590   LDSSSPLPSEKM-EIMQGVLVLRQHTPDSELKRAFTSRWKHLTGGSLGLNSYALYAYDSV  766
             LDS++PL   K+ + + GVL LR HTP+S  KR F +RWK L+ G++GLN Y LYAYD+V
Sbjct  266   LDSANPLSLPKVAKSLTGVLTLRIHTPESRKKRDFAARWKKLSNGTVGLNVYGLYAYDTV  325

Query  767   WLIAHAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLT  946
             W+IA A+ S L+ G  ISFS+DS+L  ++G TL+L ALS+FD G   L+ ++++   G+T
Sbjct  326   WIIARAVKSLLDSGANISFSSDSRLNHLKGGTLNLAALSMFDQGQQFLDYIVETKMSGVT  385

Query  947   GQFKFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKL  1126
             G  +F  D+S++ P+YDI+NV+G G R IG+W N+SGLS  PPE L+S+P N SS+NQ L
Sbjct  386   GPVEFLPDRSMIQPAYDIINVVGDGLRQIGYWSNHSGLSVIPPELLFSKPSNRSSSNQHL  445

Query  1127  YGVVWPGQSVKKAPGVGFPEQ  1189
               V WPG       G  FP+ 
Sbjct  446   KNVTWPGGGSVTPRGWVFPDN  466



>emb|CDY24327.1| BnaA07g02520D [Brassica napus]
Length=912

 Score =   457 bits (1177),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 262/406 (65%), Positives = 330/406 (81%), Gaps = 9/406 (2%)
 Frame = +3

Query  1164  PRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNT--FKGFSVDVFTAAVNLLPYAVPFQ  1337
             PRGWVFPNNGK LRIGVP R S+K+F+S+V G+++   +G+ +DVF AAV LL Y VP +
Sbjct  450   PRGWVFPNNGKLLRIGVPNRASFKDFVSRVNGSSSHIVQGYCIDVFEAAVKLLSYPVPHE  509

Query  1338  FVPFGNGRENPSYSELVRLVSTGY-FDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPF  1514
             F+ FG+G +NP+Y++LV  V+ G  FD A+GDIAIVT RT++VD+TQPY+ SGL+VVAP 
Sbjct  510   FIFFGDGLQNPNYNDLVNKVANGVDFDAAVGDIAIVTKRTRIVDYTQPYIESGLVVVAPV  569

Query  1515  KKLNTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSL  1694
               LN   WAFL PF+  MW VTA FF+VVG V+WILEHR NDEFRG P++Q+ITILWF+ 
Sbjct  570   TALNENPWAFLRPFTPPMWAVTASFFMVVGAVIWILEHRTNDEFRGPPRRQIITILWFTF  629

Query  1695  STLFFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESLKEG  1874
             ST+FF+HRENT STLGRMVL+IWLFVVLII SSYTASLTS+LTVQQL SPIKGV++L   
Sbjct  630   STMFFSHRENTTSTLGRMVLLIWLFVVLIITSSYTASLTSMLTVQQLNSPIKGVDTLISS  689

Query  1875  NDPIGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERPYVE  2054
             +  IG+Q+GSFAE+Y+I+E+ I++SRL+ALGSP+ YA AL+ G     V+AIVDERPYV+
Sbjct  690   SGRIGFQVGSFAENYMIDELNIARSRLVALGSPQEYATALQNGT----VAAIVDERPYVD  745

Query  2055  NFLSTQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLtrts  2234
              FLS  CKF I GQEFT+ GWGFAFPRDSPLAVDMSTAIL LSE G+LQRIHD+WL++++
Sbjct  746   LFLSDYCKFAIRGQEFTRCGWGFAFPRDSPLAVDMSTAILGLSETGELQRIHDRWLSKSN  805

Query  2235  cssestelesD--RLHLKSFWglfllcgaacflalfIYFVQIMLKF  2366
             CSS       D  +L++ SFWG+FL+CG ACF+ALFI+FV+++  F
Sbjct  806   CSSPHGSQSGDSEQLNVHSFWGMFLVCGIACFVALFIHFVKVVRNF  851


 Score =   414 bits (1063),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 197/380 (52%), Positives = 274/380 (72%), Gaps = 7/380 (2%)
 Frame = +2

Query  56    LVAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTT  235
             ++ AL+FM+TDVVAI+GPQ+S++AH +SH+ANEL VP+LSF A DPTL+ LQFP+F++T 
Sbjct  84    IMGALQFMETDVVAIIGPQTSIMAHVLSHLANELTVPMLSFTALDPTLSPLQFPFFVQTA  143

Query  236   QSDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGA  415
              +D++ M AIA++I +YGW +V+A++ DDD  RNG+ AL D L  +RCKISYKA +P   
Sbjct  144   PNDLFLMRAIAEMITYYGWSDVVALYNDDDNSRNGVTALGDELEERRCKISYKAVLPLDV  203

Query  416   --TTRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTV  589
               T+ AEI++ L +I  MESR++V++ +P  G M+F  A  LGMM  GYVWI+T WLS++
Sbjct  204   VITSPAEIIEELTKIRGMESRIIVVNTFPNTGKMIFEEAKKLGMMEKGYVWIATTWLSSL  263

Query  590   LDSSSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLTGGSLGLNSYALYAYDSVW  769
             +DS  PL    ++ + GVL LR HTPDS  KR F +RWK     ++GLN Y LYAYD+VW
Sbjct  264   VDSDFPL---DLKSLNGVLTLRLHTPDSRKKRDFAARWKK--NKTIGLNVYGLYAYDTVW  318

Query  770   LIAHAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLTG  949
             +IA A+ SFL  GG ++FS+D+KL +++G  L+L ALS FD GP LL+ ++++   GLTG
Sbjct  319   IIAQAVKSFLEAGGNLTFSHDAKLSNLKGEALNLSALSRFDEGPQLLDYIMRTKMSGLTG  378

Query  950   QFKFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKLY  1129
               +F+ D+S+V PSYDI+NV+  GFR IG+W N+SGLS  PPE+ Y++P N SS+NQ L 
Sbjct  379   PVQFHRDRSMVQPSYDIINVVDGGFRQIGYWSNHSGLSVLPPESFYNKPSNRSSSNQHLN  438

Query  1130  GVVWPGQSVKKAPGVGFPEQ  1189
              V WPG +     G  FP  
Sbjct  439   SVTWPGGTSVTPRGWVFPNN  458



>ref|XP_004171803.1| PREDICTED: LOW QUALITY PROTEIN: glutamate receptor 3.4-like [Cucumis 
sativus]
Length=935

 Score =   449 bits (1155),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 257/404 (64%), Positives = 319/404 (79%), Gaps = 1/404 (0%)
 Frame = +3

Query  1164  PRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYAVPFQFV  1343
             PRGWVFP++GK L+I VP RVSYK F+S+       KG+ +DVF AA+NLLPY VP  ++
Sbjct  470   PRGWVFPHSGKPLQIVVPNRVSYKAFVSKDKNHPGVKGYCIDVFEAAINLLPYPVPHTYI  529

Query  1344  PFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPFKKL  1523
              +G+G + P YS LV  VS   +D  +GDI IVTNRTK+VDFTQP++ SGL+VV    + 
Sbjct  530   LYGDGXDTPEYSNLVYEVSQNKYDAVVGDITIVTNRTKIVDFTQPFMESGLVVVTVVNEE  589

Query  1524  NTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSLSTL  1703
              +  WAFL PF+ QMW VTA FF+ VG VVWILEHR N+EFRG P+QQLITI WFS ST+
Sbjct  590   KSSPWAFLRPFTIQMWAVTAIFFIFVGAVVWILEHRTNEEFRGPPRQQLITIFWFSFSTM  649

Query  1704  FFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESLKEGNDP  1883
             FF+H+ENTVSTLGR+VLIIWLFVVLIINSSYT SLTSILTVQQL S IKG++SL    D 
Sbjct  650   FFSHKENTVSTLGRLVLIIWLFVVLIINSSYTXSLTSILTVQQLTSKIKGIDSLISRTDV  709

Query  1884  IGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERPYVENFL  2063
             IG Q GSFA HYLI+++G++ SR+I L   E YA+AL +GP  GGV+AIVDE PYVE FL
Sbjct  710   IGVQEGSFALHYLIDDLGVAASRIIKLKDQEEYADALRRGPENGGVAAIVDELPYVELFL  769

Query  2064  S-TQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLtrtscs  2240
             + T C +RIVG+EFTKSGWGFAF RDSPLAVD+STAIL LSENGDLQ+IHDKWL+RT CS
Sbjct  770   AGTNCMYRIVGEEFTKSGWGFAFQRDSPLAVDLSTAILQLSENGDLQKIHDKWLSRTECS  829

Query  2241  sestelesDRLHLKSFWglfllcgaacflalfIYFVQIMLKFRR  2372
             ++  +++ ++L L SFWGLFL+CG ACF+AL ++F +++ ++RR
Sbjct  830   TDLNQVDVNQLSLSSFWGLFLICGIACFIALSVFFFRVLFQYRR  873


 Score =   421 bits (1083),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 204/377 (54%), Positives = 267/377 (71%), Gaps = 3/377 (1%)
 Frame = +2

Query  59    VAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTTQ  238
             + AL+ M+ +VVA +GPQSS +AH ISHV NEL +PLLSF ATDP L++ Q+ YF+RTTQ
Sbjct  103   MEALQLMEDEVVAAIGPQSSGIAHVISHVINELHIPLLSFGATDPALSAQQYQYFVRTTQ  162

Query  239   SDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGAT  418
             SD +QM AIAD++  +GWKEV+A+F+DDD GR+GI+AL DALA KR KI+YKA  P G++
Sbjct  163   SDYFQMNAIADMVAKFGWKEVVAIFVDDDNGRSGISALSDALAKKRAKIAYKAAFPSGSS  222

Query  419   TRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVLDS  598
               + I D+LV + +MESRV ++H  P  G  VFSVA  L MMG GYVWI+TDWL + LDS
Sbjct  223   I-STISDLLVSVNMMESRVYIVHVNPDTGLSVFSVAKKLQMMGSGYVWIATDWLPSFLDS  281

Query  599   SSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLT-GGSLGLNSYALYAYDSVWLI  775
                   + M  +QGV+ LR HTPD  LK+ F S+W++L    S   NSYALYAYDSVWLI
Sbjct  282   FETNSPDVMNQLQGVVALRHHTPDGNLKKNFISKWRNLKYKKSPNFNSYALYAYDSVWLI  341

Query  776   AHAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLTGQF  955
             A A+D+F  +GG ISFSND KL+   GS  + ++  +F+GG  LL  + +++F GL+GQ 
Sbjct  342   ARALDTFFKEGGNISFSNDPKLRENNGSMFYYKSFKVFNGGEQLLQTIKRTNFTGLSGQI  401

Query  956   KFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKLYGV  1135
             +F + K L+ P+YDILN+ GTG R IG+W NYSGLST  PE LY +P N +S N  LY V
Sbjct  402   QFGDGKHLIHPAYDILNIGGTGVRRIGYWSNYSGLSTIAPENLYVKPLN-ASPNNNLYSV  460

Query  1136  VWPGQSVKKAPGVGFPE  1186
             +WPG++     G  FP 
Sbjct  461   IWPGETTTIPRGWVFPH  477



>ref|XP_009118614.1| PREDICTED: glutamate receptor 3.4-like [Brassica rapa]
 ref|XP_009118615.1| PREDICTED: glutamate receptor 3.4-like [Brassica rapa]
Length=940

 Score =   439 bits (1129),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 208/375 (55%), Positives = 276/375 (74%), Gaps = 7/375 (2%)
 Frame = +2

Query  59    VAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTTQ  238
             + AL+ M+T VVA LGPQSS +AH IS+VANEL VPLLSFAATDPTL+SLQ+PYFLRTTQ
Sbjct  101   MGALQLMETQVVAALGPQSSGIAHMISYVANELHVPLLSFAATDPTLSSLQYPYFLRTTQ  160

Query  239   SDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGAT  418
             +D +QM A+AD I + GW++VIA+++DD+YGRNGI+ L DALA KR KISYKA I PGA 
Sbjct  161   NDHFQMHAVADFISYSGWRQVIAIYVDDEYGRNGISILSDALAKKRSKISYKAAITPGAE  220

Query  419   TRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVLDS  598
             + + I  +LV + L  SRV V+H  P +G  VF+VA  LGMMG+GYVWI+TDWL T LDS
Sbjct  221   STS-IESLLVSVNLKASRVYVVHVNPDSGLNVFTVAKSLGMMGNGYVWIATDWLPTSLDS  279

Query  599   SSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLTGGSLGLNSYALYAYDSVWLIA  778
              +P+ SE M+++QGV+  R +T ++ +KR    RWK+      G NSYALYAYDSVWL+A
Sbjct  280   MAPVGSETMDLLQGVVAFRHYTTETSMKRELKGRWKN------GFNSYALYAYDSVWLLA  333

Query  779   HAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLTGQFK  958
              A+D F  +   I+FSND  L     S++ L ALS+F+ G  LL  +L  +  GLTG+ +
Sbjct  334   RALDVFFKEHNTITFSNDQNLTKTSDSSIQLSALSVFNEGEKLLEIILGMNHTGLTGRIQ  393

Query  959   FNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKLYGVV  1138
             F+ +++ V P+Y++LN+ GTG R +G+W N+SGLS   PETLYS+PPN+S+ANQ+LYG++
Sbjct  394   FDAERNRVNPAYEVLNIAGTGPRRVGYWSNHSGLSVVTPETLYSKPPNTSTANQRLYGII  453

Query  1139  WPGQSVKKAPGVGFP  1183
             WPG+  K   G  FP
Sbjct  454   WPGEVTKPPRGWVFP  468


 Score =   431 bits (1109),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 244/408 (60%), Positives = 308/408 (75%), Gaps = 2/408 (0%)
 Frame = +3

Query  1158  KKPRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYAVPFQ  1337
             K PRGWVFPNNGK L+I VP RVSYK+++S+       +G+ VDVF AA+ LLPY VP  
Sbjct  460   KPPRGWVFPNNGKPLKIAVPNRVSYKDYVSKDKNPPGVRGYCVDVFEAALELLPYPVPRN  519

Query  1338  FVPFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPFK  1517
             ++ +G+G++NPSY+ L+  V T  FD A+GDI I TNRT+ VDFTQP++ SGL+VVAP K
Sbjct  520   YILYGDGKKNPSYNNLINEVVTENFDVAVGDITITTNRTRFVDFTQPFIESGLVVVAPVK  579

Query  1518  KLNTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSLS  1697
                +  W+FL PF+ +MW VT  FF++VG +VWILEHR N EFRG PK+QLITI WFS S
Sbjct  580   AAKSSPWSFLKPFTIEMWAVTGAFFLLVGAIVWILEHRFNQEFRGPPKRQLITIFWFSFS  639

Query  1698  TLFFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESLKEGN  1877
             T+FF+HRENTVSTLGR+VLIIWLFVVLIINSSYTASLTSILTVQQL S I+G++SL + N
Sbjct  640   TMFFSHRENTVSTLGRLVLIIWLFVVLIINSSYTASLTSILTVQQLTSRIEGIDSLIQSN  699

Query  1878  DPIGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERPYVEN  2057
             +PIG Q G+FA +YL+ E+ IS  R++ L   E Y  AL+ GP  GGV+AIVDE PYVE 
Sbjct  700   EPIGVQDGTFARNYLVNELNISPHRIVPLRDEEHYLSALQLGPKAGGVAAIVDELPYVEV  759

Query  2058  FLS-TQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLtrts  2234
              L+ + CK+R VGQ FT++GWGFAF RDSPLAVDMSTAIL LSE G+L++IH KWL    
Sbjct  760   LLTNSNCKYRTVGQVFTRTGWGFAFQRDSPLAVDMSTAILQLSEEGELEKIHRKWLNYKH  819

Query  2235  cssestelesD-RLHLKSFWglfllcgaacflalfIYFVQIMLKFRRV  2375
               S       +  L LKSFWGLFL+CG  CF+AL ++F ++  +++R+
Sbjct  820   ECSMQISNGENSELSLKSFWGLFLICGITCFVALTVFFWRVFWQYQRL  867



>ref|XP_006283116.1| hypothetical protein CARUB_v10004138mg [Capsella rubella]
 ref|XP_006283117.1| hypothetical protein CARUB_v10004138mg [Capsella rubella]
 gb|EOA16014.1| hypothetical protein CARUB_v10004138mg [Capsella rubella]
 gb|EOA16015.1| hypothetical protein CARUB_v10004138mg [Capsella rubella]
Length=824

 Score =   466 bits (1199),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 264/414 (64%), Positives = 337/414 (81%), Gaps = 7/414 (2%)
 Frame = +3

Query  1164  PRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYAVPFQFV  1343
             PRGWVFPNNG++LRIGVP R S+K+F+S+V G+N   G+++DVF AAV ++ Y VP +F+
Sbjct  366   PRGWVFPNNGRRLRIGVPDRASFKDFVSRVDGSNKVHGYAIDVFEAAVKMISYPVPHEFI  425

Query  1344  PFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPFKKL  1523
              FG+G +NP+++E V  V+TG FD  +GDIAIVT RT++VDFTQPY+ SGL+VVAP  KL
Sbjct  426   LFGDGHKNPNFNEFVNNVTTGVFDAVVGDIAIVTKRTRIVDFTQPYIESGLVVVAPVTKL  485

Query  1524  NTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSLSTL  1703
             N   WAFL PF+  MW VTA FFV+VG V+WILEHR+NDEFRG P++Q++TILWFS ST+
Sbjct  486   NDTPWAFLRPFTPPMWAVTAAFFVIVGSVIWILEHRINDEFRGPPRKQIVTILWFSFSTM  545

Query  1704  FFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESLKEGNDP  1883
             FF+HRENTVSTLGR+VL+IWLFVVLII SSYTASLTSILTVQQL SPIKGV++L   +  
Sbjct  546   FFSHRENTVSTLGRLVLLIWLFVVLIITSSYTASLTSILTVQQLNSPIKGVDTLISSSGR  605

Query  1884  IGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERPYVENFL  2063
             +G+Q+GS+AE+Y+I+E+ I++SRL+ LGSP+ YA AL+     G V+AIVDERPYV+ FL
Sbjct  606   VGFQVGSYAENYMIDELNIARSRLVPLGSPKEYATALQ----NGTVAAIVDERPYVDLFL  661

Query  2064  STQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLtrtscss  2243
             S  C F I GQEFT+SGWGFAFPRDSPLAVDMSTAIL LSE G LQ+IHDKWL+R++CS+
Sbjct  662   SEFCGFAIRGQEFTRSGWGFAFPRDSPLAVDMSTAILGLSETGQLQKIHDKWLSRSNCSN  721

Query  2244  ---estelesDRLHLKSFWglfllcgaacflalfIYFVQIMLKFRRVARAEPVA  2396
                  ++ +S++L L+SFWGLFL+CG ACF+AL IYF +I+  F R ++ E  A
Sbjct  722   LNGSESDEDSEQLKLRSFWGLFLVCGIACFIALTIYFFKIVRDFCRHSKPEEEA  775


 Score =   404 bits (1037),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 194/374 (52%), Positives = 265/374 (71%), Gaps = 3/374 (1%)
 Frame = +2

Query  77    MQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTTQSDMYQM  256
             M+TD VAI+GPQ+S++AH +SH+ANEL VP+LSF A DP+L+ LQFP+F++T  SD++ M
Sbjct  1     METDAVAIIGPQTSIMAHVLSHLANELNVPMLSFLALDPSLSPLQFPFFVQTAPSDLFLM  60

Query  257   MAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGA--TTRAE  430
              AIA++I +YGW +VIA++ DDD  RNGI AL D L  +RCKISYKA +P     T+  E
Sbjct  61    RAIAEMISYYGWSDVIALYNDDDSSRNGITALGDELEGRRCKISYKAVLPLDVVITSPRE  120

Query  431   IMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVLDSSSPL  610
             I+D LV+I  MESRV++++ +P  G M+F  A  LGM+  GYVWI+T WL+++LDS +PL
Sbjct  121   IIDELVKIQGMESRVIIVNTFPKTGKMIFEEAKKLGMLEKGYVWIATTWLTSLLDSGNPL  180

Query  611   PSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLTGGSLGLNSYALYAYDSVWLIAHAID  790
             P +  E  +GVL LR HTP+S  KR F +RW  L+ G++GL+ Y LYAYD+VW+IA A+ 
Sbjct  181   PPKNTESFRGVLSLRIHTPNSRKKRDFVARWNKLSNGTVGLDVYGLYAYDTVWIIARAVK  240

Query  791   SFLNKGGVISFSNDSKLQSIEGS-TLHLEALSIFDGGPLLLNNLLQSDFVGLTGQFKFNN  967
             S L+ G  ISFS+D KL S+ G  +L+L ALSIFD G    + ++ +   GLTGQ +F  
Sbjct  241   SLLDSGANISFSSDPKLTSMTGEGSLNLGALSIFDQGSQFRDYIVNTKMSGLTGQIQFLP  300

Query  968   DKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKLYGVVWPG  1147
             D+S++ P+YDI+NV+  G R IG+W N+SGLS  PPE+LY +P N SS+NQ L  V WPG
Sbjct  301   DRSMIQPAYDIINVVDEGVRQIGYWSNHSGLSIIPPESLYKKPSNRSSSNQHLNNVTWPG  360

Query  1148  QSVKKAPGVGFPEQ  1189
              +     G  FP  
Sbjct  361   GTSVTPRGWVFPNN  374



>gb|AET03597.2| glutamate receptor 3.2 [Medicago truncatula]
Length=936

 Score =   459 bits (1182),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 249/403 (62%), Positives = 317/403 (79%), Gaps = 0/403 (0%)
 Frame = +3

Query  1164  PRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYAVPFQFV  1343
             PRGWVF +NG++L++GVP+++SY E +S++ G++ F G+ +DVFTAAV LLPY+VP +++
Sbjct  462   PRGWVFASNGRRLKVGVPLKISYHELVSRIKGSDMFAGYCIDVFTAAVELLPYSVPCKYI  521

Query  1344  PFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPFKKL  1523
             P G+G+ NP+Y++++  ++ G FD  +GDI I TNRTK+VDFTQPY  SGL+VVAP  KL
Sbjct  522   PVGDGKTNPTYTDILHKMTEGDFDAVVGDITITTNRTKIVDFTQPYSESGLVVVAPIMKL  581

Query  1524  NTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSLSTL  1703
                 WAFL PF+  MW VT  FF VVG VVWI+E R ND+FRG  K+Q +TILWFS ST+
Sbjct  582   KASPWAFLRPFAPMMWLVTGVFFFVVGSVVWIVERRFNDDFRGPAKKQFVTILWFSFSTM  641

Query  1704  FFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESLKEGNDP  1883
             F  HRE TVSTLGR++LIIWLFVV+I+NSSYT+SLTSILTV+QL S +KG+ESL   ND 
Sbjct  642   FSTHREKTVSTLGRLLLIIWLFVVMILNSSYTSSLTSILTVEQLSSSVKGLESLATSNDR  701

Query  1884  IGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERPYVENFL  2063
             IGY  GSF+E+YL +E+ I +SRL+ L SP  Y +AL+ GP  GGV+AIVDER Y+E FL
Sbjct  702   IGYLRGSFSENYLTQELNIHRSRLVPLNSPSEYEKALKDGPTNGGVAAIVDERAYMEIFL  761

Query  2064  STQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLtrtscss  2243
               +C+F I+GQEFTK GWGFAFPRDSPLA+DMSTAIL LSENG LQRIHDKWLTR+SC S
Sbjct  762   EMRCEFGIIGQEFTKMGWGFAFPRDSPLAIDMSTAILKLSENGGLQRIHDKWLTRSSCRS  821

Query  2244  estelesDRLHLKSFWglfllcgaacflalfIYFVQIMLKFRR  2372
             E  +   DRL L+SFWGLFL+ G ACF++LF Y  Q+   +R+
Sbjct  822   EEEKQGMDRLDLQSFWGLFLITGIACFVSLFCYVFQMAYSYRK  864


 Score =   410 bits (1053),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 203/385 (53%), Positives = 263/385 (68%), Gaps = 19/385 (5%)
 Frame = +2

Query  56    LVAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTT  235
             +V +L  M+ + VAI+GPQ SV+AH ISH+ANE+QVP+LSFAATDPTL SL+FPYF+RTT
Sbjct  86    IVDSLLLMEKETVAIIGPQFSVMAHVISHIANEMQVPILSFAATDPTLTSLEFPYFVRTT  145

Query  236   QSDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGA  415
             QSD+ QM A+AD++DH+ W++VIA+FIDDD+GRNGIAAL D LA K  KISYKA + P  
Sbjct  146   QSDLNQMAAVADIVDHFQWRDVIAIFIDDDHGRNGIAALGDKLAEKHSKISYKAALRPDQ  205

Query  416   TTRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVLD  595
              T  EI + L ++ALMESRV+VLH     G  V  +A    MMG GYVWI+TDWLST+LD
Sbjct  206   LTTDEINNALFKVALMESRVIVLHVTLHFGLQVLHLAQSHEMMGSGYVWIATDWLSTILD  265

Query  596   SSSPLP-SEKMEIMQGVLVLRQHTPDSELKRAFTSRWK------------HLTGGSLGLN  736
             S   L  S  M  MQGV+ LR +TP+S+ KR FTSRW             H  G S GLN
Sbjct  266   SDPSLSTSATMNDMQGVITLRMYTPESKNKRNFTSRWNRNLSHNIGSDHDHNHGPSFGLN  325

Query  737   SYALYAYDSVWLIAHAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNN  916
              + LYAYD+V+++A A+D+F N GG +SFSNDS L  + G TLHL+ + +F  G +LL  
Sbjct  326   MFGLYAYDTVYVLASALDAFFNSGGTLSFSNDSNLNMLRGDTLHLDNMKVFVNGSMLLQK  385

Query  917   LLQSDFVGLTGQFKFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRP  1096
             +L+ +  GLTG   F+++ +L+ PSY+I+NVIG+G R IGFW    GL T          
Sbjct  386   ILEVNITGLTGNIMFDSNGNLMNPSYEIINVIGSGIRRIGFWSESYGLHTG------VES  439

Query  1097  PNSSSANQKLYGVVWPGQSVKKAPG  1171
             PN S+  + LYGV+WPGQ+     G
Sbjct  440   PNHSNLRKGLYGVIWPGQTTHTPRG  464



>ref|XP_009121142.1| PREDICTED: glutamate receptor 3.1 isoform X1 [Brassica rapa]
Length=912

 Score =   459 bits (1180),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 263/406 (65%), Positives = 330/406 (81%), Gaps = 9/406 (2%)
 Frame = +3

Query  1164  PRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFK--GFSVDVFTAAVNLLPYAVPFQ  1337
             PRGWVFPNNGK LRIGVP R S+K+F+S+V G+++ K  G+ +DVF AAV LL Y VP +
Sbjct  450   PRGWVFPNNGKLLRIGVPNRASFKDFVSRVNGSSSHKAQGYCIDVFEAAVKLLSYPVPHE  509

Query  1338  FVPFGNGRENPSYSELVRLVSTGY-FDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPF  1514
             F+ FG+G +NP+Y++LV  V+ G  FD A+GDIAIVT RT++VD+TQPY+ SGL+VVAP 
Sbjct  510   FIFFGDGLQNPNYNDLVNKVANGVDFDAAVGDIAIVTKRTRIVDYTQPYIESGLVVVAPV  569

Query  1515  KKLNTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSL  1694
               LN   WAFL PF+  MW VTA FF+VVG V+WILEHR NDEFRG P++Q+ITILWF+ 
Sbjct  570   TALNENPWAFLRPFTPPMWAVTASFFMVVGAVIWILEHRTNDEFRGPPRRQIITILWFTF  629

Query  1695  STLFFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESLKEG  1874
             ST+FF+HRENT STLGRMVL+IWLFVVLII SSYTASLTS+LTVQQL SPIKGV++L   
Sbjct  630   STMFFSHRENTTSTLGRMVLLIWLFVVLIITSSYTASLTSMLTVQQLNSPIKGVDTLISS  689

Query  1875  NDPIGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERPYVE  2054
             +  IG+Q+GSFAE+Y+I+E+ I++SRL+ALGSP+ YA AL+ G     V+AIVDERPYV+
Sbjct  690   SGRIGFQVGSFAENYMIDELNIARSRLVALGSPQEYATALQNGT----VAAIVDERPYVD  745

Query  2055  NFLSTQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLtrts  2234
              FLS  CKF I GQEFT+ GWGFAFPRDSPLAVDMSTAIL LSE G+LQRIHD+WL++++
Sbjct  746   LFLSDYCKFAIRGQEFTRCGWGFAFPRDSPLAVDMSTAILGLSETGELQRIHDRWLSKSN  805

Query  2235  cssestelesD--RLHLKSFWglfllcgaacflalfIYFVQIMLKF  2366
             CSS       D  +L++ SFWG+FL+CG ACF+ALFI+FV+++  F
Sbjct  806   CSSPHGSQSGDSEQLNVHSFWGMFLVCGIACFVALFIHFVKVVRNF  851


 Score =   410 bits (1053),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 195/380 (51%), Positives = 273/380 (72%), Gaps = 7/380 (2%)
 Frame = +2

Query  56    LVAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTT  235
             ++ AL+FM+TDVVAI+GPQ+S++AH +SH+ANEL VP+LSF A DPTL+ LQFP+F++T 
Sbjct  84    IMGALQFMETDVVAIIGPQTSIMAHVLSHLANELTVPMLSFTALDPTLSPLQFPFFVQTA  143

Query  236   QSDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGA  415
              +D++ M AIA++I +YGW +V+A++ DDD  RNG+ AL D L  +RCKISYKA +P   
Sbjct  144   PNDLFLMRAIAEMITYYGWSDVVALYNDDDNSRNGVTALGDELEERRCKISYKAVLPLDV  203

Query  416   --TTRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTV  589
               T+ AEI++ L +I  MESR++V++ +P  G ++F  A  LGMM  GYVWI+T WLS++
Sbjct  204   VITSPAEIIEELTKIRGMESRIIVVNTFPNTGKIIFEEAKKLGMMEKGYVWIATTWLSSL  263

Query  590   LDSSSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLTGGSLGLNSYALYAYDSVW  769
             +DS  PL    ++ + GVL LR HTPDS  KR F +RWK     ++GLN Y LYAYD+VW
Sbjct  264   VDSDFPL---DLKSLNGVLTLRLHTPDSRKKRDFAARWKK--NKTIGLNVYGLYAYDTVW  318

Query  770   LIAHAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLTG  949
             +IA A+ SFL  GG ++FS+D+KL +++G  L+L ALS FD GP LL+ ++++   GLTG
Sbjct  319   IIAQAVKSFLEAGGNLTFSHDAKLSNLKGEALNLSALSRFDEGPQLLDYIMRTKMSGLTG  378

Query  950   QFKFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKLY  1129
               +F+ D+S+V PSYDI+NV+   FR IG+W N+SGLS  PPE+ Y++P N SS+NQ L 
Sbjct  379   PVQFHRDRSMVQPSYDIINVVDGRFRQIGYWSNHSGLSVVPPESFYNKPSNRSSSNQHLN  438

Query  1130  GVVWPGQSVKKAPGVGFPEQ  1189
              V WPG +     G  FP  
Sbjct  439   SVTWPGGTSVTPRGWVFPNN  458



>gb|AAF21901.1|AF109392_1 ligand gated channel-like protein [Brassica napus]
Length=912

 Score =   460 bits (1184),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 264/406 (65%), Positives = 331/406 (82%), Gaps = 9/406 (2%)
 Frame = +3

Query  1164  PRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFK--GFSVDVFTAAVNLLPYAVPFQ  1337
             PRGWVFPNNGK LRIGVP R S+K+F+S+V G+++ K  G+ +DVF AAV LL Y VP +
Sbjct  450   PRGWVFPNNGKLLRIGVPNRASFKDFVSRVNGSSSHKVQGYCIDVFEAAVKLLSYPVPHE  509

Query  1338  FVPFGNGRENPSYSELVRLVSTGY-FDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPF  1514
             F+ FG+G +NP+Y++LV  V+TG  FD A+GDIAIVT RT++VD+TQPY+ SGL+VVAP 
Sbjct  510   FIFFGDGLQNPNYNDLVNKVATGVDFDAAVGDIAIVTKRTRIVDYTQPYIESGLVVVAPV  569

Query  1515  KKLNTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSL  1694
               LN   WAFL PF+  MW VTA FF+VVG V+WILEHR NDEFRG P++Q+ITILWF+ 
Sbjct  570   TALNENPWAFLRPFTPPMWAVTASFFMVVGAVIWILEHRTNDEFRGPPRRQIITILWFTF  629

Query  1695  STLFFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESLKEG  1874
             ST+FF+HRENT STLGRMVL+IWLFVVLII SSYTASLTS+LTVQQL SPIKGV++L   
Sbjct  630   STMFFSHRENTTSTLGRMVLLIWLFVVLIITSSYTASLTSMLTVQQLNSPIKGVDTLISS  689

Query  1875  NDPIGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERPYVE  2054
             +  IG+Q+GSFAE+Y+I+E+ I++SRL+ALGSP+ YA AL+ G     V+AIVDERPYV+
Sbjct  690   SGRIGFQVGSFAENYMIDELNIARSRLVALGSPQEYATALQNGT----VAAIVDERPYVD  745

Query  2055  NFLSTQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLtrts  2234
              FLS  CKF I GQEFT+ GWGFAFPRDSPLAVDMSTAIL LSE G+LQRIHD+WL++++
Sbjct  746   LFLSDYCKFAIRGQEFTRCGWGFAFPRDSPLAVDMSTAILGLSETGELQRIHDRWLSKSN  805

Query  2235  cssestelesD--RLHLKSFWglfllcgaacflalfIYFVQIMLKF  2366
             CSS       D  +L++ SFWG+FL+CG ACF+ALFI+FV+++  F
Sbjct  806   CSSPHGSQSGDSEQLNVHSFWGMFLVCGIACFVALFIHFVKVVRNF  851


 Score =   407 bits (1045),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 194/380 (51%), Positives = 271/380 (71%), Gaps = 7/380 (2%)
 Frame = +2

Query  56    LVAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTT  235
             ++ AL+FM+TDVVAI+G Q+S++AH +SH+ANEL VP+LSF A DPTL+ LQFP+F++T 
Sbjct  84    IMGALQFMETDVVAIIGLQTSIMAHVLSHLANELTVPMLSFTALDPTLSPLQFPFFVQTA  143

Query  236   QSDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGA  415
              +D++ M AIA++I +YGW +V+ ++ DDD  RNG+ AL D L  +RCKISYKA +P   
Sbjct  144   PNDLFLMRAIAEMITYYGWSDVVVLYNDDDNSRNGVTALGDELEERRCKISYKAVLPLDV  203

Query  416   --TTRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTV  589
               T+ AEI++ L +I  MESR++V++ +P  G M+F  A  LGMM  GYVWI+T WLS++
Sbjct  204   VITSPAEIIEELTKIRGMESRIIVVNTFPNTGKMIFEEAKKLGMMEKGYVWIATTWLSSL  263

Query  590   LDSSSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLTGGSLGLNSYALYAYDSVW  769
             +DS  PL    ++ + GVL LR HTPD   KR F +RWK     ++GLN Y LYAYD+VW
Sbjct  264   VDSDFPL---DLKSLNGVLTLRLHTPDPRKKRDFAARWKK--NKTIGLNVYGLYAYDTVW  318

Query  770   LIAHAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLTG  949
             +IA A+ SFL  GG ++FS+D+KL +++G  L+L ALS FD GP LL+ ++++   GLTG
Sbjct  319   IIAQAVKSFLEAGGNLTFSHDAKLSNLKGEALNLSALSRFDEGPQLLDYIMRTKMSGLTG  378

Query  950   QFKFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKLY  1129
               +F+ D+S+V PSYDI+NV+  GFR IG+W N+SGLS  PPE+ Y++P N SS+NQ L 
Sbjct  379   PVQFHRDRSMVQPSYDIINVVDGGFRQIGYWSNHSGLSVVPPESFYNKPSNRSSSNQHLN  438

Query  1130  GVVWPGQSVKKAPGVGFPEQ  1189
              V WPG +     G  FP  
Sbjct  439   SVTWPGGTSVTPRGWVFPNN  458



>ref|XP_003527492.1| PREDICTED: glutamate receptor 3.4-like isoform X1 [Glycine max]
 ref|XP_006582347.1| PREDICTED: glutamate receptor 3.4-like isoform X2 [Glycine max]
Length=929

 Score =   433 bits (1113),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 246/404 (61%), Positives = 313/404 (77%), Gaps = 3/404 (1%)
 Frame = +3

Query  1164  PRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYAVPFQFV  1343
             PRGWVFPNNG+ LRI VP RVS+K+F+++       +G+ +DVF AA+NLL Y VP Q++
Sbjct  472   PRGWVFPNNGQPLRIAVPNRVSFKDFVAKSKNPQGVQGYCIDVFEAALNLLTYPVPRQYM  531

Query  1344  PFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPFKKL  1523
              FGNG  NPSY+ELV+ V+   FD  +GD+ IVTNRT++VDFTQP++ SGL+VV P ++ 
Sbjct  532   LFGNGERNPSYNELVQQVAQNNFDAVVGDVTIVTNRTRIVDFTQPFMPSGLVVVVPVEEE  591

Query  1524  NTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSLSTL  1703
              +  W+FL PF+ QMW VT  FF+ VG VVWILEHR+N EFRGSP++QLIT+ WFS ST+
Sbjct  592   KSSPWSFLVPFTTQMWLVTGAFFLFVGTVVWILEHRLNPEFRGSPRKQLITVFWFSFSTM  651

Query  1704  FFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESLKEGNDP  1883
             FF+HRENTVS LGR+VLIIWLFVVLIINSSYTASLTSILTVQQL S I G++SL     P
Sbjct  652   FFSHRENTVSGLGRLVLIIWLFVVLIINSSYTASLTSILTVQQLSSQIAGIDSLISSTQP  711

Query  1884  IGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERPYVENFL  2063
             IG Q GSFA  YLI+++ I++SR++ L + E Y +AL +GP  GGV+A+VDE PYVE  +
Sbjct  712   IGIQDGSFARKYLIDDLNIAESRIVTLKNMEDYIDALRRGPKAGGVAAVVDELPYVEVLM  771

Query  2064  ST-QCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLtrtscs  2240
             S+  CKF IVGQEFTKSGWGFAF RDSPLA+D+STAIL LSE+GDLQ+IHDKWL      
Sbjct  772   SSIDCKFTIVGQEFTKSGWGFAFQRDSPLAIDLSTAILQLSESGDLQKIHDKWL--NKKE  829

Query  2241  sestelesDRLHLKSFWglfllcgaacflalfIYFVQIMLKFRR  2372
               + + +S++L L SFWGLFL+CG AC +AL I+F +I  ++ +
Sbjct  830   CSTVDTDSNKLALTSFWGLFLICGIACVIALTIFFARIFCQYNK  873


 Score =   431 bits (1107),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 207/380 (54%), Positives = 275/380 (72%), Gaps = 4/380 (1%)
 Frame = +2

Query  59    VAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTTQ  238
             + AL+ M+ DVVA++GP SS +AH ISHV NEL VPLLSF ATDPTL+SLQ+PYF+RTTQ
Sbjct  102   MEALQLMENDVVAVVGPLSSGIAHVISHVVNELHVPLLSFGATDPTLSSLQYPYFVRTTQ  161

Query  239   SDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGAT  418
             +D +QM AIAD +D+Y WK+VIA++IDDD GRNG++ L DA++ KR KISYKA  PPGA 
Sbjct  162   NDYFQMYAIADFVDYYRWKKVIAIYIDDDNGRNGVSVLGDAMSRKRAKISYKAAFPPGA-  220

Query  419   TRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVLDS  598
             T ++I D+L ++ LMESRV VLH  P  G  +FS+A  L MM  GYVWI+TDWL +VLDS
Sbjct  221   TESDISDLLNEVNLMESRVYVLHVNPDHGLAIFSIAKRLRMMDSGYVWIATDWLPSVLDS  280

Query  599   SSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWK-HLTGGSLGLNSYALYAYDSVWLI  775
                  ++ M+++QGV+    H PD++LK++F SR K      ++  NSYALYAYDSVWL 
Sbjct  281   FDLPDTDTMDLLQGVVAFHHHIPDTDLKKSFLSRLKSQRDNETVSFNSYALYAYDSVWLA  340

Query  776   AHAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLTGQF  955
             A A+D++LN+GG ISFS+D KL+   GS L L +L  FDGGP  L  +L  +F GL+GQ 
Sbjct  341   ARALDAYLNEGGNISFSSDPKLRDTNGSMLQLASLRTFDGGPQFLKTILGMNFTGLSGQV  400

Query  956   KFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSS--ANQKLY  1129
             +F+ +K+LV P+YDILN+ G+G   IG+W N+SGLS   PE LY + P+ +S  +NQ+LY
Sbjct  401   EFDMEKNLVRPAYDILNIGGSGSHRIGYWSNHSGLSVIAPEVLYEKKPSKTSLKSNQQLY  460

Query  1130  GVVWPGQSVKKAPGVGFPEQ  1189
              V+WPG++     G  FP  
Sbjct  461   SVIWPGEATTTPRGWVFPNN  480



>ref|XP_002460792.1| hypothetical protein SORBIDRAFT_02g034960 [Sorghum bicolor]
 gb|EER97313.1| hypothetical protein SORBIDRAFT_02g034960 [Sorghum bicolor]
Length=924

 Score =   462 bits (1189),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 258/409 (63%), Positives = 324/409 (79%), Gaps = 0/409 (0%)
 Frame = +3

Query  1146  GSR*KKPRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYA  1325
             G   +KPRGWVF  +GK +RIGVP+R SYKEF+ Q  G +  KGF+VDVF AA++LLPY 
Sbjct  446   GQTSEKPRGWVFSYHGKPMRIGVPLRTSYKEFVMQDNGPDGVKGFAVDVFKAAISLLPYP  505

Query  1326  VPFQFVPFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVV  1505
             V  +FV FG+G +NPSYSELV+ VS  YFD A+GDIAIVTNRT++VDFTQPY+ SGL++V
Sbjct  506   VSCKFVLFGDGLKNPSYSELVQKVSENYFDAAVGDIAIVTNRTRLVDFTQPYIESGLIIV  565

Query  1506  APFKKLNTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILW  1685
             AP + + + AWAFL PF+ +MW V    F+ VG VVWILEHR N EFRG P+QQ++T+ W
Sbjct  566   APARVVESNAWAFLKPFTFRMWCVLVVIFLFVGAVVWILEHRTNTEFRGPPRQQIMTVCW  625

Query  1686  FSLSTLFFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESL  1865
             FS ST+FFAHRENTVS LGR VL+IWLF VLIINSSYTA+LTS+LTVQ+L S I+G++SL
Sbjct  626   FSFSTMFFAHRENTVSALGRFVLLIWLFAVLIINSSYTANLTSLLTVQELTSGIQGLDSL  685

Query  1866  KEGNDPIGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERP  2045
                +  IGYQ+GSF+ +YL++E+ I++SRL+ L SP  YA ALE G   GGV+AI+DE P
Sbjct  686   ISSSSAIGYQVGSFSRNYLVDELNIAESRLVPLNSPSDYARALELGSGNGGVAAIIDELP  745

Query  2046  YVENFLSTQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLt  2225
             YVE FLS  CKF+ VGQ FTKSGWGFAFPRDSPLA D+STAIL+LSENG+LQRIHD+WL+
Sbjct  746   YVEIFLSKYCKFKTVGQVFTKSGWGFAFPRDSPLAEDLSTAILALSENGNLQRIHDEWLS  805

Query  2226  rtscssestelesDRLHLKSFWglfllcgaacflalfIYFVQIMLKFRR  2372
              T CS+++    S+ L L SFWGLFL+CG AC +AL I+F++I  ++ R
Sbjct  806   ATECSADNNGAASNSLSLSSFWGLFLICGLACLVALVIFFLRIFCQYSR  854


 Score =   402 bits (1032),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 203/371 (55%), Positives = 264/371 (71%), Gaps = 6/371 (2%)
 Frame = +2

Query  59    VAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTTQ  238
             + AL+ +  DVVA+LGPQSS VAH ISH  NEL VPL+SFAATDP L+SL++PYF+R T 
Sbjct  90    IEALQLLAKDVVAVLGPQSSAVAHVISHAVNELHVPLISFAATDPALSSLEYPYFVRATH  149

Query  239   SDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGAT  418
             SD YQM AIA +I  Y WK+VIA+++DDDYGR GI+ L DALA ++CKISYKA +PPGA 
Sbjct  150   SDYYQMGAIAAIISQYQWKQVIAIYVDDDYGRGGISVLGDALAKRKCKISYKAKLPPGA-  208

Query  419   TRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVLDS  598
              +  I DIL+Q+  MESRV V+H  P +G  VF  A  LGMM  GYVWI+TDWLS V+DS
Sbjct  209   AKTSIKDILMQVNDMESRVYVIHVNPDSGLNVFLAAKSLGMMSSGYVWIATDWLSAVIDS  268

Query  599   SSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLTGGSLGLNSYALYAYDSVWLIA  778
             S     + ME+ QGVLVLRQH  DS+++ A  S+W +LT      +SY ++AYDSVWL+A
Sbjct  269   SEHGNPDVMELTQGVLVLRQHIADSDIQHA--SKWNNLTRNG---SSYFMHAYDSVWLVA  323

Query  779   HAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLTGQFK  958
             HA++ FL +G  ISFS D  LQ+ + S L L++L IF+ G  LL  +  ++F G++G  +
Sbjct  324   HAVERFLREGDAISFSADPNLQAKKESNLQLDSLRIFNSGDKLLEKVWSANFSGVSGPVQ  383

Query  959   FNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKLYGVV  1138
             F  D+ LV P+YDILN+ GTG RTIG+W N SGLS   PE+L S   +SS  N +L+ V+
Sbjct  384   FTLDRDLVHPAYDILNIGGTGLRTIGYWSNSSGLSVVAPESLSSSALDSSVNNVELHSVI  443

Query  1139  WPGQSVKKAPG  1171
             WPGQ+ +K  G
Sbjct  444   WPGQTSEKPRG  454



>ref|XP_008455862.1| PREDICTED: glutamate receptor 3.4-like [Cucumis melo]
Length=842

 Score =   442 bits (1136),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 262/419 (63%), Positives = 322/419 (77%), Gaps = 9/419 (2%)
 Frame = +3

Query  1164  PRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYAVPFQFV  1343
             PRGWVFP++GK L+I VP RVSYK F+S+       KG+ +DVF AA+NLLPY VP  ++
Sbjct  377   PRGWVFPHSGKPLQIVVPNRVSYKAFVSKDKNPPGVKGYCIDVFEAAINLLPYPVPHTYI  436

Query  1344  PFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPFKKL  1523
              +G+G++ P YS LV  VS   +D A+GDI IVTNRTK+VDFTQP++ SGL+VV   K+ 
Sbjct  437   LYGDGKDTPEYSNLVYEVSQNKYDAAVGDITIVTNRTKIVDFTQPFMESGLVVVTVVKEE  496

Query  1524  NTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSLSTL  1703
              +  WAFL PF+ QMW VTA FF+ VG VVWILEHR N+EFRG P+QQLITI WFS ST+
Sbjct  497   KSSPWAFLRPFTIQMWAVTAIFFIFVGAVVWILEHRTNEEFRGPPRQQLITIFWFSFSTM  556

Query  1704  FFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESLKEGNDP  1883
             FF+H+ENTVSTLGR+VLIIWLFVVLIINSSYTASLTSILTVQQL S IKG++SL    D 
Sbjct  557   FFSHKENTVSTLGRLVLIIWLFVVLIINSSYTASLTSILTVQQLTSNIKGIDSLISSTDA  616

Query  1884  IGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERPYVENFL  2063
             IG Q GSFA  YLI+++GI+ SR+I L   E YA+AL  G   GGV+AIVDE PYVE FL
Sbjct  617   IGVQEGSFALKYLIDDLGIAASRIIKLKDQEEYADALRHGAEDGGVAAIVDELPYVELFL  676

Query  2064  S-TQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLtrtscs  2240
             + T C +RIVG+EFTKSGWGFAF RDSPLAVD+ST IL LSENGDLQ+IHDKWL+RT CS
Sbjct  677   AGTNCMYRIVGEEFTKSGWGFAFQRDSPLAVDLSTVILQLSENGDLQKIHDKWLSRTECS  736

Query  2241  sestelesDRLHLKSFWglfllcgaacflalfIYFVQIMLKFRR--------VARAEPV  2393
             +   +++ ++L L SFWGLFL+CG ACF+AL ++F +++ ++RR        V   EPV
Sbjct  737   TNLNQVDVNQLSLSSFWGLFLICGIACFVALSVFFFRLLSQYRRFSPETQSEVEEMEPV  795


 Score =   422 bits (1084),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 204/373 (55%), Positives = 267/373 (72%), Gaps = 4/373 (1%)
 Frame = +2

Query  71    KFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTTQSDMY  250
             K M+ +VVA +GPQSS +AH ISHV NEL +PLLSF ATDP L++ Q+ YF+RTTQSD +
Sbjct  13    KLMEDEVVAAIGPQSSGIAHVISHVINELHIPLLSFGATDPALSAQQYQYFVRTTQSDYF  72

Query  251   QMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGATTRAE  430
             QM AIAD++D +GWKEV+A+F+DDD GR+GI+AL DALA KR KISYKA  P G++  + 
Sbjct  73    QMNAIADMVDKFGWKEVVAIFVDDDNGRSGISALSDALAKKRAKISYKAAFPSGSSI-ST  131

Query  431   IMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVLDSSSPL  610
             I D+LV + +MESRV V+H  P  G  VFS+A  L MMG GYVWI+TDWL + LDS    
Sbjct  132   ISDLLVSVNMMESRVYVVHVNPDTGLSVFSIAKKLQMMGSGYVWIATDWLPSFLDSFETN  191

Query  611   PSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLT-GGSLGLNSYALYAYDSVWLIAHAI  787
               + M  +QGV+  R HTPD  LK+ F S+W++L    S   NSYAL+AYDSVWL+A A+
Sbjct  192   SPDVMNQLQGVVAFRHHTPDGNLKKNFISKWRNLKYKKSPNFNSYALHAYDSVWLVARAL  251

Query  788   DSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLTGQFKFNN  967
             D+FL +GG ISFSND KL+   GS   L++  +F+GG  LL  + +++F G++GQ +F +
Sbjct  252   DTFLKEGGNISFSNDPKLRENNGSMFQLKSFKVFNGGEQLLQTIKRTNFTGVSGQIQFGD  311

Query  968   D-KSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKLYGVVWP  1144
             D K L+ P+YDILN+ GTG R IG+W NYSGLST  PE LY++P N +S N  LY V+WP
Sbjct  312   DGKHLIHPAYDILNIGGTGIRRIGYWSNYSGLSTIAPENLYAKPLN-ASPNNHLYSVIWP  370

Query  1145  GQSVKKAPGVGFP  1183
             G++     G  FP
Sbjct  371   GETSTTPRGWVFP  383



>ref|XP_008644922.1| PREDICTED: glutamate receptor 3.4-like isoform X1 [Zea mays]
Length=953

 Score =   444 bits (1142),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 213/380 (56%), Positives = 272/380 (72%), Gaps = 4/380 (1%)
 Frame = +2

Query  59    VAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTTQ  238
             V AL+ M+ +VVA++GPQSS + H ISHV NEL VPLLSFAATDPTL++ ++PYF+RTT 
Sbjct  91    VEALQLMERNVVAVIGPQSSGIGHVISHVVNELHVPLLSFAATDPTLSASEYPYFIRTTI  150

Query  239   SDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGAT  418
             SD +QM A+A ++D+Y WKEV A+F+DDDYGR G++AL DALAAKR +ISYKA IPP + 
Sbjct  151   SDYFQMNAVASIVDYYQWKEVTAIFVDDDYGRGGVSALGDALAAKRARISYKAAIPPNSN  210

Query  419   TRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVLDS  598
             T   I D+L +  +MESRVMV+H  P  G  +FSVA+ L MM  GYVWI TDWL+ VLDS
Sbjct  211   TDV-INDVLFKANMMESRVMVVHVNPDTGTRIFSVANKLQMMATGYVWIVTDWLAAVLDS  269

Query  599   SSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLTGG---SLGLNSYALYAYDSVW  769
             S+    ++M  +QG++VLRQHTP+S  K  F S+W +       + GLNSY  YAYDSVW
Sbjct  270   STSRDRKEMSHIQGLIVLRQHTPESVAKNKFISKWNNAARNRSITSGLNSYGFYAYDSVW  329

Query  770   LIAHAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLTG  949
              IA  +D FLN G  I+FS D  L    GS+LHL  L IFDGG  +L  LL ++F GLTG
Sbjct  330   AIARGVDQFLNNGQQINFSTDPVLHDTNGSSLHLSTLKIFDGGEQMLQQLLLTNFTGLTG  389

Query  950   QFKFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKLY  1129
             + +FN+D++LV P+YDILN+ G+G R IG+W NYSGLS A PE LY +PP++SS  Q+L+
Sbjct  390   RVQFNSDRNLVHPAYDILNIGGSGSRLIGYWSNYSGLSVAAPEILYQKPPDTSSIAQRLH  449

Query  1130  GVVWPGQSVKKAPGVGFPEQ  1189
              VVWPG S     G  FP  
Sbjct  450   NVVWPGDSTTTPKGWVFPNN  469


 Score =   417 bits (1071),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 242/419 (58%), Positives = 308/419 (74%), Gaps = 8/419 (2%)
 Frame = +3

Query  1164  PRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYAVPFQFV  1343
             P+GWVFPNNG+ LR+GVPI+ S+KE ++   G +   G+ +D+F AA+ LLPY VP QF+
Sbjct  461   PKGWVFPNNGQPLRVGVPIKPSFKELVAAGKGPDNVTGYCIDIFNAAIRLLPYPVPCQFI  520

Query  1344  PFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPFKKL  1523
               G+GR+NP+Y +++ +V+    D A+GD AIV NRTK+ +FTQPY+ SGL++VAP K+ 
Sbjct  521   AIGDGRKNPNYDDIISMVAANSLDAAVGDFAIVRNRTKIAEFTQPYIESGLVIVAPVKQA  580

Query  1524  NTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSLSTL  1703
              + AWAFL PF+ +MW VT   F+ VGIVVWILEHR N+EFRGSP++QLITI    LS  
Sbjct  581   TSSAWAFLKPFTLEMWCVTGALFIFVGIVVWILEHRSNEEFRGSPRRQLITIFCV-LSLC  639

Query  1704  FFAHR-------ENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVES  1862
                H        +NTVS LGR VLIIWLFVVLIINSSYTASLTSILTVQQL + I G++S
Sbjct  640   EGKHLDGKLTAGQNTVSALGRFVLIIWLFVVLIINSSYTASLTSILTVQQLATGITGIDS  699

Query  1863  LKEGNDPIGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDER  2042
             L     PIGYQ G F  +YLIEE+ I +SRL+ L + + YA+AL++GP  GGV AIVDE 
Sbjct  700   LISSGLPIGYQAGKFTRNYLIEELNIPESRLVPLNTIQEYADALKRGPKDGGVVAIVDEM  759

Query  2043  PYVENFLSTQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWL  2222
             PYVE FLS  C FRIVGQEFTK GWGFAF RD PLA D+STAIL LSE+G LQRIHD+W 
Sbjct  760   PYVEIFLSYHCNFRIVGQEFTKEGWGFAFKRDFPLAADLSTAILQLSESGQLQRIHDEWF  819

Query  2223  trtscssestelesDRLHLKSFWglfllcgaacflalfIYFVQIMLKFRRVARAEPVAD  2399
             TR SCSS+ +E+ + RL L SFWGLFL+C   C LAL ++F++I  ++ + + +E   +
Sbjct  820   TRPSCSSDDSEVGATRLGLGSFWGLFLVCALICLLALLVFFIRICWQYNKYSNSEAAGE  878



>ref|XP_010109511.1| Glutamate receptor 3.4 [Morus notabilis]
 gb|EXC23115.1| Glutamate receptor 3.4 [Morus notabilis]
Length=939

 Score =   458 bits (1178),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 215/378 (57%), Positives = 282/378 (75%), Gaps = 2/378 (1%)
 Frame = +2

Query  59    VAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTTQ  238
             V +L+ ++ DVVA +GPQSS ++H ISHV NELQVPL+SF +TDPTL++LQ+PYF+RTTQ
Sbjct  119   VESLQLIEKDVVAAIGPQSSGISHVISHVVNELQVPLISFGSTDPTLSALQYPYFVRTTQ  178

Query  239   SDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGAT  418
             SD +QM AIAD+++HYGW+EVIA+F+DDD GRNGI+ L DALA KR KISYKA   P A+
Sbjct  179   SDYFQMYAIADLVEHYGWREVIAIFVDDDNGRNGISVLGDALAKKRAKISYKAAFTPKAS  238

Query  419   TRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVLDS  598
               AEI D+LV + LMESRV V+H  P  G  +FSVA  LGMMG  YVWI+TDWL T LDS
Sbjct  239   N-AEINDLLVGVNLMESRVYVVHVNPDTGLTIFSVAKSLGMMGSSYVWIATDWLPTFLDS  297

Query  599   SSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLTG-GSLGLNSYALYAYDSVWLI  775
                   + M ++QGV+ LR HTPDS+LK+ FTSRW+ L    S   NSYALYAYDS+WL 
Sbjct  298   FQAPDPDTMNLLQGVVALRHHTPDSDLKKQFTSRWEKLQNDSSASFNSYALYAYDSIWLA  357

Query  776   AHAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLTGQF  955
             A A+D FLN+GG +SFS D KL+    S L+L +L IF+GGP  L  +L  +F GL+G+ 
Sbjct  358   ARALDVFLNEGGNLSFSIDPKLRDTNRSALNLASLHIFNGGPQYLRTILGMNFTGLSGRI  417

Query  956   KFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKLYGV  1135
             +F+ DK+LV P+YD+LN+ GTG R +G+W N+SGLS   PE +Y++PPN+S++NQ+LY +
Sbjct  418   QFDYDKNLVNPAYDVLNIGGTGSRRVGYWTNHSGLSIVAPEIVYTKPPNTSASNQQLYSI  477

Query  1136  VWPGQSVKKAPGVGFPEQ  1189
             +WPG+++    G  FP  
Sbjct  478   IWPGETINTPRGWVFPNN  495


 Score =   402 bits (1034),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 243/404 (60%), Positives = 293/404 (73%), Gaps = 23/404 (6%)
 Frame = +3

Query  1164  PRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYAVPFQFV  1343
             PRGWVFPNNGK LRI VP RVSYK F+ +       KGF +DVF AA+ LLPY VP  +V
Sbjct  487   PRGWVFPNNGKPLRIAVPNRVSYKAFVVKDKDPPGVKGFCIDVFEAAIKLLPYPVPRTYV  546

Query  1344  PFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPFKKL  1523
              FG+G+ NP ++E+V  V+   +D A+GDI I TNRTK+VDFTQPY  SGL+VVAP K  
Sbjct  547   LFGDGKRNPEFNEIVYQVAENKYDAAVGDITITTNRTKIVDFTQPYTESGLVVVAPVKVE  606

Query  1524  NTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSLSTL  1703
              +  WAFL PF+  MW VTA FF+ VG VVWILEHRMN EFRG                 
Sbjct  607   KSYPWAFLKPFTLSMWFVTAGFFLFVGAVVWILEHRMNHEFRG-----------------  649

Query  1704  FFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESLKEGNDP  1883
                  ENTVSTLGR VLIIWLFVVLIINSSYTASLTSILTVQQL S I+G++SL   NDP
Sbjct  650   -----ENTVSTLGRFVLIIWLFVVLIINSSYTASLTSILTVQQLTSRIEGIDSLISSNDP  704

Query  1884  IGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERPYVENFL  2063
             IG Q GSFA  Y++ E+ I++SRL+ L + EAY EAL  GP  GGV+AIVDE PY+E F+
Sbjct  705   IGIQEGSFAWKYVVNELNIAESRLVKLKNQEAYGEALRLGPKAGGVAAIVDELPYIELFM  764

Query  2064  -STQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLtrtscs  2240
              ST C++R VGQEFTK+GWGFAF RDSPLAVD+STAIL LSENGDLQ++ +KWL    CS
Sbjct  765   SSTNCQYRTVGQEFTKNGWGFAFQRDSPLAVDLSTAILQLSENGDLQKLRNKWLPTQECS  824

Query  2241  sestelesDRLHLKSFWglfllcgaacflalfIYFVQIMLKFRR  2372
              +  + +++RL L SFWGLFL+ G ACF+AL I+F +I  +F++
Sbjct  825   MQINDEDANRLSLTSFWGLFLISGIACFIALTIFFCRICCQFQK  868



>ref|XP_003540841.1| PREDICTED: glutamate receptor 3.4-like isoform X1 [Glycine max]
 ref|XP_006592377.1| PREDICTED: glutamate receptor 3.4-like isoform X2 [Glycine max]
Length=924

 Score =   438 bits (1126),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 249/404 (62%), Positives = 309/404 (76%), Gaps = 4/404 (1%)
 Frame = +3

Query  1164  PRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYAVPFQFV  1343
             PRGWVFPNNG+ LRI VP RVSY +F+S+       +G+ +DVF AA+ LL Y VP Q++
Sbjct  469   PRGWVFPNNGQPLRIAVPNRVSYTDFVSKSKNPPGVQGYCIDVFEAALKLLNYPVPRQYI  528

Query  1344  PFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPFKKL  1523
              FGNG  NPSY+ELV  V+   FD  +GD+ IVTNRT++VDFTQP++ SGL+VV P +K 
Sbjct  529   LFGNGERNPSYNELVEQVAQNNFDAVVGDVTIVTNRTRIVDFTQPFMPSGLVVVVPVEK-  587

Query  1524  NTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSLSTL  1703
              +  W+FL PF+AQMW VT  FF+ VG VVWILEHR N EFRGSP++QLIT+ WFS ST+
Sbjct  588   KSSPWSFLEPFTAQMWLVTGAFFLFVGTVVWILEHRHNPEFRGSPRKQLITVFWFSFSTM  647

Query  1704  FFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESLKEGNDP  1883
             FF+HRENTVS LGR+VLIIWLFVVLIINSSYTASLTSILTVQQL S I+G++SL     P
Sbjct  648   FFSHRENTVSGLGRLVLIIWLFVVLIINSSYTASLTSILTVQQLSSQIEGIDSLISSTQP  707

Query  1884  IGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERPYVENFL  2063
             IG Q GSFA  YLI+++ I++SR++ L + E Y +AL++GP  GGV A+VDE PY+E  +
Sbjct  708   IGIQDGSFARKYLIDDLNIAESRIVTLKNMEDYIDALQRGPKAGGVVAVVDELPYIEVLM  767

Query  2064  S-TQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLtrtscs  2240
             S T CKF  VGQEFTKSGWGFAF RDSPLAVD+STAIL LSE+GDLQRIHDKWL      
Sbjct  768   SRTDCKFTTVGQEFTKSGWGFAFQRDSPLAVDLSTAILQLSESGDLQRIHDKWL--NKKE  825

Query  2241  sestelesDRLHLKSFWglfllcgaacflalfIYFVQIMLKFRR  2372
               + +  S++L L SFWGLFL+CG AC +AL I+F +I  ++ +
Sbjct  826   CATVDANSNKLALTSFWGLFLICGIACVIALIIFFARIFCQYNK  869


 Score =   421 bits (1082),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 204/380 (54%), Positives = 271/380 (71%), Gaps = 4/380 (1%)
 Frame = +2

Query  59    VAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTTQ  238
             + AL+ M+ DVVA++GP SS +AH ISHV NEL VPLLSF ATDPTL++LQ+PYF+RTTQ
Sbjct  99    MEALQLMENDVVAVVGPVSSGIAHVISHVVNELHVPLLSFGATDPTLSALQYPYFVRTTQ  158

Query  239   SDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGAT  418
             +D +QM AIAD +D+Y WK+VIA+++DDD GRNG++ L DA++ KR KISYKA  PP A 
Sbjct  159   NDYFQMYAIADFVDYYRWKKVIAIYVDDDNGRNGVSVLGDAMSKKRAKISYKAAFPPEA-  217

Query  419   TRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVLDS  598
               ++I D+L ++ LMESRV VLH  P  G  +FS+A  L MM  GYVWI+TDWL +VLDS
Sbjct  218   KESDISDLLNEVNLMESRVYVLHVNPDHGLAIFSIAKRLRMMDSGYVWIATDWLPSVLDS  277

Query  599   SSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWK-HLTGGSLGLNSYALYAYDSVWLI  775
                  ++ M+++QGV+  R H PD++LK++F SR K      ++  NSYALYAYDSVWL 
Sbjct  278   LDSPDTDTMDLLQGVVAFRHHIPDTDLKKSFLSRLKSQRDNETVSFNSYALYAYDSVWLA  337

Query  776   AHAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLTGQF  955
             A A+D++LN+GG +SFS+D KL+   GS L L +L  FDGGP  L  +L  +F GL+GQ 
Sbjct  338   ARALDAYLNEGGNVSFSSDPKLRDTNGSMLQLASLRTFDGGPQFLKTILGMNFTGLSGQV  397

Query  956   KFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYS--RPPNSSSANQKLY  1129
             +F+ DK+LV P+YDILN+ G+G R IG+W N+SGLS   PE LY       S  +NQ+LY
Sbjct  398   EFDMDKNLVHPAYDILNIGGSGSRRIGYWSNHSGLSVIAPEVLYEKKSSKTSLKSNQELY  457

Query  1130  GVVWPGQSVKKAPGVGFPEQ  1189
              V+WPG++     G  FP  
Sbjct  458   SVIWPGEATTTPRGWVFPNN  477



>ref|XP_006582348.1| PREDICTED: glutamate receptor 3.4-like isoform X3 [Glycine max]
Length=822

 Score =   433 bits (1113),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 246/404 (61%), Positives = 313/404 (77%), Gaps = 3/404 (1%)
 Frame = +3

Query  1164  PRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYAVPFQFV  1343
             PRGWVFPNNG+ LRI VP RVS+K+F+++       +G+ +DVF AA+NLL Y VP Q++
Sbjct  365   PRGWVFPNNGQPLRIAVPNRVSFKDFVAKSKNPQGVQGYCIDVFEAALNLLTYPVPRQYM  424

Query  1344  PFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPFKKL  1523
              FGNG  NPSY+ELV+ V+   FD  +GD+ IVTNRT++VDFTQP++ SGL+VV P ++ 
Sbjct  425   LFGNGERNPSYNELVQQVAQNNFDAVVGDVTIVTNRTRIVDFTQPFMPSGLVVVVPVEEE  484

Query  1524  NTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSLSTL  1703
              +  W+FL PF+ QMW VT  FF+ VG VVWILEHR+N EFRGSP++QLIT+ WFS ST+
Sbjct  485   KSSPWSFLVPFTTQMWLVTGAFFLFVGTVVWILEHRLNPEFRGSPRKQLITVFWFSFSTM  544

Query  1704  FFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESLKEGNDP  1883
             FF+HRENTVS LGR+VLIIWLFVVLIINSSYTASLTSILTVQQL S I G++SL     P
Sbjct  545   FFSHRENTVSGLGRLVLIIWLFVVLIINSSYTASLTSILTVQQLSSQIAGIDSLISSTQP  604

Query  1884  IGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERPYVENFL  2063
             IG Q GSFA  YLI+++ I++SR++ L + E Y +AL +GP  GGV+A+VDE PYVE  +
Sbjct  605   IGIQDGSFARKYLIDDLNIAESRIVTLKNMEDYIDALRRGPKAGGVAAVVDELPYVEVLM  664

Query  2064  ST-QCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLtrtscs  2240
             S+  CKF IVGQEFTKSGWGFAF RDSPLA+D+STAIL LSE+GDLQ+IHDKWL      
Sbjct  665   SSIDCKFTIVGQEFTKSGWGFAFQRDSPLAIDLSTAILQLSESGDLQKIHDKWL--NKKE  722

Query  2241  sestelesDRLHLKSFWglfllcgaacflalfIYFVQIMLKFRR  2372
               + + +S++L L SFWGLFL+CG AC +AL I+F +I  ++ +
Sbjct  723   CSTVDTDSNKLALTSFWGLFLICGIACVIALTIFFARIFCQYNK  766


 Score =   426 bits (1095),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 205/374 (55%), Positives = 271/374 (72%), Gaps = 4/374 (1%)
 Frame = +2

Query  77    MQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTTQSDMYQM  256
             M+ DVVA++GP SS +AH ISHV NEL VPLLSF ATDPTL+SLQ+PYF+RTTQ+D +QM
Sbjct  1     MENDVVAVVGPLSSGIAHVISHVVNELHVPLLSFGATDPTLSSLQYPYFVRTTQNDYFQM  60

Query  257   MAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGATTRAEIM  436
              AIAD +D+Y WK+VIA++IDDD GRNG++ L DA++ KR KISYKA  PPGA T ++I 
Sbjct  61    YAIADFVDYYRWKKVIAIYIDDDNGRNGVSVLGDAMSRKRAKISYKAAFPPGA-TESDIS  119

Query  437   DILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVLDSSSPLPS  616
             D+L ++ LMESRV VLH  P  G  +FS+A  L MM  GYVWI+TDWL +VLDS     +
Sbjct  120   DLLNEVNLMESRVYVLHVNPDHGLAIFSIAKRLRMMDSGYVWIATDWLPSVLDSFDLPDT  179

Query  617   EKMEIMQGVLVLRQHTPDSELKRAFTSRWK-HLTGGSLGLNSYALYAYDSVWLIAHAIDS  793
             + M+++QGV+    H PD++LK++F SR K      ++  NSYALYAYDSVWL A A+D+
Sbjct  180   DTMDLLQGVVAFHHHIPDTDLKKSFLSRLKSQRDNETVSFNSYALYAYDSVWLAARALDA  239

Query  794   FLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLTGQFKFNNDK  973
             +LN+GG ISFS+D KL+   GS L L +L  FDGGP  L  +L  +F GL+GQ +F+ +K
Sbjct  240   YLNEGGNISFSSDPKLRDTNGSMLQLASLRTFDGGPQFLKTILGMNFTGLSGQVEFDMEK  299

Query  974   SLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSS--ANQKLYGVVWPG  1147
             +LV P+YDILN+ G+G   IG+W N+SGLS   PE LY + P+ +S  +NQ+LY V+WPG
Sbjct  300   NLVRPAYDILNIGGSGSHRIGYWSNHSGLSVIAPEVLYEKKPSKTSLKSNQQLYSVIWPG  359

Query  1148  QSVKKAPGVGFPEQ  1189
             ++     G  FP  
Sbjct  360   EATTTPRGWVFPNN  373



>gb|KHN41219.1| Glutamate receptor 3.4 [Glycine soja]
Length=1073

 Score =   433 bits (1114),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 246/404 (61%), Positives = 313/404 (77%), Gaps = 3/404 (1%)
 Frame = +3

Query  1164  PRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYAVPFQFV  1343
             PRGWVFPNNG+ LRI VP RVS+K+F+++       +G+ +DVF AA+NLL Y VP Q++
Sbjct  472   PRGWVFPNNGQPLRIAVPNRVSFKDFVAKSKNPQGVQGYCIDVFEAALNLLTYPVPRQYM  531

Query  1344  PFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPFKKL  1523
              FGNG  NPSY+ELV+ V+   FD  +GD+ IVTNRT++VDFTQP++ SGL+VV P ++ 
Sbjct  532   LFGNGERNPSYNELVQQVAQNNFDAVVGDVTIVTNRTRIVDFTQPFMPSGLVVVVPVEEE  591

Query  1524  NTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSLSTL  1703
              +  W+FL PF+ QMW VT  FF+ VG VVWILEHR+N EFRGSP++QLIT+ WFS ST+
Sbjct  592   KSSPWSFLVPFTTQMWLVTGAFFLFVGTVVWILEHRLNPEFRGSPRKQLITVFWFSFSTM  651

Query  1704  FFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESLKEGNDP  1883
             FF+HRENTVS LGR+VLIIWLFVVLIINSSYTASLTSILTVQQL S I G++SL     P
Sbjct  652   FFSHRENTVSGLGRLVLIIWLFVVLIINSSYTASLTSILTVQQLSSQIAGIDSLISSTQP  711

Query  1884  IGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERPYVENFL  2063
             IG Q GSFA  YLI+++ I++SR++ L + E Y +AL +GP  GGV+A+VDE PYVE  +
Sbjct  712   IGIQDGSFARKYLIDDLNIAESRIVTLKNMEDYIDALRRGPKAGGVAAVVDELPYVEVLM  771

Query  2064  ST-QCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLtrtscs  2240
             S+  CKF IVGQEFTKSGWGFAF RDSPLA+D+STAIL LSE+GDLQ+IHDKWL      
Sbjct  772   SSIDCKFTIVGQEFTKSGWGFAFQRDSPLAIDLSTAILQLSESGDLQKIHDKWL--NKKE  829

Query  2241  sestelesDRLHLKSFWglfllcgaacflalfIYFVQIMLKFRR  2372
               + + +S++L L SFWGLFL+CG AC +AL I+F +I  ++ +
Sbjct  830   CSTVDTDSNKLALTSFWGLFLICGIACVIALTIFFARIFCQYNK  873


 Score =   425 bits (1093),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 205/380 (54%), Positives = 273/380 (72%), Gaps = 4/380 (1%)
 Frame = +2

Query  59    VAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTTQ  238
             + AL+ M+ DVVA++GP SS +AH ISHV NEL VPLLSF ATDPTL+SLQ+PYF+RTTQ
Sbjct  102   MEALQLMENDVVAVVGPLSSGIAHVISHVVNELHVPLLSFGATDPTLSSLQYPYFVRTTQ  161

Query  239   SDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGAT  418
             +D +QM AIAD +D+Y WK+VIA++IDDD GRNG++ L DA++ KR KISYKA  PP A 
Sbjct  162   NDYFQMYAIADFVDYYRWKKVIAIYIDDDNGRNGVSVLGDAMSRKRAKISYKAAFPPEA-  220

Query  419   TRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVLDS  598
               ++I D+L ++ LMESRV VLH  P  G  +FS+A  L MM  GYVWI+TDWL +VLDS
Sbjct  221   KESDISDLLNEVNLMESRVYVLHVNPDHGLAIFSIAKRLRMMDSGYVWIATDWLPSVLDS  280

Query  599   SSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWK-HLTGGSLGLNSYALYAYDSVWLI  775
                  ++ M+++QGV+    H PD++LK++F SR K      ++  NSYALYAYDSVWL 
Sbjct  281   FDLPDTDTMDLLQGVVAFHHHIPDTDLKKSFLSRLKSQRDNETVSFNSYALYAYDSVWLA  340

Query  776   AHAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLTGQF  955
             A A+D++LN+GG ISFS+D KL+   GS L L +L  FDGGP  L  +L  +F GL+GQ 
Sbjct  341   ARALDAYLNEGGNISFSSDPKLRDTNGSMLQLASLRTFDGGPQFLKTILGMNFTGLSGQV  400

Query  956   KFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSS--ANQKLY  1129
             +F+ +K+LV P+YDILN+ G+G   IG+W N+SGLS   PE LY + P+ +S  +NQ+LY
Sbjct  401   EFDMEKNLVRPAYDILNIGGSGSHRIGYWSNHSGLSVIAPEVLYEKKPSKTSLKSNQQLY  460

Query  1130  GVVWPGQSVKKAPGVGFPEQ  1189
              V+WPG++     G  FP  
Sbjct  461   SVIWPGEATTTPRGWVFPNN  480



>ref|XP_007156250.1| hypothetical protein PHAVU_003G270600g [Phaseolus vulgaris]
 gb|ESW28244.1| hypothetical protein PHAVU_003G270600g [Phaseolus vulgaris]
Length=819

 Score =   439 bits (1130),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 231/365 (63%), Positives = 286/365 (78%), Gaps = 13/365 (4%)
 Frame = +3

Query  1146  GSR*KKPRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTN------TFKGFSVDVFTAAV  1307
             G   + PRGW+F N G+ LRIGVP+R+SY+EF+S+  GT        F G+ +DVFTAA+
Sbjct  449   GQTTQTPRGWIFSNTGRNLRIGVPLRISYREFVSRTEGTEGTEGNEMFGGYCIDVFTAAL  508

Query  1308  NLLPYAVPFQFVPFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVA  1487
             +L+PY VP+ FVP+G+G+ NPS S+L+ L++ G FD  +GDI I TNRTK+VDFTQPYV 
Sbjct  509   HLVPYPVPYTFVPYGDGKTNPSNSKLLNLITIGEFDAVVGDITITTNRTKIVDFTQPYVE  568

Query  1488  SGLLVVAPFKKLNTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQ  1667
             SGL+VVAP +K+ + AWAFL PF+  MW VT  FF+VVG VVWILE R+ND+FRG  ++ 
Sbjct  569   SGLVVVAPIRKMKSSAWAFLRPFTPMMWFVTGMFFLVVGAVVWILERRLNDDFRGPARR-  627

Query  1668  LITILWFSLSTLFFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPI  1847
                   FS STLFF+HRE TVSTLGR+VLIIWLFVVLI+NSSY ASLTSILTV+QL S +
Sbjct  628   ------FSFSTLFFSHREKTVSTLGRLVLIIWLFVVLILNSSYIASLTSILTVEQLSSSV  681

Query  1848  KGVESLKEGNDPIGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSA  2027
             KG+ESL   +D IG+  GSFAE+YL EE+ I +SRL+ L SP  Y +AL+ GP  GGV+A
Sbjct  682   KGIESLATSDDRIGFPSGSFAENYLTEELNIHRSRLVPLNSPSEYEKALKDGPANGGVTA  741

Query  2028  IVDERPYVENFLSTQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRI  2207
             I+DER Y+E FL+T+C++ IVGQEFTK GWGFAFPRDSPLA+DMSTAIL LSENG LQRI
Sbjct  742   IIDERAYMELFLATRCEYSIVGQEFTKMGWGFAFPRDSPLAIDMSTAILKLSENGGLQRI  801

Query  2208  HDKWL  2222
             HDKWL
Sbjct  802   HDKWL  806


 Score =   418 bits (1074),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 201/379 (53%), Positives = 269/379 (71%), Gaps = 14/379 (4%)
 Frame = +2

Query  56    LVAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTT  235
             +V +L+ M+ D VAI+GPQ SV+AH ISH+ANE+QVPLLSFAATDPTL SLQFPYF+RTT
Sbjct  86    IVDSLRLMENDTVAIIGPQFSVMAHVISHIANEMQVPLLSFAATDPTLTSLQFPYFVRTT  145

Query  236   QSDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGA  415
             QSD+YQM A+A+++DH+ W++VIA++IDDD+GRNG++AL D LA KR KIS+KA   PG 
Sbjct  146   QSDLYQMTAVAEIVDHFQWRDVIAIYIDDDHGRNGVSALGDKLAEKRGKISHKAPFKPGN  205

Query  416   TTRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVLD  595
              TR EI + LV+I LMES V+VLH YP+ G  V +VA  LGMM  GYVWI+TDWLST+LD
Sbjct  206   ITREEINNALVKIGLMESTVIVLHIYPSFGLDVLNVARSLGMMESGYVWIATDWLSTLLD  265

Query  596   SSSPL-PSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLTG------GSLGLNSYALYA  754
             S+  L  ++ M  +QGV+ LR +TP+SE+KR F+S W  L+       G   LN++  YA
Sbjct  266   SNPSLFTTQSMNDIQGVITLRMYTPESEIKRKFSSSWNKLSKQKDPVEGPFALNTFGFYA  325

Query  755   YDSVWLIAHAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDF  934
             YD+VW++A A+D+F   GG +SFSNDS L  + G +LHL+ + +F  G  LL  +L+ + 
Sbjct  326   YDTVWVLASALDAFFRSGGTLSFSNDSSLNMLRGDSLHLDTMGVFLHGGKLLQQILEVNR  385

Query  935   VGLTGQFKFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSA  1114
              GLTGQ  F  D +LV  SY+++NVIG+G R IG+W   SGL T           N S +
Sbjct  386   TGLTGQMMFGEDGNLVHSSYEVINVIGSGIRRIGYWSETSGLHTG-------EATNHSIS  438

Query  1115  NQKLYGVVWPGQSVKKAPG  1171
             ++ LY V+WPGQ+ +   G
Sbjct  439   SEGLYSVIWPGQTTQTPRG  457



>ref|XP_010237634.1| PREDICTED: glutamate receptor 3.4-like isoform X2 [Brachypodium 
distachyon]
Length=895

 Score =   433 bits (1114),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 245/405 (60%), Positives = 299/405 (74%), Gaps = 30/405 (7%)
 Frame = +3

Query  1158  KKPRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYAVPFQ  1337
             +KPRGW FP +GK LRIGVP+R SYKEF+ Q  G +  KGFSVDVF +AV+LLPY V F 
Sbjct  459   EKPRGWAFPYHGKPLRIGVPLRTSYKEFVMQDNGPDGVKGFSVDVFKSAVSLLPYPVAFN  518

Query  1338  FVPFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPFK  1517
             FV FG+G +NPSYS+LV+ VS  YFD AIGDI IVTNRT++VDFTQPY  SGLL      
Sbjct  519   FVLFGDGLKNPSYSDLVQKVSENYFDAAIGDITIVTNRTRLVDFTQPYTESGLLF-----  573

Query  1518  KLNTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSLS  1697
              L  GA                        VVWILEHR N EFRG+P+QQ++T+ WFS S
Sbjct  574   -LFVGA------------------------VVWILEHRTNTEFRGTPRQQIMTVCWFSFS  608

Query  1698  TLFFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESLKEGN  1877
             T+FFAHRENT S LGR VL++WLFVVLI+NSSYTASLTS+LTVQ+L S +KG++SL   +
Sbjct  609   TMFFAHRENTSSALGRFVLLVWLFVVLIVNSSYTASLTSLLTVQELTSGVKGLDSLISSS  668

Query  1878  DPIGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERPYVEN  2057
              PIGYQ+GSFA +YL++E+ I+ SRL+ L SP  YA ALE G   GGV+AI+DE PYVE 
Sbjct  669   SPIGYQVGSFARNYLVDELNIADSRLVPLNSPSDYARALELGSGNGGVAAIIDELPYVEI  728

Query  2058  FLSTQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLtrtsc  2237
             FLS  CKF+ VGQ FTK GWGFAFPRDSPLA D+STAIL+LSENG+LQRIHD+WL+   C
Sbjct  729   FLSKYCKFKTVGQVFTKGGWGFAFPRDSPLAEDLSTAILALSENGNLQRIHDEWLSGEGC  788

Query  2238  ssestelesDRLHLKSFWglfllcgaacflalfIYFVQIMLKFRR  2372
             S++  E+ S+ L L SFWGLF++CG  C +AL I+F +I  ++ R
Sbjct  789   STDDIEIASNSLSLSSFWGLFVICGLTCAIALLIFFWRIFFQYSR  833


 Score =   423 bits (1088),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 198/377 (53%), Positives = 275/377 (73%), Gaps = 3/377 (1%)
 Frame = +2

Query  59    VAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTTQ  238
             + AL+ +  DV+A+LGPQSS +AH ISH  NEL VPL+SFAA+DPTL+SL++PYF+RTT 
Sbjct  92    IEALQLLAKDVIAVLGPQSSTIAHVISHAVNELHVPLISFAASDPTLSSLEYPYFVRTTL  151

Query  239   SDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGAT  418
             SD YQM A+A +I  Y W+EVIA+++DDDYGR GI AL DALA ++ KI+YKA +PPGA 
Sbjct  152   SDYYQMAAVASIISQYQWREVIAIYVDDDYGRGGITALGDALAKRKSKIAYKAKLPPGA-  210

Query  419   TRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVLDS  598
              R+ I DIL+++  MESRV V+H  P +G  VFS A  LGMM +GYVWI+TDWLS V+DS
Sbjct  211   GRSTIQDILMRVNEMESRVYVVHVNPDSGLAVFSAAKSLGMMSNGYVWIATDWLSAVIDS  270

Query  599   SSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLT--GGSLGLNSYALYAYDSVWL  772
             S     + ME  QGV++L+QH  DS+++ +   +  + T  G    ++SY ++AYDSVWL
Sbjct  271   SRHDNPDAMEHTQGVIMLQQHVADSDIQHSLLRKLNNQTREGNRSSVSSYTVHAYDSVWL  330

Query  773   IAHAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLTGQ  952
             +A AI+ FL++G  +SFS +  LQ ++ S+L L++L  F+ G  LL  + +++F G++GQ
Sbjct  331   VARAIEQFLSEGNAVSFSANQNLQPVKRSSLQLDSLRRFNNGDKLLEKVWRANFTGVSGQ  390

Query  953   FKFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKLYG  1132
              +F  D++L+ P+YDILN+ GTGFRTIG+W N+SGLS   PE L+S PPNSS+ N +L  
Sbjct  391   VQFTLDRNLIHPAYDILNIGGTGFRTIGYWSNFSGLSVVAPENLHSAPPNSSTNNIQLRS  450

Query  1133  VVWPGQSVKKAPGVGFP  1183
             V+WPGQ+ +K  G  FP
Sbjct  451   VIWPGQTAEKPRGWAFP  467



>gb|KHN21237.1| Glutamate receptor 3.4 [Glycine soja]
Length=946

 Score =   432 bits (1110),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 247/404 (61%), Positives = 308/404 (76%), Gaps = 3/404 (1%)
 Frame = +3

Query  1164  PRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYAVPFQFV  1343
             PRGWVFPNNG+ LRI VP RVSY +F+S+       +G+ +DVF AA+ LL Y VP Q++
Sbjct  490   PRGWVFPNNGQPLRIAVPNRVSYTDFVSKSKNPPGVQGYCIDVFEAALKLLNYPVPRQYI  549

Query  1344  PFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPFKKL  1523
              FGNG  NPSY+ELV  V+   FD  +GD+ IVTNRT++VDFTQP++ SGL+VV P ++ 
Sbjct  550   LFGNGERNPSYNELVEQVAQNNFDAVVGDVTIVTNRTRIVDFTQPFMPSGLVVVVPVEEK  609

Query  1524  NTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSLSTL  1703
              +  W+FL PF+AQMW VT  FF+ VG  VWILEHR N EFRGSP++QLIT+ WFS ST+
Sbjct  610   KSSPWSFLEPFTAQMWLVTGAFFLFVGTAVWILEHRHNPEFRGSPRKQLITVFWFSFSTM  669

Query  1704  FFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESLKEGNDP  1883
             FF+HRENTVS LGR+VLIIWLFVVLIINSSYTASLTSILTVQQL S I+G++SL     P
Sbjct  670   FFSHRENTVSGLGRLVLIIWLFVVLIINSSYTASLTSILTVQQLSSQIEGIDSLISSTQP  729

Query  1884  IGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERPYVENFL  2063
             IG Q GSFA  YLI+++ I++SR++ L + E Y +AL++GP  GGV A+VDE PY+E  +
Sbjct  730   IGIQDGSFARKYLIDDLNIAESRIVTLKNMEDYIDALQRGPKAGGVVAVVDELPYIEVLM  789

Query  2064  S-TQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLtrtscs  2240
             S T CKF  VGQEFTKSGWGFAF RDSPLAVD+STAIL LSE+GDLQRIHDKWL      
Sbjct  790   SRTDCKFTTVGQEFTKSGWGFAFQRDSPLAVDLSTAILQLSESGDLQRIHDKWL--NKKE  847

Query  2241  sestelesDRLHLKSFWglfllcgaacflalfIYFVQIMLKFRR  2372
               + +  S++L L SFWGLFL+CG AC +AL I+F +I  ++ +
Sbjct  848   CATVDANSNKLALTSFWGLFLICGIACVIALIIFFARIFCQYNK  891


 Score =   422 bits (1086),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 207/391 (53%), Positives = 275/391 (70%), Gaps = 4/391 (1%)
 Frame = +2

Query  26    TKFRFVDKILLVAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLAS  205
             +K  F    L + AL+ M+ DVVA++GP SS +AH ISHV NEL VPLLSF ATDPTL++
Sbjct  109   SKLEFHLGHLHIEALQLMENDVVAVVGPVSSGIAHVISHVVNELHVPLLSFGATDPTLSA  168

Query  206   LQFPYFLRTTQSDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKI  385
             LQ+PYF+RTTQ+D +QM AIAD +D+Y WK+VIA+++DDD GRNG++ L DA++ KR KI
Sbjct  169   LQYPYFVRTTQNDYFQMYAIADFVDYYRWKKVIAIYVDDDNGRNGVSVLGDAMSKKRAKI  228

Query  386   SYKAGIPPGATTRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWI  565
             SYKA  PP A   ++I D+L ++ LMESRV VLH  P  G  +FS+A  L MM  GYVWI
Sbjct  229   SYKAAFPPEA-KESDISDLLNEVNLMESRVYVLHVNPDHGLAIFSIAKRLRMMDSGYVWI  287

Query  566   STDWLSTVLDSSSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWK-HLTGGSLGLNSY  742
             +TDWL +VLDS     ++ M+++QGV+  R H PD++LK++F SR K      ++  NSY
Sbjct  288   ATDWLPSVLDSLDSPDTDTMDLLQGVVAFRHHIPDTDLKKSFLSRLKSQRDNETVSFNSY  347

Query  743   ALYAYDSVWLIAHAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLL  922
             ALYAYDSVWL A A+D++LN+GG +SFS+D KL+   GS L L +L  FDGGP  L  +L
Sbjct  348   ALYAYDSVWLAARALDAYLNEGGNVSFSSDPKLRDTNGSMLQLASLRTFDGGPQFLKTIL  407

Query  923   QSDFVGLTGQFKFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYS--RP  1096
               +F GL+GQ +F+ DK+LV P+YDILN+ G+G R IG+W N+SGLS   PE LY     
Sbjct  408   GMNFTGLSGQVEFDMDKNLVHPAYDILNIGGSGSRRIGYWSNHSGLSVIAPEVLYEKKSS  467

Query  1097  PNSSSANQKLYGVVWPGQSVKKAPGVGFPEQ  1189
               S  +NQ+LY V+WPG++     G  FP  
Sbjct  468   KTSLKSNQELYSVIWPGEATTTPRGWVFPNN  498



>ref|XP_010515365.1| PREDICTED: glutamate receptor 3.1 [Camelina sativa]
Length=881

 Score =   456 bits (1174),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 259/407 (64%), Positives = 325/407 (80%), Gaps = 8/407 (2%)
 Frame = +3

Query  1164  PRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGT-NTFKGFSVDVFTAAVNLLPYAVPFQF  1340
             PRGWVF NNG++LRIGVP R S+K+F+S+V G+ N  +G+ +DVF AAV LL Y VP +F
Sbjct  415   PRGWVFRNNGRRLRIGVPDRASFKDFVSRVNGSSNEVQGYCIDVFEAAVKLLSYPVPHEF  474

Query  1341  VPFGNGRENPSYSELVRLVSTGY-FDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPFK  1517
             + FG+G  NP+Y+ELV+ V+TG  FD  +GDIAIVT RTK+VD+TQPY+ SGL+VVAP  
Sbjct  475   IFFGDGLTNPNYNELVKKVTTGVDFDAVVGDIAIVTRRTKIVDYTQPYIESGLVVVAPVT  534

Query  1518  KLNTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSLS  1697
             +LN   WAFL PF+  MWGVTA FFV+VG  +WILEHR+NDEFRG P++Q+ITILWF+ S
Sbjct  535   RLNENPWAFLRPFTLPMWGVTASFFVIVGAAIWILEHRINDEFRGPPRRQIITILWFTFS  594

Query  1698  TLFFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESLKEGN  1877
             T+FF+HRE TVSTLGRMVL+IWLFVVLII SSYTASLTSILTVQQL SPIKGV++L   +
Sbjct  595   TMFFSHRETTVSTLGRMVLLIWLFVVLIITSSYTASLTSILTVQQLNSPIKGVDTLISSS  654

Query  1878  DPIGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERPYVEN  2057
               IG+Q+GSFAE+Y+ EE+ I++SRL+ L SPE YA AL+ G     V+AIVDERPYV+ 
Sbjct  655   GRIGFQVGSFAENYMTEELNIARSRLVPLASPEEYANALQNGT----VAAIVDERPYVDL  710

Query  2058  FLSTQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLtrtsc  2237
             FLS  CKF I GQEFT+ GWGFAFPRDSPLAVDMSTAIL LSE G+LQ+IHD+WL++++C
Sbjct  711   FLSDYCKFAIRGQEFTRCGWGFAFPRDSPLAVDMSTAILGLSETGELQKIHDRWLSKSNC  770

Query  2238  ssestelesD--RLHLKSFWglfllcgaacflalfIYFVQIMLKFRR  2372
             SS       D  +L++ SFWG+FL+ G  C +ALFI+F +I+  F +
Sbjct  771   SSPHGSQSGDSEQLNVHSFWGMFLVVGIVCLVALFIHFFKIIHDFCK  817


 Score =   397 bits (1021),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 189/369 (51%), Positives = 263/369 (71%), Gaps = 8/369 (2%)
 Frame = +2

Query  56    LVAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTT  235
             ++ AL+FM+TD VAI+GPQ+S++AH +SH+ANEL VP+LSF A DPTL+ LQFPYF++T 
Sbjct  44    IMGALQFMETDAVAIIGPQTSIMAHVLSHLANELTVPMLSFTALDPTLSPLQFPYFVQTA  103

Query  236   QSDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGA  415
              SD++ M A+AD+I +YGW +V+A++ DDD  RNG+ AL D L  +RC+ISYKA +P   
Sbjct  104   PSDLFLMRAVADMITYYGWSDVVALYNDDDNSRNGVTALGDELEERRCRISYKAVLPLDV  163

Query  416   --TTRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTV  589
               ++  EI++ L++I  MESRV+V++ +P  G M+F  A  LGMM  GYVWI+T WL+++
Sbjct  164   VISSPVEIIEELIKIRGMESRVIVVNTFPNTGNMIFKEAERLGMMEKGYVWIATTWLTSL  223

Query  590   LDSSSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHL---TGGSLGLNSYALYAYD  760
             LDS  PL +    +  GVL LR HTPDS  KR F +RWK+       ++GLN Y LYAYD
Sbjct  224   LDSKYPLDNR---LFNGVLTLRLHTPDSRKKRDFAARWKNKLSNNNKTIGLNVYGLYAYD  280

Query  761   SVWLIAHAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVG  940
             +VW+IA A+ + L  GG ++FSN + L S++G  L+L ALS FD G LLL+ ++ +   G
Sbjct  281   TVWIIARAVKALLEAGGNLTFSNHANLGSLKGEALNLSALSKFDQGSLLLDYIVHTKMSG  340

Query  941   LTGQFKFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQ  1120
             LTG  +F+ D+S++ PSYDI+N++  G   IG+W NYSGLS  PPE+ YS+ PN SS+NQ
Sbjct  341   LTGPVQFHLDRSMLHPSYDIINLVDHGVHQIGYWSNYSGLSIVPPESFYSKSPNRSSSNQ  400

Query  1121  KLYGVVWPG  1147
              L  V WPG
Sbjct  401   HLNSVTWPG  409



>ref|XP_006592378.1| PREDICTED: glutamate receptor 3.4-like isoform X3 [Glycine max]
Length=820

 Score =   437 bits (1124),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 249/404 (62%), Positives = 309/404 (76%), Gaps = 4/404 (1%)
 Frame = +3

Query  1164  PRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYAVPFQFV  1343
             PRGWVFPNNG+ LRI VP RVSY +F+S+       +G+ +DVF AA+ LL Y VP Q++
Sbjct  365   PRGWVFPNNGQPLRIAVPNRVSYTDFVSKSKNPPGVQGYCIDVFEAALKLLNYPVPRQYI  424

Query  1344  PFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPFKKL  1523
              FGNG  NPSY+ELV  V+   FD  +GD+ IVTNRT++VDFTQP++ SGL+VV P +K 
Sbjct  425   LFGNGERNPSYNELVEQVAQNNFDAVVGDVTIVTNRTRIVDFTQPFMPSGLVVVVPVEK-  483

Query  1524  NTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSLSTL  1703
              +  W+FL PF+AQMW VT  FF+ VG VVWILEHR N EFRGSP++QLIT+ WFS ST+
Sbjct  484   KSSPWSFLEPFTAQMWLVTGAFFLFVGTVVWILEHRHNPEFRGSPRKQLITVFWFSFSTM  543

Query  1704  FFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESLKEGNDP  1883
             FF+HRENTVS LGR+VLIIWLFVVLIINSSYTASLTSILTVQQL S I+G++SL     P
Sbjct  544   FFSHRENTVSGLGRLVLIIWLFVVLIINSSYTASLTSILTVQQLSSQIEGIDSLISSTQP  603

Query  1884  IGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERPYVENFL  2063
             IG Q GSFA  YLI+++ I++SR++ L + E Y +AL++GP  GGV A+VDE PY+E  +
Sbjct  604   IGIQDGSFARKYLIDDLNIAESRIVTLKNMEDYIDALQRGPKAGGVVAVVDELPYIEVLM  663

Query  2064  S-TQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLtrtscs  2240
             S T CKF  VGQEFTKSGWGFAF RDSPLAVD+STAIL LSE+GDLQRIHDKWL      
Sbjct  664   SRTDCKFTTVGQEFTKSGWGFAFQRDSPLAVDLSTAILQLSESGDLQRIHDKWL--NKKE  721

Query  2241  sestelesDRLHLKSFWglfllcgaacflalfIYFVQIMLKFRR  2372
               + +  S++L L SFWGLFL+CG AC +AL I+F +I  ++ +
Sbjct  722   CATVDANSNKLALTSFWGLFLICGIACVIALIIFFARIFCQYNK  765


 Score =   416 bits (1070),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 202/374 (54%), Positives = 267/374 (71%), Gaps = 4/374 (1%)
 Frame = +2

Query  77    MQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTTQSDMYQM  256
             M+ DVVA++GP SS +AH ISHV NEL VPLLSF ATDPTL++LQ+PYF+RTTQ+D +QM
Sbjct  1     MENDVVAVVGPVSSGIAHVISHVVNELHVPLLSFGATDPTLSALQYPYFVRTTQNDYFQM  60

Query  257   MAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGATTRAEIM  436
              AIAD +D+Y WK+VIA+++DDD GRNG++ L DA++ KR KISYKA  PP A   ++I 
Sbjct  61    YAIADFVDYYRWKKVIAIYVDDDNGRNGVSVLGDAMSKKRAKISYKAAFPPEA-KESDIS  119

Query  437   DILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVLDSSSPLPS  616
             D+L ++ LMESRV VLH  P  G  +FS+A  L MM  GYVWI+TDWL +VLDS     +
Sbjct  120   DLLNEVNLMESRVYVLHVNPDHGLAIFSIAKRLRMMDSGYVWIATDWLPSVLDSLDSPDT  179

Query  617   EKMEIMQGVLVLRQHTPDSELKRAFTSRWK-HLTGGSLGLNSYALYAYDSVWLIAHAIDS  793
             + M+++QGV+  R H PD++LK++F SR K      ++  NSYALYAYDSVWL A A+D+
Sbjct  180   DTMDLLQGVVAFRHHIPDTDLKKSFLSRLKSQRDNETVSFNSYALYAYDSVWLAARALDA  239

Query  794   FLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLTGQFKFNNDK  973
             +LN+GG +SFS+D KL+   GS L L +L  FDGGP  L  +L  +F GL+GQ +F+ DK
Sbjct  240   YLNEGGNVSFSSDPKLRDTNGSMLQLASLRTFDGGPQFLKTILGMNFTGLSGQVEFDMDK  299

Query  974   SLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYS--RPPNSSSANQKLYGVVWPG  1147
             +LV P+YDILN+ G+G R IG+W N+SGLS   PE LY       S  +NQ+LY V+WPG
Sbjct  300   NLVHPAYDILNIGGSGSRRIGYWSNHSGLSVIAPEVLYEKKSSKTSLKSNQELYSVIWPG  359

Query  1148  QSVKKAPGVGFPEQ  1189
             ++     G  FP  
Sbjct  360   EATTTPRGWVFPNN  373



>ref|XP_007132553.1| hypothetical protein PHAVU_011G104300g [Phaseolus vulgaris]
 gb|ESW04547.1| hypothetical protein PHAVU_011G104300g [Phaseolus vulgaris]
Length=929

 Score =   444 bits (1141),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 246/404 (61%), Positives = 317/404 (78%), Gaps = 3/404 (1%)
 Frame = +3

Query  1164  PRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYAVPFQFV  1343
             PRGWVFPNNG+ LRI VP RVSYK+F+S+       +G+ +DVF AA+ LLPY VP +++
Sbjct  462   PRGWVFPNNGQALRIAVPNRVSYKDFVSKDKNPPGVQGYCIDVFEAAIKLLPYPVPRKYM  521

Query  1344  PFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPFKKL  1523
              FGNG+ NPSY++LV  V+   FD  +GD+ IVTNRT+++DFTQP++ SGL+VV PF++ 
Sbjct  522   LFGNGKRNPSYNDLVEQVAQNNFDAVVGDVTIVTNRTRILDFTQPFLPSGLVVVVPFEEQ  581

Query  1524  NTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSLSTL  1703
              +  W+FL PF+ +MW VT  FF+ VG VVWILEHR+N +FRGSP++QLIT+ WFS ST+
Sbjct  582   KSSPWSFLEPFTTEMWCVTGAFFLFVGSVVWILEHRLNPDFRGSPRKQLITVFWFSFSTM  641

Query  1704  FFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESLKEGNDP  1883
             FF+HRENTVS LGR+VLIIWLFVVLIINSSYTASLTSILTVQQL S I G++SL    +P
Sbjct  642   FFSHRENTVSGLGRLVLIIWLFVVLIINSSYTASLTSILTVQQLSSQIVGIDSLISSTEP  701

Query  1884  IGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERPYVENFL  2063
             IG Q GSFA  YL++++ I++SR++ L + E Y  AL++GP  GGV A+VDE PY+E  +
Sbjct  702   IGIQDGSFARKYLVDDLHIAESRIVTLKNMEDYINALQRGPKAGGVVAVVDELPYIEVLM  761

Query  2064  -STQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLtrtscs  2240
              S+ CKFRIVGQEFTKSGWGFAF RDSPLAVD+STAIL LSE+GDLQRIHDKWL   +  
Sbjct  762   SSSHCKFRIVGQEFTKSGWGFAFQRDSPLAVDLSTAILQLSESGDLQRIHDKWL--NTKE  819

Query  2241  sestelesDRLHLKSFWglfllcgaacflalfIYFVQIMLKFRR  2372
               + E++S++L L SFWGLFL+CG A F+AL I+F +I  ++ +
Sbjct  820   CTTVEVDSNKLALTSFWGLFLICGIAFFIALVIFFARIFCQYNK  863


 Score =   408 bits (1048),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 201/379 (53%), Positives = 266/379 (70%), Gaps = 8/379 (2%)
 Frame = +2

Query  59    VAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTTQ  238
             + AL+ M+ DVVA++GP SS +AH ISHV NEL VPLLSF ATDPTL+SLQ+PYF+RTTQ
Sbjct  98    MEALQLMENDVVAVVGPLSSGIAHIISHVVNELHVPLLSFGATDPTLSSLQYPYFIRTTQ  157

Query  239   SDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGAT  418
             +D +QM A++  I+++ W+EVIA+++DDD GRNGI+ L DAL+ KR KISYKA   PGA 
Sbjct  158   NDYFQMYAVSAFINYHRWREVIAIYVDDDNGRNGISVLGDALSKKRGKISYKAAFSPGA-  216

Query  419   TRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVLDS  598
             + ++I D+L ++ +MESRV VLH  P  G  +FS+A  L M G GYVWISTDWL +VLDS
Sbjct  217   SESDISDLLNEVNMMESRVYVLHVNPDTGLAIFSIAKKLRMTGSGYVWISTDWLPSVLDS  276

Query  599   -SSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWK-HLTGGSLGLNSYALYAYDSVWL  772
               SP P   M+++QG++  R + PD++ K    SR K      ++  NSYA YAYDSVWL
Sbjct  277   LESPDPG-TMDLLQGIVAFRHYIPDTDPKNNLLSRLKSQRVNETVSFNSYAFYAYDSVWL  335

Query  773   IAHAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLTGQ  952
              A A+D++LN+GG ISFSND K Q   GS LHLE+L  FDGGP  L  +L  +F G++GQ
Sbjct  336   AARALDAYLNEGGNISFSNDPKFQDTNGSMLHLESLRTFDGGPQFLQTVLGMNFTGVSGQ  395

Query  953   FKFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKLYG  1132
               F+ DK+L+ P+Y+ILN+ G+G R IG+W N+SGLS   PETLY + P    +N  L+ 
Sbjct  396   IVFDMDKNLLHPAYEILNIGGSGSRRIGYWSNHSGLSVIAPETLYLKKP----SNTSLHS  451

Query  1133  VVWPGQSVKKAPGVGFPEQ  1189
             V+WPG+      G  FP  
Sbjct  452   VIWPGEVTATPRGWVFPNN  470



>ref|XP_004966221.1| PREDICTED: glutamate receptor 3.5-like [Setaria italica]
Length=927

 Score =   435 bits (1119),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 210/380 (55%), Positives = 274/380 (72%), Gaps = 6/380 (2%)
 Frame = +2

Query  59    VAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTTQ  238
             V AL+ M+ +VVA++GPQSS + H ISHVANELQVPLLSFAATDP+L++L++PYFLRTT 
Sbjct  87    VEALQLMEENVVAVIGPQSSGIGHVISHVANELQVPLLSFAATDPSLSALEYPYFLRTTI  146

Query  239   SDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGAT  418
             SD +QM A+A ++D+Y WK V A+F+DDDYGR G+ AL DALAAKR KISYKA IPP + 
Sbjct  147   SDYFQMNAVASIVDYYQWKRVTAIFVDDDYGRGGVFALGDALAAKRAKISYKAAIPPNSD  206

Query  419   TRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVLDS  598
             +   I D+L +  +MESR+MV+H  P  G  +FS+A+ L MM  GYVWI TDWL+ VLDS
Sbjct  207   SDV-ISDVLSRANMMESRIMVVHVNPDTGMRIFSIANNLQMMASGYVWIVTDWLAAVLDS  265

Query  599   SSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLTGG---SLGLNSYALYAYDSVW  769
             S+    + +  +QG++VLRQHTP+S+ K  F S+W  +      + GLNSY+ YAYD+VW
Sbjct  266   STSRDLKDLSHIQGLIVLRQHTPESDAKNKFISKWNAVARNRSVTSGLNSYSFYAYDTVW  325

Query  770   LIAHAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLTG  949
              +A AID FLN G  I+FS D +L    GSTL L  L IF+GG  +L  LL ++F G+TG
Sbjct  326   TVARAIDQFLNSGQQINFSTDPRLHDSNGSTLRLSTLKIFEGGDQMLQQLLLTNFTGVTG  385

Query  950   QFKFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKLY  1129
               +F +D+SLV P+Y+ILNV G+G R IG+W NYSGLS A P+ LY +PPN+S+  Q+LY
Sbjct  386   PVQFGSDRSLVRPAYEILNVGGSGSRLIGYWSNYSGLSVAAPDILYQKPPNTSA--QQLY  443

Query  1130  GVVWPGQSVKKAPGVGFPEQ  1189
              VVWPG+S     G  FP  
Sbjct  444   DVVWPGESTSTPRGWVFPNN  463


 Score =   416 bits (1069),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 214/353 (61%), Positives = 274/353 (78%), Gaps = 1/353 (0%)
 Frame = +3

Query  1164  PRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYAVPFQFV  1343
             PRGWVFPNNG+ LR+G+P + S+KE +S   G     G+ +DVF+AA+ LLPY VP +FV
Sbjct  455   PRGWVFPNNGQPLRVGIPNKASFKELVSS-GGPGNVTGYCIDVFSAAIKLLPYPVPLEFV  513

Query  1344  PFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPFKKL  1523
               G+G +NPSY  +VR+V+    D A+GD AIV N T + ++TQPYV +GL++VAP K++
Sbjct  514   TIGDGTKNPSYIGIVRMVANNSLDAAVGDFAIVRNGTAISEYTQPYVEAGLVIVAPVKQV  573

Query  1524  NTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSLSTL  1703
                AW FL PF+ +MW VT   F++VG+VVWILEHR+N+EFRGSP++Q++TI WFS ST+
Sbjct  574   TPSAWTFLQPFTLEMWCVTGALFILVGVVVWILEHRINEEFRGSPRRQVVTIFWFSFSTM  633

Query  1704  FFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESLKEGNDP  1883
             F++HRENTVS LGR VLIIWLFVVLII SSYTASLTSILTVQQL + I G++SL   + P
Sbjct  634   FYSHRENTVSALGRFVLIIWLFVVLIITSSYTASLTSILTVQQLDTGITGLDSLISSSLP  693

Query  1884  IGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERPYVENFL  2063
             IGYQ G F + YLI E+ I +SRL+AL + + YA+AL +GP  GGV+AIVDE+PY++ FL
Sbjct  694   IGYQNGKFTKKYLILELNIPESRLVALNTIQDYADALNRGPKNGGVAAIVDEKPYIDIFL  753

Query  2064  STQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWL  2222
             S  C FRIVGQ+FT+ GWGF+F RDSP+A DMSTAIL LSE+G LQRIHD W 
Sbjct  754   SHYCNFRIVGQQFTREGWGFSFRRDSPIAADMSTAILQLSESGQLQRIHDDWF  806



>gb|AAQ02674.1| glutamate receptor [Raphanus sativus var. sativus]
Length=915

 Score =   453 bits (1166),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 244/381 (64%), Positives = 310/381 (81%), Gaps = 9/381 (2%)
 Frame = +3

Query  1164  PRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNT--FKGFSVDVFTAAVNLLPYAVPFQ  1337
             PRGWVFPNNG++LRIGVP R S+K+F+S+V G+++    G+S++VF AA+ LL Y VP +
Sbjct  457   PRGWVFPNNGRRLRIGVPNRASFKDFVSRVNGSSSSHIDGYSINVFEAAIKLLSYPVPHE  516

Query  1338  FVPFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPFK  1517
             F+ FG+  +NP+Y++LV  V+TG FD  +GDIAIVT RT++VDFTQPY+ SGL+VVAP  
Sbjct  517   FILFGDSLKNPNYNDLVNNVTTGVFDAVVGDIAIVTKRTRIVDFTQPYIESGLVVVAPVT  576

Query  1518  KLNTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSLS  1697
             KLN   WAFL PF+  MW VTA FF++VG V+WILEHR+NDEFRG P++Q++TILWFS S
Sbjct  577   KLNDTPWAFLRPFTPPMWAVTAAFFLIVGSVIWILEHRINDEFRGPPRRQIVTILWFSFS  636

Query  1698  TLFFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESLKEGN  1877
             T+FF+HRENTVSTLGR+VL+IWLFVVLII SSYTASLTSILTVQQL SPIKGV++L   +
Sbjct  637   TMFFSHRENTVSTLGRIVLLIWLFVVLIITSSYTASLTSILTVQQLNSPIKGVDTLISSS  696

Query  1878  DPIGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERPYVEN  2057
               +G+QIGS+AE+Y+I+E+ I++SRL+ LGSP+ YA AL+ G     V+AIVDERPYV+ 
Sbjct  697   GRVGFQIGSYAENYMIDELNIARSRLVPLGSPKEYATALQNGT----VAAIVDERPYVDL  752

Query  2058  FLSTQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLtrtsc  2237
             FLS  C F I GQEFT+SGWGFAFPRDSPLAVDMSTAIL LSE G LQ+IHDKWL++++C
Sbjct  753   FLSEFCGFAIRGQEFTRSGWGFAFPRDSPLAVDMSTAILGLSETGKLQKIHDKWLSKSNC  812

Query  2238  ssestelesD---RLHLKSFW  2291
             S+ +     D   +L L+SFW
Sbjct  813   SNLNGSESDDDPEQLKLRSFW  833


 Score =   398 bits (1022),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 191/381 (50%), Positives = 267/381 (70%), Gaps = 3/381 (1%)
 Frame = +2

Query  56    LVAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTT  235
             ++ AL+FM+TD VAI+GPQ+S++AH +S++ANEL VP+ SF A DP+L+ LQFP+F++T 
Sbjct  85    IMKALQFMETDSVAIIGPQTSIMAHVLSYLANELNVPMCSFTALDPSLSPLQFPFFVQTA  144

Query  236   QSDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGA  415
              SD++ M AIA++I +YGW +VIA++ DDD  RNG+ +L D L  +RCKISYKA +P   
Sbjct  145   PSDLFLMRAIAEMITYYGWSDVIALYNDDDNSRNGVTSLGDELEGRRCKISYKAVLPLDV  204

Query  416   TTRA--EIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTV  589
               +   EI+  LV+I  MESRV++++ +P  G MVF  A  LGM G GYVWI+T W++++
Sbjct  205   VIKTPREIVRELVKIQKMESRVIIVNTFPKTGKMVFEEARRLGMTGRGYVWIATTWMTSL  264

Query  590   LDSSSPLPSEKM-EIMQGVLVLRQHTPDSELKRAFTSRWKHLTGGSLGLNSYALYAYDSV  766
             LDS+ PL   K+ E ++GVL LR HTP S  KR F +RW  L+ GS+GLN Y LYAYD+V
Sbjct  265   LDSADPLSLPKVAESLRGVLTLRIHTPVSRKKRDFAARWNKLSNGSVGLNVYGLYAYDTV  324

Query  767   WLIAHAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLT  946
             W+IA A+ + L+    I FS DSKL  ++G +L+L ALS+FD G   L+ ++++   G+T
Sbjct  325   WIIARAVKNLLDSRANIPFSGDSKLDHLKGGSLNLGALSMFDQGQQFLDYIVKTKMSGVT  384

Query  947   GQFKFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKL  1126
             G  +F  D+S+V P+YDI+NV+G G R IG+W N+SGLS  PPE L+S+P N SS+NQ L
Sbjct  385   GPVQFLPDRSMVQPAYDIINVVGGGLRQIGYWSNHSGLSVIPPELLFSKPSNRSSSNQHL  444

Query  1127  YGVVWPGQSVKKAPGVGFPEQ  1189
               V WPG       G  FP  
Sbjct  445   ENVTWPGGGSVTPRGWVFPNN  465



>ref|XP_006296930.1| hypothetical protein CARUB_v10012924mg [Capsella rubella]
 gb|EOA29828.1| hypothetical protein CARUB_v10012924mg [Capsella rubella]
Length=922

 Score =   453 bits (1166),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 259/407 (64%), Positives = 325/407 (80%), Gaps = 8/407 (2%)
 Frame = +3

Query  1164  PRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGT-NTFKGFSVDVFTAAVNLLPYAVPFQF  1340
             PRGWVF NNG++LRIGVP R S+K+F+S+V G+ N  +G+ +DVF AAV LL Y VP +F
Sbjct  458   PRGWVFRNNGRRLRIGVPDRGSFKDFVSRVNGSSNEVQGYCIDVFEAAVKLLSYPVPHEF  517

Query  1341  VPFGNGRENPSYSELVRLVSTGY-FDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPFK  1517
             + FG+G  +P+Y+ELV  V+TG  FD  +GDIAIVT RTK+VDFTQPY+ SGL+VVAP  
Sbjct  518   IFFGDGLTSPNYNELVNKVTTGVDFDAVVGDIAIVTKRTKIVDFTQPYIESGLVVVAPVT  577

Query  1518  KLNTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSLS  1697
             +LN   WAFL PF+  MW VTA FFV+VG  +WILEHR+NDEFRG+P++Q+ITILWF+ S
Sbjct  578   RLNENPWAFLRPFTLPMWAVTASFFVIVGAAIWILEHRINDEFRGTPRRQIITILWFTFS  637

Query  1698  TLFFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESLKEGN  1877
             T+FF+HRE TVSTLGRMVL+IWLFVVLII SSYTASLTSILTVQQL SPIKGV++L    
Sbjct  638   TMFFSHRETTVSTLGRMVLLIWLFVVLIITSSYTASLTSILTVQQLNSPIKGVDTLISST  697

Query  1878  DPIGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERPYVEN  2057
               IG+Q+GSFAE+Y+ EE+ I++SRL+AL SPE YA AL+ G     V+AIVDERPY++ 
Sbjct  698   GRIGFQVGSFAENYMTEELNIARSRLVALTSPEEYANALQNGT----VAAIVDERPYIDL  753

Query  2058  FLSTQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLtrtsc  2237
             FLS  CKF I GQEFT+ GWGFAFPRDSPLAVDMSTAIL LSE G+LQ+IHD+WL++++C
Sbjct  754   FLSDYCKFAIRGQEFTRCGWGFAFPRDSPLAVDMSTAILGLSETGELQKIHDRWLSKSNC  813

Query  2238  ssestelesD--RLHLKSFWglfllcgaacflalfIYFVQIMLKFRR  2372
             SS       D  +L++ SFWG+FL+ G AC +ALFI+F +I+  F +
Sbjct  814   SSPHGSQSGDSEQLNVHSFWGMFLVVGIACLVALFIHFFKIIRNFCK  860


 Score =   396 bits (1018),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 188/368 (51%), Positives = 264/368 (72%), Gaps = 7/368 (2%)
 Frame = +2

Query  56    LVAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTT  235
             ++ AL+FM+TD VAI+GPQ+S++AH +SH+ANEL VP+LSF A DPTL+ LQFPYF++T 
Sbjct  88    IMGALQFMETDAVAIIGPQTSIMAHVLSHLANELTVPMLSFTALDPTLSPLQFPYFVQTA  147

Query  236   QSDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGA  415
              SD++ M A+A++I +YGW +V+A++ DDD  RNG+ AL D L  +RC+ISYKA +P   
Sbjct  148   PSDLFLMRAVAEMITYYGWSDVVALYNDDDNSRNGVTALGDELEERRCRISYKAILPLDV  207

Query  416   --TTRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTV  589
               ++  EI++ L++I  MESRV+V++ +P  G M+F  A  LGMM  GYVWI+T WLS++
Sbjct  208   VISSPVEIIEELIKIRGMESRVIVVNTFPNTGTMIFKEAQRLGMMEKGYVWIATTWLSSL  267

Query  590   LDSSSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHL--TGGSLGLNSYALYAYDS  763
             LDS+ PL     ++  GVL LR HTPDS  KR F +RWK+      ++GLN Y LYAYD+
Sbjct  268   LDSNFPL---DKKLFNGVLTLRLHTPDSRKKRDFAARWKNKLSNNKTIGLNVYGLYAYDT  324

Query  764   VWLIAHAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGL  943
             VW+IA A+ + L  GG +SFSN ++L S++G  L+L ALS FD G  LL+ ++ +   GL
Sbjct  325   VWIIARAVKALLEAGGNLSFSNHAQLGSLKGEALNLSALSRFDQGSQLLDYIVHTKMSGL  384

Query  944   TGQFKFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQK  1123
             TG  +F+ D+S++ PSYDI+N++      IG+W NYSGLS  PPE+ Y++PPN SS+NQ 
Sbjct  385   TGPVQFHLDRSMLHPSYDIINLVDDRVHQIGYWSNYSGLSIVPPESFYTKPPNRSSSNQH  444

Query  1124  LYGVVWPG  1147
             L  V WPG
Sbjct  445   LNSVTWPG  452



>ref|XP_006447544.1| hypothetical protein CICLE_v10014175mg [Citrus clementina]
 ref|XP_006447546.1| hypothetical protein CICLE_v10014175mg [Citrus clementina]
 gb|ESR60784.1| hypothetical protein CICLE_v10014175mg [Citrus clementina]
 gb|ESR60786.1| hypothetical protein CICLE_v10014175mg [Citrus clementina]
Length=822

 Score =   463 bits (1192),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 222/378 (59%), Positives = 279/378 (74%), Gaps = 5/378 (1%)
 Frame = +2

Query  65    ALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTTQSD  244
             AL+ M+ +VVA +GPQSS +AH ISHV NEL VPLLSF ATDPTL SLQ+PYFLRTTQSD
Sbjct  108   ALQLMENEVVAAIGPQSSGIAHVISHVVNELNVPLLSFGATDPTLTSLQYPYFLRTTQSD  167

Query  245   MYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGATTR  424
              YQM A+AD++++YGW+EVIA+F+DDDYGRNGI+ L DAL+ KR KISYKA   PGA +R
Sbjct  168   YYQMHAVADLVEYYGWREVIAIFVDDDYGRNGISVLGDALSKKRAKISYKAPFSPGA-SR  226

Query  425   AEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVLDSSS  604
             + I  +LV   LMESRV V+H  P  G  +FSVA  LGM    YVWI+TDWL +VLDS+ 
Sbjct  227   SAINSLLVGANLMESRVFVVHVNPDTGLTIFSVAKSLGMTAGSYVWIATDWLPSVLDSTE  286

Query  605   PLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLT---GGSLGLNSYALYAYDSVWLI  775
             P+  + M ++QGV+ LR HTPD++LK+ F SRWK+L        G NSYALYAYDSVWL+
Sbjct  287   PVDIDTMNLLQGVVALRHHTPDTDLKKNFISRWKNLKYKENSPSGFNSYALYAYDSVWLV  346

Query  776   AHAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLTGQF  955
             AHA+D+ LN+GG  +FSND KL    GS L+L +L +FDGG   L  LL+ +F GL+G+ 
Sbjct  347   AHALDALLNEGGKFTFSNDPKLHDTNGSMLNLSSLRVFDGGQQFLQTLLRMNFTGLSGEI  406

Query  956   KFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKLYGV  1135
             +F+ DK+LV P+YD+LN+ GTG R IG+W NYSGLS   PE LY++PPNSSS N+ LY V
Sbjct  407   RFDADKNLVNPAYDVLNIGGTGSRRIGYWSNYSGLSVVAPEILYTKPPNSSS-NRHLYSV  465

Query  1136  VWPGQSVKKAPGVGFPEQ  1189
             +WPG+      G  FP  
Sbjct  466   IWPGEITATPRGWVFPNN  483


 Score =   385 bits (988),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 207/322 (64%), Positives = 254/322 (79%), Gaps = 1/322 (0%)
 Frame = +3

Query  1164  PRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYAVPFQFV  1343
             PRGWVFPNNG  LRI VP RVSY EF+++       KG+ +DVF AAVNLLPY VP  ++
Sbjct  475   PRGWVFPNNGMPLRIAVPNRVSYNEFVAKDKSPPGVKGYCIDVFEAAVNLLPYPVPHNYI  534

Query  1344  PFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPFKKL  1523
              +GNG+ NP Y+++V+ V+   FD A+GDI IVTNRTK+VDFTQPY+ SGL+VVAP +KL
Sbjct  535   MYGNGKRNPIYNDIVQQVALNKFDAAVGDITIVTNRTKLVDFTQPYMESGLVVVAPVQKL  594

Query  1524  NTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSLSTL  1703
              +  WAFL PF+  MW VT  FF+ VG VVWILEHR N+EFRG P QQL+TI WFS ST+
Sbjct  595   KSSPWAFLKPFTIPMWLVTGGFFLFVGAVVWILEHRFNNEFRGPPSQQLVTIFWFSFSTM  654

Query  1704  FFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESLKEGNDP  1883
             FF+HRENTVS+LGR+VLI+WLFVVLIINSSYTASLTSILTVQQL S I+G++SL    +P
Sbjct  655   FFSHRENTVSSLGRVVLIVWLFVVLIINSSYTASLTSILTVQQLTSQIEGIDSLISSTEP  714

Query  1884  IGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERPYVENFL  2063
             IG Q GSFA +YL++E+ I++SRL+ L + E Y+ AL +GP  GGV+AIVDE PY+E F+
Sbjct  715   IGVQDGSFAWNYLVDELKIAESRLVKLKNMEEYSIALARGPKGGGVAAIVDELPYIELFM  774

Query  2064  S-TQCKFRIVGQEFTKSGWGFA  2126
             S T C+FR VGQEFTKSGWGF 
Sbjct  775   SKTNCEFRTVGQEFTKSGWGFV  796



>gb|AGN92471.1| glutamate receptor 1 [Echinochloa crus-galli]
Length=930

 Score =   428 bits (1101),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 209/383 (55%), Positives = 275/383 (72%), Gaps = 4/383 (1%)
 Frame = +2

Query  50    ILLVAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLR  229
             I ++ AL+ M+ +VVA++GPQSS + H ISHV NEL VPLLSFAATDPTL++ ++PYFLR
Sbjct  82    IGIMEALELMEKNVVAVIGPQSSGIGHAISHVVNELHVPLLSFAATDPTLSTTEYPYFLR  141

Query  230   TTQSDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPP  409
             TT SD +QM A+A ++D+Y WK V A+F+DDDYGR G++AL DALAAKR +ISYKA IPP
Sbjct  142   TTISDYFQMNAVASIVDYYQWKTVTAIFVDDDYGRGGVSALGDALAAKRARISYKAAIPP  201

Query  410   GATTRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTV  589
              + +   I D+L +  +MESR+MV+H  P  G  +FS+A+ L MM  GYVWI TDWL+ V
Sbjct  202   NSNSDV-ISDVLFRANMMESRIMVVHVNPDTGMRIFSIANKLQMMASGYVWIVTDWLAAV  260

Query  590   LDSSSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLTGG---SLGLNSYALYAYD  760
             LDSS+    ++   +QG++VLRQHTP+S+ +  F S+W ++      + GLNSY  +AYD
Sbjct  261   LDSSASRDLKEKSHIQGLIVLRQHTPESDARIKFISKWNNMARNRSIASGLNSYGFFAYD  320

Query  761   SVWLIAHAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVG  940
             SVW +A AID FLN G  I+FS D +L +  GSTLHL +L IFDGG  LL  LL ++F G
Sbjct  321   SVWAVARAIDQFLNTGQQINFSTDPRLPNSNGSTLHLSSLKIFDGGEQLLQQLLLTNFTG  380

Query  941   LTGQFKFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQ  1120
             LTG  +F  D++LV PSYDILNV G+  R IG+W N+SGLS A PE LY +PPN+S++ +
Sbjct  381   LTGPVQFGLDRNLVRPSYDILNVGGSDLRLIGYWSNHSGLSVAAPEILYQKPPNTSTSPE  440

Query  1121  KLYGVVWPGQSVKKAPGVGFPEQ  1189
             +LY VVWPG S     G  FP  
Sbjct  441   QLYNVVWPGDSTTTPRGWVFPNN  463


 Score =   419 bits (1076),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 232/408 (57%), Positives = 310/408 (76%), Gaps = 2/408 (0%)
 Frame = +3

Query  1164  PRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYAVPFQFV  1343
             PRGWVFPNNG+ LR+GVPI+ S+KE +S   G +   G+ +DVF AA+ LLPY VP QFV
Sbjct  455   PRGWVFPNNGQPLRVGVPIKASFKELVSG-RGPDNVTGYCIDVFNAAIKLLPYPVPCQFV  513

Query  1344  PFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPFKKL  1523
               G+G +NPSY ++++ V+    D A+GD AIV N T++ ++TQPYV +GL++VAP K++
Sbjct  514   TIGDGTKNPSYLDIIKSVAGNSLDAAVGDFAIVRNGTQLAEYTQPYVEAGLVIVAPVKQI  573

Query  1524  NTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSLSTL  1703
             +  AWAFL PF+ +MW VT   F++VGIVVW+LEHR+N+EFRG+P+ Q+ TI WFS ST+
Sbjct  574   SASAWAFLKPFTLEMWCVTGALFILVGIVVWLLEHRINEEFRGTPRHQITTIFWFSFSTM  633

Query  1704  FFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESLKEGNDP  1883
             F++HR+NTVS LGR VLIIWLFVVLII SSYTASLTSILTVQQL + I G++SL   + P
Sbjct  634   FYSHRQNTVSALGRFVLIIWLFVVLIITSSYTASLTSILTVQQLETGITGLDSLISSSLP  693

Query  1884  IGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERPYVENFL  2063
             IGYQ G F + YL +++ +++SRL+ L + + YA+AL +GP  GGV+AIVDE+PY++ FL
Sbjct  694   IGYQGGKFTKRYLTKDLNVAESRLVPLNTIQEYADALNRGPKNGGVAAIVDEKPYIDIFL  753

Query  2064  STQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLtr-tscs  2240
             S  C FRIVGQ+FT+ GWGFAF RDSPLA DMSTAIL LSE+G LQRIHD+W TR    +
Sbjct  754   SYYCNFRIVGQQFTREGWGFAFQRDSPLAADMSTAILQLSESGQLQRIHDEWFTRPGCAA  813

Query  2241  sestelesDRLHLKSFWglfllcgaacflalfIYFVQIMLKFRRVARA  2384
              + TE+ + RL L SF GLFL+C   C  AL +YF++I  ++ + + +
Sbjct  814   DDDTEVGATRLGLGSFSGLFLMCAMTCLFALVVYFIRICWQYNKYSNS  861



>ref|XP_004966220.1| PREDICTED: glutamate receptor 3.5-like [Setaria italica]
Length=923

 Score =   432 bits (1111),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 209/380 (55%), Positives = 273/380 (72%), Gaps = 6/380 (2%)
 Frame = +2

Query  59    VAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTTQ  238
             V AL+ M+ +VVA++GPQSS + H ISHVANELQVPLLSFAATDP+L++L++PYFLRTT 
Sbjct  83    VRALQLMEENVVAVIGPQSSGIGHVISHVANELQVPLLSFAATDPSLSALEYPYFLRTTI  142

Query  239   SDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGAT  418
             SD +QM A+A ++D+Y WK V A+F+DDDYGR G+ AL DALAAKR KISYKA IPP + 
Sbjct  143   SDYFQMNAVASIVDYYQWKRVTAIFVDDDYGRGGVFALGDALAAKRAKISYKAAIPPNSD  202

Query  419   TRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVLDS  598
             +   I D+L +  +MESR+MV+H  P  G  +FS+A+ L MM  GYVWI TDWL+ VLDS
Sbjct  203   SDV-ISDVLSRANMMESRIMVVHVNPDTGMRIFSIANNLQMMTSGYVWIVTDWLAAVLDS  261

Query  599   SSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLTGG---SLGLNSYALYAYDSVW  769
             S+    + +  +QG++VLRQHTP+S+ K  F S+W  +      + GLNSY  YAYD+VW
Sbjct  262   STSRDLKDLSHIQGLIVLRQHTPESDAKNKFISKWNAVARNRSVTSGLNSYGFYAYDTVW  321

Query  770   LIAHAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLTG  949
              +A AID FLN G  I+FS D +L    GSTL L  L IF+GG  +L  LL ++F G+TG
Sbjct  322   TVARAIDQFLNSGQQINFSTDPRLHDSNGSTLRLSTLKIFEGGDQMLQQLLLTNFTGVTG  381

Query  950   QFKFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKLY  1129
               +F +D+SLV P+Y+ILNV G+G R IG+W NYSGLS A P+ LY +PPN+S+  Q+LY
Sbjct  382   PVQFGSDRSLVRPAYEILNVGGSGSRLIGYWSNYSGLSVAAPDILYQKPPNTSA--QQLY  439

Query  1130  GVVWPGQSVKKAPGVGFPEQ  1189
              V+WPG+S     G  FP  
Sbjct  440   DVLWPGESTSTPRGWVFPNN  459


 Score =   413 bits (1062),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 213/353 (60%), Positives = 272/353 (77%), Gaps = 1/353 (0%)
 Frame = +3

Query  1164  PRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYAVPFQFV  1343
             PRGWVFPNNG+ LR+G+P + S+KE +S   G     G+ +DVF+AA+ LLPY VP +FV
Sbjct  451   PRGWVFPNNGQPLRVGIPNKASFKELVSS-GGPGNVTGYCIDVFSAAIKLLPYPVPLEFV  509

Query  1344  PFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPFKKL  1523
               G+G +NPSY  +VR+V+    D A+GD AIV N T + ++TQPYV +GL++VAP K++
Sbjct  510   TIGDGTKNPSYIGIVRMVANNSLDAAVGDFAIVRNGTAISEYTQPYVEAGLVIVAPVKQV  569

Query  1524  NTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSLSTL  1703
                AW FL PF+ +MW VT   F++VG+VVW+LEHR+N+EFRGSP++Q++TI WFS ST+
Sbjct  570   TPSAWTFLKPFTLEMWCVTGALFILVGVVVWLLEHRINEEFRGSPRRQVVTIFWFSFSTM  629

Query  1704  FFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESLKEGNDP  1883
             F +HRENTVS LGR VLIIWLFVVLII SSYTASLTSILTVQQL + I G++SL   + P
Sbjct  630   FHSHRENTVSALGRFVLIIWLFVVLIITSSYTASLTSILTVQQLDTGITGLDSLISSSLP  689

Query  1884  IGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERPYVENFL  2063
             IGYQ G F + YLI E+ I +SRL+AL + + YA+AL +GP  GGV+AIVDE+PY++ FL
Sbjct  690   IGYQNGKFTKKYLILELNIPESRLVALNTIQDYADALNRGPKNGGVAAIVDEKPYIDIFL  749

Query  2064  STQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWL  2222
             S  C FRIVGQ+FT+ GWGF F RDSP+A DMSTAIL LSE+G LQRIHD W 
Sbjct  750   SHYCNFRIVGQQFTREGWGFTFQRDSPIAADMSTAILQLSESGQLQRIHDDWF  802



>ref|XP_010690549.1| PREDICTED: glutamate receptor 3.2-like [Beta vulgaris subsp. 
vulgaris]
Length=941

 Score =   436 bits (1122),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 251/403 (62%), Positives = 313/403 (78%), Gaps = 5/403 (1%)
 Frame = +3

Query  1164  PRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYAVPFQFV  1343
             PRGWVFP +GK+LRIGVP RVS+ +F+ Q   T+   G+ +DVF AAV LLPYAV ++F+
Sbjct  455   PRGWVFPRDGKKLRIGVPRRVSFLKFVYQDNQTHAIGGYCIDVFKAAVKLLPYAVSYEFI  514

Query  1344  PFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPFKKL  1523
              FG+G +NP+Y++L++ ++TG F+ A+GDIAIVTNRT +VDFTQPY  SGL+VVAP KKL
Sbjct  515   FFGDGHQNPNYNDLMKRITTGEFEAAVGDIAIVTNRTMIVDFTQPYADSGLVVVAPVKKL  574

Query  1524  NTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSLSTL  1703
             ++ +WAFL PF+  MW VT  FF+VVG V+WILEHR+NDEFRG P +QL+TILWFS STL
Sbjct  575   SSSSWAFLRPFTGLMWAVTGVFFLVVGAVIWILEHRLNDEFRGPPSKQLMTILWFSFSTL  634

Query  1704  FFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESLKEGNDP  1883
             FFAHRENTVSTLGRMVL+IWLFVVLII SSYTASLTS LTVQQL   IKG++SL   N P
Sbjct  635   FFAHRENTVSTLGRMVLVIWLFVVLIIQSSYTASLTSFLTVQQLSFSIKGIDSLITSNAP  694

Query  1884  IGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERPYVENFL  2063
             IG+Q+GS+AE+YL EE+ I +SRL  L SPE YA+AL+     G V+A+VDE+PYV+ FL
Sbjct  695   IGFQVGSYAENYLNEELNIHRSRLKPLNSPEDYADALK----SGRVAAVVDEQPYVDLFL  750

Query  2064  STQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLtrtscss  2243
             S  C+F I G +FTKSGWGFAF RDSPLA+DMSTA+L LSENG LQ I + WL +     
Sbjct  751   SNYCQFAISGPQFTKSGWGFAFKRDSPLALDMSTALLELSENGSLQNITEFWLKKKQVCQ  810

Query  2244  estele-sDRLHLKSFWglfllcgaacflalfIYFVQIMLKFR  2369
                 +  S++L L +F GLFL+CG AC LAL IYF  ++ +F 
Sbjct  811   SQLSVNDSEQLKLDNFVGLFLICGVACILALIIYFCLMLYQFH  853


 Score =   407 bits (1047),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 197/378 (52%), Positives = 264/378 (70%), Gaps = 3/378 (1%)
 Frame = +2

Query  56    LVAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTT  235
             ++ AL+FM+TD VAI+GPQSS++AH +SH+AN+L VPLLSF A DPTL+ +Q+PYF +T 
Sbjct  87    VMGALQFMETDTVAIIGPQSSIMAHVLSHLANQLHVPLLSFTALDPTLSPIQYPYFFQTA  146

Query  236   QSDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGA  415
              +D++QM AIA+++ +Y W +VIA+F D++  RNGI AL D L  +R KISYKA +PP  
Sbjct  147   PNDLFQMAAIAEMVSYYRWTQVIAIFTDEEQSRNGITALGDKLTERRAKISYKAVLPPDI  206

Query  416   TTRAEIMDI-LVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVL  592
               +  ++   L ++ +MESRV+V+H   A G ++   A  LGM+GDGYVWIST WL  VL
Sbjct  207   RGQLSVVKQELAKVKMMESRVLVVHTLSAYGKIILEAAEELGMIGDGYVWISTAWLPAVL  266

Query  593   DSSSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLTGGSLGLNSYALYAYDSVWL  772
             DS      E  +  QGV+ LR HTPDS  K+AF +RW +L+ GS GL  Y LYAYD+VWL
Sbjct  267   DSKQN--PETYKRTQGVITLRPHTPDSPRKKAFIARWNNLSKGSTGLTVYGLYAYDTVWL  324

Query  773   IAHAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLTGQ  952
             IA AID+FL +G  ISFSND  L S+ G  ++L ALSIFDGG  LL  +L+++  GLTG 
Sbjct  325   IARAIDAFLRQGNNISFSNDPVLTSVGGGNMNLSALSIFDGGSELLKLILETNMTGLTGP  384

Query  953   FKFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKLYG  1132
               +N D+ LV PS+D++N++G+  + IG+W NYSGLS  PPE L  RP N S A+QKL  
Sbjct  385   IWYNPDRVLVNPSFDVINIVGSQMKQIGYWSNYSGLSVLPPEILRERPQNRSMASQKLSS  444

Query  1133  VVWPGQSVKKAPGVGFPE  1186
             VVWPG + +   G  FP 
Sbjct  445   VVWPGGTNQIPRGWVFPR  462



>ref|XP_004987272.1| PREDICTED: glutamate receptor 3.4-like [Setaria italica]
Length=938

 Score =   481 bits (1237),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 270/404 (67%), Positives = 326/404 (81%), Gaps = 4/404 (1%)
 Frame = +3

Query  1164  PRGWVFPNNGKQLRIGVPIRVSYKEFISQVP--GTNTFKGFSVDVFTAAVNLLPYAVPFQ  1337
             PRGWVFPNNG+ LRIGVP R +YK+F+S+    G +   G+ VDVF AAV LLPY VP  
Sbjct  447   PRGWVFPNNGRPLRIGVPYRTTYKQFVSRDSSGGPDGVSGYCVDVFKAAVELLPYPVPVS  506

Query  1338  FVPFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPFK  1517
             FV FG+G +NPSY ELV+ V+ G+FD A+GDI+IVTNRT+VVDFTQPYV SGL++V+P K
Sbjct  507   FVLFGDGVKNPSYGELVQRVADGFFDAAVGDISIVTNRTRVVDFTQPYVESGLVIVSPVK  566

Query  1518  KLNTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSLS  1697
               ++  WAFL PF+  MW +TA FF+ VG VVWILEHR N EFRGSP++Q++TI WFS S
Sbjct  567   AKSSNEWAFLKPFTPGMWAITAGFFLFVGAVVWILEHRFNPEFRGSPRKQMVTIFWFSFS  626

Query  1698  TLFFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESLKEGN  1877
             T+FFAHRENTVSTLGR VL+IWLFVVLIINSSYTASLTSILTVQQL + I+G++SL   N
Sbjct  627   TMFFAHRENTVSTLGRFVLLIWLFVVLIINSSYTASLTSILTVQQLSTGIQGLDSLLSSN  686

Query  1878  DPIGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERPYVEN  2057
             DPIGYQ+GSFA  Y++EE+G+  SRL  L + + YA++L++GP  GGV+AIVDE PYVE 
Sbjct  687   DPIGYQVGSFARSYMMEELGVPASRLREL-AIDQYADSLQRGPGNGGVAAIVDELPYVEL  745

Query  2058  FLSTQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLt-rts  2234
             FLST C+FR VGQEFTKSGWGFAF RDSPLAVD+STAIL+LSENGDLQRIHDKWL   T 
Sbjct  746   FLSTNCQFRTVGQEFTKSGWGFAFQRDSPLAVDLSTAILTLSENGDLQRIHDKWLNPGTC  805

Query  2235  cssestelesDRLHLKSFWglfllcgaacflalfIYFVQIMLKF  2366
              S  +    +DRL+L SFWGLFL+CG ACF+AL IYF +I+ +F
Sbjct  806   DSQSADVGSADRLNLNSFWGLFLICGVACFIALLIYFARILCQF  849


 Score =   362 bits (928),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 185/384 (48%), Positives = 261/384 (68%), Gaps = 17/384 (4%)
 Frame = +2

Query  59    VAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTTQ  238
             + AL+ M+  VVA++GPQSS +AH +SH AN+L+VPL+SFAA DP LAS Q+PYF+R   
Sbjct  82    IRALELMEKQVVAVVGPQSSGIAHVVSHAANQLRVPLVSFAAQDPALASTQYPYFVRAAH  141

Query  239   SDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGAT  418
              D +QM A+A ++ H+GW+EV AV++D+DYGR G+ AL DAL   R +I+ KA  PPGA 
Sbjct  142   DDAFQMAAVAGIVAHFGWREVTAVYVDNDYGRGGVDALGDALQDVRARITCKAAFPPGA-  200

Query  419   TRAEIMDILVQIALMESRVMVLHAYPAAGF-MVFSVAHYLGMMGDGYVWISTDWLSTVLD  595
              RA + D+L++  +MESRV V+HA P +G   VF+VAH L MM  GYVWI+T+WL+  +D
Sbjct  201   DRAALADVLLRANMMESRVFVVHASPDSGVDDVFAVAHTLNMMDSGYVWIATEWLAAAID  260

Query  596   SSSPL---PSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLTGGSLGLNSYALYAYDSV  766
             SSS     P   M ++QGVL LRQ+TP+S+ KR+  +R+   +  S  +N+Y L+AYDSV
Sbjct  261   SSSSSSRAPRGMMGLIQGVLTLRQYTPESDAKRSLETRFAAAS-RSRSMNAYGLFAYDSV  319

Query  767   WLIAHAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLT  946
             W++A AID+FL  GG ISFS D  ++   GS L L +L +FD G  LL  ++ ++F G+T
Sbjct  320   WMVARAIDAFLGDGGNISFSADPTIRDDNGSALRLSSLRVFDQGEQLLRKVMLANFTGVT  379

Query  947   GQFKFN--NDKSLVLPSYDILNVIGTGFRTIGFWCNYS-GLSTAPPETLYSRPPNSSSAN  1117
             G+ +F+  + ++LV  +Y++LNV GTG R +G+W N++  LS A        PPN+ S N
Sbjct  380   GEVRFDDGDRRALVGAAYEVLNVGGTGVRRVGYWSNHTRQLSVAA-------PPNNGS-N  431

Query  1118  QKLYGVVWPGQSVKKAPGVGFPEQ  1189
             QKLY V+WPG +     G  FP  
Sbjct  432   QKLYSVIWPGDTTATPRGWVFPNN  455



>ref|XP_010276019.1| PREDICTED: glutamate receptor 3.7-like isoform X1 [Nelumbo nucifera]
 ref|XP_010276020.1| PREDICTED: glutamate receptor 3.7-like isoform X1 [Nelumbo nucifera]
 ref|XP_010276021.1| PREDICTED: glutamate receptor 3.7-like isoform X1 [Nelumbo nucifera]
 ref|XP_010276022.1| PREDICTED: glutamate receptor 3.7-like isoform X1 [Nelumbo nucifera]
 ref|XP_010276024.1| PREDICTED: glutamate receptor 3.7-like isoform X1 [Nelumbo nucifera]
Length=909

 Score =   447 bits (1150),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 241/415 (58%), Positives = 313/415 (75%), Gaps = 1/415 (0%)
 Frame = +3

Query  1146  GSR*KKPRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYA  1325
             G + +KPRGWV  +  + LRIGVP R S+ EF ++  GT  F+GF +DVF AA  L+ Y 
Sbjct  447   GKKAEKPRGWVIADIERPLRIGVPYRASFVEFATEKHGTKDFEGFCIDVFFAARKLVAYD  506

Query  1326  VPFQFVPFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVV  1505
             +PF F+PFG+G+ NP+Y ELVR+V+TG  D A+GDIAIVTNRTK+ DFTQPY A+GL++V
Sbjct  507   IPFMFMPFGDGQSNPNYDELVRMVATGVLDAAVGDIAIVTNRTKIADFTQPYAATGLVIV  566

Query  1506  APFKKLNTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILW  1685
             AP     + AW FL PF+ +MW VTA FFV++G+V+WILEHR+ND+FRG P++QLIT+  
Sbjct  567   APINNRKSSAWVFLKPFTVEMWCVTATFFVLIGVVIWILEHRINDDFRGPPRRQLITVFL  626

Query  1686  FSLSTLFFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESL  1865
             FS STLF  ++E+T+S LGRMV+++WLF++++I SSYTASLTSILT+QQL SPI G++SL
Sbjct  627   FSFSTLFKTNQEDTISALGRMVMVVWLFLLMVITSSYTASLTSILTIQQLSSPITGLDSL  686

Query  1866  KEGNDPIGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERP  2045
                  PIGYQ+GSFA  YL +   I +SRL++LGSPE Y EAL  GP  GGV+AI+DE P
Sbjct  687   ITSRWPIGYQVGSFAPSYLTDNFNIPQSRLVSLGSPEEYEEALRLGPGNGGVAAIIDELP  746

Query  2046  YVENFLSTQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLt  2225
             YVE FLS Q  F IVGQ FTK+GWGFAF RDSPLAVDMSTAIL LSENG+LQ+IHDKW  
Sbjct  747   YVELFLSKQTDFGIVGQMFTKNGWGFAFQRDSPLAVDMSTAILELSENGELQKIHDKWFC  806

Query  2226  rtscssest-elesDRLHLKSFWglfllcgaacflalfIYFVQIMLKFRRVARAE  2387
             +  C  E   + ++++LHL SFW L+LL G     AL ++ V+++ +F R  R +
Sbjct  807   KMGCGIERRPQSDTNQLHLSSFWALYLLSGVVTLGALLVFLVRMVRQFVRYKRKQ  861


 Score =   392 bits (1006),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 195/374 (52%), Positives = 256/374 (68%), Gaps = 5/374 (1%)
 Frame = +2

Query  59    VAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTTQ  238
             V A + ++ +VVAI+GPQSS VAH IS +AN +QVPL+SF ATDPTL++LQFP+F+RTTQ
Sbjct  84    VEAFRVLEKEVVAIIGPQSSGVAHLISMIANGVQVPLVSFVATDPTLSALQFPFFVRTTQ  143

Query  239   SDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGAT  418
             SD YQM A+AD+ID+YGW+EVIA+F+DDDYGRNGI+ LDD LA K  KI YK  +P GA+
Sbjct  144   SDSYQMAAMADLIDYYGWREVIAIFVDDDYGRNGISTLDDELAKKMTKI-YKLALPTGAS  202

Query  419   TRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVLDS  598
               + I ++L     +  RV V+H  P +G  V S+A  L MM  GYVW++TDWLST LDS
Sbjct  203   V-SRITELLSNSKFIGPRVYVVHVNPDSGLTVLSLAQELEMMTSGYVWLATDWLSTTLDS  261

Query  599   SSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLTGGSL---GLNSYALYAYDSVW  769
                +    +   QGV+ LRQHTP S  K+AF SRW+ L    L   GLN+Y LYAYD+VW
Sbjct  262   LPLINQTSLRNFQGVVGLRQHTPPSLQKKAFVSRWRDLHQKGLVSYGLNTYGLYAYDTVW  321

Query  770   LIAHAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLTG  949
              +A +ID +LN+   I+FS +  L   + + L LE +  FDGG LLL  LLQ +F GLTG
Sbjct  322   AVAQSIDGYLNEYQNITFSFNKNLHGNKATKLQLENIKTFDGGTLLLRKLLQMNFSGLTG  381

Query  950   QFKFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKLY  1129
               +F++D++L+   YDI+N+      TIG+W NYSGLS   PETL  +P +SS  +QKL 
Sbjct  382   SVRFDSDRNLIGGGYDIINIAQIAIHTIGYWSNYSGLSVVTPETLNRKPHSSSHLDQKLN  441

Query  1130  GVVWPGQSVKKAPG  1171
              V WPG+  +K  G
Sbjct  442   SVTWPGKKAEKPRG  455



>dbj|BAK02402.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=929

 Score =   459 bits (1181),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 256/402 (64%), Positives = 321/402 (80%), Gaps = 2/402 (0%)
 Frame = +3

Query  1164  PRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYAVPFQFV  1343
             PRGWVFPNNG+ LRIGVP R + ++F+S+  G +   G+ +DVF AAV LLPY VP  F+
Sbjct  456   PRGWVFPNNGRPLRIGVPYRTTQRQFVSKDSGPDGASGYCIDVFKAAVALLPYPVPVSFI  515

Query  1344  PFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPFKKL  1523
              FG+G +NPSYS+LV  V+   FD A+GD++IVTNRT+VVDFTQPYV SGL++V+P K+ 
Sbjct  516   LFGDGVKNPSYSDLVNKVANNVFDAAVGDVSIVTNRTRVVDFTQPYVESGLVIVSPVKEK  575

Query  1524  NTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSLSTL  1703
             ++ AWAFL PF+  MW VT  FF+ VG VVW+LEHR N EFRGSP++QL+TI WFS ST+
Sbjct  576   SSNAWAFLKPFTLGMWAVTGAFFLFVGSVVWVLEHRFNPEFRGSPRKQLVTIFWFSFSTM  635

Query  1704  FFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESLKEGNDP  1883
             FFAHRENTVS+LGR VLIIWLFVVLIINSSYTASLTSILTVQQL + I+G++ L    DP
Sbjct  636   FFAHRENTVSSLGRFVLIIWLFVVLIINSSYTASLTSILTVQQLSTGIQGLDGLLASADP  695

Query  1884  IGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERPYVENFL  2063
             IGYQIGSFA+ Y+++E+ + +SRL  L   + YA +L+ GP  GGV+AIVDE PYV+ FL
Sbjct  696   IGYQIGSFAKSYMMQELNVPESRLKELAIDD-YAASLQLGPRNGGVAAIVDELPYVDLFL  754

Query  2064  STQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLt-rtscs  2240
             ST C+F+ VGQEFTKSGWGFAF RDSPLAVD+STAIL+LSENGDL+RIHDKWL      S
Sbjct  755   STNCQFKTVGQEFTKSGWGFAFQRDSPLAVDLSTAILTLSENGDLERIHDKWLNPGQCDS  814

Query  2241  sestelesDRLHLKSFWglfllcgaacflalfIYFVQIMLKF  2366
             S+  ++ +DRL+L SFWGLFL+ G ACF+AL I+F +I+ ++
Sbjct  815   SQGGDVTADRLNLSSFWGLFLISGIACFIALVIFFTRILCQY  856


 Score =   375 bits (964),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 189/388 (49%), Positives = 263/388 (68%), Gaps = 15/388 (4%)
 Frame = +2

Query  59    VAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTTQ  238
             + AL+ M+  VVA++GPQSS +AH +SHV NEL VPLLSFAATDP LAS Q+PYF+R  +
Sbjct  81    IQALQLMEKKVVAVVGPQSSGIAHVVSHVVNELHVPLLSFAATDPALASAQYPYFVRAAR  140

Query  239   -SDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGA  415
               D  QM A+AD++ +YGW+EV  +++D+DYGR G+ AL DAL AKR K+S+KA  PP A
Sbjct  141   GDDSSQMAAVADIVAYYGWREVTVIYVDNDYGRGGVDALGDALEAKRAKLSFKAPFPPDA  200

Query  416   TTRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVLD  595
               +A I D+L+Q+ +MESRV V+H  P +G  VF+ A  LGMM  GYVWI+TDWL+  LD
Sbjct  201   D-QAAIADLLLQVTMMESRVCVVHVNPDSGLAVFAAARSLGMMASGYVWIATDWLAAALD  259

Query  596   SSSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRW---KHLTGGSLGLNSYALYAYDSV  766
             S+ P   + M ++QGV+ LRQ+ PDS  KR+ TSR+   +     +L LN+Y L AYD+V
Sbjct  260   STRPPNPKAMSLLQGVVTLRQYAPDSGAKRSLTSRFAAGQLNRSATLSLNAYGLAAYDAV  319

Query  767   WLIAHAIDSFLNKGGVISFSNDSKL-QSIEG-STLHLEALSIFDGGPLLLNNLLQSDFVG  940
             W+ A AID FL  GG ++FS D +L Q + G STL L+AL +FD G  LL+ ++ ++F G
Sbjct  320   WMAARAIDEFLEDGGNVTFSADPRLQQEVNGTSTLRLDALRVFDQGEQLLHKVMLANFTG  379

Query  941   LTGQFKFNND-KSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSS---  1108
             +TG  +F+ D +SL  P+Y++LNV GTG R +G+W N+S LS + P    +   NSS   
Sbjct  380   ITGDVRFSADGRSLADPAYEVLNVGGTGVRRVGYWSNHSHLSVSAPTPFQA---NSSQQQ  436

Query  1109  -SANQKLYGVVWPGQSVKKAPGVGFPEQ  1189
                 ++LY ++WPG++     G  FP  
Sbjct  437   QQQERRLYSMIWPGETTSPPRGWVFPNN  464



>ref|XP_010276025.1| PREDICTED: glutamate receptor 3.7-like isoform X2 [Nelumbo nucifera]
Length=908

 Score =   441 bits (1134),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 240/415 (58%), Positives = 311/415 (75%), Gaps = 2/415 (0%)
 Frame = +3

Query  1146  GSR*KKPRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYA  1325
             G + +KPRGWV  +  + LRIGVP R S+ EF ++  GT  F+GF +DVF AA  L+ Y 
Sbjct  447   GKKAEKPRGWVIADIERPLRIGVPYRASFVEFATEKHGTKDFEGFCIDVFFAARKLVAYD  506

Query  1326  VPFQFVPFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVV  1505
             +PF F+PFG+G+ NP+Y ELVR+V+TG  D A+GDIAIVTNRTK+ DFTQPY A+GL++V
Sbjct  507   IPFMFMPFGDGQSNPNYDELVRMVATGVLDAAVGDIAIVTNRTKIADFTQPYAATGLVIV  566

Query  1506  APFKKLNTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILW  1685
             AP     + AW FL PF+ +MW VTA FFV++G+V+WILEHR+ND+FRG P++QLIT+  
Sbjct  567   APINNRKSSAWVFLKPFTVEMWCVTATFFVLIGVVIWILEHRINDDFRGPPRRQLITVFL  626

Query  1686  FSLSTLFFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESL  1865
             FS STLF    ++T+S LGRMV+++WLF++++I SSYTASLTSILT+QQL SPI G++SL
Sbjct  627   FSFSTLF-KTNQDTISALGRMVMVVWLFLLMVITSSYTASLTSILTIQQLSSPITGLDSL  685

Query  1866  KEGNDPIGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERP  2045
                  PIGYQ+GSFA  YL +   I +SRL++LGSPE Y EAL  GP  GGV+AI+DE P
Sbjct  686   ITSRWPIGYQVGSFAPSYLTDNFNIPQSRLVSLGSPEEYEEALRLGPGNGGVAAIIDELP  745

Query  2046  YVENFLSTQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLt  2225
             YVE FLS Q  F IVGQ FTK+GWGFAF RDSPLAVDMSTAIL LSENG+LQ+IHDKW  
Sbjct  746   YVELFLSKQTDFGIVGQMFTKNGWGFAFQRDSPLAVDMSTAILELSENGELQKIHDKWFC  805

Query  2226  rtscssest-elesDRLHLKSFWglfllcgaacflalfIYFVQIMLKFRRVARAE  2387
             +  C  E   + ++++LHL SFW L+LL G     AL ++ V+++ +F R  R +
Sbjct  806   KMGCGIERRPQSDTNQLHLSSFWALYLLSGVVTLGALLVFLVRMVRQFVRYKRKQ  860


 Score =   392 bits (1006),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 195/374 (52%), Positives = 256/374 (68%), Gaps = 5/374 (1%)
 Frame = +2

Query  59    VAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTTQ  238
             V A + ++ +VVAI+GPQSS VAH IS +AN +QVPL+SF ATDPTL++LQFP+F+RTTQ
Sbjct  84    VEAFRVLEKEVVAIIGPQSSGVAHLISMIANGVQVPLVSFVATDPTLSALQFPFFVRTTQ  143

Query  239   SDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGAT  418
             SD YQM A+AD+ID+YGW+EVIA+F+DDDYGRNGI+ LDD LA K  KI YK  +P GA+
Sbjct  144   SDSYQMAAMADLIDYYGWREVIAIFVDDDYGRNGISTLDDELAKKMTKI-YKLALPTGAS  202

Query  419   TRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVLDS  598
               + I ++L     +  RV V+H  P +G  V S+A  L MM  GYVW++TDWLST LDS
Sbjct  203   V-SRITELLSNSKFIGPRVYVVHVNPDSGLTVLSLAQELEMMTSGYVWLATDWLSTTLDS  261

Query  599   SSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLTGGSL---GLNSYALYAYDSVW  769
                +    +   QGV+ LRQHTP S  K+AF SRW+ L    L   GLN+Y LYAYD+VW
Sbjct  262   LPLINQTSLRNFQGVVGLRQHTPPSLQKKAFVSRWRDLHQKGLVSYGLNTYGLYAYDTVW  321

Query  770   LIAHAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLTG  949
              +A +ID +LN+   I+FS +  L   + + L LE +  FDGG LLL  LLQ +F GLTG
Sbjct  322   AVAQSIDGYLNEYQNITFSFNKNLHGNKATKLQLENIKTFDGGTLLLRKLLQMNFSGLTG  381

Query  950   QFKFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKLY  1129
               +F++D++L+   YDI+N+      TIG+W NYSGLS   PETL  +P +SS  +QKL 
Sbjct  382   SVRFDSDRNLIGGGYDIINIAQIAIHTIGYWSNYSGLSVVTPETLNRKPHSSSHLDQKLN  441

Query  1130  GVVWPGQSVKKAPG  1171
              V WPG+  +K  G
Sbjct  442   SVTWPGKKAEKPRG  455



>ref|XP_010515558.1| PREDICTED: glutamate receptor 3.6-like isoform X2 [Camelina sativa]
Length=773

 Score =   435 bits (1118),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 199/372 (53%), Positives = 277/372 (74%), Gaps = 7/372 (2%)
 Frame = +2

Query  56    LVAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTT  235
             ++  L FM+++ VAI+GPQ S  A  ++HVA EL+VP+LSF+ATDPT++ LQFP+F+RT 
Sbjct  84    IMEPLHFMESETVAIIGPQRSTTARVVAHVATELKVPILSFSATDPTMSPLQFPFFIRTA  143

Query  236   QSDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGA  415
              +D++QM AIAD++  YGW+EV+A++ DDDYGRNGIA+L D LA KRC+ISYKA +PPG 
Sbjct  144   HNDLFQMAAIADIVQFYGWREVVAIYGDDDYGRNGIASLGDRLAEKRCRISYKAALPPGP  203

Query  416   TTRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVLD  595
              TR  I D+L+++AL ESR++V+HA    G  +F+VA  LGMM  GYVWI+T+WLST++D
Sbjct  204   -TRENITDLLIKVALSESRIIVIHASFIWGLELFNVAQNLGMMSTGYVWIATNWLSTIID  262

Query  596   SSSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLTGGSLGLNSYALYAYDSVWLI  775
             + SPLP + +  +QGV+ LR HTP+S +K+ F  RW++LT   +GL++Y LYAYD+VWL+
Sbjct  263   TDSPLPLDTINNIQGVIALRPHTPNSIMKQNFVQRWRNLT--RVGLSTYGLYAYDTVWLL  320

Query  776   AHAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLTGQF  955
             A AI+ F  KGG +SFS +  L  + G  LHL+AL +FDGG + L ++LQ D +GLTG+ 
Sbjct  321   AQAIEDFFQKGGNVSFSKNPILSELVGGNLHLDALKVFDGGKMFLESILQVDRIGLTGRM  380

Query  956   KFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKLYGV  1135
             KF  D++LV P +D+LNVIGTG+RTIG+W N+ GLS  P +       N+S + QKL+ V
Sbjct  381   KFTRDRNLVNPEFDVLNVIGTGYRTIGYWSNHLGLSVVPAD----ERQNTSFSGQKLHSV  436

Query  1136  VWPGQSVKKAPG  1171
             VWPGQ+ K   G
Sbjct  437   VWPGQTTKVPRG  448


 Score =   395 bits (1015),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 211/327 (65%), Positives = 252/327 (77%), Gaps = 1/327 (0%)
 Frame = +3

Query  1146  GSR*KKPRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYA  1325
             G   K PRGWVF NNG+ LRIGVP R   +E +S V       GF VDVFTAA+NLLPYA
Sbjct  440   GQTTKVPRGWVFSNNGRHLRIGVPNRYRSEEVVS-VKSNGMITGFCVDVFTAALNLLPYA  498

Query  1326  VPFQFVPFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVV  1505
             VPF+ V FGNG +NPS SELVRL++TG +D  +GDI I+T RTK+ DFTQPYV SGL+VV
Sbjct  499   VPFELVAFGNGHDNPSNSELVRLITTGVYDAGVGDITIITERTKMADFTQPYVESGLVVV  558

Query  1506  APFKKLNTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILW  1685
             AP +KL + A AFL PF+ QMW +TA  F++VG V+W LEH+ NDEFRG P +Q IT  W
Sbjct  559   APVRKLGSSAMAFLRPFTPQMWLITAASFLIVGAVIWCLEHKHNDEFRGPPCRQFITTFW  618

Query  1686  FSLSTLFFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESL  1865
             FS STLFF+HRE T S+LGR+VLIIWLFVVLIINSSYTASLTSILTV QL SPIKG+E+L
Sbjct  619   FSFSTLFFSHRETTTSSLGRIVLIIWLFVVLIINSSYTASLTSILTVHQLSSPIKGIETL  678

Query  1866  KEGNDPIGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERP  2045
             +  +DPIGY  GSF   YL+ E+ I +SRL+ L SPE Y +AL  GP KGGV+A+VDER 
Sbjct  679   QANHDPIGYPKGSFVRDYLVHELSIHESRLVPLSSPEEYDKALRDGPGKGGVAAVVDERA  738

Query  2046  YVENFLSTQCKFRIVGQEFTKSGWGFA  2126
             Y+E FLS +C+F IVG+EFTK+GWGF 
Sbjct  739   YIELFLSNRCEFGIVGKEFTKNGWGFV  765



>ref|XP_003561526.1| PREDICTED: glutamate receptor 3.4-like [Brachypodium distachyon]
Length=945

 Score =   467 bits (1201),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 265/417 (64%), Positives = 327/417 (78%), Gaps = 10/417 (2%)
 Frame = +3

Query  1164  PRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGT--NTFKGFSVDVFTAAVNLLPYAVPFQ  1337
             PRGWVFPNNG+ LRIGVP R +Y++F+S+  GT  +   G+ VDVF AAV+LLPY VPF 
Sbjct  453   PRGWVFPNNGRPLRIGVPWRTTYRQFVSK-DGTSPDGASGYCVDVFKAAVSLLPYPVPFS  511

Query  1338  FVPFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPFK  1517
             FV FG+G +NPSY +LV  V+   FD A+GD++IVTNRT+VVDFTQPYV SGL++V+P K
Sbjct  512   FVLFGDGEKNPSYGDLVSKVANDEFDAAVGDVSIVTNRTRVVDFTQPYVESGLVIVSPVK  571

Query  1518  KLNTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSLS  1697
             + N  AWAFL PF+  MW VT  FF+ VG VVW+LEHR N +FRGSP++QL+TI WFS S
Sbjct  572   EKNPNAWAFLKPFTGAMWAVTGAFFLFVGAVVWVLEHRFNPDFRGSPRKQLVTIFWFSFS  631

Query  1698  TLFFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESLKEGN  1877
             T+FFAHRENTVSTLGRMVLIIWLFVVLIINSSYTASLTSILTVQQL + I+G++ L    
Sbjct  632   TMFFAHRENTVSTLGRMVLIIWLFVVLIINSSYTASLTSILTVQQLSTGIQGLDGLIASA  691

Query  1878  DPIGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERPYVEN  2057
             +PIGYQ+GSFA+ Y++EE+ + +SRL  L + + YA +L+ GPH GGV+AIVDE PYV+ 
Sbjct  692   EPIGYQVGSFAKSYMMEELNVPESRLKEL-AIDDYASSLQLGPHNGGVAAIVDELPYVDL  750

Query  2058  FLSTQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWL----t  2225
             FLST C+F+ VGQEFTKSGWGFAF RDSPLAVD+STAIL+LSENGDLQRIHDKWL     
Sbjct  751   FLSTNCQFKTVGQEFTKSGWGFAFQRDSPLAVDLSTAILTLSENGDLQRIHDKWLNPGQC  810

Query  2226  rtscssestelesDRLHLKSFWglfllcgaacflalfIYFVQIMLKF--RRVARAEP  2390
               +         +DRL+L SFWGLFL+ G ACFLAL +YF +I+ ++   ++A  EP
Sbjct  811   DGATQGADVTAAADRLNLGSFWGLFLISGVACFLALLVYFARILCQYGKYKLAGGEP  867


 Score =   363 bits (932),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 195/389 (50%), Positives = 254/389 (65%), Gaps = 24/389 (6%)
 Frame = +2

Query  59    VAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTTQ  238
             + AL+ M+  VVA++GPQSS +AH +SHV NEL VPLL+FAATDP LAS Q+PY LR  +
Sbjct  85    IQALQLMEKKVVAVVGPQSSGIAHVVSHVVNELHVPLLTFAATDPALASSQYPYLLRAAR  144

Query  239   -SDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGA  415
               D  QM A+AD++  YGW++V AV+ D D+GR G+ AL DAL   R +I+ +A  PPGA
Sbjct  145   GDDASQMAAVADIVAFYGWRQVAAVYADTDHGRGGVDALGDALEPHRARIALRAPFPPGA  204

Query  416   TTRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVLD  595
              + A + D+LVQ++L ESRV+V+H  P +G  VFS A  LGMM  GYVWI+TDWL+  +D
Sbjct  205   GS-AAMADLLVQVSLAESRVIVVHVSPDSGLAVFSAARSLGMMAAGYVWIATDWLAAAID  263

Query  596   SSSPL------PSEKMEIMQGVLVLRQHTPDSELKRAF--TSRWKHLTGGSLGLNSYALY  751
             SSS        P   M ++QGVL LR+++PDS  KRA    SR KH       LN+Y L 
Sbjct  264   SSSSSSHPANHPKSTMGLIQGVLTLRRYSPDSPAKRALAMASRSKH-------LNAYGLA  316

Query  752   AYDSVWLIAHAIDSFLNKGGVISFSNDSKLQSIE---GSTLHLEALSIFDGGPLLLNNLL  922
             AYDSVW  A AID+FL  G  ++FS+D +LQ+ +    STL L AL +FD GP LL  LL
Sbjct  317   AYDSVWTAARAIDAFLADGLDVTFSDDPRLQAEQSGSNSTLRLGALKVFDQGPRLLEKLL  376

Query  923   QSDFVGLTGQFKFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPN  1102
              S+  G+TG  +F  D+SLV P Y++LNV GTG R +GFW N + LS A P+T      N
Sbjct  377   LSNSTGITGALRFGADRSLVDPVYEVLNVGGTGVRRVGFWSNRTRLSLAAPDT----KKN  432

Query  1103  SSSANQKLYGVVWPGQSVKKAPGVGFPEQ  1189
              SS+ Q LY V+WPG++     G  FP  
Sbjct  433   GSSSQQGLYSVIWPGETTATPRGWVFPNN  461



>ref|XP_003608176.1| Glutamate receptor 3.3, partial [Medicago truncatula]
Length=799

 Score =   458 bits (1178),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 236/376 (63%), Positives = 298/376 (79%), Gaps = 0/376 (0%)
 Frame = +3

Query  1164  PRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYAVPFQFV  1343
             PRGWVF +NG++L++GVP+++SY E +S++ G++ F G+ +DVFTAAV LLPY+VP +++
Sbjct  402   PRGWVFASNGRRLKVGVPLKISYHELVSRIKGSDMFAGYCIDVFTAAVELLPYSVPCKYI  461

Query  1344  PFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPFKKL  1523
             P G+G+ NP+Y++++  ++ G FD  +GDI I TNRTK+VDFTQPY  SGL+VVAP  KL
Sbjct  462   PVGDGKTNPTYTDILHKMTEGDFDAVVGDITITTNRTKIVDFTQPYSESGLVVVAPIMKL  521

Query  1524  NTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSLSTL  1703
                 WAFL PF+  MW VT  FF VVG VVWI+E R ND+FRG  K+Q +TILWFS ST+
Sbjct  522   KASPWAFLRPFAPMMWLVTGVFFFVVGSVVWIVERRFNDDFRGPAKKQFVTILWFSFSTM  581

Query  1704  FFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESLKEGNDP  1883
             F  HRE TVSTLGR++LIIWLFVV+I+NSSYT+SLTSILTV+QL S +KG+ESL   ND 
Sbjct  582   FSTHREKTVSTLGRLLLIIWLFVVMILNSSYTSSLTSILTVEQLSSSVKGLESLATSNDR  641

Query  1884  IGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERPYVENFL  2063
             IGY  GSF+E+YL +E+ I +SRL+ L SP  Y +AL+ GP  GGV+AIVDER Y+E FL
Sbjct  642   IGYLRGSFSENYLTQELNIHRSRLVPLNSPSEYEKALKDGPTNGGVAAIVDERAYMEIFL  701

Query  2064  STQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLtrtscss  2243
               +C+F I+GQEFTK GWGFAFPRDSPLA+DMSTAIL LSENG LQRIHDKWLTR+SC S
Sbjct  702   EMRCEFGIIGQEFTKMGWGFAFPRDSPLAIDMSTAILKLSENGGLQRIHDKWLTRSSCRS  761

Query  2244  estelesDRLHLKSFW  2291
             E  +   DRL L+SFW
Sbjct  762   EEEKQGMDRLDLQSFW  777


 Score =   371 bits (952),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 191/385 (50%), Positives = 246/385 (64%), Gaps = 49/385 (13%)
 Frame = +2

Query  65    ALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTTQSD  244
              L  M+ + VAI+GPQ SV+AH ISH+ANE+QVP+LSFAATDPTL SL+FPYF+RTTQSD
Sbjct  59    TLLLMEKETVAIIGPQFSVMAHVISHIANEMQVPILSFAATDPTLTSLEFPYFVRTTQSD  118

Query  245   MYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGATTR  424
             + QM A+AD++DH+ W++VIA+FIDDD+GRNGIAAL D LA K  KISYKA + P   T 
Sbjct  119   LNQMAAVADIVDHFQWRDVIAIFIDDDHGRNGIAALGDKLAEKHSKISYKAALRPDQLTT  178

Query  425   AEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVLDSSS  604
              EI + L ++ALMESRV+VLH     G  V  +A    MMG GYVWI+TDWLST+LDS  
Sbjct  179   DEINNALFKVALMESRVIVLHVTLHFGLQVLHLAQSHEMMGSGYVWIATDWLSTILDSDP  238

Query  605   PLP-SEKMEIMQGVLVLRQHTPDSELKRAFTSRWK------------HLTGGSLGLNSYA  745
              L  S  M  MQGV+ LR +TP+S+ KR FTSRW             H  G S GLN + 
Sbjct  239   SLSTSATMNDMQGVITLRMYTPESKNKRNFTSRWNRNLSHNIGSDHDHNHGPSFGLNMFG  298

Query  746   LYAYDSVWLIAHAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQ  925
             LYAYD+V+++A A+D+F N GG +SFSNDS L  + G TLHL+ + +F  G +LL  +L+
Sbjct  299   LYAYDTVYVLASALDAFFNSGGTLSFSNDSNLNMLRGDTLHLDNMKVFVNGSMLLQKILE  358

Query  926   SDFVGLTGQFKFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNS  1105
              +  GLTG   F+++ +L+ PSY+I+NVIG                              
Sbjct  359   VNITGLTGNIMFDSNGNLMNPSYEIINVIG------------------------------  388

Query  1106  SSANQKLYGVVWPGQSVKKAPGVGF  1180
                   LYGV+WPGQ+     G  F
Sbjct  389   ------LYGVIWPGQTTHTPRGWVF  407



>gb|EMS63860.1| Glutamate receptor 3.4 [Triticum urartu]
Length=876

 Score =   440 bits (1131),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 214/393 (54%), Positives = 279/393 (71%), Gaps = 8/393 (2%)
 Frame = +2

Query  32    FRFVDKILLV----AALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTL  199
             ++F+ ++L+     +AL+ M+ +VVA++GPQSS + H ISHV NEL VPLLSFAATDPTL
Sbjct  30    WKFIRQLLVTFPLGSALELMEKNVVAVIGPQSSGIGHVISHVVNELHVPLLSFAATDPTL  89

Query  200   ASLQFPYFLRTTQSDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRC  379
             ++ ++PYF+RTT SD +QM AIA ++D+Y WKEV A+F+DDDYGR G++AL DALAAKR 
Sbjct  90    SASEYPYFIRTTMSDYFQMNAIASIVDYYQWKEVTAIFVDDDYGRGGVSALGDALAAKRA  149

Query  380   KISYKAGIPPGATTRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYV  559
             KIS+KA IPP + T+  I D+L +  +MESRVMV+HA P  G  +FSVA+ L MM  GYV
Sbjct  150   KISHKAAIPPNSNTQV-INDVLFRANMMESRVMVVHANPDTGMKIFSVANKLQMMASGYV  208

Query  560   WISTDWLSTVLDSSSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLT---GGSLG  730
             WI TDWL+ VLDSS+    + M  +QG++VLRQHTP+S+ K  F ++W +     G + G
Sbjct  209   WIVTDWLAAVLDSSASGDLKGMSHIQGLIVLRQHTPESDAKDKFITKWNNAARSRGITSG  268

Query  731   LNSYALYAYDSVWLIAHAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLL  910
             LNSY  YAYDSVW +A  I+ FL+ G  ++FS D +L     STL L  L +FDGG  +L
Sbjct  269   LNSYGFYAYDSVWAVARGINKFLDNGQQVNFSTDPRLHRSNDSTLQLSTLKVFDGGEQML  328

Query  911   NNLLQSDFVGLTGQFKFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYS  1090
               LL ++F GLTG  +F  D +LV P+YDILNV G+G R IG+W NYSGLS A PETLY 
Sbjct  329   QQLLLTNFTGLTGLVQFGPDHNLVRPAYDILNVGGSGSRLIGYWSNYSGLSVAAPETLYQ  388

Query  1091  RPPNSSSANQKLYGVVWPGQSVKKAPGVGFPEQ  1189
             +PPN+SS  Q+LY VVWPG S     G  FP  
Sbjct  389   KPPNASSVAQRLYNVVWPGDSTTTPKGWVFPNN  421


 Score =   387 bits (994),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 219/412 (53%), Positives = 292/412 (71%), Gaps = 16/412 (4%)
 Frame = +3

Query  1164  PRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYAVPFQFV  1343
             P+GWVFPNNG+ LR+GVPI+ S+KE ++   G++   G+ VD+F AA+ LLPY VP QF+
Sbjct  413   PKGWVFPNNGQPLRVGVPIKASFKELVAGGRGSDNVTGYCVDIFNAAIRLLPYPVPCQFI  472

Query  1344  PFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPFKKL  1523
               G+G++NP+Y +++ +++    D A+GD AIV NRTK+ +FTQPY+ SGL++VAP ++ 
Sbjct  473   TIGDGKKNPNYDDIISMIADNSLDAAVGDFAIVRNRTKMAEFTQPYIESGLVIVAPVQRA  532

Query  1524  NTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSLSTL  1703
              + AWAF+ PF+ +MW V             +L  +   +F             FS ST+
Sbjct  533   PSSAWAFMKPFTLEMWDVFYPMLATKS----VLSLKFMRQF------------LFSFSTM  576

Query  1704  FFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESLKEGNDP  1883
             FF+HR+NT S LGR VLIIWLFVVLIINSSYTASLTSILTVQQL + I G+++L     P
Sbjct  577   FFSHRQNTGSALGRFVLIIWLFVVLIINSSYTASLTSILTVQQLSTGITGIDNLISSGLP  636

Query  1884  IGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERPYVENFL  2063
             IGYQ G F ++YLIEE+ I +SRL+AL +   YA+AL +G   GGV+AIVDE PYVE FL
Sbjct  637   IGYQAGKFTKNYLIEELSIPESRLVALNTIHEYADALRRGSGDGGVAAIVDEMPYVEIFL  696

Query  2064  STQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLtrtscss  2243
             S  C FRIVGQEFTK GWGFAF RDSPLA D+STAIL LSE+G LQRIHD+W TR SCS+
Sbjct  697   SYHCDFRIVGQEFTKEGWGFAFQRDSPLAADLSTAILQLSESGQLQRIHDEWFTRPSCST  756

Query  2244  estelesDRLHLKSFWglfllcgaacflalfIYFVQIMLKFRRVARAEPVAD  2399
             + TE+ +  L L+SFWGLFL+C   C LAL ++F+++  ++ R + +E   +
Sbjct  757   DDTEVGATSLGLRSFWGLFLVCALICLLALLVFFIRVCWQYSRYSSSEAAGE  808



>ref|XP_010267706.1| PREDICTED: glutamate receptor 3.7-like isoform X1 [Nelumbo nucifera]
Length=919

 Score =   439 bits (1129),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 233/415 (56%), Positives = 313/415 (75%), Gaps = 1/415 (0%)
 Frame = +3

Query  1146  GSR*KKPRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYA  1325
             G R +KPRGWV  +NG+ LRIGVP R S+ EF++++ GT  F+G+ +DVFTAA  L+PY 
Sbjct  456   GKRTEKPRGWVIGDNGRPLRIGVPYRASFVEFVTEIHGTKDFQGYCIDVFTAARELVPYD  515

Query  1326  VPFQFVPFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVV  1505
             +P++FV FG+G+ NPSY E VR+V+    DGA+GDI IVTNR K+ DFTQPY A+GL++V
Sbjct  516   IPYKFVAFGDGKSNPSYDEFVRMVAENVIDGAVGDITIVTNRMKITDFTQPYAATGLVIV  575

Query  1506  APFKKLNTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILW  1685
             AP     + AW FL PF+  MW VTA FF+++G+V+WILEHR+ND+FRG P++QLIT+  
Sbjct  576   APISNGKSSAWVFLKPFTVDMWCVTASFFILIGVVIWILEHRINDDFRGPPRRQLITMFL  635

Query  1686  FSLSTLFFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESL  1865
             FS STLF  ++E T+S LGRMV+++WLF++++I SSYTA+LTSILT+Q+L SPI G++SL
Sbjct  636   FSFSTLFKTNKEQTLSALGRMVMMVWLFLLMVITSSYTANLTSILTIQKLTSPITGLDSL  695

Query  1866  KEGNDPIGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERP  2045
                  PIGYQ+GSFA  Y+I+   I +SRL++LGSPE Y  AL  GP  GGV+AIVDE P
Sbjct  696   TTSRWPIGYQVGSFARSYMIDNFNIPESRLVSLGSPEDYERALRLGPGNGGVAAIVDELP  755

Query  2046  YVENFLSTQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLt  2225
             YVE FLS +  F IVG+ FTK+GWGFAFPRDSPLA+DMSTAIL LSENG+L +IH KW  
Sbjct  756   YVELFLSNRTDFGIVGEMFTKNGWGFAFPRDSPLAIDMSTAILRLSENGELHKIHKKWFC  815

Query  2226  rt-scssestelesDRLHLKSFWglfllcgaacflalfIYFVQIMLKFRRVARAE  2387
             +      +  + +S++LH+ SFWGLFLLCG    +AL ++  +++ +F +  R +
Sbjct  816   QMGCTEGQGHQSKSNQLHMISFWGLFLLCGIVTIIALLVFLARMVRQFVQYKRKQ  870


 Score =   387 bits (995),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 189/374 (51%), Positives = 260/374 (70%), Gaps = 4/374 (1%)
 Frame = +2

Query  59    VAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTTQ  238
             + A + ++ + VAI+GPQSS +AH IS +AN LQVPL+S+A+TDP+L++LQFP+F+R+TQ
Sbjct  92    IGAFQVLEKEAVAIIGPQSSTIAHMISFIANGLQVPLISYASTDPSLSALQFPFFVRSTQ  151

Query  239   SDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGAT  418
             SD YQM A+AD+I +YGW+EVIA+F DD+YGR+GI++LD+ L  +  KISYK   P G+ 
Sbjct  152   SDAYQMTAMADLIGYYGWREVIAIFADDEYGRSGISSLDNELTKQMSKISYKLAWPTGSN  211

Query  419   TRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVLDS  598
               + I D+L +  L+ +RV V+HA P +G  +FSVA  L MM +GYVWI+TDWL   LDS
Sbjct  212   L-SYITDLLNKTKLIGTRVFVVHANPDSGIAIFSVAQDLQMMTNGYVWIATDWLCATLDS  270

Query  599   SSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLTGGSL---GLNSYALYAYDSVW  769
             S  +    ++ +QGV+ L QHTP S  K+AF SRWKH+    L   GLN+Y LYAYD+VW
Sbjct  271   SPLMNQTSLQNLQGVVGLCQHTPQSLRKKAFVSRWKHMFQKGLVSYGLNTYGLYAYDTVW  330

Query  770   LIAHAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLTG  949
              +A +ID FLN  G I+FS +  L+ ++ S+L L  L  FDGG LL + LLQ +F GLTG
Sbjct  331   AVARSIDDFLNDYGNITFSFNKALRGMQTSSLKLGKLRTFDGGTLLRSKLLQMNFTGLTG  390

Query  950   QFKFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKLY  1129
               +F++D++L+   YDI+N+     R IG+W NYSGLS  PPETL     + S  +QKL 
Sbjct  391   PVRFDSDRNLIGAGYDIINIDEKTIRRIGYWSNYSGLSVVPPETLKRGQRHGSLLDQKLK  450

Query  1130  GVVWPGQSVKKAPG  1171
              V WPG+  +K  G
Sbjct  451   NVTWPGKRTEKPRG  464



>ref|XP_010267707.1| PREDICTED: glutamate receptor 3.7-like isoform X2 [Nelumbo nucifera]
Length=911

 Score =   439 bits (1129),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 233/415 (56%), Positives = 313/415 (75%), Gaps = 1/415 (0%)
 Frame = +3

Query  1146  GSR*KKPRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYA  1325
             G R +KPRGWV  +NG+ LRIGVP R S+ EF++++ GT  F+G+ +DVFTAA  L+PY 
Sbjct  448   GKRTEKPRGWVIGDNGRPLRIGVPYRASFVEFVTEIHGTKDFQGYCIDVFTAARELVPYD  507

Query  1326  VPFQFVPFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVV  1505
             +P++FV FG+G+ NPSY E VR+V+    DGA+GDI IVTNR K+ DFTQPY A+GL++V
Sbjct  508   IPYKFVAFGDGKSNPSYDEFVRMVAENVIDGAVGDITIVTNRMKITDFTQPYAATGLVIV  567

Query  1506  APFKKLNTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILW  1685
             AP     + AW FL PF+  MW VTA FF+++G+V+WILEHR+ND+FRG P++QLIT+  
Sbjct  568   APISNGKSSAWVFLKPFTVDMWCVTASFFILIGVVIWILEHRINDDFRGPPRRQLITMFL  627

Query  1686  FSLSTLFFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESL  1865
             FS STLF  ++E T+S LGRMV+++WLF++++I SSYTA+LTSILT+Q+L SPI G++SL
Sbjct  628   FSFSTLFKTNKEQTLSALGRMVMMVWLFLLMVITSSYTANLTSILTIQKLTSPITGLDSL  687

Query  1866  KEGNDPIGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERP  2045
                  PIGYQ+GSFA  Y+I+   I +SRL++LGSPE Y  AL  GP  GGV+AIVDE P
Sbjct  688   TTSRWPIGYQVGSFARSYMIDNFNIPESRLVSLGSPEDYERALRLGPGNGGVAAIVDELP  747

Query  2046  YVENFLSTQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLt  2225
             YVE FLS +  F IVG+ FTK+GWGFAFPRDSPLA+DMSTAIL LSENG+L +IH KW  
Sbjct  748   YVELFLSNRTDFGIVGEMFTKNGWGFAFPRDSPLAIDMSTAILRLSENGELHKIHKKWFC  807

Query  2226  rt-scssestelesDRLHLKSFWglfllcgaacflalfIYFVQIMLKFRRVARAE  2387
             +      +  + +S++LH+ SFWGLFLLCG    +AL ++  +++ +F +  R +
Sbjct  808   QMGCTEGQGHQSKSNQLHMISFWGLFLLCGIVTIIALLVFLARMVRQFVQYKRKQ  862


 Score =   387 bits (994),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 189/374 (51%), Positives = 260/374 (70%), Gaps = 4/374 (1%)
 Frame = +2

Query  59    VAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTTQ  238
             + A + ++ + VAI+GPQSS +AH IS +AN LQVPL+S+A+TDP+L++LQFP+F+R+TQ
Sbjct  84    IGAFQVLEKEAVAIIGPQSSTIAHMISFIANGLQVPLISYASTDPSLSALQFPFFVRSTQ  143

Query  239   SDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGAT  418
             SD YQM A+AD+I +YGW+EVIA+F DD+YGR+GI++LD+ L  +  KISYK   P G+ 
Sbjct  144   SDAYQMTAMADLIGYYGWREVIAIFADDEYGRSGISSLDNELTKQMSKISYKLAWPTGSN  203

Query  419   TRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVLDS  598
               + I D+L +  L+ +RV V+HA P +G  +FSVA  L MM +GYVWI+TDWL   LDS
Sbjct  204   L-SYITDLLNKTKLIGTRVFVVHANPDSGIAIFSVAQDLQMMTNGYVWIATDWLCATLDS  262

Query  599   SSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLTGGSL---GLNSYALYAYDSVW  769
             S  +    ++ +QGV+ L QHTP S  K+AF SRWKH+    L   GLN+Y LYAYD+VW
Sbjct  263   SPLMNQTSLQNLQGVVGLCQHTPQSLRKKAFVSRWKHMFQKGLVSYGLNTYGLYAYDTVW  322

Query  770   LIAHAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLTG  949
              +A +ID FLN  G I+FS +  L+ ++ S+L L  L  FDGG LL + LLQ +F GLTG
Sbjct  323   AVARSIDDFLNDYGNITFSFNKALRGMQTSSLKLGKLRTFDGGTLLRSKLLQMNFTGLTG  382

Query  950   QFKFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKLY  1129
               +F++D++L+   YDI+N+     R IG+W NYSGLS  PPETL     + S  +QKL 
Sbjct  383   PVRFDSDRNLIGAGYDIINIDEKTIRRIGYWSNYSGLSVVPPETLKRGQRHGSLLDQKLK  442

Query  1130  GVVWPGQSVKKAPG  1171
              V WPG+  +K  G
Sbjct  443   NVTWPGKRTEKPRG  456



>ref|XP_008644925.1| PREDICTED: glutamate receptor 3.5-like isoform X1 [Zea mays]
 gb|AFW69069.1| hypothetical protein ZEAMMB73_591659 [Zea mays]
Length=925

 Score =   416 bits (1070),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 205/379 (54%), Positives = 261/379 (69%), Gaps = 4/379 (1%)
 Frame = +2

Query  59    VAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTTQ  238
             + AL+ M+ +VVA++GPQSS + H IS V NEL VPLLSFAATDPTL++ ++PYFLRTT 
Sbjct  89    IKALELMEKNVVAVIGPQSSGIGHAISQVVNELHVPLLSFAATDPTLSASEYPYFLRTTT  148

Query  239   SDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGAT  418
             SD +QM A+A ++D+Y WK V AV+IDD+YGR G++AL DALA KR ++SYKA IPP + 
Sbjct  149   SDYFQMNAVASIVDYYQWKRVTAVYIDDEYGRGGVSALGDALALKRAQVSYKATIPPNSN  208

Query  419   TRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVLDS  598
             T   I D+L +  +MESRVMV+H  P  G  VFS A  L MM  GYVWI TDWL+ VLDS
Sbjct  209   TDV-IRDVLFKANMMESRVMVVHVNPDTGLRVFSAAKKLQMMASGYVWIVTDWLAAVLDS  267

Query  599   SSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLTGG---SLGLNSYALYAYDSVW  769
             S+    + M  +QGV+VLRQHTPDS+ K  F SRW ++      + GLNSY  YAYDSVW
Sbjct  268   SASRNPKYMSNIQGVIVLRQHTPDSDAKNKFISRWNNVARNRSMTPGLNSYGFYAYDSVW  327

Query  770   LIAHAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLTG  949
              +A ++D FLN G  I+FS D +L    G+TL L  L IFDGG  +L  LL ++F GLTG
Sbjct  328   AVARSVDQFLNAGNQINFSTDPRLHDPNGTTLRLSTLKIFDGGDQMLQQLLLTNFTGLTG  387

Query  950   QFKFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKLY  1129
               KF++  +L+ P+YDILNV  +G   IG+W NYSGLS A PE LY   PN+S++  +L 
Sbjct  388   AVKFDSGGNLLHPAYDILNVGRSGTHLIGYWSNYSGLSVAAPEILYQMSPNASTSTHQLN  447

Query  1130  GVVWPGQSVKKAPGVGFPE  1186
              VVWPG S     G  FP 
Sbjct  448   SVVWPGDSTDIPRGWVFPN  466


 Score =   409 bits (1050),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 220/410 (54%), Positives = 309/410 (75%), Gaps = 4/410 (1%)
 Frame = +3

Query  1164  PRGWVFPNNGKQLRIGVPIRVSYKEFIS-QVPGTNTFKGFSVDVFTAAVNLLPYAVPFQF  1340
             PRGWVFPN+G+ LR+GVP++ S+K  +S   P  ++ +G+ +DVF +A+ LLPY VP+QF
Sbjct  459   PRGWVFPNDGQPLRVGVPVKPSFKALVSGSTP--DSVRGYCIDVFKSAIKLLPYPVPYQF  516

Query  1341  VPFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPFKK  1520
             +P G+G +NPSY  +V +V++   D A+GD AIV N T++ ++TQPY+ SGL++VAP K 
Sbjct  517   IPIGDGTKNPSYVSIVGMVASNTLDAAVGDFAIVRNGTRLAEYTQPYIDSGLVIVAPVKH  576

Query  1521  LNTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSLST  1700
             + + AWAFL PF+ +MW +T   F++VGIVVW+LEHR N EFRG P  Q+ITI WFS ST
Sbjct  577   ITSSAWAFLKPFTWEMWFITGALFILVGIVVWLLEHRSNPEFRGPPCNQVITIFWFSFST  636

Query  1701  LFFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESLKEGND  1880
             +FF+H+ENT + LGR VLIIW+FVVLII SSYTASLTSILTVQQL + I G++SL   + 
Sbjct  637   MFFSHQENTRTALGRFVLIIWMFVVLIITSSYTASLTSILTVQQLATGITGLDSLISSSL  696

Query  1881  PIGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERPYVENF  2060
             PIGYQ G F + YL+  + + +SRL+ L + E YA+AL +GP  GGV+AI+DE+PY++ F
Sbjct  697   PIGYQTGKFTKKYLMLNLNVPESRLVQLNTIEEYADALNRGPKNGGVAAIIDEKPYIDIF  756

Query  2061  LSTQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLtr-tsc  2237
             LS  C F+IVGQ+FT+ GWGFAF +DSPLA DMSTAIL LSE+G LQ IHD+W T+ +  
Sbjct  757   LSHYCNFKIVGQQFTREGWGFAFQKDSPLAADMSTAILQLSESGQLQSIHDEWFTQPSCA  816

Query  2238  ssestelesDRLHLKSFWglfllcgaacflalfIYFVQIMLKFRRVARAE  2387
             +++ + + + RL L SFWGLFL+C   C  A+ ++F+++  ++++ + +E
Sbjct  817   TNDESNVGATRLGLGSFWGLFLICALICLFAVVVFFIRVCWQYKQYSNSE  866



>gb|EMT02012.1| Glutamate receptor 3.4 [Aegilops tauschii]
Length=791

 Score =   436 bits (1121),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 211/381 (55%), Positives = 271/381 (71%), Gaps = 4/381 (1%)
 Frame = +2

Query  56    LVAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTT  235
             L +AL+ M+ +VVA++GPQSS + H ISHV NEL VPLLSFAATDPTL++ ++PYF+RTT
Sbjct  24    LGSALELMEKNVVAVIGPQSSGIGHVISHVVNELHVPLLSFAATDPTLSASEYPYFIRTT  83

Query  236   QSDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGA  415
              SD +QM A+A ++D+Y WKEV A+F DDDYGR G++AL DALA +R KIS+KA IPP +
Sbjct  84    MSDYFQMNAVASIVDYYQWKEVTAIFADDDYGRGGVSALGDALATRRAKISHKAAIPPNS  143

Query  416   TTRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVLD  595
              T   I D+L +  +MESRVMV+HA P  G  +FSVA+ L MM  GYVWI TDWL+ VLD
Sbjct  144   NTEV-INDVLFRANMMESRVMVVHANPDTGMRIFSVANKLQMMASGYVWIVTDWLAAVLD  202

Query  596   SSSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLT---GGSLGLNSYALYAYDSV  766
             SS+    + M  +QG++VLRQHTP+S+ K  FT++W +     G + GLNSY  YAYDSV
Sbjct  203   SSASRDLKGMSHIQGLVVLRQHTPESDAKDKFTTKWNNAARSRGINSGLNSYGFYAYDSV  262

Query  767   WLIAHAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLT  946
             W +A  ID FL+ G  ++FS D +L   + STL L  L +FDGG  +L  LL ++F GLT
Sbjct  263   WAVARGIDQFLDNGQQVNFSADPRLHRSKDSTLQLSTLKVFDGGEQMLQQLLLTNFTGLT  322

Query  947   GQFKFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKL  1126
             G  +F  D++LV P+YDILNV G+G R IG+W NYSGLS A PETLY +P N+SS  Q+L
Sbjct  323   GLVQFGPDRNLVRPAYDILNVGGSGSRLIGYWSNYSGLSVAAPETLYQKPSNASSVAQRL  382

Query  1127  YGVVWPGQSVKKAPGVGFPEQ  1189
             Y VVWPG S     G  FP  
Sbjct  383   YNVVWPGDSTTTPKGWVFPNN  403


 Score =   384 bits (987),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 216/408 (53%), Positives = 286/408 (70%), Gaps = 38/408 (9%)
 Frame = +3

Query  1164  PRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYAVPFQFV  1343
             P+GWVFPNNG+ LR+GVPI+ S+KE ++   G++   G+ +D+F AA+ LLPY VP QF+
Sbjct  395   PKGWVFPNNGQPLRVGVPIKASFKELVAGGRGSDNVTGYCIDIFNAAIRLLPYPVPCQFI  454

Query  1344  PFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPFKKL  1523
               G+G++NP+Y +++ +V+    D A+GD AIV NRTK+ +FTQPY+ SGL++VAP ++ 
Sbjct  455   TIGDGKKNPNYDDIISMVADNSLDAAVGDFAIVRNRTKMAEFTQPYIESGLVIVAPVQRA  514

Query  1524  NTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSLSTL  1703
              + AWAF+ PF+ +M                                      WFS ST+
Sbjct  515   PSSAWAFMKPFTLEM--------------------------------------WFSFSTM  536

Query  1704  FFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESLKEGNDP  1883
             FF+HR+NT S LGR VLIIWLFVVLIINSSYTASLTSILTVQQL + I G+++L     P
Sbjct  537   FFSHRQNTGSALGRFVLIIWLFVVLIINSSYTASLTSILTVQQLSTGITGIDNLISSGLP  596

Query  1884  IGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERPYVENFL  2063
             IGYQ G F ++YLIEE+ I +SRL+AL + + YA+AL +G   GGV+AIVDE PYVE FL
Sbjct  597   IGYQAGKFTKNYLIEELSIPESRLVALNTIKEYADALRRGSGDGGVAAIVDEMPYVEIFL  656

Query  2064  STQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLtrtscss  2243
             S  C FRIVGQEFTK GWGFAF RDSPLA D+STAIL LSE+G LQRIHD+W TR SCS+
Sbjct  657   SYHCDFRIVGQEFTKEGWGFAFQRDSPLAADLSTAILQLSESGQLQRIHDEWFTRPSCST  716

Query  2244  estelesDRLHLKSFWglfllcgaacflalfIYFVQIMLKFRRVARAE  2387
             + TE+ +  L L+SFWGLFL+C   C LAL ++F+++  ++ R + +E
Sbjct  717   DDTEVGATSLGLRSFWGLFLVCALICLLALLVFFIRVCWQYSRYSSSE  764



>emb|CAB63012.1| putative glutamate receptor [Arabidopsis thaliana]
Length=1039

 Score =   437 bits (1124),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 199/372 (53%), Positives = 283/372 (76%), Gaps = 7/372 (2%)
 Frame = +2

Query  56    LVAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTT  235
             ++  L+FM+++ VAI+GPQ S  A  ++HVA EL++P+LSF+ATDPT++ LQFP+F+RT+
Sbjct  258   IMEPLQFMESETVAIIGPQRSTTARVVAHVATELKIPILSFSATDPTMSPLQFPFFIRTS  317

Query  236   QSDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGA  415
             Q+D++QM AIAD++  YGW+EV+A++ DDDYGRNG+AAL D L+ KRC+ISYKA +PP A
Sbjct  318   QNDLFQMAAIADIVQFYGWREVVAIYGDDDYGRNGVAALGDRLSEKRCRISYKAALPP-A  376

Query  416   TTRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVLD  595
              TR  I D+L+++AL ESR++V+HA    G  +F+VA  LGMM  GYVWI+T+WLST++D
Sbjct  377   PTRENITDLLIKVALSESRIIVVHASFIWGLELFNVARNLGMMSTGYVWIATNWLSTIID  436

Query  596   SSSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLTGGSLGLNSYALYAYDSVWLI  775
             + SPLP + +  +QGV+ LR HTP+S +K+ F  RW +LT   +GL++YALYAYD+VWL+
Sbjct  437   TDSPLPLDTINNIQGVITLRLHTPNSIMKQNFVQRWHNLT--HVGLSTYALYAYDTVWLL  494

Query  776   AHAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLTGQF  955
             A AID F  KGG +SFS +  +  + G  LHL+AL +FDGG + L ++LQ D +GLTG+ 
Sbjct  495   AQAIDDFFKKGGNVSFSKNPIISELGGGNLHLDALKVFDGGKIFLESILQVDRIGLTGRM  554

Query  956   KFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKLYGV  1135
             KF +D++LV P++D+LNVIGTG+ TIG+W N+SGLS  P + +     N+S + QKL+ V
Sbjct  555   KFTSDRNLVNPAFDVLNVIGTGYTTIGYWFNHSGLSVMPADEM----ENTSFSGQKLHSV  610

Query  1136  VWPGQSVKKAPG  1171
             VWPG S+K   G
Sbjct  611   VWPGHSIKIPRG  622


 Score =   383 bits (983),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 217/403 (54%), Positives = 272/403 (67%), Gaps = 39/403 (10%)
 Frame = +3

Query  1158  KKPRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYAVPFQ  1337
             K PRGWVF NNG+ LRIGVP R  ++E +S V       GF VDVF AA+NLLPYAVPF+
Sbjct  618   KIPRGWVFSNNGRHLRIGVPNRYRFEEVVS-VKSNGMITGFCVDVFIAAINLLPYAVPFE  676

Query  1338  FVPFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPFK  1517
              V FGNG +NPS SELVRL++TG +D  +GDI I+T RTK+ DFTQPYV SGL+VVAP +
Sbjct  677   LVAFGNGHDNPSNSELVRLITTGVYDAGVGDITIITERTKMADFTQPYVESGLVVVAPVR  736

Query  1518  KLNTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSLS  1697
             KL + A AFL PF+ QMW + A  F++VG V+W LEH+ NDEFRG P++Q+IT  W    
Sbjct  737   KLGSSAMAFLRPFTPQMWLIAAASFLIVGAVIWCLEHKHNDEFRGPPRRQVITTFWRDY-  795

Query  1698  TLFFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESLKEGN  1877
                  H++   ++   M +                                 +E+L+  +
Sbjct  796   -----HQQPRKNSADNMAIR--------------------------------IETLQTNH  818

Query  1878  DPIGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERPYVEN  2057
             DPIGY  GSF   YLI E+ I  SRL+ L SPE Y +AL  GP KGGV+A+VDER Y+E 
Sbjct  819   DPIGYPQGSFVRDYLIHELNIHVSRLVPLRSPEEYDKALRDGPGKGGVAAVVDERAYIEL  878

Query  2058  FLSTQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLtrtsc  2237
             FLS +C+F IVGQEFTK+GWGFAFPR+SPLAVD+S AIL LSENGD+QRI DKWL R +C
Sbjct  879   FLSNRCEFGIVGQEFTKNGWGFAFPRNSPLAVDVSAAILQLSENGDMQRIRDKWLLRKAC  938

Query  2238  ssestelesDRLHLKSFWglfllcgaacflalfIYFVQIMLKF  2366
             S +  E+E DRL LKSFWGLF++CG AC LAL +Y V ++ +F
Sbjct  939   SLQGAEIEVDRLELKSFWGLFVVCGVACVLALAVYTVLMIRQF  981


 Score = 77.4 bits (189),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 39/71 (55%), Positives = 47/71 (66%), Gaps = 3/71 (4%)
 Frame = +3

Query  1194  KQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYAVPFQFVPFGNGRENPS  1373
             + LR GVP R    E +  V       GF VDVF AA+NLLPYAVPF+ + FG+G +NPS
Sbjct  100   RHLRSGVPNR---SEEVVSVKSNGMISGFCVDVFIAALNLLPYAVPFELLAFGSGHDNPS  156

Query  1374  YSELVRLVSTG  1406
              SELVRL+ TG
Sbjct  157   NSELVRLIRTG  167


 Score = 58.5 bits (140),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = +2

Query  929   DFVGLTGQFKFNNDKSLVLPSYDILNVIGTGFRTIGFW  1042
             D +GLT + KF  D++LV P++D+LNVIGTG+RTIG+W
Sbjct  50    DRIGLTARIKFTRDRNLVNPAFDLLNVIGTGYRTIGYW  87



>ref|XP_008644926.1| PREDICTED: glutamate receptor 3.5-like isoform X2 [Zea mays]
Length=831

 Score =   411 bits (1057),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 203/373 (54%), Positives = 257/373 (69%), Gaps = 4/373 (1%)
 Frame = +2

Query  77    MQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTTQSDMYQM  256
             M+ +VVA++GPQSS + H IS V NEL VPLLSFAATDPTL++ ++PYFLRTT SD +QM
Sbjct  1     MEKNVVAVIGPQSSGIGHAISQVVNELHVPLLSFAATDPTLSASEYPYFLRTTTSDYFQM  60

Query  257   MAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGATTRAEIM  436
              A+A ++D+Y WK V AV+IDD+YGR G++AL DALA KR ++SYKA IPP + T   I 
Sbjct  61    NAVASIVDYYQWKRVTAVYIDDEYGRGGVSALGDALALKRAQVSYKATIPPNSNTDV-IR  119

Query  437   DILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVLDSSSPLPS  616
             D+L +  +MESRVMV+H  P  G  VFS A  L MM  GYVWI TDWL+ VLDSS+    
Sbjct  120   DVLFKANMMESRVMVVHVNPDTGLRVFSAAKKLQMMASGYVWIVTDWLAAVLDSSASRNP  179

Query  617   EKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLTGG---SLGLNSYALYAYDSVWLIAHAI  787
             + M  +QGV+VLRQHTPDS+ K  F SRW ++      + GLNSY  YAYDSVW +A ++
Sbjct  180   KYMSNIQGVIVLRQHTPDSDAKNKFISRWNNVARNRSMTPGLNSYGFYAYDSVWAVARSV  239

Query  788   DSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLTGQFKFNN  967
             D FLN G  I+FS D +L    G+TL L  L IFDGG  +L  LL ++F GLTG  KF++
Sbjct  240   DQFLNAGNQINFSTDPRLHDPNGTTLRLSTLKIFDGGDQMLQQLLLTNFTGLTGAVKFDS  299

Query  968   DKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKLYGVVWPG  1147
               +L+ P+YDILNV  +G   IG+W NYSGLS A PE LY   PN+S++  +L  VVWPG
Sbjct  300   GGNLLHPAYDILNVGRSGTHLIGYWSNYSGLSVAAPEILYQMSPNASTSTHQLNSVVWPG  359

Query  1148  QSVKKAPGVGFPE  1186
              S     G  FP 
Sbjct  360   DSTDIPRGWVFPN  372


 Score =   408 bits (1049),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 220/410 (54%), Positives = 309/410 (75%), Gaps = 4/410 (1%)
 Frame = +3

Query  1164  PRGWVFPNNGKQLRIGVPIRVSYKEFIS-QVPGTNTFKGFSVDVFTAAVNLLPYAVPFQF  1340
             PRGWVFPN+G+ LR+GVP++ S+K  +S   P  ++ +G+ +DVF +A+ LLPY VP+QF
Sbjct  365   PRGWVFPNDGQPLRVGVPVKPSFKALVSGSTP--DSVRGYCIDVFKSAIKLLPYPVPYQF  422

Query  1341  VPFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPFKK  1520
             +P G+G +NPSY  +V +V++   D A+GD AIV N T++ ++TQPY+ SGL++VAP K 
Sbjct  423   IPIGDGTKNPSYVSIVGMVASNTLDAAVGDFAIVRNGTRLAEYTQPYIDSGLVIVAPVKH  482

Query  1521  LNTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSLST  1700
             + + AWAFL PF+ +MW +T   F++VGIVVW+LEHR N EFRG P  Q+ITI WFS ST
Sbjct  483   ITSSAWAFLKPFTWEMWFITGALFILVGIVVWLLEHRSNPEFRGPPCNQVITIFWFSFST  542

Query  1701  LFFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESLKEGND  1880
             +FF+H+ENT + LGR VLIIW+FVVLII SSYTASLTSILTVQQL + I G++SL   + 
Sbjct  543   MFFSHQENTRTALGRFVLIIWMFVVLIITSSYTASLTSILTVQQLATGITGLDSLISSSL  602

Query  1881  PIGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERPYVENF  2060
             PIGYQ G F + YL+  + + +SRL+ L + E YA+AL +GP  GGV+AI+DE+PY++ F
Sbjct  603   PIGYQTGKFTKKYLMLNLNVPESRLVQLNTIEEYADALNRGPKNGGVAAIIDEKPYIDIF  662

Query  2061  LSTQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLtr-tsc  2237
             LS  C F+IVGQ+FT+ GWGFAF +DSPLA DMSTAIL LSE+G LQ IHD+W T+ +  
Sbjct  663   LSHYCNFKIVGQQFTREGWGFAFQKDSPLAADMSTAILQLSESGQLQSIHDEWFTQPSCA  722

Query  2238  ssestelesDRLHLKSFWglfllcgaacflalfIYFVQIMLKFRRVARAE  2387
             +++ + + + RL L SFWGLFL+C   C  A+ ++F+++  ++++ + +E
Sbjct  723   TNDESNVGATRLGLGSFWGLFLICALICLFAVVVFFIRVCWQYKQYSNSE  772



>ref|XP_003629121.1| Glutamate receptor [Medicago truncatula]
Length=745

 Score =   457 bits (1175),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 236/376 (63%), Positives = 298/376 (79%), Gaps = 0/376 (0%)
 Frame = +3

Query  1164  PRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYAVPFQFV  1343
             PRGWVF +NG++L++GVP+++SY E +S++ G++ F G+ +DVFTAAV LLPY+VP +++
Sbjct  337   PRGWVFASNGRRLKVGVPLKISYHELVSRIKGSDMFAGYCIDVFTAAVELLPYSVPCKYI  396

Query  1344  PFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPFKKL  1523
             P G+G+ NP+Y++++  ++ G FD  +GDI I TNRTK+VDFTQPY  SGL+VVAP  KL
Sbjct  397   PVGDGKTNPTYTDILHKMTEGDFDAVVGDITITTNRTKIVDFTQPYSESGLVVVAPIMKL  456

Query  1524  NTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSLSTL  1703
                 WAFL PF+  MW VT  FF VVG VVWI+E R ND+FRG  K+Q +TILWFS ST+
Sbjct  457   KASPWAFLRPFAPMMWLVTGVFFFVVGSVVWIVERRFNDDFRGPAKKQFVTILWFSFSTM  516

Query  1704  FFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESLKEGNDP  1883
             F  HRE TVSTLGR++LIIWLFVV+I+NSSYT+SLTSILTV+QL S +KG+ESL   ND 
Sbjct  517   FSTHREKTVSTLGRLLLIIWLFVVMILNSSYTSSLTSILTVEQLSSSVKGLESLATSNDR  576

Query  1884  IGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERPYVENFL  2063
             IGY  GSF+E+YL +E+ I +SRL+ L SP  Y +AL+ GP  GGV+AIVDER Y+E FL
Sbjct  577   IGYLRGSFSENYLTQELNIHRSRLVPLNSPSEYEKALKDGPTNGGVAAIVDERAYMEIFL  636

Query  2064  STQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLtrtscss  2243
               +C+F I+GQEFTK GWGFAFPRDSPLA+DMSTAIL LSENG LQRIHDKWLTR+SC S
Sbjct  637   EMRCEFGIIGQEFTKMGWGFAFPRDSPLAIDMSTAILKLSENGGLQRIHDKWLTRSSCRS  696

Query  2244  estelesDRLHLKSFW  2291
             E  +   DRL L+SFW
Sbjct  697   EEEKQGMDRLDLQSFW  712


 Score =   359 bits (922),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 186/366 (51%), Positives = 240/366 (66%), Gaps = 28/366 (8%)
 Frame = +2

Query  77    MQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTTQSDMYQM  256
             M+ + VAI+GPQ SV+AH ISH+ANE+QVP+LSFAATDPTL SL+FPYF+RTTQSD+ QM
Sbjct  1     MEKETVAIIGPQFSVMAHVISHIANEMQVPILSFAATDPTLTSLEFPYFVRTTQSDLNQM  60

Query  257   MAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGATTRAEIM  436
              A+AD++DH+ W++VIA+FIDDD+GRNGIAAL D LA K  KISYKA + P   T  EI 
Sbjct  61    AAVADIVDHFQWRDVIAIFIDDDHGRNGIAALGDKLAEKHSKISYKAALRPDQLTTDEIN  120

Query  437   DILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVLDSSSPLP-  613
             + L ++ALMESRV+VLH     G  V  +A    MMG GYVWI+TDWLST+LDS   L  
Sbjct  121   NALFKVALMESRVIVLHVTLHFGLQVLHLAQSHEMMGSGYVWIATDWLSTILDSDPSLST  180

Query  614   SEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLTGGSLGLNSYALYAYDSVWLIAHAIDS  793
             S  M  MQGV+ LR +     L     S   H  G S GLN + LYAYD+V+++A A+D+
Sbjct  181   SATMNDMQGVITLRIN-----LSHNIGSDHDHNHGPSFGLNMFGLYAYDTVYVLASALDA  235

Query  794   FLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLTGQFKFNNDK  973
             F N GG +SFSNDS L  + G TLHL+ + +F  G  ++                F+++ 
Sbjct  236   FFNSGGTLSFSNDSNLNMLRGDTLHLDNMKVFVNGSNIM----------------FDSNG  279

Query  974   SLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKLYGVVWPGQS  1153
             +L+ PSY+I+NVIG+G R IGFW    GL T          PN S+  + LYGV+WPGQ+
Sbjct  280   NLMNPSYEIINVIGSGIRRIGFWSESYGLHTG------VESPNHSNLRKGLYGVIWPGQT  333

Query  1154  VKKAPG  1171
                  G
Sbjct  334   THTPRG  339



>ref|XP_009121143.1| PREDICTED: glutamate receptor 3.1 isoform X2 [Brassica rapa]
Length=876

 Score =   409 bits (1052),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 195/380 (51%), Positives = 273/380 (72%), Gaps = 7/380 (2%)
 Frame = +2

Query  56    LVAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTT  235
             ++ AL+FM+TDVVAI+GPQ+S++AH +SH+ANEL VP+LSF A DPTL+ LQFP+F++T 
Sbjct  84    IMGALQFMETDVVAIIGPQTSIMAHVLSHLANELTVPMLSFTALDPTLSPLQFPFFVQTA  143

Query  236   QSDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGA  415
              +D++ M AIA++I +YGW +V+A++ DDD  RNG+ AL D L  +RCKISYKA +P   
Sbjct  144   PNDLFLMRAIAEMITYYGWSDVVALYNDDDNSRNGVTALGDELEERRCKISYKAVLPLDV  203

Query  416   --TTRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTV  589
               T+ AEI++ L +I  MESR++V++ +P  G ++F  A  LGMM  GYVWI+T WLS++
Sbjct  204   VITSPAEIIEELTKIRGMESRIIVVNTFPNTGKIIFEEAKKLGMMEKGYVWIATTWLSSL  263

Query  590   LDSSSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLTGGSLGLNSYALYAYDSVW  769
             +DS  PL    ++ + GVL LR HTPDS  KR F +RWK     ++GLN Y LYAYD+VW
Sbjct  264   VDSDFPL---DLKSLNGVLTLRLHTPDSRKKRDFAARWKK--NKTIGLNVYGLYAYDTVW  318

Query  770   LIAHAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLTG  949
             +IA A+ SFL  GG ++FS+D+KL +++G  L+L ALS FD GP LL+ ++++   GLTG
Sbjct  319   IIAQAVKSFLEAGGNLTFSHDAKLSNLKGEALNLSALSRFDEGPQLLDYIMRTKMSGLTG  378

Query  950   QFKFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKLY  1129
               +F+ D+S+V PSYDI+NV+   FR IG+W N+SGLS  PPE+ Y++P N SS+NQ L 
Sbjct  379   PVQFHRDRSMVQPSYDIINVVDGRFRQIGYWSNHSGLSVVPPESFYNKPSNRSSSNQHLN  438

Query  1130  GVVWPGQSVKKAPGVGFPEQ  1189
              V WPG +     G  FP  
Sbjct  439   SVTWPGGTSVTPRGWVFPNN  458


 Score =   405 bits (1041),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 230/406 (57%), Positives = 296/406 (73%), Gaps = 45/406 (11%)
 Frame = +3

Query  1164  PRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFK--GFSVDVFTAAVNLLPYAVPFQ  1337
             PRGWVFPNNGK LRIGVP R S+K+F+S+V G+++ K  G+ +DVF AAV LL Y VP +
Sbjct  450   PRGWVFPNNGKLLRIGVPNRASFKDFVSRVNGSSSHKAQGYCIDVFEAAVKLLSYPVPHE  509

Query  1338  FVPFGNGRENPSYSELVRLVSTGY-FDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPF  1514
             F+ FG+G +NP+Y++LV  V+ G  FD A+GDIAIVT RT++VD+TQPY+ SGL+VVAP 
Sbjct  510   FIFFGDGLQNPNYNDLVNKVANGVDFDAAVGDIAIVTKRTRIVDYTQPYIESGLVVVAPV  569

Query  1515  KKLNTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSL  1694
               LN   WAFL PF+  MW VTA FF+VVG V+WILEHR NDEFRG P++Q+ITILWF+ 
Sbjct  570   TALNENPWAFLRPFTPPMWAVTASFFMVVGAVIWILEHRTNDEFRGPPRRQIITILWFTF  629

Query  1695  STLFFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESLKEG  1874
             ST+FF+H                                    +QQL SPIKGV++L   
Sbjct  630   STMFFSH------------------------------------MQQLNSPIKGVDTLISS  653

Query  1875  NDPIGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERPYVE  2054
             +  IG+Q+GSFAE+Y+I+E+ I++SRL+ALGSP+ YA AL+ G     V+AIVDERPYV+
Sbjct  654   SGRIGFQVGSFAENYMIDELNIARSRLVALGSPQEYATALQNGT----VAAIVDERPYVD  709

Query  2055  NFLSTQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLtrts  2234
              FLS  CKF I GQEFT+ GWGFAFPRDSPLAVDMSTAIL LSE G+LQRIHD+WL++++
Sbjct  710   LFLSDYCKFAIRGQEFTRCGWGFAFPRDSPLAVDMSTAILGLSETGELQRIHDRWLSKSN  769

Query  2235  cssestelesD--RLHLKSFWglfllcgaacflalfIYFVQIMLKF  2366
             CSS       D  +L++ SFWG+FL+CG ACF+ALFI+FV+++  F
Sbjct  770   CSSPHGSQSGDSEQLNVHSFWGMFLVCGIACFVALFIHFVKVVRNF  815



>ref|XP_008447826.1| PREDICTED: glutamate receptor 3.2 [Cucumis melo]
Length=922

 Score =   448 bits (1152),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 254/412 (62%), Positives = 316/412 (77%), Gaps = 6/412 (1%)
 Frame = +3

Query  1161  KPRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYAVPFQF  1340
             KPRGWV P +G+QLRIGVP RVSY+EF+    G  T KG+ +DVFTAA+NLLPYAV ++F
Sbjct  473   KPRGWVLPLDGRQLRIGVPRRVSYQEFVMPGNGNGTIKGYCIDVFTAAINLLPYAVKYEF  532

Query  1341  VPFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPFKK  1520
             V FG+G ENPSY ELV  V++  FD A+GDIAIVT+RTK+VDFTQPY+ SGL+V+ P KK
Sbjct  533   VLFGDGEENPSYLELVNKVASKEFDAAVGDIAIVTSRTKIVDFTQPYIDSGLVVLTPVKK  592

Query  1521  LNTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSLST  1700
             +N+   AFL PFS  MW VTA FF ++G+VVWILEHR NDEFRG P+ Q++TILWF  ST
Sbjct  593   VNSSPLAFLRPFSPMMWAVTATFFFLIGLVVWILEHRKNDEFRGHPRTQIVTILWFGFST  652

Query  1701  LFFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESLKEGND  1880
             +FFA REN VSTLGR V+++WLFVVLII SSYTA+LTSI TVQ   SPI G++SL   N 
Sbjct  653   MFFAQRENVVSTLGRFVIVVWLFVVLIITSSYTANLTSIFTVQLATSPITGIDSLISSNV  712

Query  1881  PIGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERPYVENF  2060
              IG+Q+GSFAE YL E++ + KSRLIALGSPE YA AL+ G     V AIVDE+PY++ F
Sbjct  713   RIGFQVGSFAETYLSEQLNVQKSRLIALGSPEEYAAALKNGT----VGAIVDEQPYIDLF  768

Query  2061  LSTQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLtrtscs  2240
             L+  C + I GQ+FTKSGWGFAFPRDSPLAVD+STAIL+LSENG LQ+IH+KW   +  S
Sbjct  769   LTEYCDYSIQGQQFTKSGWGFAFPRDSPLAVDLSTAILTLSENGQLQKIHNKWF--SRKS  826

Query  2241  sestelesDRLHLKSFWglfllcgaacflalfIYFVQIMLKFRRVARAEPVA  2396
               S + +S++LHL+SF GLF +C   C  AL ++F+  M +F R  + +P A
Sbjct  827   CSSGDSDSEQLHLQSFIGLFSICAGVCLFALLLHFLATMCQFNRHLKQDPEA  878


 Score =   363 bits (933),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 192/379 (51%), Positives = 254/379 (67%), Gaps = 4/379 (1%)
 Frame = +2

Query  56    LVAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTT  235
             +  A+K+M +D VAILGP+ S +AH +SH++NEL +PLLSF A DPTL+SLQ+PYF++T 
Sbjct  103   ITGAMKYMVSDTVAILGPEDSTMAHILSHLSNELHIPLLSFTALDPTLSSLQYPYFIQTA  162

Query  236   QSDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGA  415
              +D +QM AIAD+I +YGW +V+ VF DDD  RN +  L D L  +  KIS K  +PP  
Sbjct  163   PNDQFQMTAIADIIHYYGWHDVVVVFTDDDQCRNSMIDLGDKLEQRSLKISSKVPLPPFP  222

Query  416   T-TRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVL  592
             T TR ++ D LV+I +MESRV+VL+ +   GF+VF VA  L MM  GYVWI++ WLST +
Sbjct  223   TATRTQVQDALVKIKMMESRVIVLYTFSKTGFLVFEVARSLKMMEPGYVWITSSWLSTEI  282

Query  593   DSSSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLTGG-SLGLNSYALYAYDSVW  769
             DS+S LP +    +QGVL LR HTPDS+ KR+F SRW  L+   S+ LN+Y LYAYD+VW
Sbjct  283   DSTSSLPLDIANSIQGVLTLRLHTPDSKSKRSFISRWNELSNNSSIRLNTYGLYAYDTVW  342

Query  770   LIAHAIDSFLNKGGVISFSNDSK-LQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLT  946
             +IA  +   L++ G ISFS D+K   S+ G TL   +L IF+ G  LL++LL    +GLT
Sbjct  343   MIARGVKKLLDQNGTISFSKDTKSAGSLIGDTLDFSSLRIFNEGNDLLDSLLNISMIGLT  402

Query  947   GQFKFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKL  1126
             G  +F  DKS V PSYDILNV+ +  + IG+W NYSGLS   PETLY +  N S +  KL
Sbjct  403   GPIQF-QDKSPVRPSYDILNVVKSDMKRIGYWSNYSGLSVVAPETLYQKSINRSMSTDKL  461

Query  1127  YGVVWPGQSVKKAPGVGFP  1183
                +WPG    K  G   P
Sbjct  462   NSTMWPGGLKTKPRGWVLP  480



>gb|EAZ02474.1| hypothetical protein OsI_24580 [Oryza sativa Indica Group]
Length=951

 Score =   436 bits (1120),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 257/404 (64%), Positives = 322/404 (80%), Gaps = 6/404 (1%)
 Frame = +3

Query  1164  PRGWVFPNNGKQLRIGVPIRVSYKEFISQ-VPGTNTFKGFSVDVFTAAVNLLPYAVPFQF  1340
             PRGWVFPNNGK LRIGVP R +YK+F+S+   G +   G+ +DVF AAV LL Y VP  +
Sbjct  459   PRGWVFPNNGKALRIGVPYRTTYKQFVSKDAGGPDGASGYCIDVFKAAVALLAYPVPVSY  518

Query  1341  VPFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPFKK  1520
             V  G+G +NPSY ELV+ V+ G  D A+GDI+IVTNRT+VVDFTQPYV SGL++V   ++
Sbjct  519   VVVGDGVKNPSYGELVQRVAEGELDAAVGDISIVTNRTRVVDFTQPYVESGLVIVTAVRE  578

Query  1521  LNTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSLST  1700
               + AWAFL PF+ +MW VT  FF+ VG VVW+LEHR N +FRGSP++QL+T+ WFS ST
Sbjct  579   RASSAWAFLKPFTGEMWAVTGGFFLFVGAVVWVLEHRSNTDFRGSPRKQLVTVFWFSFST  638

Query  1701  LFFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESLKEGND  1880
             +FFAHRENTVSTLGR+VLIIWLFVVLIINSSYTASLTSILTVQQL + I+G++ L   +D
Sbjct  639   MFFAHRENTVSTLGRLVLIIWLFVVLIINSSYTASLTSILTVQQLSTGIQGLDGLIASSD  698

Query  1881  PIGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERPYVENF  2060
             PIG+Q+GSFA+ YL++E+G+ +SRL  L   + YA +L+ G     V+AIVDE PYVE F
Sbjct  699   PIGFQVGSFAKSYLMQELGVPESRLRELAITD-YASSLQTGV----VAAIVDELPYVELF  753

Query  2061  LSTQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLtrtscs  2240
             LST C+FR VGQEFTKSGWGFAF RDSPLAVD+STAIL+LSENGDLQRIHDKWL+   C+
Sbjct  754   LSTNCQFRTVGQEFTKSGWGFAFQRDSPLAVDLSTAILTLSENGDLQRIHDKWLSPGQCA  813

Query  2241  sestelesDRLHLKSFWglfllcgaacflalfIYFVQIMLKFRR  2372
             S+ T++ +DRL+L SFWGLFL+CG ACF+AL I+F + + ++ R
Sbjct  814   SQGTDVGADRLNLSSFWGLFLICGVACFIALLIFFFRTLRQYFR  857


 Score =   375 bits (964),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 181/389 (47%), Positives = 262/389 (67%), Gaps = 13/389 (3%)
 Frame = +2

Query  50    ILLVAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLR  229
             I ++  L+ M+  VVA++GPQSS + H +SHVA+EL++PL+SFAATDPTL S Q+PYFLR
Sbjct  83    IGIIQGLQVMEKKVVAVVGPQSSGIGHVVSHVADELRIPLVSFAATDPTLGSSQYPYFLR  142

Query  230   TTQSDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPP  409
              T SD +QM A+AD+I HY W+E   +++D+DYGR  + AL D L + R K+SY+A +PP
Sbjct  143   ATHSDFFQMAAVADIISHYAWREATLIYVDNDYGRAALDALGDHLQSMRSKVSYRAPLPP  202

Query  410   GATTRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTV  589
              A  RA I D+L+++++MESRV+V+HA P +G  +F+ A  LGMM  GYVWI+T+WL+ +
Sbjct  203   AA-DRAAITDLLLRVSMMESRVIVVHANPDSGLDIFAAAQSLGMMSSGYVWIATEWLAAL  261

Query  590   LDSSS--PLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRW-----KHLTGGSLGLNSYAL  748
             LDS S  P  +  + ++QGV+ LRQ+TPDS+ KR+  SR+      H T G  G+N+Y L
Sbjct  262   LDSDSSPPRKTTALALLQGVVTLRQYTPDSDAKRSLMSRFAARLQAHNTTG--GINAYVL  319

Query  749   YAYDSVWLIAHAIDSFLNKGGVISFSNDSKLQSIE--GSTLHLEALSIFDGGPLLLNNLL  922
             +AYD+VW+ A AID  L  G  +SFS+D++L++    GS L L AL +FD G  LL+ + 
Sbjct  320   FAYDAVWMAARAIDQLLVDGSNVSFSDDARLRAENETGSALRLGALKVFDQGEQLLSKMK  379

Query  923   QSDFVGLTGQFKFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPN  1102
               +F G+TGQ +F +D++L  P+Y++LNV GTG R +G+W N + LS   PE        
Sbjct  380   TLNFTGVTGQVRFGDDRNLADPAYEVLNVGGTGVRRVGYWSNRTRLSVTAPEQ-EQNGKK  438

Query  1103  SSSANQKLYGVVWPGQSVKKAPGVGFPEQ  1189
                  ++LY V+WPG++     G  FP  
Sbjct  439   KKQQGEELYSVIWPGETASTPRGWVFPNN  467



>ref|NP_001058687.1| Os07g0103100 [Oryza sativa Japonica Group]
 dbj|BAF20601.1| Os07g0103100 [Oryza sativa Japonica Group]
 gb|EAZ38406.1| hypothetical protein OsJ_22783 [Oryza sativa Japonica Group]
Length=956

 Score =   435 bits (1119),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 257/404 (64%), Positives = 322/404 (80%), Gaps = 6/404 (1%)
 Frame = +3

Query  1164  PRGWVFPNNGKQLRIGVPIRVSYKEFISQ-VPGTNTFKGFSVDVFTAAVNLLPYAVPFQF  1340
             PRGWVFPNNGK LRIGVP R +YK+F+S+   G +   G+ +DVF AAV LL Y VP  +
Sbjct  459   PRGWVFPNNGKALRIGVPYRTTYKQFVSKDAGGPDGASGYCIDVFKAAVALLAYPVPVSY  518

Query  1341  VPFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPFKK  1520
             V  G+G +NPSY ELV+ V+ G  D A+GDI+IVTNRT+VVDFTQPYV SGL++V   ++
Sbjct  519   VVVGDGVKNPSYGELVQRVAEGELDAAVGDISIVTNRTRVVDFTQPYVESGLVIVTAVRE  578

Query  1521  LNTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSLST  1700
               + AWAFL PF+ +MW VT  FF+ VG VVW+LEHR N +FRGSP++QL+T+ WFS ST
Sbjct  579   RASSAWAFLKPFTREMWAVTGGFFLFVGAVVWVLEHRSNTDFRGSPRKQLVTVFWFSFST  638

Query  1701  LFFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESLKEGND  1880
             +FFAHRENTVSTLGR+VLIIWLFVVLIINSSYTASLTSILTVQQL + I+G++ L   +D
Sbjct  639   MFFAHRENTVSTLGRLVLIIWLFVVLIINSSYTASLTSILTVQQLSTGIQGLDGLIASSD  698

Query  1881  PIGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERPYVENF  2060
             PIG+Q+GSFA+ YL++E+G+ +SRL  L   + YA +L+ G     V+AIVDE PYVE F
Sbjct  699   PIGFQVGSFAKSYLMQELGVPESRLRELAITD-YASSLQTGV----VAAIVDELPYVELF  753

Query  2061  LSTQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLtrtscs  2240
             LST C+FR VGQEFTKSGWGFAF RDSPLAVD+STAIL+LSENGDLQRIHDKWL+   C+
Sbjct  754   LSTNCQFRTVGQEFTKSGWGFAFQRDSPLAVDLSTAILTLSENGDLQRIHDKWLSPGQCA  813

Query  2241  sestelesDRLHLKSFWglfllcgaacflalfIYFVQIMLKFRR  2372
             S+ T++ +DRL+L SFWGLFL+CG ACF+AL I+F + + ++ R
Sbjct  814   SQGTDVGADRLNLSSFWGLFLICGVACFIALLIFFFRTLRQYFR  857


 Score =   375 bits (962),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 180/389 (46%), Positives = 262/389 (67%), Gaps = 13/389 (3%)
 Frame = +2

Query  50    ILLVAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLR  229
             I ++  L+ M+  VVA++GPQSS + H +SHVA+EL++PL+SFAATDPTL S Q+PYFLR
Sbjct  83    IGIIQGLQVMEKKVVAVVGPQSSGIGHVVSHVADELRIPLVSFAATDPTLGSSQYPYFLR  142

Query  230   TTQSDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPP  409
              T SD +QM A+AD+I HY W+E   +++D+DYGR  + AL D L + R K+SY+A +PP
Sbjct  143   ATHSDFFQMAAVADIISHYAWREATLIYVDNDYGRAALDALGDHLQSMRSKVSYRAPLPP  202

Query  410   GATTRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTV  589
              A  RA I D+L+++++MESRV+V+HA P +G  +F+ A  LGMM  GYVWI+T+WL+ +
Sbjct  203   AA-DRAAITDLLLRVSMMESRVIVVHANPDSGLDIFAAAQSLGMMSSGYVWIATEWLAAL  261

Query  590   LDSSS--PLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRW-----KHLTGGSLGLNSYAL  748
             LDS S  P  +  + ++QGV+ LRQ+TPDS+ KR+  SR+      H T G  G+N+Y L
Sbjct  262   LDSDSSPPRKTTALALLQGVVTLRQYTPDSDAKRSLMSRFAARLQAHNTTG--GINAYVL  319

Query  749   YAYDSVWLIAHAIDSFLNKGGVISFSNDSKLQSIE--GSTLHLEALSIFDGGPLLLNNLL  922
             +AYD+VW+ A A+D  L  G  +SFS+D++L++    GS L L AL +FD G  LL+ + 
Sbjct  320   FAYDAVWMAARAVDQLLVDGSNVSFSDDARLRAENETGSALRLGALKVFDQGEQLLSKMK  379

Query  923   QSDFVGLTGQFKFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPN  1102
               +F G+TGQ +F +D++L  P+Y++LNV GTG R +G+W N + LS   PE        
Sbjct  380   TLNFTGVTGQVRFGDDRNLADPAYEVLNVGGTGVRRVGYWSNRTRLSVTAPEQ-EQNGKK  438

Query  1103  SSSANQKLYGVVWPGQSVKKAPGVGFPEQ  1189
                  ++LY V+WPG++     G  FP  
Sbjct  439   KKQQGEELYSVIWPGETASTPRGWVFPNN  467



>dbj|BAC10393.1| glutamate receptor, ionotropic kainate 5 precursor-like protein 
[Oryza sativa Japonica Group]
Length=955

 Score =   435 bits (1119),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 257/404 (64%), Positives = 322/404 (80%), Gaps = 6/404 (1%)
 Frame = +3

Query  1164  PRGWVFPNNGKQLRIGVPIRVSYKEFISQ-VPGTNTFKGFSVDVFTAAVNLLPYAVPFQF  1340
             PRGWVFPNNGK LRIGVP R +YK+F+S+   G +   G+ +DVF AAV LL Y VP  +
Sbjct  458   PRGWVFPNNGKALRIGVPYRTTYKQFVSKDAGGPDGASGYCIDVFKAAVALLAYPVPVSY  517

Query  1341  VPFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPFKK  1520
             V  G+G +NPSY ELV+ V+ G  D A+GDI+IVTNRT+VVDFTQPYV SGL++V   ++
Sbjct  518   VVVGDGVKNPSYGELVQRVAEGELDAAVGDISIVTNRTRVVDFTQPYVESGLVIVTAVRE  577

Query  1521  LNTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSLST  1700
               + AWAFL PF+ +MW VT  FF+ VG VVW+LEHR N +FRGSP++QL+T+ WFS ST
Sbjct  578   RASSAWAFLKPFTREMWAVTGGFFLFVGAVVWVLEHRSNTDFRGSPRKQLVTVFWFSFST  637

Query  1701  LFFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESLKEGND  1880
             +FFAHRENTVSTLGR+VLIIWLFVVLIINSSYTASLTSILTVQQL + I+G++ L   +D
Sbjct  638   MFFAHRENTVSTLGRLVLIIWLFVVLIINSSYTASLTSILTVQQLSTGIQGLDGLIASSD  697

Query  1881  PIGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERPYVENF  2060
             PIG+Q+GSFA+ YL++E+G+ +SRL  L   + YA +L+ G     V+AIVDE PYVE F
Sbjct  698   PIGFQVGSFAKSYLMQELGVPESRLRELAITD-YASSLQTGV----VAAIVDELPYVELF  752

Query  2061  LSTQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLtrtscs  2240
             LST C+FR VGQEFTKSGWGFAF RDSPLAVD+STAIL+LSENGDLQRIHDKWL+   C+
Sbjct  753   LSTNCQFRTVGQEFTKSGWGFAFQRDSPLAVDLSTAILTLSENGDLQRIHDKWLSPGQCA  812

Query  2241  sestelesDRLHLKSFWglfllcgaacflalfIYFVQIMLKFRR  2372
             S+ T++ +DRL+L SFWGLFL+CG ACF+AL I+F + + ++ R
Sbjct  813   SQGTDVGADRLNLSSFWGLFLICGVACFIALLIFFFRTLRQYFR  856


 Score =   374 bits (960),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 179/383 (47%), Positives = 259/383 (68%), Gaps = 13/383 (3%)
 Frame = +2

Query  68    LKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTTQSDM  247
             L+ M+  VVA++GPQSS + H +SHVA+EL++PL+SFAATDPTL S Q+PYFLR T SD 
Sbjct  88    LQVMEKKVVAVVGPQSSGIGHVVSHVADELRIPLVSFAATDPTLGSSQYPYFLRATHSDF  147

Query  248   YQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGATTRA  427
             +QM A+AD+I HY W+E   +++D+DYGR  + AL D L + R K+SY+A +PP A  RA
Sbjct  148   FQMAAVADIISHYAWREATLIYVDNDYGRAALDALGDHLQSMRSKVSYRAPLPPAA-DRA  206

Query  428   EIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVLDSSS-  604
              I D+L+++++MESRV+V+HA P +G  +F+ A  LGMM  GYVWI+T+WL+ +LDS S 
Sbjct  207   AITDLLLRVSMMESRVIVVHANPDSGLDIFAAAQSLGMMSSGYVWIATEWLAALLDSDSS  266

Query  605   -PLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRW-----KHLTGGSLGLNSYALYAYDSV  766
              P  +  + ++QGV+ LRQ+TPDS+ KR+  SR+      H T G  G+N+Y L+AYD+V
Sbjct  267   PPRKTTALALLQGVVTLRQYTPDSDAKRSLMSRFAARLQAHNTTG--GINAYVLFAYDAV  324

Query  767   WLIAHAIDSFLNKGGVISFSNDSKLQSIE--GSTLHLEALSIFDGGPLLLNNLLQSDFVG  940
             W+ A A+D  L  G  +SFS+D++L++    GS L L AL +FD G  LL+ +   +F G
Sbjct  325   WMAARAVDQLLVDGSNVSFSDDARLRAENETGSALRLGALKVFDQGEQLLSKMKTLNFTG  384

Query  941   LTGQFKFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQ  1120
             +TGQ +F +D++L  P+Y++LNV GTG R +G+W N + LS   PE             +
Sbjct  385   VTGQVRFGDDRNLADPAYEVLNVGGTGVRRVGYWSNRTRLSVTAPEQ-EQNGKKKKQQGE  443

Query  1121  KLYGVVWPGQSVKKAPGVGFPEQ  1189
             +LY V+WPG++     G  FP  
Sbjct  444   ELYSVIWPGETASTPRGWVFPNN  466



>ref|XP_010680624.1| PREDICTED: glutamate receptor 3.6-like [Beta vulgaris subsp. 
vulgaris]
Length=907

 Score =   442 bits (1138),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 251/415 (60%), Positives = 315/415 (76%), Gaps = 0/415 (0%)
 Frame = +3

Query  1146  GSR*KKPRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYA  1325
             G   ++PRGWV+ NNGK LRIGVP RV+Y EF+S    TN+F G+S+DVFTAA+NLLPY 
Sbjct  459   GQSTERPRGWVYSNNGKVLRIGVPRRVTYLEFVSYSAQTNSFTGYSIDVFTAALNLLPYG  518

Query  1326  VPFQFVPFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVV  1505
             V ++ +PFG+G+ NP+  +L+  +S+G FD  +GDI I T R ++VDFTQP+V SGL+VV
Sbjct  519   VSYKLIPFGDGKSNPNIDDLINNMSSGVFDAVVGDIVITTKRARLVDFTQPFVESGLVVV  578

Query  1506  APFKKLNTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILW  1685
             AP K  ++ AWAFL P + +MW VT    +V+G+V+WILEHR NDEFRGSP+ Q+ T+LW
Sbjct  579   APAKTKDSDAWAFLWPLTPKMWCVTGLSVIVLGVVIWILEHRFNDEFRGSPRNQIRTVLW  638

Query  1686  FSLSTLFFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESL  1865
             F  ST F +HRE T+S LGR+VL IWLFVVLI+ SSYTASL+SI TVQQLYSP+ G+ESL
Sbjct  639   FGCSTWFGSHRETTLSVLGRVVLFIWLFVVLIVKSSYTASLSSIQTVQQLYSPVTGIESL  698

Query  1866  KEGNDPIGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERP  2045
              E   PIGYQ GSF+ +YL EE+   KS+L+ L + EAYAEAL KGP KGGV A+VD+  
Sbjct  699   MESKYPIGYQKGSFSGNYLHEELHFPKSQLVPLENEEAYAEALRKGPKKGGVVALVDDMT  758

Query  2046  YVENFLSTQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLt  2225
              +E FLS +C+F I GQ FTK+G GFAF R SPLAVDMSTAIL +SENGDLQRIHDKWL 
Sbjct  759   RIEAFLSRRCEFIIRGQRFTKNGRGFAFSRGSPLAVDMSTAILKMSENGDLQRIHDKWLR  818

Query  2226  rtscssestelesDRLHLKSFWglfllcgaacflalfIYFVQIMLKFRRVARAEP  2390
             +++C S+ T+L  DRL LKSFWGLFLL G ACF AL +YF  ++    R +R  P
Sbjct  819   KSACRSQDTKLTVDRLELKSFWGLFLLSGLACFFALIVYFGIMVRDLVRRSRRPP  873


 Score =   365 bits (936),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 174/380 (46%), Positives = 261/380 (69%), Gaps = 12/380 (3%)
 Frame = +2

Query  56    LVAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTT  235
              V  + FM++ VVAI+GP+SS  A+ +S +A  LQ+PL+SF+ATDPTL S+++P+ ++TT
Sbjct  92    FVQTMTFMESGVVAIIGPESSETANVVSGLAQGLQIPLVSFSATDPTLCSMEYPFVVQTT  151

Query  236   QSDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGA  415
             Q+D +QM AIAD+I+++GW+E+ A++ DD YGRNGIA+L D LA  +C+I+YKA + P  
Sbjct  152   QNDRFQMDAIADIINYFGWREITAIYTDDSYGRNGIASLGDKLAENQCRITYKAPMSP-E  210

Query  416   TTRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVLD  595
                 +I  +L ++   ESRV+VLH     G  V  VA  L M+  G+VWI+T+WL  ++D
Sbjct  211   PNEDDIRGVLFRVISEESRVLVLHTNDYYGLKVLKVARSLQMLERGFVWIATNWLIDIID  270

Query  596   SSSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLTGGS-----LGLNSYALYAYD  760
             +  PL S+ M  +QG+L LR HTP+S+LK+ F +RW  L          GLN+Y LYAYD
Sbjct  271   TDPPLSSDAMSDVQGLLTLRAHTPNSQLKKNFMARWSDLVKRKHSNVPFGLNTYGLYAYD  330

Query  761   SVWLIAHAIDSFLNKGGVISFSNDSKLQ--SIEGSTLHLEALSIFDGGPLLLNNLLQSDF  934
             +VW+IA A+D+FL++GG +SF+  S L    +  + LHL+++ I +GG  LL+++ Q + 
Sbjct  331   TVWVIASALDAFLSQGGNLSFTKFSTLNHLKVNYTNLHLDSIRISNGGEKLLSDIYQVNR  390

Query  935   VGLTGQFKFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLY-SRPPNSSS  1111
              GLTG  +F+ D+ L+ P+++ILNV+GTG  T+G+W N+SGLS  PP  ++ S+PP    
Sbjct  391   TGLTGHIQFDQDRHLINPAFEILNVVGTGLNTVGYWSNFSGLSAKPPGVVHDSKPP---G  447

Query  1112  ANQKLYGVVWPGQSVKKAPG  1171
             A Q L  V+WPGQS ++  G
Sbjct  448   ARQHLSSVIWPGQSTERPRG  467



>ref|XP_010515559.1| PREDICTED: glutamate receptor 3.6-like isoform X3 [Camelina sativa]
Length=751

 Score =   435 bits (1119),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 199/372 (53%), Positives = 277/372 (74%), Gaps = 7/372 (2%)
 Frame = +2

Query  56    LVAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTT  235
             ++  L FM+++ VAI+GPQ S  A  ++HVA EL+VP+LSF+ATDPT++ LQFP+F+RT 
Sbjct  84    IMEPLHFMESETVAIIGPQRSTTARVVAHVATELKVPILSFSATDPTMSPLQFPFFIRTA  143

Query  236   QSDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGA  415
              +D++QM AIAD++  YGW+EV+A++ DDDYGRNGIA+L D LA KRC+ISYKA +PPG 
Sbjct  144   HNDLFQMAAIADIVQFYGWREVVAIYGDDDYGRNGIASLGDRLAEKRCRISYKAALPPGP  203

Query  416   TTRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVLD  595
              TR  I D+L+++AL ESR++V+HA    G  +F+VA  LGMM  GYVWI+T+WLST++D
Sbjct  204   -TRENITDLLIKVALSESRIIVIHASFIWGLELFNVAQNLGMMSTGYVWIATNWLSTIID  262

Query  596   SSSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLTGGSLGLNSYALYAYDSVWLI  775
             + SPLP + +  +QGV+ LR HTP+S +K+ F  RW++LT   +GL++Y LYAYD+VWL+
Sbjct  263   TDSPLPLDTINNIQGVIALRPHTPNSIMKQNFVQRWRNLT--RVGLSTYGLYAYDTVWLL  320

Query  776   AHAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLTGQF  955
             A AI+ F  KGG +SFS +  L  + G  LHL+AL +FDGG + L ++LQ D +GLTG+ 
Sbjct  321   AQAIEDFFQKGGNVSFSKNPILSELVGGNLHLDALKVFDGGKMFLESILQVDRIGLTGRM  380

Query  956   KFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKLYGV  1135
             KF  D++LV P +D+LNVIGTG+RTIG+W N+ GLS  P +       N+S + QKL+ V
Sbjct  381   KFTRDRNLVNPEFDVLNVIGTGYRTIGYWSNHLGLSVVPAD----ERQNTSFSGQKLHSV  436

Query  1136  VWPGQSVKKAPG  1171
             VWPGQ+ K   G
Sbjct  437   VWPGQTTKVPRG  448


 Score =   369 bits (946),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 199/310 (64%), Positives = 237/310 (76%), Gaps = 1/310 (0%)
 Frame = +3

Query  1146  GSR*KKPRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYA  1325
             G   K PRGWVF NNG+ LRIGVP R   +E +S V       GF VDVFTAA+NLLPYA
Sbjct  440   GQTTKVPRGWVFSNNGRHLRIGVPNRYRSEEVVS-VKSNGMITGFCVDVFTAALNLLPYA  498

Query  1326  VPFQFVPFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVV  1505
             VPF+ V FGNG +NPS SELVRL++TG +D  +GDI I+T RTK+ DFTQPYV SGL+VV
Sbjct  499   VPFELVAFGNGHDNPSNSELVRLITTGVYDAGVGDITIITERTKMADFTQPYVESGLVVV  558

Query  1506  APFKKLNTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILW  1685
             AP +KL + A AFL PF+ QMW +TA  F++VG V+W LEH+ NDEFRG P +Q IT  W
Sbjct  559   APVRKLGSSAMAFLRPFTPQMWLITAASFLIVGAVIWCLEHKHNDEFRGPPCRQFITTFW  618

Query  1686  FSLSTLFFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESL  1865
             FS STLFF+HRE T S+LGR+VLIIWLFVVLIINSSYTASLTSILTV QL SPIKG+E+L
Sbjct  619   FSFSTLFFSHRETTTSSLGRIVLIIWLFVVLIINSSYTASLTSILTVHQLSSPIKGIETL  678

Query  1866  KEGNDPIGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERP  2045
             +  +DPIGY  GSF   YL+ E+ I +SRL+ L SPE Y +AL  GP KGGV+A+VDER 
Sbjct  679   QANHDPIGYPKGSFVRDYLVHELSIHESRLVPLSSPEEYDKALRDGPGKGGVAAVVDERA  738

Query  2046  YVENFLSTQC  2075
             Y+E FLS +C
Sbjct  739   YIELFLSNRC  748



>gb|EMT06987.1| Glutamate receptor 3.3 [Aegilops tauschii]
Length=901

 Score =   427 bits (1098),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 205/381 (54%), Positives = 279/381 (73%), Gaps = 7/381 (2%)
 Frame = +2

Query  56    LVAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTT  235
             +V AL+FM+TDVVA++GPQ S ++H IS+VANEL+VPL+SFA +D TL+S+QFP+F+RT 
Sbjct  86    MVQALQFMETDVVALIGPQCSTISHIISYVANELRVPLMSFA-SDATLSSIQFPFFVRTG  144

Query  236   QSDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGA  415
              +D+YQM A+A+V+D+  WK V A++ID+ YGRNGIAALDDALA KRCKISYK G P  A
Sbjct  145   PNDLYQMAAVAEVVDYNHWKIVTAIYIDNVYGRNGIAALDDALALKRCKISYKVGFPSNA  204

Query  416   TTRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVLD  595
               R+E++++LV ++ MESRV++LH     G  +FS+   L MMG+GYVWI+TDWLS  LD
Sbjct  205   K-RSELINLLVSVSYMESRVIILHTGAEPGLKLFSMVKQLNMMGNGYVWIATDWLSAYLD  263

Query  596   SSSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLTGGS----LGLNSYALYAYDS  763
             ++S  P++ +  +QGVL LR H P+S++K    S+W   +  S    L +N+Y  Y YDS
Sbjct  264   ANSSAPAQTISGLQGVLTLRPHIPNSKMKSNLVSKWNKQSKKSNYSDLRVNTYGFYVYDS  323

Query  764   VWLIAHAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGL  943
             VW +A A+D+F + GG ISFSNDS L    G TLHLEA+SI D G  LL  + + +F G+
Sbjct  324   VWAVARALDAFFDDGGRISFSNDSMLHDETGGTLHLEAMSISDMGNKLLEKIRKVNFTGV  383

Query  944   TGQFKFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSG-LSTAPPETLYSRPPNSSSANQ  1120
             +GQ +F+   +L+ P+YDI+N+IG G RTIGFW NYSG LST  PE LYS+PPN S A+Q
Sbjct  384   SGQVQFDAGGNLIHPAYDIINIIGNGMRTIGFWSNYSGLLSTVSPEALYSKPPNISLADQ  443

Query  1121  KLYGVVWPGQSVKKAPGVGFP  1183
              LY V+WPG++ ++  G  FP
Sbjct  444   HLYDVIWPGETAQRPRGWVFP  464


 Score =   375 bits (962),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 232/429 (54%), Positives = 295/429 (69%), Gaps = 72/429 (17%)
 Frame = +3

Query  1158  KKPRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYAVPFQ  1337
             ++PRGWVFP+N KQL+IGVP R S+KEF+++   T + KG+ +DVFT A+ LLPY V ++
Sbjct  456   QRPRGWVFPSNAKQLKIGVPNRFSFKEFVTKDNSTGSMKGYCIDVFTQALALLPYPVSYK  515

Query  1338  FVPFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPFK  1517
             FVPFGNG ENP+Y +LV+++ +                                      
Sbjct  516   FVPFGNGTENPNYDKLVQMIES--------------------------------------  537

Query  1518  KLNTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSLS  1697
                        PF+ QMW VT  +F++VG+VVW+LEHR+ND+FRGS +QQ+ITI WFS S
Sbjct  538   ----------NPFTLQMWCVTGSYFLIVGVVVWVLEHRINDDFRGSVRQQIITIFWFSFS  587

Query  1698  TLFFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESLKEGN  1877
             TLFFAHRENT+S+ GR VLIIWLFVVLII SSYTASLTSILTVQQL + IKG++ LK  N
Sbjct  588   TLFFAHRENTMSSSGRGVLIIWLFVVLIIVSSYTASLTSILTVQQLDTSIKGIDDLKSSN  647

Query  1878  DPIGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERPYVEN  2057
             DPIG+Q+GSFA+ Y+++E+ IS+SRL AL SP+ YAEAL+ GP +GGV AIVDERPYVE 
Sbjct  648   DPIGFQVGSFAQDYMVKELNISRSRLRALSSPQEYAEALKLGPKEGGVMAIVDERPYVEL  707

Query  2058  FLSTQCKFRIVGQEFTKSGWGF-----------------------AFPRDSPLAVDMSTA  2168
             FLST CK  + G +FT  GWGF                       AFPRDSPL VD+STA
Sbjct  708   FLSTYCKIAVAGTDFTSRGWGFSIVESSQRLIFRNGGRLTSSFYQAFPRDSPLQVDLSTA  767

Query  2169  ILSLSENGDLQRIHDKWLtrtscsseste-lesDRLHLKSFWglfllcgaacflalfIYF  2345
             ILSLSENG+LQRIHDKWL    C+++++E ++SD+L L+SF GLFL+CG AC LAL IYF
Sbjct  768   ILSLSENGELQRIHDKWLKTGECATDNSEFVDSDQLRLESFLGLFLICGVACILALLIYF  827

Query  2346  VQIMLKFRR  2372
               ++ K+ R
Sbjct  828   GIMLRKYLR  836



>ref|XP_010426706.1| PREDICTED: glutamate receptor 3.6 isoform X2 [Camelina sativa]
Length=751

 Score =   434 bits (1116),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 199/372 (53%), Positives = 276/372 (74%), Gaps = 7/372 (2%)
 Frame = +2

Query  56    LVAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTT  235
             ++  L FM+++ VAI+GPQ S  A  ++HVA EL+VP+LSF+ATDPT++ LQFP+F+RT 
Sbjct  84    IMEPLHFMESETVAIIGPQRSTTARVVAHVATELRVPILSFSATDPTMSPLQFPFFIRTA  143

Query  236   QSDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGA  415
              +D++QM AIAD++  YGW+EV+A++ DDDYGRNG+A+L D LA KRC+ISYKA +PPG 
Sbjct  144   HNDLFQMAAIADIVQFYGWREVVAIYGDDDYGRNGVASLGDRLAEKRCRISYKAALPPGP  203

Query  416   TTRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVLD  595
              TR  I D+L+++AL ESR++V+HA    G  +F+VA  LGMM  GYVWI+T+WLST++D
Sbjct  204   -TRENITDLLIKVALSESRIIVIHASFIWGLELFNVAQNLGMMSTGYVWIATNWLSTIID  262

Query  596   SSSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLTGGSLGLNSYALYAYDSVWLI  775
             + SPLP + +  +QGV+ LR HTP+S +K+ F  RW +LT   +GL++Y LYAYD+VWL+
Sbjct  263   TDSPLPLDTINNIQGVIALRPHTPNSIMKQNFIQRWHNLT--HVGLSTYGLYAYDTVWLL  320

Query  776   AHAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLTGQF  955
             A AID F  KGG +SFS +  L  + G  LHL+AL +FDGG + L ++LQ D +GLTG+ 
Sbjct  321   AQAIDDFFQKGGNVSFSKNPILSELVGGNLHLDALKVFDGGKMFLESILQVDRIGLTGRM  380

Query  956   KFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKLYGV  1135
             KF  D++LV P +D+LNVIGTG+RTIG+W N+ GLS  P +       N+S + QKL+ V
Sbjct  381   KFTRDRNLVNPEFDVLNVIGTGYRTIGYWSNHLGLSVVPAD----ERQNTSFSGQKLHSV  436

Query  1136  VWPGQSVKKAPG  1171
             VWPGQ+ K   G
Sbjct  437   VWPGQTTKVPRG  448


 Score =   367 bits (942),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 198/310 (64%), Positives = 237/310 (76%), Gaps = 1/310 (0%)
 Frame = +3

Query  1146  GSR*KKPRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYA  1325
             G   K PRGWVF NNG+ LRIGVP R   +E +S V       GF VDVFTAA+NLLPYA
Sbjct  440   GQTTKVPRGWVFSNNGRHLRIGVPNRYRSEEVVS-VKSNGMITGFCVDVFTAALNLLPYA  498

Query  1326  VPFQFVPFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVV  1505
             VPF+ V FGNG +NPS SELVRL++TG +D  +GDI I+T RTK+ DFTQPYV SGL+VV
Sbjct  499   VPFELVAFGNGHDNPSNSELVRLITTGVYDAGVGDITIITERTKMADFTQPYVESGLVVV  558

Query  1506  APFKKLNTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILW  1685
             AP +KL + A AFL PF+ QMW +TA  F++VG V+W LEH+ NDEFRG P +Q IT  W
Sbjct  559   APVRKLGSSAMAFLRPFTPQMWLITAASFLIVGAVIWCLEHKHNDEFRGPPCRQFITTFW  618

Query  1686  FSLSTLFFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESL  1865
             FS STLFF+HRE T S+LG++VLIIWLFVVLIINSSYTASLTSILTV QL SPIKG+E+L
Sbjct  619   FSFSTLFFSHRETTTSSLGKIVLIIWLFVVLIINSSYTASLTSILTVHQLSSPIKGIETL  678

Query  1866  KEGNDPIGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERP  2045
             +  +DPIGY  GSF   YL+ E+ I +SRL+ L SPE Y +AL  GP KGGV+A+VDER 
Sbjct  679   QANHDPIGYPKGSFVRDYLVHELNIHESRLVPLSSPEEYDKALRDGPGKGGVAAVVDERA  738

Query  2046  YVENFLSTQC  2075
             Y+E FLS +C
Sbjct  739   YIELFLSNRC  748



>ref|XP_008230072.1| PREDICTED: glutamate receptor 3.7 [Prunus mume]
Length=912

 Score =   426 bits (1096),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 231/417 (55%), Positives = 313/417 (75%), Gaps = 1/417 (0%)
 Frame = +3

Query  1146  GSR*KKPRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYA  1325
             G   ++PRGWV  +N K LRIGVP R S+ EF++++  ++T +G+ +DVFT A  L+PY 
Sbjct  448   GGNTERPRGWVIADNEKPLRIGVPKRASFVEFVTELNDSHTVQGYCIDVFTEARKLVPYD  507

Query  1326  VPFQFVPFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVV  1505
             +P++F PFG+G  NPSY ELV++V+   FD A+GDIAIV NRT +VDF+QPY  +GL++V
Sbjct  508   IPYRFEPFGDGLSNPSYDELVKMVAENVFDAAVGDIAIVKNRTLIVDFSQPYATTGLVIV  567

Query  1506  APFKKLNTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILW  1685
             AP     + AW FL PF+ +MW VTA FFV++ +V+W LEHR+N +FRG PK+QLIT+  
Sbjct  568   APIDNSKSNAWVFLKPFTWEMWCVTAAFFVMIAVVIWTLEHRVNKDFRGPPKRQLITMFL  627

Query  1686  FSLSTLFFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESL  1865
             FS STLF  ++E+TVS LGRMV+++WLF++++I SSYTA+LTSILTVQQL SPI G++SL
Sbjct  628   FSFSTLFKKNQEDTVSPLGRMVMVVWLFLLMVITSSYTANLTSILTVQQLSSPITGIDSL  687

Query  1866  KEGNDPIGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERP  2045
                N PIGYQ+GSFA  YL E + I +SRL+ LGSPE Y +AL +GP+ GGV AI+DE  
Sbjct  688   IASNWPIGYQVGSFAYSYLTESLYIPRSRLVQLGSPEEYEKALRQGPYDGGVGAIIDELT  747

Query  2046  YVENFLSTQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLt  2225
             Y+E FLS Q  F I+GQ FT+SGWGFAF RDSPLA+DMSTAIL LSE+G+L++IH+KW  
Sbjct  748   YIELFLSRQTDFGIIGQTFTRSGWGFAFQRDSPLAIDMSTAILKLSESGELRKIHEKWFC  807

Query  2226  rtsc-ssestelesDRLHLKSFWglfllcgaacflalfIYFVQIMLKFRRVARAEPV  2393
             +  C   ++ E E +RLHL SFWGL+LLCG      L I+ ++++L+F +  + + V
Sbjct  808   KMGCPGEKNLESEPNRLHLISFWGLYLLCGVFSLTVLLIFLLRVVLQFVQYKKQQAV  864


 Score =   373 bits (957),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 182/374 (49%), Positives = 249/374 (67%), Gaps = 4/374 (1%)
 Frame = +2

Query  59    VAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTTQ  238
             V   + +   +VAI+GPQSS +AH IS +AN LQVPL+S+AATDP+L++LQFP+FLRTTQ
Sbjct  84    VEVFQVLHKSIVAIVGPQSSSIAHMISEIANGLQVPLISYAATDPSLSALQFPFFLRTTQ  143

Query  239   SDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGAT  418
             SD YQM A+AD+ID YGWKEVIAV++DDDYGRNG+  L D L  K  +ISYK  +P    
Sbjct  144   SDAYQMAAMADLIDFYGWKEVIAVYVDDDYGRNGVYTLGDELEKKMSRISYKLALPVQFN  203

Query  419   TRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVLDS  598
               ++I ++L +  ++  RV V+H  P     +F+VA  L MM   YVW++TDWLST +DS
Sbjct  204   L-SDITELLNKSKVLGPRVYVVHVDPDPRLRIFTVAKQLQMMTSSYVWLATDWLSTTIDS  262

Query  599   SSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLTGGSLG---LNSYALYAYDSVW  769
              SP     + +++GV+ LRQH P S  K AF SRWK +    L    LN+Y LYAYD+VW
Sbjct  263   FSPTNRTSLTVLEGVVTLRQHIPQSNRKHAFISRWKKMQKEGLASSELNAYGLYAYDTVW  322

Query  770   LIAHAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLTG  949
              +AH+I++F+N+   ISFS   +L   + S + L  L +FDGG LL   LL+++  GLTG
Sbjct  323   AVAHSIENFINEYRNISFSFIDRLHDKKPSKIELGKLKVFDGGSLLRMKLLKTNMSGLTG  382

Query  950   QFKFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKLY  1129
             Q +FN D++LV   YD++N+     RT+GFW NYSG S +PP+TL  R  + S  + KL 
Sbjct  383   QVQFNEDRNLVSGGYDVINIDQMTIRTVGFWTNYSGFSVSPPKTLKGRRSSYSPLDYKLD  442

Query  1130  GVVWPGQSVKKAPG  1171
              V WPG + ++  G
Sbjct  443   NVTWPGGNTERPRG  456



>ref|XP_010503844.1| PREDICTED: glutamate receptor 3.6-like isoform X2 [Camelina sativa]
Length=751

 Score =   433 bits (1113),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 198/372 (53%), Positives = 277/372 (74%), Gaps = 7/372 (2%)
 Frame = +2

Query  56    LVAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTT  235
             ++  L FM+++ VAI+GPQ S  A  ++HVA EL+VP+LSF+ATDPT++ LQFP+F+RT 
Sbjct  84    IMEPLHFMESETVAIIGPQRSTTARVVAHVATELKVPILSFSATDPTMSPLQFPFFIRTA  143

Query  236   QSDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGA  415
              +D++QM AIAD++  YGW+EV+A++ DDDYGRNG+A+L D LA KRC+ISYKA +PP  
Sbjct  144   HNDLFQMAAIADIVQFYGWREVVAIYGDDDYGRNGVASLGDRLAEKRCRISYKAALPP-R  202

Query  416   TTRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVLD  595
              TR  I D+L+++AL ESR++V+HA    G  +F+VA  LGMM  GYVWI+T+WLST++D
Sbjct  203   PTRENITDLLIKVALSESRIIVIHASFIWGLELFNVAQNLGMMSTGYVWIATNWLSTIID  262

Query  596   SSSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLTGGSLGLNSYALYAYDSVWLI  775
             + SPLP + +  +QGV+ LR HTP+S +K+ F  RW++LT   +GL++Y LYAYD+VWL+
Sbjct  263   TDSPLPLDTINNIQGVIALRPHTPNSIMKQNFVQRWRNLT--HVGLSTYGLYAYDTVWLL  320

Query  776   AHAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLTGQF  955
             A AI+ F  KGG +SFS +  L  + G  LHL+AL +FDGG + L ++LQ D +GLTG+ 
Sbjct  321   AQAIEDFFQKGGNVSFSKNPILSELVGGNLHLDALKVFDGGKMFLESILQVDRIGLTGRM  380

Query  956   KFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKLYGV  1135
             KFN D++LV P +D+LNVIGTG+RTIG+W N+ GLS  P +   S    +S + QKL+ V
Sbjct  381   KFNRDRNLVNPEFDVLNVIGTGYRTIGYWSNHLGLSVVPADERQS----TSFSGQKLHSV  436

Query  1136  VWPGQSVKKAPG  1171
             VWPGQ+ K   G
Sbjct  437   VWPGQTTKVPRG  448


 Score =   366 bits (940),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 198/310 (64%), Positives = 236/310 (76%), Gaps = 1/310 (0%)
 Frame = +3

Query  1146  GSR*KKPRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYA  1325
             G   K PRGWVF NNG+ LRIGVP R   +E +S V       GF VDVFTAA+NLLPYA
Sbjct  440   GQTTKVPRGWVFSNNGRHLRIGVPNRYRSEEVVS-VKSNGMITGFCVDVFTAALNLLPYA  498

Query  1326  VPFQFVPFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVV  1505
             VPF+ V FGNG +NPS SELVRL++TG +D  +GDI I+T RTK+ DFTQPYV SGL+VV
Sbjct  499   VPFELVAFGNGHDNPSNSELVRLITTGVYDAGVGDITIITERTKMADFTQPYVESGLVVV  558

Query  1506  APFKKLNTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILW  1685
             AP +KL + A AFL PF+ QMW +TA  F++VG V+W LEH+ ND FRG P +Q IT  W
Sbjct  559   APVRKLGSSAMAFLRPFTPQMWLITAASFLIVGAVIWCLEHKHNDAFRGPPCRQFITTFW  618

Query  1686  FSLSTLFFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESL  1865
             FS STLFF+HRE T S+LGR+VLIIWLFVVLIINSSYTASLTSILTV QL SPIKG+E+L
Sbjct  619   FSFSTLFFSHRETTTSSLGRIVLIIWLFVVLIINSSYTASLTSILTVHQLSSPIKGIETL  678

Query  1866  KEGNDPIGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERP  2045
             +  +DPIGY  GSF   YL+ E+ I +SRL+ L SPE Y +AL  GP KGGV+A+VDER 
Sbjct  679   QANHDPIGYPKGSFVRDYLVHELNIHESRLVPLSSPEEYDKALRDGPGKGGVAAVVDERA  738

Query  2046  YVENFLSTQC  2075
             Y+E FLS +C
Sbjct  739   YIELFLSNRC  748



>ref|XP_002273713.1| PREDICTED: glutamate receptor 3.7 [Vitis vinifera]
Length=909

 Score =   422 bits (1084),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 227/416 (55%), Positives = 308/416 (74%), Gaps = 1/416 (0%)
 Frame = +3

Query  1158  KKPRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYAVPFQ  1337
             +KPRGW    N + LR+G+P R S+ +F++++  ++  +G+ +DVF AA+ L+PY VP  
Sbjct  450   EKPRGWEIAANERPLRLGIPKRTSFVDFVTELNTSHKVQGYCIDVFNAALKLVPYNVPHT  509

Query  1338  FVPFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPFK  1517
             F+PFG+GR NP Y ELV+ V+   FDG +GD+AIVTNRT++VDFTQPY A+GL++VAP  
Sbjct  510   FIPFGDGRSNPHYDELVQKVADDVFDGVVGDVAIVTNRTRIVDFTQPYAATGLVIVAPVH  569

Query  1518  KLNTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSLS  1697
                  AW FL PF+ +MW VTA  FV++ +V+WILEHR+ND+FRG PK+QLIT+  FS S
Sbjct  570   NTKLSAWVFLKPFTVEMWCVTAAAFVMIAVVIWILEHRVNDDFRGPPKRQLITMFLFSFS  629

Query  1698  TLFFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESLKEGN  1877
             TLF  ++E+T STLGR+V+++WLF++++I SSYTASLTSILTVQQL SPI G++SL   +
Sbjct  630   TLFKTNQEDTRSTLGRIVMVVWLFLLMVITSSYTASLTSILTVQQLSSPITGIDSLIASD  689

Query  1878  DPIGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERPYVEN  2057
              PIGYQ+GSFA  YL + + + +SRL++LGSPEAY  AL KGP  GGV+AIVDE PYVE 
Sbjct  690   LPIGYQVGSFAFSYLRDSLYVHQSRLVSLGSPEAYEMALRKGPKGGGVAAIVDELPYVEL  749

Query  2058  FLSTQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLtrtsc  2237
             FL  Q  F + GQ FTKSGWGFAF +DSPLA D+STAIL LSE G LQ+IH+ W  +  C
Sbjct  750   FLEKQKDFGVFGQTFTKSGWGFAFQKDSPLAADLSTAILRLSETGTLQKIHENWFCKMGC  809

Query  2238  ss-estelesDRLHLKSFWglfllcgaacflalfIYFVQIMLKFRRVARAEPVADG  2402
                   + E ++LH+ SFWGL+LLCG+   +AL ++ ++ + +F R  R +P+  G
Sbjct  810   PGWRRRKSEPNQLHMISFWGLYLLCGSITLIALLVFLLRTIRQFARYKRKKPIQIG  865


 Score =   374 bits (961),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 182/374 (49%), Positives = 247/374 (66%), Gaps = 6/374 (2%)
 Frame = +2

Query  59    VAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTTQ  238
             +AA + ++  V+AI+GPQSS +AH IS +AN LQVP +S+AATDPTL++LQFP+FLRTT 
Sbjct  84    IAAFQVLERQVLAIIGPQSSSIAHMISQIANGLQVPQISYAATDPTLSALQFPFFLRTTH  143

Query  239   SDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGAT  418
             SD YQM A+AD+ID+YGWKEVI +F+DDDYGRNG+AALDD L  +  KISYK  +P    
Sbjct  144   SDSYQMAAMADLIDYYGWKEVIVIFVDDDYGRNGMAALDDELEKRGSKISYKLPLPTEFN  203

Query  419   TRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVLDS  598
              R +  ++L +  L+  RV V+H  P   F +FS+A  L MM  GYVW +TDWL   LDS
Sbjct  204   VR-DFTEMLNKSKLIGPRVYVVHVNPDPSFRIFSIAQKLQMMTRGYVWFATDWLCATLDS  262

Query  599   SSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLTGGSL---GLNSYALYAYDSVW  769
              SP+    +  +QGV+ LRQH P S  K AF S+W+ +    L   GLN+Y LYAYD+VW
Sbjct  263   FSPMNQTSLRFLQGVVGLRQHIPQSRKKDAFVSQWRKMQKKGLVSSGLNTYGLYAYDTVW  322

Query  770   LIAHAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLTG  949
              +A+AID FL + G +SFS   KL  +  +      L +F+ G  L   LLQ +F GLTG
Sbjct  323   AVAYAIDKFLKENGNMSFSESDKLHDMRAT--QFGKLEVFENGNFLREQLLQINFTGLTG  380

Query  950   QFKFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKLY  1129
             + +F+ +++++  SYD++N++ T  R +G+W NYSGLS  PPE L      +S  +QKL 
Sbjct  381   RIQFDPERNVMNGSYDVINIVHTEIRGVGYWSNYSGLSVLPPEDLKGEQNRNSLLDQKLR  440

Query  1130  GVVWPGQSVKKAPG  1171
              V WPG   +K  G
Sbjct  441   IVTWPGGITEKPRG  454



>emb|CBI28942.3| unnamed protein product [Vitis vinifera]
Length=838

 Score =   421 bits (1083),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 227/416 (55%), Positives = 308/416 (74%), Gaps = 1/416 (0%)
 Frame = +3

Query  1158  KKPRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYAVPFQ  1337
             +KPRGW    N + LR+G+P R S+ +F++++  ++  +G+ +DVF AA+ L+PY VP  
Sbjct  379   EKPRGWEIAANERPLRLGIPKRTSFVDFVTELNTSHKVQGYCIDVFNAALKLVPYNVPHT  438

Query  1338  FVPFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPFK  1517
             F+PFG+GR NP Y ELV+ V+   FDG +GD+AIVTNRT++VDFTQPY A+GL++VAP  
Sbjct  439   FIPFGDGRSNPHYDELVQKVADDVFDGVVGDVAIVTNRTRIVDFTQPYAATGLVIVAPVH  498

Query  1518  KLNTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSLS  1697
                  AW FL PF+ +MW VTA  FV++ +V+WILEHR+ND+FRG PK+QLIT+  FS S
Sbjct  499   NTKLSAWVFLKPFTVEMWCVTAAAFVMIAVVIWILEHRVNDDFRGPPKRQLITMFLFSFS  558

Query  1698  TLFFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESLKEGN  1877
             TLF  ++E+T STLGR+V+++WLF++++I SSYTASLTSILTVQQL SPI G++SL   +
Sbjct  559   TLFKTNQEDTRSTLGRIVMVVWLFLLMVITSSYTASLTSILTVQQLSSPITGIDSLIASD  618

Query  1878  DPIGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERPYVEN  2057
              PIGYQ+GSFA  YL + + + +SRL++LGSPEAY  AL KGP  GGV+AIVDE PYVE 
Sbjct  619   LPIGYQVGSFAFSYLRDSLYVHQSRLVSLGSPEAYEMALRKGPKGGGVAAIVDELPYVEL  678

Query  2058  FLSTQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLtrtsc  2237
             FL  Q  F + GQ FTKSGWGFAF +DSPLA D+STAIL LSE G LQ+IH+ W  +  C
Sbjct  679   FLEKQKDFGVFGQTFTKSGWGFAFQKDSPLAADLSTAILRLSETGTLQKIHENWFCKMGC  738

Query  2238  ss-estelesDRLHLKSFWglfllcgaacflalfIYFVQIMLKFRRVARAEPVADG  2402
                   + E ++LH+ SFWGL+LLCG+   +AL ++ ++ + +F R  R +P+  G
Sbjct  739   PGWRRRKSEPNQLHMISFWGLYLLCGSITLIALLVFLLRTIRQFARYKRKKPIQIG  794


 Score =   374 bits (961),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 182/374 (49%), Positives = 247/374 (66%), Gaps = 6/374 (2%)
 Frame = +2

Query  59    VAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTTQ  238
             +AA + ++  V+AI+GPQSS +AH IS +AN LQVP +S+AATDPTL++LQFP+FLRTT 
Sbjct  13    IAAFQVLERQVLAIIGPQSSSIAHMISQIANGLQVPQISYAATDPTLSALQFPFFLRTTH  72

Query  239   SDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGAT  418
             SD YQM A+AD+ID+YGWKEVI +F+DDDYGRNG+AALDD L  +  KISYK  +P    
Sbjct  73    SDSYQMAAMADLIDYYGWKEVIVIFVDDDYGRNGMAALDDELEKRGSKISYKLPLPTEFN  132

Query  419   TRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVLDS  598
              R +  ++L +  L+  RV V+H  P   F +FS+A  L MM  GYVW +TDWL   LDS
Sbjct  133   VR-DFTEMLNKSKLIGPRVYVVHVNPDPSFRIFSIAQKLQMMTRGYVWFATDWLCATLDS  191

Query  599   SSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLTGGSL---GLNSYALYAYDSVW  769
              SP+    +  +QGV+ LRQH P S  K AF S+W+ +    L   GLN+Y LYAYD+VW
Sbjct  192   FSPMNQTSLRFLQGVVGLRQHIPQSRKKDAFVSQWRKMQKKGLVSSGLNTYGLYAYDTVW  251

Query  770   LIAHAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLTG  949
              +A+AID FL + G +SFS   KL  +  +      L +F+ G  L   LLQ +F GLTG
Sbjct  252   AVAYAIDKFLKENGNMSFSESDKLHDMRAT--QFGKLEVFENGNFLREQLLQINFTGLTG  309

Query  950   QFKFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKLY  1129
             + +F+ +++++  SYD++N++ T  R +G+W NYSGLS  PPE L      +S  +QKL 
Sbjct  310   RIQFDPERNVMNGSYDVINIVHTEIRGVGYWSNYSGLSVLPPEDLKGEQNRNSLLDQKLR  369

Query  1130  GVVWPGQSVKKAPG  1171
              V WPG   +K  G
Sbjct  370   IVTWPGGITEKPRG  383



>ref|XP_006409331.1| hypothetical protein EUTSA_v10022533mg [Eutrema salsugineum]
 gb|ESQ50784.1| hypothetical protein EUTSA_v10022533mg [Eutrema salsugineum]
Length=937

 Score =   403 bits (1035),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 195/382 (51%), Positives = 268/382 (70%), Gaps = 7/382 (2%)
 Frame = +2

Query  56    LVAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTT  235
             ++ AL+FM+TDVVAI+GPQ+S++AH +SH+ANEL VP+LSF A DPTL+ LQFP+F++T 
Sbjct  155   IMGALQFMETDVVAIIGPQTSIMAHVLSHLANELTVPMLSFTALDPTLSPLQFPFFVQTA  214

Query  236   QSDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGA  415
              SD++ M AIA++I +YGW +V+A++ DDD  RNG+ AL D L  +RC+ISYKA +P   
Sbjct  215   PSDLFLMRAIAEMITYYGWSDVVALYNDDDNSRNGVTALGDELEERRCRISYKAVLPLDV  274

Query  416   --TTRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTV  589
               ++  EI++ L +I  MESR++V++ +P  G M+F  A  LGMM  GYVWI+T WLS++
Sbjct  275   VISSPVEIIEELTKIQRMESRIIVVNTFPNTGKMIFEEAERLGMMETGYVWIATTWLSSL  334

Query  590   LDSSSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHL--TGGSLGLNSYALYAYDS  763
             LDS  PL  + +    GVL LR HTPDS  KR F +RWK+      ++GLN Y LYAYD+
Sbjct  335   LDSGLPLDRKSL---NGVLTLRLHTPDSRNKRDFAARWKNKLSNNKTIGLNVYGLYAYDT  391

Query  764   VWLIAHAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGL  943
             VW+IA AI + L  GG +SFS D+KL S++G  L+L ALS FD G  LL+ ++ +   GL
Sbjct  392   VWIIARAIKTHLEAGGNLSFSQDAKLSSLKGEALNLSALSRFDQGSQLLDYIMHTKMSGL  451

Query  944   TGQFKFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQK  1123
              G  +F+ D+S++ PSYDI+NV+  GFR IG+W N+SGLS  PPE+ YS+P N SS+NQ 
Sbjct  452   AGPVQFHQDRSMLQPSYDIINVVDDGFRQIGYWSNHSGLSIGPPESFYSKPSNRSSSNQH  511

Query  1124  LYGVVWPGQSVKKAPGVGFPEQ  1189
             L  V WPG +     G  FP  
Sbjct  512   LKLVTWPGGTSVTPRGWVFPNN  533


 Score =   392 bits (1006),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 227/405 (56%), Positives = 286/405 (71%), Gaps = 51/405 (13%)
 Frame = +3

Query  1164  PRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGT-NTFKGFSVDVFTAAVNLLPYAVPFQF  1340
             PRGWVFPNNGK LRIGVP R S+K F+S+V G+ N  +G+ +DVF AAV LL Y VP +F
Sbjct  525   PRGWVFPNNGKLLRIGVPDRASFKAFVSRVNGSSNNVQGYCIDVFEAAVKLLSYPVPHEF  584

Query  1341  VPFGNGRENPSYSELVRLVSTGY-FDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPFK  1517
             + FG+G +NP+Y+ELV  V+TG  FD  +GD+AIVT RT++VDFTQPY+ SGL+VVAP  
Sbjct  585   IFFGDGLKNPNYNELVHKVTTGVEFDAVVGDVAIVTKRTRIVDFTQPYIESGLVVVAPVS  644

Query  1518  KLNTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSLS  1697
               N   WAFL PF+  MW VTA FF+VVG V+WILEHR NDEFRG P++Q++TIL     
Sbjct  645   TPNENPWAFLRPFTPPMWAVTAVFFIVVGAVIWILEHRKNDEFRGPPRRQIVTIL-----  699

Query  1698  TLFFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESLKEGN  1877
                                             YTASLTS+LTVQQL SPIKGV++L    
Sbjct  700   -------------------------------CYTASLTSMLTVQQLNSPIKGVDTLISST  728

Query  1878  DPIGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERPYVEN  2057
               IG+QIGSFAE+Y+++E+ I++SRL+ LGSP+ YA AL+ G     V+AIVDERPYV+ 
Sbjct  729   GRIGFQIGSFAENYMVDELNIARSRLVPLGSPQEYATALQNGT----VAAIVDERPYVDL  784

Query  2058  FLSTQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLtrtsc  2237
             FLS  CKF I GQEFT++GWGFAFPRDSPLAVDMSTAIL LSE G+LQ+IHD+WL++++C
Sbjct  785   FLSDYCKFAIRGQEFTRNGWGFAFPRDSPLAVDMSTAILGLSETGELQKIHDRWLSKSNC  844

Query  2238  ssestelesDRLHLKSFWglfllcgaacflalfIYFVQIMLKFRR  2372
             SS          H   FWG+FL+CG ACF+AL I+F +I+  F +
Sbjct  845   SSP---------HWSHFWGMFLVCGIACFVALLIHFFKIVRDFCK  880



>gb|KHN36533.1| Glutamate receptor 3.7 [Glycine soja]
Length=909

 Score =   430 bits (1105),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 226/405 (56%), Positives = 310/405 (77%), Gaps = 1/405 (0%)
 Frame = +3

Query  1161  KPRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYAVPFQF  1340
             +PRGWV  +N K LRIGVP R S+ EF++++P ++  +G+ +DVF  A+  +PY VPF F
Sbjct  453   RPRGWVIADNTKPLRIGVPKRASFVEFVTELPDSHQIQGYCIDVFKKALEFIPYEVPFVF  512

Query  1341  VPFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPFKK  1520
              PFGNG+ENP+Y  LV++V    +D  +GDIAIVTNRT +VDF+QP+ +S L++VAP  K
Sbjct  513   KPFGNGKENPNYDALVKMVDENVYDAVVGDIAIVTNRTMIVDFSQPFASSSLVIVAPINK  572

Query  1521  LNTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSLST  1700
               + AW FL PF+A MW  TA  F+VVG+V+WILEHR+N++FRG PK+QL+T+L FSLST
Sbjct  573   ARSNAWVFLQPFTADMWCATAASFLVVGVVIWILEHRVNNDFRGPPKKQLLTMLMFSLST  632

Query  1701  LFFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESLKEGND  1880
             LF  ++E+TVS+L +MV+I+WLF++++I +SYTASLTSILTV+QL SPI G++SL   N 
Sbjct  633   LFKKNQEDTVSSLSKMVMIVWLFLLMVITASYTASLTSILTVEQLSSPITGIDSLIASNW  692

Query  1881  PIGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERPYVENF  2060
             PIG+Q+GSF  +YL + + +SKSRLI+LGSPE YA AL+KGP  GGV+AI+DE PYVE F
Sbjct  693   PIGFQVGSFTYNYLTDNLYVSKSRLISLGSPEEYATALKKGPSGGGVAAIIDELPYVELF  752

Query  2061  LSTQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLtrtsc-  2237
             LS +  F I+GQ F +S WGFAF R+SPLA DMSTAIL LSENGDL++IH+KW  +  C 
Sbjct  753   LSNETDFGIIGQPFARSSWGFAFQRESPLAFDMSTAILKLSENGDLRKIHEKWFCKMRCP  812

Query  2238  ssestelesDRLHLKSFWglfllcgaacflalfIYFVQIMLKFRR  2372
                ++  + D+LHL SFWGL+L CG    +AL ++ ++++ ++ R
Sbjct  813   EDRTSNSKPDQLHLISFWGLYLSCGIVSLVALALFLLRMIRQYAR  857


 Score =   363 bits (932),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 186/376 (49%), Positives = 244/376 (65%), Gaps = 6/376 (2%)
 Frame = +2

Query  59    VAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTTQ  238
             + A + ++  V AI+GPQSS VAHT+S +A+ LQVPL+S+AATDPTL+SLQFP+F+RTTQ
Sbjct  82    IGAFQVLEKGVAAIIGPQSSAVAHTVSQIADALQVPLVSYAATDPTLSSLQFPFFIRTTQ  141

Query  239   SDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGAT  418
             SD+ QM A+AD+ID +GWKEVI VF+DDDYGRNG++AL D L  ++ KISYK  +     
Sbjct  142   SDLAQMTAMADIIDFHGWKEVIVVFLDDDYGRNGLSALSDELEKRKLKISYKLPLSIKFD  201

Query  419   TRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVLDS  598
                EI ++L Q  ++  RV V+H  P     +F +AH L MM   YVW+ TDWLS  LDS
Sbjct  202   LD-EITNLLNQSKVVGPRVYVVHVNPDPRLRIFLIAHKLQMMAKDYVWLVTDWLSATLDS  260

Query  599   SSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLTGGSL---GLNSYALYAYDSVW  769
              SP+      ++QGV+ LRQH PDS  KRAF SRW  +    L   GLNSY +YAYD+VW
Sbjct  261   LSPVNQTSFSVLQGVVGLRQHIPDSSKKRAFVSRWIKMQKEGLANTGLNSYGIYAYDTVW  320

Query  770   LIAHAIDSFLNKGGVISFS--NDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGL  943
              +A AID F+     I+FS  ++  L    G  + L+ L IF GG  L++ LLQS+F G+
Sbjct  321   AVARAIDIFIKVHNNITFSLPDNYNLSHTVGIGILLDKLKIFAGGSDLVDILLQSNFTGV  380

Query  944   TGQFKFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQK  1123
             +GQ  FN+D+S+V   YDI+NV   G   +GFW N SG S  PP  L  R  N  S +QK
Sbjct  381   SGQLHFNSDRSIVSGGYDIINVNQMGISGVGFWSNNSGFSVVPPTALKKRKYNRFSQDQK  440

Query  1124  LYGVVWPGQSVKKAPG  1171
             L  V+WPG    +  G
Sbjct  441   LGKVIWPGGVTDRPRG  456



>ref|XP_003541946.1| PREDICTED: glutamate receptor 3.7-like isoform X1 [Glycine max]
Length=909

 Score =   429 bits (1104),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 226/405 (56%), Positives = 310/405 (77%), Gaps = 1/405 (0%)
 Frame = +3

Query  1161  KPRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYAVPFQF  1340
             +PRGWV  +N K LRIGVP R S+ EF++++P ++  +G+ +DVF  A+  +PY VPF F
Sbjct  453   QPRGWVIADNTKPLRIGVPKRASFVEFVTELPDSHQIQGYCIDVFKKALEFIPYEVPFVF  512

Query  1341  VPFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPFKK  1520
              PFGNG+ENP+Y  LV++V    +D  +GDIAIVTNRT +VDF+QP+ +S L++VAP  K
Sbjct  513   KPFGNGKENPNYDALVKMVDENVYDAVVGDIAIVTNRTMIVDFSQPFASSSLVIVAPINK  572

Query  1521  LNTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSLST  1700
               + AW FL PF+A MW  TA  F+VVG+V+WILEHR+N++FRG PK+QL+T+L FSLST
Sbjct  573   ARSNAWVFLQPFTADMWCATAASFLVVGVVIWILEHRVNNDFRGPPKKQLLTMLMFSLST  632

Query  1701  LFFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESLKEGND  1880
             LF  ++E+TVS+L +MV+I+WLF++++I +SYTASLTSILTV+QL SPI G++SL   N 
Sbjct  633   LFKKNQEDTVSSLSKMVMIVWLFLLMVITASYTASLTSILTVEQLSSPITGIDSLIASNW  692

Query  1881  PIGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERPYVENF  2060
             PIG+Q+GSF  +YL + + +SKSRLI+LGSPE YA AL+KGP  GGV+AI+DE PYVE F
Sbjct  693   PIGFQVGSFTYNYLTDNLYVSKSRLISLGSPEEYATALKKGPSGGGVAAIIDELPYVELF  752

Query  2061  LSTQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLtrtsc-  2237
             LS +  F I+GQ F +S WGFAF R+SPLA DMSTAIL LSENGDL++IH+KW  +  C 
Sbjct  753   LSNETDFGIIGQPFARSSWGFAFQRESPLAFDMSTAILKLSENGDLRKIHEKWFCKMRCP  812

Query  2238  ssestelesDRLHLKSFWglfllcgaacflalfIYFVQIMLKFRR  2372
                ++  + D+LHL SFWGL+L CG    +AL ++ ++++ ++ R
Sbjct  813   EDRTSNSKPDQLHLISFWGLYLSCGIVSLVALALFLLRMIRQYAR  857


 Score =   363 bits (932),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 185/368 (50%), Positives = 242/368 (66%), Gaps = 6/368 (2%)
 Frame = +2

Query  59    VAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTTQ  238
             + A + ++  V AI+GPQSS VAHT+S +A+ LQVPL+S+AATDPTL+SLQFP+F+RTTQ
Sbjct  82    IGAFQVLEKGVAAIIGPQSSAVAHTVSQIADALQVPLVSYAATDPTLSSLQFPFFIRTTQ  141

Query  239   SDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGAT  418
             SD+ QM A+AD+ID +GWKEVI VF+DDDYGRNG++AL D L  ++ KISYK  +     
Sbjct  142   SDLAQMTAMADIIDFHGWKEVIVVFLDDDYGRNGLSALSDELEKRKLKISYKLPLSIKFD  201

Query  419   TRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVLDS  598
                EI ++L Q  ++  RV V+H  P     +F +AH L MM   YVW+ TDWLS  LDS
Sbjct  202   LD-EITNLLNQSKVVGPRVYVVHVNPDPRLRIFFIAHKLQMMAKDYVWLVTDWLSATLDS  260

Query  599   SSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLTGGSL---GLNSYALYAYDSVW  769
              SP+      ++QGV+ LRQH PDS  KRAF SRW  +    L   GLNSY +YAYD+VW
Sbjct  261   LSPVNQTSFSVLQGVVGLRQHIPDSSKKRAFVSRWIKMQKEGLANTGLNSYGIYAYDTVW  320

Query  770   LIAHAIDSFLNKGGVISFS--NDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGL  943
              +A AID F+     I+FS  ++  L    G  + L+ L IF GG  L++ LLQS+F G+
Sbjct  321   AVARAIDIFIKVHNNITFSLPDNYNLSHTVGIGILLDKLKIFAGGSDLVDILLQSNFTGV  380

Query  944   TGQFKFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQK  1123
             +GQ  FN+D+S+V   YDI+NV   G   +GFW N SG S  PP  L  R  N  S +QK
Sbjct  381   SGQLHFNSDRSIVSGGYDIINVNQMGISGVGFWSNNSGFSVVPPTALKKRKYNRFSQDQK  440

Query  1124  LYGVVWPG  1147
             L  V+WPG
Sbjct  441   LGKVIWPG  448



>ref|XP_010276026.1| PREDICTED: glutamate receptor 3.7-like isoform X3 [Nelumbo nucifera]
Length=878

 Score =   398 bits (1022),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 224/415 (54%), Positives = 291/415 (70%), Gaps = 32/415 (8%)
 Frame = +3

Query  1146  GSR*KKPRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYA  1325
             G + +KPRGWV  +  + LRIGVP R S+ EF ++  GT  F+GF +DVF AA  L+ Y 
Sbjct  447   GKKAEKPRGWVIADIERPLRIGVPYRASFVEFATEKHGTKDFEGFCIDVFFAARKLVAYD  506

Query  1326  VPFQFVPFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVV  1505
             +PF F+PFG+G+ NP+Y ELVR+V+TG  D A+GDIAIVTNRTK+ DFTQPY A+GL++V
Sbjct  507   IPFMFMPFGDGQSNPNYDELVRMVATGVLDAAVGDIAIVTNRTKIADFTQPYAATGLVIV  566

Query  1506  APFKKLNTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILW  1685
             AP     + AW FL PF+ +MW VTA FFV++G+V+WILEHR+ND+FRG P++QLIT+  
Sbjct  567   APINNRKSSAWVFLKPFTVEMWCVTATFFVLIGVVIWILEHRINDDFRGPPRRQLITVFL  626

Query  1686  FSLSTLFFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESL  1865
             FS STLF  ++E+T+S LGRMV+++WLF++++I SSYTASLTSILT+QQL SPI G++SL
Sbjct  627   FSFSTLFKTNQEDTISALGRMVMVVWLFLLMVITSSYTASLTSILTIQQLSSPITGLDSL  686

Query  1866  KEGNDPIGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERP  2045
                                               SPE Y EAL  GP  GGV+AI+DE P
Sbjct  687   -------------------------------ITSSPEEYEEALRLGPGNGGVAAIIDELP  715

Query  2046  YVENFLSTQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLt  2225
             YVE FLS Q  F IVGQ FTK+GWGFAF RDSPLAVDMSTAIL LSENG+LQ+IHDKW  
Sbjct  716   YVELFLSKQTDFGIVGQMFTKNGWGFAFQRDSPLAVDMSTAILELSENGELQKIHDKWFC  775

Query  2226  rtscssest-elesDRLHLKSFWglfllcgaacflalfIYFVQIMLKFRRVARAE  2387
             +  C  E   + ++++LHL SFW L+LL G     AL ++ V+++ +F R  R +
Sbjct  776   KMGCGIERRPQSDTNQLHLSSFWALYLLSGVVTLGALLVFLVRMVRQFVRYKRKQ  830


 Score =   392 bits (1006),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 195/374 (52%), Positives = 256/374 (68%), Gaps = 5/374 (1%)
 Frame = +2

Query  59    VAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTTQ  238
             V A + ++ +VVAI+GPQSS VAH IS +AN +QVPL+SF ATDPTL++LQFP+F+RTTQ
Sbjct  84    VEAFRVLEKEVVAIIGPQSSGVAHLISMIANGVQVPLVSFVATDPTLSALQFPFFVRTTQ  143

Query  239   SDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGAT  418
             SD YQM A+AD+ID+YGW+EVIA+F+DDDYGRNGI+ LDD LA K  KI YK  +P GA+
Sbjct  144   SDSYQMAAMADLIDYYGWREVIAIFVDDDYGRNGISTLDDELAKKMTKI-YKLALPTGAS  202

Query  419   TRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVLDS  598
               + I ++L     +  RV V+H  P +G  V S+A  L MM  GYVW++TDWLST LDS
Sbjct  203   V-SRITELLSNSKFIGPRVYVVHVNPDSGLTVLSLAQELEMMTSGYVWLATDWLSTTLDS  261

Query  599   SSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLTGGSL---GLNSYALYAYDSVW  769
                +    +   QGV+ LRQHTP S  K+AF SRW+ L    L   GLN+Y LYAYD+VW
Sbjct  262   LPLINQTSLRNFQGVVGLRQHTPPSLQKKAFVSRWRDLHQKGLVSYGLNTYGLYAYDTVW  321

Query  770   LIAHAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLTG  949
              +A +ID +LN+   I+FS +  L   + + L LE +  FDGG LLL  LLQ +F GLTG
Sbjct  322   AVAQSIDGYLNEYQNITFSFNKNLHGNKATKLQLENIKTFDGGTLLLRKLLQMNFSGLTG  381

Query  950   QFKFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKLY  1129
               +F++D++L+   YDI+N+      TIG+W NYSGLS   PETL  +P +SS  +QKL 
Sbjct  382   SVRFDSDRNLIGGGYDIINIAQIAIHTIGYWSNYSGLSVVTPETLNRKPHSSSHLDQKLN  441

Query  1130  GVVWPGQSVKKAPG  1171
              V WPG+  +K  G
Sbjct  442   SVTWPGKKAEKPRG  455



>ref|XP_002301626.1| Glutamate receptor 3.7 precursor family protein [Populus trichocarpa]
 gb|EEE80899.1| Glutamate receptor 3.7 precursor family protein [Populus trichocarpa]
Length=861

 Score =   424 bits (1090),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 227/415 (55%), Positives = 313/415 (75%), Gaps = 1/415 (0%)
 Frame = +3

Query  1146  GSR*KKPRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYA  1325
             G + K PRGWV   + + LRIGVP R S+ +F+++V  ++  KG+ +DVF  A+ L+PY 
Sbjct  398   GGKSKTPRGWVIAVDERPLRIGVPNRASFTDFVTEVHVSHKIKGYCIDVFLKALELVPYH  457

Query  1326  VPFQFVPFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVV  1505
             VP+ F PFGNGR NP Y +LV++V+   FD A+GDIAIVTNRTK+VDF+QPY ++GL++V
Sbjct  458   VPYMFQPFGNGRSNPKYDDLVKMVAADVFDAAVGDIAIVTNRTKIVDFSQPYASTGLVIV  517

Query  1506  APFKKLNTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILW  1685
             AP +   + AW FL PF+A+MW VTA  FVV+ +V+W+LEHR+ND+FRG P++QL+T+  
Sbjct  518   APIRNSKSSAWVFLKPFTAEMWCVTAASFVVIAVVIWVLEHRVNDDFRGPPRRQLVTMFM  577

Query  1686  FSLSTLFFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESL  1865
             FS STLF  ++E TVS LG++V+++WLF++++I +SYTASLTSILT+QQL SPI G+ESL
Sbjct  578   FSFSTLFKTNKETTVSPLGKLVMVVWLFLLMVITASYTASLTSILTIQQLSSPITGIESL  637

Query  1866  KEGNDPIGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERP  2045
                + PIGYQ GSFA +YL E + I++SRL+ LGSPE Y  AL +GP  GGV+AIVDE P
Sbjct  638   IASHWPIGYQTGSFAYNYLSETLYIARSRLVPLGSPEEYESALRRGPSDGGVAAIVDELP  697

Query  2046  YVENFLSTQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLt  2225
             YVE FLS+Q  F I+GQ FT+ GWGFAF R+SPLA+D+STAIL LSENG+LQ+I++KW  
Sbjct  698   YVELFLSSQKDFGIIGQPFTRGGWGFAFQRESPLALDISTAILKLSENGELQKIYEKWFC  757

Query  2226  rtscssesteles-DRLHLKSFWglfllcgaacflalfIYFVQIMLKFRRVARAE  2387
             +  C  E    +  ++L L SFWGL++LCGA    AL ++ ++++ +F R  R +
Sbjct  758   KMGCHGEKKHGDGPNQLKLTSFWGLYILCGAFALTALVVFLLRMVRQFVRYKRRQ  812


 Score =   363 bits (931),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 177/374 (47%), Positives = 249/374 (67%), Gaps = 4/374 (1%)
 Frame = +2

Query  59    VAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTTQ  238
             + A + ++ +VVAI+GPQ S +AH IS +AN LQVPL+S+AATDPTL++LQFP+F+RTTQ
Sbjct  34    IDAFQLIEKEVVAIIGPQVSGIAHMISSIANGLQVPLISYAATDPTLSALQFPFFVRTTQ  93

Query  239   SDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGAT  418
             SD YQM A+AD++D + WKEVI V +DDDYGRNGIAAL++ L  K  KISYK  +     
Sbjct  94    SDSYQMAAMADLVDFFRWKEVIVVGVDDDYGRNGIAALEEELNKKMAKISYKLML-CNQL  152

Query  419   TRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVLDS  598
               +E+MD L +  L+ SRV V+H  P     +F+VA  L MM D Y W++TDWLS  LDS
Sbjct  153   DESEVMDKLSKSKLLGSRVYVVHVNPDPKLRIFTVAQKLQMMTDTYTWLATDWLSATLDS  212

Query  599   SSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLT---GGSLGLNSYALYAYDSVW  769
               P     +  +QGV+ LRQHTP+S  KRA  SRWK +      S  LN+Y L AYD+VW
Sbjct  213   FPPTKKTSLGFLQGVVGLRQHTPESSQKRALMSRWKRMQQKGSASSELNTYGLQAYDTVW  272

Query  770   LIAHAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLTG  949
             L+A+AID FL++   I+FS +S +  ++ S L +E L +F GG  L + +LQ++F GL+G
Sbjct  273   LVAYAIDRFLDEHKNITFSPNSNILHMKISGLQIEKLKVFTGGNDLRDIVLQTNFTGLSG  332

Query  950   QFKFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKLY  1129
             Q +FN D+++    YD+LN+ G   RT+G+W N +G S +PP+    +  ++   +Q+L+
Sbjct  333   QIQFNEDRNVFSGGYDVLNIDGVSIRTVGYWSNAAGFSLSPPDARKGKQDSNCCLDQRLH  392

Query  1130  GVVWPGQSVKKAPG  1171
              + WPG   K   G
Sbjct  393   NITWPGGKSKTPRG  406



>ref|XP_003540305.1| PREDICTED: glutamate receptor 3.7-like isoform X1 [Glycine max]
Length=909

 Score =   428 bits (1101),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 219/378 (58%), Positives = 291/378 (77%), Gaps = 1/378 (0%)
 Frame = +3

Query  1161  KPRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYAVPFQF  1340
             +PRGWV  +N K LRIGVP R S+ EF++++P ++  +G+ +DVF  A+  +PY VPF F
Sbjct  453   RPRGWVIADNTKPLRIGVPKRASFVEFVTELPDSHQIQGYCIDVFKKALEFIPYEVPFVF  512

Query  1341  VPFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPFKK  1520
              PFGNG+ NP+Y  LV++V    +D  +GDIAIVTNRT +VDF+QP+ +S L++VAP  K
Sbjct  513   KPFGNGKANPNYDALVKMVDENVYDAVVGDIAIVTNRTMIVDFSQPFASSSLVIVAPINK  572

Query  1521  LNTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSLST  1700
               + AW FL PF+A MW  TA  F+VVG+V+WILEHR+N++FRG PK+Q++T+L FSLST
Sbjct  573   ARSNAWVFLQPFTADMWCATAASFLVVGVVIWILEHRVNNDFRGPPKKQIVTMLMFSLST  632

Query  1701  LFFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESLKEGND  1880
             LF  ++E+TVS+L +MV+I+WLF++++I +SYTASLTSILTV+QL SPI G++SL   N 
Sbjct  633   LFKKNQEDTVSSLSKMVMIVWLFLLMVITASYTASLTSILTVEQLSSPITGIDSLIASNW  692

Query  1881  PIGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERPYVENF  2060
             PIGYQ+GSFA +YL + + +SKSRLI LGSPE YA AL+KGP  GGV+AI+DE PYVE F
Sbjct  693   PIGYQVGSFAYNYLTDNLYVSKSRLIPLGSPEEYATALQKGPSGGGVAAIIDELPYVELF  752

Query  2061  LSTQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLtrtscs  2240
             LS +  F I+GQ F +S WGFAF R+SPLA DMSTAIL LSENGDL++IH+KW  +  C+
Sbjct  753   LSNETDFGIIGQPFARSSWGFAFQRESPLAYDMSTAILKLSENGDLRKIHEKWFCKMGCA  812

Query  2241  sesteles-DRLHLKSFW  2291
              + T     D+LHL SFW
Sbjct  813   EDRTSNSKPDQLHLISFW  830


 Score =   357 bits (917),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 181/376 (48%), Positives = 241/376 (64%), Gaps = 6/376 (2%)
 Frame = +2

Query  59    VAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTTQ  238
             + A + ++  V AI+GPQSS VAHT+S +A+ LQVPL+S+AATDPTL+SLQFP+F+RTTQ
Sbjct  82    IGAFQVLEKGVAAIIGPQSSAVAHTVSQIADALQVPLVSYAATDPTLSSLQFPFFIRTTQ  141

Query  239   SDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGAT  418
             SD+ QM A+AD+ID +GWKEVI VF+DDDYGRNG++AL D L  +R +ISYK  +     
Sbjct  142   SDLAQMTAMADLIDFHGWKEVIVVFLDDDYGRNGVSALRDELEKRRLRISYKLPLSIKFD  201

Query  419   TRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVLDS  598
                E  ++L Q  +   RV V+H  P     +FS+AH L MM   YVW+ TDWLS  LDS
Sbjct  202   LD-EFTNLLNQSKVFGPRVYVVHVNPDPRLRIFSIAHNLQMMAKDYVWLVTDWLSATLDS  260

Query  599   SSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLTGGSLG---LNSYALYAYDSVW  769
              SP+      ++ GV+ LRQH PDS  K+AF SRW  +    L    LNSY +YAYD+VW
Sbjct  261   LSPVNQTSFSVLHGVVGLRQHIPDSSKKKAFVSRWIEMQKEGLANTSLNSYGIYAYDTVW  320

Query  770   LIAHAIDSFLNKGGVISFS--NDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGL  943
              +A AID F+     I+FS  ++  L  + G  + L+ L IF GG  L++ LLQS+F G+
Sbjct  321   AVARAIDIFIKVHNTITFSFPDNYNLSHMVGIGIQLDKLKIFAGGSDLVDILLQSNFTGV  380

Query  944   TGQFKFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQK  1123
             +GQ  FN+D+S+V   YDI+NV   G + +GFW N SG S  P   L  R  N  S +QK
Sbjct  381   SGQLHFNSDRSIVSGGYDIINVNQMGIKGVGFWSNNSGFSVVPHTALKKRKYNRFSQDQK  440

Query  1124  LYGVVWPGQSVKKAPG  1171
             L  + WPG    +  G
Sbjct  441   LGNITWPGGITDRPRG  456



>gb|KHN44876.1| Glutamate receptor 3.7 [Glycine soja]
Length=905

 Score =   428 bits (1100),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 218/378 (58%), Positives = 291/378 (77%), Gaps = 1/378 (0%)
 Frame = +3

Query  1161  KPRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYAVPFQF  1340
             +PRGWV  +N K LRIGVP R S+ EF++++P ++  +G+ +DVF  A+  +PY VPF F
Sbjct  449   RPRGWVIADNTKPLRIGVPKRASFVEFVTELPDSHQIQGYCIDVFKKALEFIPYEVPFVF  508

Query  1341  VPFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPFKK  1520
              PFGNG+ NP+Y  LV++V    +D  +GDIAIVTNRT +VDF+QP+ +S L++VAP  K
Sbjct  509   KPFGNGKANPNYDALVKMVDENVYDAVVGDIAIVTNRTMIVDFSQPFASSSLVIVAPINK  568

Query  1521  LNTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSLST  1700
               + AW FL PF+A MW  TA  F+VVG+V+WILEHR+N++FRG PK+Q++T+L FSLST
Sbjct  569   ARSNAWVFLQPFTADMWCATAASFLVVGVVIWILEHRVNNDFRGPPKKQIVTMLMFSLST  628

Query  1701  LFFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESLKEGND  1880
             LF  ++E+TVS+L +MV+I+WLF++++I +SYTASLTSILTV+QL SPI G++SL   N 
Sbjct  629   LFKKNQEDTVSSLSKMVMIVWLFLLMVITASYTASLTSILTVEQLSSPITGIDSLIASNW  688

Query  1881  PIGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERPYVENF  2060
             PIGYQ+GSFA +YL + + +SKSRLI LGSPE YA AL+KGP  GGV+AI+DE PYVE F
Sbjct  689   PIGYQVGSFAYNYLTDNLYVSKSRLIPLGSPEEYATALQKGPSGGGVAAIIDELPYVELF  748

Query  2061  LSTQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLtrtsc-  2237
             LS +  F I+GQ F +S WGFAF R+SPLA DMSTAIL LSENGDL++IH+KW  +  C 
Sbjct  749   LSNETDFGIIGQPFARSSWGFAFQRESPLAYDMSTAILKLSENGDLRKIHEKWFCKMRCP  808

Query  2238  ssestelesDRLHLKSFW  2291
                ++  + D+LHL SFW
Sbjct  809   EDRTSNSKPDQLHLISFW  826


 Score =   357 bits (917),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 181/376 (48%), Positives = 241/376 (64%), Gaps = 6/376 (2%)
 Frame = +2

Query  59    VAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTTQ  238
             + A + ++  V AI+GPQSS VAHT+S +A+ LQVPL+S+AATDPTL+SLQFP+F+RTTQ
Sbjct  78    IGAFQVLEKGVAAIIGPQSSAVAHTVSQIADALQVPLVSYAATDPTLSSLQFPFFIRTTQ  137

Query  239   SDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGAT  418
             SD+ QM A+AD+ID +GWKEVI VF+DDDYGRNG++AL D L  +R +ISYK  +     
Sbjct  138   SDLAQMTAMADLIDFHGWKEVIVVFLDDDYGRNGVSALRDELEKRRLRISYKLPLSIKFD  197

Query  419   TRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVLDS  598
                E  ++L Q  +   RV V+H  P     +FS+AH L MM   YVW+ TDWLS  LDS
Sbjct  198   LD-EFTNLLNQSKVFGPRVYVVHVNPDPRLRIFSIAHNLQMMAKDYVWLVTDWLSATLDS  256

Query  599   SSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLTGGSLG---LNSYALYAYDSVW  769
              SP+      ++ GV+ LRQH PDS  K+AF SRW  +    L    LNSY +YAYD+VW
Sbjct  257   LSPVNQTSFSVLHGVVGLRQHIPDSSKKKAFVSRWIEMQKEGLANTSLNSYGIYAYDTVW  316

Query  770   LIAHAIDSFLNKGGVISFS--NDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGL  943
              +A AID F+     I+FS  ++  L  + G  + L+ L IF GG  L++ LLQS+F G+
Sbjct  317   AVARAIDIFIKVHNTITFSFPDNYNLSHMVGIGIQLDKLKIFAGGSDLVDILLQSNFTGV  376

Query  944   TGQFKFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQK  1123
             +GQ  FN+D+S+V   YDI+NV   G + +GFW N SG S  P   L  R  N  S +QK
Sbjct  377   SGQLHFNSDRSIVSGGYDIINVNQMGIKGVGFWSNNSGFSVVPHTALKKRKYNRFSQDQK  436

Query  1124  LYGVVWPGQSVKKAPG  1171
             L  + WPG    +  G
Sbjct  437   LGNITWPGGITDRPRG  452



>ref|XP_008455863.1| PREDICTED: glutamate receptor 3.7-like [Cucumis melo]
 ref|XP_008455864.1| PREDICTED: glutamate receptor 3.7-like [Cucumis melo]
 ref|XP_008455866.1| PREDICTED: glutamate receptor 3.7-like [Cucumis melo]
 ref|XP_008455867.1| PREDICTED: glutamate receptor 3.7-like [Cucumis melo]
 ref|XP_008455868.1| PREDICTED: glutamate receptor 3.7-like [Cucumis melo]
Length=914

 Score =   425 bits (1092),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 237/417 (57%), Positives = 314/417 (75%), Gaps = 3/417 (1%)
 Frame = +3

Query  1146  GSR*KKPRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTN-TFKGFSVDVFTAAVNLLPY  1322
             G + +KPRGWV  +N + L IGVP RVS+ EF++ V G++   +G+ +D+F  A  L+PY
Sbjct  448   GGKTEKPRGWVLADNERPLIIGVPHRVSFVEFVTAVNGSHKNIEGYCIDLFNEARKLVPY  507

Query  1323  AVPFQFVPFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLV  1502
              VP++ +PFGNG  NPSY +LV+ V+ G FD A+GDIAIVTNRT++VDF+QP+ ++GL++
Sbjct  508   DVPYRLIPFGNGYSNPSYDDLVKNVANGIFDAAVGDIAIVTNRTRIVDFSQPFASTGLVI  567

Query  1503  VAPFKKLNTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITIL  1682
             VAP K   + AW FL PF+ +MW VT+  F ++G V+W+LEHR+ND+FRG PK+QL+T++
Sbjct  568   VAPIKNSKSNAWVFLKPFTVEMWCVTSASFFMIGAVIWLLEHRVNDDFRGPPKRQLMTVI  627

Query  1683  WFSLSTLFFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVES  1862
              FS STLF  ++E TVS LGRMV+++WLF++++I SSYTASLTSILTVQQL SPIKG++ 
Sbjct  628   LFSFSTLFKTNQEATVSPLGRMVMVVWLFLLMVITSSYTASLTSILTVQQLSSPIKGLDD  687

Query  1863  LKEGNDPIGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGP-HKGGVSAIVDE  2039
             L     PIGYQ+GSFA  YL E + + +SRL++LGSPE Y  AL KGP  KGGV+AIVDE
Sbjct  688   LITNEQPIGYQVGSFAYSYLTESLYVPRSRLVSLGSPEEYEAALLKGPFRKGGVAAIVDE  747

Query  2040  RPYVENFLSTQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKW  2219
              PY+E FLS +  F ++GQ FTKSGWGFAF R SPLAVDMSTAIL LSENG LQ+IH+KW
Sbjct  748   LPYMELFLSGRNDFGMIGQPFTKSGWGFAFQRGSPLAVDMSTAILKLSENGKLQKIHEKW  807

Query  2220  LtrtscssestelesD-RLHLKSFWglfllcgaacflalfIYFVQIMLKFRRVARAE  2387
               R  C +E        +LHL SFWGL+LLCGA   +ALFI+ ++I+ +F R  R +
Sbjct  808   FCRMGCPAERRRKSEPIQLHLVSFWGLYLLCGAFSLVALFIFLLRIVRQFARYIRQQ  864


 Score =   360 bits (925),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 182/375 (49%), Positives = 246/375 (66%), Gaps = 6/375 (2%)
 Frame = +2

Query  59    VAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTTQ  238
             + A + ++ DVVAI+GPQSSVVAH +  +AN LQVPL+S+AATDPTL++LQFP+FLRTTQ
Sbjct  84    IGAFQVLEKDVVAIVGPQSSVVAHMVLQIANNLQVPLISYAATDPTLSALQFPFFLRTTQ  143

Query  239   SDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIP-PGA  415
             SD YQM A+AD+ID Y WKEVI +F+DDDYGRNGI+ L D L  +  KISYK  IP P  
Sbjct  144   SDAYQMTAMADLIDFYEWKEVIMIFVDDDYGRNGISTLTDELDKRMFKISYK--IPLPSH  201

Query  416   TTRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVLD  595
                +EI  IL +  L+  RV V+H  P     +F +AH L MM   YVW++TDWLST LD
Sbjct  202   FNLSEITAILNKSKLLGPRVYVVHVNPDPRLSIFKIAHQLDMMTSDYVWLATDWLSTTLD  261

Query  596   SSSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHL---TGGSLGLNSYALYAYDSV  766
             S   +    + I+QGV+VLRQH P+S  K    SR + +      +  LN YAL AYD++
Sbjct  262   SVRLVQQTSINILQGVVVLRQHIPESSQKTTLWSRLRKMLPEDSRNSSLNVYALSAYDTI  321

Query  767   WLIAHAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLT  946
              ++A AID FLN+G  I+FS  +K   +  S +    L IFD G LLL+ LLQ++F GL+
Sbjct  322   QVVARAIDKFLNEGRSITFSLKNKFHDLNTSRMPWGKLKIFDDGALLLSILLQANFTGLS  381

Query  947   GQFKFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKL  1126
             G  +FN+D+++V   Y+++N+  TG R++G+W N +G +   PETL  +  + S  NQ L
Sbjct  382   GHIEFNSDRNIVTRGYEVINIDQTGLRSVGYWSNVTGFTIQSPETLKQKQISYSHLNQTL  441

Query  1127  YGVVWPGQSVKKAPG  1171
               V WPG   +K  G
Sbjct  442   GNVTWPGGKTEKPRG  456



>ref|XP_007045627.1| Glutamate receptor isoform 1 [Theobroma cacao]
 gb|EOY01459.1| Glutamate receptor isoform 1 [Theobroma cacao]
Length=922

 Score =   418 bits (1075),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 228/415 (55%), Positives = 305/415 (73%), Gaps = 1/415 (0%)
 Frame = +3

Query  1146  GSR*KKPRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYA  1325
             G + ++PRGWV  ++ + LRIGVP R S+ +F++++  ++   G+ +DVFT A+ L+PY 
Sbjct  453   GGKIERPRGWVIADDERPLRIGVPYRASFVDFVTELHDSHQIVGYCIDVFTEALKLVPYY  512

Query  1326  VPFQFVPFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVV  1505
             VP++F  FGNGR NP+Y +LV++V+   FD A+GDIAIV NRT++VDF+QPY+ +GL++V
Sbjct  513   VPYKFELFGNGRSNPNYGQLVKMVADNVFDAAVGDIAIVKNRTEIVDFSQPYITTGLVIV  572

Query  1506  APFKKLNTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILW  1685
             AP +   + AW FL PF+  MW +TA  FV++GIV+WILEHR+ND+FRG P++Q++T+  
Sbjct  573   APIRNPKSSAWVFLKPFTVDMWCMTAAAFVIIGIVIWILEHRVNDDFRGPPRRQIVTMFM  632

Query  1686  FSLSTLFFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESL  1865
             FS STLF  ++E TVSTLGR+V+++WLF++++I SSYTA+LTSILTVQQL SPI G++SL
Sbjct  633   FSFSTLFKTNQEETVSTLGRVVMVVWLFLLMVITSSYTANLTSILTVQQLLSPITGIDSL  692

Query  1866  KEGNDPIGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERP  2045
                  PIGYQ+GSFA  YL E + I +SRL+ L SPE Y  AL  GP  GGV+AIVDE P
Sbjct  693   IANTWPIGYQVGSFAYGYLSENLNIHQSRLVELHSPEEYESALRLGPDNGGVAAIVDELP  752

Query  2046  YVENFLSTQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLt  2225
             YVE FLS    F I+GQ FTK GWGFAF RDS LAVDMSTAIL LSENG LQ IH KWL 
Sbjct  753   YVELFLSKHTDFGIIGQPFTKRGWGFAFQRDSVLAVDMSTAILRLSENGMLQEIHKKWLC  812

Query  2226  rtsc-ssestelesDRLHLKSFWglfllcgaacflalfIYFVQIMLKFRRVARAE  2387
             +  C        E ++LHL SFWGL+LLCG     AL I+ ++++ +F R  R +
Sbjct  813   KMGCPGERRKNYEPNQLHLTSFWGLYLLCGCITLAALLIFLLRMVRQFVRYRRRQ  867


 Score =   367 bits (941),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 174/372 (47%), Positives = 248/372 (67%), Gaps = 4/372 (1%)
 Frame = +2

Query  65    ALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTTQSD  244
             A + ++ +VVAI+GPQSS +AH IS +AN LQVP +S+AATDPTL++LQFP+FLRT QSD
Sbjct  91    AFQVIEKEVVAIIGPQSSSIAHIISAIANGLQVPQVSYAATDPTLSALQFPFFLRTVQSD  150

Query  245   MYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGATTR  424
               QM+A+AD+ID YGWKEVIA+++DDDYGRNGI+ L++ L  +  K  YK  +P     +
Sbjct  151   SNQMIAMADLIDFYGWKEVIAIYVDDDYGRNGISVLNNELDRRMAKAFYKLPLP-AHFAQ  209

Query  425   AEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVLDSSS  604
             ++I+ +L    L+  RV V+H  P     +F+ A  L MM   YVW++TDWLS  +DS S
Sbjct  210   SDIISLLNNSKLLGPRVFVVHVNPDPQLRIFAFAEKLQMMTSDYVWLATDWLSATIDSFS  269

Query  605   PLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLTGGSLG---LNSYALYAYDSVWLI  775
             P+    +  +QGV+ LRQH P+S  K+ F SRW+ +    L    LNSY L AYD+VW +
Sbjct  270   PMNRTALHSLQGVVGLRQHIPESNQKKDFMSRWRKMQQKGLATSQLNSYGLCAYDTVWTV  329

Query  776   AHAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLTGQF  955
             AH+ID F+N G  ++FS+  KL  I+   +HLE L +FDGG +LL  LLQ++F GLTGQ 
Sbjct  330   AHSIDKFINDGNNLTFSSSDKLNDIKTGEMHLEKLKVFDGGDILLKELLQTNFSGLTGQV  389

Query  956   KFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKLYGV  1135
              F++D+++V   YD++N+      T+G+W    G S +PPETL      +S  +Q+L+ V
Sbjct  390   HFSSDRNIVTSGYDVINIDNMAVHTVGYWSGTFGFSVSPPETLQGTQHGNSEIDQELHSV  449

Query  1136  VWPGQSVKKAPG  1171
              WPG  +++  G
Sbjct  450   TWPGGKIERPRG  461



>tpg|DAA59325.1| TPA: hypothetical protein ZEAMMB73_375779 [Zea mays]
Length=875

 Score =   421 bits (1081),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 250/415 (60%), Positives = 315/415 (76%), Gaps = 4/415 (1%)
 Frame = +3

Query  1164  PRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGT-NTFKGFSVDVFTAAVNLLPYAVPFQF  1340
             PRGWVF +NGK L IGVP R SYKEF+S+   + +   G+ VDVF AAV LLPY VP  F
Sbjct  389   PRGWVFADNGKPLTIGVPYRTSYKEFVSKDETSPDGVSGYCVDVFKAAVALLPYPVPVSF  448

Query  1341  VPFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPFKK  1520
             V FG+G ENPSY+ELV+ V+ GYFD A+GDI+IVTNRT+VVDFTQPY+ SGL++V+  K 
Sbjct  449   VLFGDGVENPSYNELVQKVADGYFDAAVGDISIVTNRTRVVDFTQPYIDSGLMIVSTVKS  508

Query  1521  LNTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSLST  1700
              ++  WAFL PF+ ++W     F + VG VVWILEHR NDEFRG  K+Q++TI WFS S+
Sbjct  509   SSSDEWAFLKPFTPELWATVVAFCIFVGAVVWILEHRHNDEFRGPLKKQMVTIFWFSFSS  568

Query  1701  LFFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESLKEGND  1880
             +FF  RE+TVS  GR V+I+WLFVVLII  SYTASLTSILTVQQL + I+G+  L   ND
Sbjct  569   MFFTQREDTVSVPGRFVVIMWLFVVLIITQSYTASLTSILTVQQLSTGIQGLSDLLASND  628

Query  1881  PIGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERPYVENF  2060
             PIGYQ+GSFA  Y+ +E+G++ +RL  L  P+ YA++L++GP  GGV+AIVDE PY+E F
Sbjct  629   PIGYQVGSFAGSYMNKELGVAATRLREL-DPDDYADSLQRGPRGGGVAAIVDELPYMELF  687

Query  2061  LSTQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLtr-tsc  2237
             LS+ C+F+ VGQEFTKSGWGFAFP DSPLAVD+STAIL+LSENGDLQRIHD WL   T  
Sbjct  688   LSSNCQFQTVGQEFTKSGWGFAFPLDSPLAVDLSTAILTLSENGDLQRIHDNWLNTGTCD  747

Query  2238  ssestelesDRLHLKSFWglfllcgaacflalfIYFVQIMLKFRRVARAEPVADG  2402
             S  +    ++RL L++F GLFL+CG AC +AL I+FV+I+ +F +  R    ADG
Sbjct  748   SQNNGVGGAERLSLRNFGGLFLICGVACVIALLIHFVRILFQFCQY-RRHGAADG  801


 Score =   364 bits (935),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 192/392 (49%), Positives = 255/392 (65%), Gaps = 18/392 (5%)
 Frame = +2

Query  62    AALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTTQS  241
             A L+ M+ +VVA++GPQSSV+AH +SHVAN+L+VPLLSFAATDP LAS Q+PYF+RT   
Sbjct  8     AGLELMEKEVVAVVGPQSSVIAHVVSHVANQLRVPLLSFAATDPALASTQYPYFVRTVHD  67

Query  242   DMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGATT  421
             D +QM AIADV+ H+GW+EV AV++DDDYGR G+ AL DAL A R ++SY+A  P GA  
Sbjct  68    DRFQMAAIADVVSHFGWREVTAVYVDDDYGRGGVIALADALEATRARVSYRAAFPLGA-D  126

Query  422   RAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVLDSS  601
             RA + DIL +   MESRV ++HA P +G  VF+ A  LGMM  GY WI+TDWL+T    +
Sbjct  127   RATLADILQRANFMESRVFIVHASPDSGLNVFAAARGLGMMVSGYTWIATDWLATAAIDA  186

Query  602   SPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHL----TGGSLGLNSYALYAYDSVW  769
             +   S    I QGVL LRQ+TPDS+ K +  SR           +  +N+Y L+AYDSVW
Sbjct  187   AGAASNSSNI-QGVLTLRQYTPDSDAKASLLSRLAAADPTSNNATASVNTYGLFAYDSVW  245

Query  770   LIAHAIDSFLNK--GGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGL  943
             + A+AID FL    GG +SFS D  ++   GS L L AL +FD G  LL  ++ S+F G+
Sbjct  246   MAAYAIDQFLGDAGGGNVSFSADPTIRDANGSALGLSALRVFDQGEQLLGKVMLSNFTGV  305

Query  944   TGQFKF------NNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSR--PP  1099
             TG  +F      N+  +LV P+Y+ILNV GTG R + +W NY+ LS   P+ L     PP
Sbjct  306   TGHVEFQFDAGVNSSGTLVNPAYEILNVGGTGVRRVAYWSNYTRLSVDAPKQLGDGVPPP  365

Query  1100  NSSS--ANQKLYGVVWPGQSVKKAPGVGFPEQ  1189
             NS+S  A Q++  V+WPG +     G  F + 
Sbjct  366   NSTSTTAQQQMSNVIWPGGTTATPRGWVFADN  397



>ref|XP_011008403.1| PREDICTED: glutamate receptor 3.7 [Populus euphratica]
Length=909

 Score =   421 bits (1083),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 224/415 (54%), Positives = 312/415 (75%), Gaps = 1/415 (0%)
 Frame = +3

Query  1146  GSR*KKPRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYA  1325
             G + K PRGWV   + + LRIGVP R S+ +F+++V G++  +G+ +DVF  A+ L+PY 
Sbjct  446   GGKSKTPRGWVIAVDERPLRIGVPNRASFTDFVTEVHGSHKIEGYCIDVFVKALELVPYH  505

Query  1326  VPFQFVPFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVV  1505
             VP+ F PFGNGR NP Y +LV++V+   FD A+GDIAIVTNRTK+VDF+QPY ++GL++V
Sbjct  506   VPYMFQPFGNGRSNPKYDDLVKMVAADVFDAAVGDIAIVTNRTKIVDFSQPYASTGLVIV  565

Query  1506  APFKKLNTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILW  1685
             AP +   + AW FL PF+A+MW VTA  FV++ +V+W+LEHR+ND+FRG P++Q++T+  
Sbjct  566   APIRNSKSSAWVFLKPFTAEMWCVTAASFVMIAVVIWVLEHRVNDDFRGPPRRQIVTMFM  625

Query  1686  FSLSTLFFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESL  1865
             FS STLF  ++E TVS LG++V+++WLF++++I +SYTASLTSILT+QQL SPI G+ESL
Sbjct  626   FSFSTLFKKNKETTVSPLGKLVMVVWLFLLMVITASYTASLTSILTIQQLSSPITGIESL  685

Query  1866  KEGNDPIGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERP  2045
                + PIGYQ GSFA  YL E + I +SRL++LGSPE Y  AL++GP   GV+AIVDE P
Sbjct  686   IASHWPIGYQTGSFAYDYLSETLYIPRSRLVSLGSPEEYESALQRGPSDRGVAAIVDELP  745

Query  2046  YVENFLSTQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLt  2225
             YVE FLS+Q  F I+GQ FT  GWGFAF R+SPLA+D+STAIL LSENG+LQ+I++KW  
Sbjct  746   YVELFLSSQKDFGIIGQPFTHGGWGFAFRRESPLALDISTAILKLSENGELQKIYEKWFC  805

Query  2226  rtscssesteles-DRLHLKSFWglfllcgaacflalfIYFVQIMLKFRRVARAE  2387
             +  C  E       ++L+L SFWGL++LCGA    AL ++ ++++ +F R  R +
Sbjct  806   KMGCHGEKKHGNEPNQLNLISFWGLYILCGAFALTALVVFLLRMVRQFVRYKRRQ  860


 Score =   363 bits (933),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 181/374 (48%), Positives = 248/374 (66%), Gaps = 4/374 (1%)
 Frame = +2

Query  59    VAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTTQ  238
             V A + ++ +VVAI+GPQ S +AH IS +A+ LQVPL+S+AATDPTL++LQFP+F+RTTQ
Sbjct  82    VDAFQLVEKEVVAIIGPQVSGIAHMISSIASGLQVPLISYAATDPTLSALQFPFFVRTTQ  141

Query  239   SDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGAT  418
             SD YQM A+AD+ID + WKEVI V +DDDYGRNGIAAL++ L  K  KISYK  +     
Sbjct  142   SDSYQMAAMADLIDFFRWKEVIVVGVDDDYGRNGIAALEEELNKKMAKISYKLML-SNQL  200

Query  419   TRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVLDS  598
               +E+MD L +  L+ SRV V+H  P     +F+VA  L MM D Y W++TDWLS  +DS
Sbjct  201   DESEVMDKLSKSKLLGSRVYVVHVNPDPKLRIFTVAQKLQMMTDTYSWLATDWLSATIDS  260

Query  599   SSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLT---GGSLGLNSYALYAYDSVW  769
               P     +  +QGV+ LRQHTP+S  KRAF SRWK +      S  LN+Y L AYD+VW
Sbjct  261   FPPTKKTSLRFLQGVVGLRQHTPESSQKRAFMSRWKRMQQKGSASSELNTYGLQAYDTVW  320

Query  770   LIAHAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLTG  949
             L+A+AID FL++   I+FS +SK+  +  S L +E L IF GG  LL+ +LQ+ F GL+G
Sbjct  321   LVAYAIDRFLDEHKNITFSPNSKILDMNISGLQIEKLKIFTGGNDLLDIVLQTKFTGLSG  380

Query  950   QFKFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKLY  1129
             Q +FN D+++    YD+LN+ G   RT+G+W   +G S +PPE    +   +   +Q+L+
Sbjct  381   QIQFNQDRNVFSGGYDVLNIDGMSIRTVGYWSIAAGFSLSPPEARKGKQDINCCLDQRLH  440

Query  1130  GVVWPGQSVKKAPG  1171
              + WPG   K   G
Sbjct  441   NITWPGGKSKTPRG  454



>ref|XP_006592814.1| PREDICTED: glutamate receptor 3.7-like isoform X2 [Glycine max]
Length=835

 Score =   428 bits (1100),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 219/378 (58%), Positives = 291/378 (77%), Gaps = 1/378 (0%)
 Frame = +3

Query  1161  KPRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYAVPFQF  1340
             +PRGWV  +N K LRIGVP R S+ EF++++P ++  +G+ +DVF  A+  +PY VPF F
Sbjct  379   RPRGWVIADNTKPLRIGVPKRASFVEFVTELPDSHQIQGYCIDVFKKALEFIPYEVPFVF  438

Query  1341  VPFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPFKK  1520
              PFGNG+ NP+Y  LV++V    +D  +GDIAIVTNRT +VDF+QP+ +S L++VAP  K
Sbjct  439   KPFGNGKANPNYDALVKMVDENVYDAVVGDIAIVTNRTMIVDFSQPFASSSLVIVAPINK  498

Query  1521  LNTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSLST  1700
               + AW FL PF+A MW  TA  F+VVG+V+WILEHR+N++FRG PK+Q++T+L FSLST
Sbjct  499   ARSNAWVFLQPFTADMWCATAASFLVVGVVIWILEHRVNNDFRGPPKKQIVTMLMFSLST  558

Query  1701  LFFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESLKEGND  1880
             LF  ++E+TVS+L +MV+I+WLF++++I +SYTASLTSILTV+QL SPI G++SL   N 
Sbjct  559   LFKKNQEDTVSSLSKMVMIVWLFLLMVITASYTASLTSILTVEQLSSPITGIDSLIASNW  618

Query  1881  PIGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERPYVENF  2060
             PIGYQ+GSFA +YL + + +SKSRLI LGSPE YA AL+KGP  GGV+AI+DE PYVE F
Sbjct  619   PIGYQVGSFAYNYLTDNLYVSKSRLIPLGSPEEYATALQKGPSGGGVAAIIDELPYVELF  678

Query  2061  LSTQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLtrtscs  2240
             LS +  F I+GQ F +S WGFAF R+SPLA DMSTAIL LSENGDL++IH+KW  +  C+
Sbjct  679   LSNETDFGIIGQPFARSSWGFAFQRESPLAYDMSTAILKLSENGDLRKIHEKWFCKMGCA  738

Query  2241  sesteles-DRLHLKSFW  2291
              + T     D+LHL SFW
Sbjct  739   EDRTSNSKPDQLHLISFW  756


 Score =   355 bits (911),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 181/373 (49%), Positives = 240/373 (64%), Gaps = 6/373 (2%)
 Frame = +2

Query  68    LKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTTQSDM  247
             L+ ++  V AI+GPQSS VAHT+S +A+ LQVPL+S+AATDPTL+SLQFP+F+RTTQSD+
Sbjct  11    LEVLEKGVAAIIGPQSSAVAHTVSQIADALQVPLVSYAATDPTLSSLQFPFFIRTTQSDL  70

Query  248   YQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGATTRA  427
              QM A+AD+ID +GWKEVI VF+DDDYGRNG++AL D L  +R +ISYK  +        
Sbjct  71    AQMTAMADLIDFHGWKEVIVVFLDDDYGRNGVSALRDELEKRRLRISYKLPLSIKFDLD-  129

Query  428   EIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVLDSSSP  607
             E  ++L Q  +   RV V+H  P     +FS+AH L MM   YVW+ TDWLS  LDS SP
Sbjct  130   EFTNLLNQSKVFGPRVYVVHVNPDPRLRIFSIAHNLQMMAKDYVWLVTDWLSATLDSLSP  189

Query  608   LPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLTGGSLG---LNSYALYAYDSVWLIA  778
             +      ++ GV+ LRQH PDS  K+AF SRW  +    L    LNSY +YAYD+VW +A
Sbjct  190   VNQTSFSVLHGVVGLRQHIPDSSKKKAFVSRWIEMQKEGLANTSLNSYGIYAYDTVWAVA  249

Query  779   HAIDSFLNKGGVISFS--NDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLTGQ  952
              AID F+     I+FS  ++  L  + G  + L+ L IF GG  L++ LLQS+F G++GQ
Sbjct  250   RAIDIFIKVHNTITFSFPDNYNLSHMVGIGIQLDKLKIFAGGSDLVDILLQSNFTGVSGQ  309

Query  953   FKFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKLYG  1132
               FN+D+S+V   YDI+NV   G + +GFW N SG S  P   L  R  N  S +QKL  
Sbjct  310   LHFNSDRSIVSGGYDIINVNQMGIKGVGFWSNNSGFSVVPHTALKKRKYNRFSQDQKLGN  369

Query  1133  VVWPGQSVKKAPG  1171
             + WPG    +  G
Sbjct  370   ITWPGGITDRPRG  382



>gb|KGN63257.1| hypothetical protein Csa_2G418920 [Cucumis sativus]
Length=914

 Score =   422 bits (1084),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 234/417 (56%), Positives = 313/417 (75%), Gaps = 3/417 (1%)
 Frame = +3

Query  1146  GSR*KKPRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTN-TFKGFSVDVFTAAVNLLPY  1322
             G + +KPRGWV  +N + L IGVP RVS+ EF++ + G++   +G+ +D+F  A  L+PY
Sbjct  448   GGKTEKPRGWVIADNERPLIIGVPHRVSFVEFVTAINGSHKNIEGYCIDLFNEARKLVPY  507

Query  1323  AVPFQFVPFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLV  1502
              VP++ +PFGNG  NPSY +LV+ V+ G FD A+GDIAIVTNRT++VDF+QP+ ++GL++
Sbjct  508   DVPYRLIPFGNGYSNPSYDDLVKNVANGIFDAAVGDIAIVTNRTRIVDFSQPFASTGLVI  567

Query  1503  VAPFKKLNTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITIL  1682
             VAP K   + AW FL PF+ +MW +T+  F ++G V+W+LEHR+ND+FRG PK+QL+T++
Sbjct  568   VAPIKNSKSNAWVFLKPFTVEMWCITSASFFMIGAVIWLLEHRVNDDFRGPPKRQLMTVI  627

Query  1683  WFSLSTLFFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVES  1862
              FS STLF  ++E TVS LGRMV+++WLF++++I SSYTASLTSILTVQQL SPIKG++ 
Sbjct  628   LFSFSTLFKTNQEATVSPLGRMVMVVWLFLLMVITSSYTASLTSILTVQQLSSPIKGLDD  687

Query  1863  LKEGNDPIGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGP-HKGGVSAIVDE  2039
             L     PIGYQ+GSFA  YL E + + +SRL++LGSP+ Y  AL KGP  KGGV+AIVDE
Sbjct  688   LITNEQPIGYQVGSFAYSYLTESLYVPRSRLVSLGSPDEYEAALLKGPFRKGGVAAIVDE  747

Query  2040  RPYVENFLSTQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKW  2219
              PYVE FLS +  F ++GQ FTKSGWGFAF R SPLAVDMSTAIL LSENG LQ+IH+KW
Sbjct  748   LPYVELFLSGRNDFGMIGQPFTKSGWGFAFQRGSPLAVDMSTAILKLSENGKLQKIHEKW  807

Query  2220  LtrtscssestelesD-RLHLKSFWglfllcgaacflalfIYFVQIMLKFRRVARAE  2387
               R  C +E        +L L SFWGL+LLCGA   +ALFI+ ++I+ +F R  R +
Sbjct  808   FCRMGCPAERRRKSKPIQLQLVSFWGLYLLCGAFSLIALFIFLLRIVRQFARYIRQQ  864


 Score =   360 bits (925),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 183/375 (49%), Positives = 245/375 (65%), Gaps = 6/375 (2%)
 Frame = +2

Query  59    VAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTTQ  238
             + A + ++ DVVAI+GPQSSVVAH +  +AN LQVPL+S+AATDPTL++LQFP+FLRTTQ
Sbjct  84    IGAFQVLEKDVVAIVGPQSSVVAHMVLQIANNLQVPLISYAATDPTLSALQFPFFLRTTQ  143

Query  239   SDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIP-PGA  415
             SD  QM A+AD+ID Y WKEVI +F+DDDYGRNGI+ L D L  +  KISYK  IP P  
Sbjct  144   SDANQMTAMADLIDFYEWKEVIMIFVDDDYGRNGISTLTDELDKRMFKISYK--IPLPSH  201

Query  416   TTRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVLD  595
                +EI  IL +  L+  RV V+H  P     +F +AH L MM   YVW++TDWLST LD
Sbjct  202   CNLSEITAILNKSKLLGPRVYVVHVNPDPRLSIFKIAHQLDMMTSDYVWLATDWLSTTLD  261

Query  596   SSSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHL---TGGSLGLNSYALYAYDSV  766
             S   +    + I+QGV+VLRQH P+S  K    SR + +      +  LN YAL AYD++
Sbjct  262   SILLVQQTSLNILQGVVVLRQHIPESSQKVTLWSRLRKMLPEDSRNSSLNVYALSAYDTI  321

Query  767   WLIAHAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLT  946
              ++AHAID FLN+G  I+FS  +K   +  S +    L IFD G LLL+ LLQ++F GL+
Sbjct  322   QVVAHAIDKFLNEGRSITFSLKNKFHDLNTSRMPWGKLKIFDDGALLLSILLQANFTGLS  381

Query  947   GQFKFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKL  1126
             GQ +FN D+++V   Y+++N+  TG R +G+W N +G +   PETL  +  + S  NQ L
Sbjct  382   GQIEFNTDRNIVTRGYEVINIDQTGLRRVGYWSNVTGFTIQSPETLKRKQISYSHLNQTL  441

Query  1127  YGVVWPGQSVKKAPG  1171
               V WPG   +K  G
Sbjct  442   GNVTWPGGKTEKPRG  456



>ref|XP_008341999.1| PREDICTED: glutamate receptor 3.7-like [Malus domestica]
Length=912

 Score =   423 bits (1087),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 233/413 (56%), Positives = 309/413 (75%), Gaps = 1/413 (0%)
 Frame = +3

Query  1146  GSR*KKPRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYA  1325
             G   ++PRGW   +N K LRIGVP RVS+ EF++++  ++  +G+ +DVF  A  L+PY 
Sbjct  448   GGNTERPRGWEIADNEKPLRIGVPKRVSFVEFVTELNNSHKIEGYCIDVFNEARKLIPYD  507

Query  1326  VPFQFVPFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVV  1505
             VP +F PFG+G  NPSY+ELV++V+   FD A+GDIAIV NRT +VDF+QPY  +GL++V
Sbjct  508   VPHRFEPFGDGXSNPSYNELVKMVAEKVFDAAVGDIAIVKNRTVMVDFSQPYATTGLVIV  567

Query  1506  APFKKLNTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILW  1685
             AP     + AW FL PFS +MW VTA FFV++ +V+WILEHR+N +FRG PK+Q++T+  
Sbjct  568   APIDNSKSNAWVFLKPFSLEMWCVTASFFVIIAVVMWILEHRVNKDFRGPPKRQIVTMFL  627

Query  1686  FSLSTLFFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESL  1865
             FS STLF  ++E+TVS LGRMV+++WLF++++I SSYTASLTSILTVQQL SPI G++SL
Sbjct  628   FSFSTLFKKNQEDTVSPLGRMVMVVWLFLLMVITSSYTASLTSILTVQQLSSPITGIDSL  687

Query  1866  KEGNDPIGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERP  2045
                N PIGYQ+GSFA  YL + + I +SRL+ LGSPE Y  AL KGP  GGV+AI+DE  
Sbjct  688   IASNWPIGYQVGSFAYGYLTDGLYIPRSRLVPLGSPEEYENALRKGPDDGGVAAIIDELT  747

Query  2046  YVENFLSTQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLt  2225
             YVE FLS+Q  F I+GQ FT+SGWGFAFPRDSPLA+DMSTAIL LSENG LQ+IH+KW  
Sbjct  748   YVELFLSSQTDFGIIGQPFTRSGWGFAFPRDSPLAIDMSTAILKLSENGALQKIHEKWFC  807

Query  2226  rt-scssestelesDRLHLKSFWglfllcgaacflalfIYFVQIMLKFRRVAR  2381
             +T   +      ES++L+L SFWGL+LLCG+    AL I+ ++ + +F R  +
Sbjct  808   KTGCLNKNLDSDESNQLYLISFWGLYLLCGSVTLAALIIFLLRAVHQFVRYKK  860


 Score =   359 bits (922),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 175/374 (47%), Positives = 248/374 (66%), Gaps = 4/374 (1%)
 Frame = +2

Query  59    VAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTTQ  238
             V A + +   +VAI+GPQSS +AH IS +AN LQVPL+S+AATDPTL++LQFP+FLRTTQ
Sbjct  84    VEAFQVLDKSIVAIIGPQSSSIAHMISEIANGLQVPLISYAATDPTLSALQFPFFLRTTQ  143

Query  239   SDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGAT  418
             SD +QM A+A +I+ YGWKEVIAVF+DDDYGRN I++L D L     +ISYK  +P    
Sbjct  144   SDAHQMAAMAGLINFYGWKEVIAVFVDDDYGRNAISSLHDELDKIMSRISYKLALPVDFN  203

Query  419   TRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVLDS  598
               ++I D+L +  L+  RV ++H  P     +F+VA  L MM   YVW +TDWLS+ +DS
Sbjct  204   L-SDIADLLNKSKLLGPRVYIVHVDPDPRLRIFTVAKELHMMTSNYVWFATDWLSSTVDS  262

Query  599   SSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLTGGSLG---LNSYALYAYDSVW  769
              +P+    + ++QGV+ LR+H P+S  KRAF +RWK +    L    LN Y LYAYD+VW
Sbjct  263   XAPMNRTSLAVLQGVVTLRKHIPESRQKRAFMTRWKKMQQDGLAISELNVYGLYAYDTVW  322

Query  770   LIAHAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLTG  949
              +A +I++++N+   ISFS   KL  ++ S + L  L +FDGG LL   LL++   GLTG
Sbjct  323   AVAQSIENYINEYRNISFSVIDKLHVMKPSQIQLGKLKVFDGGSLLREKLLETKMSGLTG  382

Query  950   QFKFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKLY  1129
               +F++++S  + +YDI+N+      T+GFW NYS LS +PPET   R  + S  +QKL 
Sbjct  383   HIEFDHERSRAIGTYDIINIDQMTIHTVGFWTNYSXLSVSPPETHKXRRSSYSPLDQKLG  442

Query  1130  GVVWPGQSVKKAPG  1171
              + WPG + ++  G
Sbjct  443   NITWPGGNTERPRG  456



>ref|XP_007217061.1| hypothetical protein PRUPE_ppa001093mg [Prunus persica]
 gb|EMJ18260.1| hypothetical protein PRUPE_ppa001093mg [Prunus persica]
Length=911

 Score =   410 bits (1053),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 228/418 (55%), Positives = 308/418 (74%), Gaps = 2/418 (0%)
 Frame = +3

Query  1146  GSR*KKPRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYA  1325
             G   ++PRGWV  +N K LRIGVP R S+ EF++++  ++T +G+ +DVFT A  L+PY 
Sbjct  448   GGNTERPRGWVIADNEKPLRIGVPNRASFVEFVTELNDSHTVQGYCIDVFTEARKLVPYD  507

Query  1326  VPFQFVPFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVV  1505
             +P++F PFG+G  NPSY ELV++V+   FD A+GDIAIV NRT +VDF+QPY  +GL++V
Sbjct  508   IPYRFEPFGDGLSNPSYDELVKMVAENVFDAAVGDIAIVKNRTLIVDFSQPYATTGLVIV  567

Query  1506  APFKKLNTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILW  1685
             AP     + AW FL PF+ +MW VTA FFV++ +V+W LEHR+N +FRG PK+QL+T+  
Sbjct  568   APIDNSKSNAWVFLKPFTWEMWCVTAAFFVMIAVVIWTLEHRVNKDFRGPPKRQLVTMFL  627

Query  1686  FSLSTLFFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESL  1865
               L  L     E+TVS LGRMV+++WLF++++I SSYTA+LTSILTVQQL SPI G++SL
Sbjct  628   MYLFLLSITE-EDTVSPLGRMVMVVWLFLLMVITSSYTANLTSILTVQQLSSPITGIDSL  686

Query  1866  KEGNDPIGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERP  2045
                N PIGYQ+GSFA  YL E + I +SRL+ LGSPE Y +AL +GP+ GGV AI+DE  
Sbjct  687   IASNWPIGYQVGSFAYSYLTESLYIPRSRLVQLGSPEEYEKALRQGPYDGGVGAIIDELT  746

Query  2046  YVENFLSTQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLt  2225
             Y+E FLS Q  F I+GQ FT+SGWGFAF RDSPLA+DMSTAIL LSE+G+LQ+IH+KW  
Sbjct  747   YIELFLSRQTDFGIIGQTFTRSGWGFAFQRDSPLAIDMSTAILKLSESGELQKIHEKWFC  806

Query  2226  rtsc-ssestelesDRLHLKSFWglfllcgaacflalfIYFVQIMLKFRRVARAEPVA  2396
             +  C S ++ E E ++L L SFWGL+LLCG     AL I+ ++++L+F R  + + V 
Sbjct  807   KMGCPSEKNLESEPNQLKLISFWGLYLLCGVFTISALLIFLLRVVLQFVRYKKQQAVT  864


 Score =   372 bits (955),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 180/372 (48%), Positives = 249/372 (67%), Gaps = 4/372 (1%)
 Frame = +2

Query  65    ALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTTQSD  244
               + +   +VAI+GPQSS +AH IS +AN LQVPL+S+AATDP+L++LQFP+FLRTTQSD
Sbjct  86    VFQVLDKSIVAIVGPQSSSIAHMISEIANGLQVPLISYAATDPSLSALQFPFFLRTTQSD  145

Query  245   MYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGATTR  424
              YQM A+AD+ID YGWKEVIAV++DDDYGRNG+  L   L  K  +ISYK  +P      
Sbjct  146   AYQMAAMADLIDFYGWKEVIAVYVDDDYGRNGVYTLGHELGKKMSRISYKLALPVQFNL-  204

Query  425   AEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVLDSSS  604
             ++I ++L +  ++  RV V+H  P     +F+VA  L MM   YVW++TDWLST +DS S
Sbjct  205   SDITELLNKSKVLGPRVYVVHVDPDPRLRIFTVAKQLQMMTSSYVWLATDWLSTTVDSFS  264

Query  605   PLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLTGGSLG---LNSYALYAYDSVWLI  775
             P     + +++GV+ LRQH P S  KRAF SRWK +    L    LN+Y LYAYD+VW +
Sbjct  265   PTNRTSLTVLEGVVTLRQHIPQSNRKRAFISRWKKMQKEGLASSELNAYGLYAYDTVWAV  324

Query  776   AHAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLTGQF  955
             AH+I++F+N+   ISFS   +L  ++ S + L  L +FDGG LL   LL+++  GLTGQ 
Sbjct  325   AHSIENFINEYRNISFSFVDRLHDMKPSKIELGKLKVFDGGSLLRRKLLKTNMSGLTGQV  384

Query  956   KFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKLYGV  1135
             +FN D++ V+  YD++N+     RT+GFW NYSG S +PP+TL  R  + S  + KL  V
Sbjct  385   QFNEDRNRVIGGYDVINIDQMTIRTVGFWTNYSGFSVSPPKTLKGRRSSYSPLDYKLDNV  444

Query  1136  VWPGQSVKKAPG  1171
              WPG + ++  G
Sbjct  445   TWPGGNTERPRG  456



>ref|XP_004151886.1| PREDICTED: glutamate receptor 3.7-like [Cucumis sativus]
Length=866

 Score =   421 bits (1082),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 234/417 (56%), Positives = 313/417 (75%), Gaps = 3/417 (1%)
 Frame = +3

Query  1146  GSR*KKPRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTN-TFKGFSVDVFTAAVNLLPY  1322
             G + +KPRGWV  +N + L IGVP RVS+ EF++ + G++   +G+ +D+F  A  L+PY
Sbjct  400   GGKTEKPRGWVIADNERPLIIGVPHRVSFVEFVTAINGSHKNIEGYCIDLFNEARKLVPY  459

Query  1323  AVPFQFVPFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLV  1502
              VP++ +PFGNG  NPSY +LV+ V+ G FD A+GDIAIVTNRT++VDF+QP+ ++GL++
Sbjct  460   DVPYRLIPFGNGYSNPSYDDLVKNVANGIFDAAVGDIAIVTNRTRIVDFSQPFASTGLVI  519

Query  1503  VAPFKKLNTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITIL  1682
             VAP K   + AW FL PF+ +MW +T+  F ++G V+W+LEHR+ND+FRG PK+QL+T++
Sbjct  520   VAPIKNSKSNAWVFLKPFTVEMWCITSASFFMIGAVIWLLEHRVNDDFRGPPKRQLMTVI  579

Query  1683  WFSLSTLFFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVES  1862
              FS STLF  ++E TVS LGRMV+++WLF++++I SSYTASLTSILTVQQL SPIKG++ 
Sbjct  580   LFSFSTLFKTNQEATVSPLGRMVMVVWLFLLMVITSSYTASLTSILTVQQLSSPIKGLDD  639

Query  1863  LKEGNDPIGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGP-HKGGVSAIVDE  2039
             L     PIGYQ+GSFA  YL E + + +SRL++LGSP+ Y  AL KGP  KGGV+AIVDE
Sbjct  640   LITNEQPIGYQVGSFAYSYLTESLYVPRSRLVSLGSPDEYEAALLKGPFRKGGVAAIVDE  699

Query  2040  RPYVENFLSTQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKW  2219
              PYVE FLS +  F ++GQ FTKSGWGFAF R SPLAVDMSTAIL LSENG LQ+IH+KW
Sbjct  700   LPYVELFLSGRNDFGMIGQPFTKSGWGFAFQRGSPLAVDMSTAILKLSENGKLQKIHEKW  759

Query  2220  LtrtscssestelesD-RLHLKSFWglfllcgaacflalfIYFVQIMLKFRRVARAE  2387
               R  C +E        +L L SFWGL+LLCGA   +ALFI+ ++I+ +F R  R +
Sbjct  760   FCRMGCPAERRRKSKPIQLQLVSFWGLYLLCGAFSLIALFIFLLRIVRQFARYIRQQ  816


 Score =   361 bits (926),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 181/374 (48%), Positives = 244/374 (65%), Gaps = 4/374 (1%)
 Frame = +2

Query  59    VAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTTQ  238
             + A + ++ DVVAI+GPQSSVVAH +  +AN LQVPL+S+AATDPTL++LQFP+FLRTTQ
Sbjct  36    IGAFQVLEKDVVAIVGPQSSVVAHMVLQIANNLQVPLISYAATDPTLSALQFPFFLRTTQ  95

Query  239   SDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGAT  418
             SD  QM A+AD+ID Y WKEVI +F+DDDYGRNGI+ L D L  +  KISYK  +P    
Sbjct  96    SDANQMTAMADLIDFYEWKEVIMIFVDDDYGRNGISTLTDELDKRMFKISYKIPLPSHCN  155

Query  419   TRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVLDS  598
               +EI  IL +  L+  RV V+H  P     +F +AH L MM   YVW++TDWLST LDS
Sbjct  156   L-SEITAILNKSKLLGPRVYVVHVNPDPRLSIFKIAHQLDMMTSDYVWLATDWLSTTLDS  214

Query  599   SSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHL---TGGSLGLNSYALYAYDSVW  769
                +    + I+QGV+VLRQH P+S  K    SR + +      +  LN YAL AYD++ 
Sbjct  215   ILLVQQTSLNILQGVVVLRQHIPESSQKVTLWSRLRKMLPEDSRNSSLNVYALSAYDTIQ  274

Query  770   LIAHAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLTG  949
             ++AHAID FLN+G  I+FS  +K   +  S +    L IFD G LLL+ LLQ++F GL+G
Sbjct  275   VVAHAIDKFLNEGRSITFSLKNKFHDLNTSRMPWGKLKIFDDGALLLSILLQANFTGLSG  334

Query  950   QFKFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKLY  1129
             Q +FN D+++V   Y+++N+  TG R +G+W N +G +   PETL  +  + S  NQ L 
Sbjct  335   QIEFNTDRNIVTRGYEVINIDQTGLRRVGYWSNVTGFTIQSPETLKRKQISYSHLNQTLG  394

Query  1130  GVVWPGQSVKKAPG  1171
              V WPG   +K  G
Sbjct  395   NVTWPGGKTEKPRG  408



>ref|XP_007149971.1| hypothetical protein PHAVU_005G114900g [Phaseolus vulgaris]
 gb|ESW21965.1| hypothetical protein PHAVU_005G114900g [Phaseolus vulgaris]
Length=909

 Score =   431 bits (1107),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 222/383 (58%), Positives = 292/383 (76%), Gaps = 1/383 (0%)
 Frame = +3

Query  1146  GSR*KKPRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYA  1325
             G +  +PRGWV  +N K LRIGVP R S+ EF+++VP ++  +G+ +DVF  A++ +PY 
Sbjct  447   GGKTDRPRGWVIADNTKPLRIGVPKRASFVEFVTEVPNSHEIQGYCIDVFKKALDFIPYE  506

Query  1326  VPFQFVPFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVV  1505
             VPF F PFGNG+ NP+Y ELV+ V+   +D  +GDIAIVTNRT++VDF+QP+ +S L++V
Sbjct  507   VPFVFKPFGNGKANPNYDELVKRVADNVYDAVVGDIAIVTNRTRIVDFSQPFASSSLVIV  566

Query  1506  APFKKLNTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILW  1685
             AP  K  + AW FL PF+A MW  TA  F+V+GIV+WILEHR+N++FRG PK+Q++T+L 
Sbjct  567   APINKAGSNAWVFLKPFTADMWCATAASFLVIGIVIWILEHRVNNDFRGPPKKQIVTMLM  626

Query  1686  FSLSTLFFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESL  1865
             FSLSTLF  ++E+T+S+L +MV+I+WLF++++I +SYTASLTSILTV+QL SPI G+ESL
Sbjct  627   FSLSTLFKKNQEDTISSLSKMVMIVWLFLLMVITASYTASLTSILTVEQLSSPITGIESL  686

Query  1866  KEGNDPIGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERP  2045
                N PIGYQ+GSFA  YL + + +SKSRLI LGSPE YA AL+KGP  GGV+AIVDE P
Sbjct  687   IGSNWPIGYQVGSFAYSYLADNLYVSKSRLIPLGSPEEYALALQKGPSGGGVAAIVDELP  746

Query  2046  YVENFLSTQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLt  2225
             YVE FLS +  F I+GQ F KS WGFAF R+SP A DMSTAIL LSENGDL  IH+KW  
Sbjct  747   YVELFLSKETDFGIIGQPFAKSSWGFAFQRESPFAFDMSTAILKLSENGDLHMIHEKWFC  806

Query  2226  rtsc-ssestelesDRLHLKSFW  2291
             +  C    ++  + D+LHL SFW
Sbjct  807   KMGCPEERTSNSKPDQLHLVSFW  829


 Score =   351 bits (901),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 181/375 (48%), Positives = 235/375 (63%), Gaps = 5/375 (1%)
 Frame = +2

Query  59    VAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTTQ  238
             + A + ++  V AI+GPQSS VAHT+S +A+ LQVPL+S+AATDPTL+SLQFP+F+R+TQ
Sbjct  82    IGAFQLLEKGVAAIIGPQSSAVAHTVSQIADALQVPLVSYAATDPTLSSLQFPFFIRSTQ  141

Query  239   SDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGAT  418
             SD+ QM A+AD+ID  GWKEVI VF+DDDYGRNGI+AL D L  +R KISYK  +     
Sbjct  142   SDLAQMTAMADLIDFNGWKEVIVVFLDDDYGRNGISALSDELEKRRLKISYKLPLSIKFD  201

Query  419   TRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVLDS  598
                EI ++L Q  L   RV V+H  P     +FSVAH L M+   YVW+ TDWLS  + S
Sbjct  202   LD-EITNLLNQSKLFGPRVYVVHVNPDPRLRIFSVAHKLQMIAKDYVWLVTDWLSATIGS  260

Query  599   SSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLTGGSL---GLNSYALYAYDSVW  769
              SP+      ++QGV+ LRQH  DS  KRAF SRW       L    LNSY   AYD+VW
Sbjct  261   LSPVNQTSFSVLQGVVGLRQHILDSRKKRAFVSRWTKRQRDGLTNASLNSYGFSAYDTVW  320

Query  770   LIAHAIDSFLNKGG-VISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLT  946
              IA +ID F+        F +  KL   EG  + L+ L IF GG  L+  LLQS+F G++
Sbjct  321   AIALSIDKFIKVNNFTFMFHDKYKLSHTEGIGVQLDKLKIFTGGSDLVKILLQSNFTGVS  380

Query  947   GQFKFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKL  1126
             GQ  FN+D+++V   YDI+NV   G   +GFW NY+G S  PP TL  +  +  S +QKL
Sbjct  381   GQVMFNSDRNIVSGGYDIINVNQLGITRVGFWSNYTGFSVVPPATLKKKEHSRFSKDQKL  440

Query  1127  YGVVWPGQSVKKAPG  1171
               + WPG    +  G
Sbjct  441   DNITWPGGKTDRPRG  455



>ref|XP_009353277.1| PREDICTED: glutamate receptor 3.7 isoform X2 [Pyrus x bretschneideri]
Length=910

 Score =   423 bits (1088),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 234/412 (57%), Positives = 306/412 (74%), Gaps = 0/412 (0%)
 Frame = +3

Query  1146  GSR*KKPRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYA  1325
             G   ++PRGW   +N K LRIGVP R S+ +F+++   ++  +G+ +DVF  A+ L+PYA
Sbjct  448   GGNTERPRGWEIADNEKPLRIGVPKRASFVDFVTERNNSHKIEGYCIDVFNEALKLVPYA  507

Query  1326  VPFQFVPFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVV  1505
             VP++F PFG+GR NP Y ELV++V+   FD A+GDIAIV NRT +VDF+QPYV +GL++V
Sbjct  508   VPYRFEPFGDGRSNPDYGELVKMVAENVFDAAVGDIAIVKNRTMIVDFSQPYVITGLVIV  567

Query  1506  APFKKLNTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILW  1685
             AP     + AW FL PFS +MW VTA FFV++ +V+W+LEHR+N +FRG PK+QL TI  
Sbjct  568   APIDNSKSNAWVFLKPFSLEMWCVTASFFVLIAVVMWVLEHRVNRDFRGPPKRQLATIFT  627

Query  1686  FSLSTLFFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESL  1865
             FS STLF   +E TVS LGRMV++IWLF++++I SSYTASLTSILTVQQL  PI G++SL
Sbjct  628   FSFSTLFKKTQEETVSPLGRMVMVIWLFLLMVIISSYTASLTSILTVQQLSIPITGIDSL  687

Query  1866  KEGNDPIGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERP  2045
                N  IGYQ+GSFA  YL + + I KSRL+ LGSPE Y  AL KGP  GGV+AI+DE  
Sbjct  688   IASNWRIGYQVGSFAYSYLTDSLYIHKSRLVPLGSPEEYETALRKGPDDGGVAAIIDELT  747

Query  2046  YVENFLSTQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLt  2225
             YVE FLS+Q  F I+G  FT+SGWGFAFPRDSPLA+D+S+AIL LSE+G LQ+IH+KW  
Sbjct  748   YVELFLSSQTDFGIIGDTFTRSGWGFAFPRDSPLAIDISSAILKLSESGTLQKIHEKWFC  807

Query  2226  rtscssestelesDRLHLKSFWglfllcgaacflalfIYFVQIMLKFRRVAR  2381
             +  C S+    ESD+LHL SFWGL+LLCGA    AL I+ ++++ +F R  +
Sbjct  808   KMGCLSDKKSDESDQLHLMSFWGLYLLCGAFTLAALVIFLLRVIHQFVRYKK  859


 Score =   357 bits (915),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 179/374 (48%), Positives = 242/374 (65%), Gaps = 4/374 (1%)
 Frame = +2

Query  59    VAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTTQ  238
             V A + +   +VAI+GPQ+S +A+ IS +AN L+VPL+S+AATDPTL++LQFP+FLRTTQ
Sbjct  84    VEAFQVLDKSIVAIIGPQTSSMAYMISEIANGLKVPLISYAATDPTLSALQFPFFLRTTQ  143

Query  239   SDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGAT  418
             SD +QM A+A +ID YGWKEVIAVF+DDDYGRNGI+AL D L     +I++   +P    
Sbjct  144   SDAHQMAAMAGLIDFYGWKEVIAVFVDDDYGRNGISALHDELDKTMSRITHNLALPVHYN  203

Query  419   TRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVLDS  598
                +I D+L +   +  RV ++H  P     +F+VA  L MM   YVW +TDWLST +DS
Sbjct  204   LN-DIADLLNKSRFLGPRVYIVHVDPDPRLRIFTVAKELHMMTSNYVWFATDWLSTTVDS  262

Query  599   SSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLTGGSLG---LNSYALYAYDSVW  769
              SP+    +  +QGV+ LR+H P+S  KRAF SRWK +    L    LN Y LYAYD+VW
Sbjct  263   FSPMNRTSLTALQGVVTLRKHIPESSRKRAFMSRWKKMQQDGLASSELNVYGLYAYDTVW  322

Query  770   LIAHAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLTG  949
             ++AH+I++F+N+   ISFS   KL  I  S + L  L +FDGG LL   LL++   GLTG
Sbjct  323   VVAHSIENFINENRNISFSVLDKLLDIRPSQIQLGKLKVFDGGSLLREKLLETHMSGLTG  382

Query  950   QFKFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKLY  1129
               +F+ D+S     YDI+N      RT+GFW  YSG S +PPETL     + S  +QKL 
Sbjct  383   HVEFDKDRSRASGIYDIINFDQMKIRTVGFWTYYSGFSVSPPETLNRGRSSYSPLDQKLD  442

Query  1130  GVVWPGQSVKKAPG  1171
              V WPG + ++  G
Sbjct  443   NVTWPGGNTERPRG  456



>ref|XP_008812267.1| PREDICTED: glutamate receptor 3.7 isoform X1 [Phoenix dactylifera]
 ref|XP_008812268.1| PREDICTED: glutamate receptor 3.7 isoform X1 [Phoenix dactylifera]
Length=909

 Score =   423 bits (1088),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 232/417 (56%), Positives = 313/417 (75%), Gaps = 3/417 (1%)
 Frame = +3

Query  1146  GSR*KKPRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTN--TFKGFSVDVFTAAVNLLP  1319
             G + +KP+GWV  NN K LRIGVP R SY EF++    +N     G+ +DVF A + ++P
Sbjct  445   GGKTEKPQGWVVANNEKPLRIGVPFRASYLEFVTVTNKSNIVNVSGYCIDVFKAIIKIIP  504

Query  1320  YAVPFQFVPFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLL  1499
             Y V +QFVPFG GR NP+Y ELV +V+    D AIGDIAIVTNRTK+VDFTQPY+++GL+
Sbjct  505   YDVSYQFVPFGYGRSNPNYDELVGMVAEDVIDAAIGDIAIVTNRTKIVDFTQPYISTGLV  564

Query  1500  VVAPFKKLNTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITI  1679
             ++A  K + + AW FL PF+  MW +T  FF ++G+V+W+LEHR+N  FRG PK+Q IT+
Sbjct  565   ILASIKSIKSNAWVFLRPFTMGMWCMTGAFFFLIGVVIWMLEHRVNSAFRGPPKRQCITM  624

Query  1680  LWFSLSTLFFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVE  1859
               FS ST F + +E+T+STLGR V+++WLF++++I SSYTASLTS LTVQQL SPIKG +
Sbjct  625   FLFSFSTPFQSQQEDTLSTLGRFVMMVWLFLLMVITSSYTASLTSFLTVQQLSSPIKGFD  684

Query  1860  SLKEGNDPIGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDE  2039
             SL   N PIGYQ+GSFA+ YLI  + +  SRL++LGSPEAY  AL++GP  GGV AIVDE
Sbjct  685   SLIASNQPIGYQVGSFAQSYLIYGLNVHPSRLVSLGSPEAYEVALQRGPKNGGVVAIVDE  744

Query  2040  RPYVENFLSTQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKW  2219
              PYVE FLS +  F IVGQ FT+SGWGFAFPRDSPLA+DMS A+L+LSENG+LQ+IH KW
Sbjct  745   LPYVEIFLSKRSGFGIVGQPFTRSGWGFAFPRDSPLAIDMSRAMLNLSENGELQKIHKKW  804

Query  2220  Ltrtscssesteles-DRLHLKSFWglfllcgaacflalfIYFVQIMLKFRRVARAE  2387
               +T+C ++++     ++LH+ SFWGLFL+CG A F++L ++ ++ + +F +  R +
Sbjct  805   FCKTNCVTQTSTSSDPNQLHVSSFWGLFLVCGIATFISLLLFLIRAIRQFIQFNRKQ  861


 Score =   357 bits (915),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 183/374 (49%), Positives = 249/374 (67%), Gaps = 6/374 (2%)
 Frame = +2

Query  59    VAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTTQ  238
             + A   ++   +AI+GPQSS VAH IS ++N LQ+PL+SFAATDPTL+SL++P+FLRTT 
Sbjct  83    LGAFSVLEKQAIAIIGPQSSAVAHMISSISNGLQIPLISFAATDPTLSSLEYPFFLRTTH  142

Query  239   SDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGAT  418
             SD YQM A+ADVID+YGW+ VIA+F+DDDYGRNGI  LDD LA K  KI YK  +P  A 
Sbjct  143   SDSYQMAAVADVIDYYGWRRVIAIFVDDDYGRNGIYYLDDELAKKMSKI-YKIALPVKA-  200

Query  419   TRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVLDS  598
             TR +I+D+L +  ++  RV V+H  P +G  +FS A  L M+ + YVW++TDWLST LD+
Sbjct  201   TRDKILDVLQKSRMIGPRVYVVHVTPDSGLEIFSAARDLQMLTEEYVWLATDWLSTTLDT  260

Query  599   SSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLTGGSL---GLNSYALYAYDSVW  769
             S  +    +  +QGV+  RQ+ P S  K AF SRW  L    L    LN+Y  YAYD+VW
Sbjct  261   SESISRNSLGYLQGVVGFRQYVPQSNEKDAFVSRWNELNKEGLVNFKLNTYGFYAYDTVW  320

Query  770   LIAHAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLTG  949
              +AHAI+ FLN+ G ++FS++SKL + +G  + L  L  FDGG LL   LL   F GL+G
Sbjct  321   AVAHAINDFLNESGNVTFSSNSKLPTSKGK-MQLGKLKTFDGGSLLHKKLLSLKFTGLSG  379

Query  950   QFKFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKLY  1129
               +F++D +L+   Y+I+NV G+   T+G+W NY GLS + PE+ Y     + S NQ L 
Sbjct  380   PVQFDSDNNLINGIYEIINVNGSMVHTVGYWSNYLGLSISIPESSYRNGQRNLSFNQVLD  439

Query  1130  GVVWPGQSVKKAPG  1171
              +VWPG   +K  G
Sbjct  440   RIVWPGGKTEKPQG  453



>ref|XP_009353276.1| PREDICTED: glutamate receptor 3.7 isoform X1 [Pyrus x bretschneideri]
Length=930

 Score =   423 bits (1087),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 234/412 (57%), Positives = 306/412 (74%), Gaps = 0/412 (0%)
 Frame = +3

Query  1146  GSR*KKPRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYA  1325
             G   ++PRGW   +N K LRIGVP R S+ +F+++   ++  +G+ +DVF  A+ L+PYA
Sbjct  468   GGNTERPRGWEIADNEKPLRIGVPKRASFVDFVTERNNSHKIEGYCIDVFNEALKLVPYA  527

Query  1326  VPFQFVPFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVV  1505
             VP++F PFG+GR NP Y ELV++V+   FD A+GDIAIV NRT +VDF+QPYV +GL++V
Sbjct  528   VPYRFEPFGDGRSNPDYGELVKMVAENVFDAAVGDIAIVKNRTMIVDFSQPYVITGLVIV  587

Query  1506  APFKKLNTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILW  1685
             AP     + AW FL PFS +MW VTA FFV++ +V+W+LEHR+N +FRG PK+QL TI  
Sbjct  588   APIDNSKSNAWVFLKPFSLEMWCVTASFFVLIAVVMWVLEHRVNRDFRGPPKRQLATIFT  647

Query  1686  FSLSTLFFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESL  1865
             FS STLF   +E TVS LGRMV++IWLF++++I SSYTASLTSILTVQQL  PI G++SL
Sbjct  648   FSFSTLFKKTQEETVSPLGRMVMVIWLFLLMVIISSYTASLTSILTVQQLSIPITGIDSL  707

Query  1866  KEGNDPIGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERP  2045
                N  IGYQ+GSFA  YL + + I KSRL+ LGSPE Y  AL KGP  GGV+AI+DE  
Sbjct  708   IASNWRIGYQVGSFAYSYLTDSLYIHKSRLVPLGSPEEYETALRKGPDDGGVAAIIDELT  767

Query  2046  YVENFLSTQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLt  2225
             YVE FLS+Q  F I+G  FT+SGWGFAFPRDSPLA+D+S+AIL LSE+G LQ+IH+KW  
Sbjct  768   YVELFLSSQTDFGIIGDTFTRSGWGFAFPRDSPLAIDISSAILKLSESGTLQKIHEKWFC  827

Query  2226  rtscssestelesDRLHLKSFWglfllcgaacflalfIYFVQIMLKFRRVAR  2381
             +  C S+    ESD+LHL SFWGL+LLCGA    AL I+ ++++ +F R  +
Sbjct  828   KMGCLSDKKSDESDQLHLMSFWGLYLLCGAFTLAALVIFLLRVIHQFVRYKK  879


 Score =   357 bits (915),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 179/374 (48%), Positives = 242/374 (65%), Gaps = 4/374 (1%)
 Frame = +2

Query  59    VAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTTQ  238
             V A + +   +VAI+GPQ+S +A+ IS +AN L+VPL+S+AATDPTL++LQFP+FLRTTQ
Sbjct  104   VEAFQVLDKSIVAIIGPQTSSMAYMISEIANGLKVPLISYAATDPTLSALQFPFFLRTTQ  163

Query  239   SDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGAT  418
             SD +QM A+A +ID YGWKEVIAVF+DDDYGRNGI+AL D L     +I++   +P    
Sbjct  164   SDAHQMAAMAGLIDFYGWKEVIAVFVDDDYGRNGISALHDELDKTMSRITHNLALPVHYN  223

Query  419   TRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVLDS  598
                +I D+L +   +  RV ++H  P     +F+VA  L MM   YVW +TDWLST +DS
Sbjct  224   LN-DIADLLNKSRFLGPRVYIVHVDPDPRLRIFTVAKELHMMTSNYVWFATDWLSTTVDS  282

Query  599   SSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLTGGSLG---LNSYALYAYDSVW  769
              SP+    +  +QGV+ LR+H P+S  KRAF SRWK +    L    LN Y LYAYD+VW
Sbjct  283   FSPMNRTSLTALQGVVTLRKHIPESSRKRAFMSRWKKMQQDGLASSELNVYGLYAYDTVW  342

Query  770   LIAHAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLTG  949
             ++AH+I++F+N+   ISFS   KL  I  S + L  L +FDGG LL   LL++   GLTG
Sbjct  343   VVAHSIENFINENRNISFSVLDKLLDIRPSQIQLGKLKVFDGGSLLREKLLETHMSGLTG  402

Query  950   QFKFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKLY  1129
               +F+ D+S     YDI+N      RT+GFW  YSG S +PPETL     + S  +QKL 
Sbjct  403   HVEFDKDRSRASGIYDIINFDQMKIRTVGFWTYYSGFSVSPPETLNRGRSSYSPLDQKLD  462

Query  1130  GVVWPGQSVKKAPG  1171
              V WPG + ++  G
Sbjct  463   NVTWPGGNTERPRG  476



>ref|XP_010909025.1| PREDICTED: glutamate receptor 3.7 [Elaeis guineensis]
Length=907

 Score =   430 bits (1105),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 220/385 (57%), Positives = 296/385 (77%), Gaps = 3/385 (1%)
 Frame = +3

Query  1146  GSR*KKPRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTN--TFKGFSVDVFTAAVNLLP  1319
             G + +KPRGWV  NN K +RIGVP R SY EF++    +N     G+ +DVF A +N++P
Sbjct  444   GGKTEKPRGWVVANNEKPMRIGVPYRASYLEFVTVTNKSNMVNVSGYCIDVFKAIINIIP  503

Query  1320  YAVPFQFVPFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLL  1499
             Y V +Q+V FGNG  NP+Y ELV +V+    D AIGDIAIVTNRTK+VDFTQPY+++GL+
Sbjct  504   YDVLYQYVLFGNGLSNPNYDELVNMVAEDVIDAAIGDIAIVTNRTKIVDFTQPYISTGLV  563

Query  1500  VVAPFKKLNTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITI  1679
             ++AP K + + AW FL PF+  MW +T  FF ++G+V+W+LEHR+N  FRG PK+Q IT+
Sbjct  564   ILAPIKSIKSNAWVFLRPFTVGMWCMTGAFFFLIGVVIWLLEHRVNSAFRGPPKRQCITM  623

Query  1680  LWFSLSTLFFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVE  1859
               FS ST F + +E+T+STLGR+V+++WLF++++I SSYTASLTS LTVQQL SPIKG++
Sbjct  624   FLFSFSTPFQSQQEDTLSTLGRIVMMVWLFLLMVITSSYTASLTSFLTVQQLSSPIKGID  683

Query  1860  SLKEGNDPIGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDE  2039
             SL   N+PIGYQ+GSFA+ YL+  + + +SRL++LGSPEAY EAL +GP  GGV+AIVDE
Sbjct  684   SLIASNEPIGYQVGSFAQSYLLYGLNVHQSRLVSLGSPEAYEEALRRGPQNGGVAAIVDE  743

Query  2040  RPYVENFLSTQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKW  2219
              PYVE FLS +  F IVGQ FT+SGWGFAFPRDSPL VDMS+AIL+LSE G+LQ++H KW
Sbjct  744   LPYVEMFLSKRSGFGIVGQPFTRSGWGFAFPRDSPLVVDMSSAILNLSEKGELQKLHKKW  803

Query  2220  Ltrtscssesteles-DRLHLKSFW  2291
               +T+C ++++     ++LH+ SFW
Sbjct  804   FCKTNCVTQTSISSDPNQLHVSSFW  828


 Score =   349 bits (895),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 179/373 (48%), Positives = 246/373 (66%), Gaps = 5/373 (1%)
 Frame = +2

Query  59    VAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTTQ  238
             + A   ++   +A++GPQSS VAH IS ++N LQ+PL+SFAATDPTL+SL+FP+FLR T 
Sbjct  83    LGAFSVLEKQAIALIGPQSSAVAHMISSISNGLQIPLISFAATDPTLSSLEFPFFLRMTH  142

Query  239   SDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGAT  418
             SD YQM A+ADV+D+YGW++VIA+F+DDDYGRNGI  LDD LA K  KI YK  +P  A 
Sbjct  143   SDSYQMAAVADVVDYYGWRQVIAIFVDDDYGRNGIYYLDDELAKKMSKI-YKIALPVKA-  200

Query  419   TRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVLDS  598
             TR +++D+L +  ++  RV V+H  P +G  +FS A  L M+ + YVW++TDW ST LD+
Sbjct  201   TRVKVLDVLQKSRMIGPRVYVVHVTPDSGLEIFSAARDLQMLTEEYVWLATDWFSTTLDT  260

Query  599   SSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWK--HLTGGSLGLNSYALYAYDSVWL  772
             S       +  +QGV+  RQ+ P S  K AF SRW   H  G    LN+Y  YAYD+VW 
Sbjct  261   SESFGRNSLGYLQGVVGFRQYVPQSNEKDAFASRWNVLHKEGLVFNLNTYGFYAYDTVWA  320

Query  773   IAHAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLTGQ  952
             +A AI+ FLN+ G I+FS++SKL + +G  + L  L  FDGG LL   LL   F GL+G 
Sbjct  321   VALAINDFLNESGNITFSSNSKLPTSKGK-MQLGKLKTFDGGSLLHKKLLSLKFTGLSGP  379

Query  953   FKFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKLYG  1132
              +F++D +L+   Y+I+NV G+   T+G+W NYSGLS +  E+ +     + S NQ L  
Sbjct  380   IQFDSDNNLINNIYEIINVNGSMVHTVGYWSNYSGLSISVHESFHGNGQRNLSFNQVLGR  439

Query  1133  VVWPGQSVKKAPG  1171
             VVWPG   +K  G
Sbjct  440   VVWPGGKTEKPRG  452



>ref|XP_004287941.1| PREDICTED: glutamate receptor 3.7-like [Fragaria vesca subsp. 
vesca]
Length=862

 Score =   409 bits (1052),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 222/409 (54%), Positives = 303/409 (74%), Gaps = 1/409 (0%)
 Frame = +3

Query  1164  PRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYAVPFQFV  1343
             PRGWV  ++ + LRIGVP RVS+ EF ++   ++  +G+ +DVF AA  L+PY VP+ FV
Sbjct  406   PRGWVITDDEQPLRIGVPKRVSFVEFATEKNNSHKLEGYCIDVFLAARKLVPYDVPYIFV  465

Query  1344  PFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPFKKL  1523
             PFG+G+ NPSY +LV++V+   FD A+GDIAIV NRT +VDF+QPY  +GL++VAP +  
Sbjct  466   PFGDGQSNPSYDQLVKMVAQNVFDAAVGDIAIVKNRTMIVDFSQPYATTGLVIVAPVENS  525

Query  1524  NTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSLSTL  1703
              + AW FL PF+ ++W VTA  FV+  +V+W LEHR+ND+FRG PK+QL T+  FS STL
Sbjct  526   KSNAWVFLQPFTWELWSVTAASFVIFAVVMWTLEHRVNDDFRGPPKKQLATMFLFSFSTL  585

Query  1704  FFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESLKEGNDP  1883
             F  ++E+TVS LGR+V+++WLF++++I SSYTA+LTSILTVQQL SPI G++SL   N P
Sbjct  586   FKKNQEDTVSPLGRIVMVMWLFLLMVITSSYTANLTSILTVQQLSSPITGIDSLIASNLP  645

Query  1884  IGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERPYVENFL  2063
             IGYQ+GSFA +YL E + I  SRL+ LGSP  Y  AL +GP  GGV A++DE  Y+E FL
Sbjct  646   IGYQVGSFAYNYLTETLYIPSSRLVPLGSPAEYERALRQGPDNGGVGAVIDELLYIELFL  705

Query  2064  STQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLtrtsc-s  2240
             S    F I+GQ FT+SGWGFAF +DSPLAVDMSTAIL LSENG+LQ+IH+KW  +  C  
Sbjct  706   SRLTDFGIIGQTFTRSGWGFAFQKDSPLAVDMSTAILKLSENGELQKIHEKWFCKMGCPG  765

Query  2241  sestelesDRLHLKSFWglfllcgaacflalfIYFVQIMLKFRRVARAE  2387
              +  ++E ++LHL SFWGL+LLCGA    A  ++ ++++ +F +  R +
Sbjct  766   DKDQDVEPNQLHLISFWGLYLLCGAFSVAAFVVFLMRMIYQFVQYKRRQ  814


 Score =   368 bits (945),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 183/366 (50%), Positives = 242/366 (66%), Gaps = 4/366 (1%)
 Frame = +2

Query  59    VAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTTQ  238
             V A + +  D+VAI+GPQSS +AH IS +AN LQVPL+S+AATDPTL++LQFPYF RTT+
Sbjct  36    VEAFQVLDKDIVAIIGPQSSAIAHMISEIANGLQVPLISYAATDPTLSALQFPYFFRTTR  95

Query  239   SDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGAT  418
             SD YQM A+A +ID+Y WK+VIAVF+DD YGRNGI+AL D L  K  KI+YK  +P    
Sbjct  96    SDGYQMAAMAGLIDYYEWKQVIAVFVDDQYGRNGISALGDELQGKMSKIAYKLALPV-EF  154

Query  419   TRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVLDS  598
              ++ + D+L +  L+  RV V+H  P  G  +F VA  L MM   YVW +TDWLST +DS
Sbjct  155   NQSYLTDLLNKSKLLGPRVYVVHINPDPGLRIFHVAKGLQMMTTDYVWFATDWLSTTIDS  214

Query  599   SSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLTGGSLG---LNSYALYAYDSVW  769
              SP+    + ++ GV+ LRQHTP S  K A+ SRWK +    L    LN Y LYAYD+VW
Sbjct  215   FSPMNRTSLAVLNGVVALRQHTPQSNKKSAYMSRWKKMQQEGLARSELNVYGLYAYDTVW  274

Query  770   LIAHAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLTG  949
              +A AI+ F+++   ISFS   KL  +E S + L  L IFDGG LL   LL+++  GLTG
Sbjct  275   TVAKAIERFIDEHENISFSVLDKLLKLEPSEIQLRKLKIFDGGSLLREKLLETNMSGLTG  334

Query  950   QFKFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKLY  1129
             Q +FN D+++V   YD++N+      T+GFW NYSG S +PPET+     +    +QKL 
Sbjct  335   QVQFNQDRNIVSGGYDVINIEKMAIHTVGFWSNYSGFSVSPPETVKRGRVSYLPLDQKLG  394

Query  1130  GVVWPG  1147
              V WPG
Sbjct  395   NVTWPG  400



>ref|XP_009786332.1| PREDICTED: glutamate receptor 3.3 isoform X2 [Nicotiana sylvestris]
Length=641

 Score =   639 bits (1649),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/379 (78%), Positives = 344/379 (91%), Gaps = 1/379 (0%)
 Frame = +2

Query  56    LVAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTT  235
             +V ALKFM+TDVVA++GPQSSVVAH+ISHVANELQVP LSFAATDPTL+SLQFPYFLRTT
Sbjct  86    MVGALKFMETDVVAVIGPQSSVVAHSISHVANELQVPFLSFAATDPTLSSLQFPYFLRTT  145

Query  236   QSDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGA  415
             QSD+YQM A A+++++YGWKEVIA+F+DDDYGRNG++ALDDALAA+RC+ISYKAGI PGA
Sbjct  146   QSDLYQMTATAEIVEYYGWKEVIAIFVDDDYGRNGVSALDDALAARRCRISYKAGISPGA  205

Query  416   -TTRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVL  592
               TR ++MD+LV++ALMESR++VLHAYP  GFMVFSVAHYLGMMGDGYVWISTDWL++VL
Sbjct  206   AVTRGDVMDVLVKVALMESRIIVLHAYPPLGFMVFSVAHYLGMMGDGYVWISTDWLTSVL  265

Query  593   DSSSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLTGGSLGLNSYALYAYDSVWL  772
             DSS PLP +KM+IMQGVLVLRQHTP+SE KRAF+SRW  LTGGS GLNSYAL+AYD+VWL
Sbjct  266   DSSFPLPQDKMDIMQGVLVLRQHTPESENKRAFSSRWNKLTGGSFGLNSYALHAYDTVWL  325

Query  773   IAHAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLTGQ  952
             +AHA+DSF N+GG ISFS+D+KLQS+EGS LHLEA+SIFDGGPLLL NLLQSDF+GLTG 
Sbjct  326   VAHALDSFFNQGGTISFSDDTKLQSVEGSNLHLEAMSIFDGGPLLLKNLLQSDFIGLTGP  385

Query  953   FKFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKLYG  1132
             FKFN DKSLVLP+YDI+NVIGTGFR +G+W NYSGLS +PPE+LYSRPPN SS NQKLY 
Sbjct  386   FKFNPDKSLVLPAYDIINVIGTGFRRVGYWSNYSGLSVSPPESLYSRPPNRSSTNQKLYS  445

Query  1133  VVWPGQSVKKAPGVGFPEQ  1189
             VVWPG +V+K  G  FP  
Sbjct  446   VVWPGNNVQKPRGWVFPNN  464


 Score =   303 bits (776),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 148/185 (80%), Positives = 165/185 (89%), Gaps = 0/185 (0%)
 Frame = +3

Query  1146  GSR*KKPRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYA  1325
             G+  +KPRGWVFPNNGKQLRIGVPIRVSY+EF+SQ+PGTN FKGF +DVFTAAVNLLPYA
Sbjct  450   GNNVQKPRGWVFPNNGKQLRIGVPIRVSYREFVSQIPGTNNFKGFCIDVFTAAVNLLPYA  509

Query  1326  VPFQFVPFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVV  1505
             VP QFVPFGNG ENPSY+E+V+L++TG FDG +GDIAIVTNRT+VVDFTQPY ASGL+VV
Sbjct  510   VPHQFVPFGNGHENPSYTEMVKLITTGNFDGVVGDIAIVTNRTRVVDFTQPYAASGLVVV  569

Query  1506  APFKKLNTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILW  1685
             APFKKLN+G WAFL PFS QMWGV   FF+ VGIVVWILEHR NDEFRG PKQQLITILW
Sbjct  570   APFKKLNSGGWAFLRPFSGQMWGVITIFFLFVGIVVWILEHRTNDEFRGPPKQQLITILW  629

Query  1686  FSLST  1700
             F+  T
Sbjct  630   FAAIT  634



>gb|KDP25837.1| hypothetical protein JCGZ_22867 [Jatropha curcas]
Length=925

 Score =   416 bits (1069),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 224/410 (55%), Positives = 310/410 (76%), Gaps = 2/410 (0%)
 Frame = +3

Query  1161  KPRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYAVPFQF  1340
             +PRGWV  +N + LRIGVP R S+ EF+++   ++  +G+ +DVF A   L+PY VPF+F
Sbjct  450   RPRGWVIADNERPLRIGVPYRASFVEFVTE-NKSHIVEGYCIDVFLAVRRLVPYDVPFKF  508

Query  1341  VPFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPFKK  1520
               FG+GR NP+Y+EL++ V+ G FD A+GDIAIVTNRTK+VDF+QPY A+GL++VAP + 
Sbjct  509   EIFGDGRSNPNYNELIQRVADGVFDAAVGDIAIVTNRTKIVDFSQPYAATGLVIVAPIRN  568

Query  1521  LNTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSLST  1700
               + AW FL PF+ +MW VTA  FV++ +V+WILEHR+ND+FRG P++Q++T+  FS ST
Sbjct  569   SKSSAWVFLKPFTVEMWCVTAASFVMIAVVIWILEHRVNDDFRGPPRRQIVTMFLFSFST  628

Query  1701  LFFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESLKEGND  1880
             LF  ++E TVS LGR+V+++WLF+++++ +SYTASLTSILTVQQL SPI G++SL   + 
Sbjct  629   LFKTNQETTVSPLGRLVMVVWLFLLMVLTASYTASLTSILTVQQLSSPIAGIDSLISSSW  688

Query  1881  PIGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERPYVENF  2060
             PIGYQ+GSFA  YL + + IS+SRL+ LG+PE Y  AL  GP+ GGV+AIVDE PYVE F
Sbjct  689   PIGYQVGSFAYGYLSDSLYISRSRLVPLGTPEEYETALRLGPNNGGVAAIVDELPYVELF  748

Query  2061  LSTQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLtrtsc-  2237
             LS Q +F I+GQ F++ GWGFAF RDSPLA+D+STAIL LSE G+LQRIH KW  +  C 
Sbjct  749   LSKQSEFGIIGQPFSRGGWGFAFQRDSPLAIDISTAILKLSETGELQRIHAKWFCKMGCP  808

Query  2238  ssestelesDRLHLKSFWglfllcgaacflalfIYFVQIMLKFRRVARAE  2387
               +  + E ++LHL SFWGL+LLCG    +A+ ++ ++ + +F R  R +
Sbjct  809   GEKRGKSEPNQLHLISFWGLYLLCGIFTLVAVLVFLLRAVRQFVRYKRRQ  858


 Score =   357 bits (915),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 179/374 (48%), Positives = 245/374 (66%), Gaps = 5/374 (1%)
 Frame = +2

Query  59    VAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTTQ  238
             V   + ++  VVAI+GPQSS +AH ISH++N LQVP +S+AATDPTL++LQFP+F+RTTQ
Sbjct  82    VGVFQLLENHVVAIIGPQSSGMAHMISHISNGLQVPQISYAATDPTLSALQFPFFVRTTQ  141

Query  239   SDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGAT  418
             SD YQM AIAD+ID Y WKE IA+++DDDYGRNGIAALDD  A K  K+  K  +     
Sbjct  142   SDSYQMAAIADLIDFYEWKEAIAIYVDDDYGRNGIAALDDEFAKKMSKLR-KLELSVNF-  199

Query  419   TRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVLDS  598
                EI D+L +  L+  RV V+H      F +F++A  L MM + YVW++TDWLST +DS
Sbjct  200   DETEITDLLKKSKLLGPRVYVVHLNADPKFRIFTIAKELQMMTNKYVWLATDWLSTAIDS  259

Query  599   SSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWK--HLTGG-SLGLNSYALYAYDSVW  769
              S +    +  +QGV+ LRQH P+S  K+AF SRW+  H  G  S  LN Y L AYD+VW
Sbjct  260   FSWMNQTSLRTLQGVVGLRQHIPESSQKKAFMSRWREMHQNGSVSSALNIYGLQAYDTVW  319

Query  770   LIAHAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLTG  949
             L+A+AID F+++   I+F++   L  +E S L L  L +F GG  LLN +L  +F GL+G
Sbjct  320   LVANAIDKFIDEFNNITFTSSDMLGELETSELRLGELKVFTGGNDLLNKILHMNFTGLSG  379

Query  950   QFKFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKLY  1129
              F+FN ++++    YD++N+     RT+G+W N SGLST PP+       N S  +QKL 
Sbjct  380   HFRFNQERNIESGGYDVINIDHMSIRTVGYWSNSSGLSTLPPQNHQGEQANYSRLDQKLR  439

Query  1130  GVVWPGQSVKKAPG  1171
              + WPG +V +  G
Sbjct  440   TITWPGGTVDRPRG  453



>ref|XP_009618635.1| PREDICTED: glutamate receptor 3.3-like [Nicotiana tomentosiformis]
 ref|XP_009618636.1| PREDICTED: glutamate receptor 3.3-like [Nicotiana tomentosiformis]
Length=930

 Score =   645 bits (1663),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/379 (78%), Positives = 345/379 (91%), Gaps = 1/379 (0%)
 Frame = +2

Query  56    LVAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTT  235
             +V ALKFM+TDVVA++GPQSSVVAHTISHVANELQVP LSFAATDPTL+SLQFPYFL+TT
Sbjct  86    MVGALKFMETDVVAVIGPQSSVVAHTISHVANELQVPFLSFAATDPTLSSLQFPYFLQTT  145

Query  236   QSDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGA  415
             QSD+YQM A A+++++YGWKEVIA+F+DDDYGRNG++ALDDALAA+RC+ISYKAGI PGA
Sbjct  146   QSDLYQMTATAEIVEYYGWKEVIAIFVDDDYGRNGVSALDDALAARRCRISYKAGISPGA  205

Query  416   T-TRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVL  592
             T TR ++MD+LV++ALMESR++VLHAYP  GFMVFSVAHYLGMMGDGYVWISTDWL++VL
Sbjct  206   TVTRGDVMDVLVKVALMESRIIVLHAYPTLGFMVFSVAHYLGMMGDGYVWISTDWLTSVL  265

Query  593   DSSSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLTGGSLGLNSYALYAYDSVWL  772
             DSSSPLP +KM+IMQGVLVLRQHTP+SE KRAF+SRW  LTGGSLGLNSYAL+AYD+VWL
Sbjct  266   DSSSPLPQDKMDIMQGVLVLRQHTPESENKRAFSSRWNKLTGGSLGLNSYALHAYDTVWL  325

Query  773   IAHAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLTGQ  952
             +AHA+DSF N+GG ISFSND+KLQS+EGS LHLEA+SIFDGGPLLL NLLQSDF+GLTG 
Sbjct  326   VAHALDSFFNQGGTISFSNDTKLQSVEGSNLHLEAMSIFDGGPLLLKNLLQSDFIGLTGP  385

Query  953   FKFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKLYG  1132
             FKFN DKSLV P+YDI+NVIGTGFR +G+W NYSGLS + PE+LYSRPPN SS NQKLY 
Sbjct  386   FKFNPDKSLVRPAYDIINVIGTGFRRVGYWSNYSGLSVSTPESLYSRPPNRSSTNQKLYS  445

Query  1133  VVWPGQSVKKAPGVGFPEQ  1189
             VVWPG +V+K  G  FP  
Sbjct  446   VVWPGNNVQKPRGWVFPNN  464


 Score =   625 bits (1613),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/467 (80%), Positives = 424/467 (91%), Gaps = 1/467 (0%)
 Frame = +3

Query  1146  GSR*KKPRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYA  1325
             G+  +KPRGWVFPNNGKQLRIGVPIRVSY+EF+SQ+PGTN FKGF +DVFTAAVNLLPYA
Sbjct  450   GNNVQKPRGWVFPNNGKQLRIGVPIRVSYREFVSQIPGTNNFKGFCIDVFTAAVNLLPYA  509

Query  1326  VPFQFVPFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVV  1505
             VP QFVPFGNG ENPSY+E+V+L++TG FDG +GDIAIVTNRT+VVDFTQPY ASGL+VV
Sbjct  510   VPHQFVPFGNGHENPSYTEMVKLITTGNFDGVVGDIAIVTNRTRVVDFTQPYAASGLVVV  569

Query  1506  APFKKLNTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILW  1685
             APFKKLN+G WAFL PFS QMWGV   FF+ VG+VVW+LEHR NDEFRG PKQQLITILW
Sbjct  570   APFKKLNSGGWAFLRPFSGQMWGVITVFFLFVGMVVWVLEHRTNDEFRGPPKQQLITILW  629

Query  1686  FSLSTLFFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESL  1865
             FSLSTLFFAHRENTVSTLGRMVLIIWLFVVLIINSSYTASLTSI TVQQLYSPIKG+ESL
Sbjct  630   FSLSTLFFAHRENTVSTLGRMVLIIWLFVVLIINSSYTASLTSIFTVQQLYSPIKGLESL  689

Query  1866  KEGNDPIGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERP  2045
             KE ++PIG+Q+GSFAE YL EEIGI KSRL++LGSPE YA AL++GP KGGV+A+VDERP
Sbjct  690   KETDEPIGFQVGSFAERYL-EEIGIPKSRLVSLGSPEQYATALQRGPGKGGVAAVVDERP  748

Query  2046  YVENFLSTQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLt  2225
             YVE FLS QCKFRIVGQEFTKSGWGFAFPRDSPLAVD+STAIL+LSENGDLQRIHDKWL+
Sbjct  749   YVELFLSNQCKFRIVGQEFTKSGWGFAFPRDSPLAVDLSTAILTLSENGDLQRIHDKWLS  808

Query  2226  rtscssestelesDRLHLKSFWglfllcgaacflalfIYFVQIMLKFRRVARAEPVADGs  2405
             R++CS E+ ELESDRLHL+SF GLFL+CG ACF+AL IYF+QIM K+R+ A+AE V+DG 
Sbjct  809   RSACSLENAELESDRLHLRSFSGLFLICGIACFIALLIYFLQIMHKYRQAAKAEAVSDGP  868

Query  2406  sstrsrrlqtllslIDEksdpskrdkkrrkidrslsdENSGSNLARD  2546
             +++RS+RLQTLLSLIDEK+D S+RD KRRKIDRS+SDEN  ++  RD
Sbjct  869   TTSRSKRLQTLLSLIDEKADKSRRDSKRRKIDRSVSDENVENDSGRD  915



>ref|XP_006592379.1| PREDICTED: glutamate receptor 3.4-like isoform X4 [Glycine max]
Length=792

 Score =   437 bits (1125),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 249/404 (62%), Positives = 309/404 (76%), Gaps = 4/404 (1%)
 Frame = +3

Query  1164  PRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYAVPFQFV  1343
             PRGWVFPNNG+ LRI VP RVSY +F+S+       +G+ +DVF AA+ LL Y VP Q++
Sbjct  337   PRGWVFPNNGQPLRIAVPNRVSYTDFVSKSKNPPGVQGYCIDVFEAALKLLNYPVPRQYI  396

Query  1344  PFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPFKKL  1523
              FGNG  NPSY+ELV  V+   FD  +GD+ IVTNRT++VDFTQP++ SGL+VV P +K 
Sbjct  397   LFGNGERNPSYNELVEQVAQNNFDAVVGDVTIVTNRTRIVDFTQPFMPSGLVVVVPVEK-  455

Query  1524  NTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSLSTL  1703
              +  W+FL PF+AQMW VT  FF+ VG VVWILEHR N EFRGSP++QLIT+ WFS ST+
Sbjct  456   KSSPWSFLEPFTAQMWLVTGAFFLFVGTVVWILEHRHNPEFRGSPRKQLITVFWFSFSTM  515

Query  1704  FFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESLKEGNDP  1883
             FF+HRENTVS LGR+VLIIWLFVVLIINSSYTASLTSILTVQQL S I+G++SL     P
Sbjct  516   FFSHRENTVSGLGRLVLIIWLFVVLIINSSYTASLTSILTVQQLSSQIEGIDSLISSTQP  575

Query  1884  IGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERPYVENFL  2063
             IG Q GSFA  YLI+++ I++SR++ L + E Y +AL++GP  GGV A+VDE PY+E  +
Sbjct  576   IGIQDGSFARKYLIDDLNIAESRIVTLKNMEDYIDALQRGPKAGGVVAVVDELPYIEVLM  635

Query  2064  S-TQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLtrtscs  2240
             S T CKF  VGQEFTKSGWGFAF RDSPLAVD+STAIL LSE+GDLQRIHDKWL      
Sbjct  636   SRTDCKFTTVGQEFTKSGWGFAFQRDSPLAVDLSTAILQLSESGDLQRIHDKWL--NKKE  693

Query  2241  sestelesDRLHLKSFWglfllcgaacflalfIYFVQIMLKFRR  2372
               + +  S++L L SFWGLFL+CG AC +AL I+F +I  ++ +
Sbjct  694   CATVDANSNKLALTSFWGLFLICGIACVIALIIFFARIFCQYNK  737


 Score =   330 bits (846),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 161/319 (50%), Positives = 219/319 (69%), Gaps = 4/319 (1%)
 Frame = +2

Query  242   DMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGATT  421
             + ++M AIAD +D+Y WK+VIA+++DDD GRNG++ L DA++ KR KISYKA  PP A  
Sbjct  28    EQWKMYAIADFVDYYRWKKVIAIYVDDDNGRNGVSVLGDAMSKKRAKISYKAAFPPEAK-  86

Query  422   RAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVLDSS  601
              ++I D+L ++ LMESRV VLH  P  G  +FS+A  L MM  GYVWI+TDWL +VLDS 
Sbjct  87    ESDISDLLNEVNLMESRVYVLHVNPDHGLAIFSIAKRLRMMDSGYVWIATDWLPSVLDSL  146

Query  602   SPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWK-HLTGGSLGLNSYALYAYDSVWLIA  778
                 ++ M+++QGV+  R H PD++LK++F SR K      ++  NSYALYAYDSVWL A
Sbjct  147   DSPDTDTMDLLQGVVAFRHHIPDTDLKKSFLSRLKSQRDNETVSFNSYALYAYDSVWLAA  206

Query  779   HAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLTGQFK  958
              A+D++LN+GG +SFS+D KL+   GS L L +L  FDGGP  L  +L  +F GL+GQ +
Sbjct  207   RALDAYLNEGGNVSFSSDPKLRDTNGSMLQLASLRTFDGGPQFLKTILGMNFTGLSGQVE  266

Query  959   FNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYS--RPPNSSSANQKLYG  1132
             F+ DK+LV P+YDILN+ G+G R IG+W N+SGLS   PE LY       S  +NQ+LY 
Sbjct  267   FDMDKNLVHPAYDILNIGGSGSRRIGYWSNHSGLSVIAPEVLYEKKSSKTSLKSNQELYS  326

Query  1133  VVWPGQSVKKAPGVGFPEQ  1189
             V+WPG++     G  FP  
Sbjct  327   VIWPGEATTTPRGWVFPNN  345



>ref|XP_009786331.1| PREDICTED: glutamate receptor 3.3 isoform X1 [Nicotiana sylvestris]
Length=930

 Score =   642 bits (1656),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/379 (78%), Positives = 344/379 (91%), Gaps = 1/379 (0%)
 Frame = +2

Query  56    LVAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTT  235
             +V ALKFM+TDVVA++GPQSSVVAH+ISHVANELQVP LSFAATDPTL+SLQFPYFLRTT
Sbjct  86    MVGALKFMETDVVAVIGPQSSVVAHSISHVANELQVPFLSFAATDPTLSSLQFPYFLRTT  145

Query  236   QSDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGA  415
             QSD+YQM A A+++++YGWKEVIA+F+DDDYGRNG++ALDDALAA+RC+ISYKAGI PGA
Sbjct  146   QSDLYQMTATAEIVEYYGWKEVIAIFVDDDYGRNGVSALDDALAARRCRISYKAGISPGA  205

Query  416   -TTRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVL  592
               TR ++MD+LV++ALMESR++VLHAYP  GFMVFSVAHYLGMMGDGYVWISTDWL++VL
Sbjct  206   AVTRGDVMDVLVKVALMESRIIVLHAYPPLGFMVFSVAHYLGMMGDGYVWISTDWLTSVL  265

Query  593   DSSSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLTGGSLGLNSYALYAYDSVWL  772
             DSS PLP +KM+IMQGVLVLRQHTP+SE KRAF+SRW  LTGGS GLNSYAL+AYD+VWL
Sbjct  266   DSSFPLPQDKMDIMQGVLVLRQHTPESENKRAFSSRWNKLTGGSFGLNSYALHAYDTVWL  325

Query  773   IAHAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLTGQ  952
             +AHA+DSF N+GG ISFS+D+KLQS+EGS LHLEA+SIFDGGPLLL NLLQSDF+GLTG 
Sbjct  326   VAHALDSFFNQGGTISFSDDTKLQSVEGSNLHLEAMSIFDGGPLLLKNLLQSDFIGLTGP  385

Query  953   FKFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKLYG  1132
             FKFN DKSLVLP+YDI+NVIGTGFR +G+W NYSGLS +PPE+LYSRPPN SS NQKLY 
Sbjct  386   FKFNPDKSLVLPAYDIINVIGTGFRRVGYWSNYSGLSVSPPESLYSRPPNRSSTNQKLYS  445

Query  1133  VVWPGQSVKKAPGVGFPEQ  1189
             VVWPG +V+K  G  FP  
Sbjct  446   VVWPGNNVQKPRGWVFPNN  464


 Score =   629 bits (1621),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/467 (80%), Positives = 424/467 (91%), Gaps = 1/467 (0%)
 Frame = +3

Query  1146  GSR*KKPRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYA  1325
             G+  +KPRGWVFPNNGKQLRIGVPIRVSY+EF+SQ+PGTN FKGF +DVFTAAVNLLPYA
Sbjct  450   GNNVQKPRGWVFPNNGKQLRIGVPIRVSYREFVSQIPGTNNFKGFCIDVFTAAVNLLPYA  509

Query  1326  VPFQFVPFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVV  1505
             VP QFVPFGNG ENPSY+E+V+L++TG FDG +GDIAIVTNRT+VVDFTQPY ASGL+VV
Sbjct  510   VPHQFVPFGNGHENPSYTEMVKLITTGNFDGVVGDIAIVTNRTRVVDFTQPYAASGLVVV  569

Query  1506  APFKKLNTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILW  1685
             APFKKLN+G WAFL PFS QMWGV   FF+ VGIVVWILEHR NDEFRG PKQQLITILW
Sbjct  570   APFKKLNSGGWAFLRPFSGQMWGVITIFFLFVGIVVWILEHRTNDEFRGPPKQQLITILW  629

Query  1686  FSLSTLFFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESL  1865
             FSLSTLFFAHRENTVSTLGRMVLIIWLFVVLIINSSYTASLTSI TVQQLYSPIKG+ESL
Sbjct  630   FSLSTLFFAHRENTVSTLGRMVLIIWLFVVLIINSSYTASLTSIFTVQQLYSPIKGLESL  689

Query  1866  KEGNDPIGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERP  2045
             KE ++PIG+Q+GSFAE YL EEIGI KSRL+ALGSPE YA AL++GP KGGV+A+VDERP
Sbjct  690   KETDEPIGFQVGSFAERYL-EEIGIPKSRLVALGSPEQYATALQRGPGKGGVAAVVDERP  748

Query  2046  YVENFLSTQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLt  2225
             Y+E FLS QCKFRIVGQEFTKSGWGFAFPRDSPLAVD+STAIL+LSENGDLQRIHDKWL+
Sbjct  749   YIELFLSNQCKFRIVGQEFTKSGWGFAFPRDSPLAVDLSTAILTLSENGDLQRIHDKWLS  808

Query  2226  rtscssestelesDRLHLKSFWglfllcgaacflalfIYFVQIMLKFRRVARAEPVADGs  2405
             R++CS E+ ELESDRLHL+SF GLFL+CG ACF+AL IYF+QIM K+R+ A+AE ++DGS
Sbjct  809   RSACSLENAELESDRLHLRSFSGLFLICGIACFIALLIYFLQIMHKYRQAAKAEAISDGS  868

Query  2406  sstrsrrlqtllslIDEksdpskrdkkrrkidrslsdENSGSNLARD  2546
             + +RS+RLQTLLSLIDEK+D S RD KRRK+DRS+SDEN  ++L RD
Sbjct  869   TGSRSKRLQTLLSLIDEKADKSSRDSKRRKVDRSVSDENMENDLGRD  915



>ref|XP_006447547.1| hypothetical protein CICLE_v10014190mg [Citrus clementina]
 ref|XP_006469690.1| PREDICTED: glutamate receptor 3.7-like [Citrus sinensis]
 gb|ESR60787.1| hypothetical protein CICLE_v10014190mg [Citrus clementina]
Length=913

 Score =   408 bits (1048),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 221/415 (53%), Positives = 303/415 (73%), Gaps = 1/415 (0%)
 Frame = +3

Query  1146  GSR*KKPRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYA  1325
             G + + PRGWV  +N + LRIGVP R S+  F+++   ++  +G+ +D+F  A+ L+PY 
Sbjct  447   GGKTETPRGWVIADNARPLRIGVPRRASFVGFVTEEHDSHKVQGYCIDIFLEALKLVPYD  506

Query  1326  VPFQFVPFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVV  1505
             VP++F  FG+G  NPSY  LV++V+   FD A+GDIAIVTNRTK+VDF+QPY+++GL++V
Sbjct  507   VPYKFELFGDGLSNPSYDGLVKMVANDVFDAAVGDIAIVTNRTKIVDFSQPYISTGLVIV  566

Query  1506  APFKKLNTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILW  1685
             AP       AW FL PF+ +MW VTA  FV++ +V+WILEHR+ND+FRG P++Q+ T+  
Sbjct  567   APINNHKASAWVFLKPFTVEMWCVTAASFVMIAVVIWILEHRVNDDFRGPPRRQIATMFL  626

Query  1686  FSLSTLFFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESL  1865
             FS STLF  ++E TVS+LGR V+++WLF++++I SSYTASL+SILTVQQL + +KG+ESL
Sbjct  627   FSFSTLFKTNQEATVSSLGRFVMVVWLFLLMVITSSYTASLSSILTVQQLSTSVKGIESL  686

Query  1866  KEGNDPIGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERP  2045
                + PIGYQ+GSFA  YL + + I KSRLI+LGSPE Y  AL +GP  GGV+AIVDE P
Sbjct  687   ITNDWPIGYQVGSFAYSYLSDSLRIQKSRLISLGSPEDYERALRQGPRNGGVAAIVDELP  746

Query  2046  YVENFLSTQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLt  2225
             YV+ FLS Q  F I+GQ FT+SGWGFAF RDSPLAV MSTAIL LSENG LQ++H+KW  
Sbjct  747   YVQLFLSNQTDFGIIGQPFTRSGWGFAFQRDSPLAVGMSTAILKLSENGMLQKLHEKWFC  806

Query  2226  rtsc-ssestelesDRLHLKSFWglfllcgaacflalfIYFVQIMLKFRRVARAE  2387
             +  C        E  +L L SFWGL+LLCG   F A  ++ ++++ ++ R  + +
Sbjct  807   KEGCPEERRQHSEPHQLRLISFWGLYLLCGTITFTAFLVFLLRMVCQYVRYKQQQ  861


 Score =   359 bits (921),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 177/374 (47%), Positives = 246/374 (66%), Gaps = 5/374 (1%)
 Frame = +2

Query  59    VAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTTQ  238
             + A + ++ +VVAI+GPQSS +AH IS VAN L+VPL+SFAATDPTL++LQFPYF+R+TQ
Sbjct  84    IEAFQLIEKEVVAIIGPQSSSIAHMISEVANGLKVPLVSFAATDPTLSALQFPYFIRSTQ  143

Query  239   SDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGAT  418
             SD  QM A+AD+ID YGWKEVIA+++DDDYGRNGI+AL + L     K+SYK  +P    
Sbjct  144   SDSQQMAAMADLIDFYGWKEVIAIYVDDDYGRNGISALSNMLEKNMAKVSYKLPLPV-QF  202

Query  419   TRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVLDS  598
              + +I  +L     +  RV V+H  P  G  +F+ A  L MM + YVW++TDWLS  L+S
Sbjct  203   NQHDITVLLNNSKPLGPRVYVVHVSPDPGLRIFTTAQKLQMMTNNYVWLATDWLSATLES  262

Query  599   SSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLTGGSL---GLNSYALYAYDSVW  769
              S +    + I+QGV+ LRQHTPDS  K+AF SRW  +    L   GLN+Y LYAYD+VW
Sbjct  263   FSKMNQTSLRILQGVVGLRQHTPDSIPKKAFLSRWSGMQQKGLVSAGLNTYGLYAYDTVW  322

Query  770   LIAHAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLTG  949
              +A +ID F+N+   I+FS   +L   + + + LE L +FDGG  LL  LLQ++F GL+G
Sbjct  323   AVARSIDKFINEHN-ITFSASHELPDSKATRVQLEQLKVFDGGTFLLRKLLQTNFTGLSG  381

Query  950   QFKFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKLY  1129
             Q +FN D+++V   YD++N+       +G+W + SG S  PPETL  +  + S  + KL 
Sbjct  382   QVQFNQDRNIVSRGYDVINIDKMEIHRVGYWFDGSGFSVLPPETLKGKNVSHSQLDWKLQ  441

Query  1130  GVVWPGQSVKKAPG  1171
              + WPG   +   G
Sbjct  442   NITWPGGKTETPRG  455



>ref|XP_009399221.1| PREDICTED: glutamate receptor 3.7-like [Musa acuminata subsp. 
malaccensis]
Length=909

 Score =   410 bits (1053),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 227/415 (55%), Positives = 301/415 (73%), Gaps = 3/415 (1%)
 Frame = +3

Query  1146  GSR*KKPRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTN--TFKGFSVDVFTAAVNLLP  1319
             G + + PRGWV  +N + LRI VP R SY EF+    G +     G+ +DVF   + L+P
Sbjct  446   GGKTETPRGWVVASNERPLRIAVPNRASYLEFVRVTNGGDMENVSGYCIDVFKEIMKLIP  505

Query  1320  YAVPFQFVPFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLL  1499
             Y VP++FVP GNG+ NP+Y ELV +V     D AIGDIAIVT+R++  DFTQPY+ +GL+
Sbjct  506   YEVPYKFVPIGNGQTNPNYDELVNMVVQHVVDAAIGDIAIVTSRSRNSDFTQPYICTGLV  565

Query  1500  VVAPFKKLNTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITI  1679
             ++AP + + + AW FL PF+  MW VT  FF VVG+V+W+LEHR+N +FRG P +Q IT+
Sbjct  566   ILAPIRSIKSSAWVFLRPFTVGMWCVTGAFFFVVGVVIWLLEHRVNSDFRGPPTRQCITM  625

Query  1680  LWFSLSTLFFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVE  1859
               FS ST F + +E  +STLGR V+++WLF++++I SSYTASLTS LTVQ+L SPIKG++
Sbjct  626   FLFSFSTPFQSQQEEILSTLGRFVMMVWLFLLMVITSSYTASLTSFLTVQKLSSPIKGID  685

Query  1860  SLKEGNDPIGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDE  2039
             SL   N+PIGYQ GSFA  YL++ + +  SRL++LGSPEAY EALE+GP  GGV+AIVDE
Sbjct  686   SLIASNEPIGYQEGSFARSYLVDGLNVQPSRLVSLGSPEAYKEALERGPENGGVAAIVDE  745

Query  2040  RPYVENFLSTQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKW  2219
              PYVE F++    F I+GQ FT++GWGFAFPRDSPLA+DMSTA+L LSENG+LQRIH KW
Sbjct  746   LPYVELFVAKTSGFGIIGQSFTRNGWGFAFPRDSPLAIDMSTAMLKLSENGELQRIHKKW  805

Query  2220  Ltrtscssesteles-DRLHLKSFWglfllcgaacflalfIYFVQIMLKFRRVAR  2381
                TSC  +S      D+LH  SFWGLFL+CG A   +L ++F++ + +F R  R
Sbjct  806   FCNTSCIVQSGINSEPDQLHFNSFWGLFLVCGVATVASLILFFLRSIWQFIRFNR  860


 Score =   353 bits (907),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 183/373 (49%), Positives = 252/373 (68%), Gaps = 6/373 (2%)
 Frame = +2

Query  62    AALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTTQS  241
             AAL  ++ D +A++GPQSS +AH IS ++  LQ+PL+SFAATDPTL+S QFP+F+RTT  
Sbjct  85    AALSVLEHDAIALIGPQSSAIAHMISSISGGLQIPLISFAATDPTLSSSQFPFFVRTTHC  144

Query  242   DMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGATT  421
             D YQM A+AD+I+++GW++VIA+++DDDYGRNGI  LDD LA    K+ YK  +P  A T
Sbjct  145   DSYQMAAMADLIEYFGWRQVIAIYVDDDYGRNGIYYLDDELAENMSKM-YKIALPVKA-T  202

Query  422   RAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVLDSS  601
             R +++D+L +   +  RV V+HA P AG  +FSVA  L MM DGYVW++TDWLSTVLD+S
Sbjct  203   RNKLIDLLQKSKTLGPRVYVVHATPDAGLNIFSVAEQLHMMTDGYVWLATDWLSTVLDTS  262

Query  602   SPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLTGG---SLGLNSYALYAYDSVWL  772
               + S  +  +QGV+  RQ+ P S  K AF SRW  L      SL L++Y  +AYD+VW 
Sbjct  263   QTVASNSISYLQGVVSFRQYIPRSNQKEAFVSRWGELQKEGLVSLNLSTYGFFAYDTVWA  322

Query  773   IAHAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLTGQ  952
              AHAI+ FLN+   I+FS++S LQSI+G  + L  L  FDGG LL+  LL  +F GL+GQ
Sbjct  323   TAHAINDFLNEYENITFSSNSNLQSIKGK-MRLGMLKTFDGGHLLIKKLLLLNFTGLSGQ  381

Query  953   FKFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKLYG  1132
              +F+ DK+L+   Y+I+NV G+    +G+W N+SGLS + PE L    P + S  Q L  
Sbjct  382   IQFDGDKNLISRMYEIVNVRGSVTNRVGYWSNHSGLSISLPENLLINRPKNLSFTQVLGR  441

Query  1133  VVWPGQSVKKAPG  1171
             + WPG   +   G
Sbjct  442   ITWPGGKTETPRG  454



>ref|XP_004487409.1| PREDICTED: glutamate receptor 3.7-like [Cicer arietinum]
Length=916

 Score =   421 bits (1081),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 222/410 (54%), Positives = 305/410 (74%), Gaps = 2/410 (0%)
 Frame = +3

Query  1146  GSR*KKPRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYA  1325
             G + ++PRGWV  +NGK LRIGVP R S+ EF++++  ++  +G+ +D+F  A+  +PY 
Sbjct  453   GGKTERPRGWVIADNGKPLRIGVPKRASFVEFVTELQDSHHVEGYCIDIFKKALEFIPYE  512

Query  1326  VPFQFVPFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVV  1505
             +P+ F P GNG+ NP+Y  LV+++    +D  +GDIAIVTNRTK+ DF+QPY +S L++V
Sbjct  513   IPYVFKPVGNGKANPNYDTLVKMIDENVYDAVVGDIAIVTNRTKIADFSQPYASSSLVIV  572

Query  1506  APFKKLNTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILW  1685
             AP     + AW FL PFSA MW + A  F+++GIV+WILEHR+ND+FRG PK+QL+TI  
Sbjct  573   APINSSKSNAWVFLKPFSADMWCIIAASFMMIGIVIWILEHRVNDDFRGPPKRQLVTIFM  632

Query  1686  FSLSTLFFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESL  1865
             FSLSTLF     NTVS+L +MV+I+WLF++++I +SYTASLTSILTV+QL SPI G++SL
Sbjct  633   FSLSTLF-KTNNNTVSSLSKMVMIVWLFLLMVITASYTASLTSILTVEQLSSPITGIDSL  691

Query  1866  KEGNDPIGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERP  2045
                N PIGYQ+GSFA  YL + + +S+SRL++LGSPE YA AL  GP  GGV+AIVDE P
Sbjct  692   IATNWPIGYQVGSFAYSYLTDNLFVSRSRLVSLGSPEEYALALRNGPSSGGVAAIVDELP  751

Query  2046  YVENFLSTQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLt  2225
             YVE FLS + +F I+GQ FT+S WGFAF RDSPLAVDMSTAIL+L+E+G+LQ+IH+KW  
Sbjct  752   YVELFLSKETEFGIIGQPFTRSSWGFAFQRDSPLAVDMSTAILNLAESGELQKIHEKWFC  811

Query  2226  rtscssestel-esDRLHLKSFWglfllcgaacflalfIYFVQIMLKFRR  2372
             +  C  E     + D+LHL SFWGL+L C      AL ++ ++++ ++ R
Sbjct  812   KMGCLGERKTDPKPDQLHLISFWGLYLSCAVISLAALVLFLLRMINQYVR  861


 Score =   342 bits (877),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 169/374 (45%), Positives = 238/374 (64%), Gaps = 6/374 (2%)
 Frame = +2

Query  65    ALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTTQSD  244
             A + ++  VV I+GPQSS +AH+IS +A+ ++VPL+S+AATDPTL+SLQFP F RT QSD
Sbjct  89    AFQLLEQGVVTIIGPQSSAMAHSISQIADAVKVPLISYAATDPTLSSLQFPLFFRTVQSD  148

Query  245   MYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGATTR  424
               QM A+A++ID  GWKEVI +F+DDDYGRNGI+AL D L  KR KI++K  +       
Sbjct  149   SEQMEAMANLIDFNGWKEVIVLFLDDDYGRNGISALSDELEKKRLKIAHKLALSIYFDLD  208

Query  425   AEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVLDSSS  604
              EI  +L Q  +   RV V+H  P     +FS+A  L MM   YVW+ TDWL+  L S S
Sbjct  209   -EITKLLNQTKVFSPRVFVVHVNPDPRLRIFSIARKLQMMTSDYVWLVTDWLAATLHSFS  267

Query  605   PLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLTG---GSLGLNSYALYAYDSVWLI  775
             P     + I++GV+ LRQHTPDS  KRAF S+WK +      +  LNSY  +AYD+VW +
Sbjct  268   PANQNSLSIVEGVVGLRQHTPDSRKKRAFISQWKKMQKEGVANTSLNSYGFFAYDTVWTV  327

Query  776   AHAIDSFLNKGGVISF--SNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLTG  949
             AH+ID FL     I+F    +++++  EG  + LE L +  GG  L+N LLQS+F G++G
Sbjct  328   AHSIDKFLRVYNNITFLPHENNEVRHTEGIGIQLEKLKVLAGGNDLVNILLQSNFSGVSG  387

Query  950   QFKFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKLY  1129
             Q +F++D+S++   YD++N+       +G+W N+SG S  PPE L  +     S +QKL 
Sbjct  388   QIRFSSDRSVISSGYDVINIHQMKINKVGYWSNHSGFSVVPPEVLAKKEHRMLSIDQKLN  447

Query  1130  GVVWPGQSVKKAPG  1171
              + WPG   ++  G
Sbjct  448   NITWPGGKTERPRG  461



>gb|KHG04010.1| Glutamate receptor 3.7 -like protein [Gossypium arboreum]
Length=921

 Score =   410 bits (1055),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 216/383 (56%), Positives = 282/383 (74%), Gaps = 1/383 (0%)
 Frame = +3

Query  1146  GSR*KKPRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYA  1325
             G + K+PRGWV  ++ + LRIGVP R S+ +F++++ G++   G+ +DVFT A+  +PY 
Sbjct  449   GGKTKQPRGWVIADDERPLRIGVPYRASFVDFVTKLNGSHKIAGYCIDVFTEALKFVPYN  508

Query  1326  VPFQFVPFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVV  1505
             VP++F  FG+G+ NP+Y +LV+ V+   FD A+GDIAIV NRTKVVDF+QPY+ +GL++V
Sbjct  509   VPYKFELFGDGQSNPNYGQLVQRVADDVFDAAVGDIAIVKNRTKVVDFSQPYITTGLVIV  568

Query  1506  APFKKLNTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILW  1685
             AP     + AW FL PF+A MW +TA  F ++  V+WILEHR+ND FRG P++QL+T+  
Sbjct  569   APIHNTKSSAWVFLKPFTADMWCMTAGGFFIIAFVIWILEHRVNDAFRGPPRRQLVTMFM  628

Query  1686  FSLSTLFFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESL  1865
             FS STLF  ++E TVSTLGR+V+++WLF++++I SSYTA+LTSILTVQQL SPI GVESL
Sbjct  629   FSFSTLFKTNQEVTVSTLGRLVMVVWLFLLMVITSSYTANLTSILTVQQLSSPITGVESL  688

Query  1866  KEGNDPIGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERP  2045
                + PIGYQ+GSFA  YL + + I +SRL+ L SPE Y  AL  GP  GGV+AIVDE  
Sbjct  689   IGNSWPIGYQVGSFAYGYLSDNLNIQRSRLVKLHSPEEYETALRLGPDNGGVAAIVDELS  748

Query  2046  YVENFLSTQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLt  2225
             YVE FLS +  F I+GQ FTKSGWGFAF RDSPLAVDMSTAIL LSE G LQ IH KW  
Sbjct  749   YVELFLSKRTDFGIIGQPFTKSGWGFAFQRDSPLAVDMSTAILKLSETGKLQEIHAKWFC  808

Query  2226  rtsc-ssestelesDRLHLKSFW  2291
             +  C      + E ++LHL SFW
Sbjct  809   KMGCPGERRGKSEPNQLHLVSFW  831


 Score =   351 bits (900),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 168/374 (45%), Positives = 241/374 (64%), Gaps = 4/374 (1%)
 Frame = +2

Query  59    VAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTTQ  238
             + A + ++ +VVA +GPQSS +AH IS +AN LQVPL+S+AATDP+L++ QFP+F+RT Q
Sbjct  85    IEAYQVIEREVVAFIGPQSSSIAHMISEIANGLQVPLVSYAATDPSLSAKQFPFFVRTVQ  144

Query  239   SDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGAT  418
             SD YQM A+A ++D YGWKEVIA+++D+DYGRNGI+AL+D L  +  K  YK  +P    
Sbjct  145   SDSYQMNAMASLVDFYGWKEVIAIYVDNDYGRNGISALNDELNRRMAKAFYKLPLPV-RF  203

Query  419   TRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVLDS  598
             T+ +I+ +L Q  L+  RV ++H  P  G  +F+ A  L MM   YVW +TDWLS  +DS
Sbjct  204   TQHDIVAVLNQSRLLGPRVYIVHVDPDPGLRIFATAEKLQMMSSNYVWFATDWLSATIDS  263

Query  599   SSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLTGGSL---GLNSYALYAYDSVW  769
              +P+    + ++QGV+ LRQH P+S   + F SRWK +    L    LN+Y L AYD+VW
Sbjct  264   FAPMNRTALSVLQGVVGLRQHIPESNQTKNFLSRWKKMQQQGLVKSELNTYGLCAYDTVW  323

Query  770   LIAHAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLTG  949
              +A +ID F++ G   +FS   KL   + + +HL  L +FDGG +LL+++L + F GLTG
Sbjct  324   TVARSIDKFIDDGNNFTFSLSVKLNDSKTTQMHLGKLKVFDGGAILLDDILNTSFSGLTG  383

Query  950   QFKFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKLY  1129
               +FN+D+++V   YD++N+       +GFW N  G S +PPETL       S   QKL 
Sbjct  384   PVRFNSDRNIVTSGYDVINIDKMAVHIVGFWSNTFGFSVSPPETLQGTKNRHSEIEQKLG  443

Query  1130  GVVWPGQSVKKAPG  1171
              V WPG   K+  G
Sbjct  444   KVAWPGGKTKQPRG  457



>ref|XP_002524180.1| glutamate receptor 3 plant, putative [Ricinus communis]
 gb|EEF38195.1| glutamate receptor 3 plant, putative [Ricinus communis]
Length=921

 Score =   407 bits (1047),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 211/384 (55%), Positives = 287/384 (75%), Gaps = 2/384 (1%)
 Frame = +3

Query  1146  GSR*KKPRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYA  1325
             G + +KPRGW   ++ + LRIGVP R S+ +F+++V  ++  +G+ +D+F  A  L+PY 
Sbjct  454   GGKMEKPRGWEIADDERPLRIGVPRRASFVDFVTEVNQSHKIEGYCIDLFLEARKLIPYY  513

Query  1326  VPFQFVPFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVV  1505
             VP++F PFG+G+ NPSY+ELVR+V+    D A+GDIAIVTNRTK+VDF+QPY ASGL+++
Sbjct  514   VPYRFEPFGDGQSNPSYNELVRMVAEDVLDAAVGDIAIVTNRTKIVDFSQPYAASGLVIL  573

Query  1506  APFKKLNTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILW  1685
             AP +   + AW FL PF+ +MW VTA  F+++ +V+WILEHR+NDEFRG P++Q++T+  
Sbjct  574   APIRNSKSSAWVFLKPFTVEMWCVTAASFLMIAVVIWILEHRVNDEFRGPPRRQIVTMFM  633

Query  1686  FSLSTLFFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESL  1865
             FS STLF  ++E T+S L RMV+++WLFV+++I +SYTASLTSILTV+QL SPI G++SL
Sbjct  634   FSFSTLFKTNQETTISPLARMVMVVWLFVLMVITASYTASLTSILTVEQLSSPITGIDSL  693

Query  1866  KEGNDPIGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHK-GGVSAIVDER  2042
                  PIGYQ+GSFA  YL E + IS+SRL+ LG+PE Y  AL  GP   GGV+A+VDE 
Sbjct  694   IASKWPIGYQVGSFAYEYLYESLYISRSRLVPLGTPEEYERALRLGPQNVGGVAAVVDEL  753

Query  2043  PYVENFLSTQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWL  2222
             PYVE FL+    F I+GQ FT+ GWGFAF RDSPLA+DMSTAIL LSE G LQ+IH+KW 
Sbjct  754   PYVELFLAKHGDFGIIGQPFTRGGWGFAFQRDSPLALDMSTAILKLSETGVLQKIHEKWF  813

Query  2223  trtscssesteles-DRLHLKSFW  2291
              +  C+ E  +    ++L L SFW
Sbjct  814   CKKGCAGEKRQKSEPNQLRLISFW  837


 Score =   354 bits (908),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 176/374 (47%), Positives = 244/374 (65%), Gaps = 5/374 (1%)
 Frame = +2

Query  59    VAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTTQ  238
             V AL+ ++ DVVAI+GPQSS +AH IS  AN LQVPL+S+AATDPTL++LQFP+F+RTTQ
Sbjct  91    VGALRVLEKDVVAIIGPQSSGIAHMISQFANGLQVPLISYAATDPTLSALQFPFFVRTTQ  150

Query  239   SDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGAT  418
             SD YQM A+A+++D YGWKEVI +++DDD GRNGI A DD L  K  K +YK  +     
Sbjct  151   SDSYQMAAMAELVDFYGWKEVIGIYVDDDPGRNGINAFDDELEKKMAK-TYKLQLSVNF-  208

Query  419   TRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVLDS  598
               AEI  +L +   +  RV V+H  P     +F+VA  L MM D YVW +TDWLS  +DS
Sbjct  209   DEAEITGLLKKSKSLGPRVYVVHVNPDPRMRIFTVAKKLQMMTDNYVWFATDWLSATVDS  268

Query  599   SSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLTGGSL---GLNSYALYAYDSVW  769
              S +   ++ ++ GV+ LRQH P+S  KRAF SRW+ +    L    LN+Y L AYD+VW
Sbjct  269   FSRINRTELSVLHGVVALRQHIPESSQKRAFVSRWREMQQKGLVSSELNTYGLQAYDTVW  328

Query  770   LIAHAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLTG  949
              +A+AID+F+N+   I+F  + +L  ++ S L L  L IF+GG  LLN +LQ +F GL+G
Sbjct  329   AVAYAIDNFINEFKNITFPLNHELLEMKTSELQLRELKIFNGGNDLLNKILQLNFTGLSG  388

Query  950   QFKFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKLY  1129
               + N D+++    YD++N++ T  RT+G+W + SG S  P ET      N S  +QKL 
Sbjct  389   HIQVNQDRNIESGGYDVINIVHTSVRTVGYWSSSSGFSLLPTETHQGEQTNYSHVDQKLQ  448

Query  1130  GVVWPGQSVKKAPG  1171
              + WPG  ++K  G
Sbjct  449   NITWPGGKMEKPRG  462



>ref|XP_010035563.1| PREDICTED: glutamate receptor 3.7 [Eucalyptus grandis]
 gb|KCW46992.1| hypothetical protein EUGRSUZ_K00798 [Eucalyptus grandis]
Length=918

 Score =   422 bits (1085),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 230/416 (55%), Positives = 310/416 (75%), Gaps = 0/416 (0%)
 Frame = +3

Query  1146  GSR*KKPRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYA  1325
             G + +KPRGWV  ++G  LRIGVP R S+ EF+ +   ++ F+G+ VDVF  A NL+PY 
Sbjct  449   GGKTEKPRGWVVADSGNPLRIGVPNRFSFTEFVMENHSSHEFQGYCVDVFNEARNLVPYE  508

Query  1326  VPFQFVPFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVV  1505
             VP++F  +G+G  NP+Y   ++ V+   FD A+GDIAIVTNRTK+VDF+QP+ +SGL++V
Sbjct  509   VPYRFEAYGDGHSNPNYDSFIKTVANNVFDAAVGDIAIVTNRTKLVDFSQPFASSGLVIV  568

Query  1506  APFKKLNTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILW  1685
             AP K   + AW FL PFSA++W VTA  FV++ +V+WILEHR+N  FRGSPK+Q+ T+  
Sbjct  569   APIKDSKSSAWVFLEPFSAELWVVTAASFVIIAVVIWILEHRVNKHFRGSPKRQIATMFL  628

Query  1686  FSLSTLFFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESL  1865
             FS ST+F  ++E+TVS LGRMV+++WLF++L+I SSYTASL+SILTV+QL SPI G++SL
Sbjct  629   FSFSTVFKKNQEDTVSPLGRMVMVVWLFLLLVITSSYTASLSSILTVRQLSSPITGIDSL  688

Query  1866  KEGNDPIGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERP  2045
                N PIGYQ+GSFA+ YL+E + IS SRLI LGSPE Y +AL  GP  GGV+AIVDE+P
Sbjct  689   IVSNWPIGYQVGSFAQSYLLESLYISPSRLIPLGSPEEYEKALRLGPSNGGVAAIVDEQP  748

Query  2046  YVENFLSTQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLt  2225
             YVE FLS   +F I+GQEFT  GWGFAF R SPLAVD+STAIL LSE+G LQ IH+KW  
Sbjct  749   YVELFLSKHTQFGIIGQEFTSGGWGFAFQRGSPLAVDISTAILKLSESGKLQEIHEKWFC  808

Query  2226  rtscssestelesDRLHLKSFWglfllcgaacflalfIYFVQIMLKFRRVARAEPV  2393
             +  C S   + ++++LHL SFWGL+LLCG     AL ++ ++++  F +  + + V
Sbjct  809   KMGCPSGRQDSKAEQLHLISFWGLYLLCGVISVTALLVFLIRMIYLFVQFKKQQMV  864


 Score =   338 bits (866),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 174/374 (47%), Positives = 240/374 (64%), Gaps = 4/374 (1%)
 Frame = +2

Query  59    VAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTTQ  238
             V A K +  +VVAI+GPQSS +AH I+ +A+ LQVPL+S++ATDP+L++ QF YF+RT Q
Sbjct  85    VEAFKVIGEEVVAIIGPQSSAIAHMIAEIADNLQVPLISYSATDPSLSAQQFSYFVRTAQ  144

Query  239   SDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGAT  418
             SD YQM A+AD+ID+YGWK+VIA++IDD++GRNGI AL D L  K  KISY+  +P    
Sbjct  145   SDSYQMAAMADLIDNYGWKDVIAIYIDDEFGRNGIYALGDELEKKMMKISYRLPLPVQYD  204

Query  419   TRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVLDS  598
             +R  I D L +      RV V+HA     F +F++A  L MMG  YVW++TDW+S  LDS
Sbjct  205   SR-HITDTLNKSKRFGPRVYVVHANLDPAFRIFTIAQELQMMGSDYVWLATDWVSATLDS  263

Query  599   SSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLTGGSL---GLNSYALYAYDSVW  769
              SP     +EIM+GV+ LR HTPDS  K  F +RW+ +    L   GLN+Y L AYD+VW
Sbjct  264   LSPKNHTYIEIMKGVVALRPHTPDSVRKSTFIARWRDMQTNGLTESGLNTYGLCAYDTVW  323

Query  770   LIAHAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLTG  949
              +A+AID ++ + G  +F+  + L   +     L  L +FDGG LLL  LLQ +F GLTG
Sbjct  324   AVAYAIDRYIKENGNFTFTFSNALYDEKTKEKQLGKLKVFDGGSLLLKKLLQLNFTGLTG  383

Query  950   QFKFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKLY  1129
             Q  F+ D+++    YD++N+   G   +GFW N +GLS  PPE +     + +  +QKL 
Sbjct  384   QIYFSPDRNVPSSGYDVINIDQRGIHLVGFWSNKTGLSVVPPENIEGGHSSYTHEDQKLR  443

Query  1130  GVVWPGQSVKKAPG  1171
              V WPG   +K  G
Sbjct  444   NVTWPGGKTEKPRG  457



>ref|XP_011100274.1| PREDICTED: glutamate receptor 3.3 [Sesamum indicum]
 ref|XP_011100281.1| PREDICTED: glutamate receptor 3.3 [Sesamum indicum]
 ref|XP_011100289.1| PREDICTED: glutamate receptor 3.3 [Sesamum indicum]
 ref|XP_011100297.1| PREDICTED: glutamate receptor 3.3 [Sesamum indicum]
Length=935

 Score =   632 bits (1631),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/476 (78%), Positives = 424/476 (89%), Gaps = 0/476 (0%)
 Frame = +3

Query  1146  GSR*KKPRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYA  1325
             G   K PRGWVFPNNGKQLRIGVP RVSY+EF+SQ+ GTN FKGF +DVFTAAVNLLPYA
Sbjct  451   GESIKTPRGWVFPNNGKQLRIGVPRRVSYREFVSQIAGTNNFKGFCIDVFTAAVNLLPYA  510

Query  1326  VPFQFVPFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVV  1505
             VP+QFVP+GNGRENPSY+ELV L++TG FDG +GDIAIVTNRTK+VDFTQPY ASGL+VV
Sbjct  511   VPYQFVPYGNGRENPSYTELVNLITTGIFDGVVGDIAIVTNRTKIVDFTQPYAASGLVVV  570

Query  1506  APFKKLNTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILW  1685
             AP +KLNTGAWAFL PFS QMWGVTA FFV +GIVVWILEHR+NDEFRG PK+QLITILW
Sbjct  571   APVRKLNTGAWAFLRPFSRQMWGVTAAFFVFIGIVVWILEHRINDEFRGPPKKQLITILW  630

Query  1686  FSLSTLFFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESL  1865
             FSLSTLFFAHRE TVSTLGR+VLI+WLFVVLIINSSYTASLTSILTVQQLYSPIKG+E+L
Sbjct  631   FSLSTLFFAHRETTVSTLGRLVLILWLFVVLIINSSYTASLTSILTVQQLYSPIKGIETL  690

Query  1866  KEGNDPIGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERP  2045
             K+G+DPIGYQ+GSFAEHYL E IGISKSRL ALGSPE YA AL+KGPH GGV+A+VDERP
Sbjct  691   KDGDDPIGYQVGSFAEHYLTEGIGISKSRLKALGSPEEYATALQKGPHNGGVAAVVDERP  750

Query  2046  YVENFLSTQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLt  2225
             Y+E FL++QC+FRI+GQEFTKSGWGFAFPRDSPLA+D+STAIL+LSENGDLQRIHDKWLT
Sbjct  751   YIELFLASQCRFRIIGQEFTKSGWGFAFPRDSPLAIDLSTAILTLSENGDLQRIHDKWLT  810

Query  2226  rtscssestelesDRLHLKSFWglfllcgaacflalfIYFVQIMLKFRRVARAEPVADGs  2405
              +SCSS++TELESDRLHLKSFWGL+LLCG ACF+AL IYF+QI+ KFR+ A  E V DG 
Sbjct  811   TSSCSSDNTELESDRLHLKSFWGLYLLCGIACFIALLIYFLQIVHKFRKAAPEEYVIDGQ  870

Query  2406  sstrsrrlqtllslIDEksdpskrdkkrrkidrslsdENSGSNLARDPGGGSSERS  2573
              S+RS+RL TLLSLIDEK D S+ D+KRRK+++ LS+ N   +L RD    SS+ S
Sbjct  871   GSSRSKRLHTLLSLIDEKEDQSRSDRKRRKLEQMLSENNGEVDLERDSKRKSSQIS  926


 Score =   598 bits (1543),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/380 (72%), Positives = 332/380 (87%), Gaps = 2/380 (1%)
 Frame = +2

Query  56    LVAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTT  235
             LV AL++M+TDVVA++GPQSSVVAHTI HVANEL+ P LSFAATDPTL+SLQFPYF+RTT
Sbjct  86    LVEALRYMETDVVAVIGPQSSVVAHTILHVANELKTPFLSFAATDPTLSSLQFPYFIRTT  145

Query  236   QSDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGA  415
             QSD++QM A+AD+++HYGWKEVI +F+DDDYGRNG++ALDDALAA+RC++SYKAGIPPG 
Sbjct  146   QSDLHQMTAVADIVEHYGWKEVIVIFLDDDYGRNGLSALDDALAARRCRVSYKAGIPPGD  205

Query  416   TTRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVLD  595
              +R+++MDILV++AL ESRV+VLHAYP AGFMVFSVAHYLGMM DGY WI+TDWLS+ LD
Sbjct  206   LSRSDVMDILVKVALTESRVIVLHAYPRAGFMVFSVAHYLGMMDDGYAWIATDWLSSALD  265

Query  596   SSSPLPSEKM-EIMQGVLVLRQHTPDSELKRAFTSRWKHLTGGSLGLNSYALYAYDSVWL  772
             S+SP  ++ + E MQGVLVLRQHTPDSE KRAF +RW +LTGGSLGL++Y LYAYD+VWL
Sbjct  266   SASPQRAQTLTETMQGVLVLRQHTPDSERKRAFMARWNNLTGGSLGLSTYGLYAYDTVWL  325

Query  773   IAHAIDSFLNKGGVISFSNDSKLQSIEGST-LHLEALSIFDGGPLLLNNLLQSDFVGLTG  949
              AHAIDSF N+GGVISFSNDS+L S+EGS+ LHLEA+ IFDGGPLLL N+LQ++FVGLTG
Sbjct  326   TAHAIDSFFNQGGVISFSNDSRLNSLEGSSQLHLEAMVIFDGGPLLLKNILQTEFVGLTG  385

Query  950   QFKFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKLY  1129
               KFN DKSL  P+Y+I+N+IGTG   +G+WCNYSGLST  PETLYS+PPN SSANQ+L 
Sbjct  386   PVKFNPDKSLTSPAYEIINIIGTGLHRVGYWCNYSGLSTVAPETLYSQPPNRSSANQQLN  445

Query  1130  GVVWPGQSVKKAPGVGFPEQ  1189
              V+WPG+S+K   G  FP  
Sbjct  446   SVIWPGESIKTPRGWVFPNN  465



>gb|EPS72603.1| glutamate receptor, partial [Genlisea aurea]
Length=827

 Score =   383 bits (984),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 214/353 (61%), Positives = 263/353 (75%), Gaps = 5/353 (1%)
 Frame = +3

Query  1164  PRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYAVPFQFV  1343
             PRGW FP NGK+LRIGVP R S+K F  +V  T    G+S+DVF  AV+LLPYA+P++ V
Sbjct  427   PRGWDFPQNGKELRIGVPNRFSFKAFAYEVNKTG-IDGYSIDVFKHAVDLLPYALPYKLV  485

Query  1344  PFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPFKKL  1523
              FG+G++NPSY ELV  +S    DGA+GDI IVTNR K+VDFTQPY+ SGL+VV P +K+
Sbjct  486   LFGDGKKNPSYKELVDNISLNVVDGAVGDITIVTNRIKIVDFTQPYIESGLVVVVPSRKI  545

Query  1524  NTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSLSTL  1703
                AW FL PF+  MW VT F  + VG VVW LE  +N+EFRGSPK+QL+TI WF  S+ 
Sbjct  546   KHKAWVFLHPFTPAMWVVTVFVSIYVGFVVWFLERHVNEEFRGSPKEQLVTIFWFGFSSF  605

Query  1704  FFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESLKEGNDP  1883
             F A +EN +  L R+VL+IWLFV LI+ SSYTASL++ILTV+     I G+ESL   ND 
Sbjct  606   FSAPKENMMGALARVVLLIWLFVALIVTSSYTASLSAILTVEHAAPSITGIESLIMSNDR  665

Query  1884  IGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERPYVENFL  2063
             IGYQ+GSF+E+YLIE++ I+KSRL+ LGSPE YA+AL      G VSAIVDERPYV+ FL
Sbjct  666   IGYQLGSFSEYYLIEQLNIAKSRLVPLGSPEEYADALT----TGNVSAIVDERPYVDLFL  721

Query  2064  STQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWL  2222
             +  C F IVGQEFTKS  GFAF RDSPL VD+STAIL+LSE G LQ + +KWL
Sbjct  722   ANYCSFEIVGQEFTKSSMGFAFQRDSPLVVDLSTAILTLSEKGVLQSLLNKWL  774


 Score =   371 bits (953),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 184/381 (48%), Positives = 262/381 (69%), Gaps = 4/381 (1%)
 Frame = +2

Query  56    LVAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTT  235
             L+  LK+M+  +VAI+GPQ S  AH +SH+ANEL VP+LSF A DP+L+SLQ+PYF++T 
Sbjct  56    LLGGLKYMEAQMVAIIGPQVSETAHILSHLANELHVPMLSFTALDPSLSSLQYPYFVQTA  115

Query  236   QSDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGA  415
              +D++QM AIAD++ ++G++ VIA++ DD+  R  IA+L   LA +   I+YKA + PG 
Sbjct  116   PNDLFQMTAIADMLSYFGFRRVIALYTDDEQSRGPIASLAVKLAERHSVITYKAVLLPGN  175

Query  416   -TTRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVL  592
              T+  EIM  L +I  MESRV++LH++   G  V  +A+ L MM  GYVWI+T WLSTVL
Sbjct  176   LTSDEEIMKQLAKIKTMESRVIILHSFAVVGLRVLKLANQLKMMEKGYVWIATAWLSTVL  235

Query  593   DSSSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLTGGSLGLNSYALYAYDSVWL  772
             D S P   E    ++GVL LR HTPDS+ K AF SRWK L+ GS+GLN Y LYAYD+VW+
Sbjct  236   D-SIPFSVENETYLKGVLTLRPHTPDSDKKTAFLSRWKTLSNGSIGLNPYGLYAYDTVWI  294

Query  773   IAHAIDSFLNKGGVISFSNDSKLQSIEGS-TLHLEALSIFDGGPLLLNNLLQSDFVGLTG  949
             IA+A+  FL++GG ISFS ++ L  + G   L+L AL   D G  +L+ +LQ+   GLTG
Sbjct  295   IANAVKRFLDQGGNISFSPNTYLNGLAGDGNLNLGALCTCDAGSQVLDLILQTHMTGLTG  354

Query  950   QFKFNNDKSLVLPSYDILNVI-GTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKL  1126
             +  F++DKS++ P+++ILNV+  + ++ IG+W NYSGLS + PE L+    N S +NQ+L
Sbjct  355   KISFDSDKSVIRPAFEILNVVLKSNYKRIGYWSNYSGLSVSSPEILFGLQVNRSRSNQQL  414

Query  1127  YGVVWPGQSVKKAPGVGFPEQ  1189
               ++WPG +     G  FP+ 
Sbjct  415   DSIIWPGNTTVMPRGWDFPQN  435



>emb|CDP11784.1| unnamed protein product [Coffea canephora]
Length=912

 Score =   403 bits (1036),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 211/379 (56%), Positives = 278/379 (73%), Gaps = 2/379 (1%)
 Frame = +3

Query  1158  KKPRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYAVPFQ  1337
             KKPRGWV  N G+ LRIG+P R S+ EF++++  ++  +G+ +++F  A  L+PY VP  
Sbjct  452   KKPRGWVIANGGRPLRIGIPKRASFTEFVTELDKSHNVQGYCINLFDEARQLVPYDVPST  511

Query  1338  FVPFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPFK  1517
             FVPFGNG  NP+Y  LV++V+ G FD AIGDIAIVTNRT+  DFTQP+ A+GL++V P  
Sbjct  512   FVPFGNGLSNPNYDALVKMVADGVFDAAIGDIAIVTNRTRNADFTQPFAATGLVIVVPID  571

Query  1518  KLNTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSLS  1697
                +  W F+ PF+ ++W V A  FVV+ +V+WILEHR+NDEFRG PKQQL T+  FS S
Sbjct  572   NSKSTPWVFVKPFALKLWAVIAISFVVIAVVIWILEHRVNDEFRGPPKQQLRTMFLFSFS  631

Query  1698  TLFFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSP-IKGVESLKEG  1874
             TLF  ++E T+S L RMV+++WLF+++++ SSYTASLTSILTVQQL S  I G++SL   
Sbjct  632   TLFKTNQEKTISPLSRMVMVVWLFLLMVVTSSYTASLTSILTVQQLSSSTITGIDSLIAS  691

Query  1875  NDPIGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERPYVE  2054
             + PIGYQ+GSFA  YL + + I KSRL++LGSPE Y +AL +GP  GGV+AIVDE PY+E
Sbjct  692   DWPIGYQVGSFAYSYLKDNLNIRKSRLVSLGSPEEYEKALRQGPKSGGVAAIVDELPYIE  751

Query  2055  NFLSTQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLtr-t  2231
              FLS +  F IVGQ FTK GWGFAF +DSPLAVDMSTAIL L+E+G LQ IH KW  +  
Sbjct  752   LFLSNRTDFIIVGQPFTKGGWGFAFQKDSPLAVDMSTAILKLAESGKLQEIHHKWFCKPE  811

Query  2232  scssestelesDRLHLKSF  2288
               +      + ++LHL+SF
Sbjct  812   CPAQRIHNPDPNQLHLRSF  830


 Score =   351 bits (900),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 173/372 (47%), Positives = 235/372 (63%), Gaps = 4/372 (1%)
 Frame = +2

Query  65    ALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTTQSD  244
             A + +  +VVAI+GP+SS +AH IS +AN L VPL+S+AATDPTL++LQFPYFLR+T SD
Sbjct  86    AFQVLDNEVVAIIGPESSPIAHMISQIANGLHVPLVSYAATDPTLSALQFPYFLRSTHSD  145

Query  245   MYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGATTR  424
              YQM A+AD I+ YGWKEVIA+FID+DYGRNGI+ L D L  K  KISYK  +P      
Sbjct  146   FYQMEAVADFINFYGWKEVIAIFIDNDYGRNGISVLGDELTEKMAKISYKLALPSQFDVN  205

Query  425   AEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVLDSSS  604
               I D+L     +  RV V+H  P      F +A  L MM   YVW++TDWLS+ LDS S
Sbjct  206   F-ITDVLNNSKYLGPRVYVVHINPDPMLRFFHIAQQLNMMTSEYVWLATDWLSSTLDSLS  264

Query  605   PLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLTGGSL---GLNSYALYAYDSVWLI  775
                 +   I++GV+V R HTP + LK+AF SRW+ L        GLN Y LYAYD+VW +
Sbjct  265   KDNQDLFSILEGVIVFRPHTPTTTLKKAFVSRWRKLQQRDTVHSGLNVYGLYAYDTVWAV  324

Query  776   AHAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLTGQF  955
             AHAID  L +   ISFS+   LQ  + + + L    +F+GG LLL  L +++  GLTGQ 
Sbjct  325   AHAIDKILKQHINISFSSSGTLQDAKTNRMQLGKFKVFNGGELLLKILSETNLTGLTGQI  384

Query  956   KFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKLYGV  1135
             +FN D+++++  Y+++N++    R + +W N++G S  PPE       + S  +QK+  V
Sbjct  385   RFNADRNIIITGYEVVNIVRMVTRVVSYWSNHTGFSLLPPEFRKENQTSYSHPDQKIDNV  444

Query  1136  VWPGQSVKKAPG  1171
              WPG   KK  G
Sbjct  445   TWPGGMTKKPRG  456



>dbj|BAL15056.1| glutamate receptor 3.3 [Solanum lycopersicum]
Length=808

 Score =   623 bits (1606),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/379 (77%), Positives = 334/379 (88%), Gaps = 1/379 (0%)
 Frame = +2

Query  56    LVAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTT  235
             +V ALKFM+TDVVA++GPQSSVVAHTISHVANELQVP LSFAATDPTL+SLQFPYFLRTT
Sbjct  91    MVGALKFMETDVVAVIGPQSSVVAHTISHVANELQVPFLSFAATDPTLSSLQFPYFLRTT  150

Query  236   QSDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGA  415
             QSD+YQM AIA++I+ Y WKEVIA+FIDDDYGRNG++ALDDALA +RC+ISYK GI PGA
Sbjct  151   QSDLYQMTAIAEIIEFYAWKEVIAIFIDDDYGRNGVSALDDALATRRCRISYKVGISPGA  210

Query  416   T-TRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVL  592
             T TR ++MD++V++ALMESRV+VLHAY   G MV SVAHYLGMMGDGYVWISTDWL+TVL
Sbjct  211   TVTRGDVMDVMVKVALMESRVIVLHAYRKLGLMVLSVAHYLGMMGDGYVWISTDWLTTVL  270

Query  593   DSSSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLTGGSLGLNSYALYAYDSVWL  772
             DSS PLP + M+ MQGVLVLRQHTP+S+ KRAF+SRW  LTGG LGLNSYAL+AYD+VWL
Sbjct  271   DSSPPLPQDTMDTMQGVLVLRQHTPESKNKRAFSSRWNKLTGGLLGLNSYALHAYDTVWL  330

Query  773   IAHAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLTGQ  952
             +AHAIDSF N+GG ISFSND+KLQ++EGS LHLEA+SIFDGGPLLL NLL+SDFVGLTG 
Sbjct  331   VAHAIDSFFNQGGTISFSNDTKLQTVEGSNLHLEAMSIFDGGPLLLKNLLESDFVGLTGP  390

Query  953   FKFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKLYG  1132
             FKF+ DKSL+ P+YDI+NVIGTGFR +G+W NYSGLS  PPET YSRPPN SS NQKLY 
Sbjct  391   FKFSPDKSLIRPAYDIINVIGTGFRRVGYWSNYSGLSILPPETYYSRPPNRSSTNQKLYS  450

Query  1133  VVWPGQSVKKAPGVGFPEQ  1189
             VVWPG +V+K  G  FP  
Sbjct  451   VVWPGNNVQKPRGWVFPNN  469


 Score =   520 bits (1338),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 267/327 (82%), Positives = 298/327 (91%), Gaps = 1/327 (0%)
 Frame = +3

Query  1146  GSR*KKPRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYA  1325
             G+  +KPRGWVFPNNGKQL+IGVPIRVSY+EF+SQ+PGTN FKGF +DVFTAAVNLLPYA
Sbjct  455   GNNVQKPRGWVFPNNGKQLKIGVPIRVSYREFVSQIPGTNNFKGFCIDVFTAAVNLLPYA  514

Query  1326  VPFQFVPFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVV  1505
             VP +FVP+GNG ENPSY+++VRL++ G FDG +GDIAIVTNRT+VVDFTQPY ASGL+VV
Sbjct  515   VPHKFVPYGNGHENPSYTDMVRLITIGKFDGVVGDIAIVTNRTRVVDFTQPYAASGLVVV  574

Query  1506  APFKKLNTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILW  1685
             APF+KLN+G WAFL PFSAQMWGV   FF+ VG+VVWILEHR+NDEFRG PKQQLITILW
Sbjct  575   APFEKLNSGGWAFLRPFSAQMWGVITIFFLFVGMVVWILEHRINDEFRGPPKQQLITILW  634

Query  1686  FSLSTLFFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESL  1865
             FSLSTLFFAHRENTVSTLGRMVLIIWLFVVLIINSSYTASLTSILTVQQLYSPIKG+ESL
Sbjct  635   FSLSTLFFAHRENTVSTLGRMVLIIWLFVVLIINSSYTASLTSILTVQQLYSPIKGIESL  694

Query  1866  KEGNDPIGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERP  2045
             KE ++PIGYQ+GSFAE YL EEIGI KSRL+ LGSPE YA AL++GP  GGV+A+VDERP
Sbjct  695   KETDEPIGYQVGSFAERYL-EEIGIPKSRLVPLGSPEEYATALQRGPANGGVAAVVDERP  753

Query  2046  YVENFLSTQCKFRIVGQEFTKSGWGFA  2126
             YVE FLS QCKFRIVGQEFTKSGWGF 
Sbjct  754   YVELFLSNQCKFRIVGQEFTKSGWGFV  780



>ref|XP_003596995.1| Glutamate receptor 3.7 [Medicago truncatula]
 gb|AES67246.1| glutamate receptor 2 [Medicago truncatula]
Length=914

 Score =   407 bits (1046),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 209/383 (55%), Positives = 279/383 (73%), Gaps = 2/383 (1%)
 Frame = +3

Query  1146  GSR*KKPRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYA  1325
             G + ++PRGWV  +N K LRIGVP R S+ EF+++V   +  +G+ +D+F  A+  +PY 
Sbjct  451   GGKTERPRGWVIADNAKPLRIGVPKRASFVEFVTEVQEIHQMQGYCIDIFMKALEFIPYE  510

Query  1326  VPFQFVPFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVV  1505
             +PF F P GNG+ NP+Y  LV+ +    +D  +GDIAIVTNRTK+ DF+QP+ +S L+VV
Sbjct  511   IPFVFKPVGNGKANPNYDALVKKLDENVYDAVVGDIAIVTNRTKIADFSQPFASSSLVVV  570

Query  1506  APFKKLNTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILW  1685
             AP     + AW FL PFS  MW +    F+++G+V+WILEHR+ND+FRG PK+QL+T+  
Sbjct  571   APINSSKSNAWVFLKPFSPDMWCIIVASFMMIGVVIWILEHRVNDDFRGPPKRQLVTMFM  630

Query  1686  FSLSTLFFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESL  1865
             FSLSTLF     NT+S+L +MVLI+WLF++++I +SYTASLTSILTV+QL SPI G++SL
Sbjct  631   FSLSTLF-KTNNNTISSLSKMVLIVWLFLLMVITASYTASLTSILTVEQLSSPITGIDSL  689

Query  1866  KEGNDPIGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERP  2045
                N PIGYQ+GSFA  YL + + +S SRL++LGSPE YA AL  GP  GGV+AIVDE P
Sbjct  690   IASNWPIGYQVGSFAYSYLTDNLYVSSSRLVSLGSPEEYAVALRNGPSGGGVAAIVDELP  749

Query  2046  YVENFLSTQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLt  2225
             YVE FLS +  F I+GQ FT+S WGFAF R+SPLA+DMSTAIL L+E+G+LQ IH+KW  
Sbjct  750   YVELFLSKETDFGIIGQPFTRSSWGFAFQRESPLALDMSTAILKLAESGELQNIHEKWFC  809

Query  2226  rtsc-ssestelesDRLHLKSFW  2291
             +  C        + D+LHL SFW
Sbjct  810   KMGCPGERKRNSKPDQLHLSSFW  832


 Score =   337 bits (863),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 166/373 (45%), Positives = 234/373 (63%), Gaps = 5/373 (1%)
 Frame = +2

Query  65    ALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTTQSD  244
             A + ++  V AI+GPQSS +AH+IS +A+ + VPL+S+AATDPTL+SLQFP F RT QSD
Sbjct  88    AFQVLEQGVAAIIGPQSSAIAHSISQIADAVHVPLISYAATDPTLSSLQFPLFFRTIQSD  147

Query  245   MYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGATTR  424
               QM A+A++ID  GWKEVI +F+DDDYGRNGI+AL D L  +R K+++K  +       
Sbjct  148   SEQMAAMANLIDFNGWKEVIVIFLDDDYGRNGISALSDELEKRRLKLAHKLPLSIHYDLD  207

Query  425   AEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVLDSSS  604
              EI  +L Q  +   RV V+H  P     +FS+A  L MM   YVW++TDWLS    S S
Sbjct  208   -EITKLLNQSRVYSPRVFVVHVNPDPRLRIFSIARKLQMMTSDYVWLATDWLSATSHSFS  266

Query  605   PLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLTGG--SLGLNSYALYAYDSVWLIA  778
                   + I++GV+ LRQH PDS  KR F SRWK +  G  +  LNSY  +AYD+VW +A
Sbjct  267   SANQNSLSIVEGVVALRQHVPDSRKKRDFISRWKKMQKGVANTSLNSYGFFAYDTVWTVA  326

Query  779   HAIDSFLNKGGVISFS--NDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLTGQ  952
             H+ID +L     I+FS   ++ +   EG  +  E L +F GG  L+N LLQS+F GL+GQ
Sbjct  327   HSIDKYLKVYNNITFSLHENNMVPHTEGIGIQFEKLKVFAGGSDLVNILLQSNFRGLSGQ  386

Query  953   FKFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKLYG  1132
              +F++D++++   YD++N+       +G+W N+SG S  PPE L  +     S +QKL  
Sbjct  387   IRFSSDRNIISSGYDVININQMKINKVGYWSNHSGFSVLPPEVLAKKKHRRVSVDQKLGN  446

Query  1133  VVWPGQSVKKAPG  1171
             + WPG   ++  G
Sbjct  447   ITWPGGKTERPRG  459



>ref|XP_004238633.2| PREDICTED: glutamate receptor 3.3 [Solanum lycopersicum]
 ref|XP_010320472.1| PREDICTED: glutamate receptor 3.3 [Solanum lycopersicum]
 ref|XP_010320473.1| PREDICTED: glutamate receptor 3.3 [Solanum lycopersicum]
 ref|XP_010320474.1| PREDICTED: glutamate receptor 3.3 [Solanum lycopersicum]
 ref|XP_010320475.1| PREDICTED: glutamate receptor 3.3 [Solanum lycopersicum]
Length=945

 Score =   624 bits (1608),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/379 (77%), Positives = 334/379 (88%), Gaps = 1/379 (0%)
 Frame = +2

Query  56    LVAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTT  235
             +V ALKFM+TDVVA++GPQSSVVAHTISHVANELQVP LSFAATDPTL+SLQFPYFLRTT
Sbjct  103   MVGALKFMETDVVAVIGPQSSVVAHTISHVANELQVPFLSFAATDPTLSSLQFPYFLRTT  162

Query  236   QSDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGA  415
             QSD+YQM AIA++I+ Y WKEVIA+FIDDDYGRNG++ALDDALA +RC+ISYK GI PGA
Sbjct  163   QSDLYQMTAIAEIIEFYAWKEVIAIFIDDDYGRNGVSALDDALATRRCRISYKVGISPGA  222

Query  416   T-TRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVL  592
             T TR ++MD++V++ALMESRV+VLHAY   G MV SVAHYLGMMGDGYVWISTDWL+TVL
Sbjct  223   TVTRGDVMDVMVKVALMESRVIVLHAYRKLGLMVLSVAHYLGMMGDGYVWISTDWLTTVL  282

Query  593   DSSSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLTGGSLGLNSYALYAYDSVWL  772
             DSS PLP + M+ MQGVLVLRQHTP+S+ KRAF+SRW  LTGG LGLNSYAL+AYD+VWL
Sbjct  283   DSSPPLPQDTMDTMQGVLVLRQHTPESKNKRAFSSRWNKLTGGLLGLNSYALHAYDTVWL  342

Query  773   IAHAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLTGQ  952
             +AHAIDSF N+GG ISFSND+KLQ++EGS LHLEA+SIFDGGPLLL NLL+SDFVGLTG 
Sbjct  343   VAHAIDSFFNQGGTISFSNDTKLQTVEGSNLHLEAMSIFDGGPLLLKNLLESDFVGLTGP  402

Query  953   FKFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKLYG  1132
             FKF+ DKSL+ P+YDI+NVIGTGFR +G+W NYSGLS  PPET YSRPPN SS NQKLY 
Sbjct  403   FKFSPDKSLIRPAYDIINVIGTGFRRVGYWSNYSGLSILPPETYYSRPPNRSSTNQKLYS  462

Query  1133  VVWPGQSVKKAPGVGFPEQ  1189
             VVWPG +V+K  G  FP  
Sbjct  463   VVWPGNNVQKPRGWVFPNN  481


 Score =   613 bits (1582),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/419 (80%), Positives = 378/419 (90%), Gaps = 1/419 (0%)
 Frame = +3

Query  1146  GSR*KKPRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYA  1325
             G+  +KPRGWVFPNNGKQL+IGVPIRVSY+EF+SQ+PGTN FKGF +DVFTAAVNLLPYA
Sbjct  467   GNNVQKPRGWVFPNNGKQLKIGVPIRVSYREFVSQIPGTNNFKGFCIDVFTAAVNLLPYA  526

Query  1326  VPFQFVPFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVV  1505
             VP +FVP+GNG ENPSY+++VRL++ G FDG +GDIAIVTNRT+VVDFTQPY ASGL+VV
Sbjct  527   VPHKFVPYGNGHENPSYTDMVRLITIGKFDGVVGDIAIVTNRTRVVDFTQPYAASGLVVV  586

Query  1506  APFKKLNTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILW  1685
             APF+KLN+G WAFL PFSAQMWGV   FF+ VG+VVWILEHR+NDEFRG PKQQLITILW
Sbjct  587   APFEKLNSGGWAFLRPFSAQMWGVITIFFLFVGMVVWILEHRINDEFRGPPKQQLITILW  646

Query  1686  FSLSTLFFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESL  1865
             FSLSTLFFAHRENTVSTLGRMVLIIWLFVVLIINSSYTASLTSILTVQQLYSPIKG+ESL
Sbjct  647   FSLSTLFFAHRENTVSTLGRMVLIIWLFVVLIINSSYTASLTSILTVQQLYSPIKGIESL  706

Query  1866  KEGNDPIGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERP  2045
             KE ++PIGYQ+GSFAE YL EEIGI KSRL+ LGSPE YA AL++GP  GGV+A+VDERP
Sbjct  707   KETDEPIGYQVGSFAERYL-EEIGIPKSRLVPLGSPEEYATALQRGPANGGVAAVVDERP  765

Query  2046  YVENFLSTQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLt  2225
             YVE FLS QCKFRIVGQEFTKSGWGFAFPRDSPLAVD+STAIL+LSENGDLQRIHDKWL 
Sbjct  766   YVELFLSNQCKFRIVGQEFTKSGWGFAFPRDSPLAVDLSTAILTLSENGDLQRIHDKWLA  825

Query  2226  rtscssestelesDRLHLKSFWglfllcgaacflalfIYFVQIMLKFRRVARAEPVADG  2402
             R++CS ++ ELESDRLHL+SF GLFL+CG ACF+AL IYF+QI+ KF R + A   +DG
Sbjct  826   RSACSLDNAELESDRLHLRSFSGLFLICGIACFIALLIYFIQILRKFCRTSNAAVDSDG  884



>ref|XP_006342151.1| PREDICTED: glutamate receptor 3.3-like isoform X1 [Solanum tuberosum]
 ref|XP_006342152.1| PREDICTED: glutamate receptor 3.3-like isoform X2 [Solanum tuberosum]
 ref|XP_006342153.1| PREDICTED: glutamate receptor 3.3-like isoform X3 [Solanum tuberosum]
Length=946

 Score =   622 bits (1603),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/379 (77%), Positives = 332/379 (88%), Gaps = 1/379 (0%)
 Frame = +2

Query  56    LVAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTT  235
             +V ALKFM+TDVVA++GPQSSVVAHTISHVANELQVP LSFAATDPTL+ LQFPYFLRTT
Sbjct  101   MVGALKFMETDVVAVIGPQSSVVAHTISHVANELQVPFLSFAATDPTLSCLQFPYFLRTT  160

Query  236   QSDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGA  415
             QSD+YQM AIA++I+ Y WKEVIA+FIDDDYGRNG++ALD+ALA +RC+ISYKAGI PGA
Sbjct  161   QSDLYQMTAIAEIIEFYAWKEVIAIFIDDDYGRNGVSALDEALATRRCRISYKAGISPGA  220

Query  416   T-TRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVL  592
             T TR ++MD++V++ALMESRV+VLHAY   G MV SVAHYLGMMGDGYVWISTDWL+TVL
Sbjct  221   TVTRGDVMDVMVKVALMESRVIVLHAYRTLGLMVLSVAHYLGMMGDGYVWISTDWLTTVL  280

Query  593   DSSSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLTGGSLGLNSYALYAYDSVWL  772
             DSS PL  + M+ MQGVLVLRQHTPDSE KRAF+SRW  LTGG LGLNSYAL+AYD+VWL
Sbjct  281   DSSPPLLQDTMDTMQGVLVLRQHTPDSENKRAFSSRWNKLTGGLLGLNSYALHAYDTVWL  340

Query  773   IAHAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLTGQ  952
              AHAIDSF N+GG ISFSND+KLQS+EGS LHLEA+SIFDGGPLLL NLL+SDFVGLTG 
Sbjct  341   AAHAIDSFFNQGGTISFSNDTKLQSVEGSNLHLEAMSIFDGGPLLLKNLLESDFVGLTGP  400

Query  953   FKFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKLYG  1132
             FKF+ DKSL+ P+YDI+NVIGTGFR +G+W NYSGLS  PPET YSRPPN SS NQKLY 
Sbjct  401   FKFSPDKSLIRPAYDIINVIGTGFRRVGYWSNYSGLSILPPETFYSRPPNRSSTNQKLYS  460

Query  1133  VVWPGQSVKKAPGVGFPEQ  1189
             VVWPG +V+K  G  FP  
Sbjct  461   VVWPGNNVQKPRGWVFPNN  479


 Score =   613 bits (1581),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/419 (80%), Positives = 377/419 (90%), Gaps = 1/419 (0%)
 Frame = +3

Query  1146  GSR*KKPRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYA  1325
             G+  +KPRGWVFPNNGKQL+IGVPIRVSY+EF+SQ PGTN FKGF +DVFTAAVNLLPYA
Sbjct  465   GNNVQKPRGWVFPNNGKQLKIGVPIRVSYREFVSQSPGTNNFKGFCIDVFTAAVNLLPYA  524

Query  1326  VPFQFVPFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVV  1505
             VP +FVP+GNG ENPSY+++VRL++TG FDG +GD+AIVTNRT+VVDFTQPY ASGL+VV
Sbjct  525   VPHKFVPYGNGHENPSYTDMVRLITTGKFDGVVGDVAIVTNRTRVVDFTQPYAASGLVVV  584

Query  1506  APFKKLNTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILW  1685
             APF+KLN+G WAFL PFSAQMWGV   FF+ VG+VVWILEHR NDEFRG PKQQLITILW
Sbjct  585   APFQKLNSGGWAFLRPFSAQMWGVITIFFLFVGMVVWILEHRTNDEFRGPPKQQLITILW  644

Query  1686  FSLSTLFFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESL  1865
             FSLSTLFFAHRENTVSTLGRMVLIIWLFVVLIINSSYTASLTSILTVQQLYSPIKG+ESL
Sbjct  645   FSLSTLFFAHRENTVSTLGRMVLIIWLFVVLIINSSYTASLTSILTVQQLYSPIKGIESL  704

Query  1866  KEGNDPIGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERP  2045
             KE ++PIGYQ+GSFAE YL EEIGI KSRL+ LGSPE YA AL++GP KGGVSA+VDERP
Sbjct  705   KETDEPIGYQVGSFAERYL-EEIGIPKSRLVPLGSPEEYATALQRGPAKGGVSAVVDERP  763

Query  2046  YVENFLSTQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLt  2225
             YVE FLS QCKFRIVGQEFTKSGWGFAFPRDSPLAVD+STAIL+LSENGDLQRIHDKWL 
Sbjct  764   YVELFLSNQCKFRIVGQEFTKSGWGFAFPRDSPLAVDLSTAILTLSENGDLQRIHDKWLA  823

Query  2226  rtscssestelesDRLHLKSFWglfllcgaacflalfIYFVQIMLKFRRVARAEPVADG  2402
             R++CS ++ ELESDRLHL+SF GLFL+CG ACF+AL IYF+QI+ KF + + A    DG
Sbjct  824   RSACSLDNAELESDRLHLRSFSGLFLICGIACFIALLIYFIQILRKFCQTSNAAVDMDG  882



>gb|AFW69068.1| hypothetical protein ZEAMMB73_591659 [Zea mays]
Length=922

 Score =   418 bits (1074),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 205/379 (54%), Positives = 261/379 (69%), Gaps = 4/379 (1%)
 Frame = +2

Query  59    VAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTTQ  238
             + AL+ M+ +VVA++GPQSS + H IS V NEL VPLLSFAATDPTL++ ++PYFLRTT 
Sbjct  89    IKALELMEKNVVAVIGPQSSGIGHAISQVVNELHVPLLSFAATDPTLSASEYPYFLRTTT  148

Query  239   SDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGAT  418
             SD +QM A+A ++D+Y WK V AV+IDD+YGR G++AL DALA KR ++SYKA IPP + 
Sbjct  149   SDYFQMNAVASIVDYYQWKRVTAVYIDDEYGRGGVSALGDALALKRAQVSYKATIPPNSN  208

Query  419   TRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVLDS  598
             T   I D+L +  +MESRVMV+H  P  G  VFS A  L MM  GYVWI TDWL+ VLDS
Sbjct  209   TDV-IRDVLFKANMMESRVMVVHVNPDTGLRVFSAAKKLQMMASGYVWIVTDWLAAVLDS  267

Query  599   SSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLTGG---SLGLNSYALYAYDSVW  769
             S+    + M  +QGV+VLRQHTPDS+ K  F SRW ++      + GLNSY  YAYDSVW
Sbjct  268   SASRNPKYMSNIQGVIVLRQHTPDSDAKNKFISRWNNVARNRSMTPGLNSYGFYAYDSVW  327

Query  770   LIAHAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLTG  949
              +A ++D FLN G  I+FS D +L    G+TL L  L IFDGG  +L  LL ++F GLTG
Sbjct  328   AVARSVDQFLNAGNQINFSTDPRLHDPNGTTLRLSTLKIFDGGDQMLQQLLLTNFTGLTG  387

Query  950   QFKFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKLY  1129
               KF++  +L+ P+YDILNV  +G   IG+W NYSGLS A PE LY   PN+S++  +L 
Sbjct  388   AVKFDSGGNLLHPAYDILNVGRSGTHLIGYWSNYSGLSVAAPEILYQMSPNASTSTHQLN  447

Query  1130  GVVWPGQSVKKAPGVGFPE  1186
              VVWPG S     G  FP 
Sbjct  448   SVVWPGDSTDIPRGWVFPN  466


 Score =   320 bits (821),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 187/410 (46%), Positives = 268/410 (65%), Gaps = 7/410 (2%)
 Frame = +3

Query  1164  PRGWVFPNNGKQLRIGVPIRVSYKEFIS-QVPGTNTFKGFSVDVFTAAVNLLPYAVPFQF  1340
             PRGWVFPN+G+ LR+GVP++ S+K  +S   P  ++ +G+ +DVF +A+ LLPY VP+QF
Sbjct  459   PRGWVFPNDGQPLRVGVPVKPSFKALVSGSTP--DSVRGYCIDVFKSAIKLLPYPVPYQF  516

Query  1341  VPFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPFKK  1520
             +P G+G +NPSY  +V +V++   D A+GD AIV N T++ ++TQPY+ SGL++VAP   
Sbjct  517   IPIGDGTKNPSYVSIVGMVASNTLDAAVGDFAIVRNGTRLAEYTQPYIDSGLVIVAPTVN  576

Query  1521  LNTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSLST  1700
             +       +   S    G          +               SP+    T L   L  
Sbjct  577   MIPDMILVVYKLSDPRHGSEMGACDTTSMSFARAHAPNQTHGSASPQCSSHTKL---LDE  633

Query  1701  LFFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESLKEGND  1880
                   ENT + LGR VLIIW+FVVLII SSYTASLTSILTVQQL + I G++SL   + 
Sbjct  634   KLSPSEENTRTALGRFVLIIWMFVVLIITSSYTASLTSILTVQQLATGITGLDSLISSSL  693

Query  1881  PIGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERPYVENF  2060
             PIGYQ G F + YL+  + + +SRL+ L + E YA+AL +GP  GGV+AI+DE+PY++ F
Sbjct  694   PIGYQTGKFTKKYLMLNLNVPESRLVQLNTIEEYADALNRGPKNGGVAAIIDEKPYIDIF  753

Query  2061  LSTQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLtr-tsc  2237
             LS  C F+IVGQ+FT+ GWGFAF +DSPLA DMSTAIL LSE+G LQ IHD+W T+ +  
Sbjct  754   LSHYCNFKIVGQQFTREGWGFAFQKDSPLAADMSTAILQLSESGQLQSIHDEWFTQPSCA  813

Query  2238  ssestelesDRLHLKSFWglfllcgaacflalfIYFVQIMLKFRRVARAE  2387
             +++ + + + RL L SFWGLFL+C   C  A+ ++F+++  ++++ + +E
Sbjct  814   TNDESNVGATRLGLGSFWGLFLICALICLFAVVVFFIRVCWQYKQYSNSE  863



>gb|KDO41665.1| hypothetical protein CISIN_1g003633mg [Citrus sinensis]
 gb|KDO41666.1| hypothetical protein CISIN_1g003633mg [Citrus sinensis]
Length=806

 Score =   405 bits (1040),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 220/415 (53%), Positives = 302/415 (73%), Gaps = 1/415 (0%)
 Frame = +3

Query  1146  GSR*KKPRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYA  1325
             G + + PRGWV  +N + LRIGVP R S+  F+++   ++  +G+ +D+   A+ L+PY 
Sbjct  340   GGKTETPRGWVIADNARPLRIGVPRRASFVGFVTEEHDSHKVQGYCIDILLEALKLVPYD  399

Query  1326  VPFQFVPFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVV  1505
             VP++F  FG+G  NPSY  LV++V+   FD A+GDIAIVTNRTK+VDF+QPY+++GL++V
Sbjct  400   VPYKFELFGDGLSNPSYDGLVKMVANDVFDAAVGDIAIVTNRTKIVDFSQPYISTGLVIV  459

Query  1506  APFKKLNTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILW  1685
             AP       AW FL PF+ +MW VTA  FV++ +V+WILEHR+ND+FRG P++Q+ T+  
Sbjct  460   APINNHKASAWVFLKPFTVEMWCVTAASFVMIAVVIWILEHRVNDDFRGPPRRQIATMFL  519

Query  1686  FSLSTLFFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESL  1865
             FS STLF  ++E TVS+LGR V+++WLF++++I SSYTASL+SILTVQQL + +KG+ESL
Sbjct  520   FSFSTLFKTNQEATVSSLGRFVMVVWLFLLMVITSSYTASLSSILTVQQLSTSVKGIESL  579

Query  1866  KEGNDPIGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERP  2045
                + PIGYQ+GSFA  YL + + I KSRLI+LGSPE Y  AL +GP  GGV+AIVDE P
Sbjct  580   ITNDWPIGYQVGSFAYSYLSDSLRIQKSRLISLGSPEDYERALRQGPRNGGVAAIVDELP  639

Query  2046  YVENFLSTQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLt  2225
             YV+ FLS Q  F I+GQ FT+SGWGFAF RDSPLAV MSTAIL LSENG LQ++H+KW  
Sbjct  640   YVQLFLSNQTDFGIIGQPFTRSGWGFAFQRDSPLAVGMSTAILKLSENGMLQKLHEKWFC  699

Query  2226  rtsc-ssestelesDRLHLKSFWglfllcgaacflalfIYFVQIMLKFRRVARAE  2387
             +  C        E  +L L SFWGL+LLCG   F A  ++ ++++ ++ R  + +
Sbjct  700   KEGCPEERRQHSEPHQLRLISFWGLYLLCGTITFTAFLVFLLRMVCQYVRYKQQQ  754


 Score =   331 bits (849),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 165/349 (47%), Positives = 227/349 (65%), Gaps = 5/349 (1%)
 Frame = +2

Query  134   ISHVANELQVPLLSFAATDPTLASLQFPYFLRTTQSDMYQMMAIADVIDHYGWKEVIAVF  313
             IS VAN L+VPL+SFAATDPTL++LQFPYF+R+TQSD  QM A+AD+ID YGWKEVIA++
Sbjct  2     ISEVANGLKVPLVSFAATDPTLSALQFPYFIRSTQSDSQQMAAMADLIDFYGWKEVIAIY  61

Query  314   IDDDYGRNGIAALDDALAAKRCKISYKAGIPPGATTRAEIMDILVQIALMESRVMVLHAY  493
             +DDDYGRNGI+AL + L     K+SYK  +P     + +I  +L     +  RV V+H  
Sbjct  62    VDDDYGRNGISALSNMLEKNMAKVSYKLPLPV-QFNQHDITVLLNNSKPLGPRVYVVHVS  120

Query  494   PAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVLDSSSPLPSEKMEIMQGVLVLRQHTPDS  673
             P  G  +F+ A  L MM + YVW++TDWLS  L+S S +    + I+QGV+ LRQHTPDS
Sbjct  121   PDPGLRIFTTAQKLQMMTNNYVWLATDWLSATLESFSKMNQTSLRILQGVVGLRQHTPDS  180

Query  674   ELKRAFTSRWKHLTGGSL---GLNSYALYAYDSVWLIAHAIDSFLNKGGVISFSNDSKLQ  844
               K+AF SRW  +    L   GLN+Y LYAYD+VW +A +ID F+N+   I+FS   +L 
Sbjct  181   IPKKAFLSRWSGMQQKGLVSAGLNTYGLYAYDTVWAVARSIDKFINEHN-ITFSASHELP  239

Query  845   SIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLTGQFKFNNDKSLVLPSYDILNVIGTGF  1024
               + + + LE L +FDGG  LL  LLQ++F GL+GQ +FN D+++V   YD++N+     
Sbjct  240   DSKATRVQLEQLKVFDGGTFLLRKLLQTNFTGLSGQVQFNQDRNIVSRGYDVINIDKMEI  299

Query  1025  RTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKLYGVVWPGQSVKKAPG  1171
               +G+W + SG S  PPETL  +  + S  + KL  + WPG   +   G
Sbjct  300   HRVGYWFDGSGFSVLPPETLKGKNVSHSQLDWKLQNITWPGGKTETPRG  348



>ref|XP_008455424.1| PREDICTED: glutamate receptor 3.7 isoform X1 [Cucumis melo]
Length=933

 Score =   407 bits (1047),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 216/383 (56%), Positives = 285/383 (74%), Gaps = 1/383 (0%)
 Frame = +3

Query  1146  GSR*KKPRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYA  1325
             G + + PRGWV  ++GK LRI  P R S+ +F++Q+  TN  +G+ +D+F  A+  +PY 
Sbjct  441   GGKKEIPRGWVIADSGKPLRIAFPRRASFVDFVTQLNNTNIVQGYVIDIFKEALKFVPYE  500

Query  1326  VPFQFVPFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVV  1505
             VP++FVPFG+G+ NPSY ELV+ V+   FD A+GDIAI+TNRTKVVDF+QPY  +GL++V
Sbjct  501   VPYKFVPFGDGKVNPSYDELVQSVANNVFDAAVGDIAIITNRTKVVDFSQPYTTTGLIIV  560

Query  1506  APFKKLNTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILW  1685
             AP +   + AW FL PF+ +MW  TA  FVV+GIV+W+LEHR+ND FRG PK+Q+IT+  
Sbjct  561   APVEDSKSSAWVFLKPFTVEMWCATAGSFVVIGIVIWMLEHRINDHFRGPPKRQIITMCL  620

Query  1686  FSLSTLFFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESL  1865
             FS STLF A++E T+S L R+V+++WLF++L+I SSYTASLTSILT+QQL+SPI+G++ L
Sbjct  621   FSFSTLFKANQEATISPLSRLVMLVWLFLLLVITSSYTASLTSILTLQQLWSPIRGIDDL  680

Query  1866  KEGNDPIGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERP  2045
                N PIGYQ+GSFA  YL + + I  SRL+ L SPE Y +AL  GP  GGV+AI+DE P
Sbjct  681   VASNLPIGYQVGSFAYDYLTQSLFIPSSRLLRLDSPEDYEKALRLGPKGGGVAAIIDELP  740

Query  2046  YVENFLSTQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLt  2225
             Y+E FLS   +F I+GQ FT+SGWGFAF R S LAVDMSTAIL LSE+G LQ IHD W  
Sbjct  741   YLELFLSNTKEFGIIGQPFTRSGWGFAFQRGSRLAVDMSTAILKLSESGKLQEIHDSWFC  800

Query  2226  rtsc-ssestelesDRLHLKSFW  2291
             +  C  +   + E D+LHL SFW
Sbjct  801   KLGCPGNRGGKSEPDQLHLISFW  823


 Score =   322 bits (825),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 168/368 (46%), Positives = 234/368 (64%), Gaps = 20/368 (5%)
 Frame = +2

Query  59    VAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTTQ  238
             V AL+ ++ ++VA++GPQSSVVAH IS + N LQ+P +S+AATDPTL++LQ PYFLRTT 
Sbjct  89    VGALQVLEKEIVALIGPQSSVVAHVISQIVNGLQIPQVSYAATDPTLSTLQLPYFLRTTI  148

Query  239   SDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGAT  418
             SD YQM A+AD+ID+YGWKEVIA+F+DDDYGRNGI+ L D L  K C+IS+   + P   
Sbjct  149   SDSYQMAAMADLIDYYGWKEVIAIFLDDDYGRNGISFLGDELQKKMCRISHAFPL-PSLD  207

Query  419   TRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVLDS  598
                +I  IL    L+  RV V+H  P     +F++AH LGM+   YVW +TDWLST LDS
Sbjct  208   NLTKITQILDNSKLLGPRVYVVHVGPDPQLRIFTIAHKLGMLSSNYVWFATDWLSTTLDS  267

Query  599   SSPLP-SEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLTGGSL---GLNSYALYAYDSV  766
             SSP+     ++++ G++ LR HTP+S+ KR   +R   +    L    LN Y LYAYDSV
Sbjct  268   SSPITIGASLDMLNGIVGLRPHTPESKGKRDLWNRISKMQPKGLTNSALNVYGLYAYDSV  327

Query  767   WLIAHAIDSFLNKGG-VISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGL  943
             W++A A+D FL + G +++FS   K+     S + L  + +FD G  LL  L+Q+D+ GL
Sbjct  328   WIVAKAVDKFLKENGTIVTFSPTGKVFGSNESGIQLGKVKVFDRGSDLLRILMQTDYNGL  387

Query  944   TGQFKFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQK  1123
             +G+ +F  D+S+V  SYD++N+     + +G W N S                 S  +QK
Sbjct  388   SGRIQFGEDRSVVNGSYDVININQRKMKLVGHWSNDSRF--------------HSYLDQK  433

Query  1124  LYGVVWPG  1147
             L  VVWPG
Sbjct  434   LENVVWPG  441



>ref|XP_002459200.1| hypothetical protein SORBIDRAFT_02g000440 [Sorghum bicolor]
 gb|EER95721.1| hypothetical protein SORBIDRAFT_02g000440 [Sorghum bicolor]
Length=977

 Score =   411 bits (1057),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 235/409 (57%), Positives = 296/409 (72%), Gaps = 4/409 (1%)
 Frame = +3

Query  1164  PRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGT-NTFKGFSVDVFTAAVNLLPYAVPFQF  1340
             PRGWVF +NG  LR+GVP R S  EF+S+   + +   G+ +DVF AA+  LPY VP  F
Sbjct  490   PRGWVFADNGTPLRVGVPYRTSDTEFVSKDDTSKDGVSGYCIDVFEAALQQLPYPVPVSF  549

Query  1341  VPFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPFKK  1520
             V FG+G  +PSY ELV+ V+ G+FD A+GDI+IVTNRT+VVDFTQPY+ SGL++V+  K 
Sbjct  550   VLFGDGVTSPSYDELVQKVADGFFDAAVGDISIVTNRTRVVDFTQPYIDSGLVIVSTVKS  609

Query  1521  LNTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSLST  1700
              ++  WAFL PF+ ++WG      V VG V+WILEHR N+EFRGS   Q+ T+ WFS S 
Sbjct  610   SSSDEWAFLKPFTPELWGTFVAMCVFVGAVIWILEHRHNEEFRGSLWNQMRTLFWFSFSA  669

Query  1701  LFFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESLKEGND  1880
             +FF  RE T+S+LGR V+I+WL VVLII  SYTASLTSILTVQQL + I+G+  L   ND
Sbjct  670   IFFTQREETISSLGRFVVIMWLVVVLIITQSYTASLTSILTVQQLSTGIQGINDLLASND  729

Query  1881  PIGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERPYVENF  2060
             PIGYQ GSFA  YLI E+G+  SRL  L + E YA+ L++GP  GGV AIVDE PYVE F
Sbjct  730   PIGYQQGSFAGSYLINELGVKASRLREL-AIEEYADRLQRGPRDGGVVAIVDELPYVELF  788

Query  2061  LSTQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLtrtscs  2240
             LS+ C+F +VGQEFTK GWGFAFP +SPLAVD+STAIL LSE GDLQRIHD WL + +C 
Sbjct  789   LSSNCQFTMVGQEFTKGGWGFAFPHESPLAVDLSTAILKLSETGDLQRIHDNWLNQGTCD  848

Query  2241  sestelesD--RLHLKSFWglfllcgaacflalfIYFVQIMLKFRRVAR  2381
             ++S        RL + +F GLFL+CG AC +AL IYF +I+ +F +  R
Sbjct  849   TQSQGTGGGALRLSVANFGGLFLICGVACGVALLIYFARILFQFYQYHR  897


 Score =   318 bits (814),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 168/365 (46%), Positives = 235/365 (64%), Gaps = 28/365 (8%)
 Frame = +2

Query  62    AALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTTQS  241
             A ++ M+ +VVA++GP+SSV+AH +S+VANEL+VPL+SFAATDP LAS Q+PY +R    
Sbjct  95    AGMELMEKEVVAVVGPESSVIAHVVSNVANELRVPLVSFAATDPALASSQYPYLVRAVHD  154

Query  242   DMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGATT  421
             D +QM A+AD++  YGW+EV AV++DDDYGR G+AAL DAL   R +++YK   P GA  
Sbjct  155   DRFQMAAVADIVSLYGWREVTAVYVDDDYGRGGVAALTDALQPTRARVTYKTAFPRGA-D  213

Query  422   RAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVLDSS  601
             RA + ++L     MESRV V+HA P +G  VF+ AH LGMM   Y WI+TDW +      
Sbjct  214   RATLANLLQLANSMESRVFVVHASPDSGLDVFAAAHDLGMMVAEYAWIATDWFAAAAIDG  273

Query  602   SPLPSEKM--EIMQGVLVLRQHTPDSELKRAFTSRWKHLTGGSL----------GLNSYA  745
             +P  + +    I+QGVL LRQ+ PDS+ K +  SR   L G ++            N+Y+
Sbjct  274   APAAASESNNNIIQGVLTLRQYIPDSDAKASLVSR---LAGAAIPPSSNNDATVAANAYS  330

Query  746   LYAYDSVWLIAHAIDSFLNK-GGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLL  922
             L+AYDSVW+ AHAID FL++  G ++FS D  ++   GS L L AL +FD G  LL  ++
Sbjct  331   LFAYDSVWIAAHAIDQFLDEAAGNVTFSADPNIRDANGSALRLSALRVFDQGDQLLRKVM  390

Query  923   QSDFVGLTGQ--FKFNND-------KSLVLPSYDILNVIG--TGFRTIGFWCNYSGLSTA  1069
              ++F G+TGQ  F+F+ D        +L+ P+Y+ILNV G  TG R + +W NY+ LS  
Sbjct  391   LANFTGVTGQVAFQFDADGNNGTGSGTLINPAYEILNVAGGNTGVRRVAYWSNYTRLSVD  450

Query  1070  PPETL  1084
              P  L
Sbjct  451   APTLL  455



>ref|XP_008455425.1| PREDICTED: glutamate receptor 3.7 isoform X2 [Cucumis melo]
Length=862

 Score =   407 bits (1046),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 216/383 (56%), Positives = 285/383 (74%), Gaps = 1/383 (0%)
 Frame = +3

Query  1146  GSR*KKPRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYA  1325
             G + + PRGWV  ++GK LRI  P R S+ +F++Q+  TN  +G+ +D+F  A+  +PY 
Sbjct  370   GGKKEIPRGWVIADSGKPLRIAFPRRASFVDFVTQLNNTNIVQGYVIDIFKEALKFVPYE  429

Query  1326  VPFQFVPFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVV  1505
             VP++FVPFG+G+ NPSY ELV+ V+   FD A+GDIAI+TNRTKVVDF+QPY  +GL++V
Sbjct  430   VPYKFVPFGDGKVNPSYDELVQSVANNVFDAAVGDIAIITNRTKVVDFSQPYTTTGLIIV  489

Query  1506  APFKKLNTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILW  1685
             AP +   + AW FL PF+ +MW  TA  FVV+GIV+W+LEHR+ND FRG PK+Q+IT+  
Sbjct  490   APVEDSKSSAWVFLKPFTVEMWCATAGSFVVIGIVIWMLEHRINDHFRGPPKRQIITMCL  549

Query  1686  FSLSTLFFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESL  1865
             FS STLF A++E T+S L R+V+++WLF++L+I SSYTASLTSILT+QQL+SPI+G++ L
Sbjct  550   FSFSTLFKANQEATISPLSRLVMLVWLFLLLVITSSYTASLTSILTLQQLWSPIRGIDDL  609

Query  1866  KEGNDPIGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERP  2045
                N PIGYQ+GSFA  YL + + I  SRL+ L SPE Y +AL  GP  GGV+AI+DE P
Sbjct  610   VASNLPIGYQVGSFAYDYLTQSLFIPSSRLLRLDSPEDYEKALRLGPKGGGVAAIIDELP  669

Query  2046  YVENFLSTQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLt  2225
             Y+E FLS   +F I+GQ FT+SGWGFAF R S LAVDMSTAIL LSE+G LQ IHD W  
Sbjct  670   YLELFLSNTKEFGIIGQPFTRSGWGFAFQRGSRLAVDMSTAILKLSESGKLQEIHDSWFC  729

Query  2226  rtsc-ssestelesDRLHLKSFW  2291
             +  C  +   + E D+LHL SFW
Sbjct  730   KLGCPGNRGGKSEPDQLHLISFW  752


 Score =   320 bits (820),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 167/367 (46%), Positives = 233/367 (63%), Gaps = 20/367 (5%)
 Frame = +2

Query  62    AALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTTQS  241
             A L+ ++ ++VA++GPQSSVVAH IS + N LQ+P +S+AATDPTL++LQ PYFLRTT S
Sbjct  19    APLEVLEKEIVALIGPQSSVVAHVISQIVNGLQIPQVSYAATDPTLSTLQLPYFLRTTIS  78

Query  242   DMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGATT  421
             D YQM A+AD+ID+YGWKEVIA+F+DDDYGRNGI+ L D L  K C+IS+   + P    
Sbjct  79    DSYQMAAMADLIDYYGWKEVIAIFLDDDYGRNGISFLGDELQKKMCRISHAFPL-PSLDN  137

Query  422   RAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVLDSS  601
               +I  IL    L+  RV V+H  P     +F++AH LGM+   YVW +TDWLST LDSS
Sbjct  138   LTKITQILDNSKLLGPRVYVVHVGPDPQLRIFTIAHKLGMLSSNYVWFATDWLSTTLDSS  197

Query  602   SPLP-SEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLTGGSL---GLNSYALYAYDSVW  769
             SP+     ++++ G++ LR HTP+S+ KR   +R   +    L    LN Y LYAYDSVW
Sbjct  198   SPITIGASLDMLNGIVGLRPHTPESKGKRDLWNRISKMQPKGLTNSALNVYGLYAYDSVW  257

Query  770   LIAHAIDSFLNKGG-VISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLT  946
             ++A A+D FL + G +++FS   K+     S + L  + +FD G  LL  L+Q+D+ GL+
Sbjct  258   IVAKAVDKFLKENGTIVTFSPTGKVFGSNESGIQLGKVKVFDRGSDLLRILMQTDYNGLS  317

Query  947   GQFKFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKL  1126
             G+ +F  D+S+V  SYD++N+     + +G W N S                 S  +QKL
Sbjct  318   GRIQFGEDRSVVNGSYDVININQRKMKLVGHWSNDSRF--------------HSYLDQKL  363

Query  1127  YGVVWPG  1147
               VVWPG
Sbjct  364   ENVVWPG  370



>ref|XP_004144586.1| PREDICTED: glutamate receptor 3.7-like [Cucumis sativus]
 gb|KGN43530.1| hypothetical protein Csa_7G044210 [Cucumis sativus]
Length=935

 Score =   404 bits (1038),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 216/383 (56%), Positives = 284/383 (74%), Gaps = 1/383 (0%)
 Frame = +3

Query  1146  GSR*KKPRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYA  1325
             G + + PRGWV  ++GK LRI  P R S+ +F++Q+  TN  +G+ +D+F  A+  +PY 
Sbjct  441   GGKEEIPRGWVIADSGKPLRIAFPRRASFVDFVTQLNNTNIVRGYVIDIFKEALKFVPYE  500

Query  1326  VPFQFVPFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVV  1505
             VP++FVPFG+G+ NPSY ELV+ V+   FD A+GDIAIVTNRTKVVDF+QPY  +GL++V
Sbjct  501   VPYKFVPFGDGKVNPSYDELVQSVANNVFDAAVGDIAIVTNRTKVVDFSQPYTTTGLIIV  560

Query  1506  APFKKLNTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILW  1685
             AP +   + AW FL PF+ +MW  TA  FVV+GIV+W+LEHR+ND FRG PK+Q+IT+  
Sbjct  561   APVEDSKSSAWVFLKPFTVEMWCATAGSFVVIGIVIWMLEHRINDHFRGPPKRQIITMCL  620

Query  1686  FSLSTLFFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESL  1865
             FS+STLF A++E T+S L R+V+++WLF++L+I SSYTASLTSILT+QQL+SPI+G++ L
Sbjct  621   FSISTLFKANQEATISPLSRLVMLVWLFLLLVITSSYTASLTSILTLQQLWSPIRGIDDL  680

Query  1866  KEGNDPIGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERP  2045
                N PIGYQ+GSFA  YL + + I  SRL  L S E Y +AL  GP  GGV+AI+DE P
Sbjct  681   VASNLPIGYQVGSFAYDYLTQSLFIPSSRLQRLNSSEDYEKALRLGPKGGGVAAIIDELP  740

Query  2046  YVENFLSTQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLt  2225
             Y+E FLS   +F I+GQ FT+SGWGFAF R S LAVDMSTAIL LSE+G LQ IHD W  
Sbjct  741   YLELFLSKTKEFGIIGQPFTRSGWGFAFQRGSRLAVDMSTAILKLSESGKLQEIHDSWFC  800

Query  2226  rtsc-ssestelesDRLHLKSFW  2291
             +  C  +   + E D+LHL SFW
Sbjct  801   KLGCPGNRGGKSEPDQLHLISFW  823


 Score =   322 bits (826),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 169/368 (46%), Positives = 236/368 (64%), Gaps = 20/368 (5%)
 Frame = +2

Query  59    VAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTTQ  238
             V AL+ ++ ++VA++GPQSSVVAH IS + N LQ+PL+S+AATDPTL++LQ P+FLRTT 
Sbjct  89    VQALQVLEKEIVAMIGPQSSVVAHVISQIVNGLQIPLVSYAATDPTLSTLQLPFFLRTTI  148

Query  239   SDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGAT  418
             SD YQM A+AD+ID+YGWKEVI +F+DDDYGRNGI+ L D L  K C+IS+   + P   
Sbjct  149   SDSYQMAAMADLIDYYGWKEVIVIFLDDDYGRNGISFLGDELQKKMCRISHAFPL-PSLD  207

Query  419   TRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVLDS  598
               ++I  IL    L+  RV V+H  P     +F++AH LGM+   YVW +TDWLST LDS
Sbjct  208   NLSKITQILNNSKLLGPRVYVVHVGPDPQLRIFTIAHKLGMLSSNYVWFATDWLSTTLDS  267

Query  599   SSPLPS-EKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLTGGSL---GLNSYALYAYDSV  766
             SSP+ +   ++++ GV+ LR HTP+S+ KR    R + +    L    LN Y LYAYDSV
Sbjct  268   SSPITNGASLDMLNGVVGLRPHTPESKGKRDLWDRLRKMQPKGLTNSALNVYGLYAYDSV  327

Query  767   WLIAHAIDSFLNK-GGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGL  943
             W++A A+D FL + G +I+FS   K+     S + L  + +FD G  LL  L+Q+D+ GL
Sbjct  328   WVVAKAVDKFLKENGNIITFSPTGKVLGSNESGIQLGNVKVFDRGSDLLKILMQTDYNGL  387

Query  944   TGQFKFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQK  1123
             +G+ +F  D+S+V  SYD++N+       +G W N           L   P    + +QK
Sbjct  388   SGRIQFGEDRSVVNGSYDVININQRKMNLVGHWSN----------DLRFHP----NLDQK  433

Query  1124  LYGVVWPG  1147
             L  VVWPG
Sbjct  434   LEKVVWPG  441



>ref|XP_004164856.1| PREDICTED: LOW QUALITY PROTEIN: glutamate receptor 3.7-like [Cucumis 
sativus]
Length=882

 Score =   404 bits (1038),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 216/383 (56%), Positives = 284/383 (74%), Gaps = 1/383 (0%)
 Frame = +3

Query  1146  GSR*KKPRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYA  1325
             G + + PRGWV  ++GK LRI  P R S+ +F++Q+  TN  +G+ +D+F  A+  +PY 
Sbjct  388   GGKEEIPRGWVIADSGKPLRIAFPRRASFVDFVTQLNNTNIVRGYVIDIFKEALKFVPYE  447

Query  1326  VPFQFVPFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVV  1505
             VP++FVPFG+G+ NPSY ELV+ V+   FD A+GDIAIVTNRTKVVDF+QPY  +GL++V
Sbjct  448   VPYKFVPFGDGKVNPSYDELVQSVANNVFDAAVGDIAIVTNRTKVVDFSQPYTTTGLIIV  507

Query  1506  APFKKLNTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILW  1685
             AP +   + AW FL PF+ +MW  TA  FVV+GIV+W+LEHR+ND FRG PK+Q+IT+  
Sbjct  508   APVEDSKSSAWVFLKPFTVEMWCATAGSFVVIGIVIWMLEHRINDHFRGPPKRQIITMCL  567

Query  1686  FSLSTLFFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESL  1865
             FS+STLF A++E T+S L R+V+++WLF++L+I SSYTASLTSILT+QQL+SPI+G++ L
Sbjct  568   FSISTLFKANQEATISPLSRLVMLVWLFLLLVITSSYTASLTSILTLQQLWSPIRGIDDL  627

Query  1866  KEGNDPIGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERP  2045
                N PIGYQ+GSFA  YL + + I  SRL  L S E Y +AL  GP  GGV+AI+DE P
Sbjct  628   VASNLPIGYQVGSFAYDYLTQSLFIPSSRLQRLNSSEDYEKALRLGPKGGGVAAIIDELP  687

Query  2046  YVENFLSTQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLt  2225
             Y+E FLS   +F I+GQ FT+SGWGFAF R S LAVDMSTAIL LSE+G LQ IHD W  
Sbjct  688   YLELFLSKTKEFGIIGQPFTRSGWGFAFQRGSRLAVDMSTAILKLSESGKLQEIHDSWFC  747

Query  2226  rtsc-ssestelesDRLHLKSFW  2291
             +  C  +   + E D+LHL SFW
Sbjct  748   KLGCPGNRGGKSEPDQLHLISFW  770


 Score =   321 bits (823),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 169/368 (46%), Positives = 236/368 (64%), Gaps = 20/368 (5%)
 Frame = +2

Query  59    VAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTTQ  238
             V AL+ ++ ++VA++GPQSSVVAH IS + N LQ+PL+S+AATDPTL++LQ P+FLRTT 
Sbjct  36    VQALQVLEKEIVAMIGPQSSVVAHVISQIVNGLQIPLVSYAATDPTLSTLQXPFFLRTTI  95

Query  239   SDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGAT  418
             SD YQM A+AD+ID+YGWKEVI +F+DDDYGRNGI+ L D L  K C+IS+   + P   
Sbjct  96    SDSYQMAAMADLIDYYGWKEVIVIFLDDDYGRNGISFLGDELQKKMCRISHAFPL-PSLD  154

Query  419   TRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVLDS  598
               ++I  IL    L+  RV V+H  P     +F++AH LGM+   YVW +TDWLST LDS
Sbjct  155   NLSKITQILNNSKLLGPRVYVVHVGPDPQLRIFTIAHKLGMLSSNYVWFATDWLSTTLDS  214

Query  599   SSPLPS-EKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLTGGSL---GLNSYALYAYDSV  766
             SSP+ +   ++++ GV+ LR HTP+S+ KR    R + +    L    LN Y LYAYDSV
Sbjct  215   SSPITNGASLDMLNGVVGLRPHTPESKGKRDLWDRLRKMQPKGLTNSALNVYGLYAYDSV  274

Query  767   WLIAHAIDSFLNK-GGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGL  943
             W++A A+D FL + G +I+FS   K+     S + L  + +FD G  LL  L+Q+D+ GL
Sbjct  275   WVVAKAVDKFLKENGNIITFSPTGKVLGSNESGIQLGNVKVFDRGSDLLKILMQTDYNGL  334

Query  944   TGQFKFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQK  1123
             +G+ +F  D+S+V  SYD++N+       +G W N           L   P    + +QK
Sbjct  335   SGRIQFGEDRSVVNGSYDVININQRKMNLVGHWSN----------DLRFHP----NLDQK  380

Query  1124  LYGVVWPG  1147
             L  VVWPG
Sbjct  381   LEKVVWPG  388



>ref|XP_007045629.1| Glutamate receptor isoform 3 [Theobroma cacao]
 gb|EOY01461.1| Glutamate receptor isoform 3 [Theobroma cacao]
Length=723

 Score =   366 bits (939),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 174/372 (47%), Positives = 248/372 (67%), Gaps = 4/372 (1%)
 Frame = +2

Query  65    ALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTTQSD  244
             A + ++ +VVAI+GPQSS +AH IS +AN LQVP +S+AATDPTL++LQFP+FLRT QSD
Sbjct  31    AFQVIEKEVVAIIGPQSSSIAHIISAIANGLQVPQVSYAATDPTLSALQFPFFLRTVQSD  90

Query  245   MYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGATTR  424
               QM+A+AD+ID YGWKEVIA+++DDDYGRNGI+ L++ L  +  K  YK  +P     +
Sbjct  91    SNQMIAMADLIDFYGWKEVIAIYVDDDYGRNGISVLNNELDRRMAKAFYKLPLP-AHFAQ  149

Query  425   AEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVLDSSS  604
             ++I+ +L    L+  RV V+H  P     +F+ A  L MM   YVW++TDWLS  +DS S
Sbjct  150   SDIISLLNNSKLLGPRVFVVHVNPDPQLRIFAFAEKLQMMTSDYVWLATDWLSATIDSFS  209

Query  605   PLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLTGGSLG---LNSYALYAYDSVWLI  775
             P+    +  +QGV+ LRQH P+S  K+ F SRW+ +    L    LNSY L AYD+VW +
Sbjct  210   PMNRTALHSLQGVVGLRQHIPESNQKKDFMSRWRKMQQKGLATSQLNSYGLCAYDTVWTV  269

Query  776   AHAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLTGQF  955
             AH+ID F+N G  ++FS+  KL  I+   +HLE L +FDGG +LL  LLQ++F GLTGQ 
Sbjct  270   AHSIDKFINDGNNLTFSSSDKLNDIKTGEMHLEKLKVFDGGDILLKELLQTNFSGLTGQV  329

Query  956   KFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKLYGV  1135
              F++D+++V   YD++N+      T+G+W    G S +PPETL      +S  +Q+L+ V
Sbjct  330   HFSSDRNIVTSGYDVINIDNMAVHTVGYWSGTFGFSVSPPETLQGTQHGNSEIDQELHSV  389

Query  1136  VWPGQSVKKAPG  1171
              WPG  +++  G
Sbjct  390   TWPGGKIERPRG  401


 Score =   358 bits (919),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 181/327 (55%), Positives = 247/327 (76%), Gaps = 0/327 (0%)
 Frame = +3

Query  1146  GSR*KKPRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYA  1325
             G + ++PRGWV  ++ + LRIGVP R S+ +F++++  ++   G+ +DVFT A+ L+PY 
Sbjct  393   GGKIERPRGWVIADDERPLRIGVPYRASFVDFVTELHDSHQIVGYCIDVFTEALKLVPYY  452

Query  1326  VPFQFVPFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVV  1505
             VP++F  FGNGR NP+Y +LV++V+   FD A+GDIAIV NRT++VDF+QPY+ +GL++V
Sbjct  453   VPYKFELFGNGRSNPNYGQLVKMVADNVFDAAVGDIAIVKNRTEIVDFSQPYITTGLVIV  512

Query  1506  APFKKLNTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILW  1685
             AP +   + AW FL PF+  MW +TA  FV++GIV+WILEHR+ND+FRG P++Q++T+  
Sbjct  513   APIRNPKSSAWVFLKPFTVDMWCMTAAAFVIIGIVIWILEHRVNDDFRGPPRRQIVTMFM  572

Query  1686  FSLSTLFFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESL  1865
             FS STLF  ++E TVSTLGR+V+++WLF++++I SSYTA+LTSILTVQQL SPI G++SL
Sbjct  573   FSFSTLFKTNQEETVSTLGRVVMVVWLFLLMVITSSYTANLTSILTVQQLLSPITGIDSL  632

Query  1866  KEGNDPIGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERP  2045
                  PIGYQ+GSFA  YL E + I +SRL+ L SPE Y  AL  GP  GGV+AIVDE P
Sbjct  633   IANTWPIGYQVGSFAYGYLSENLNIHQSRLVELHSPEEYESALRLGPDNGGVAAIVDELP  692

Query  2046  YVENFLSTQCKFRIVGQEFTKSGWGFA  2126
             YVE FLS    F I+GQ FTK GWGF 
Sbjct  693   YVELFLSKHTDFGIIGQPFTKRGWGFV  719



>ref|XP_008812269.1| PREDICTED: glutamate receptor 3.7 isoform X2 [Phoenix dactylifera]
Length=869

 Score =   423 bits (1087),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 232/417 (56%), Positives = 313/417 (75%), Gaps = 3/417 (1%)
 Frame = +3

Query  1146  GSR*KKPRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTN--TFKGFSVDVFTAAVNLLP  1319
             G + +KP+GWV  NN K LRIGVP R SY EF++    +N     G+ +DVF A + ++P
Sbjct  405   GGKTEKPQGWVVANNEKPLRIGVPFRASYLEFVTVTNKSNIVNVSGYCIDVFKAIIKIIP  464

Query  1320  YAVPFQFVPFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLL  1499
             Y V +QFVPFG GR NP+Y ELV +V+    D AIGDIAIVTNRTK+VDFTQPY+++GL+
Sbjct  465   YDVSYQFVPFGYGRSNPNYDELVGMVAEDVIDAAIGDIAIVTNRTKIVDFTQPYISTGLV  524

Query  1500  VVAPFKKLNTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITI  1679
             ++A  K + + AW FL PF+  MW +T  FF ++G+V+W+LEHR+N  FRG PK+Q IT+
Sbjct  525   ILASIKSIKSNAWVFLRPFTMGMWCMTGAFFFLIGVVIWMLEHRVNSAFRGPPKRQCITM  584

Query  1680  LWFSLSTLFFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVE  1859
               FS ST F + +E+T+STLGR V+++WLF++++I SSYTASLTS LTVQQL SPIKG +
Sbjct  585   FLFSFSTPFQSQQEDTLSTLGRFVMMVWLFLLMVITSSYTASLTSFLTVQQLSSPIKGFD  644

Query  1860  SLKEGNDPIGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDE  2039
             SL   N PIGYQ+GSFA+ YLI  + +  SRL++LGSPEAY  AL++GP  GGV AIVDE
Sbjct  645   SLIASNQPIGYQVGSFAQSYLIYGLNVHPSRLVSLGSPEAYEVALQRGPKNGGVVAIVDE  704

Query  2040  RPYVENFLSTQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKW  2219
              PYVE FLS +  F IVGQ FT+SGWGFAFPRDSPLA+DMS A+L+LSENG+LQ+IH KW
Sbjct  705   LPYVEIFLSKRSGFGIVGQPFTRSGWGFAFPRDSPLAIDMSRAMLNLSENGELQKIHKKW  764

Query  2220  Ltrtscssesteles-DRLHLKSFWglfllcgaacflalfIYFVQIMLKFRRVARAE  2387
               +T+C ++++     ++LH+ SFWGLFL+CG A F++L ++ ++ + +F +  R +
Sbjct  765   FCKTNCVTQTSTSSDPNQLHVSSFWGLFLVCGIATFISLLLFLIRAIRQFIQFNRKQ  821


 Score =   299 bits (766),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 165/371 (44%), Positives = 222/371 (60%), Gaps = 40/371 (11%)
 Frame = +2

Query  59    VAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTTQ  238
             + A   ++   +AI+GPQSS VAH IS ++N LQ+PL+SFAATDPTL+SL++P+FLRTT 
Sbjct  83    LGAFSVLEKQAIAIIGPQSSAVAHMISSISNGLQIPLISFAATDPTLSSLEYPFFLRTTH  142

Query  239   SDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGAT  418
             SD YQM A+ADVID+YGW+ VIA+F+DDDYGRNGI  LDD LA K  KI YK  +P  A 
Sbjct  143   SDSYQMAAVADVIDYYGWRRVIAIFVDDDYGRNGIYYLDDELAKKMSKI-YKIALPVKA-  200

Query  419   TRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVLDS  598
             TR +I+D+L +  ++  RV V+H  P +G  +FS A  L M+ + YVW++TDWLST LD+
Sbjct  201   TRDKILDVLQKSRMIGPRVYVVHVTPDSGLEIFSAARDLQMLTEEYVWLATDWLSTTLDT  260

Query  599   SSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLTGGSLGLNSYALYAYDSVWLIA  778
             S  +    +  +QGV+  RQ+ P S  K AF SRW                         
Sbjct  261   SESISRNSLGYLQGVVGFRQYVPQSNEKDAFVSRWNE-----------------------  297

Query  779   HAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLTGQFK  958
                   LNK G        KL + +G  + L  L  FDGG LL   LL   F GL+G  +
Sbjct  298   ------LNKEG--------KLPTSKGK-MQLGKLKTFDGGSLLHKKLLSLKFTGLSGPVQ  342

Query  959   FNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKLYGVV  1138
             F++D +L+   Y+I+NV G+   T+G+W NY GLS + PE+ Y     + S NQ L  +V
Sbjct  343   FDSDNNLINGIYEIINVNGSMVHTVGYWSNYLGLSISIPESSYRNGQRNLSFNQVLDRIV  402

Query  1139  WPGQSVKKAPG  1171
             WPG   +K  G
Sbjct  403   WPGGKTEKPQG  413



>gb|EYU41186.1| hypothetical protein MIMGU_mgv1a000937mg [Erythranthe guttata]
Length=938

 Score =   607 bits (1565),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/414 (80%), Positives = 372/414 (90%), Gaps = 0/414 (0%)
 Frame = +3

Query  1146  GSR*KKPRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYA  1325
             G   + PRGWVFPNNGKQL+IGVP RVSY+EF+SQV G NT KGF +DVFT+AVNLLPYA
Sbjct  456   GETTRAPRGWVFPNNGKQLKIGVPRRVSYREFVSQVSGANTSKGFCIDVFTSAVNLLPYA  515

Query  1326  VPFQFVPFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVV  1505
             VP+QFVPFGNG ENPSY ELV+L++TGYFD  +GDIAIVTNRTKVVDFTQPY ASGL+VV
Sbjct  516   VPYQFVPFGNGVENPSYDELVKLITTGYFDAVVGDIAIVTNRTKVVDFTQPYAASGLVVV  575

Query  1506  APFKKLNTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILW  1685
             AP KKLNTGAWAFL PFS QMWGV+A FFV +GIVVW LEHR NDEFRG PKQQLITILW
Sbjct  576   APVKKLNTGAWAFLRPFSRQMWGVSAAFFVFIGIVVWTLEHRTNDEFRGPPKQQLITILW  635

Query  1686  FSLSTLFFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESL  1865
             FSLSTLFFAHRE TVSTLGR+VLIIWLFVVLIINSSYTASLTSILTVQQLYSPIKG+E+L
Sbjct  636   FSLSTLFFAHRETTVSTLGRLVLIIWLFVVLIINSSYTASLTSILTVQQLYSPIKGIETL  695

Query  1866  KEGNDPIGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERP  2045
             +EGNDPIG+Q+GSFAEHYL E IGI +SRL+ LG PEAYAEAL+ GP KGGV+A+VDERP
Sbjct  696   REGNDPIGFQVGSFAEHYLREGIGIPQSRLVPLGGPEAYAEALQLGPEKGGVAAVVDERP  755

Query  2046  YVENFLSTQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLt  2225
             Y+E FL++QCKFRI+GQEFTKSGWGFAFPRDSPLA+D+STAIL+LSENGDLQRIHDKWLT
Sbjct  756   YIELFLASQCKFRIIGQEFTKSGWGFAFPRDSPLAIDLSTAILTLSENGDLQRIHDKWLT  815

Query  2226  rtscssestelesDRLHLKSFWglfllcgaacflalfIYFVQIMLKFRRVARAE  2387
              ++CSS++TELESDRLHLKSFWGL+LLCG ACF+AL IY  QI  +FR  A  +
Sbjct  816   MSTCSSDNTELESDRLHLKSFWGLYLLCGIACFIALLIYVFQIFHRFRHAATED  869


 Score =   553 bits (1426),  Expect = 1e-177, Method: Compositional matrix adjust.
 Identities = 263/381 (69%), Positives = 320/381 (84%), Gaps = 3/381 (1%)
 Frame = +2

Query  56    LVAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTT  235
             LV AL+FM+TDV+A++GPQSSVVAHTI HVANELQ P LSFAATDPTL+SLQFPYFLRTT
Sbjct  90    LVEALRFMETDVMAVIGPQSSVVAHTILHVANELQTPFLSFAATDPTLSSLQFPYFLRTT  149

Query  236   QSDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGA  415
             QSD++QM AIA++++HY WK+VI +FIDDDYGRNG+++LDDAL+++RC++SYKAGIPPG 
Sbjct  150   QSDLHQMTAIAELVEHYNWKDVIVIFIDDDYGRNGLSSLDDALSSRRCRVSYKAGIPPGD  209

Query  416   TTRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVLD  595
              TR++IMDILV++ALMESRV+VLHAYP  G +VF VAHYLGMM +GYVWI+TDWLS+VLD
Sbjct  210   ITRSDIMDILVKVALMESRVIVLHAYPHVGSVVFDVAHYLGMMDEGYVWIATDWLSSVLD  269

Query  596   SSSPLPSEKMEI-MQGVLVLRQHTPDSELKRAFTSRWKHLTGGSLGLNSYALYAYDSVWL  772
             SS    SE +    QGVLVLRQHTPDSE KR F +RW  LT GSLG+++YALYAYD+VWL
Sbjct  270   SSPLHFSEAITASTQGVLVLRQHTPDSEKKREFLTRWNKLTKGSLGVSTYALYAYDTVWL  329

Query  773   IAHAIDSFLNKGGVISFSNDSKL-QSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLTG  949
             +AHAIDSF+N+GGVISFSNDS L  S++ S L+LEA+SIFDGGPLL+ N+L+SDFVGLTG
Sbjct  330   LAHAIDSFINQGGVISFSNDSSLVNSLQESNLNLEAMSIFDGGPLLMKNILESDFVGLTG  389

Query  950   QFKFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSR-PPNSSSANQKL  1126
               KF  +KSLV PSY+I+N+IGTG   +G+W NYSGLS   PE LY + PPN SSANQ L
Sbjct  390   PVKFTPEKSLVFPSYEIVNIIGTGLHRVGYWSNYSGLSVVAPEILYLQGPPNRSSANQLL  449

Query  1127  YGVVWPGQSVKKAPGVGFPEQ  1189
              GVVWPG++ +   G  FP  
Sbjct  450   NGVVWPGETTRAPRGWVFPNN  470



>emb|CDP07274.1| unnamed protein product [Coffea canephora]
Length=923

 Score =   600 bits (1547),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/413 (80%), Positives = 373/413 (90%), Gaps = 0/413 (0%)
 Frame = +3

Query  1161  KPRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYAVPFQF  1340
             KPRGWVFPNNGKQL+I VP RV Y+EF+SQVPGT+TFKGF +DVFTAAVNLLPYAVP+QF
Sbjct  459   KPRGWVFPNNGKQLKIAVPRRVGYREFVSQVPGTSTFKGFCIDVFTAAVNLLPYAVPYQF  518

Query  1341  VPFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPFKK  1520
             + FG+G ENPSYSELV L+S G FDGA+GDI IVTNRTK VDFTQPYV+SGL+VVAPF+K
Sbjct  519   IAFGDGHENPSYSELVELISAGVFDGAVGDITIVTNRTKTVDFTQPYVSSGLVVVAPFRK  578

Query  1521  LNTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSLST  1700
             LNTGAWAFL PFS  MWGVTA FF++VGIVVWILEHR NDEFRG PKQQLITILWFSLST
Sbjct  579   LNTGAWAFLRPFSGLMWGVTAAFFLLVGIVVWILEHRTNDEFRGPPKQQLITILWFSLST  638

Query  1701  LFFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESLKEGND  1880
             LFFAHRE+T S LGR+VLIIWLFVVLIINSSYTASLTSILTVQQLYSPIKG+ESLKE ++
Sbjct  639   LFFAHRESTASALGRVVLIIWLFVVLIINSSYTASLTSILTVQQLYSPIKGIESLKESDE  698

Query  1881  PIGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERPYVENF  2060
             PIGYQ+GSFAE+YLIEEIGI KSRL++LG+PE YA  L  GP KGGV+A+VDE PYVE F
Sbjct  699   PIGYQVGSFAENYLIEEIGIPKSRLVSLGTPEEYATNLLSGPKKGGVAAVVDELPYVELF  758

Query  2061  LSTQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLtrtscs  2240
             LS+QCKFRIVGQEFTKSGWGFAFPRDS LAVD+STAIL+LSENGDLQRIHDKWLT+++CS
Sbjct  759   LSSQCKFRIVGQEFTKSGWGFAFPRDSALAVDLSTAILALSENGDLQRIHDKWLTKSTCS  818

Query  2241  sestelesDRLHLKSFWglfllcgaacflalfIYFVQIMLKFRRVARAEPVAD  2399
             S++ E++SDRLHLKSF GLFLLCG  CF+AL IYF+QIM KFR  ARA  +A+
Sbjct  819   SDNAEIDSDRLHLKSFSGLFLLCGITCFIALLIYFLQIMHKFREAARAGRIAN  871


 Score =   596 bits (1537),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/379 (73%), Positives = 329/379 (87%), Gaps = 1/379 (0%)
 Frame = +2

Query  56    LVAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTT  235
             +V AL+ M+T+ VA++GPQSSVVAHTISHVANELQVPLLSFAATDPTL+SLQFPYF+RTT
Sbjct  90    MVGALQLMETETVAVIGPQSSVVAHTISHVANELQVPLLSFAATDPTLSSLQFPYFVRTT  149

Query  236   QSDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPG-  412
             +SD YQM AIA+++D+YGWK+VI VF+DDDYGRNG++ALDDA+AA+R +ISYKAGIPP  
Sbjct  150   RSDSYQMTAIAEMVDYYGWKDVIVVFLDDDYGRNGVSALDDAIAARRGRISYKAGIPPAP  209

Query  413   ATTRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVL  592
                R +I+DIL+++A+MESRV+VLHAYP  GFMVFSVA YLGMMGDGYVWI+TDWLS+VL
Sbjct  210   GVNRTDIIDILIKVAVMESRVIVLHAYPDVGFMVFSVAQYLGMMGDGYVWIATDWLSSVL  269

Query  593   DSSSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLTGGSLGLNSYALYAYDSVWL  772
             DSSSPLP E M+ MQGVLVLRQHTPDS+ KR+F SRW  L GGSLGL+SY LYAYD+VWL
Sbjct  270   DSSSPLPPENMDSMQGVLVLRQHTPDSDRKRSFLSRWNKLNGGSLGLHSYGLYAYDTVWL  329

Query  773   IAHAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLTGQ  952
             +AHAI+SF  +GG ISFS+D  L+ ++GSTLHLE L IFDGGPLLL  +L+S+FVGLTG 
Sbjct  330   VAHAINSFFEEGGRISFSSDPNLRFVQGSTLHLEELKIFDGGPLLLKKILESNFVGLTGP  389

Query  953   FKFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKLYG  1132
              KFN+DKSLV P+YDI+NVIGTGFR IG W NYSGLST PPETLYSRPPN SSANQ+L+G
Sbjct  390   VKFNSDKSLVFPAYDIINVIGTGFRVIGHWSNYSGLSTVPPETLYSRPPNRSSANQQLFG  449

Query  1133  VVWPGQSVKKAPGVGFPEQ  1189
             VVWPG++V K  G  FP  
Sbjct  450   VVWPGETVIKPRGWVFPNN  468



>ref|XP_007210370.1| hypothetical protein PRUPE_ppa001283mg [Prunus persica]
 gb|EMJ11569.1| hypothetical protein PRUPE_ppa001283mg [Prunus persica]
Length=863

 Score =   593 bits (1528),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/380 (71%), Positives = 332/380 (87%), Gaps = 2/380 (1%)
 Frame = +2

Query  56    LVAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTT  235
             +V AL+FM+TD+VAI+GPQSSVVAH ISHVANELQVPLLSFAATDPTL+SLQFP+F+RTT
Sbjct  12    MVQALQFMETDIVAIIGPQSSVVAHIISHVANELQVPLLSFAATDPTLSSLQFPFFVRTT  71

Query  236   QSDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPG-  412
             +SD+YQM A+A ++DHYGWKEVIA+FIDDDYGRNG++ALDD LA +RC+ISYK GIPPG 
Sbjct  72    RSDLYQMSAVAQIVDHYGWKEVIAIFIDDDYGRNGMSALDDKLAERRCRISYKLGIPPGP  131

Query  413   ATTRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVL  592
               TR +IMD+LV +A +ESRV+VLH  P +G M+ SVAHYL MMGDG+VWI+TDWLS++L
Sbjct  132   GATRGDIMDLLVNVAQLESRVIVLHVNPDSGLMILSVAHYLQMMGDGFVWIATDWLSSLL  191

Query  593   DSSSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLTGGSLGLNSYALYAYDSVWL  772
             DS+ PLPSE M+ +QGVLVLRQHTPDS+ KR F S+W  LTGGSLGL+SY LYAYDSVWL
Sbjct  192   DSALPLPSETMDTLQGVLVLRQHTPDSDRKRTFFSKWNKLTGGSLGLHSYGLYAYDSVWL  251

Query  773   IAHAIDSFLNKGGVISFSNDSKLQSIE-GSTLHLEALSIFDGGPLLLNNLLQSDFVGLTG  949
             +AHA+D+F N+GG+ISFSNDS+++S+E G +LHLEA+SIFD GPLLL N+LQS F+GLTG
Sbjct  252   VAHALDAFFNQGGIISFSNDSRIKSVEKGGSLHLEAMSIFDDGPLLLKNVLQSTFLGLTG  311

Query  950   QFKFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKLY  1129
               KF++++SLVLP+YDI+NV+GTGFR IG+WCNYSGLST PPE LYS+PPN SSANQ+LY
Sbjct  312   PIKFDSERSLVLPAYDIINVLGTGFRRIGYWCNYSGLSTVPPEMLYSKPPNRSSANQQLY  371

Query  1130  GVVWPGQSVKKAPGVGFPEQ  1189
              V+WPG+++ K  G  FP  
Sbjct  372   SVIWPGETLSKPRGWVFPNN  391


 Score =   582 bits (1501),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/406 (80%), Positives = 372/406 (92%), Gaps = 2/406 (0%)
 Frame = +3

Query  1161  KPRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGT-NTFKGFSVDVFTAAVNLLPYAVPFQ  1337
             KPRGWVFPNNGKQLRIGVPIRVSY EF+SQV GT N FKGF +DVF AAVNLLPYAVP++
Sbjct  382   KPRGWVFPNNGKQLRIGVPIRVSYLEFVSQVRGTDNMFKGFCIDVFIAAVNLLPYAVPYR  441

Query  1338  FVPFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPFK  1517
             F+PFG+G++NPSY+ELV  V+TG FD A+GDIAIVTNRTK+VDF+QPY ASGL+VVAPFK
Sbjct  442   FIPFGDGQKNPSYNELVYSVATGVFDAAVGDIAIVTNRTKIVDFSQPYAASGLVVVAPFK  501

Query  1518  KLNTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSLS  1697
             +LN+ AWAFL PF+A+MW VTA  F+V+GIVVWILEHR+NDEFRG PK+QLITILWFS+S
Sbjct  502   RLNSSAWAFLRPFTARMWVVTAASFLVIGIVVWILEHRINDEFRGPPKKQLITILWFSIS  561

Query  1698  TLFFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESLKEGN  1877
             TLFFAHRENTVSTLGR+VLIIWLFVVLIINSSYTASLTSILTVQ L SPIKG+ESLK  +
Sbjct  562   TLFFAHRENTVSTLGRLVLIIWLFVVLIINSSYTASLTSILTVQHLSSPIKGIESLKNSD  621

Query  1878  DPIGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHK-GGVSAIVDERPYVE  2054
             +PIGYQ+GSFAEHYL EE+GISKSRLI LGSP+AYA+AL+ GP K GGV+A+VDERPYVE
Sbjct  622   EPIGYQVGSFAEHYLSEELGISKSRLIPLGSPQAYAQALQLGPKKAGGVAAVVDERPYVE  681

Query  2055  NFLSTQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLtrts  2234
              FLS+QCKFR++GQEFTKSGWGFAFPRDSPLAVDMSTA+L LSENGDLQRI+DKWL ++S
Sbjct  682   VFLSSQCKFRVIGQEFTKSGWGFAFPRDSPLAVDMSTALLQLSENGDLQRIYDKWLRQSS  741

Query  2235  cssestelesDRLHLKSFWglfllcgaacflalfIYFVQIMLKFRR  2372
             C+ ESTELESDRLHLKSFWGLFL+CG ACF+ALFIYF+QI+ K R 
Sbjct  742   CTLESTELESDRLHLKSFWGLFLICGIACFIALFIYFLQILNKLRH  787



>ref|XP_008237957.1| PREDICTED: glutamate receptor 3.3 [Prunus mume]
Length=945

 Score =   594 bits (1531),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/380 (71%), Positives = 331/380 (87%), Gaps = 2/380 (1%)
 Frame = +2

Query  56    LVAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTT  235
             +V AL+FM+TD+VAI+GPQSSVVAH ISHVANELQVPLLSFAATDPTL+SLQFP+F+RTT
Sbjct  94    MVQALQFMETDIVAIIGPQSSVVAHIISHVANELQVPLLSFAATDPTLSSLQFPFFVRTT  153

Query  236   QSDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPG-  412
              SD+YQM A+A ++DHYGWKEVIA+FIDDDYGRNG++ALDD LA +RC+ISYK GIPPG 
Sbjct  154   HSDLYQMSAVAQIVDHYGWKEVIAIFIDDDYGRNGMSALDDKLAERRCRISYKLGIPPGP  213

Query  413   ATTRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVL  592
               TR +IMD+LV +A +ESRV+VLH  P +G M+ SVAHYL MMGDG+VWI+TDWLS++L
Sbjct  214   GATRGDIMDLLVNVAQLESRVIVLHVNPDSGLMILSVAHYLQMMGDGFVWIATDWLSSLL  273

Query  593   DSSSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLTGGSLGLNSYALYAYDSVWL  772
             DS+ PLPSE M+ +QGVLVLRQHTPDS+ KR F S+W  LTGGSLGL+SY LYAYDSVWL
Sbjct  274   DSALPLPSETMDTLQGVLVLRQHTPDSDRKRTFFSKWNKLTGGSLGLHSYGLYAYDSVWL  333

Query  773   IAHAIDSFLNKGGVISFSNDSKLQSIE-GSTLHLEALSIFDGGPLLLNNLLQSDFVGLTG  949
             +AHA+DSF N+GG+ISFSNDS+++S+E G +LHLEA+SIFD GPLLL N+LQS F+GLTG
Sbjct  334   VAHALDSFFNQGGIISFSNDSRIKSVEKGGSLHLEAMSIFDDGPLLLKNVLQSTFLGLTG  393

Query  950   QFKFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKLY  1129
               KF++++SLVLP+YDI+NV+GTGFR IG+WCNYSGLST PPE LYS+PPN SSANQ+LY
Sbjct  394   PIKFDSERSLVLPAYDIINVLGTGFRRIGYWCNYSGLSTVPPEMLYSKPPNRSSANQQLY  453

Query  1130  GVVWPGQSVKKAPGVGFPEQ  1189
              V+WPG+++ K  G  FP  
Sbjct  454   SVIWPGETLSKPRGWVFPNN  473


 Score =   581 bits (1498),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/406 (80%), Positives = 372/406 (92%), Gaps = 2/406 (0%)
 Frame = +3

Query  1161  KPRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGT-NTFKGFSVDVFTAAVNLLPYAVPFQ  1337
             KPRGWVFPNNGKQLRIGVPIRVSY+EF+SQV GT N FKGF +DVF AAVNLLPYAVP++
Sbjct  464   KPRGWVFPNNGKQLRIGVPIRVSYREFVSQVRGTDNMFKGFCIDVFIAAVNLLPYAVPYR  523

Query  1338  FVPFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPFK  1517
             F+PFG+G++NPSY+ELV  V+TG FD A+GDIAIVTNRTK+VDF+QPY ASGL+VVAPFK
Sbjct  524   FIPFGDGQKNPSYNELVYSVATGDFDAAVGDIAIVTNRTKIVDFSQPYAASGLVVVAPFK  583

Query  1518  KLNTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSLS  1697
             KLN+ AWAFL PF+A+MW VTA  F+V+GIVVWILEHR+NDEFRG PK+QLITILWFS+S
Sbjct  584   KLNSSAWAFLRPFTARMWVVTAASFLVIGIVVWILEHRINDEFRGPPKKQLITILWFSIS  643

Query  1698  TLFFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESLKEGN  1877
             TLFFAHRENTVSTLGR+VLIIWLFVVLIINSSYTASLTSILTVQ L SPIKG+ESLK  +
Sbjct  644   TLFFAHRENTVSTLGRLVLIIWLFVVLIINSSYTASLTSILTVQHLSSPIKGIESLKNSD  703

Query  1878  DPIGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHK-GGVSAIVDERPYVE  2054
             +PIGYQ+GSFAEHYL EE+GISKSRLI LGSP+AYA+AL+ GP K GGV+A+VDER YVE
Sbjct  704   EPIGYQVGSFAEHYLSEELGISKSRLIPLGSPQAYAQALQLGPKKAGGVAAVVDERLYVE  763

Query  2055  NFLSTQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLtrts  2234
              FLS+QCKFR++GQEFTKSGWGFAFPRDSPLAVDMSTA+L LSENGDLQRI+DKWL ++S
Sbjct  764   VFLSSQCKFRVIGQEFTKSGWGFAFPRDSPLAVDMSTALLQLSENGDLQRIYDKWLRQSS  823

Query  2235  cssestelesDRLHLKSFWglfllcgaacflalfIYFVQIMLKFRR  2372
             C+ ESTELESDRLHLKSFWGLFL+CG ACF+ALFIYF+QI+ K R 
Sbjct  824   CTLESTELESDRLHLKSFWGLFLICGIACFVALFIYFLQILNKLRH  869



>ref|XP_002510703.1| glutamate receptor 3 plant, putative [Ricinus communis]
 gb|EEF52890.1| glutamate receptor 3 plant, putative [Ricinus communis]
Length=927

 Score =   589 bits (1519),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/448 (74%), Positives = 387/448 (86%), Gaps = 7/448 (2%)
 Frame = +3

Query  1056  GCQLLLPR-LFTR--DRPIVQVQIKNYMV*FGLGSR*KKPRGWVFPNNGKQLRIGVPIRV  1226
             G  ++LP  L+TR  +R     Q+++ +     G    KPRGWVFPNNGKQL+IGVPIRV
Sbjct  420   GLSIVLPETLYTRPPNRSSANQQLQSVI---WPGETLLKPRGWVFPNNGKQLKIGVPIRV  476

Query  1227  SYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYAVPFQFVPFGNGRENPSYSELVRLVSTG  1406
             SYKEF+SQV GT+ FKGF +DVFTAA++LLPYAVP+QF+P+G+G+ NPSY+ELV+L++ G
Sbjct  477   SYKEFVSQVRGTDIFKGFCIDVFTAAISLLPYAVPYQFIPYGDGKRNPSYTELVQLITAG  536

Query  1407  YFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPFKKLNTGAWAFLTPFSAQMWGvtaf  1586
               D  +GDIAIVTNRTK+VDFTQPYV+SGL+VVAPF+KLNTGAWAFL PFS  MW VT  
Sbjct  537   SIDAVVGDIAIVTNRTKIVDFTQPYVSSGLVVVAPFRKLNTGAWAFLQPFSPLMWAVTFC  596

Query  1587  ffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSLSTLFFAHRENTVSTLGRMvliiwl  1766
             FF+ VG+VVWILEHR NDEFRG P++Q+ITILWFSLSTLFFAH+ENTVSTLGR VLIIWL
Sbjct  597   FFIAVGVVVWILEHRTNDEFRGPPRKQIITILWFSLSTLFFAHKENTVSTLGRFVLIIWL  656

Query  1767  fvvliiNSSYTASLTSILTVQQLYSPIKGVESLKEGNDPIGYQIGSFAEHYLIEEIGISK  1946
             FVVLIINSSYTASLTSILTVQQLYSPI G+ESLKE ++PIGYQ+GSFAE+YL EE+GISK
Sbjct  657   FVVLIINSSYTASLTSILTVQQLYSPINGIESLKESDEPIGYQVGSFAEYYLSEELGISK  716

Query  1947  SRLIALGSPEAYAEALEKGPHK-GGVSAIVDERPYVENFLSTQCKFRIVGQEFTKSGWGF  2123
             SRL+ALGSPEAYA AL++GP K GGV+AIVDE PYVE FLS+QC FRIVGQEFTKSGWGF
Sbjct  717   SRLVALGSPEAYATALQRGPKKAGGVAAIVDELPYVELFLSSQCSFRIVGQEFTKSGWGF  776

Query  2124  AFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLtrtscssestelesDRLHLKSFWglfl  2303
             AFPRDSPLAVDMSTAIL LSENGDLQRIHDKWL  + CSS++TE+ESDRL LKSFWGLFL
Sbjct  777   AFPRDSPLAVDMSTAILELSENGDLQRIHDKWLMHSGCSSDTTEIESDRLELKSFWGLFL  836

Query  2304  lcgaacflalfIYFVQIMLKFRRVARAE  2387
             +CG ACF+ALFIYF+QIM +   V  +E
Sbjct  837   ICGIACFIALFIYFLQIMRQLDHVPPSE  864


 Score =   575 bits (1483),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/379 (71%), Positives = 319/379 (84%), Gaps = 1/379 (0%)
 Frame = +2

Query  56    LVAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTT  235
             +V AL+FM+TDVVAILGPQSSVVAHTISHV NELQVPLLSFAATDPTL SLQFP+F+RTT
Sbjct  86    MVEALRFMETDVVAILGPQSSVVAHTISHVVNELQVPLLSFAATDPTLTSLQFPFFVRTT  145

Query  236   QSDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGA  415
             QSD+YQM AIA+++DHY WK+VIA+FIDD +GRNGI AL D LA +RC+ISYK GI P A
Sbjct  146   QSDLYQMAAIAEIVDHYSWKQVIAIFIDDHFGRNGILALSDKLAVRRCRISYKVGIEPEA  205

Query  416   -TTRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVL  592
                +  IMDILV++ALMESRV++LH     GF VFSVA YLGMMG+GYVWI+TDWLS+ L
Sbjct  206   EVNKGNIMDILVKVALMESRVIILHLNSKLGFTVFSVAKYLGMMGNGYVWIATDWLSSFL  265

Query  593   DSSSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLTGGSLGLNSYALYAYDSVWL  772
             D+ SPLPSE M+ MQGVL LRQHTP S+ KR+F+S W  LTGGS GLNSY LYAYDSVWL
Sbjct  266   DTFSPLPSETMDTMQGVLALRQHTPQSDRKRSFSSAWSKLTGGSFGLNSYGLYAYDSVWL  325

Query  773   IAHAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLTGQ  952
             IAHAID+FL++GG+ISFSNDS+L S+EGS LHL+A+S+F+ G  LL N+LQSDFVGLTG+
Sbjct  326   IAHAIDAFLDQGGIISFSNDSRLHSVEGSNLHLDAMSLFNDGTHLLKNILQSDFVGLTGR  385

Query  953   FKFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKLYG  1132
              KF++ KSL+LP+YDI+NVIGTGFR IGFW NYSGLS   PETLY+RPPN SSANQ+L  
Sbjct  386   VKFDSQKSLILPAYDIINVIGTGFRQIGFWSNYSGLSIVLPETLYTRPPNRSSANQQLQS  445

Query  1133  VVWPGQSVKKAPGVGFPEQ  1189
             V+WPG+++ K  G  FP  
Sbjct  446   VIWPGETLLKPRGWVFPNN  464



>ref|XP_007045628.1| Glutamate receptor isoform 2, partial [Theobroma cacao]
 gb|EOY01460.1| Glutamate receptor isoform 2, partial [Theobroma cacao]
Length=705

 Score =   367 bits (941),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 174/372 (47%), Positives = 248/372 (67%), Gaps = 4/372 (1%)
 Frame = +2

Query  65    ALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTTQSD  244
             A + ++ +VVAI+GPQSS +AH IS +AN LQVP +S+AATDPTL++LQFP+FLRT QSD
Sbjct  38    AFQVIEKEVVAIIGPQSSSIAHIISAIANGLQVPQVSYAATDPTLSALQFPFFLRTVQSD  97

Query  245   MYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGATTR  424
               QM+A+AD+ID YGWKEVIA+++DDDYGRNGI+ L++ L  +  K  YK  +P     +
Sbjct  98    SNQMIAMADLIDFYGWKEVIAIYVDDDYGRNGISVLNNELDRRMAKAFYKLPLP-AHFAQ  156

Query  425   AEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVLDSSS  604
             ++I+ +L    L+  RV V+H  P     +F+ A  L MM   YVW++TDWLS  +DS S
Sbjct  157   SDIISLLNNSKLLGPRVFVVHVNPDPQLRIFAFAEKLQMMTSDYVWLATDWLSATIDSFS  216

Query  605   PLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLTGGSLG---LNSYALYAYDSVWLI  775
             P+    +  +QGV+ LRQH P+S  K+ F SRW+ +    L    LNSY L AYD+VW +
Sbjct  217   PMNRTALHSLQGVVGLRQHIPESNQKKDFMSRWRKMQQKGLATSQLNSYGLCAYDTVWTV  276

Query  776   AHAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLTGQF  955
             AH+ID F+N G  ++FS+  KL  I+   +HLE L +FDGG +LL  LLQ++F GLTGQ 
Sbjct  277   AHSIDKFINDGNNLTFSSSDKLNDIKTGEMHLEKLKVFDGGDILLKELLQTNFSGLTGQV  336

Query  956   KFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKLYGV  1135
              F++D+++V   YD++N+      T+G+W    G S +PPETL      +S  +Q+L+ V
Sbjct  337   HFSSDRNIVTSGYDVINIDNMAVHTVGYWSGTFGFSVSPPETLQGTQHGNSEIDQELHSV  396

Query  1136  VWPGQSVKKAPG  1171
              WPG  +++  G
Sbjct  397   TWPGGKIERPRG  408


 Score =   333 bits (854),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 169/306 (55%), Positives = 234/306 (76%), Gaps = 0/306 (0%)
 Frame = +3

Query  1146  GSR*KKPRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYA  1325
             G + ++PRGWV  ++ + LRIGVP R S+ +F++++  ++   G+ +DVFT A+ L+PY 
Sbjct  400   GGKIERPRGWVIADDERPLRIGVPYRASFVDFVTELHDSHQIVGYCIDVFTEALKLVPYY  459

Query  1326  VPFQFVPFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVV  1505
             VP++F  FGNGR NP+Y +LV++V+   FD A+GDIAIV NRT++VDF+QPY+ +GL++V
Sbjct  460   VPYKFELFGNGRSNPNYGQLVKMVADNVFDAAVGDIAIVKNRTEIVDFSQPYITTGLVIV  519

Query  1506  APFKKLNTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILW  1685
             AP +   + AW FL PF+  MW +TA  FV++GIV+WILEHR+ND+FRG P++Q++T+  
Sbjct  520   APIRNPKSSAWVFLKPFTVDMWCMTAAAFVIIGIVIWILEHRVNDDFRGPPRRQIVTMFM  579

Query  1686  FSLSTLFFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESL  1865
             FS STLF  ++E TVSTLGR+V+++WLF++++I SSYTA+LTSILTVQQL SPI G++SL
Sbjct  580   FSFSTLFKTNQEETVSTLGRVVMVVWLFLLMVITSSYTANLTSILTVQQLLSPITGIDSL  639

Query  1866  KEGNDPIGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERP  2045
                  PIGYQ+GSFA  YL E + I +SRL+ L SPE Y  AL  GP  GGV+AIVDE P
Sbjct  640   IANTWPIGYQVGSFAYGYLSENLNIHQSRLVELHSPEEYESALRLGPDNGGVAAIVDELP  699

Query  2046  YVENFL  2063
             YVE FL
Sbjct  700   YVELFL  705



>ref|XP_010094542.1| Glutamate receptor 3.3 [Morus notabilis]
 gb|EXB56296.1| Glutamate receptor 3.3 [Morus notabilis]
Length=932

 Score =   588 bits (1516),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/411 (80%), Positives = 371/411 (90%), Gaps = 3/411 (1%)
 Frame = +3

Query  1161  KPRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYAVPFQF  1340
             KPRGWVFPNNGKQLRIGVP RVSY+EF+S+V GT+ FKGF +DVF +AVNLLPYAVP++F
Sbjct  455   KPRGWVFPNNGKQLRIGVPNRVSYREFVSRVRGTDMFKGFCIDVFVSAVNLLPYAVPYKF  514

Query  1341  VPFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPFKK  1520
             +PFGNGRENPSY+ELV  + +G FD AIGDIAIVTNRT++VDFTQPY ASGL+VVAPFK+
Sbjct  515   IPFGNGRENPSYTELVTEIVSGSFDAAIGDIAIVTNRTRIVDFTQPYAASGLVVVAPFKR  574

Query  1521  LNTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSLST  1700
             +NTGAWAFL PF+  MW VTA FF++VGIVVWILEHR+NDEFRG PK+QLITILWFSLST
Sbjct  575   MNTGAWAFLRPFNPLMWTVTAVFFILVGIVVWILEHRINDEFRGPPKRQLITILWFSLST  634

Query  1701  LFFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESLKEGND  1880
             +FFAHRENTVSTLGR VLIIWLFVVLIINSSYTASLTSILTVQQL S IKG+ESLK G++
Sbjct  635   MFFAHRENTVSTLGRFVLIIWLFVVLIINSSYTASLTSILTVQQLSSHIKGIESLKNGDE  694

Query  1881  PIGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERPYVENF  2060
             PIGYQIGSFAEHYL EEIGISKSRLIALGSPEAYA+AL+ GP KGGV+A+VDER Y+E F
Sbjct  695   PIGYQIGSFAEHYLTEEIGISKSRLIALGSPEAYAKALQDGPSKGGVAAVVDERAYIELF  754

Query  2061  LSTQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLtrtscs  2240
             LSTQCKFR+VGQEFTKSGWGFAFPRDSPLAVDMSTAIL +SENGDLQRIHDKWL R++CS
Sbjct  755   LSTQCKFRVVGQEFTKSGWGFAFPRDSPLAVDMSTAILQMSENGDLQRIHDKWLMRSACS  814

Query  2241  sestelesDRLHLKSFWglfllcgaacflalfIYFVQIMLKFRRVARAEPV  2393
              E  ELESD+LHLKSF GLFL+CG ACF+A+ IYF++I   F+R+  A P+
Sbjct  815   MEGAELESDQLHLKSFAGLFLMCGVACFVAILIYFLRI---FKRLYYAAPL  862


 Score =   574 bits (1479),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/378 (69%), Positives = 322/378 (85%), Gaps = 0/378 (0%)
 Frame = +2

Query  56    LVAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTT  235
             +V AL+ ++ DV+AI+GPQSSVVAH ISHVANEL+ PLLSFAATDPTL+SLQFPYF+RTT
Sbjct  87    MVEALQLLEKDVIAIIGPQSSVVAHIISHVANELKTPLLSFAATDPTLSSLQFPYFVRTT  146

Query  236   QSDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGA  415
              SD+YQM A+A+++D YGWKE+IA+F+DDD+GRNGI+AL D LA +RC++SYK  IPPGA
Sbjct  147   HSDLYQMAAVAEIVDFYGWKELIAIFVDDDFGRNGISALGDKLAERRCRMSYKVPIPPGA  206

Query  416   TTRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVLD  595
              +R+E++D+LV++AL+ESRV+VLH  P +GF VFSVA YLGMMG+G+VWI+TDWLS+VLD
Sbjct  207   VSRSEVLDLLVKVALLESRVIVLHVNPDSGFTVFSVAQYLGMMGNGFVWIATDWLSSVLD  266

Query  596   SSSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLTGGSLGLNSYALYAYDSVWLI  775
             +S PLPS +ME MQGVLVLR HTPDS+ KRAFTSRW+ LTG S GLNSY LYAYDSVWL+
Sbjct  267   TSFPLPSGRMESMQGVLVLRPHTPDSDRKRAFTSRWRKLTGDSPGLNSYGLYAYDSVWLV  326

Query  776   AHAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLTGQF  955
             AHAID+F ++GGVISF+ND+K++S E   LHLEA+SIFD G  LL N+LQS+ VGLTG  
Sbjct  327   AHAIDAFFDQGGVISFTNDTKIKSTEAGLLHLEAMSIFDQGDRLLKNILQSNLVGLTGPI  386

Query  956   KFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKLYGV  1135
             +F+ ++SLV PSYDI+NV+GTG R +G+WCNYSGLST PPETLYSRPPN S ANQ+LY V
Sbjct  387   RFDLERSLVFPSYDIINVVGTGVRRVGYWCNYSGLSTVPPETLYSRPPNRSIANQRLYSV  446

Query  1136  VWPGQSVKKAPGVGFPEQ  1189
             +WPG++  K  G  FP  
Sbjct  447   IWPGETSLKPRGWVFPNN  464



>ref|XP_004500849.1| PREDICTED: glutamate receptor 3.3-like isoform X2 [Cicer arietinum]
Length=871

 Score =   582 bits (1501),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/413 (77%), Positives = 370/413 (90%), Gaps = 0/413 (0%)
 Frame = +3

Query  1161  KPRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYAVPFQF  1340
             +PRGWVFPNNGKQLRIGVPIRVS+ EF+S V GT+TFKGF VDVF AAVNLLPYAVP++F
Sbjct  404   RPRGWVFPNNGKQLRIGVPIRVSFHEFVSPVKGTDTFKGFCVDVFAAAVNLLPYAVPYRF  463

Query  1341  VPFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPFKK  1520
             VPFG+GR+NPSY+ELV  ++TGYFDGA+GDIAIVTNRT++VDFTQPY ASGL+VVAPFKK
Sbjct  464   VPFGDGRKNPSYTELVNSITTGYFDGAVGDIAIVTNRTRIVDFTQPYAASGLVVVAPFKK  523

Query  1521  LNTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSLST  1700
             +N+G W+FL PF+  MW VTA FF  VGIVVWILEHR+NDEFRG PKQQ ITILWFSLST
Sbjct  524   INSGGWSFLQPFTPSMWIVTACFFFFVGIVVWILEHRINDEFRGPPKQQFITILWFSLST  583

Query  1701  LFFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESLKEGND  1880
             LFF+HRENTVS LGR V++IWLFVVLIINSSYTASLTSILTVQQL SPI G++SLK  ++
Sbjct  584   LFFSHRENTVSALGRGVVLIWLFVVLIINSSYTASLTSILTVQQLSSPISGIDSLKASDE  643

Query  1881  PIGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERPYVENF  2060
             PIG+Q+GSFAE YL E+IGISKSRL+ALGSPE YA+AL+ GP+KGGV+AI+DERPYVE F
Sbjct  644   PIGFQVGSFAERYLTEDIGISKSRLVALGSPEEYAKALQLGPNKGGVAAIIDERPYVEIF  703

Query  2061  LSTQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLtrtscs  2240
             LS QC FRIVGQEFT+SGWGFAFPRDSPLAVD+STAIL LSE GDLQRIHDKW+TR++CS
Sbjct  704   LSAQCTFRIVGQEFTRSGWGFAFPRDSPLAVDLSTAILQLSETGDLQRIHDKWMTRSTCS  763

Query  2241  sestelesDRLHLKSFWglfllcgaacflalfIYFVQIMLKFRRVARAEPVAD  2399
              ++TE++SDRL LKSFWGLF++CG ACF+AL IYF+QIML   R A +EP ++
Sbjct  764   LDNTEIDSDRLQLKSFWGLFIICGLACFIALLIYFLQIMLLLWRSAPSEPASN  816


 Score =   519 bits (1337),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 243/380 (64%), Positives = 310/380 (82%), Gaps = 3/380 (1%)
 Frame = +2

Query  56    LVAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTT  235
             ++ AL+FM+TDV+AILGPQSSVV+H +SHVANEL+VP+LSFAATDPTL+SLQFP+F+RTT
Sbjct  35    MIQALRFMETDVIAILGPQSSVVSHIVSHVANELRVPMLSFAATDPTLSSLQFPFFVRTT  94

Query  236   QSDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGA  415
              SD+YQM A+A++ID YGWKEVIA+++DDDYGRNG++ L+DALA +RC+ISYKAGI  G 
Sbjct  95    LSDLYQMTAVAEIIDFYGWKEVIAIYVDDDYGRNGVSVLEDALAGRRCRISYKAGIKSGP  154

Query  416   -TTRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVL  592
                R EI ++LV +A M+SRV+V+HA+  +GFM+F VA YLGMM +GYVWI+TDWLSTVL
Sbjct  155   DVDRGEITNLLVNVAQMQSRVIVVHAHSNSGFMIFKVARYLGMMQEGYVWIATDWLSTVL  214

Query  593   DSSSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLTGGSLGLNSYALYAYDSVWL  772
             DSSS LP E M+ +QG L LRQHTPD++ K+AF +RW  +TGGSLGL+SY L+AYDSVWL
Sbjct  215   DSSS-LPLETMDTLQGALGLRQHTPDTDKKKAFFTRWNKITGGSLGLHSYGLHAYDSVWL  273

Query  773   IAHAIDSFLNKGGVISFSNDSKLQSI-EGSTLHLEALSIFDGGPLLLNNLLQSDFVGLTG  949
             +A AID F N+GGVIS +N + L    +G  L+L+A+SIFD G LLL+N+LQSDFVGL+G
Sbjct  274   VARAIDEFFNQGGVISCTNYTSLHDKGKGGGLNLDAMSIFDNGTLLLDNILQSDFVGLSG  333

Query  950   QFKFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKLY  1129
               KF+ DK+L  P+YDI+NV+G GFR IG+W NYSGLS   PETLY+ PPN SSANQ L+
Sbjct  334   PMKFDLDKNLFRPAYDIINVVGNGFRRIGYWSNYSGLSIVSPETLYANPPNRSSANQHLH  393

Query  1130  GVVWPGQSVKKAPGVGFPEQ  1189
              V+WPG++  +  G  FP  
Sbjct  394   SVIWPGETPSRPRGWVFPNN  413



>ref|XP_008373417.1| PREDICTED: glutamate receptor 3.3 [Malus domestica]
Length=959

 Score =   585 bits (1508),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/413 (78%), Positives = 371/413 (90%), Gaps = 1/413 (0%)
 Frame = +3

Query  1161  KPRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGT-NTFKGFSVDVFTAAVNLLPYAVPFQ  1337
             KPRGWVFPNNGKQ+RIGVPIRVSY+EF+S+V GT N FKGF +DVFTAAVNLLPYAVP++
Sbjct  483   KPRGWVFPNNGKQIRIGVPIRVSYREFVSKVRGTDNMFKGFCIDVFTAAVNLLPYAVPYR  542

Query  1338  FVPFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPFK  1517
             F+PFG+G+ NPSY+ELV  ++TG FD AIGDIAIVTNRTK VDF+QPY ASGL+VVAPFK
Sbjct  543   FIPFGDGKNNPSYTELVTSIATGVFDAAIGDIAIVTNRTKNVDFSQPYAASGLVVVAPFK  602

Query  1518  KLNTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSLS  1697
             KLN+ AWAF  PF+A+MW VTA  F+VVGIVVWILEHR+NDEFRG PK+QLITILWFS+S
Sbjct  603   KLNSSAWAFFRPFTARMWVVTAASFLVVGIVVWILEHRINDEFRGPPKKQLITILWFSIS  662

Query  1698  TLFFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESLKEGN  1877
             TLFF+HRENTVSTLGR+VLIIWLFVVLIINSSYTASLTSILTVQ L SPIKG+ESLK  +
Sbjct  663   TLFFSHRENTVSTLGRVVLIIWLFVVLIINSSYTASLTSILTVQHLSSPIKGIESLKSSD  722

Query  1878  DPIGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERPYVEN  2057
             +PIGYQ+GSFAEHYL EE+GI K+RL+ALGSP+AYA AL+ GP KGGV+A+VDERPYVE 
Sbjct  723   EPIGYQVGSFAEHYLSEELGIPKNRLMALGSPQAYARALQLGPKKGGVAAVVDERPYVEL  782

Query  2058  FLSTQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLtrtsc  2237
             FLS+QCKFR+VG EFTKSGWGFAFPRDSPLAVDMSTAIL LSENGDLQRIHDKWL ++SC
Sbjct  783   FLSSQCKFRVVGPEFTKSGWGFAFPRDSPLAVDMSTAILQLSENGDLQRIHDKWLMQSSC  842

Query  2238  ssestelesDRLHLKSFWglfllcgaacflalfIYFVQIMLKFRRVARAEPVA  2396
             S ++TELESDRLHLKSFWGLFL+CG AC +ALFIY +Q++ K RR    + V+
Sbjct  843   SLDTTELESDRLHLKSFWGLFLICGIACSVALFIYLLQVLNKLRRAEVTQRVS  895


 Score =   569 bits (1466),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/380 (69%), Positives = 323/380 (85%), Gaps = 2/380 (1%)
 Frame = +2

Query  56    LVAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTT  235
             +V AL+FM+TD+VAI+GPQSSVVAH ISHV+NELQVPLLSFAATDPTL+SLQFP+F+RTT
Sbjct  113   MVQALQFMETDIVAIIGPQSSVVAHIISHVSNELQVPLLSFAATDPTLSSLQFPFFVRTT  172

Query  236   QSDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPG-  412
              SD+YQM A+A+++DHYGWK VIA++IDDDYGRNG++ LDD LA +RC+ISYK GIPPG 
Sbjct  173   HSDLYQMTAVAEMVDHYGWKXVIAIYIDDDYGRNGVSTLDDKLAERRCRISYKLGIPPGH  232

Query  413   ATTRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVL  592
               TR ++MD+LV+++ +ESRV+VLH     G  V SVA YL MMGDG+VWI+TDWLS++L
Sbjct  233   GATRGDLMDLLVKVSQLESRVIVLHVNTDLGLNVLSVAQYLQMMGDGFVWIATDWLSSLL  292

Query  593   DSSSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLTGGSLGLNSYALYAYDSVWL  772
             DS+ PL  E M+ MQGVLVLRQHTPDS+ KRAF S+W  LTGGSLGL+SY LYAYDSVWL
Sbjct  293   DSALPLSPEIMDTMQGVLVLRQHTPDSDRKRAFFSKWNKLTGGSLGLHSYGLYAYDSVWL  352

Query  773   IAHAIDSFLNKGGVISFSNDSKLQSIE-GSTLHLEALSIFDGGPLLLNNLLQSDFVGLTG  949
             +AHAID+F N+GG+ISFSNDS++ S++ G +LHLEA+SIFD GPLLL N+LQS F+GLTG
Sbjct  353   VAHAIDAFFNQGGIISFSNDSRINSVDKGGSLHLEAMSIFDDGPLLLKNILQSSFLGLTG  412

Query  950   QFKFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKLY  1129
               KF++D+SL LP+YDI+NV+GTGFR IG+WCNYSGLST PPE LYS+PPN SSA+Q+LY
Sbjct  413   PVKFDSDRSLALPAYDIINVLGTGFRRIGYWCNYSGLSTVPPEMLYSKPPNRSSASQQLY  472

Query  1130  GVVWPGQSVKKAPGVGFPEQ  1189
              VVWPG+ + K  G  FP  
Sbjct  473   SVVWPGEILSKPRGWVFPNN  492



>ref|XP_004500848.1| PREDICTED: glutamate receptor 3.3-like isoform X1 [Cicer arietinum]
Length=935

 Score =   583 bits (1502),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/413 (77%), Positives = 370/413 (90%), Gaps = 0/413 (0%)
 Frame = +3

Query  1161  KPRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYAVPFQF  1340
             +PRGWVFPNNGKQLRIGVPIRVS+ EF+S V GT+TFKGF VDVF AAVNLLPYAVP++F
Sbjct  468   RPRGWVFPNNGKQLRIGVPIRVSFHEFVSPVKGTDTFKGFCVDVFAAAVNLLPYAVPYRF  527

Query  1341  VPFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPFKK  1520
             VPFG+GR+NPSY+ELV  ++TGYFDGA+GDIAIVTNRT++VDFTQPY ASGL+VVAPFKK
Sbjct  528   VPFGDGRKNPSYTELVNSITTGYFDGAVGDIAIVTNRTRIVDFTQPYAASGLVVVAPFKK  587

Query  1521  LNTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSLST  1700
             +N+G W+FL PF+  MW VTA FF  VGIVVWILEHR+NDEFRG PKQQ ITILWFSLST
Sbjct  588   INSGGWSFLQPFTPSMWIVTACFFFFVGIVVWILEHRINDEFRGPPKQQFITILWFSLST  647

Query  1701  LFFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESLKEGND  1880
             LFF+HRENTVS LGR V++IWLFVVLIINSSYTASLTSILTVQQL SPI G++SLK  ++
Sbjct  648   LFFSHRENTVSALGRGVVLIWLFVVLIINSSYTASLTSILTVQQLSSPISGIDSLKASDE  707

Query  1881  PIGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERPYVENF  2060
             PIG+Q+GSFAE YL E+IGISKSRL+ALGSPE YA+AL+ GP+KGGV+AI+DERPYVE F
Sbjct  708   PIGFQVGSFAERYLTEDIGISKSRLVALGSPEEYAKALQLGPNKGGVAAIIDERPYVEIF  767

Query  2061  LSTQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLtrtscs  2240
             LS QC FRIVGQEFT+SGWGFAFPRDSPLAVD+STAIL LSE GDLQRIHDKW+TR++CS
Sbjct  768   LSAQCTFRIVGQEFTRSGWGFAFPRDSPLAVDLSTAILQLSETGDLQRIHDKWMTRSTCS  827

Query  2241  sestelesDRLHLKSFWglfllcgaacflalfIYFVQIMLKFRRVARAEPVAD  2399
              ++TE++SDRL LKSFWGLF++CG ACF+AL IYF+QIML   R A +EP ++
Sbjct  828   LDNTEIDSDRLQLKSFWGLFIICGLACFIALLIYFLQIMLLLWRSAPSEPASN  880


 Score =   519 bits (1337),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 243/380 (64%), Positives = 310/380 (82%), Gaps = 3/380 (1%)
 Frame = +2

Query  56    LVAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTT  235
             ++ AL+FM+TDV+AILGPQSSVV+H +SHVANEL+VP+LSFAATDPTL+SLQFP+F+RTT
Sbjct  99    MIQALRFMETDVIAILGPQSSVVSHIVSHVANELRVPMLSFAATDPTLSSLQFPFFVRTT  158

Query  236   QSDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGA  415
              SD+YQM A+A++ID YGWKEVIA+++DDDYGRNG++ L+DALA +RC+ISYKAGI  G 
Sbjct  159   LSDLYQMTAVAEIIDFYGWKEVIAIYVDDDYGRNGVSVLEDALAGRRCRISYKAGIKSGP  218

Query  416   -TTRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVL  592
                R EI ++LV +A M+SRV+V+HA+  +GFM+F VA YLGMM +GYVWI+TDWLSTVL
Sbjct  219   DVDRGEITNLLVNVAQMQSRVIVVHAHSNSGFMIFKVARYLGMMQEGYVWIATDWLSTVL  278

Query  593   DSSSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLTGGSLGLNSYALYAYDSVWL  772
             DSSS LP E M+ +QG L LRQHTPD++ K+AF +RW  +TGGSLGL+SY L+AYDSVWL
Sbjct  279   DSSS-LPLETMDTLQGALGLRQHTPDTDKKKAFFTRWNKITGGSLGLHSYGLHAYDSVWL  337

Query  773   IAHAIDSFLNKGGVISFSNDSKLQSI-EGSTLHLEALSIFDGGPLLLNNLLQSDFVGLTG  949
             +A AID F N+GGVIS +N + L    +G  L+L+A+SIFD G LLL+N+LQSDFVGL+G
Sbjct  338   VARAIDEFFNQGGVISCTNYTSLHDKGKGGGLNLDAMSIFDNGTLLLDNILQSDFVGLSG  397

Query  950   QFKFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKLY  1129
               KF+ DK+L  P+YDI+NV+G GFR IG+W NYSGLS   PETLY+ PPN SSANQ L+
Sbjct  398   PMKFDLDKNLFRPAYDIINVVGNGFRRIGYWSNYSGLSIVSPETLYANPPNRSSANQHLH  457

Query  1130  GVVWPGQSVKKAPGVGFPEQ  1189
              V+WPG++  +  G  FP  
Sbjct  458   SVIWPGETPSRPRGWVFPNN  477



>emb|CAN72607.1| hypothetical protein VITISV_021339 [Vitis vinifera]
Length=916

 Score =   581 bits (1498),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/406 (80%), Positives = 364/406 (90%), Gaps = 0/406 (0%)
 Frame = +3

Query  1161  KPRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYAVPFQF  1340
             KPRGWVFPNNGK L+IGVP RVSY+EF+S+V GT+ FKGF +DVFTAAV LLPYAVPFQ+
Sbjct  437   KPRGWVFPNNGKLLKIGVPNRVSYREFVSRVRGTDMFKGFCIDVFTAAVTLLPYAVPFQY  496

Query  1341  VPFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPFKK  1520
             V  G+G +NP+YSELVR+V+ G  D  +GDIAIVT+RT++VDFTQPY +SGL+VVAPF+K
Sbjct  497   VSVGDGHKNPNYSELVRMVAEGELDAVVGDIAIVTSRTRIVDFTQPYASSGLVVVAPFRK  556

Query  1521  LNTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSLST  1700
             LN+GAWAFL PFS  MWGVTA FF+V+GIVVWILEHR+NDEFRG PK Q+ITILWFS ST
Sbjct  557   LNSGAWAFLRPFSPLMWGVTACFFIVIGIVVWILEHRINDEFRGPPKHQIITILWFSFST  616

Query  1701  LFFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESLKEGND  1880
             +FFAHRE+TVS LGR+VLIIWLFVVLIINSSYTASLTSILTVQQL SPIKGVESL   ND
Sbjct  617   MFFAHRESTVSALGRLVLIIWLFVVLIINSSYTASLTSILTVQQLSSPIKGVESLINSND  676

Query  1881  PIGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERPYVENF  2060
             PIGYQ+GSFAEHYL EE+ IS+SRL+ALGSPE YA+AL+ GP KGGV+A+VDERPYVE F
Sbjct  677   PIGYQVGSFAEHYLSEELNISESRLVALGSPEEYAKALQNGPGKGGVAAVVDERPYVELF  736

Query  2061  LSTQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLtrtscs  2240
             LSTQCKFRIVGQEFTKSGWGF FPRDSPLAVDMSTAIL+LSENGDLQRIHDKWL  ++CS
Sbjct  737   LSTQCKFRIVGQEFTKSGWGFVFPRDSPLAVDMSTAILALSENGDLQRIHDKWLATSACS  796

Query  2241  sestelesDRLHLKSFWglfllcgaacflalfIYFVQIMLKFRRVA  2378
             SESTELESDRLHLKSFWGLFL+CG ACF+AL IYF QI+ KFR  A
Sbjct  797   SESTELESDRLHLKSFWGLFLICGLACFVALVIYFFQILRKFRNAA  842


 Score =   572 bits (1475),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/381 (69%), Positives = 327/381 (86%), Gaps = 1/381 (0%)
 Frame = +2

Query  50    ILLVAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLR  229
             I ++ AL+FM+T+ +AI+GPQSSVVAH ISHVANELQVPLLSFAATDPTL+SLQFP+F+R
Sbjct  66    IGMIGALQFMETETIAIIGPQSSVVAHMISHVANELQVPLLSFAATDPTLSSLQFPFFVR  125

Query  230   TTQSDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPP  409
             TTQSD+YQM AI +++D+YGW+ VIA+FIDDDYGRNG++ALDDALA KR KIS+K GIPP
Sbjct  126   TTQSDLYQMKAITELVDYYGWRSVIAIFIDDDYGRNGVSALDDALAEKRLKISHKEGIPP  185

Query  410   GAT-TRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLST  586
             GA+ ++ +IMDILV+++++ESR++VLH  P  GF VFSVA YLGMM +GYVWI+TDWLS+
Sbjct  186   GASASQGDIMDILVKVSVLESRIIVLHVNPDIGFKVFSVARYLGMMQNGYVWIATDWLSS  245

Query  587   VLDSSSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLTGGSLGLNSYALYAYDSV  766
             VLD+SSPL S+ M+ MQGVLVLR+HTPDS+ KRAF SRWK LTGGSLGLNSY LYAYD+V
Sbjct  246   VLDTSSPLASDTMDSMQGVLVLRRHTPDSDRKRAFLSRWKKLTGGSLGLNSYGLYAYDTV  305

Query  767   WLIAHAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLT  946
             WL+AHA+D+F N+GG ISFSNDSKL SI   + HLE +++FDGG LLLNN+L+S+FVGLT
Sbjct  306   WLLAHALDAFFNQGGTISFSNDSKLLSIGRGSRHLEEMNVFDGGMLLLNNILKSNFVGLT  365

Query  947   GQFKFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKL  1126
             G FKF +D+SL  P++DI+NVIGTG+R IG+W NYSGLST  PE LY +PPN SS NQ+L
Sbjct  366   GPFKFTSDRSLYAPAFDIINVIGTGYRQIGYWSNYSGLSTETPEALYGKPPNRSSVNQRL  425

Query  1127  YGVVWPGQSVKKAPGVGFPEQ  1189
             YGVVWPG+++ K  G  FP  
Sbjct  426   YGVVWPGETLSKPRGWVFPNN  446



>emb|CBI40741.3| unnamed protein product [Vitis vinifera]
Length=934

 Score =   582 bits (1499),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/406 (80%), Positives = 364/406 (90%), Gaps = 0/406 (0%)
 Frame = +3

Query  1161  KPRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYAVPFQF  1340
             KPRGWVFPNNGK L+IGVP RVSY+EF+S+V GT+ FKGF +DVFTAAV LLPYAVPFQ+
Sbjct  455   KPRGWVFPNNGKLLKIGVPNRVSYREFVSRVRGTDMFKGFCIDVFTAAVTLLPYAVPFQY  514

Query  1341  VPFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPFKK  1520
             V  G+G +NP+YSELVR+V+ G  D  +GDIAIVT+RT++VDFTQPY +SGL+VVAPF+K
Sbjct  515   VSVGDGHKNPNYSELVRMVAEGELDAVVGDIAIVTSRTRIVDFTQPYASSGLVVVAPFRK  574

Query  1521  LNTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSLST  1700
             LN+GAWAFL PFS  MWGVTA FF+V+GIVVWILEHR+NDEFRG PK Q+ITILWFS ST
Sbjct  575   LNSGAWAFLRPFSPLMWGVTACFFIVIGIVVWILEHRINDEFRGPPKHQIITILWFSFST  634

Query  1701  LFFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESLKEGND  1880
             +FFAHRE+TVS LGR+VLIIWLFVVLIINSSYTASLTSILTVQQL SPIKGVESL   ND
Sbjct  635   MFFAHRESTVSALGRLVLIIWLFVVLIINSSYTASLTSILTVQQLSSPIKGVESLINSND  694

Query  1881  PIGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERPYVENF  2060
             PIGYQ+GSFAEHYL EE+ IS+SRL+ALGSPE YA+AL+ GP KGGV+A+VDERPYVE F
Sbjct  695   PIGYQVGSFAEHYLSEELNISESRLVALGSPEEYAKALQNGPGKGGVAAVVDERPYVELF  754

Query  2061  LSTQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLtrtscs  2240
             LSTQCKFRIVGQEFTKSGWGF FPRDSPLAVDMSTAIL+LSENGDLQRIHDKWL  ++CS
Sbjct  755   LSTQCKFRIVGQEFTKSGWGFVFPRDSPLAVDMSTAILALSENGDLQRIHDKWLATSACS  814

Query  2241  sestelesDRLHLKSFWglfllcgaacflalfIYFVQIMLKFRRVA  2378
             SESTELESDRLHLKSFWGLFL+CG ACF+AL IYF QI+ KFR  A
Sbjct  815   SESTELESDRLHLKSFWGLFLICGLACFVALVIYFFQILRKFRNAA  860


 Score =   573 bits (1477),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/381 (69%), Positives = 327/381 (86%), Gaps = 1/381 (0%)
 Frame = +2

Query  50    ILLVAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLR  229
             I ++ AL+FM+T+ +AI+GPQSSVVAH ISHVANELQVPLLSFAATDPTL+SLQFP+F+R
Sbjct  84    IGMIGALQFMETETIAIIGPQSSVVAHMISHVANELQVPLLSFAATDPTLSSLQFPFFVR  143

Query  230   TTQSDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPP  409
             TTQSD+YQM AI +++D+YGW+ VIA+FIDDDYGRNG++ALDDALA KR KIS+K GIPP
Sbjct  144   TTQSDLYQMKAITELVDYYGWRSVIAIFIDDDYGRNGVSALDDALAEKRLKISHKEGIPP  203

Query  410   GAT-TRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLST  586
             GA+ ++ +IMDILV+++++ESR++VLH  P  GF VFSVA YLGMM +GYVWI+TDWLS+
Sbjct  204   GASASQGDIMDILVKVSVLESRIIVLHVNPDIGFKVFSVARYLGMMQNGYVWIATDWLSS  263

Query  587   VLDSSSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLTGGSLGLNSYALYAYDSV  766
             VLD+SSPL S+ M+ MQGVLVLR+HTPDS+ KRAF SRWK LTGGSLGLNSY LYAYD+V
Sbjct  264   VLDTSSPLASDTMDSMQGVLVLRRHTPDSDRKRAFLSRWKKLTGGSLGLNSYGLYAYDTV  323

Query  767   WLIAHAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLT  946
             WL+AHA+D+F N+GG ISFSNDSKL SI   + HLE +++FDGG LLLNN+L+S+FVGLT
Sbjct  324   WLLAHALDAFFNQGGTISFSNDSKLLSIGRGSRHLEEMNVFDGGMLLLNNILKSNFVGLT  383

Query  947   GQFKFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKL  1126
             G FKF +D+SL  P++DI+NVIGTG+R IG+W NYSGLST  PE LY +PPN SS NQ+L
Sbjct  384   GPFKFTSDRSLYAPAFDIINVIGTGYRQIGYWSNYSGLSTETPEALYGKPPNRSSVNQRL  443

Query  1127  YGVVWPGQSVKKAPGVGFPEQ  1189
             YGVVWPG+++ K  G  FP  
Sbjct  444   YGVVWPGETLSKPRGWVFPNN  464



>ref|XP_002272859.2| PREDICTED: glutamate receptor 3.3 [Vitis vinifera]
Length=964

 Score =   582 bits (1499),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/406 (80%), Positives = 364/406 (90%), Gaps = 0/406 (0%)
 Frame = +3

Query  1161  KPRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYAVPFQF  1340
             KPRGWVFPNNGK L+IGVP RVSY+EF+S+V GT+ FKGF +DVFTAAV LLPYAVPFQ+
Sbjct  485   KPRGWVFPNNGKLLKIGVPNRVSYREFVSRVRGTDMFKGFCIDVFTAAVTLLPYAVPFQY  544

Query  1341  VPFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPFKK  1520
             V  G+G +NP+YSELVR+V+ G  D  +GDIAIVT+RT++VDFTQPY +SGL+VVAPF+K
Sbjct  545   VSVGDGHKNPNYSELVRMVAEGELDAVVGDIAIVTSRTRIVDFTQPYASSGLVVVAPFRK  604

Query  1521  LNTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSLST  1700
             LN+GAWAFL PFS  MWGVTA FF+V+GIVVWILEHR+NDEFRG PK Q+ITILWFS ST
Sbjct  605   LNSGAWAFLRPFSPLMWGVTACFFIVIGIVVWILEHRINDEFRGPPKHQIITILWFSFST  664

Query  1701  LFFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESLKEGND  1880
             +FFAHRE+TVS LGR+VLIIWLFVVLIINSSYTASLTSILTVQQL SPIKGVESL   ND
Sbjct  665   MFFAHRESTVSALGRLVLIIWLFVVLIINSSYTASLTSILTVQQLSSPIKGVESLINSND  724

Query  1881  PIGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERPYVENF  2060
             PIGYQ+GSFAEHYL EE+ IS+SRL+ALGSPE YA+AL+ GP KGGV+A+VDERPYVE F
Sbjct  725   PIGYQVGSFAEHYLSEELNISESRLVALGSPEEYAKALQNGPGKGGVAAVVDERPYVELF  784

Query  2061  LSTQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLtrtscs  2240
             LSTQCKFRIVGQEFTKSGWGF FPRDSPLAVDMSTAIL+LSENGDLQRIHDKWL  ++CS
Sbjct  785   LSTQCKFRIVGQEFTKSGWGFVFPRDSPLAVDMSTAILALSENGDLQRIHDKWLATSACS  844

Query  2241  sestelesDRLHLKSFWglfllcgaacflalfIYFVQIMLKFRRVA  2378
             SESTELESDRLHLKSFWGLFL+CG ACF+AL IYF QI+ KFR  A
Sbjct  845   SESTELESDRLHLKSFWGLFLICGLACFVALVIYFFQILRKFRNAA  890


 Score =   573 bits (1477),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/381 (69%), Positives = 327/381 (86%), Gaps = 1/381 (0%)
 Frame = +2

Query  50    ILLVAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLR  229
             I ++ AL+FM+T+ +AI+GPQSSVVAH ISHVANELQVPLLSFAATDPTL+SLQFP+F+R
Sbjct  114   IGMIGALQFMETETIAIIGPQSSVVAHMISHVANELQVPLLSFAATDPTLSSLQFPFFVR  173

Query  230   TTQSDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPP  409
             TTQSD+YQM AI +++D+YGW+ VIA+FIDDDYGRNG++ALDDALA KR KIS+K GIPP
Sbjct  174   TTQSDLYQMKAITELVDYYGWRSVIAIFIDDDYGRNGVSALDDALAEKRLKISHKEGIPP  233

Query  410   GAT-TRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLST  586
             GA+ ++ +IMDILV+++++ESR++VLH  P  GF VFSVA YLGMM +GYVWI+TDWLS+
Sbjct  234   GASASQGDIMDILVKVSVLESRIIVLHVNPDIGFKVFSVARYLGMMQNGYVWIATDWLSS  293

Query  587   VLDSSSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLTGGSLGLNSYALYAYDSV  766
             VLD+SSPL S+ M+ MQGVLVLR+HTPDS+ KRAF SRWK LTGGSLGLNSY LYAYD+V
Sbjct  294   VLDTSSPLASDTMDSMQGVLVLRRHTPDSDRKRAFLSRWKKLTGGSLGLNSYGLYAYDTV  353

Query  767   WLIAHAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLT  946
             WL+AHA+D+F N+GG ISFSNDSKL SI   + HLE +++FDGG LLLNN+L+S+FVGLT
Sbjct  354   WLLAHALDAFFNQGGTISFSNDSKLLSIGRGSRHLEEMNVFDGGMLLLNNILKSNFVGLT  413

Query  947   GQFKFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKL  1126
             G FKF +D+SL  P++DI+NVIGTG+R IG+W NYSGLST  PE LY +PPN SS NQ+L
Sbjct  414   GPFKFTSDRSLYAPAFDIINVIGTGYRQIGYWSNYSGLSTETPEALYGKPPNRSSVNQRL  473

Query  1127  YGVVWPGQSVKKAPGVGFPEQ  1189
             YGVVWPG+++ K  G  FP  
Sbjct  474   YGVVWPGETLSKPRGWVFPNN  494



>ref|XP_007018097.1| Glutamate receptor 3.3 isoform 4 [Theobroma cacao]
 ref|XP_007018098.1| Glutamate receptor 3.3 isoform 4 [Theobroma cacao]
 gb|EOY15322.1| Glutamate receptor 3.3 isoform 4 [Theobroma cacao]
 gb|EOY15323.1| Glutamate receptor 3.3 isoform 4 [Theobroma cacao]
Length=843

 Score =   577 bits (1488),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/379 (70%), Positives = 322/379 (85%), Gaps = 1/379 (0%)
 Frame = +2

Query  56    LVAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTT  235
             +V AL++M+TDVVAI+GPQ +VVAH ISHVANELQVPLLSFA TDPTL+SLQFP+F+RTT
Sbjct  86    MVEALQYMETDVVAIIGPQCAVVAHIISHVANELQVPLLSFAVTDPTLSSLQFPFFVRTT  145

Query  236   QSDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGA  415
             QSD+YQM A+A++++HYGWKEVIA+FIDDD GRNG++AL+D LA +RC+ISYK GIPP +
Sbjct  146   QSDLYQMTAVAEIVEHYGWKEVIAIFIDDDGGRNGVSALNDKLAERRCRISYKVGIPPDS  205

Query  416   T-TRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVL  592
                R  IMDILV++ALM+SR++VLH     GF VFSVA+YLGMMG+GYVWI+TDWLS+VL
Sbjct  206   VANRGAIMDILVKVALMQSRIVVLHVNSMIGFKVFSVANYLGMMGNGYVWIATDWLSSVL  265

Query  593   DSSSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLTGGSLGLNSYALYAYDSVWL  772
             DS SPLPSE ME +QGVL LR HTPDS+ KRAF SRW  +TGGSLGLN+Y LYAYDSVWL
Sbjct  266   DSDSPLPSETMETIQGVLTLRPHTPDSDRKRAFFSRWNKITGGSLGLNTYGLYAYDSVWL  325

Query  773   IAHAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLTGQ  952
             +AHA+D F N+GG+ISFSNDS++ S+ GSTLHL+A+SIFD G LLL N+L S+FVGLTG 
Sbjct  326   LAHALDDFFNQGGIISFSNDSRISSVAGSTLHLDAMSIFDDGMLLLKNILLSNFVGLTGP  385

Query  953   FKFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKLYG  1132
              KFN D+SL+LP+YDI+NV+GTGFR IG+W NYSGLST  PETLY+R PN SSA+QKLY 
Sbjct  386   LKFNTDRSLILPAYDIINVLGTGFRRIGYWSNYSGLSTVSPETLYTRQPNRSSASQKLYS  445

Query  1133  VVWPGQSVKKAPGVGFPEQ  1189
             V+WPG++  K  G  FP  
Sbjct  446   VIWPGETSSKPRGWVFPNN  464


 Score =   343 bits (880),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 184/235 (78%), Positives = 212/235 (90%), Gaps = 0/235 (0%)
 Frame = +3

Query  1161  KPRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYAVPFQF  1340
             KPRGWVFPNNGKQLRIGVP R SY+EF+S+V GT+ FKGF +D+FTAAVNLLPYAVP++F
Sbjct  455   KPRGWVFPNNGKQLRIGVPNRASYREFVSRVRGTDFFKGFCIDIFTAAVNLLPYAVPYKF  514

Query  1341  VPFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPFKK  1520
             + FG+GR NPSY+ELV  ++TG FD  +GDIAIVTNRTK VDFTQPY++SGL++V+PFKK
Sbjct  515   ISFGDGRNNPSYTELVNKITTGDFDAVVGDIAIVTNRTKTVDFTQPYISSGLVIVSPFKK  574

Query  1521  LNTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSLST  1700
              NTGAWAFL PFS +MW VT  FF+VVGIVVWILEHR+ND+FRG PK Q+ITILWFS ST
Sbjct  575   QNTGAWAFLRPFSPRMWIVTGSFFLVVGIVVWILEHRINDDFRGPPKHQVITILWFSFST  634

Query  1701  LFFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESL  1865
             LFFAHRENT+STLGR+VLIIWLFVVLIINSSYTASLTSILTVQQL SPIKG++SL
Sbjct  635   LFFAHRENTMSTLGRLVLIIWLFVVLIINSSYTASLTSILTVQQLSSPIKGIDSL  689


 Score = 75.9 bits (185),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = +3

Query  2145  LAVDMSTAILSLSENGDLQRIHDKWLtrtscssestelesDRLHLKSFWglfllcgaacf  2324
             +AVDMSTAIL+L+ENGDLQRI DKWL +++CS ESTE+ES+RLHL SFWGLFL+CG ACF
Sbjct  693   VAVDMSTAILALAENGDLQRIRDKWLLQSTCSLESTEIESNRLHLSSFWGLFLICGIACF  752

Query  2325  lalfIYFVQIMLKFRRVARAEPVADG  2402
             +ALFIYF+QI+ + RRV   E  + G
Sbjct  753   IALFIYFLQILRQLRRVPPPESASTG  778



>gb|KDP36767.1| hypothetical protein JCGZ_08058 [Jatropha curcas]
Length=926

 Score =   580 bits (1494),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/411 (78%), Positives = 367/411 (89%), Gaps = 4/411 (1%)
 Frame = +3

Query  1161  KPRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYAVPFQF  1340
             KPRGWVFPNNGKQLRIGVPIRVS+KEF+++V GT+ FKGF +DVFTAA +LLPYAVP+QF
Sbjct  455   KPRGWVFPNNGKQLRIGVPIRVSFKEFVTRVQGTDMFKGFCIDVFTAAASLLPYAVPYQF  514

Query  1341  VPFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPFKK  1520
             VPFGNG+ NPSY+ELV +++TG  D  +GDIAIVTNRTK+VDFTQPY ASGL++VAPF+K
Sbjct  515   VPFGNGKANPSYTELVNMITTGVLDAVVGDIAIVTNRTKIVDFTQPYAASGLVIVAPFRK  574

Query  1521  LNTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSLST  1700
             L +GAWAFL PFS  MW VTA FF+ VG VVW+LEHR+NDEFRG PK Q+IT+LWFSLST
Sbjct  575   LKSGAWAFLQPFSPLMWVVTACFFIAVGTVVWVLEHRINDEFRGPPKHQIITVLWFSLST  634

Query  1701  LFFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESLKEGND  1880
             +FFAHRENTVSTLGR VLIIWLFVVLIINSSYTASLTSILTVQQL SPIKG+ESLKE +D
Sbjct  635   MFFAHRENTVSTLGRFVLIIWLFVVLIINSSYTASLTSILTVQQLSSPIKGIESLKESDD  694

Query  1881  PIGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHK-GGVSAIVDERPYVEN  2057
             PIGYQ+GSFAE+YL EE+GI+KSRL+ LGSPEAYA AL++GP+K GGV+A+VDERPYVE 
Sbjct  695   PIGYQVGSFAEYYLSEELGINKSRLVPLGSPEAYATALQRGPNKEGGVAAVVDERPYVEL  754

Query  2058  FLSTQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLtrtsc  2237
             FLSTQC FRIVGQEFTKSGWGFAFPRDSPLAVDMSTAIL L+ENGDLQRIHDKWL  + C
Sbjct  755   FLSTQCTFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILELTENGDLQRIHDKWLMHSGC  814

Query  2238  ssestelesDRLHLKSFWglfllcgaacflalfIYFVQIMLKFRRVARAEP  2390
             SS+++ELESDRL LKSFWGLFL+CG ACFL+LF+YF QI    R++  A P
Sbjct  815   SSDASELESDRLELKSFWGLFLICGIACFLSLFVYFWQIT---RQLYSAHP  862


 Score =   570 bits (1469),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/379 (70%), Positives = 318/379 (84%), Gaps = 1/379 (0%)
 Frame = +2

Query  56    LVAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTT  235
             +V ALKFM+TDVVAI+GPQSSVVAH ISHV NELQVPLLSFAATDPTL SLQFP+F+RT 
Sbjct  86    MVEALKFMETDVVAIIGPQSSVVAHIISHVVNELQVPLLSFAATDPTLNSLQFPFFVRTI  145

Query  236   QSDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGA  415
             QSD+YQM AIA+++++YGWK+VI++FIDDDYGRNGI AL D LA +RCKISYK GIPP +
Sbjct  146   QSDLYQMTAIAEIVNYYGWKQVISIFIDDDYGRNGILALSDKLAERRCKISYKLGIPPDS  205

Query  416   -TTRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVL  592
               +  EIMDILV++ALMESRV+VLH     GF VFSVA YLGMMG+GYVWI+TDWLS+VL
Sbjct  206   GVSNGEIMDILVKVALMESRVVVLHVNSKLGFEVFSVAKYLGMMGNGYVWIATDWLSSVL  265

Query  593   DSSSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLTGGSLGLNSYALYAYDSVWL  772
             DSSSPL SE M  MQGVL LRQH PDS+ KR+F+SRW  LT GS GLNSY L AYDSVWL
Sbjct  266   DSSSPLSSEAMGTMQGVLTLRQHIPDSDRKRSFSSRWSKLTSGSPGLNSYGLCAYDSVWL  325

Query  773   IAHAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLTGQ  952
             +AHAID+F ++GG+ISFSNDS+L+S  GS LHL+A+SIFD G LLL N+L+SD VGLTG 
Sbjct  326   VAHAIDAFFDQGGIISFSNDSRLRSAGGSDLHLDAMSIFDDGRLLLENILKSDLVGLTGP  385

Query  953   FKFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKLYG  1132
              K+++D+S +LP+YD++NV+GTGFR +GFW NYSGLST PPETLY RPPN SSANQ+LY 
Sbjct  386   IKYDSDRSRILPAYDVINVVGTGFRMVGFWSNYSGLSTVPPETLYIRPPNRSSANQQLYS  445

Query  1133  VVWPGQSVKKAPGVGFPEQ  1189
             V+WPG++  K  G  FP  
Sbjct  446   VIWPGETSSKPRGWVFPNN  464



>ref|XP_009372603.1| PREDICTED: glutamate receptor 3.3-like [Pyrus x bretschneideri]
Length=936

 Score =   579 bits (1493),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/413 (77%), Positives = 369/413 (89%), Gaps = 1/413 (0%)
 Frame = +3

Query  1161  KPRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGT-NTFKGFSVDVFTAAVNLLPYAVPFQ  1337
             KPRGWVFPNNGKQLRIGVPIRVS++EF+SQV GT N FKGF +DVFTAAVNLLPYAVP++
Sbjct  460   KPRGWVFPNNGKQLRIGVPIRVSFREFVSQVRGTDNMFKGFCIDVFTAAVNLLPYAVPYR  519

Query  1338  FVPFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPFK  1517
             F+PFG+G++NP+Y+ELV  ++TG FD A+GDIAIVTNRTK VDF+QPY ASGL+VVAPFK
Sbjct  520   FIPFGDGKKNPTYTELVTSIATGVFDAAVGDIAIVTNRTKNVDFSQPYAASGLVVVAPFK  579

Query  1518  KLNTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSLS  1697
             KLN+ AWAF  PF+A+MW VTA  F+VVGIVVWILEHR+ND+FRG PK+QLITILWFS+S
Sbjct  580   KLNSSAWAFFRPFTARMWVVTAASFLVVGIVVWILEHRINDDFRGPPKKQLITILWFSIS  639

Query  1698  TLFFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESLKEGN  1877
             TLFF+HRENTVSTLGR+VLIIWLFVVLIINSSYTASLTSILTVQ L SPIKG+ESLK  N
Sbjct  640   TLFFSHRENTVSTLGRVVLIIWLFVVLIINSSYTASLTSILTVQHLSSPIKGIESLKSSN  699

Query  1878  DPIGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERPYVEN  2057
             +PIGYQ+GSFAE YL EE+GI K+RLIALGSP+AYA AL+ GP KGGV+A+VDERPYVE 
Sbjct  700   EPIGYQVGSFAEQYLSEELGIPKNRLIALGSPQAYALALQLGPKKGGVAAVVDERPYVEL  759

Query  2058  FLSTQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLtrtsc  2237
             FLS+QCKFR+VG EFTKSGWGFAFPRDSPLAVDMSTAIL LSENGDLQRIHDKWL ++SC
Sbjct  760   FLSSQCKFRVVGPEFTKSGWGFAFPRDSPLAVDMSTAILQLSENGDLQRIHDKWLMQSSC  819

Query  2238  ssestelesDRLHLKSFWglfllcgaacflalfIYFVQIMLKFRRVARAEPVA  2396
               ++TELESDRLHLKSFWGLFL+CG AC ++LFIY +Q++ K R     + ++
Sbjct  820   GLDTTELESDRLHLKSFWGLFLICGIACSVSLFIYLLQVLNKLRHAEVTQHIS  872


 Score =   568 bits (1465),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/380 (68%), Positives = 322/380 (85%), Gaps = 2/380 (1%)
 Frame = +2

Query  56    LVAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTT  235
             +V AL+FM+TD+VA++GPQSSVVAH ISHV+NELQVPLLSFAATDPTL+S QFP+F+RTT
Sbjct  90    MVQALQFMETDIVAVIGPQSSVVAHIISHVSNELQVPLLSFAATDPTLSSFQFPFFVRTT  149

Query  236   QSDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPG-  412
              SD+YQM A+A+++DHYGWKEVIA++IDDDYGRNG++ LDD LA +RC+ISYK GIPPG 
Sbjct  150   HSDLYQMTAVAEIVDHYGWKEVIAIYIDDDYGRNGVSTLDDKLAERRCRISYKLGIPPGH  209

Query  413   ATTRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVL  592
               TR ++MD+LV+++ +ESRV+VLH  P  G  V SVA YL MMGDG+VWI+TDWLS++L
Sbjct  210   GATRGDLMDLLVKVSQLESRVIVLHVNPDLGLNVLSVAQYLQMMGDGFVWIATDWLSSLL  269

Query  593   DSSSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLTGGSLGLNSYALYAYDSVWL  772
             DS+ PL  E M+ MQGVLVLRQHTPDS+ KRAF S+W  LTGGSLG++SY LYAYDSVWL
Sbjct  270   DSALPLSPEIMDTMQGVLVLRQHTPDSDRKRAFFSKWNKLTGGSLGMHSYGLYAYDSVWL  329

Query  773   IAHAIDSFLNKGGVISFSNDSKLQSIE-GSTLHLEALSIFDGGPLLLNNLLQSDFVGLTG  949
             +AHAID+F N+GG+ISFSNDS + S++ G +LHL A+SIFD GPLLL N+LQS F+GLTG
Sbjct  330   VAHAIDAFFNQGGIISFSNDSMINSVDKGGSLHLAAMSIFDDGPLLLKNILQSSFLGLTG  389

Query  950   QFKFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKLY  1129
               KF++++SL LP+YDI+NV+GTGFR IG+WCNYSGLST PPE LYS+PPN SSA+Q+LY
Sbjct  390   PVKFDSERSLALPAYDIINVLGTGFRRIGYWCNYSGLSTVPPEMLYSKPPNRSSASQQLY  449

Query  1130  GVVWPGQSVKKAPGVGFPEQ  1189
              VVWPG+ V K  G  FP  
Sbjct  450   SVVWPGEMVSKPRGWVFPNN  469



>ref|XP_007018099.1| Glutamate receptor 3.3 isoform 6 [Theobroma cacao]
 gb|EOY15324.1| Glutamate receptor 3.3 isoform 6 [Theobroma cacao]
Length=870

 Score =   576 bits (1484),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/379 (70%), Positives = 322/379 (85%), Gaps = 1/379 (0%)
 Frame = +2

Query  56    LVAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTT  235
             +V AL++M+TDVVAI+GPQ +VVAH ISHVANELQVPLLSFA TDPTL+SLQFP+F+RTT
Sbjct  86    MVEALQYMETDVVAIIGPQCAVVAHIISHVANELQVPLLSFAVTDPTLSSLQFPFFVRTT  145

Query  236   QSDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGA  415
             QSD+YQM A+A++++HYGWKEVIA+FIDDD GRNG++AL+D LA +RC+ISYK GIPP +
Sbjct  146   QSDLYQMTAVAEIVEHYGWKEVIAIFIDDDGGRNGVSALNDKLAERRCRISYKVGIPPDS  205

Query  416   T-TRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVL  592
                R  IMDILV++ALM+SR++VLH     GF VFSVA+YLGMMG+GYVWI+TDWLS+VL
Sbjct  206   VANRGAIMDILVKVALMQSRIVVLHVNSMIGFKVFSVANYLGMMGNGYVWIATDWLSSVL  265

Query  593   DSSSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLTGGSLGLNSYALYAYDSVWL  772
             DS SPLPSE ME +QGVL LR HTPDS+ KRAF SRW  +TGGSLGLN+Y LYAYDSVWL
Sbjct  266   DSDSPLPSETMETIQGVLTLRPHTPDSDRKRAFFSRWNKITGGSLGLNTYGLYAYDSVWL  325

Query  773   IAHAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLTGQ  952
             +AHA+D F N+GG+ISFSNDS++ S+ GSTLHL+A+SIFD G LLL N+L S+FVGLTG 
Sbjct  326   LAHALDDFFNQGGIISFSNDSRISSVAGSTLHLDAMSIFDDGMLLLKNILLSNFVGLTGP  385

Query  953   FKFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKLYG  1132
              KFN D+SL+LP+YDI+NV+GTGFR IG+W NYSGLST  PETLY+R PN SSA+QKLY 
Sbjct  386   LKFNTDRSLILPAYDIINVLGTGFRRIGYWSNYSGLSTVSPETLYTRQPNRSSASQKLYS  445

Query  1133  VVWPGQSVKKAPGVGFPEQ  1189
             V+WPG++  K  G  FP  
Sbjct  446   VIWPGETSSKPRGWVFPNN  464


 Score =   249 bits (637),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 123/167 (74%), Positives = 146/167 (87%), Gaps = 0/167 (0%)
 Frame = +3

Query  1161  KPRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYAVPFQF  1340
             KPRGWVFPNNGKQLRIGVP R SY+EF+S+V GT+ FKGF +D+FTAAVNLLPYAVP++F
Sbjct  455   KPRGWVFPNNGKQLRIGVPNRASYREFVSRVRGTDFFKGFCIDIFTAAVNLLPYAVPYKF  514

Query  1341  VPFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPFKK  1520
             + FG+GR NPSY+ELV  ++TG FD  +GDIAIVTNRTK VDFTQPY++SGL++V+PFKK
Sbjct  515   ISFGDGRNNPSYTELVNKITTGDFDAVVGDIAIVTNRTKTVDFTQPYISSGLVIVSPFKK  574

Query  1521  LNTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPK  1661
              NTGAWAFL PFS +MW VT  FF+VVGIVVWILEHR+ND+FRG  K
Sbjct  575   QNTGAWAFLRPFSPRMWIVTGSFFLVVGIVVWILEHRINDDFRGPLK  621


 Score =   244 bits (623),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 135/187 (72%), Positives = 165/187 (88%), Gaps = 0/187 (0%)
 Frame = +3

Query  1842  PIKGVESLKEGNDPIGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGV  2021
             P+KG++SL + ++PIG+Q+GSFAEHYL +E+ IS+SRL+ALGSPEAYA AL+ GP KGGV
Sbjct  619   PLKGIDSLIKSDEPIGFQVGSFAEHYLSQELNISRSRLVALGSPEAYASALKLGPEKGGV  678

Query  2022  SAIVDERPYVENFLSTQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQ  2201
             +A+VDERPY+E FLS+QC FRIVGQEFTKSGWGFAFPRDSPLAVDMSTAIL+L+ENGDLQ
Sbjct  679   AAVVDERPYIELFLSSQCTFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILALAENGDLQ  738

Query  2202  RIHDKWLtrtscssestelesDRLHLKSFWglfllcgaacflalfIYFVQIMLKFRRVAR  2381
             RI DKWL +++CS ESTE+ES+RLHL SFWGLFL+CG ACF+ALFIYF+QI+ + RRV  
Sbjct  739   RIRDKWLLQSTCSLESTEIESNRLHLSSFWGLFLICGIACFIALFIYFLQILRQLRRVPP  798

Query  2382  AEPVADG  2402
              E  + G
Sbjct  799   PESASTG  805



>ref|XP_003527293.1| PREDICTED: glutamate receptor 3.3-like isoform X1 [Glycine max]
 ref|XP_006581132.1| PREDICTED: glutamate receptor 3.3-like isoform X2 [Glycine max]
 ref|XP_006581133.1| PREDICTED: glutamate receptor 3.3-like isoform X3 [Glycine max]
Length=929

 Score =   577 bits (1487),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/404 (76%), Positives = 367/404 (91%), Gaps = 0/404 (0%)
 Frame = +3

Query  1161  KPRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYAVPFQF  1340
             KPRGWVFPNNG+QLRIGVPIRVSY+EF++ V GT  FKGF VDVFTAAVNLLPYAVP++F
Sbjct  458   KPRGWVFPNNGRQLRIGVPIRVSYREFVAPVQGTEMFKGFCVDVFTAAVNLLPYAVPYRF  517

Query  1341  VPFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPFKK  1520
             VPFG+G +NPSY++LV L++TGYFDGAIGDIAIVTNRT++VDFTQPY ASGL+VVAPFKK
Sbjct  518   VPFGDGHKNPSYTQLVNLITTGYFDGAIGDIAIVTNRTRIVDFTQPYAASGLVVVAPFKK  577

Query  1521  LNTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSLST  1700
             +N+G W+FL PF+  MW VTA FF+ +GIV+WILEHR+NDEFRG P+QQ+IT+LWFSLST
Sbjct  578   INSGGWSFLQPFTPLMWIVTACFFLFIGIVIWILEHRINDEFRGPPRQQIITMLWFSLST  637

Query  1701  LFFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESLKEGND  1880
             LFF+HRENT+S+LGR+V++IWLFVVLI+ SSYTASLTSILTVQQLYSPI G+ESLK  ++
Sbjct  638   LFFSHRENTMSSLGRLVMLIWLFVVLILTSSYTASLTSILTVQQLYSPISGIESLKASDE  697

Query  1881  PIGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERPYVENF  2060
             PIG+Q+GSFAEHY+ +++GI+KSRLI LGSPE YA AL+ GP +GGV+AIVDERPYVE F
Sbjct  698   PIGFQVGSFAEHYMTQDLGIAKSRLIPLGSPEEYANALQLGPKRGGVAAIVDERPYVEIF  757

Query  2061  LSTQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLtrtscs  2240
             LS+QC FRIVGQEFT+SGWGFAFPRDSPLAVDMSTAIL LSE GDLQRIHDKW+TR+SCS
Sbjct  758   LSSQCTFRIVGQEFTRSGWGFAFPRDSPLAVDMSTAILQLSETGDLQRIHDKWMTRSSCS  817

Query  2241  sestelesDRLHLKSFWglfllcgaacflalfIYFVQIMLKFRR  2372
              E+ E++SDRL LKSFWGLFL+CG ACF+AL ++F+Q+M + R+
Sbjct  818   LENAEIDSDRLQLKSFWGLFLICGIACFIALVLHFLQLMFQLRQ  861


 Score =   536 bits (1380),  Expect = 5e-171, Method: Compositional matrix adjust.
 Identities = 250/381 (66%), Positives = 315/381 (83%), Gaps = 2/381 (1%)
 Frame = +2

Query  50    ILLVAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLR  229
             I +V AL+FM+TDV+AI+GPQSSV AH ISHVANEL+VPL+SFAATDPTL+SLQFP+F+R
Sbjct  88    IGMVQALRFMETDVIAIIGPQSSVTAHIISHVANELRVPLVSFAATDPTLSSLQFPFFVR  147

Query  230   TTQSDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPP  409
             TTQSD+YQM A+A++ID+YGWKEVIA+++DDDYGRNG+AALDD LAA+RC+IS+K GI  
Sbjct  148   TTQSDLYQMKAVAEIIDYYGWKEVIAIYVDDDYGRNGVAALDDELAARRCRISFKEGIKS  207

Query  410   GATT-RAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLST  586
             G    R EI  +LV++ALM+SRV+VLHA   +GFMVF++A YLGM G+GYVWI TDWLS+
Sbjct  208   GTEVDRGEITSLLVKVALMQSRVIVLHAQTDSGFMVFNLARYLGMTGNGYVWIVTDWLSS  267

Query  587   VLDSSSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLTGGSLGLNSYALYAYDSV  766
              LDSS  LPSE M+++QGVLVLR HTPDS+ KRAF SRWK LTGGSLGL+SY LYAYDSV
Sbjct  268   FLDSSY-LPSETMDVLQGVLVLRHHTPDSDRKRAFLSRWKKLTGGSLGLHSYGLYAYDSV  326

Query  767   WLIAHAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLT  946
              L+A AID+F ++GG++SF+N + L   +G  L+L+ +SIFD G LLL N+LQSDFVGL+
Sbjct  327   LLVARAIDAFFSQGGIVSFTNYTSLGGDKGGGLNLDVMSIFDNGTLLLKNILQSDFVGLS  386

Query  947   GQFKFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKL  1126
             G+ KF  D+SLV P+Y++LNV+G G R +G+W NYSGLS   PE LY++PPN SSANQKL
Sbjct  387   GRMKFEPDRSLVHPAYEVLNVVGNGLRRVGYWSNYSGLSIVTPEILYAKPPNRSSANQKL  446

Query  1127  YGVVWPGQSVKKAPGVGFPEQ  1189
             Y V+WPG+++ K  G  FP  
Sbjct  447   YSVIWPGETLSKPRGWVFPNN  467



>ref|XP_007018094.1| Glutamate receptor 3.3 isoform 1 [Theobroma cacao]
 ref|XP_007018095.1| Glutamate receptor 3.3 isoform 1 [Theobroma cacao]
 gb|EOY15319.1| Glutamate receptor 3.3 isoform 1 [Theobroma cacao]
 gb|EOY15320.1| Glutamate receptor 3.3 isoform 1 [Theobroma cacao]
Length=933

 Score =   577 bits (1486),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/379 (70%), Positives = 322/379 (85%), Gaps = 1/379 (0%)
 Frame = +2

Query  56    LVAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTT  235
             +V AL++M+TDVVAI+GPQ +VVAH ISHVANELQVPLLSFA TDPTL+SLQFP+F+RTT
Sbjct  86    MVEALQYMETDVVAIIGPQCAVVAHIISHVANELQVPLLSFAVTDPTLSSLQFPFFVRTT  145

Query  236   QSDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGA  415
             QSD+YQM A+A++++HYGWKEVIA+FIDDD GRNG++AL+D LA +RC+ISYK GIPP +
Sbjct  146   QSDLYQMTAVAEIVEHYGWKEVIAIFIDDDGGRNGVSALNDKLAERRCRISYKVGIPPDS  205

Query  416   T-TRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVL  592
                R  IMDILV++ALM+SR++VLH     GF VFSVA+YLGMMG+GYVWI+TDWLS+VL
Sbjct  206   VANRGAIMDILVKVALMQSRIVVLHVNSMIGFKVFSVANYLGMMGNGYVWIATDWLSSVL  265

Query  593   DSSSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLTGGSLGLNSYALYAYDSVWL  772
             DS SPLPSE ME +QGVL LR HTPDS+ KRAF SRW  +TGGSLGLN+Y LYAYDSVWL
Sbjct  266   DSDSPLPSETMETIQGVLTLRPHTPDSDRKRAFFSRWNKITGGSLGLNTYGLYAYDSVWL  325

Query  773   IAHAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLTGQ  952
             +AHA+D F N+GG+ISFSNDS++ S+ GSTLHL+A+SIFD G LLL N+L S+FVGLTG 
Sbjct  326   LAHALDDFFNQGGIISFSNDSRISSVAGSTLHLDAMSIFDDGMLLLKNILLSNFVGLTGP  385

Query  953   FKFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKLYG  1132
              KFN D+SL+LP+YDI+NV+GTGFR IG+W NYSGLST  PETLY+R PN SSA+QKLY 
Sbjct  386   LKFNTDRSLILPAYDIINVLGTGFRRIGYWSNYSGLSTVSPETLYTRQPNRSSASQKLYS  445

Query  1133  VVWPGQSVKKAPGVGFPEQ  1189
             V+WPG++  K  G  FP  
Sbjct  446   VIWPGETSSKPRGWVFPNN  464


 Score =   570 bits (1469),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/414 (76%), Positives = 369/414 (89%), Gaps = 0/414 (0%)
 Frame = +3

Query  1161  KPRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYAVPFQF  1340
             KPRGWVFPNNGKQLRIGVP R SY+EF+S+V GT+ FKGF +D+FTAAVNLLPYAVP++F
Sbjct  455   KPRGWVFPNNGKQLRIGVPNRASYREFVSRVRGTDFFKGFCIDIFTAAVNLLPYAVPYKF  514

Query  1341  VPFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPFKK  1520
             + FG+GR NPSY+ELV  ++TG FD  +GDIAIVTNRTK VDFTQPY++SGL++V+PFKK
Sbjct  515   ISFGDGRNNPSYTELVNKITTGDFDAVVGDIAIVTNRTKTVDFTQPYISSGLVIVSPFKK  574

Query  1521  LNTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSLST  1700
              NTGAWAFL PFS +MW VT  FF+VVGIVVWILEHR+ND+FRG PK Q+ITILWFS ST
Sbjct  575   QNTGAWAFLRPFSPRMWIVTGSFFLVVGIVVWILEHRINDDFRGPPKHQVITILWFSFST  634

Query  1701  LFFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESLKEGND  1880
             LFFAHRENT+STLGR+VLIIWLFVVLIINSSYTASLTSILTVQQL SPIKG++SL + ++
Sbjct  635   LFFAHRENTMSTLGRLVLIIWLFVVLIINSSYTASLTSILTVQQLSSPIKGIDSLIKSDE  694

Query  1881  PIGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERPYVENF  2060
             PIG+Q+GSFAEHYL +E+ IS+SRL+ALGSPEAYA AL+ GP KGGV+A+VDERPY+E F
Sbjct  695   PIGFQVGSFAEHYLSQELNISRSRLVALGSPEAYASALKLGPEKGGVAAVVDERPYIELF  754

Query  2061  LSTQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLtrtscs  2240
             LS+QC FRIVGQEFTKSGWGFAFPRDSPLAVDMSTAIL+L+ENGDLQRI DKWL +++CS
Sbjct  755   LSSQCTFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILALAENGDLQRIRDKWLLQSTCS  814

Query  2241  sestelesDRLHLKSFWglfllcgaacflalfIYFVQIMLKFRRVARAEPVADG  2402
              ESTE+ES+RLHL SFWGLFL+CG ACF+ALFIYF+QI+ + RRV   E  + G
Sbjct  815   LESTEIESNRLHLSSFWGLFLICGIACFIALFIYFLQILRQLRRVPPPESASTG  868



>ref|XP_007018096.1| Glutamate receptor 3.3 isoform 3 [Theobroma cacao]
 gb|EOY15321.1| Glutamate receptor 3.3 isoform 3 [Theobroma cacao]
Length=941

 Score =   576 bits (1485),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/379 (70%), Positives = 322/379 (85%), Gaps = 1/379 (0%)
 Frame = +2

Query  56    LVAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTT  235
             +V AL++M+TDVVAI+GPQ +VVAH ISHVANELQVPLLSFA TDPTL+SLQFP+F+RTT
Sbjct  86    MVEALQYMETDVVAIIGPQCAVVAHIISHVANELQVPLLSFAVTDPTLSSLQFPFFVRTT  145

Query  236   QSDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGA  415
             QSD+YQM A+A++++HYGWKEVIA+FIDDD GRNG++AL+D LA +RC+ISYK GIPP +
Sbjct  146   QSDLYQMTAVAEIVEHYGWKEVIAIFIDDDGGRNGVSALNDKLAERRCRISYKVGIPPDS  205

Query  416   T-TRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVL  592
                R  IMDILV++ALM+SR++VLH     GF VFSVA+YLGMMG+GYVWI+TDWLS+VL
Sbjct  206   VANRGAIMDILVKVALMQSRIVVLHVNSMIGFKVFSVANYLGMMGNGYVWIATDWLSSVL  265

Query  593   DSSSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLTGGSLGLNSYALYAYDSVWL  772
             DS SPLPSE ME +QGVL LR HTPDS+ KRAF SRW  +TGGSLGLN+Y LYAYDSVWL
Sbjct  266   DSDSPLPSETMETIQGVLTLRPHTPDSDRKRAFFSRWNKITGGSLGLNTYGLYAYDSVWL  325

Query  773   IAHAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLTGQ  952
             +AHA+D F N+GG+ISFSNDS++ S+ GSTLHL+A+SIFD G LLL N+L S+FVGLTG 
Sbjct  326   LAHALDDFFNQGGIISFSNDSRISSVAGSTLHLDAMSIFDDGMLLLKNILLSNFVGLTGP  385

Query  953   FKFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKLYG  1132
              KFN D+SL+LP+YDI+NV+GTGFR IG+W NYSGLST  PETLY+R PN SSA+QKLY 
Sbjct  386   LKFNTDRSLILPAYDIINVLGTGFRRIGYWSNYSGLSTVSPETLYTRQPNRSSASQKLYS  445

Query  1133  VVWPGQSVKKAPGVGFPEQ  1189
             V+WPG++  K  G  FP  
Sbjct  446   VIWPGETSSKPRGWVFPNN  464


 Score =   560 bits (1443),  Expect = 3e-180, Method: Compositional matrix adjust.
 Identities = 313/422 (74%), Positives = 368/422 (87%), Gaps = 8/422 (2%)
 Frame = +3

Query  1161  KPRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYAVPFQF  1340
             KPRGWVFPNNGKQLRIGVP R SY+EF+S+V GT+ FKGF +D+FTAAVNLLPYAVP++F
Sbjct  455   KPRGWVFPNNGKQLRIGVPNRASYREFVSRVRGTDFFKGFCIDIFTAAVNLLPYAVPYKF  514

Query  1341  VPFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPFKK  1520
             + FG+GR NPSY+ELV  ++TG FD  +GDIAIVTNRTK VDFTQPY++SGL++V+PFKK
Sbjct  515   ISFGDGRNNPSYTELVNKITTGDFDAVVGDIAIVTNRTKTVDFTQPYISSGLVIVSPFKK  574

Query  1521  LNTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSLST  1700
              NTGAWAFL PFS +MW VT  FF+VVGIVVWILEHR+ND+FRG PK Q+ITILWFS ST
Sbjct  575   QNTGAWAFLRPFSPRMWIVTGSFFLVVGIVVWILEHRINDDFRGPPKHQVITILWFSFST  634

Query  1701  LFFAHR--------ENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGV  1856
             LFFAH         ENT+STLGR+VLIIWLFVVLIINSSYTASLTSILTVQQL SPIKG+
Sbjct  635   LFFAHTGHFIAFAGENTMSTLGRLVLIIWLFVVLIINSSYTASLTSILTVQQLSSPIKGI  694

Query  1857  ESLKEGNDPIGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVD  2036
             +SL + ++PIG+Q+GSFAEHYL +E+ IS+SRL+ALGSPEAYA AL+ GP KGGV+A+VD
Sbjct  695   DSLIKSDEPIGFQVGSFAEHYLSQELNISRSRLVALGSPEAYASALKLGPEKGGVAAVVD  754

Query  2037  ERPYVENFLSTQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDK  2216
             ERPY+E FLS+QC FRIVGQEFTKSGWGFAFPRDSPLAVDMSTAIL+L+ENGDLQRI DK
Sbjct  755   ERPYIELFLSSQCTFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILALAENGDLQRIRDK  814

Query  2217  WLtrtscssestelesDRLHLKSFWglfllcgaacflalfIYFVQIMLKFRRVARAEPVA  2396
             WL +++CS ESTE+ES+RLHL SFWGLFL+CG ACF+ALFIYF+QI+ + RRV   E  +
Sbjct  815   WLLQSTCSLESTEIESNRLHLSSFWGLFLICGIACFIALFIYFLQILRQLRRVPPPESAS  874

Query  2397  DG  2402
              G
Sbjct  875   TG  876



>ref|XP_003603849.1| Glutamate-gated kainate-type ion channel receptor subunit GluR5 
[Medicago truncatula]
 gb|AES74100.1| glutamate receptor 3.2 [Medicago truncatula]
Length=914

 Score =   574 bits (1480),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/409 (77%), Positives = 365/409 (89%), Gaps = 0/409 (0%)
 Frame = +3

Query  1146  GSR*KKPRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYA  1325
             G    +PRGWVFPNNGKQLRIGVPIR SY+EF+S V GT+ FKGF VDVF AAVNLLPYA
Sbjct  448   GETTSRPRGWVFPNNGKQLRIGVPIRASYREFVSPVKGTDLFKGFCVDVFVAAVNLLPYA  507

Query  1326  VPFQFVPFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVV  1505
             VP++FVPFG+G +NPSY+E V  ++TGYFDGA+GDIAIVTNRT++VDFTQPY ASGL+VV
Sbjct  508   VPYRFVPFGDGHKNPSYTEFVNKITTGYFDGAVGDIAIVTNRTRIVDFTQPYAASGLVVV  567

Query  1506  APFKKLNTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILW  1685
             APFKK+N+G W+FL PF+  MW VTA FF  VGIVVWILEHR+NDEFRGSPKQQ +TILW
Sbjct  568   APFKKINSGGWSFLQPFTPFMWIVTACFFFFVGIVVWILEHRVNDEFRGSPKQQFVTILW  627

Query  1686  FSLSTLFFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESL  1865
             FSLSTLFF+HRENT+STLGR V++IWLFVVLIINSSYTASLTSILTVQQL S I G+ESL
Sbjct  628   FSLSTLFFSHRENTMSTLGRGVVLIWLFVVLIINSSYTASLTSILTVQQLSSRISGIESL  687

Query  1866  KEGNDPIGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERP  2045
             K  ++PIG+Q+GSFAEHYL E+IGIS+SRL+ LGSPE YA+AL+ GP+KGGV+AIVDERP
Sbjct  688   KASDEPIGFQVGSFAEHYLTEDIGISRSRLVPLGSPEEYAKALQLGPNKGGVAAIVDERP  747

Query  2046  YVENFLSTQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLt  2225
             YVE FLSTQC FRIVGQEFT+SGWGFAFPRDSPLAVD+STAIL LSE GDLQRIHDKW+T
Sbjct  748   YVEIFLSTQCTFRIVGQEFTRSGWGFAFPRDSPLAVDLSTAILQLSETGDLQRIHDKWMT  807

Query  2226  rtscssestelesDRLHLKSFWglfllcgaacflalfIYFVQIMLKFRR  2372
             R++CS ++TE+ESDRL LKSFWGLF++CGAACF+AL IYF+QIML  R 
Sbjct  808   RSTCSLDNTEIESDRLQLKSFWGLFIICGAACFIALVIYFLQIMLLVRH  856


 Score =   522 bits (1344),  Expect = 8e-166, Method: Compositional matrix adjust.
 Identities = 236/379 (62%), Positives = 313/379 (83%), Gaps = 2/379 (1%)
 Frame = +2

Query  56    LVAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTT  235
             ++ AL+FM+TDV+AILGPQSSVV+H ++HVANEL+VP+LSFAATDPTL+SLQFP+F+RTT
Sbjct  85    MIQALRFMETDVIAILGPQSSVVSHIVAHVANELRVPMLSFAATDPTLSSLQFPFFVRTT  144

Query  236   QSDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGA  415
              SD+YQM A+A++ID YGWKEVI +++DDDYGRNG++ALDDALA +RC+ISYK GI  G 
Sbjct  145   LSDLYQMTAVAEIIDFYGWKEVITIYVDDDYGRNGVSALDDALAERRCRISYKVGIKSGP  204

Query  416   TT-RAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVL  592
                R EI ++LV +A+M+SR++V+HA+  +GFM+F VAHYLGMM +GYVWI+TDWLSTVL
Sbjct  205   DVDRGEITNLLVNVAMMQSRIIVVHAHSNSGFMIFKVAHYLGMMQEGYVWIATDWLSTVL  264

Query  593   DSSSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLTGGSLGLNSYALYAYDSVWL  772
             DS+S LP E M+ +QG LVLRQHTPD++ K+ FTS+W +LTGGSLGLNSY L+AYD+VWL
Sbjct  265   DSTS-LPLETMDTLQGALVLRQHTPDTDRKKMFTSKWNNLTGGSLGLNSYGLHAYDTVWL  323

Query  773   IAHAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLTGQ  952
             +A AID+F ++GGV+S +N + L S +   L+L+A+SIFD G LLLNN+L+S+FVGL+G 
Sbjct  324   VAQAIDNFFSQGGVVSCTNYTSLHSDKAGGLNLDAMSIFDNGTLLLNNILRSNFVGLSGP  383

Query  953   FKFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKLYG  1132
              K ++++SL  P+YDI+NV+G G R +G+W NYSGLS   PETLY+ PPN SSANQ L+ 
Sbjct  384   IKLDSERSLFRPAYDIINVVGNGVRRVGYWSNYSGLSIVSPETLYANPPNRSSANQHLHT  443

Query  1133  VVWPGQSVKKAPGVGFPEQ  1189
             V+WPG++  +  G  FP  
Sbjct  444   VIWPGETTSRPRGWVFPNN  462



>ref|XP_007135963.1| hypothetical protein PHAVU_009G006500g [Phaseolus vulgaris]
 ref|XP_007135964.1| hypothetical protein PHAVU_009G006500g [Phaseolus vulgaris]
 gb|ESW07957.1| hypothetical protein PHAVU_009G006500g [Phaseolus vulgaris]
 gb|ESW07958.1| hypothetical protein PHAVU_009G006500g [Phaseolus vulgaris]
Length=918

 Score =   574 bits (1479),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/412 (75%), Positives = 369/412 (90%), Gaps = 0/412 (0%)
 Frame = +3

Query  1161  KPRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYAVPFQF  1340
             KPRGWVFPNNG+QLRIGVPIRVSY+EF+S V GT  F GF VDVFTAA+NLLPYAVP++F
Sbjct  453   KPRGWVFPNNGRQLRIGVPIRVSYREFLSPVKGTQMFNGFCVDVFTAALNLLPYAVPYRF  512

Query  1341  VPFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPFKK  1520
             VPFG+G +NPSY+ELV L++TGYFDGAIGDIAIVTNRT++VDFTQPY +SGL+VVAPF K
Sbjct  513   VPFGDGHKNPSYTELVHLITTGYFDGAIGDIAIVTNRTRIVDFTQPYASSGLVVVAPFTK  572

Query  1521  LNTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSLST  1700
             +N+G WAFL PF+  MW VTA FF+++GIV+WILEHR+NDEFRG P+QQ+IT+LWFSLST
Sbjct  573   INSGGWAFLQPFTTLMWIVTATFFLLIGIVIWILEHRINDEFRGPPRQQIITMLWFSLST  632

Query  1701  LFFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESLKEGND  1880
             LFF+HRENT+S+LGR V++IWLFVVLI+ SSYTASLTSILTVQQL S I G++SLK  ++
Sbjct  633   LFFSHRENTMSSLGRFVMLIWLFVVLILTSSYTASLTSILTVQQLSSRISGIDSLKASDE  692

Query  1881  PIGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERPYVENF  2060
             PIG+Q+GSFAEHYLI++IGISKSRLIALGSPE YA+AL+ GP +GGV+AIVDERPYVE F
Sbjct  693   PIGFQVGSFAEHYLIQDIGISKSRLIALGSPEEYAKALQLGPKRGGVAAIVDERPYVEIF  752

Query  2061  LSTQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLtrtscs  2240
             LS+QC FRIVGQEFT+SGWGFAFPRDSPLAVDMSTAIL LSE GDLQRIHDKW+TR+SCS
Sbjct  753   LSSQCTFRIVGQEFTRSGWGFAFPRDSPLAVDMSTAILQLSETGDLQRIHDKWMTRSSCS  812

Query  2241  sestelesDRLHLKSFWglfllcgaacflalfIYFVQIMLKFRRVARAEPVA  2396
              ++ E++SDRL LKSFWGLF++CG ACF+AL ++F+QI+ +  +   +EP A
Sbjct  813   LDNAEIDSDRLQLKSFWGLFIICGIACFVALLLHFLQIIFQLWKSPPSEPAA  864


 Score =   511 bits (1317),  Expect = 7e-162, Method: Compositional matrix adjust.
 Identities = 251/380 (66%), Positives = 312/380 (82%), Gaps = 3/380 (1%)
 Frame = +2

Query  56    LVAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTT  235
             +V AL+FM+TDVVAI+GPQSSVVAH ISHVANEL+VPLLSFAATDPTL SLQFP+F+RTT
Sbjct  84    MVQALRFMETDVVAIIGPQSSVVAHIISHVANELRVPLLSFAATDPTLTSLQFPFFVRTT  143

Query  236   QSDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGA  415
             QSD+YQM A+A++ID+YGWKEVIA+++DDDYGRNG+AALDD LAA+RC+IS+K GI  G 
Sbjct  144   QSDLYQMKAVAEIIDYYGWKEVIAIYVDDDYGRNGVAALDDELAARRCRISFKEGINSGT  203

Query  416   -TTRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVL  592
                R +I  +LV++ALM+SRV+VLHA    GFMVF+VA YLGM  +GYVWI TDWLS++L
Sbjct  204   EVNRGDITSLLVKVALMQSRVIVLHAQTDYGFMVFNVARYLGMTDNGYVWIVTDWLSSLL  263

Query  593   DSSSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLTGGSLGLNSYALYAYDSVWL  772
               S+ LPSE M+++QGVLVLRQHTPDS+ KRAF SRW  LTGGSLGL+SY LYAYDSVWL
Sbjct  264   -DSASLPSETMDVLQGVLVLRQHTPDSDRKRAFFSRWNKLTGGSLGLHSYGLYAYDSVWL  322

Query  773   IAHAIDSFLNKGGVISFSNDSKL-QSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLTG  949
             +A AID+F ++GG +S +N + L    +G  L+L+A+SIFD G LLL N+LQSDFVGL+G
Sbjct  323   VARAIDAFFSQGGDLSCTNYTSLGGENKGGDLNLDAMSIFDNGTLLLKNILQSDFVGLSG  382

Query  950   QFKFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKLY  1129
             + KF  D+SLV P+YD+LNV+GTG R +G+W NYSGLS   PE LY++ PN SSANQKLY
Sbjct  383   RMKFEPDRSLVHPAYDVLNVVGTGLRRVGYWSNYSGLSIVSPEILYAKLPNRSSANQKLY  442

Query  1130  GVVWPGQSVKKAPGVGFPEQ  1189
              V+WPG+++ K  G  FP  
Sbjct  443   SVIWPGETLSKPRGWVFPNN  462



>gb|KEH36346.1| glutamate receptor 3.2 [Medicago truncatula]
Length=959

 Score =   575 bits (1482),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/409 (77%), Positives = 365/409 (89%), Gaps = 0/409 (0%)
 Frame = +3

Query  1146  GSR*KKPRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYA  1325
             G    +PRGWVFPNNGKQLRIGVPIR SY+EF+S V GT+ FKGF VDVF AAVNLLPYA
Sbjct  493   GETTSRPRGWVFPNNGKQLRIGVPIRASYREFVSPVKGTDLFKGFCVDVFVAAVNLLPYA  552

Query  1326  VPFQFVPFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVV  1505
             VP++FVPFG+G +NPSY+E V  ++TGYFDGA+GDIAIVTNRT++VDFTQPY ASGL+VV
Sbjct  553   VPYRFVPFGDGHKNPSYTEFVNKITTGYFDGAVGDIAIVTNRTRIVDFTQPYAASGLVVV  612

Query  1506  APFKKLNTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILW  1685
             APFKK+N+G W+FL PF+  MW VTA FF  VGIVVWILEHR+NDEFRGSPKQQ +TILW
Sbjct  613   APFKKINSGGWSFLQPFTPFMWIVTACFFFFVGIVVWILEHRVNDEFRGSPKQQFVTILW  672

Query  1686  FSLSTLFFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESL  1865
             FSLSTLFF+HRENT+STLGR V++IWLFVVLIINSSYTASLTSILTVQQL S I G+ESL
Sbjct  673   FSLSTLFFSHRENTMSTLGRGVVLIWLFVVLIINSSYTASLTSILTVQQLSSRISGIESL  732

Query  1866  KEGNDPIGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERP  2045
             K  ++PIG+Q+GSFAEHYL E+IGIS+SRL+ LGSPE YA+AL+ GP+KGGV+AIVDERP
Sbjct  733   KASDEPIGFQVGSFAEHYLTEDIGISRSRLVPLGSPEEYAKALQLGPNKGGVAAIVDERP  792

Query  2046  YVENFLSTQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLt  2225
             YVE FLSTQC FRIVGQEFT+SGWGFAFPRDSPLAVD+STAIL LSE GDLQRIHDKW+T
Sbjct  793   YVEIFLSTQCTFRIVGQEFTRSGWGFAFPRDSPLAVDLSTAILQLSETGDLQRIHDKWMT  852

Query  2226  rtscssestelesDRLHLKSFWglfllcgaacflalfIYFVQIMLKFRR  2372
             R++CS ++TE+ESDRL LKSFWGLF++CGAACF+AL IYF+QIML  R 
Sbjct  853   RSTCSLDNTEIESDRLQLKSFWGLFIICGAACFIALVIYFLQIMLLVRH  901


 Score =   522 bits (1345),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 236/379 (62%), Positives = 313/379 (83%), Gaps = 2/379 (1%)
 Frame = +2

Query  56    LVAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTT  235
             ++ AL+FM+TDV+AILGPQSSVV+H ++HVANEL+VP+LSFAATDPTL+SLQFP+F+RTT
Sbjct  130   MIQALRFMETDVIAILGPQSSVVSHIVAHVANELRVPMLSFAATDPTLSSLQFPFFVRTT  189

Query  236   QSDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGA  415
              SD+YQM A+A++ID YGWKEVI +++DDDYGRNG++ALDDALA +RC+ISYK GI  G 
Sbjct  190   LSDLYQMTAVAEIIDFYGWKEVITIYVDDDYGRNGVSALDDALAERRCRISYKVGIKSGP  249

Query  416   TT-RAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVL  592
                R EI ++LV +A+M+SR++V+HA+  +GFM+F VAHYLGMM +GYVWI+TDWLSTVL
Sbjct  250   DVDRGEITNLLVNVAMMQSRIIVVHAHSNSGFMIFKVAHYLGMMQEGYVWIATDWLSTVL  309

Query  593   DSSSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLTGGSLGLNSYALYAYDSVWL  772
             DS+S LP E M+ +QG LVLRQHTPD++ K+ FTS+W +LTGGSLGLNSY L+AYD+VWL
Sbjct  310   DSTS-LPLETMDTLQGALVLRQHTPDTDRKKMFTSKWNNLTGGSLGLNSYGLHAYDTVWL  368

Query  773   IAHAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLTGQ  952
             +A AID+F ++GGV+S +N + L S +   L+L+A+SIFD G LLLNN+L+S+FVGL+G 
Sbjct  369   VAQAIDNFFSQGGVVSCTNYTSLHSDKAGGLNLDAMSIFDNGTLLLNNILRSNFVGLSGP  428

Query  953   FKFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKLYG  1132
              K ++++SL  P+YDI+NV+G G R +G+W NYSGLS   PETLY+ PPN SSANQ L+ 
Sbjct  429   IKLDSERSLFRPAYDIINVVGNGVRRVGYWSNYSGLSIVSPETLYANPPNRSSANQHLHT  488

Query  1133  VVWPGQSVKKAPGVGFPEQ  1189
             V+WPG++  +  G  FP  
Sbjct  489   VIWPGETTSRPRGWVFPNN  507



>ref|XP_006577929.1| PREDICTED: glutamate receptor 3.3-like [Glycine max]
Length=925

 Score =   574 bits (1479),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/402 (76%), Positives = 364/402 (91%), Gaps = 0/402 (0%)
 Frame = +3

Query  1161  KPRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYAVPFQF  1340
             KPRGWVFPNNG+QLRIGVPIRVSY+EF++ V GT  FKGF VDVFTAAVNLLPYAVP++F
Sbjct  458   KPRGWVFPNNGRQLRIGVPIRVSYREFVAPVQGTEMFKGFCVDVFTAAVNLLPYAVPYRF  517

Query  1341  VPFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPFKK  1520
             VPFG+G +NPSY++LV L++TGYFDGAIGDIAIVTNRT++VDFTQPY ASGL+VVAPFKK
Sbjct  518   VPFGDGHKNPSYTQLVNLITTGYFDGAIGDIAIVTNRTRIVDFTQPYAASGLVVVAPFKK  577

Query  1521  LNTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSLST  1700
             +N+G W+FL PF+  MW VT   F+ +GIVVWILEHR+NDEFRG P+QQ+IT+LWFSLST
Sbjct  578   INSGGWSFLQPFTPLMWIVTGCLFLFIGIVVWILEHRINDEFRGPPRQQIITMLWFSLST  637

Query  1701  LFFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESLKEGND  1880
             LFF+HRENT+S+LGR+V++IWLFVVLI+ SSYTASLTSILTVQQLYSPI G+ESLK  ++
Sbjct  638   LFFSHRENTMSSLGRLVMLIWLFVVLILTSSYTASLTSILTVQQLYSPISGIESLKASDE  697

Query  1881  PIGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERPYVENF  2060
             PIG+ +GSFAEHYLI+++GI+KSRLI LGSPE YA+AL+ GP +GGV+AIVDERPYVE F
Sbjct  698   PIGFPVGSFAEHYLIQDLGIAKSRLIPLGSPEEYAKALQLGPKRGGVAAIVDERPYVEIF  757

Query  2061  LSTQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLtrtscs  2240
             LS+QC FRIVGQEFT+SGWGFAFPRDSPLAVDMSTAIL LSE GDLQRIHDKW+TR+SCS
Sbjct  758   LSSQCTFRIVGQEFTRSGWGFAFPRDSPLAVDMSTAILQLSETGDLQRIHDKWMTRSSCS  817

Query  2241  sestelesDRLHLKSFWglfllcgaacflalfIYFVQIMLKF  2366
              E+ E++SDRL LKSFWGLFL+CG ACF+AL ++F+Q+M + 
Sbjct  818   LENAEIDSDRLQLKSFWGLFLICGIACFIALVLHFMQLMFQL  859


 Score =   520 bits (1338),  Expect = 8e-165, Method: Compositional matrix adjust.
 Identities = 248/379 (65%), Positives = 313/379 (83%), Gaps = 2/379 (1%)
 Frame = +2

Query  56    LVAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTT  235
             +V AL+FM+TDV+AI+GPQSSV AH ISHVANEL+VPL+SFAATDPTL+SLQFP+F+RTT
Sbjct  90    MVQALRFMETDVIAIIGPQSSVTAHIISHVANELRVPLVSFAATDPTLSSLQFPFFVRTT  149

Query  236   QSDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGA  415
             QSD+YQM A+A++ID+YGWKEVIA+++DDDYGRNG+AALDD LA++RC+IS+K GI  G 
Sbjct  150   QSDLYQMKAVAEIIDYYGWKEVIAIYVDDDYGRNGVAALDDELASRRCRISFKEGIKSGT  209

Query  416   TT-RAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVL  592
                R EI  +LV++ALM+SRV+VLHA   +GFM+F++A YLGM  +GYVWI TDWLS+ L
Sbjct  210   KVDRGEITSLLVKVALMQSRVIVLHAQTDSGFMIFNLARYLGMTDNGYVWIVTDWLSSFL  269

Query  593   DSSSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLTGGSLGLNSYALYAYDSVWL  772
             DSSS   SE M+++QGVLVLRQHTPDS+ KRAF SRWK LTGGSLGL+SY LYAYDSVWL
Sbjct  270   DSSSLP-SETMDVLQGVLVLRQHTPDSDRKRAFLSRWKKLTGGSLGLHSYGLYAYDSVWL  328

Query  773   IAHAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLTGQ  952
             +A AID+F ++GG++S +N + L   +G  L+L+A+SIFD G LLL N+LQSDFVGL+GQ
Sbjct  329   VARAIDAFFSQGGIVSCTNYTSLGGDKGGDLNLDAMSIFDNGTLLLKNILQSDFVGLSGQ  388

Query  953   FKFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKLYG  1132
              KF  D+SLV P+YD+LNV+G G R +G+W NYSGLS   PE  Y++PPN SSANQKLY 
Sbjct  389   MKFEPDRSLVHPAYDVLNVVGNGLRRVGYWSNYSGLSIVSPEIFYAKPPNRSSANQKLYS  448

Query  1133  VVWPGQSVKKAPGVGFPEQ  1189
             V+WPG+++ K  G  FP  
Sbjct  449   VIWPGETLSKPRGWVFPNN  467



>ref|NP_174978.1| glutamate receptor 3.3 [Arabidopsis thaliana]
 sp|Q9C8E7.1|GLR33_ARATH RecName: Full=Glutamate receptor 3.3; AltName: Full=Ligand-gated 
ion channel 3.3; Flags: Precursor [Arabidopsis thaliana]
 gb|AAG51316.1|AC025815_3 ligand-gated ion channel, putative [Arabidopsis thaliana]
 gb|AEE31925.1| glutamate receptor 3.3 [Arabidopsis thaliana]
Length=933

 Score =   574 bits (1479),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/449 (71%), Positives = 379/449 (84%), Gaps = 3/449 (1%)
 Frame = +3

Query  1056  GCQLLLPRL-FTRDRPIVQVQIKNYMV*FGLGSR*KKPRGWVFPNNGKQLRIGVPIRVSY  1232
             G   +LP L +T+++P +    K   V +  G    KPRGWVF NNGK+L+IGVP+RVSY
Sbjct  418   GLSTVLPELLYTKEKPNMSTSPKLKHVIWP-GETFTKPRGWVFSNNGKELKIGVPLRVSY  476

Query  1233  KEFISQVPGT-NTFKGFSVDVFTAAVNLLPYAVPFQFVPFGNGRENPSYSELVRLVSTGY  1409
             KEF+SQ+ GT N FKGF +DVFTAAVNLLPYAVP +F+P+GNG+ENPSY+ +V +++TG 
Sbjct  477   KEFVSQIRGTENMFKGFCIDVFTAAVNLLPYAVPVKFIPYGNGKENPSYTHMVEMITTGN  536

Query  1410  FDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPFKKLNTGAWAFLTPFSAQMWGvtaff  1589
             FDG +GD+AIVTNRTK+VDFTQPY ASGL+VVAPFKKLN+GAWAFL PF+  MW VT   
Sbjct  537   FDGVVGDVAIVTNRTKIVDFTQPYAASGLVVVAPFKKLNSGAWAFLRPFNRLMWAVTGCC  596

Query  1590  fvvvgivvWILEHRMNDEFRGSPKQQLITILWFSLSTLFFAHRENTVSTLGRMvliiwlf  1769
             F+ VGIVVWILEHR NDEFRG PK+Q +TILWFS ST+FFAHRENTVSTLGR+VLIIWLF
Sbjct  597   FLFVGIVVWILEHRTNDEFRGPPKRQCVTILWFSFSTMFFAHRENTVSTLGRLVLIIWLF  656

Query  1770  vvliiNSSYTASLTSILTVQQLYSPIKGVESLKEGNDPIGYQIGSFAEHYLIEEIGISKS  1949
             VVLIINSSYTASLTSILTVQQL SPIKG+ESL+E +DPIGYQ+GSFAE YL  E+ IS+S
Sbjct  657   VVLIINSSYTASLTSILTVQQLSSPIKGIESLRERDDPIGYQVGSFAESYLRNELNISES  716

Query  1950  RLIALGSPEAYAEALEKGPHKGGVSAIVDERPYVENFLSTQCKFRIVGQEFTKSGWGFAF  2129
             RL+ LG+PEAYA+AL+ GP KGGV+AIVDERPYVE FLS+ C +RIVGQEFTKSGWGFAF
Sbjct  717   RLVPLGTPEAYAKALKDGPSKGGVAAIVDERPYVELFLSSNCAYRIVGQEFTKSGWGFAF  776

Query  2130  PRDSPLAVDMSTAILSLSENGDLQRIHDKWLtrtscssestelesDRLHLKSFWglfllc  2309
             PRDSPLA+D+STAIL L+ENGDLQRIHDKWL + +C+ E+ ELESDRLHLKSFWGLFL+C
Sbjct  777   PRDSPLAIDLSTAILELAENGDLQRIHDKWLMKNACTLENAELESDRLHLKSFWGLFLIC  836

Query  2310  gaacflalfIYFVQIMLKFRRVARAEPVA  2396
             G AC LALF+YFVQI+ +  +    + +A
Sbjct  837   GVACLLALFLYFVQIIRQLYKKPTDDAIA  865


 Score =   475 bits (1222),  Expect = 8e-148, Method: Compositional matrix adjust.
 Identities = 221/374 (59%), Positives = 288/374 (77%), Gaps = 2/374 (1%)
 Frame = +2

Query  56    LVAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTT  235
             +V AL+FM+ D+V I+GPQ SVVAH ISH+ANEL+VPLLSFA TDP ++ LQFPYF+RTT
Sbjct  83    MVEALRFMEKDIVGIIGPQCSVVAHMISHMANELRVPLLSFAVTDPVMSPLQFPYFIRTT  142

Query  236   QSDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGI-PPG  412
             QSD+YQM AIA ++D YGWKEVIAVF+DDD+GRNG+AAL+D LA++R +I+YKAG+ P  
Sbjct  143   QSDLYQMDAIASIVDFYGWKEVIAVFVDDDFGRNGVAALNDKLASRRLRITYKAGLHPDT  202

Query  413   ATTRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVL  592
             A  + EIM++L++I L++ R++V+H Y   GF VF  A YLGMMG+GYVWI+TDWLST L
Sbjct  203   AVNKNEIMNMLIKIMLLQPRIVVIHVYSELGFAVFKEAKYLGMMGNGYVWIATDWLSTNL  262

Query  593   DSSSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLTGGSLGLNSYALYAYDSVWL  772
             DSSSPLP+E++E +QGVLVLR HTPDS+ KR F  RW+ ++G SL LN+Y LYAYDSV L
Sbjct  263   DSSSPLPAERLETIQGVLVLRPHTPDSDFKREFFKRWRKMSGASLALNTYGLYAYDSVML  322

Query  773   IAHAIDSFLNKGGVISFSNDSKLQSIEGS-TLHLEALSIFDGGPLLLNNLLQSDFVGLTG  949
             +A  +D F   GG ISFSN S L ++  S  L+LEA+++FDGG  LL ++L +  VGLTG
Sbjct  323   LARGLDKFFKDGGNISFSNHSMLNTLGKSGNLNLEAMTVFDGGEALLKDILGTRMVGLTG  382

Query  950   QFKFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKLY  1129
             Q +F  D+S   P+YDI+NV GTG R IG+W N+SGLST  PE LY++   + S + KL 
Sbjct  383   QLQFTPDRSRTRPAYDIINVAGTGVRQIGYWSNHSGLSTVLPELLYTKEKPNMSTSPKLK  442

Query  1130  GVVWPGQSVKKAPG  1171
              V+WPG++  K  G
Sbjct  443   HVIWPGETFTKPRG  456



>ref|XP_009143982.1| PREDICTED: glutamate receptor 3.7 isoform X1 [Brassica rapa]
 ref|XP_009143983.1| PREDICTED: glutamate receptor 3.7 isoform X1 [Brassica rapa]
 ref|XP_009143984.1| PREDICTED: glutamate receptor 3.7 isoform X1 [Brassica rapa]
Length=922

 Score =   357 bits (916),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 200/413 (48%), Positives = 293/413 (71%), Gaps = 4/413 (1%)
 Frame = +3

Query  1158  KKPRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGT-NTFKGFSVDVFTAAVNLLPYAVPF  1334
             +KPRGWV  +    L+I +P RVS+ EF+++   + +  KG  +D+FT A+  +PY+VP+
Sbjct  446   EKPRGWVIADVANPLKIVIPKRVSFVEFVTEENNSSHRIKGLCIDIFTEALKFVPYSVPY  505

Query  1335  QFVPFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPF  1514
              F  FG+GR +P+Y++++++V+ G +D A+GDIAIV  R+K+VDF+QPY ++GL+VV P 
Sbjct  506   IFESFGDGRSSPNYNQMIQMVADGVYDAAVGDIAIVPTRSKLVDFSQPYASTGLVVVIPA  565

Query  1515  KKLNTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSL  1694
                N   W FL PF+  +W V    F  + IV+WILEHR+N++FRG P++QLIT++ FS 
Sbjct  566   NDDN-ATWIFLRPFTIGLWCVVIASFFCIAIVIWILEHRINEDFRGPPRRQLITMILFSF  624

Query  1695  STLFFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESLKEG  1874
             STLF  ++E+T+S L R+V+I+WLF+++++ +SYTA+LTSILTVQQL S I G++SL+  
Sbjct  625   STLFKRNQEDTISNLARLVMIVWLFLLMVLTASYTANLTSILTVQQLPSAITGIDSLRAS  684

Query  1875  NDPIGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHK-GGVSAIVDERPYV  2051
               P+GYQ G+F   YL   +G+++SRL+ L S E Y  AL+ GP   GGV+AIVDE PY+
Sbjct  685   EVPVGYQSGTFTLEYLTYSLGMARSRLVPLESTEEYERALKLGPTAFGGVAAIVDELPYI  744

Query  2052  ENFLSTQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLtrt  2231
             E FL+ +  F+IVG+ F   GWGFAF RDSPLA+DMSTAIL L+E   LQ I ++WL  T
Sbjct  745   EGFLAERPGFKIVGEPFMHRGWGFAFKRDSPLAIDMSTAILKLAETRKLQEIRERWLCNT  804

Query  2232  scssest-elesDRLHLKSFWglfllcgaacflalfIYFVQIMLKFRRVARAE  2387
             SC+ +S    E ++LHLKSF GL+L+C A    A  ++ ++++ +F R  R E
Sbjct  805   SCAEKSNWNPEPNQLHLKSFKGLYLVCIAITVSAFLVFVLRMIRQFVRYRRME  857


 Score =   322 bits (826),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 163/369 (44%), Positives = 237/369 (64%), Gaps = 6/369 (2%)
 Frame = +2

Query  65    ALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTTQSD  244
             A + ++ +VVA++GP SS VAHT++ +A  LQ PL+SFAATDPTL++LQFP+FLRTT +D
Sbjct  88    AFEVLEKEVVAMVGPLSSSVAHTLTDIAKGLQFPLVSFAATDPTLSALQFPFFLRTTPND  147

Query  245   MYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGATTR  424
              +QM AI D+I  +GWKEVI+V+ DD+ GRNG++ALDD L  KR +ISYK  +   +   
Sbjct  148   AHQMSAIVDLISFHGWKEVISVYSDDELGRNGVSALDDELYKKRSRISYKVPLSVHSDDT  207

Query  425   AEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVLDSSS  604
             + I + L +   +  RV +LH  P     +FS+A  L MM + YVW++TDWL+  LDSS 
Sbjct  208   S-IANALNKSKSLGPRVYILHFGPDPSLRIFSIAQKLQMMTNEYVWLATDWLAVTLDSSV  266

Query  605   PLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLTGGSLGLNSYALYAYDSVWLIAHA  784
                +  ++ ++GV+ LRQH P+S     FT    H    +  +N+YA +AYD+VW+IA+ 
Sbjct  267   S-DNSTLKRLEGVVGLRQHIPESVKMHQFT----HKMNSNKSMNAYAFHAYDTVWMIAYG  321

Query  785   IDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLTGQFKFN  964
             I+  LN G  I+FS   KL   +G+ LHLE + IF+ G LLL  LLQ +F G+ GQ +F 
Sbjct  322   IEKMLNDGVNITFSYSEKLIQAQGAKLHLERVKIFNSGKLLLEKLLQVNFTGIAGQVQFG  381

Query  965   NDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKLYGVVWP  1144
             + ++++   YDI+NV  TG  T+GFW  + G S   PET ++R  +  +  +KL  + WP
Sbjct  382   SGRNVIGCDYDIINVDRTGVHTVGFWSKHGGFSVVAPETRHTRKKSGFAFEEKLGNITWP  441

Query  1145  GQSVKKAPG  1171
             G   +K  G
Sbjct  442   GGGREKPRG  450



>gb|AAR27949.1| GLR3.3 [Arabidopsis thaliana]
Length=933

 Score =   574 bits (1479),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/449 (71%), Positives = 379/449 (84%), Gaps = 3/449 (1%)
 Frame = +3

Query  1056  GCQLLLPRL-FTRDRPIVQVQIKNYMV*FGLGSR*KKPRGWVFPNNGKQLRIGVPIRVSY  1232
             G   +LP L +T+++P +    K   V +  G    KPRGWVF NNGK+L+IGVP+RVSY
Sbjct  418   GLSTVLPELLYTKEKPNMSTSPKLRHVIWP-GETFTKPRGWVFSNNGKELKIGVPLRVSY  476

Query  1233  KEFISQVPGT-NTFKGFSVDVFTAAVNLLPYAVPFQFVPFGNGRENPSYSELVRLVSTGY  1409
             KEF+SQ+ GT N FKGF +DVFTAAVNLLPYAVP +F+P+GNG+ENPSY+ +V +++TG 
Sbjct  477   KEFVSQIRGTENMFKGFCIDVFTAAVNLLPYAVPVKFIPYGNGKENPSYTHMVEMITTGN  536

Query  1410  FDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPFKKLNTGAWAFLTPFSAQMWGvtaff  1589
             FDG +GD+AIVTNRTK+VDFTQPY ASGL+VVAPFKKLN+GAWAFL PF+  MW VT   
Sbjct  537   FDGVVGDVAIVTNRTKIVDFTQPYAASGLVVVAPFKKLNSGAWAFLRPFNRLMWAVTGCC  596

Query  1590  fvvvgivvWILEHRMNDEFRGSPKQQLITILWFSLSTLFFAHRENTVSTLGRMvliiwlf  1769
             F+ VGIVVWILEHR NDEFRG PK+Q +TILWFS ST+FFAHRENTVSTLGR+VLIIWLF
Sbjct  597   FLFVGIVVWILEHRTNDEFRGPPKRQCVTILWFSFSTMFFAHRENTVSTLGRLVLIIWLF  656

Query  1770  vvliiNSSYTASLTSILTVQQLYSPIKGVESLKEGNDPIGYQIGSFAEHYLIEEIGISKS  1949
             VVLIINSSYTASLTSILTVQQL SPIKG+ESL+E +DPIGYQ+GSFAE YL  E+ IS+S
Sbjct  657   VVLIINSSYTASLTSILTVQQLSSPIKGIESLRERDDPIGYQVGSFAESYLRNELNISES  716

Query  1950  RLIALGSPEAYAEALEKGPHKGGVSAIVDERPYVENFLSTQCKFRIVGQEFTKSGWGFAF  2129
             RL+ LG+PEAYA+AL+ GP KGGV+AIVDERPYVE FLS+ C +RIVGQEFTKSGWGFAF
Sbjct  717   RLVPLGTPEAYAKALKDGPSKGGVAAIVDERPYVELFLSSNCAYRIVGQEFTKSGWGFAF  776

Query  2130  PRDSPLAVDMSTAILSLSENGDLQRIHDKWLtrtscssestelesDRLHLKSFWglfllc  2309
             PRDSPLA+D+STAIL L+ENGDLQRIHDKWL + +C+ E+ ELESDRLHLKSFWGLFL+C
Sbjct  777   PRDSPLAIDLSTAILELAENGDLQRIHDKWLMKNACTLENAELESDRLHLKSFWGLFLIC  836

Query  2310  gaacflalfIYFVQIMLKFRRVARAEPVA  2396
             G AC LALF+YFVQI+ +  +    + +A
Sbjct  837   GVACLLALFLYFVQIIRQLYKKPTDDAIA  865


 Score =   475 bits (1223),  Expect = 7e-148, Method: Compositional matrix adjust.
 Identities = 221/374 (59%), Positives = 288/374 (77%), Gaps = 2/374 (1%)
 Frame = +2

Query  56    LVAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTT  235
             +V AL+FM+ D+V I+GPQ SVVAH ISH+ANEL+VPLLSFA TDP ++ LQFPYF+RTT
Sbjct  83    MVEALRFMEKDIVGIIGPQCSVVAHMISHMANELRVPLLSFAVTDPVMSPLQFPYFIRTT  142

Query  236   QSDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGI-PPG  412
             QSD+YQM AIA ++D YGWKEVIAVF+DDD+GRNG+AAL+D LA++R +I+YKAG+ P  
Sbjct  143   QSDLYQMDAIASIVDFYGWKEVIAVFVDDDFGRNGVAALNDKLASRRLRITYKAGLHPDT  202

Query  413   ATTRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVL  592
             A  + EIM++L++I L++ R++V+H Y   GF VF  A YLGMMG+GYVWI+TDWLST L
Sbjct  203   AVNKNEIMNMLIKIMLLQPRIVVIHVYSELGFAVFKEAKYLGMMGNGYVWIATDWLSTNL  262

Query  593   DSSSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLTGGSLGLNSYALYAYDSVWL  772
             DSSSPLP+E++E +QGVLVLR HTPDS+ KR F  RW+ ++G SL LN+Y LYAYDSV L
Sbjct  263   DSSSPLPAERLETIQGVLVLRPHTPDSDFKREFFKRWRKMSGASLALNTYGLYAYDSVML  322

Query  773   IAHAIDSFLNKGGVISFSNDSKLQSIEGS-TLHLEALSIFDGGPLLLNNLLQSDFVGLTG  949
             +A  +D F   GG ISFSN S L ++  S  L+LEA+++FDGG  LL ++L +  VGLTG
Sbjct  323   LARGLDKFFKDGGNISFSNHSMLNTLGKSGNLNLEAMTVFDGGEALLKDILGTRMVGLTG  382

Query  950   QFKFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKLY  1129
             Q +F  D+S   P+YDI+NV GTG R IG+W N+SGLST  PE LY++   + S + KL 
Sbjct  383   QLQFTPDRSRTRPAYDIINVAGTGVRQIGYWSNHSGLSTVLPELLYTKEKPNMSTSPKLR  442

Query  1130  GVVWPGQSVKKAPG  1171
              V+WPG++  K  G
Sbjct  443   HVIWPGETFTKPRG  456



>ref|XP_011008408.1| PREDICTED: glutamate receptor 3.4 isoform X2 [Populus euphratica]
Length=702

 Score =   449 bits (1156),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 215/381 (56%), Positives = 283/381 (74%), Gaps = 5/381 (1%)
 Frame = +2

Query  59    VAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTTQ  238
             V  L+ M  DVVA++GPQSS VAH ISHV NEL VPLLSFAATDPTL++LQ+PYFLRTTQ
Sbjct  113   VEVLQLMVNDVVAVIGPQSSGVAHIISHVVNELHVPLLSFAATDPTLSALQYPYFLRTTQ  172

Query  239   SDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGAT  418
             +D YQM AIAD++ ++GW+EVIA+F+DDDYGR GI+ L DALA KR KISYKA + PGA+
Sbjct  173   NDYYQMYAIADLVTYFGWREVIAIFVDDDYGRTGISILGDALAMKRAKISYKAALTPGAS  232

Query  419   TRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVLDS  598
             T ++I D+L+++  MESRV V+H  P +G  +FS A  L MM  GYVWI+TDWL +VLD+
Sbjct  233   T-SQISDLLLKVNQMESRVYVVHVNPDSGLSLFSTAKSLHMMTKGYVWIATDWLPSVLDA  291

Query  599   SSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLTG----GSLGLNSYALYAYDSV  766
               P+ ++ M ++QGV+ LR HT D++LK+ F S+W  L      G+ G NSYALYAYD+V
Sbjct  292   LEPVDTDTMNLLQGVIALRHHTQDTDLKKKFMSKWSSLNHKNSIGASGFNSYALYAYDTV  351

Query  767   WLIAHAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLT  946
             WL A A+D FL +G  +S+S+D KL    GS L+L ++ IFDGG   L  LL+ +F GL+
Sbjct  352   WLAARALDVFLGEGRNLSYSSDPKLHETNGSALNLSSMRIFDGGQEFLQTLLRMNFTGLS  411

Query  947   GQFKFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKL  1126
             GQ +F+ DK+LV P+YD+LN+ GTG R IG+W NYSGLST  PE LY++P N+S+++Q L
Sbjct  412   GQIQFDMDKNLVHPAYDVLNIGGTGSRRIGYWSNYSGLSTVTPEVLYTKPKNTSASSQHL  471

Query  1127  YGVVWPGQSVKKAPGVGFPEQ  1189
             Y V+WPG++     G  FPE 
Sbjct  472   YSVIWPGETSLVPRGWVFPEN  492


 Score =   224 bits (570),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 109/184 (59%), Positives = 141/184 (77%), Gaps = 0/184 (0%)
 Frame = +3

Query  1164  PRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYAVPFQFV  1343
             PRGWVFP NGK LRI VP R+SY +F+S+       +G+ +DVF AA+NLLPY VP  ++
Sbjct  484   PRGWVFPENGKPLRIAVPNRISYVQFVSKDKNPPGVRGYCIDVFEAAINLLPYPVPHIYM  543

Query  1344  PFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPFKKL  1523
               G+G+ NP Y+E+V+ V+   +D A+GD+ IVTNRTK+VDFTQP+  SGL+VVAP K++
Sbjct  544   LHGDGKRNPVYNEIVQAVAEDRYDAAVGDVTIVTNRTKIVDFTQPFKESGLVVVAPVKEV  603

Query  1524  NTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSLSTL  1703
              +  WAFL PF+ QMW VT  FF++VG VVWILEHR+N EFRGSP+QQL TI WFS ST+
Sbjct  604   KSSPWAFLKPFTFQMWLVTGAFFLLVGAVVWILEHRINHEFRGSPRQQLTTIFWFSFSTM  663

Query  1704  FFAH  1715
             FF+H
Sbjct  664   FFSH  667


 Score = 28.1 bits (61),  Expect(3) = 0.0, Method: Compositional matrix adjust.
 Identities = 10/27 (37%), Positives = 18/27 (67%), Gaps = 0/27 (0%)
 Frame = +2

Query  1718  REYCEHPWSNGVNHMALRGLDH*LQLH  1798
             RE+CEH  +   +H+A+  +D+  +LH
Sbjct  675   REHCEHLGTICADHLAICSVDYQFKLH  701



>emb|CDY48270.1| BnaA05g10840D [Brassica napus]
Length=922

 Score =   355 bits (912),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 198/413 (48%), Positives = 292/413 (71%), Gaps = 4/413 (1%)
 Frame = +3

Query  1158  KKPRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGT-NTFKGFSVDVFTAAVNLLPYAVPF  1334
             +KPRGWV  +    L+I +P RVS+ EF+++   + +  KG  +D+FT A+  +PY+VP+
Sbjct  446   EKPRGWVIADVANPLKIVIPKRVSFVEFVTEENNSSHRIKGLCIDIFTEALKFVPYSVPY  505

Query  1335  QFVPFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPF  1514
              F  FG+GR +P+Y++++++V+ G +D A+GDIAIV  R+K+VDF+QPY ++GL+VV P 
Sbjct  506   IFESFGDGRSSPNYNQMIQMVADGVYDAAVGDIAIVPTRSKLVDFSQPYASTGLVVVIPA  565

Query  1515  KKLNTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSL  1694
                N   W FL PF+  +W      FV+  + +WILEHR+N++FRG P++QLIT++ FS 
Sbjct  566   NDDN-ATWIFLRPFTIGLWCSVQNIFVICFLFIWILEHRINEDFRGPPRRQLITMILFSF  624

Query  1695  STLFFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESLKEG  1874
             STLF  ++E+T+S L R+V+I+WLF+++++ +SYTA+LTSILTVQQL S I G++SL+  
Sbjct  625   STLFKRNQEDTISNLARLVMIVWLFLLMVLTASYTANLTSILTVQQLPSAITGIDSLRAS  684

Query  1875  NDPIGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHK-GGVSAIVDERPYV  2051
               P+GYQ G+F   YL   +G+++SRL+ L S E Y  AL+ GP   GGV+AIVDE PY+
Sbjct  685   EVPVGYQSGTFTLEYLTYSLGMARSRLVPLESTEEYERALKLGPTAFGGVAAIVDELPYI  744

Query  2052  ENFLSTQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLtrt  2231
             E FL+ +  F+IVG+ F   GWGFAF RDSPLA+DMSTAIL L+E   LQ I ++WL  T
Sbjct  745   ELFLAERPGFKIVGEPFMHRGWGFAFKRDSPLAIDMSTAILKLAETRKLQEIRERWLCNT  804

Query  2232  scssest-elesDRLHLKSFWglfllcgaacflalfIYFVQIMLKFRRVARAE  2387
             SC+ +S    E ++LHLKSF GL+L+C A    A  ++ ++++ +F R  R E
Sbjct  805   SCAEKSNWNPEPNQLHLKSFKGLYLVCIAITVSAFLVFVLRMIRQFVRYRRME  857


 Score =   323 bits (829),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 164/369 (44%), Positives = 237/369 (64%), Gaps = 6/369 (2%)
 Frame = +2

Query  65    ALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTTQSD  244
             A + ++ +VVA++GP SS VAHT+S +A  LQ PL+SFAATDPTL++LQFP+FLRTT +D
Sbjct  88    AFEVLEKEVVAMVGPLSSSVAHTLSDIAKGLQFPLVSFAATDPTLSALQFPFFLRTTPND  147

Query  245   MYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGATTR  424
              +QM AI D+I  +GWKEVI+V+ DD+ GRNG++ALDD L  KR +ISYK  +   +   
Sbjct  148   AHQMSAIVDLISFHGWKEVISVYSDDELGRNGVSALDDELYKKRSRISYKVPLSVHSDDT  207

Query  425   AEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVLDSSS  604
             + I + L +   +  RV +LH  P     +FS+A  L MM + YVW++TDWL+  LDSS 
Sbjct  208   S-IANALNKSKSLGPRVYILHFGPDPSLRIFSIAQKLQMMTNEYVWLATDWLAVTLDSSV  266

Query  605   PLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLTGGSLGLNSYALYAYDSVWLIAHA  784
                +  ++ ++GV+ LRQH P+S     FT    H    +  +N+YA +AYD+VW+IA+ 
Sbjct  267   S-DNSTLKRLEGVVGLRQHIPESVKMHQFT----HKMNSNKSMNAYAFHAYDTVWMIAYG  321

Query  785   IDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLTGQFKFN  964
             I+  LN G  I+FS   KL   +G+ LHLE + IF+ G LLL  LLQ +F G+ GQ +F 
Sbjct  322   IEKMLNDGVNITFSYSEKLIQAQGAKLHLERVKIFNSGKLLLEKLLQVNFTGIAGQVQFG  381

Query  965   NDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKLYGVVWP  1144
             + ++++   YDI+NV  TG  T+GFW  + G S   PET ++R  +  +  +KL  + WP
Sbjct  382   SGRNVIGCDYDIINVDRTGVHTVGFWSKHGGFSVVAPETRHTRKKSGFAFEEKLGNITWP  441

Query  1145  GQSVKKAPG  1171
             G   +K  G
Sbjct  442   GGGREKPRG  450



>ref|XP_010530328.1| PREDICTED: glutamate receptor 3.3 [Tarenaya hassleriana]
Length=962

 Score =   573 bits (1478),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/415 (75%), Positives = 360/415 (87%), Gaps = 4/415 (1%)
 Frame = +3

Query  1161  KPRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGT-NTFKGFSVDVFTAAVNLLPYAVPFQ  1337
             KPRGWVFPNNG +L+IGVPIR SYKE++S++ GT N FKGF +DVFTAAVNLLPYAVP++
Sbjct  458   KPRGWVFPNNGIELKIGVPIRASYKEYVSKIRGTDNLFKGFCIDVFTAAVNLLPYAVPYK  517

Query  1338  FVPFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPFK  1517
             FVPFGNG+ENPSY+E+V +++TG FDG +GD+AIVTNRTK+VDFTQPY ASGL+VVAPFK
Sbjct  518   FVPFGNGKENPSYTEMVEMITTGVFDGVVGDVAIVTNRTKIVDFTQPYAASGLVVVAPFK  577

Query  1518  KLNTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSLS  1697
             KLN+GAWAFL PF+  MW VT+  F+ VG VVWILEHR NDEFRG PK+Q +TILWFS S
Sbjct  578   KLNSGAWAFLRPFNPLMWAVTSCCFLFVGFVVWILEHRFNDEFRGPPKRQCVTILWFSFS  637

Query  1698  TLFFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESLKEGN  1877
             T+FFAHRENTVSTLGRMVLIIWLFVVLIINSSYTASLTSILTVQQL S IKG+E+L   N
Sbjct  638   TMFFAHRENTVSTLGRMVLIIWLFVVLIINSSYTASLTSILTVQQLSSRIKGIETLVRSN  697

Query  1878  DPIGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERPYVEN  2057
             D IGYQ+GSFAEHYL  E+ IS+SRL+ LGSPEAYA+AL+ GP KGGV+AIVDERPYVE 
Sbjct  698   DRIGYQVGSFAEHYLRAELNISESRLVPLGSPEAYAKALKDGPRKGGVAAIVDERPYVEL  757

Query  2058  FLSTQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLtrtsc  2237
             FLS+ C +RIVGQEFTKSGWGFAFPRDSPLAVD+STAIL L+ENGDLQRIHDKWL + +C
Sbjct  758   FLSSNCAYRIVGQEFTKSGWGFAFPRDSPLAVDLSTAILELAENGDLQRIHDKWLMKNAC  817

Query  2238  ssestelesDRLHLKSFWglfllcgaacflalfIYFVQIMLKFRRVARAEPVADG  2402
             + ++ ELESDRLHLKSFWGLFL+CG AC LAL IYF  I+   R++ RA P  D 
Sbjct  818   TLDNAELESDRLHLKSFWGLFLICGIACLLALLIYFASIL---RQLYRANPSGDA  869


 Score =   471 bits (1211),  Expect = 7e-146, Method: Compositional matrix adjust.
 Identities = 219/381 (57%), Positives = 292/381 (77%), Gaps = 3/381 (1%)
 Frame = +2

Query  56    LVAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTT  235
             +V AL+ M+ D+VAI+GPQ SVVAH I +VANEL VPLLSF  TDP ++ LQFPYF+RT 
Sbjct  87    MVEALRLMEKDIVAIVGPQCSVVAHMIGYVANELHVPLLSFGVTDPVMSPLQFPYFVRTA  146

Query  236   QSDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGI-PPG  412
             QSD YQM A+A V+D+YGWKEVIAVF+DDDYGRNG+AAL+D LAA+RC+I++KAGI P  
Sbjct  147   QSDSYQMEAVASVVDYYGWKEVIAVFVDDDYGRNGVAALNDRLAARRCRITHKAGIHPDS  206

Query  413   ATTRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVL  592
                  E+M++L+ +  ++SR++V+H Y   GF +F  A YLGMMG+GYVWI+TDWLS VL
Sbjct  207   VVNNTEVMNVLIGVMSVQSRIVVIHVYTELGFSIFKNAKYLGMMGNGYVWIATDWLSNVL  266

Query  593   DSSSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLTGGSLGLNSYALYAYDSVWL  772
             D+ SPLP ++M+ +QGVLVLRQHTPDS+ KRAF SRW  ++GGS+ LN Y LYAYDSV +
Sbjct  267   DTFSPLPPDRMDAIQGVLVLRQHTPDSDAKRAFYSRWGKISGGSVALNVYGLYAYDSVMI  326

Query  773   IAHAIDSFLNKGGVISFSNDSKLQSI-EGSTLHLEALSIFDGGPLLLNNLLQSDFVGLTG  949
             +A A+D+F   GG ISFS DS L ++ +   L+LEA++IF+GG  LLNN+L +  VGLTG
Sbjct  327   LARALDTFFKCGGKISFSIDSTLNALGKNGELNLEAMTIFNGGEALLNNILATRMVGLTG  386

Query  950   QFKFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPET-LYSRPPNSSSANQKL  1126
             Q +F  D+S + P+YDI+NV G+G R +G+W N+SGLS  PP++ L+++  N+SS+ QKL
Sbjct  387   QLEFTPDRSRIHPAYDIINVAGSGVRLVGYWSNHSGLSVQPPDSPLHTKLQNTSSSGQKL  446

Query  1127  YGVVWPGQSVKKAPGVGFPEQ  1189
               V+WPG++  K  G  FP  
Sbjct  447   RDVIWPGETFSKPRGWVFPNN  467



>emb|CDY12210.1| BnaC04g12400D [Brassica napus]
Length=921

 Score =   355 bits (912),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 199/413 (48%), Positives = 291/413 (70%), Gaps = 4/413 (1%)
 Frame = +3

Query  1158  KKPRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGT-NTFKGFSVDVFTAAVNLLPYAVPF  1334
             +KPRGWV  +    L+I +P RVS+ EF+++   + +  KG  +D+FT A+  +PY+VP+
Sbjct  446   EKPRGWVIADAANPLKIVIPKRVSFVEFVTEENNSSHRIKGLCIDIFTEALKFVPYSVPY  505

Query  1335  QFVPFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPF  1514
              F  FG+GR +P+Y++++++V+ G +D A+GDIAIV  R+K+VDF+QPY ++GL+VV P 
Sbjct  506   VFESFGDGRSSPNYNQMIQMVADGVYDAAVGDIAIVPTRSKLVDFSQPYASTGLVVVIPA  565

Query  1515  KKLNTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSL  1694
                N   W FL PF+  +W V    F  + IV+WILEHR+N++FRG P++QLIT++ FS 
Sbjct  566   NDDN-ATWIFLRPFTIGLWCVVIASFFCIAIVMWILEHRINEDFRGPPRRQLITMILFSF  624

Query  1695  STLFFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESLKEG  1874
             STLF  ++E+T+S L R+V+I+WLF+++++ +SYTA+LTSILTVQQL S I G++SL+  
Sbjct  625   STLFKRNQEDTISNLARLVMIVWLFLLMVLTASYTANLTSILTVQQLPSAITGIDSLRAS  684

Query  1875  NDPIGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHK-GGVSAIVDERPYV  2051
               P+GYQ G+F   YL   +G+++SRL+ L S + Y  AL+ GP   GGV+AIVDE PY+
Sbjct  685   EVPVGYQSGTFTLEYLTYSLGMARSRLVPLESTDEYERALKLGPTNFGGVAAIVDELPYI  744

Query  2052  ENFLSTQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLtrt  2231
             E FL+ +  F+IVG+ F   GWGFAF RDSPLA+DMSTAIL L+E   LQ I  +WL  T
Sbjct  745   ELFLAERPGFKIVGEPFMHRGWGFAFKRDSPLAIDMSTAILKLAETRKLQEIRKRWLCNT  804

Query  2232  scssest-elesDRLHLKSFWglfllcgaacflalfIYFVQIMLKFRRVARAE  2387
             SC+ +S    E ++LHLKSF GL+L C A    A  ++ ++++ +F R  R E
Sbjct  805   SCAEKSNWNPEPNQLHLKSFKGLYLACIAITVSAFLVFVLRMIRQFVRYRRME  857


 Score =   322 bits (824),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 161/369 (44%), Positives = 239/369 (65%), Gaps = 6/369 (2%)
 Frame = +2

Query  65    ALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTTQSD  244
             A + ++ +VVA++GP SS VAHT+S +A  LQ PL+SFAATDPTL++LQFP+FLRTT +D
Sbjct  88    AFEVLEKEVVAMIGPLSSSVAHTLSDIAKGLQFPLVSFAATDPTLSALQFPFFLRTTPND  147

Query  245   MYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGATTR  424
              +QM A+ D+I  +GWKEVI+V+ DD+ GRNG++ALDD L  KR +ISYK  +   +  +
Sbjct  148   AHQMSALVDLISFHGWKEVISVYSDDELGRNGVSALDDELYKKRSRISYKVPLSVHSDDK  207

Query  425   AEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVLDSSS  604
             + I + L +   +  RV +LH  P     +FS+   L MM + YVW++TDWL+  LDSS 
Sbjct  208   S-IANALNKSKSLGPRVYILHFGPDPSLRIFSIVQKLQMMTNEYVWLATDWLAVTLDSSV  266

Query  605   PLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLTGGSLGLNSYALYAYDSVWLIAHA  784
                S  ++ ++GV+ LRQH P+S     FT + K     +  +N+YA +AYD++W+IA+ 
Sbjct  267   S-DSSTLKRLEGVVGLRQHIPESVKMHQFTHKMK----SNKSMNAYAFHAYDTLWMIAYG  321

Query  785   IDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLTGQFKFN  964
             I+  LN+G  I+FS   KL   +G+ LHLE + IF+ G LLL  LLQ +F G+ GQ +F 
Sbjct  322   IEKMLNEGLSITFSYSEKLIQAQGAKLHLERVKIFNSGKLLLEKLLQVNFTGIAGQVQFG  381

Query  965   NDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKLYGVVWP  1144
             + ++++   Y+I+NV  TG  T+GFW  + G S   PET ++R  +  +  +KL  + WP
Sbjct  382   SGRNVIGCDYEIINVDRTGVHTVGFWSKHGGFSVVAPETRHTRNKSGFAFEEKLGNITWP  441

Query  1145  GQSVKKAPG  1171
             G   +K  G
Sbjct  442   GGGREKPRG  450



>ref|XP_010063139.1| PREDICTED: LOW QUALITY PROTEIN: glutamate receptor 3.3 [Eucalyptus 
grandis]
Length=940

 Score =   571 bits (1471),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/415 (77%), Positives = 367/415 (88%), Gaps = 2/415 (0%)
 Frame = +3

Query  1161  KPRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGT-NTFKGFSVDVFTAAVNLLPYAVPFQ  1337
             KPRGWVFPNNGKQLRIGVP R S+++F+S+V GT N FKGF +DVF AAVNLLPYAVP+Q
Sbjct  462   KPRGWVFPNNGKQLRIGVPDRASFRQFVSKVRGTDNMFKGFCIDVFAAAVNLLPYAVPYQ  521

Query  1338  FVPFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPFK  1517
             FVPFGNG ENPSY++LV  ++TG FD A+GDIAI TNRTK+VDFTQPYVASGL+VVAPF+
Sbjct  522   FVPFGNGHENPSYTDLVNSITTGLFDAAVGDIAITTNRTKIVDFTQPYVASGLVVVAPFR  581

Query  1518  KLNTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSLS  1697
             K+NTGAWAFL PF+ QMW VT  FF+ +GIV+WILEHR NDEFRGSP+QQ++TILWFS S
Sbjct  582   KMNTGAWAFLRPFTPQMWIVTGAFFLAIGIVIWILEHRTNDEFRGSPRQQVMTILWFSFS  641

Query  1698  TLFFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESLKEGN  1877
             TLFFAHRENT STLGR+VLIIWLFVVLIINSSYTASLTSILTVQQL SPIKG++SL +G+
Sbjct  642   TLFFAHRENTASTLGRVVLIIWLFVVLIINSSYTASLTSILTVQQLSSPIKGIDSLIKGD  701

Query  1878  DPIGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERPYVEN  2057
             +PIG+Q+GSFAEHYL +E+ IS+SRL  LGSP+AYA+AL  GP KGGV+A+VDE PYVE 
Sbjct  702   EPIGFQVGSFAEHYLTQELKISRSRLKPLGSPDAYAKALRDGPGKGGVAALVDELPYVEM  761

Query  2058  FLSTQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLtrtsc  2237
             FLSTQC FRIVG EFTKSGWGFAFPRDSPLAVD+STAIL+LSENGDLQRIHDKWL +TSC
Sbjct  762   FLSTQCSFRIVGPEFTKSGWGFAFPRDSPLAVDLSTAILALSENGDLQRIHDKWLMQTSC  821

Query  2238  ssestelesDRLHLKSFWglfllcgaacflalfIYFVQIMLKFRRVARAEPVADG  2402
              S+S E+ESDRLHLKSFWGLFL+CG ACF+ALFIYF+QI+ +      AE V +G
Sbjct  822   LSDSAEIESDRLHLKSFWGLFLICGIACFVALFIYFLQILHQLCTTP-AESVPEG  875


 Score =   538 bits (1385),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 248/378 (66%), Positives = 310/378 (82%), Gaps = 3/378 (1%)
 Frame = +2

Query  56    LVAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTT  235
             +V  L+FM+ DVVAILGPQSSVVAH I+ +  +L VP+LSFAATDPTL+ L+FPYFLRTT
Sbjct  97    MVEVLQFMKNDVVAILGPQSSVVAH-ITGLVXQLHVPMLSFAATDPTLSYLEFPYFLRTT  155

Query  236   QSDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGA  415
             QSD+ QM A+A+++D YGWKEV A+++DDDYGRN ++AL+D LA +RCKISYK GI PG 
Sbjct  156   QSDLNQMSAVAELVDFYGWKEVTAIYLDDDYGRNAVSALNDKLAERRCKISYKVGIQPGP  215

Query  416   TTRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVLD  595
               R EIMDILV++ALMESRV+VLH  P +GF VF++A YL MMG+GYVWI+TDWLS+VLD
Sbjct  216   AKRGEIMDILVKVALMESRVIVLHVTPESGFEVFAIARYLAMMGNGYVWIATDWLSSVLD  275

Query  596   SSSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLTGGSLGLNSYALYAYDSVWLI  775
             S+SPLPSE M+ +QGVLVLRQHT +S+ KRAF SRW  LT GS GLNSY LYAYDSVWL+
Sbjct  276   SASPLPSETMDSLQGVLVLRQHTAESDKKRAFASRWNRLTRGSPGLNSYGLYAYDSVWLV  335

Query  776   AHAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLTGQF  955
             AHA+++F  +GGV+SFSNDS+++SIE   LHLE +S FD GPLLL N+LQ++FVGLTG F
Sbjct  336   AHALEAFFEQGGVLSFSNDSRIKSIESGGLHLEEMSFFDTGPLLLKNILQTNFVGLTGPF  395

Query  956   KFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKLYGV  1135
             +FN+D+ L+ P+YDI+NV+GTG R IG+W NY+GLST PPE LY R PN SS  Q+LY V
Sbjct  396   QFNSDRCLIHPAYDIINVVGTGVRRIGYWSNYTGLSTLPPEELYERAPNRSS--QQLYSV  453

Query  1136  VWPGQSVKKAPGVGFPEQ  1189
             +WPG+++ K  G  FP  
Sbjct  454   IWPGETLSKPRGWVFPNN  471



>ref|XP_006410372.1| hypothetical protein EUTSA_v10016204mg [Eutrema salsugineum]
 dbj|BAJ34475.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ51825.1| hypothetical protein EUTSA_v10016204mg [Eutrema salsugineum]
Length=921

 Score =   360 bits (924),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 202/413 (49%), Positives = 295/413 (71%), Gaps = 4/413 (1%)
 Frame = +3

Query  1158  KKPRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGT-NTFKGFSVDVFTAAVNLLPYAVPF  1334
             +KPRGWV  ++   L+I VP RVS+ EF+++   + +  KGF +D+F  A+  +PY+VP+
Sbjct  446   EKPRGWVIADSANPLKIVVPKRVSFVEFVTEEKNSSHQIKGFCIDIFIEALKFVPYSVPY  505

Query  1335  QFVPFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPF  1514
              F  FGNG  +P+Y++L+++V+ G +D A+GDIAI+  R+K+VDF+QPY ++GL+VV P 
Sbjct  506   IFESFGNGNSSPNYNQLIQMVADGVYDAAVGDIAIIPTRSKLVDFSQPYASTGLVVVIPT  565

Query  1515  KKLNTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSL  1694
                N   W FL PF+ ++W V    F+V+ +V+WILEHR+N++FRG P++QL T++ FS 
Sbjct  566   NDDN-ATWIFLRPFTIRLWCVVLASFLVIAVVIWILEHRINEDFRGPPRRQLSTMILFSF  624

Query  1695  STLFFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESLKEG  1874
             STLF  ++E+T+S L R+V+I+WLF+++++ +SYTA+LTSILTVQQL S I G++SL+  
Sbjct  625   STLFKRNQEDTISNLARLVMIVWLFLLMVLTASYTANLTSILTVQQLPSAITGIDSLRAS  684

Query  1875  NDPIGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHK-GGVSAIVDERPYV  2051
               PIGYQ G+F   YL   +G+++SRL+ L S E Y  AL+ GP   GGV+AIVDE PY+
Sbjct  685   QVPIGYQPGTFTVEYLTYSLGMARSRLVPLDSTEEYERALKLGPTAVGGVAAIVDELPYI  744

Query  2052  ENFLSTQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLtrt  2231
             E FL+ +  F+IVG+ F   GWGFAF RDSPLA+DMSTAIL LSE   LQ I  KWL +T
Sbjct  745   ELFLADRTGFKIVGEPFMHRGWGFAFKRDSPLAIDMSTAILKLSETRKLQDIRKKWLCKT  804

Query  2232  scssest-elesDRLHLKSFWglfllcgaacflalfIYFVQIMLKFRRVARAE  2387
             +C+ +S    E ++LHLKSF GL+L+C A    A  ++ ++++ +F R  R E
Sbjct  805   NCAEKSDWNPEPNQLHLKSFKGLYLVCIAITVSAFLVFVLRMIRQFVRYRRME  857


 Score =   310 bits (793),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 164/369 (44%), Positives = 236/369 (64%), Gaps = 6/369 (2%)
 Frame = +2

Query  65    ALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTTQSD  244
             A + ++ +VVA++GP SS +AHT+S VA  LQ PL+SFAATDPTL++LQFP+FLRTT  D
Sbjct  88    AFQVLEKEVVAMIGPISSSIAHTLSDVAKGLQFPLVSFAATDPTLSALQFPFFLRTTPDD  147

Query  245   MYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGATTR  424
              +QM A+ D+I+++GWKEVI+V+ DD+ GRNG++ALDD L  KR +ISYK  +      +
Sbjct  148   AHQMSALVDLINYHGWKEVISVYSDDELGRNGVSALDDELYKKRSRISYKVPLSVHFDEK  207

Query  425   AEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVLDSSS  604
             + I D L +   +  RV +LH  PA    +FS+A  L MM   YVW++TDWLS  LDSS 
Sbjct  208   S-ITDALKKSKSLGPRVYILHFGPAPLLKIFSIAQKLRMMTHEYVWLATDWLSVTLDSSL  266

Query  605   PLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLTGGSLGLNSYALYAYDSVWLIAHA  784
              +   K++ ++GV+ LRQH P+S     FT + K     +  +N+YA +AYD+VW+IA+ 
Sbjct  267   -IDKGKLKRLEGVVGLRQHIPESVKMHQFTQKLK----SNRSMNAYAFHAYDTVWMIAYG  321

Query  785   IDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLTGQFKFN  964
             I+  LN+   I+FS   KL   +G  LHLE + IFD G LLL  LLQ +F G+ GQ +F 
Sbjct  322   IEKLLNERINITFSYSEKLIHAQGDKLHLERVKIFDSGKLLLKKLLQVNFTGIAGQVQFG  381

Query  965   NDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKLYGVVWP  1144
             + ++++   Y+I+NV   G  T+GFW    G S   PET   +   +  +++KL  + WP
Sbjct  382   SGRNVISCDYEIINVDKAGVHTVGFWSKNGGFSVVTPETRQRQKKTALVSDEKLGNITWP  441

Query  1145  GQSVKKAPG  1171
             G   +K  G
Sbjct  442   GGGHEKPRG  450



>ref|XP_006293358.1| hypothetical protein CARUB_v10022600mg [Capsella rubella]
 gb|EOA26256.1| hypothetical protein CARUB_v10022600mg [Capsella rubella]
Length=923

 Score =   363 bits (932),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 204/412 (50%), Positives = 297/412 (72%), Gaps = 4/412 (1%)
 Frame = +3

Query  1161  KPRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGT-NTFKGFSVDVFTAAVNLLPYAVPFQ  1337
             +PRGWV  ++   L+I VP RVS+ EF+++   + +  +GF +DVF  A+  +PY+VP+ 
Sbjct  447   RPRGWVIADSADPLKIVVPRRVSFVEFVTEEKNSSHRIQGFCIDVFIEALKFVPYSVPYI  506

Query  1338  FVPFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPFK  1517
             F PFGNG  +P+Y++L+++V+ G +D A+GDIAIV +R+K+VDF+QPY ++GL+VV P  
Sbjct  507   FEPFGNGHSSPNYNQLIQMVTDGVYDAAVGDIAIVPSRSKLVDFSQPYASTGLVVVIPAN  566

Query  1518  KLNTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSLS  1697
               N   W FL PF+ ++W V    F+V+ +V+WILEHR+N +FRG P++QL+T++ FS S
Sbjct  567   DDN-ATWIFLRPFTIRLWCVVLVSFMVIAVVIWILEHRINGDFRGPPRRQLVTMILFSFS  625

Query  1698  TLFFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESLKEGN  1877
             TLF  ++E+T+S L R+V+I+WLF+++++ +SYTA+LTSILTVQQL S I G++SL+   
Sbjct  626   TLFKRNQEDTISNLARLVMIVWLFLLMVLTASYTANLTSILTVQQLPSAITGIDSLRTSE  685

Query  1878  DPIGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHK-GGVSAIVDERPYVE  2054
              PIGYQ G+F   YL   +G+++SRL+ L S E Y +AL+ GP   GGV+AIVDE PY+E
Sbjct  686   VPIGYQAGTFTLEYLTYSLGMARSRLVPLDSTEEYEKALKLGPTNWGGVAAIVDELPYIE  745

Query  2055  NFLSTQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLtrts  2234
              FL+ +  F+IVG+ F   GWGFAF RDSPLAVDMSTAIL LSE   LQ I  KWL +T+
Sbjct  746   LFLAERTGFKIVGEPFMHRGWGFAFKRDSPLAVDMSTAILKLSETRKLQEIRRKWLCKTN  805

Query  2235  cssest-elesDRLHLKSFWglfllcgaacflalfIYFVQIMLKFRRVARAE  2387
             C+ +S    E ++LHLKSF GL+L+C A    A  ++ ++++ +F R  R E
Sbjct  806   CAEKSNWNPEPNQLHLKSFKGLYLVCIAITVSAFLVFVLRMIRQFVRYRRME  857


 Score =   306 bits (784),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 161/371 (43%), Positives = 238/371 (64%), Gaps = 6/371 (2%)
 Frame = +2

Query  59    VAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTTQ  238
             + A + ++ +VVA++GP SS VAHTIS +A  L  PL+SFAATDPTL++LQFP+FLRTT 
Sbjct  86    LGAFQLLEKEVVAMIGPISSSVAHTISDIAKGLHFPLISFAATDPTLSALQFPFFLRTTP  145

Query  239   SDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGAT  418
             +D +QM  + D+I+ YGWKEVI+V+ DD+ GRNG+AALDD L  KR +ISYK  +   + 
Sbjct  146   NDAHQMSVLVDLINFYGWKEVISVYSDDELGRNGVAALDDELYKKRSRISYKVPLSVHSN  205

Query  419   TRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVLDS  598
              R  + D L +   +  RV +LH  P     +F +A  L MM   YVW++TDWLS  LDS
Sbjct  206   ERF-LTDALNKSKSIGPRVYILHFGPDPLLRIFDIAKKLQMMTHEYVWLATDWLSVTLDS  264

Query  599   SSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLTGGSLGLNSYALYAYDSVWLIA  778
             S  + +  +++++GV+ LRQH P+SE  + FT   +     +  +N+YAL+AYD+VW+IA
Sbjct  265   SL-MDNGTLKLLEGVVGLRQHIPESEKMQRFTYNLQ----SNRSMNAYALHAYDTVWMIA  319

Query  779   HAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLTGQFK  958
             + I+  LN+G  I+FS   KL   +G+ LHLE +  F+ G LLL  LL+ +F G+ GQ +
Sbjct  320   YGIEKLLNEGINITFSYSEKLLHAKGTKLHLEKIKFFNSGELLLEKLLKVNFTGIAGQVQ  379

Query  959   FNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKLYGVV  1138
             F + ++++   Y+I+NV  TG  T+GFW    G S   P+  +S+   S  +++KL  + 
Sbjct  380   FGSGRNVIGCDYEIINVNKTGVHTVGFWSKNGGFSVVAPKNRHSQKKTSFVSDEKLGDIT  439

Query  1139  WPGQSVKKAPG  1171
             WPG    +  G
Sbjct  440   WPGGGRDRPRG  450



>gb|KHG26328.1| Glutamate receptor 3.3 -like protein [Gossypium arboreum]
Length=909

 Score =   565 bits (1456),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/379 (69%), Positives = 322/379 (85%), Gaps = 1/379 (0%)
 Frame = +2

Query  56    LVAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTT  235
             +V AL++M TDVVAI+GPQ SVVA  ISHVA+EL+VPLLSFAATDPTL+SLQFP+F+RT 
Sbjct  86    MVEALRYMATDVVAIIGPQCSVVAPIISHVASELRVPLLSFAATDPTLSSLQFPFFVRTA  145

Query  236   QSDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGA  415
             Q+D+YQM A+AD+IDHYGWKEVIA+FIDDD+GRNG++AL+D LA +RCKISYK GI P +
Sbjct  146   QNDLYQMTAVADIIDHYGWKEVIAIFIDDDWGRNGVSALNDKLAERRCKISYKVGIQPDS  205

Query  416   T-TRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVL  592
             + T+  IMD+LV++ALM+SR++VLH     GF VFSVA++LGMMG+GYVWI+TDWLS VL
Sbjct  206   SVTQGAIMDVLVKVALMQSRIVVLHLNRRVGFKVFSVANHLGMMGNGYVWIATDWLSLVL  265

Query  593   DSSSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLTGGSLGLNSYALYAYDSVWL  772
             DS SPLPSE M+ +QGVL LRQHTPDS+ KRAF +RW  +TGGS  LN+Y LYAYD+VWL
Sbjct  266   DSESPLPSETMDKIQGVLTLRQHTPDSDGKRAFFARWNRITGGSPQLNAYGLYAYDTVWL  325

Query  773   IAHAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLTGQ  952
             +AH++D+F N+GGVISFSNDS++ S+ GS LHLEA+SIFD G LLL N+L SDFVGLTG 
Sbjct  326   LAHSLDAFFNQGGVISFSNDSRISSMAGSALHLEAMSIFDDGVLLLKNILLSDFVGLTGP  385

Query  953   FKFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKLYG  1132
              KFN+D+SL+LP+YDI+NV+GTG R IG+W NYSGLST  PETLY+RPPN SSANQKLY 
Sbjct  386   LKFNSDRSLILPAYDIINVLGTGIRQIGYWSNYSGLSTVSPETLYTRPPNRSSANQKLYS  445

Query  1133  VVWPGQSVKKAPGVGFPEQ  1189
             V+WPG+++ K  G  FP  
Sbjct  446   VIWPGETLSKPRGWVFPNN  464


 Score =   550 bits (1416),  Expect = 1e-176, Method: Compositional matrix adjust.
 Identities = 301/399 (75%), Positives = 358/399 (90%), Gaps = 0/399 (0%)
 Frame = +3

Query  1161  KPRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYAVPFQF  1340
             KPRGWVFPNNGK LRIGVP RVSYKEF+SQV GT+ FKGF VDVFTAAVNLLPYAVP++F
Sbjct  455   KPRGWVFPNNGKLLRIGVPNRVSYKEFVSQVRGTDMFKGFCVDVFTAAVNLLPYAVPYKF  514

Query  1341  VPFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPFKK  1520
             + FG+GR+NPSY+ELV  ++TG FD  +GDIAIVTNRT++VDFTQPYV+SGL++VA  +K
Sbjct  515   ISFGDGRKNPSYTELVNKITTGEFDAVVGDIAIVTNRTRIVDFTQPYVSSGLVIVARLEK  574

Query  1521  LNTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSLST  1700
               +GAWAFL PFS +MW VT  FF++VGIVVWILEHR+NDEFRG PKQQ+ITILWFS ST
Sbjct  575   ERSGAWAFLQPFSRRMWIVTGSFFLIVGIVVWILEHRINDEFRGPPKQQVITILWFSFST  634

Query  1701  LFFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESLKEGND  1880
             +FFAHRENT+STLGR+VL++WLFVVLIINSSYTASLTSILTV+ L SPIKG++SL   N+
Sbjct  635   MFFAHRENTMSTLGRLVLLVWLFVVLIINSSYTASLTSILTVEHLSSPIKGIQSLAATNE  694

Query  1881  PIGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERPYVENF  2060
             PIGYQ GSFAE YL EE+ IS+SRL++LGSPEAYA AL++GP  GGV+A+VDERPYVE F
Sbjct  695   PIGYQEGSFAERYLSEELNISRSRLVSLGSPEAYALALKRGPGNGGVAAVVDERPYVELF  754

Query  2061  LSTQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLtrtscs  2240
             LS+QC F+IVGQEFTKSGWGFAFPRDSPLA+DMSTAIL+L+ENGDLQRIHDKWL +++CS
Sbjct  755   LSSQCSFKIVGQEFTKSGWGFAFPRDSPLAIDMSTAILALAENGDLQRIHDKWLMQSTCS  814

Query  2241  sestelesDRLHLKSFWglfllcgaacflalfIYFVQIM  2357
              ESTE+E+++L+L SFWGLFL+CG AC +ALFIYF+QI+
Sbjct  815   LESTEIETNQLNLSSFWGLFLICGVACIIALFIYFLQIL  853



>gb|KDO85161.1| hypothetical protein CISIN_1g002309mg [Citrus sinensis]
 gb|KDO85162.1| hypothetical protein CISIN_1g002309mg [Citrus sinensis]
Length=930

 Score =   565 bits (1456),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/412 (76%), Positives = 366/412 (89%), Gaps = 0/412 (0%)
 Frame = +3

Query  1161  KPRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYAVPFQF  1340
             KPRGWVFPNNGK L+IGVP R SY+EF+S+V G++ F+GF +DVFTAAVNLLPYAVP+QF
Sbjct  454   KPRGWVFPNNGKLLKIGVPNRASYREFVSKVRGSDMFQGFCIDVFTAAVNLLPYAVPYQF  513

Query  1341  VPFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPFKK  1520
             V FG+G +NPSY++LV  ++TG FD  +GDI IVTNRTK+VDF+QPY ASGL+VV PF+K
Sbjct  514   VAFGDGHKNPSYTQLVDSITTGVFDAVVGDITIVTNRTKIVDFSQPYAASGLVVVVPFRK  573

Query  1521  LNTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSLST  1700
             LNTGAWAFL PFS  MW VTA FFVVVGIVVWILEHR+NDEFRG PK+Q+ITILWFSLST
Sbjct  574   LNTGAWAFLRPFSPLMWTVTACFFVVVGIVVWILEHRINDEFRGPPKRQVITILWFSLST  633

Query  1701  LFFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESLKEGND  1880
             LFFAH+ENTVSTLGR+VLIIWLFVVLIINSSYTASLTSILTVQQLYSPI G+ESL++ +D
Sbjct  634   LFFAHKENTVSTLGRLVLIIWLFVVLIINSSYTASLTSILTVQQLYSPINGIESLRKSDD  693

Query  1881  PIGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERPYVENF  2060
             PIGYQ GSFAE+YL +E+ ISKSRL+AL +PE YA+AL+ GP KGGV+A+VDERPYVE F
Sbjct  694   PIGYQEGSFAEYYLSQELNISKSRLVALRTPEDYAKALKDGPGKGGVAAVVDERPYVELF  753

Query  2061  LSTQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLtrtscs  2240
             LS+QC FRIVGQEFTKSGWGFAFPRDSPLAVD+S+AIL L+ENGDLQRIHDKWL ++SCS
Sbjct  754   LSSQCSFRIVGQEFTKSGWGFAFPRDSPLAVDLSSAILELAENGDLQRIHDKWLMKSSCS  813

Query  2241  sestelesDRLHLKSFWglfllcgaacflalfIYFVQIMLKFRRVARAEPVA  2396
              E+ ELESDRLHL SFWGLFL+CG ACF+AL IYF+QIM +  + A ++ ++
Sbjct  814   LENAELESDRLHLSSFWGLFLICGVACFIALVIYFLQIMQQLCKSAPSDSIS  865


 Score =   532 bits (1370),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 246/381 (65%), Positives = 313/381 (82%), Gaps = 2/381 (1%)
 Frame = +2

Query  50    ILLVAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLR  229
             I +V AL+FM+TD+VAI+GPQ S VAH +S+V+NELQVPLLSF  TDPTL+SLQ+P+F+R
Sbjct  84    IGMVEALRFMETDIVAIIGPQCSTVAHIVSYVSNELQVPLLSFGVTDPTLSSLQYPFFVR  143

Query  230   TTQSDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPP  409
             TTQSD YQM A+A+++ +YGW  V  +F+D++YGRNG++AL+D LA +RC+ISYK+GIPP
Sbjct  144   TTQSDSYQMTAVAEMVSYYGWNAVSVIFVDNEYGRNGVSALNDKLAERRCRISYKSGIPP  203

Query  410   -GATTRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLST  586
                     +MD+LV++ALMESRV+VLH  P+ GF VFSVA YLGMMG+GYVWI+TDWL+ 
Sbjct  204   ESGVNTGYVMDLLVKVALMESRVIVLHVSPSLGFQVFSVAKYLGMMGNGYVWIATDWLAY  263

Query  587   VLDSSSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLTGGSLGLNSYALYAYDSV  766
             +LDS+S LPSE +E MQGVLVLRQH P+S+ K+ F SRWK+LTGGSLG+NSY LYAYDSV
Sbjct  264   MLDSAS-LPSETLESMQGVLVLRQHIPESDRKKNFLSRWKNLTGGSLGMNSYGLYAYDSV  322

Query  767   WLIAHAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLT  946
             WL+AHAI+SF N+GG ISFSNDS+L+++EG  LHL A+SIFD G LLL N+LQS+ VGLT
Sbjct  323   WLLAHAIESFFNQGGKISFSNDSRLKTMEGGNLHLGAMSIFDDGMLLLGNILQSNLVGLT  382

Query  947   GQFKFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKL  1126
             G  KFN+D+SL+  +YDI+NVIGTGFR IG+W NYSGLS  PPETLY++P N SS  Q L
Sbjct  383   GPLKFNSDRSLIHAAYDIINVIGTGFRMIGYWSNYSGLSKEPPETLYAQPFNRSSTIQHL  442

Query  1127  YGVVWPGQSVKKAPGVGFPEQ  1189
             + V+WPG+++ K  G  FP  
Sbjct  443   HSVIWPGETLSKPRGWVFPNN  463



>ref|XP_006473826.1| PREDICTED: glutamate receptor 3.3-like isoform X1 [Citrus sinensis]
 ref|XP_006473827.1| PREDICTED: glutamate receptor 3.3-like isoform X2 [Citrus sinensis]
Length=930

 Score =   565 bits (1455),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/412 (76%), Positives = 366/412 (89%), Gaps = 0/412 (0%)
 Frame = +3

Query  1161  KPRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYAVPFQF  1340
             KPRGWVFPNNGK L+IGVP R SY+EF+S+V G++ F+GF +DVFTAAVNLLPYAVP+QF
Sbjct  454   KPRGWVFPNNGKLLKIGVPNRASYREFVSKVRGSDMFQGFCIDVFTAAVNLLPYAVPYQF  513

Query  1341  VPFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPFKK  1520
             V FG+G +NPSY++LV  ++TG FD  +GDI IVTNRTK+VDF+QPY ASGL+VV PF+K
Sbjct  514   VAFGDGHKNPSYTQLVDSITTGVFDAVVGDITIVTNRTKIVDFSQPYAASGLVVVVPFRK  573

Query  1521  LNTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSLST  1700
             LNTGAWAFL PFS  MW VTA FFVVVGIVVWILEHR+NDEFRG PK+Q+ITILWFSLST
Sbjct  574   LNTGAWAFLRPFSPLMWTVTACFFVVVGIVVWILEHRINDEFRGPPKRQVITILWFSLST  633

Query  1701  LFFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESLKEGND  1880
             LFFAH+ENTVSTLGR+VLIIWLFVVLIINSSYTASLTSILTVQQLYSPI G+ESL++ +D
Sbjct  634   LFFAHKENTVSTLGRLVLIIWLFVVLIINSSYTASLTSILTVQQLYSPINGIESLRKSDD  693

Query  1881  PIGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERPYVENF  2060
             PIGYQ GSFAE+YL +E+ ISKSRL+AL +PE YA+AL+ GP KGGV+A+VDERPYVE F
Sbjct  694   PIGYQEGSFAEYYLSQELNISKSRLVALRTPEDYAKALKDGPGKGGVAAVVDERPYVELF  753

Query  2061  LSTQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLtrtscs  2240
             LS+QC FRIVGQEFTKSGWGFAFPRDSPLAVD+S+AIL L+ENGDLQRIHDKWL ++SCS
Sbjct  754   LSSQCSFRIVGQEFTKSGWGFAFPRDSPLAVDLSSAILELAENGDLQRIHDKWLMKSSCS  813

Query  2241  sestelesDRLHLKSFWglfllcgaacflalfIYFVQIMLKFRRVARAEPVA  2396
              E+ ELESDRLHL SFWGLFL+CG ACF+AL IYF+QIM +  + A ++ ++
Sbjct  814   LENAELESDRLHLSSFWGLFLICGVACFIALVIYFLQIMQQLCKSAPSDSIS  865


 Score =   530 bits (1365),  Expect = 9e-169, Method: Compositional matrix adjust.
 Identities = 245/381 (64%), Positives = 314/381 (82%), Gaps = 2/381 (1%)
 Frame = +2

Query  50    ILLVAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLR  229
             I +V AL+FM+TD+VAI+GPQ S VAH +S+V+NELQVPLLSF  TDPTL+SLQ+P+F+R
Sbjct  84    IGMVEALRFMETDIVAIIGPQCSTVAHIVSYVSNELQVPLLSFGVTDPTLSSLQYPFFVR  143

Query  230   TTQSDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPP  409
             TTQSD +QM A+A+++ +YGWK V  +F+D++YGRNG++AL+D LA +RC+ISYK+GIPP
Sbjct  144   TTQSDSFQMTAVAEMVSYYGWKAVSVIFVDNEYGRNGVSALNDKLAERRCRISYKSGIPP  203

Query  410   -GATTRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLST  586
                     +MD+LV++ALMESRV+VLH  P+ GF VFSVA YLGMMG+GYVWI+TDWL+ 
Sbjct  204   ESGVNTGYVMDLLVKVALMESRVIVLHVSPSLGFQVFSVAKYLGMMGNGYVWIATDWLAY  263

Query  587   VLDSSSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLTGGSLGLNSYALYAYDSV  766
             +LDS+S LPS+ +E MQGVLVLRQH P+S+ K+ F SRWK+LTGGSLG+NSY LYAYDSV
Sbjct  264   MLDSAS-LPSDTLESMQGVLVLRQHIPESDRKKNFLSRWKNLTGGSLGMNSYGLYAYDSV  322

Query  767   WLIAHAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLT  946
             WL+AHAI+SF N+GG ISFSNDS+L+++EG  LHL A+SIFD G LLL N+LQS+ VGLT
Sbjct  323   WLLAHAIESFFNQGGKISFSNDSRLKTMEGGNLHLGAMSIFDDGMLLLGNILQSNLVGLT  382

Query  947   GQFKFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKL  1126
             G  KFN+D+SL+  +YDI+NVIGTGFR IG+W NYSGLS  PPETLY++P N SS  Q L
Sbjct  383   GPLKFNSDRSLIHAAYDIINVIGTGFRMIGYWSNYSGLSKEPPETLYAQPFNRSSTIQHL  442

Query  1127  YGVVWPGQSVKKAPGVGFPEQ  1189
             + V+WPG+++ K  G  FP  
Sbjct  443   HSVIWPGETLSKPRGWVFPNN  463



>ref|XP_006435401.1| hypothetical protein CICLE_v10000195mg [Citrus clementina]
 gb|ESR48641.1| hypothetical protein CICLE_v10000195mg [Citrus clementina]
Length=930

 Score =   564 bits (1454),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/412 (75%), Positives = 366/412 (89%), Gaps = 0/412 (0%)
 Frame = +3

Query  1161  KPRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYAVPFQF  1340
             KPRGWVFPNNGK L+IGVP R SY+EF+S+V G++ F+GF +DVFTAAVNLLPYAVP+QF
Sbjct  454   KPRGWVFPNNGKLLKIGVPNRASYREFVSKVRGSDMFQGFCIDVFTAAVNLLPYAVPYQF  513

Query  1341  VPFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPFKK  1520
             V FG+G +NPSY++LV  ++TG FD  +GDI IVTNRTK+VDF+QPY ASGL+VV PF+K
Sbjct  514   VAFGDGHKNPSYTQLVDSITTGVFDAVVGDITIVTNRTKIVDFSQPYAASGLVVVVPFRK  573

Query  1521  LNTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSLST  1700
             LNTGAWAFL PFS  MW VTA FFVVVGIVVWILEHR+NDEFRG PK+Q+ITILWFSLST
Sbjct  574   LNTGAWAFLRPFSPLMWTVTACFFVVVGIVVWILEHRINDEFRGPPKRQVITILWFSLST  633

Query  1701  LFFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESLKEGND  1880
             LFFAH+ENTVSTLGR+VLIIWLFVVLIINSSYTASLTSILTVQQLYSPI G+ESL++ +D
Sbjct  634   LFFAHKENTVSTLGRLVLIIWLFVVLIINSSYTASLTSILTVQQLYSPINGIESLRKSDD  693

Query  1881  PIGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERPYVENF  2060
             PIGYQ GSFAE+YL +E+ ISKSRL+AL +PE YA+AL+ GP KGGV+A+VDERPYVE F
Sbjct  694   PIGYQEGSFAEYYLSQELNISKSRLVALRTPEDYAKALKDGPGKGGVAAVVDERPYVELF  753

Query  2061  LSTQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLtrtscs  2240
             LS+QC FRIVGQEFTKSGWGFAFPRDSPLAVD+S+AIL L+ENGDLQRIHDKWL ++SCS
Sbjct  754   LSSQCSFRIVGQEFTKSGWGFAFPRDSPLAVDLSSAILELAENGDLQRIHDKWLMKSSCS  813

Query  2241  sestelesDRLHLKSFWglfllcgaacflalfIYFVQIMLKFRRVARAEPVA  2396
              E+ ELESDRLHL SFWGLFL+CG ACF+AL +YF+QIM +  + A ++ ++
Sbjct  814   LENAELESDRLHLSSFWGLFLICGVACFIALVVYFLQIMQQLCKSAPSDSIS  865


 Score =   532 bits (1370),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 246/381 (65%), Positives = 313/381 (82%), Gaps = 2/381 (1%)
 Frame = +2

Query  50    ILLVAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLR  229
             I +V AL+FM+TD+VAI+GPQ S VAH +S+V+NELQVPLLSF  TDPTL+SLQ+P+F+R
Sbjct  84    IGMVEALRFMETDIVAIIGPQCSTVAHIVSYVSNELQVPLLSFGVTDPTLSSLQYPFFVR  143

Query  230   TTQSDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPP  409
             TTQSD YQM A+A+++ +YGW  V  +F+D++YGRNG++AL+D LA +RC+ISYK+GIPP
Sbjct  144   TTQSDSYQMTAVAEMVSYYGWNAVSVIFVDNEYGRNGVSALNDKLAERRCRISYKSGIPP  203

Query  410   -GATTRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLST  586
                     +MD+LV++ALMESRV+VLH  P+ GF VFSVA YLGMMG+GYVWI+TDWL+ 
Sbjct  204   ESGVNTGYVMDLLVKVALMESRVIVLHVSPSLGFQVFSVAKYLGMMGNGYVWIATDWLAY  263

Query  587   VLDSSSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLTGGSLGLNSYALYAYDSV  766
             +LDS+S LPSE +E MQGVLVLRQH P+S+ K+ F SRWK+LTGGSLG+NSY LYAYDSV
Sbjct  264   MLDSAS-LPSETLESMQGVLVLRQHIPESDRKKNFLSRWKNLTGGSLGMNSYGLYAYDSV  322

Query  767   WLIAHAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLT  946
             WL+AHAI+SF N+GG ISFSNDS+L+++EG  LHL A+SIFD G LLL N+LQS+ VGLT
Sbjct  323   WLLAHAIESFFNQGGKISFSNDSRLKTMEGGNLHLGAMSIFDDGMLLLGNILQSNLVGLT  382

Query  947   GQFKFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKL  1126
             G  KFN+D+SL+  +YDI+NVIGTGFR IG+W NYSGLS  PPETLY++P N SS  Q L
Sbjct  383   GPLKFNSDRSLIHAAYDIINVIGTGFRMIGYWSNYSGLSKEPPETLYAQPFNRSSTIQHL  442

Query  1127  YGVVWPGQSVKKAPGVGFPEQ  1189
             + V+WPG+++ K  G  FP  
Sbjct  443   HSVIWPGETLSKPRGWVFPNN  463



>ref|XP_002881225.1| hypothetical protein ARALYDRAFT_482168 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57484.1| hypothetical protein ARALYDRAFT_482168 [Arabidopsis lyrata subsp. 
lyrata]
Length=922

 Score =   362 bits (928),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 202/413 (49%), Positives = 296/413 (72%), Gaps = 4/413 (1%)
 Frame = +3

Query  1158  KKPRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGT-NTFKGFSVDVFTAAVNLLPYAVPF  1334
             +KPRGWV  ++   L+I VP RVS+ EF+++   + +  +GF +DVF  A+  +PY+VP+
Sbjct  446   EKPRGWVIADSADPLKIVVPRRVSFVEFVNEEKNSSHRIQGFCIDVFIEALKFVPYSVPY  505

Query  1335  QFVPFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPF  1514
              F PFGNG  +P+Y++L+++V+ G +D A+GDIAIV +R+K+VDF+QPY ++GL+VV P 
Sbjct  506   IFEPFGNGHSSPNYNQLIQMVTDGVYDAAVGDIAIVPSRSKLVDFSQPYASTGLVVVIPA  565

Query  1515  KKLNTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSL  1694
                N   W FL PF+ ++W V    F+V+ +V+WILEHR+N++FRG P++Q  T++ FS 
Sbjct  566   NDDN-ATWIFLRPFTIRLWCVVLVSFLVIAVVIWILEHRINEDFRGPPRRQFTTMILFSF  624

Query  1695  STLFFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESLKEG  1874
             STLF  ++E+T+S L R+V+I+WLF+++++ +SYTA+LTSILTVQQL S I G++SL+  
Sbjct  625   STLFKRNQEDTISNLARLVMIVWLFLLMVLTASYTANLTSILTVQQLPSAITGIDSLRAS  684

Query  1875  NDPIGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHK-GGVSAIVDERPYV  2051
               PIGYQ G+F   YL   +G+++SRL+ L S E Y +AL+ GP   GGV+AIVDE PY+
Sbjct  685   EVPIGYQAGTFTLEYLTYSLGMARSRLVPLDSTEEYEKALKLGPTNWGGVAAIVDELPYI  744

Query  2052  ENFLSTQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLtrt  2231
             E FL+ +  F+IVG+ F   GWGFAF RDSPLA+DMSTAIL LSE   LQ I  KWL + 
Sbjct  745   ELFLAERTGFKIVGEPFMHRGWGFAFKRDSPLAIDMSTAILKLSETRKLQEIRKKWLCKK  804

Query  2232  scssest-elesDRLHLKSFWglfllcgaacflalfIYFVQIMLKFRRVARAE  2387
             +C+ +S    E ++LHLKSF GL+L+C A    A  ++ ++++ +F R  R E
Sbjct  805   NCAEKSNWNPEPNQLHLKSFKGLYLVCIAITVSAFIVFVLRMIRQFVRYRRME  857


 Score =   306 bits (783),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 164/372 (44%), Positives = 236/372 (63%), Gaps = 10/372 (3%)
 Frame = +2

Query  62    AALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTTQS  241
              A + ++ +VVAI+GP SS VAHTIS +A  L  PL+SFAATDPTL++LQFP+FLRTT +
Sbjct  87    GAFELLEKEVVAIIGPISSSVAHTISDIAKGLHFPLVSFAATDPTLSALQFPFFLRTTPN  146

Query  242   DMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGATT  421
             D +QM A+ D+I+ YGWKEVI+V+ DD+ GRNGI+ALDD L  KR +ISYK  +   +  
Sbjct  147   DAHQMSALVDLINFYGWKEVISVYSDDELGRNGISALDDELYKKRSRISYKVPLSVHSDE  206

Query  422   RAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVLDSS  601
             +  + D L +   +  RV +LH  P     +F  A  L MM   YVW++TDWLS  LDSS
Sbjct  207   KF-LTDALNKSKSIGPRVYILHFGPDPSLRIFDTAQKLQMMTHEYVWLATDWLSVTLDSS  265

Query  602   SPLPSEK--MEIMQGVLVLRQHTPDSELKRAFTSRWKHLTGGSLGLNSYALYAYDSVWLI  775
                 S+K  ++ ++GV+ LRQH P+SE  + FT +       +  +N+YA +AYD+VW+I
Sbjct  266   L---SDKGTLKRLEGVVGLRQHIPESEKVQQFTQKLH----SNRSMNAYAFHAYDTVWMI  318

Query  776   AHAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLTGQF  955
             A+ I+  LN+G  I+FS   KL    G+ LHLE +  F+ G LLL  LL+ +F G+ GQ 
Sbjct  319   AYGIEKLLNQGINITFSYSEKLLHARGTKLHLEKIKFFNSGELLLEKLLKVNFTGIAGQV  378

Query  956   KFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKLYGV  1135
             +F + ++++   Y+I+NV  TG  T+GFW    G S   P+T +S+      +++KL  +
Sbjct  379   QFGSGRNVIGCEYEIINVDKTGVHTVGFWSKNGGFSVGAPKTRHSQKKTRFGSDEKLGDI  438

Query  1136  VWPGQSVKKAPG  1171
              WPG   +K  G
Sbjct  439   TWPGGGREKPRG  450



>ref|XP_010522333.1| PREDICTED: glutamate receptor 3.7 [Tarenaya hassleriana]
 ref|XP_010522334.1| PREDICTED: glutamate receptor 3.7 [Tarenaya hassleriana]
 ref|XP_010522337.1| PREDICTED: glutamate receptor 3.7 [Tarenaya hassleriana]
 ref|XP_010522338.1| PREDICTED: glutamate receptor 3.7 [Tarenaya hassleriana]
Length=934

 Score =   358 bits (918),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 200/417 (48%), Positives = 288/417 (69%), Gaps = 3/417 (1%)
 Frame = +3

Query  1146  GSR*KKPRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYA  1325
             G R +KPRGWV  ++ K LRI VP R S+  F+++   ++  +G+ +D+F  A+  +PY 
Sbjct  446   GGRREKPRGWVIADSTKPLRIVVPRRASFVNFVTEQNRSHQIQGYCIDLFIEALKFIPYN  505

Query  1326  VPFQFVPFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVV  1505
             VP+ F  FG+G  NP+Y+++V++V+   +D A+GDIAIV +R K VDF+QPY + GL+VV
Sbjct  506   VPYTFEAFGDGHSNPNYNQIVQMVADDVYDAAVGDIAIVPSRMKWVDFSQPYTSMGLVVV  565

Query  1506  APFKKLNTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILW  1685
                 +  +  W FL PF+  +W V    F+V+GIV+W+LEHR+ND FRG PKQQL T++ 
Sbjct  566   VAVDEKKSDTWIFLRPFTIWLWCVVVVSFLVIGIVIWVLEHRVNDAFRGPPKQQLATMIL  625

Query  1686  FSLSTLFFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESL  1865
             FS STLF  ++E TVS L R+V+I+WLF+++++ SSYTA+LTSILTV QL SPI G+ SL
Sbjct  626   FSFSTLFKRNQEKTVSNLARLVMIVWLFLLMVLTSSYTANLTSILTVHQLPSPITGIGSL  685

Query  1866  KEGNDPIGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHK-GGVSAIVDER  2042
                N PIGYQ G+F + YL + +G+++SRL+ALG+PE Y  AL  GP   GGV+AIVDE 
Sbjct  686   LINNLPIGYQNGTFTDQYLTDSLGMARSRLVALGTPEDYERALRLGPRSIGGVAAIVDEL  745

Query  2043  PYVENFLSTQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWL  2222
             PYV+ FL+ +  F+IVG+ F + GWGFAF R+SPLA+DMSTAIL LSE   L+ I  KW 
Sbjct  746   PYVDVFLAERTGFKIVGEPFMRRGWGFAFKRESPLAMDMSTAILKLSETRKLREIRLKWF  805

Query  2223  trtscsses--telesDRLHLKSFWglfllcgaacflalfIYFVQIMLKFRRVARAE  2387
              +  C+ +      + + L LKSF GL+++C +   +A  ++ ++ + +F R  R E
Sbjct  806   CKKGCAEKRGWEPEKKNELQLKSFKGLYIVCSSITIMAFSVFVLRTIRQFVRFKRVE  862


 Score =   309 bits (791),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 167/373 (45%), Positives = 231/373 (62%), Gaps = 9/373 (2%)
 Frame = +2

Query  62    AALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTTQS  241
             +A + +  +VVA++GP SS +AHT+S +A  L+VPL+SFAATDPTL++LQFPYFLRTT  
Sbjct  88    SAFQVLGEEVVAMIGPISSSIAHTLSDIAKGLEVPLVSFAATDPTLSALQFPYFLRTTPH  147

Query  242   DMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGATT  421
             D  QM A+AD+ID YGWKEV++V+ DDD GRNG+AALDD L  +R K+SYK  +P  A  
Sbjct  148   DARQMAAMADLIDFYGWKEVVSVYSDDDLGRNGVAALDDELYKRRSKLSYKVPLPLHADE  207

Query  422   RAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVLDSS  601
                ++  L +   +  RV VLH  P     +F VA  L MM   Y W +TDWLS  LDSS
Sbjct  208   NF-VIHALNKSKSLGPRVYVLHFGPDPSLGIFRVAQKLQMMTRDYAWFTTDWLSVTLDSS  266

Query  602   SPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLTGGSLGLNSYALYAYDSVWLIAH  781
                    ++ ++GV+ LRQH P+S  K+ F  + K    G+  +N+YA+ AYD+VW IA+
Sbjct  267   LD-DKGLLKSVEGVIGLRQHIPESIKKQDFMQKLK----GNGSMNAYAIRAYDTVWTIAY  321

Query  782   AIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLTGQFKF  961
              ++  L+ G  I+F    KL   + + L LE + +F+ G  LL  LLQ +F G++G  +F
Sbjct  322   GVEKLLSDGTNITFYYSKKLLGKKATRLKLEKIRVFNSGERLLTKLLQVNFSGISGPVQF  381

Query  962   NNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNS---SSANQKLYG  1132
               D+++V   Y+I+NV  TG  T+GFW    G S  PPET  +R  N     S +QKL  
Sbjct  382   GPDQNIVGGDYEIINVDKTGVGTVGFWSKNGGFSVVPPETRKTRKKNGILVISDDQKLGE  441

Query  1133  VVWPGQSVKKAPG  1171
             V WPG   +K  G
Sbjct  442   VTWPGGRREKPRG  454



>ref|NP_565744.1| glutamate receptor 5 [Arabidopsis thaliana]
 sp|Q9SDQ4.2|GLR37_ARATH RecName: Full=Glutamate receptor 3.7; AltName: Full=Ionotropic 
glutamate receptor GLR5; AltName: Full=Ligand-gated ion channel 
3.7; Flags: Precursor [Arabidopsis thaliana]
 gb|AAC69938.2| putative ligand-gated ion channel subunit [Arabidopsis thaliana]
 gb|AEC08679.1| glutamate receptor 5 [Arabidopsis thaliana]
Length=921

 Score =   364 bits (935),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 205/413 (50%), Positives = 298/413 (72%), Gaps = 4/413 (1%)
 Frame = +3

Query  1158  KKPRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGT-NTFKGFSVDVFTAAVNLLPYAVPF  1334
             +KPRGWV  ++   L+I VP RVS+ EF+++   + +  +GF +DVF  A+  +PY+VP+
Sbjct  445   EKPRGWVIADSADPLKIVVPRRVSFVEFVTEEKNSSHRIQGFCIDVFIEALKFVPYSVPY  504

Query  1335  QFVPFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPF  1514
              F PFGNG  +P+Y+ L+++V+ G +D A+GDIAIV +R+K+VDF+QPY ++GL+VV P 
Sbjct  505   IFEPFGNGHSSPNYNHLIQMVTDGVYDAAVGDIAIVPSRSKLVDFSQPYASTGLVVVIPA  564

Query  1515  KKLNTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSL  1694
                N   W FL PF++++W V    F+V+ +V+WILEHR+N++FRG P++QL T+L FS 
Sbjct  565   NDDN-ATWIFLRPFTSRLWCVVLVSFLVIAVVIWILEHRINEDFRGPPRRQLSTMLLFSF  623

Query  1695  STLFFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESLKEG  1874
             STLF  ++E+T+S L R+V+I+WLF+++++ +SYTA+LTSILTVQQL S I G++SL+  
Sbjct  624   STLFKRNQEDTISNLARLVMIVWLFLLMVLTASYTANLTSILTVQQLPSAITGIDSLRAS  683

Query  1875  NDPIGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHK-GGVSAIVDERPYV  2051
               PIGYQ G+F   YL   +G+++SRL+ L S E Y +AL+ GP   GGV+AIVDE PY+
Sbjct  684   EVPIGYQAGTFTLEYLTYSLGMARSRLVPLDSTEEYEKALKLGPTNWGGVAAIVDELPYI  743

Query  2052  ENFLSTQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLtrt  2231
             E FL+ +  F+IVG+ F   GWGFAF RDSPLA+DMSTAIL LSE   LQ I  KWL +T
Sbjct  744   ELFLAERTGFKIVGEPFMHRGWGFAFKRDSPLAIDMSTAILKLSETRKLQEIRKKWLCKT  803

Query  2232  scssest-elesDRLHLKSFWglfllcgaacflalfIYFVQIMLKFRRVARAE  2387
             +C+ +S    E ++LHLKSF GL+L+C A    A  ++ ++++ +F R  R E
Sbjct  804   NCAGKSNWNPEPNQLHLKSFKGLYLVCIAITVSAFLVFVLRMIRQFVRYRRME  856


 Score =   301 bits (772),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 162/369 (44%), Positives = 233/369 (63%), Gaps = 7/369 (2%)
 Frame = +2

Query  65    ALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTTQSD  244
             A + ++ +VVA++GP SS VAHTIS +A  L  PL+SFAATDPTL++LQFP+FLRTT +D
Sbjct  88    AFELLEKEVVAMIGPISSSVAHTISDIAKGLHFPLVSFAATDPTLSALQFPFFLRTTPND  147

Query  245   MYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGATTR  424
              +QM A+ D+I+ YGWKEVI+V+ DD+ GRNG++ALDD L  KR +ISYK  +   +  +
Sbjct  148   AHQMSALVDLINFYGWKEVISVYSDDELGRNGVSALDDELYKKRSRISYKVPLSVHSDEK  207

Query  425   AEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVLDSSS  604
               + + L +   +  RV +LH  P     +F +A  L MM   YVW++TDWLS  LDS S
Sbjct  208   F-LTNALNKSKSIGPRVYILHFGPDPLLRIFDIAQKLQMMTHEYVWLATDWLSVTLDSLS  266

Query  605   PLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLTGGSLGLNSYALYAYDSVWLIAHA  784
                + K   ++GV+ LRQH P+S     FT    H    +  +N+YAL+AYD+VW+IAH 
Sbjct  267   DKGTLKR--LEGVVGLRQHIPESVKMEHFT----HKLQSNRSMNAYALHAYDTVWMIAHG  320

Query  785   IDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLTGQFKFN  964
             I+  LN+G  I+FS   KL    G+ LHLE +  F+ G LLL  LL+ +F G+ GQ +F 
Sbjct  321   IEELLNEGINITFSYSEKLLHARGTKLHLEKIKFFNSGELLLEKLLKVNFTGIAGQVQFG  380

Query  965   NDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKLYGVVWP  1144
             + ++++   Y+I+NV  T   T+GFW    G S   P+T +S+   S  +++KL  + WP
Sbjct  381   SGRNVIGCDYEIINVNKTDVHTVGFWSKNGGFSVVAPKTRHSQKKTSFVSDEKLGDITWP  440

Query  1145  GQSVKKAPG  1171
             G   +K  G
Sbjct  441   GGGREKPRG  449



>gb|AAF21042.1|AF210701_1 Glr5 [Arabidopsis thaliana]
Length=921

 Score =   362 bits (929),  Expect(2) = 1e-180, Method: Compositional matrix adjust.
 Identities = 204/416 (49%), Positives = 299/416 (72%), Gaps = 4/416 (1%)
 Frame = +3

Query  1158  KKPRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGT-NTFKGFSVDVFTAAVNLLPYAVPF  1334
             +KPRGWV  ++   L+I VP RVS+ EF+++   + +  +GF +DVF  A+  +PY+VP+
Sbjct  445   EKPRGWVIADSADPLKIVVPRRVSFVEFVTEEKNSSHRIQGFCIDVFIEALKFVPYSVPY  504

Query  1335  QFVPFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPF  1514
              F PFGNG  +P+Y+ L+++V+ G +D A+GDIAIV +R+K+VDF+QPY ++GL+VV P 
Sbjct  505   IFEPFGNGHSSPNYNHLIQMVTDGVYDAAVGDIAIVPSRSKLVDFSQPYASTGLVVVIPA  564

Query  1515  KKLNTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSL  1694
                N   W FL PF++++W V    F+V+ +V+WILEHR+N++FRG P++QL T+L FS 
Sbjct  565   NDDN-ATWIFLRPFTSRLWCVVLVSFLVIAVVIWILEHRINEDFRGPPRRQLSTMLLFSF  623

Query  1695  STLFFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESLKEG  1874
             STLF  ++E+T+S L R+V+I+WLF+++++ +SYTA+LTSILTVQQL S I G++SL+  
Sbjct  624   STLFKRNQEDTISNLARLVMIVWLFLLMVLTASYTANLTSILTVQQLPSAITGIDSLRAS  683

Query  1875  NDPIGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHK-GGVSAIVDERPYV  2051
               PIGYQ G+    YL   +G+++SRL+ L S E Y +AL+ GP   GGV+AIVDE PY+
Sbjct  684   EVPIGYQAGTVTLEYLTYSLGMARSRLVPLDSTEEYEKALKLGPTNWGGVAAIVDELPYI  743

Query  2052  ENFLSTQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLtrt  2231
             E FL+ +  F+IVG+ F   GWGFAF RDSPLA+DMSTAIL LSE   LQ I  KWL +T
Sbjct  744   ELFLAERTGFKIVGEPFMHRGWGFAFKRDSPLAIDMSTAILKLSETRKLQEIRKKWLCKT  803

Query  2232  scssest-elesDRLHLKSFWglfllcgaacflalfIYFVQIMLKFRRVARAEPVA  2396
             +C+ +S    E ++LHLKSF GL+L+C A    A  ++ ++++ +F R  R E ++
Sbjct  804   NCAGKSNWNPEPNQLHLKSFKGLYLVCIAITVSAFLVFVLRMIRQFVRYRRMERIS  859


 Score =   301 bits (772),  Expect(2) = 1e-180, Method: Compositional matrix adjust.
 Identities = 162/369 (44%), Positives = 233/369 (63%), Gaps = 7/369 (2%)
 Frame = +2

Query  65    ALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTTQSD  244
             A + ++ +VVA++GP SS VAHTIS +A  L  PL+SFAATDPTL++LQFP+FLRTT +D
Sbjct  88    AFELLEKEVVAMIGPISSSVAHTISDIAKGLHFPLVSFAATDPTLSALQFPFFLRTTPND  147

Query  245   MYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGATTR  424
              +QM A+ D+I+ YGWKEVI+V+ DD+ GRNG++ALDD L  KR +ISYK  +   +  +
Sbjct  148   AHQMSALVDLINFYGWKEVISVYSDDELGRNGVSALDDELYKKRSRISYKVPLSVHSDEK  207

Query  425   AEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVLDSSS  604
               + + L +   +  RV +LH  P     +F +A  L MM   YVW++TDWLS  LDS S
Sbjct  208   F-LTNALNKSKSIGPRVYILHFGPDPLLRIFDIAQKLQMMTHEYVWLATDWLSVTLDSLS  266

Query  605   PLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLTGGSLGLNSYALYAYDSVWLIAHA  784
                + K   ++GV+ LRQH P+S     FT    H    +  +N+YAL+AYD+VW+IAH 
Sbjct  267   DKGTLKR--LEGVVGLRQHIPESVKMEHFT----HKLQSNRSMNAYALHAYDTVWMIAHG  320

Query  785   IDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLTGQFKFN  964
             I+  LN+G  I+FS   KL    G+ LHLE +  F+ G LLL  LL+ +F G+ GQ +F 
Sbjct  321   IEELLNEGINITFSYSEKLLHARGTKLHLEKIKFFNSGELLLEKLLKVNFTGIAGQVQFG  380

Query  965   NDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKLYGVVWP  1144
             + ++++   Y+I+NV  T   T+GFW    G S   P+T +S+   S  +++KL  + WP
Sbjct  381   SGRNIIGCDYEIINVNKTDVHTVGFWSKNGGFSVVAPKTRHSQKKTSFVSDEKLGDITWP  440

Query  1145  GQSVKKAPG  1171
             G   +K  G
Sbjct  441   GGGREKPRG  449



>emb|CDY66699.1| BnaCnng51950D [Brassica napus]
Length=926

 Score =   349 bits (895),  Expect(2) = 3e-180, Method: Compositional matrix adjust.
 Identities = 197/413 (48%), Positives = 288/413 (70%), Gaps = 4/413 (1%)
 Frame = +3

Query  1158  KKPRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGT-NTFKGFSVDVFTAAVNLLPYAVPF  1334
             +KPRGWV  ++   L+I VP RVS+ EF+++   + +  KG  +D+F  A+  +PY+VP+
Sbjct  446   EKPRGWVIADSASPLKIVVPNRVSFVEFVTEENNSSHQIKGLCIDIFKEALKFVPYSVPY  505

Query  1335  QFVPFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPF  1514
              F  FG+G  +P+Y  ++++V+ G +D A+GD AIV  R+K+VDF+QPY ++GL+VV P 
Sbjct  506   IFESFGDGHSSPNYKHIIQMVTDGVYDAAVGDFAIVPTRSKLVDFSQPYASTGLVVVIPT  565

Query  1515  KKLNTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSL  1694
                N   W FL PF+  +W V    F+++ +V+WILEHR+N++FRG P++QLIT++ FS 
Sbjct  566   NDDNP-TWIFLRPFTIGLWCVVLASFLIIAVVIWILEHRINEDFRGPPRKQLITMILFSF  624

Query  1695  STLFFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESLKEG  1874
             STLF  ++E+T+S L R+V+I+WLF+++++ +SYTA+LTSILTV QL S I G++SL+E 
Sbjct  625   STLFKRNQEDTISNLARLVMIVWLFLLMVLTASYTANLTSILTVLQLPSAITGIDSLRES  684

Query  1875  NDPIGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHK-GGVSAIVDERPYV  2051
               PIGYQ G+F   YL   +G+++SRL+ L S E Y  AL+ GP   GGV+AIVDE PY+
Sbjct  685   EVPIGYQAGTFTLEYLTYSLGMARSRLVPLDSTEEYERALKLGPTAFGGVAAIVDELPYI  744

Query  2052  ENFLSTQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLtrt  2231
             E FL+ +  F+IVG+ F   GWGFAF RDSPLA+DMS AIL LSE   LQ I  KWL + 
Sbjct  745   ELFLAERTGFKIVGEPFMHRGWGFAFKRDSPLAIDMSRAILKLSETRKLQEIRMKWLCKK  804

Query  2232  scssestel-esDRLHLKSFWglfllcgaacflalfIYFVQIMLKFRRVARAE  2387
             +C+ +S    E ++LHLKSF GL+L+C A    A  ++  +++ +F R  R E
Sbjct  805   TCAEKSDGNPEPNQLHLKSFKGLYLVCTAISVSASLVFVFRMVRQFVRYRRME  857


 Score =   313 bits (802),  Expect(2) = 3e-180, Method: Compositional matrix adjust.
 Identities = 162/370 (44%), Positives = 233/370 (63%), Gaps = 6/370 (2%)
 Frame = +2

Query  62    AALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTTQS  241
              A K +  +VVA++GP SS +AHT+S +A  LQ PL+SFAATDPTL++LQFP+FLRTT  
Sbjct  87    GAFKVLDKEVVAMIGPLSSSIAHTLSDIAKGLQFPLVSFAATDPTLSALQFPFFLRTTPD  146

Query  242   DMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGATT  421
             D +QM A+ D I  +GWKEVI+V+ DD+ GRNG++ALDD L  KR +IS+K  +    + 
Sbjct  147   DAHQMSALVDFITFHGWKEVISVYSDDELGRNGVSALDDELYKKRSRISHKVPLSV-HSE  205

Query  422   RAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVLDSS  601
                + D L +   +  RV VLH  P     +F +A  L MM   YVW++TDWLS  LDSS
Sbjct  206   EGSVTDALKKSKSLGPRVYVLHFGPDPLLRIFRIAQKLQMMTREYVWLATDWLSVTLDSS  265

Query  602   SPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLTGGSLGLNSYALYAYDSVWLIAH  781
               +    ++ ++GV+ LRQH P S      T + K  + GS  +N+YAL+AYD+VW+IA+
Sbjct  266   L-IDKGTLKGLEGVVGLRQHIPQSLKVHQLTHKLK--SNGS--MNAYALHAYDTVWMIAY  320

Query  782   AIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLTGQFKF  961
              I+  LN+G  I+FS   KL   EG+ LHLE + IF+ G +LL  LLQ +F G+ GQ +F
Sbjct  321   GIEKMLNEGINITFSYSEKLLHAEGTKLHLERVKIFNSGKVLLEKLLQVNFTGIAGQVRF  380

Query  962   NNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKLYGVVW  1141
              + ++++   Y+I+NV  TG  T+GFW    G S  PP++ ++       +++KL  + W
Sbjct  381   GSGRNVIGCDYEIINVGKTGVNTVGFWSRNGGFSVVPPDSRHTHKKTGFVSDEKLGNITW  440

Query  1142  PGQSVKKAPG  1171
             PG   +K  G
Sbjct  441   PGGGREKPRG  450



>ref|XP_010923978.1| PREDICTED: glutamate receptor 3.5-like [Elaeis guineensis]
Length=661

 Score =   456 bits (1172),  Expect(2) = 4e-180, Method: Compositional matrix adjust.
 Identities = 227/378 (60%), Positives = 278/378 (74%), Gaps = 6/378 (2%)
 Frame = +2

Query  56    LVAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTT  235
             ++ AL+ M+ DVVA++GPQSS +AH ISHV NEL VPLLSFAATDPTL SLQ+PYFLRT 
Sbjct  89    IIQALQLMENDVVAVIGPQSSGIAHAISHVGNELHVPLLSFAATDPTLTSLQYPYFLRTA  148

Query  236   QSDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGA  415
             Q+D +QM AIAD+I +YGW+EVIA+FIDDDYGR GI AL DALA KRCK++YKA  PP A
Sbjct  149   QNDYFQMNAIADMIGYYGWREVIAIFIDDDYGRGGITALGDALAMKRCKLTYKAAFPPNA  208

Query  416   TTRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVLD  595
               R+ I  +L+++  MESRV V+H  P +G  VFSVA  L MM  GY WI+TDWL++VLD
Sbjct  209   -DRSVISQLLIKVNQMESRVFVVHVNPDSGLTVFSVAQDLDMMAKGYAWIATDWLASVLD  267

Query  596   SSSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRW-KHLTGGSL--GLNSYALYAYDSV  766
             SS P   + M  +QGV+VLRQHTP S   +AF SRW K L  G+    LN+Y LYAYDSV
Sbjct  268   SSQPPNPDIMGPIQGVIVLRQHTPASNRTQAFMSRWNKMLQKGNATSSLNTYGLYAYDSV  327

Query  767   WLIAHAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLT  946
              L AHAID FLN G  ISFSND +L    GS L+L AL  FDGG  LL NLL ++F GLT
Sbjct  328   LLAAHAIDRFLNDGQNISFSNDPRLHDANGSRLNLTALRYFDGGDKLLENLLLTNFTGLT  387

Query  947   GQFKFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKL  1126
             GQ +F +D++L+ P+YDILNV GTG R IG+W NYSGLS   PETLY +P N+S+ +Q+L
Sbjct  388   GQVQFGSDRNLINPAYDILNVGGTGVRRIGYWSNYSGLSA--PETLYGKPRNASTTSQQL  445

Query  1127  YGVVWPGQSVKKAPGVGF  1180
             Y  +WPG++  K  G G 
Sbjct  446   YNAIWPGETTTKPRGWGL  463


 Score =   206 bits (524),  Expect(2) = 4e-180, Method: Compositional matrix adjust.
 Identities = 111/198 (56%), Positives = 136/198 (69%), Gaps = 25/198 (13%)
 Frame = +3

Query  1161  KPRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYAVPFQF  1340
             KPRGW   NNGK LRIGVP R SYKEFIS   G +  KG+ +DVF AAV LL Y V   F
Sbjct  457   KPRGWGL-NNGKPLRIGVPYRTSYKEFISNDTGPDNVKGYCIDVFNAAVKLLSYDVTPSF  515

Query  1341  VPFGNGRENPSYSELVRLVSTG------------------------YFDGAIGDIAIVTN  1448
             + FG+G +NPSY+ELV+ V+                          YFD A+GDI+IVTN
Sbjct  516   ILFGDGHKNPSYNELVQKVADNVRVAPVTELCFRFYIVYGSTLLGFYFDAAVGDISIVTN  575

Query  1449  RTKVVDFTQPYVASGLLVVAPFKKLNTGAWAFLTPFSAQMWGvtafffvvvgivvWILEH  1628
             RT++VDFTQPY+ SGL++VAP K++N+ AWAFL PF+ QMW VT  FF+ VG VVWILEH
Sbjct  576   RTRIVDFTQPYIESGLIIVAPVKEINSSAWAFLKPFTVQMWCVTGAFFLFVGAVVWILEH  635

Query  1629  RMNDEFRGSPKQQLITIL  1682
             R+N EFRGSP++QL+TI 
Sbjct  636   RINSEFRGSPRKQLVTIF  653



>ref|XP_010414001.1| PREDICTED: glutamate receptor 3.7 isoform X1 [Camelina sativa]
Length=924

 Score =   360 bits (923),  Expect(2) = 1e-179, Method: Compositional matrix adjust.
 Identities = 201/412 (49%), Positives = 293/412 (71%), Gaps = 4/412 (1%)
 Frame = +3

Query  1161  KPRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGT-NTFKGFSVDVFTAAVNLLPYAVPFQ  1337
             KPRGWV  ++   L+I +P RVS+ EF+++   + +  KG+ +D+F  A+  +PY VP+ 
Sbjct  447   KPRGWVIADSADPLKIVIPRRVSFVEFVTEEKNSSHRIKGYCIDIFIEALKFVPYNVPYI  506

Query  1338  FVPFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPFK  1517
             F PFGNG  +P+Y++L+++V+ G +D A+GD AIV +R+K+VDF+QPY ++GL+VV P  
Sbjct  507   FEPFGNGHSSPNYNQLIQMVTGGVYDAAVGDFAIVPSRSKLVDFSQPYASTGLVVVIPAN  566

Query  1518  KLNTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSLS  1697
               N   W FL PF+ ++W V    F+V+ +V+WILEHR N++FRG P++QL+T++ FS S
Sbjct  567   DDN-ATWIFLRPFTIRLWCVVLVSFMVIAVVIWILEHRFNEDFRGPPRRQLVTMMLFSFS  625

Query  1698  TLFFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESLKEGN  1877
             TLF  ++E+TVS L R+V+I+WLF+++++ +SYTA+LTSILTVQQL S I G++SL+   
Sbjct  626   TLFKRNQEDTVSNLARLVMIVWLFLLMVLTASYTANLTSILTVQQLPSAITGIDSLRASE  685

Query  1878  DPIGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHK-GGVSAIVDERPYVE  2054
              PIGYQ G+F   YL   +G+++SRL+ L S E Y +AL+ GP   GGV+AIVDE PY+E
Sbjct  686   VPIGYQAGTFTFEYLTYSLGMARSRLVPLDSTEEYEKALKLGPTNWGGVAAIVDELPYIE  745

Query  2055  NFLSTQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLtrts  2234
              FL+ +  F+IVG+ F   GWGFAF RDSPLA DMSTAIL LSE   LQ I  KWL + +
Sbjct  746   LFLAERAGFKIVGEPFMHRGWGFAFKRDSPLAEDMSTAILKLSETRKLQEIRKKWLCKMN  805

Query  2235  cssest-elesDRLHLKSFWglfllcgaacflalfIYFVQIMLKFRRVARAE  2387
             C+ +S    E ++LHLKSF GL+L+C A    A  +Y ++++ +F R  R +
Sbjct  806   CAEKSDWNPEPNQLHLKSFKGLYLVCIAITASAFLVYVLRMIRQFVRYRRMD  857


 Score =   301 bits (770),  Expect(2) = 1e-179, Method: Compositional matrix adjust.
 Identities = 162/373 (43%), Positives = 238/373 (64%), Gaps = 10/373 (3%)
 Frame = +2

Query  59    VAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTTQ  238
             + A K ++ +VVA++GP SS VAHT+S +A  L  PL+SFAATDPTL++LQFP+FLRTT 
Sbjct  86    IGAFKLLEKEVVAMIGPISSSVAHTMSDIAKGLHFPLISFAATDPTLSALQFPFFLRTTP  145

Query  239   SDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGAT  418
             +D +QM A+ ++I  YGWKEVI+V+ DD+ GRNG+AALDD L  KR +ISYK  +   + 
Sbjct  146   NDAHQMSALVELIAFYGWKEVISVYSDDELGRNGVAALDDELYKKRSRISYKVPLSVHSD  205

Query  419   TRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVLDS  598
              +  + + L +   +  RV +LH  P     +F +A  L MM   YVW++TDWLS  LDS
Sbjct  206   EKF-LTEALKKSKSIGPRVYILHFGPDPSLRIFDIAQKLQMMTHEYVWLATDWLSVTLDS  264

Query  599   SSPLPSEK--MEIMQGVLVLRQHTPDSELKRAFTSRWKHLTGGSLGLNSYALYAYDSVWL  772
             S    S+K  ++ ++GV+ LRQH P+S   + FT + K     +  +N+YAL+AYD+VW+
Sbjct  265   SL---SDKGTLKRLEGVVGLRQHIPESIKMQQFTHKLK----SNRSMNAYALHAYDTVWM  317

Query  773   IAHAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLTGQ  952
             IA+ I+  LN+G  I+FS   KL   +G+ LHLE +  F+ G LLL  LL+ +F G+ GQ
Sbjct  318   IAYGIEKLLNEGINITFSYSEKLLHAKGTKLHLEKIKFFNSGELLLEKLLKVNFTGIAGQ  377

Query  953   FKFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKLYG  1132
              +F + ++++   Y+I+NV  TG  T+GFW    G S   P+  +S+   S  +++KL  
Sbjct  378   VQFGSGRNVIGCDYEIINVDKTGVHTVGFWSKNGGFSVVAPKLQHSQKETSLVSDEKLGD  437

Query  1133  VVWPGQSVKKAPG  1171
             + WPG    K  G
Sbjct  438   ITWPGGGHGKPRG  450



>ref|XP_001762626.1| predicted protein [Physcomitrella patens]
 gb|EDQ72425.1| predicted protein [Physcomitrella patens]
Length=865

 Score =   376 bits (966),  Expect(2) = 2e-179, Method: Compositional matrix adjust.
 Identities = 219/410 (53%), Positives = 280/410 (68%), Gaps = 5/410 (1%)
 Frame = +3

Query  1164  PRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNT---FKGFSVDVFTAAVNLLPYAVPF  1334
             P+GWV P  G+ L IGVP RV YKEF+     +N    F+GF +DVF  A++ LPYAV +
Sbjct  445   PKGWVVPKIGRPLVIGVPNRVGYKEFVESSVDSNNRTAFRGFCIDVFQQALSNLPYAVSY  504

Query  1335  QFVPFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPF  1514
              F  FG+G   PSY  LV  ++   FD  +GD+ I T R+  VDFTQP+  SGL+VV P 
Sbjct  505   YFTSFGDGNSTPSYDALVDEIAEKKFDAVVGDVTITTKRSMSVDFTQPFTTSGLVVVVPV  564

Query  1515  KKLNTG-AWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFS  1691
             K+ N   AWAFL PF+  MW  T  FF   G+VVW LEH+ N +FRG PK+Q++T LWF 
Sbjct  565   KQSNANYAWAFLRPFTPLMWLTTGAFFFFTGLVVWFLEHKKNRDFRGRPKKQVVTTLWFV  624

Query  1692  LSTLFFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESLKE  1871
               TLFF+  E   STLGR VL+IWLFVVLII SSYTASLTS LTVQQL   I+G+ SL  
Sbjct  625   FMTLFFSQNERVNSTLGRAVLVIWLFVVLIIISSYTASLTSFLTVQQLLPTIQGISSLVS  684

Query  1872  GNDPIGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHKGGVSAIVDERPYV  2051
              N PIGYQ GSF   YL++ + ++  RL+AL + + Y  AL KG  +GGV AIVDE PYV
Sbjct  685   SNVPIGYQTGSFVRDYLLQ-LNVAPDRLVALNTLDEYTAALTKGAGRGGVGAIVDELPYV  743

Query  2052  ENFLSTQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLtrt  2231
             ++FLST+C F I GQEFTKSGWGFAFP+ S LA+D STAIL L+ENG+LQRIHD W+   
Sbjct  744   QSFLSTECAFTIAGQEFTKSGWGFAFPKGSQLAIDFSTAILKLAENGELQRIHDLWVNTN  803

Query  2232  scssestelesDRLHLKSFWglfllcgaacflalfIYFVQIMLKFRRVAR  2381
             +CS+ + + +S  L + +FWGLFL+ G A      +Y+ +++++ RRV R
Sbjct  804   TCSNRNVQTDSMELGVNTFWGLFLITGLASLFCCLVYWTRMIIRHRRVFR  853


 Score =   283 bits (724),  Expect(2) = 2e-179, Method: Compositional matrix adjust.
 Identities = 152/380 (40%), Positives = 224/380 (59%), Gaps = 8/380 (2%)
 Frame = +2

Query  65    ALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTTQSD  244
             A   ++ +VVAILGPQ+SVV+H +SH+A   QVPL+SF+ATDP+L+  Q+ YF+R T SD
Sbjct  75    ASNLLKDEVVAILGPQTSVVSHFVSHMATVTQVPLVSFSATDPSLSEEQYFYFVRVTHSD  134

Query  245   MYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGATTR  424
               QM AIA +I HYGW+EV A++IDDD+G NGI +L DAL +       K+ + P  T+ 
Sbjct  135   DVQMQAIAGIIQHYGWREVTALYIDDDFGNNGINSLLDALQSMGPNTVRKSNLSPTITSE  194

Query  425   AEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVLDSSS  604
              EI  +L +++ MESRV V+H  P  G  +F +A  L MM  GYVWI T+ +++V++  S
Sbjct  195   -EISTLLTKLSEMESRVFVVHVEPKLGRELFIMAQRLQMMSQGYVWIVTEAMTSVMNDLS  253

Query  605   PLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLTGGSLGL------NSYALYAYDSV  766
               P +  + +QGV+  R H P S L + +  RW  L G    +      N YA YAYD++
Sbjct  254   TDP-KFSQALQGVIGTRSHIPGSSLLQDYKDRWVELHGNDSSVGPAQMNNVYAWYAYDAM  312

Query  767   WLIAHAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLT  946
             W +A+ I  FL+ GG  +F +     S  G    L +L +F  G LLL+++L   F GLT
Sbjct  313   WTVANGIRIFLDAGGATTFVDPPARPSDAGGESELASLKVFRDGKLLLDSILDQQFTGLT  372

Query  947   GQFKFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKL  1126
             G  + +    L+  S+D++N++G G R +G+W N +G     P    +   N +S+  +L
Sbjct  373   GPVQLDERNDLMGSSFDVVNMVGEGLRVVGYWSNATGCLPFAPALNTTSMLNENSSQSQL  432

Query  1127  YGVVWPGQSVKKAPGVGFPE  1186
               V+WPG  V    G   P+
Sbjct  433   QTVIWPGGGVDVPKGWVVPK  452



>ref|XP_010266234.1| PREDICTED: glutamate receptor 3.3-like isoform X3 [Nelumbo nucifera]
Length=928

 Score =   557 bits (1436),  Expect = 3e-179, Method: Compositional matrix adjust.
 Identities = 299/405 (74%), Positives = 358/405 (88%), Gaps = 1/405 (0%)
 Frame = +3

Query  1161  KPRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYAVPFQF  1340
             KPRGWVFPNNGK+LRIGVP RVS+++F+SQV GTN  KGF +DVFTAAVNLLPY VP++F
Sbjct  459   KPRGWVFPNNGKELRIGVPKRVSFRDFVSQVRGTNLVKGFCIDVFTAAVNLLPYPVPYKF  518

Query  1341  VPFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPFKK  1520
             +P+G+G +NPSY++LV  ++   FD  +GDIAIV +R K++DFTQP+V SGL+VVAPF+K
Sbjct  519   IPYGDGHQNPSYTDLVDKITEDVFDAVVGDIAIVADRIKILDFTQPFVESGLVVVAPFRK  578

Query  1521  LNTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSLST  1700
             LN+GAW+FL PF+AQMW V   FF+ +G V+WILEHR+NDEFRG P+ Q+IT LWFS ST
Sbjct  579   LNSGAWSFLRPFTAQMWCVICAFFLFIGAVIWILEHRLNDEFRGPPRNQIITTLWFSFST  638

Query  1701  LFFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESLKEGND  1880
             LFFAHRENT+STLGR VLIIWLFVVL INSSYTASLTSILTVQQL SPIKG+ESL++ +D
Sbjct  639   LFFAHRENTMSTLGRFVLIIWLFVVLAINSSYTASLTSILTVQQLSSPIKGIESLRKTDD  698

Query  1881  PIGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHK-GGVSAIVDERPYVEN  2057
             PIG+Q+GSFAEHYL +E+GISKSRLIALGSPE YA+AL++GP K GGV+A+VDERPYV+ 
Sbjct  699   PIGFQVGSFAEHYLTQELGISKSRLIALGSPEEYAKALQRGPGKEGGVAAVVDERPYVDL  758

Query  2058  FLSTQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLtrtsc  2237
             FLSTQC FR+VGQEFTKSGWGFAFPRDSP+AVDMSTAIL+LSENGDLQRIHDKWL R++C
Sbjct  759   FLSTQCNFRVVGQEFTKSGWGFAFPRDSPIAVDMSTAILALSENGDLQRIHDKWLKRSAC  818

Query  2238  ssestelesDRLHLKSFWglfllcgaacflalfIYFVQIMLKFRR  2372
             S +  ELES++LHLKSFWGLFL+CG ACF+ALFIYF  ++ KF R
Sbjct  819   SLDDNELESNQLHLKSFWGLFLICGLACFVALFIYFFLMIRKFTR  863


 Score =   543 bits (1398),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 258/379 (68%), Positives = 319/379 (84%), Gaps = 1/379 (0%)
 Frame = +2

Query  56    LVAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTT  235
             +V AL+FM+TD VA++GPQSSV+AH ISHV+NEL+VPL+SFA TDPTL+SLQFP+F+R T
Sbjct  90    IVEALQFMETDTVAVVGPQSSVLAHVISHVSNELRVPLVSFAVTDPTLSSLQFPFFVRMT  149

Query  236   QSDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIP-PG  412
             QSD+YQM A+A+++D+YGWKEV+A+FIDDDYGRNG+AAL D LA +RC+ISYKAGIP   
Sbjct  150   QSDLYQMTAVAEIVDYYGWKEVVAIFIDDDYGRNGVAALGDKLAERRCRISYKAGIPLEL  209

Query  413   ATTRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVL  592
               +R  ++DILV++AL+ESRV+VLHA P +G +VFSVAHYLGMMG+GYVWI+TDWLS++L
Sbjct  210   GVSRDAVVDILVKVALLESRVIVLHANPDSGLLVFSVAHYLGMMGNGYVWIATDWLSSLL  269

Query  593   DSSSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLTGGSLGLNSYALYAYDSVWL  772
             DSSSPLP E M++MQGVL  RQHT DS  KR F SRWK L GGSL LNSY LYAYDSVWL
Sbjct  270   DSSSPLPQETMDLMQGVLAFRQHTVDSIRKRTFFSRWKKLVGGSLSLNSYGLYAYDSVWL  329

Query  773   IAHAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLTGQ  952
             +AHAI++FL++GG ISFSNDS++   EG  LHLEA+SIFDGG LLLNN+LQ++ +GLTG 
Sbjct  330   VAHAINAFLDQGGTISFSNDSRIHDAEGGRLHLEAMSIFDGGKLLLNNILQTNMIGLTGP  389

Query  953   FKFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKLYG  1132
              KFN D+SLV P+YD++N+IGTGFR IG+W NYSGLS   PETLY +PPN SSANQKLY 
Sbjct  390   IKFNPDRSLVRPAYDVINIIGTGFRRIGYWSNYSGLSVVSPETLYEKPPNRSSANQKLYT  449

Query  1133  VVWPGQSVKKAPGVGFPEQ  1189
              +WPG+++ K  G  FP  
Sbjct  450   TIWPGETLIKPRGWVFPNN  468



>ref|XP_010266235.1| PREDICTED: glutamate receptor 3.3-like isoform X4 [Nelumbo nucifera]
Length=916

 Score =   556 bits (1434),  Expect = 4e-179, Method: Compositional matrix adjust.
 Identities = 299/405 (74%), Positives = 358/405 (88%), Gaps = 1/405 (0%)
 Frame = +3

Query  1161  KPRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYAVPFQF  1340
             KPRGWVFPNNGK+LRIGVP RVS+++F+SQV GTN  KGF +DVFTAAVNLLPY VP++F
Sbjct  447   KPRGWVFPNNGKELRIGVPKRVSFRDFVSQVRGTNLVKGFCIDVFTAAVNLLPYPVPYKF  506

Query  1341  VPFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPFKK  1520
             +P+G+G +NPSY++LV  ++   FD  +GDIAIV +R K++DFTQP+V SGL+VVAPF+K
Sbjct  507   IPYGDGHQNPSYTDLVDKITEDVFDAVVGDIAIVADRIKILDFTQPFVESGLVVVAPFRK  566

Query  1521  LNTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSLST  1700
             LN+GAW+FL PF+AQMW V   FF+ +G V+WILEHR+NDEFRG P+ Q+IT LWFS ST
Sbjct  567   LNSGAWSFLRPFTAQMWCVICAFFLFIGAVIWILEHRLNDEFRGPPRNQIITTLWFSFST  626

Query  1701  LFFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESLKEGND  1880
             LFFAHRENT+STLGR VLIIWLFVVL INSSYTASLTSILTVQQL SPIKG+ESL++ +D
Sbjct  627   LFFAHRENTMSTLGRFVLIIWLFVVLAINSSYTASLTSILTVQQLSSPIKGIESLRKTDD  686

Query  1881  PIGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHK-GGVSAIVDERPYVEN  2057
             PIG+Q+GSFAEHYL +E+GISKSRLIALGSPE YA+AL++GP K GGV+A+VDERPYV+ 
Sbjct  687   PIGFQVGSFAEHYLTQELGISKSRLIALGSPEEYAKALQRGPGKEGGVAAVVDERPYVDL  746

Query  2058  FLSTQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLtrtsc  2237
             FLSTQC FR+VGQEFTKSGWGFAFPRDSP+AVDMSTAIL+LSENGDLQRIHDKWL R++C
Sbjct  747   FLSTQCNFRVVGQEFTKSGWGFAFPRDSPIAVDMSTAILALSENGDLQRIHDKWLKRSAC  806

Query  2238  ssestelesDRLHLKSFWglfllcgaacflalfIYFVQIMLKFRR  2372
             S +  ELES++LHLKSFWGLFL+CG ACF+ALFIYF  ++ KF R
Sbjct  807   SLDDNELESNQLHLKSFWGLFLICGLACFVALFIYFFLMIRKFTR  851


 Score =   476 bits (1226),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 235/379 (62%), Positives = 291/379 (77%), Gaps = 32/379 (8%)
 Frame = +2

Query  56    LVAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTT  235
             +V AL+FM+TD VA++GPQSSV+AH ISHV+NEL+VPL+SFA TDPTL+SLQFP+F+R T
Sbjct  109   IVEALQFMETDTVAVVGPQSSVLAHVISHVSNELRVPLVSFAVTDPTLSSLQFPFFVRMT  168

Query  236   QSDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIP-PG  412
             QSD+YQM A+A+++D+YGWKEV+A+FIDDDYGRNG+AAL D LA +RC+ISYKAGIP   
Sbjct  169   QSDLYQMTAVAEIVDYYGWKEVVAIFIDDDYGRNGVAALGDKLAERRCRISYKAGIPLEL  228

Query  413   ATTRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVL  592
               +R  ++DILV++AL+ESRV+VLHA P +G +VFSVAHYLGMMG+GYVWI+TDWLS++L
Sbjct  229   GVSRDAVVDILVKVALLESRVIVLHANPDSGLLVFSVAHYLGMMGNGYVWIATDWLSSLL  288

Query  593   DSSSPLPSEKMEIMQGVLVLRQHTPDSELKRAFTSRWKHLTGGSLGLNSYALYAYDSVWL  772
             DSSSPLP E M++MQGVL  RQHT DS  KR F SRWK L                    
Sbjct  289   DSSSPLPQETMDLMQGVLAFRQHTVDSIRKRTFFSRWKKL--------------------  328

Query  773   IAHAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLTGQ  952
                        GG ISFSNDS++   EG  LHLEA+SIFDGG LLLNN+LQ++ +GLTG 
Sbjct  329   -----------GGTISFSNDSRIHDAEGGRLHLEAMSIFDGGKLLLNNILQTNMIGLTGP  377

Query  953   FKFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKLYG  1132
              KFN D+SLV P+YD++N+IGTGFR IG+W NYSGLS   PETLY +PPN SSANQKLY 
Sbjct  378   IKFNPDRSLVRPAYDVINIIGTGFRRIGYWSNYSGLSVVSPETLYEKPPNRSSANQKLYT  437

Query  1133  VVWPGQSVKKAPGVGFPEQ  1189
              +WPG+++ K  G  FP  
Sbjct  438   TIWPGETLIKPRGWVFPNN  456



>ref|XP_010469592.1| PREDICTED: glutamate receptor 3.7-like isoform X1 [Camelina sativa]
 ref|XP_010469593.1| PREDICTED: glutamate receptor 3.7-like isoform X1 [Camelina sativa]
Length=931

 Score =   365 bits (936),  Expect(2) = 4e-179, Method: Compositional matrix adjust.
 Identities = 202/412 (49%), Positives = 295/412 (72%), Gaps = 4/412 (1%)
 Frame = +3

Query  1161  KPRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGT-NTFKGFSVDVFTAAVNLLPYAVPFQ  1337
             KPRGWV  ++   L+I +P RVS+ EF+++   + +  KGF +DVF  A+  +PY+VP+ 
Sbjct  454   KPRGWVIADSADPLKIVIPRRVSFVEFVTEEKNSSHRIKGFCIDVFIEALKFVPYSVPYI  513

Query  1338  FVPFGNGRENPSYSELVRLVSTGYFDGAIGDIAIVTNRTKVVDFTQPYVASGLLVVAPFK  1517
             F PFGNG  +P+Y++L+++V+ G +D A+GD AIV +R+K+VDF+QPY ++GL+VV P  
Sbjct  514   FEPFGNGHSSPNYNQLIQMVTDGVYDAAVGDFAIVPSRSKIVDFSQPYASTGLVVVIPAN  573

Query  1518  KLNTGAWAFLTPFSAQMWGvtafffvvvgivvWILEHRMNDEFRGSPKQQLITILWFSLS  1697
               N   W FL PF+ ++W V    F+V+ +V+WILEHR N++FRG P++QL+T++ FS S
Sbjct  574   DDN-ATWIFLRPFTIRLWCVVLVSFMVIAVVIWILEHRFNEDFRGPPRRQLVTMMLFSFS  632

Query  1698  TLFFAHRENTVSTLGRMvliiwlfvvliiNSSYTASLTSILTVQQLYSPIKGVESLKEGN  1877
             TLF  ++E+T+S L R+V+I+WLF+++++ +SYTA+LTSILTVQQL S I G++SL+   
Sbjct  633   TLFKRNQEDTISNLARLVMIVWLFLLMVLTASYTANLTSILTVQQLPSAITGIDSLRASE  692

Query  1878  DPIGYQIGSFAEHYLIEEIGISKSRLIALGSPEAYAEALEKGPHK-GGVSAIVDERPYVE  2054
              PIGYQ G+F   YL   +G+++SRL+ L SPE Y +AL+ GP   GGV+AIVDE PY+E
Sbjct  693   VPIGYQAGTFTLEYLTYSLGMARSRLVPLDSPEEYEKALKLGPTNWGGVAAIVDELPYIE  752

Query  2055  NFLSTQCKFRIVGQEFTKSGWGFAFPRDSPLAVDMSTAILSLSENGDLQRIHDKWLtrts  2234
              FL+ +  F+IVG+ F   GWGFAF RDSPLA DMSTAIL LSE   LQ I  KWL + +
Sbjct  753   LFLAERAGFKIVGEPFMHRGWGFAFKRDSPLAEDMSTAILKLSETRKLQEIRKKWLCKMN  812

Query  2235  cssest-elesDRLHLKSFWglfllcgaacflalfIYFVQIMLKFRRVARAE  2387
             C+ +S    E ++LHLKSF GL+L+C A    A  ++ ++++ +F R  R +
Sbjct  813   CAEKSDWNPEPNQLHLKSFKGLYLVCIAITVSAFLVFVLRMIRQFVRYRRMD  864


 Score =   294 bits (752),  Expect(2) = 4e-179, Method: Compositional matrix adjust.
 Identities = 160/374 (43%), Positives = 238/374 (64%), Gaps = 7/374 (2%)
 Frame = +2

Query  59    VAALKFMQTDVVAILGPQSSVVAHTISHVANELQVPLLSFAATDPTLASLQFPYFLRTTQ  238
             + A K ++ +VVA++GP SS VAHT+S +A  L  PL+SFAATDPTL++LQFP+FLRTT 
Sbjct  88    IGAFKLLEKEVVAMIGPISSSVAHTMSDIAKGLHFPLISFAATDPTLSALQFPFFLRTTP  147

Query  239   SDMYQMMAIADVIDHYGWKEVIAVFIDDDYGRNGIAALDDALAAKRCKISYKAGIPPGAT  418
             +D +QM A+ ++I+ YGWKEVI+V+ DD+ G NG+AALDD L  KR +ISYK  +   + 
Sbjct  148   NDAHQMSALVELINFYGWKEVISVYSDDELGTNGVAALDDELYKKRSRISYKVPLSVHSD  207

Query  419   TRAEIMDILVQIALMESRVMVLHAYPAAGFMVFSVAHYLGMMGDGYVWISTDWLSTVLDS  598
              +  + + L +   +  RV +LH  P     +F +A  L MM   YVW++TDWLS  LDS
Sbjct  208   EKF-LTEALKKSKSIGPRVYILHFGPDPSLRIFDIAQKLQMMTHEYVWLATDWLSVTLDS  266

Query  599   SSPLPSEK--MEIMQGVLVLRQHTPDSELKRAFTSRWK-HLTGGSLGLNSYALYAYDSVW  769
             S    S+K  ++ ++GV+ LRQH P+S   + FT + K + +  +  L++YAL+AYD+VW
Sbjct  267   SL---SDKGTLKRLEGVVGLRQHIPESIKMQQFTHKLKSNRSMNAYALHAYALHAYDTVW  323

Query  770   LIAHAIDSFLNKGGVISFSNDSKLQSIEGSTLHLEALSIFDGGPLLLNNLLQSDFVGLTG  949
             +IA+ I+  LN+G  I+FS   KL   +G+ LHLE +  F+ G LLL  LL+ +F G+ G
Sbjct  324   MIAYGIEKLLNEGINITFSYSEKLLHAKGTKLHLEKIKFFNSGELLLEKLLKVNFTGIAG  383

Query  950   QFKFNNDKSLVLPSYDILNVIGTGFRTIGFWCNYSGLSTAPPETLYSRPPNSSSANQKLY  1129
             Q +F + ++++   Y+I+NV  TG  T+GFW    G S    +   S+   S  +++KL 
Sbjct  384   QVQFGSGRNVIGCDYEIINVDKTGVHTVGFWSKNEGFSVVATKPRDSQKETSLVSDEKLG  443

Query  1130  GVVWPGQSVKKAPG  1171
              + WPG    K  G
Sbjct  444   DITWPGGGHGKPRG  457



>ref|XP_010266233.1| PREDICTED: glutamate receptor 3.3-like isoform X2 [Nelumbo nucifera]
Length=944

 Score =   557 bits (1435),  Expect = 6e-179, Method: Compositional matrix adjust.
 Identities = 299/405 (74%), Positives = 358/405 (88%), Gaps = 1/405 (0%)
 Frame = +3

Query  1161  KPRGWVFPNNGKQLRIGVPIRVSYKEFISQVPGTNTFKGFSVDVFTAAVNLLPYAVPFQF  1340
             KPRGWVFPNNGK+LRIGVP RVS+++F+SQV GTN  KGF +DVFTAAVNLLP